2B9RA

Crystal structure of human cyclin b1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
254
structure length
254
Chain Sequence
b'VKDIYAYLRQLEAAQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNSVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFSLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Human cyclin B1
publication title The Crystal Structure of Human Cyclin B.
pubmed rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 73
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00134 Cyclin_N Cyclin, N-terminal domain
A PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2b9rA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2b9rA01
4BCOB 2C5OB 2W99A 1P5EB 1VINA 2G9XB 2C5XB 4BCHB 2W2HA 4EOOB 5L2WB 4F6WB 1OIUB 2F2CA 4YC3B 1GUXA 2UZLB 3BHUB 4UN0A 4BCQB 4CFUB 5LMKB 4F7NB 2PK9B 2V22B 2WIHB 4YOSA 1GH6B 1UNGD 4EOPB 3O0GD 5HBJB 5FGKB 1H25B 4YOOA 2WPAB 4EOIB 2WXVB 3BLRB 3DDPB 4RODA 2PHGA 2WEVB 3DDQB 4EONB 1OL1B 3RGFB 2I40B 1G3NC 2B9RA 3DOGB 3TNIB 4F7JB 1VYWB 5HQ0B 4EOJB 1OKWB 4F70B 3BHTB 1H24B 3QHRB 4BCIB 4BCND 4EOLB 4EOQB 2I53A 1FVVB 1TFBA 2X1NB 3F5XB 4IMYB 3EOCB 4EORB 3M03A 4CXAB 3POMA 1VOLA 2C5NB 4CFMB 4FX3B 1H28B 4OGRB 5I5ZB 3MY5B 4EOMB 1BU2A 1H4LD 3EJ1B 4CFNB 2C6TB 1GUXB 1QMZB 4G6LB 2QDJA 4EOKB 5HVYB 4Y72B 4CFVB 2UZDB 2IW8B 3BHVB 1OKVB 4I3ZB 5EFQB 2W9ZA 1H1RB 1AD6A 2WMBB 1H27B 3QHWB 2CCIB 5BNJB 2CJMB 2BPMB 4ELJA 4F7SB 5CEIB 4CFXB 4EOSB 1UNLD 2IW6B 4BCPB 4BCNB 4EC8B 1AISB 5HNBB 1JKWA 1URCB 3TNHB 2WIPB 4TTHA 3K7AM 5IDNB 1GY3B 2UUEB 2WHBB 2IW9B 1O9KA 3MY1B 2WMAB 1W98B 1O9KB 1E9HB 5CYIB 2IVXA 4ROEA 4KRCB 4EC9B 1H1SB 1JSTB 2JGZB 3BLHB 4F7LB 5IF1B 4NSTB 5HBHB 1H1PB 1H26B 4BCGB 5ACBA 4CFWB 4F6UB 5IDPB 1XO2A 1JOWA 4BCMD 1OIYB 3MI9B 2BKZB 3TNWB 4ROCA 2PMIB 2WFYB 2C5VB 3G33B 2R7GA 1UNHD 4YOZA 1F5QB 1ZP2A 2CCHB 1OL2B 4BCFB 1N4MA 2W96A 4CFUD 1C9BA 4BCQD 4BCJB 5ICPB 1KXUA 2UZBB 3BLQB 3EIDB 1PKDB 2PK2A 2C4GB 3MIAB 4KRDB 2EUFA 2W9FA 2UZEB 4F6SB 1JSUB 4OR5B 5LQFB 3LQ5B 1FINB 4ELLA 3TN8B 1H1QB 1OI9B 4II5B 3H4CA 4CRLB 1OGUB 4BCKB 4BCMB 5HBEB 1D3UB
chains in the Genus database with same CATH superfamily
2C5OB 2W99A 1VINA 4BCHB 4F6WB 1GUXA 4CFUB 5LMKB 4BCQB 2PK9B 4OB2B 5EJCA 1UNGD 1H25B 4HL4A 4YOOA 2DD4B 3BLRB 4RODA 3X20B 2CZ7B 4EONB 4HNUA 3X25B 2B9RA 3TNIB 2DPPB 5HQ0B 1OKWB 4F70B 3A8GB 3QHRB 4AKIA 4EOLB 4ZGDB 1TFBA 3F5XB 3M03A 3QZ9B 3POMA 1H28B 4OGRB 2DXBB 2IW8B 3BHVB 1OKVB 4I3ZB 2WMBB 3QHWB 2CCIB 3DL1A 4ELJA 5DQWA 3VYHB 4Z6YA 4MFEA 2DD5B 3MY1B 2WMAB 1JSTB 3BLHB 2WJ9A 5HBHB 1H26B 1JOWA 4ROCA 2PMIB 1F5QB 2CCHB 4BCFB 3X28B 5ICPB 2UZBB 3BLQB 3EIDB 2PJQA 4ZGJB 2PK2A 3MIAB 3A8OB 4F6SB 1JSUB 2QQ8A 3NDQA 4CRLB 1OGUB 2LW4A 2C5XB 4EOOB 2F2CA 3VKHA 3BHUB 4UN0A 5HBJB 3QWLA 2CZ6B 2WPAB 2WXVB 2WEVB 3DDQB 3HBLA 3TW6A 1OL1B 3RGFB 1G3NC 4F7JB 4EOJB 3A8MB 4EOQB 2I53A 1FVVB 2X1NB 3EOCB 4CXAB 1VOLA 2C5NB 4FX3B 1UGRB 3MY5B 4EOMB 1H4LD 4CFNB 2C6TB 3HZJA 2AHJB 2CZ1B 2KMGA 5HVYB 5EFQB 4AI6A 4MIMA 4MFDA 1AD6A 2BPMB 4F7SB 5CEIB 2QF7A 4CFXB 1AISB 4LOCA 2WIPB 1ENWA 3K7AM 5IDNB 1GY3B 2CZ0B 2IW9B 2ZPIB 1W98B 1O9KB 1E9HB 4EC9B 4KRCB 2JGZB 5IF1B 4NSTB 1H1PB 4F6UB 3DTOA 1OIYB 2BKZB 2ZPFB 2WFYB 3BG3A 4BBRM 4YOZA 4OB1B 1OL2B 2DXCB 1N4MA 1E7PA 1IREB 1UGPB 4JX6A 5LQFB 4OR5B 3LQ5B 4ELLA 1H1QB 1AHJB 1OI9B 3X26B 2CYZB 4BCOB 2W2HA 1P5EB 2G9XB 3QXEB 4HNTA 5L2WB 2ZCFB 4YC3B 4F7NB 2V22B 2WIHB 5FGKB 2BS2A 2G77A 2I40B 3DOGB 1VYWB 4HLQA 4JX4A 1H24B 4BCND 4BCIB 1TD6A 4IMYB 4CFMB 3KHIA 5I5ZB 1BU2A 1QMZB 2QDJA 4JX5A 1UGQB 4Y72B 2D0QB 2UZDB 2W9ZA 1H1RB 1H27B 4QSHA 2CJMB 2IW6B 2ZPGB 4BCNB 5HNBB 1JKWA 1URCB 2DMEA 4TTHA 2UUEB 3X24B 4BY7X 3BG9A 5CYIB 2IVXA 3PO3S 1H1SB 4BCGB 5ACBA 5IDPB 3VKGA 4BCMD 3HB9A 3TNWB 3QZ5B 2C5VB 2IN3A 3G33B 3B57A 1UNHD 1ZP2A 2W96A 1C9BA 4BCJB 2BS3A 1KXUA 1UGSB 3A8LB 2C4GB 4KRDB 2BS4A 2EUFA 4HNVA 3VYGB 3QYBA 3GTMS 4II5B 3H4CA 3DJBA 3QYEA 4BCKB 4BCMB 3HHTB 1OIUB 3BG5A 2UZLB 4YOSA 1GH6B 4EOPB 3O0GD 2ZPEB 4OB0B 3WVEB 3QYGB 4EOIB 3DDPB 2PHGA 4OB3B 2ZPBB 3BHTB 4EORB 1V29B 2ZPHB 3WVDB 3EJ1B 4ZGEB 1GUXB 4G6LB 4EOKB 4CFVB 4BY1X 5BNJB 4BBSM 2QGSA 5IHYA 4EOSB 4FM4B 1UNLD 4BCPB 4EC8B 2KR6A 3TNHB 2WHBB 4AKHA 1O9KA 4M6VA 2QDYB 4ROEA 4F7LB 4AKGA 3A8HB 4CFWB 1XO2A 4NC6A 3MI9B 4BXXX 2ZZDB 3QYHB 2R7GA 5DQVA 1FKMA 2QFZA 4CFUD 4BCQD 1PKDB 1QLBA 2W9FA 2UZEB 1FINB 3TN8B 3HO8A 3TW7A 5HBEB 1D3UB
chains in the Genus database with same CATH topology
4BCOB 2C5OB 2W99A 1P5EB 1VINA 2G9XB 2C5XB 4BCHB 2W2HA 4EOOB 5L2WB 4F6WB 1OIUB 2F2CA 4YC3B 1GUXA 2UZLB 3BHUB 4UN0A 4BCQB 4CFUB 5LMKB 4F7NB 2PK9B 2V22B 2WIHB 4YOSA 1GH6B 1UNGD 4EOPB 3O0GD 5HBJB 5FGKB 1H25B 4YOOA 2WPAB 4EOIB 2WXVB 3BLRB 3DDPB 4RODA 2PHGA 2WEVB 3DDQB 4EONB 1OL1B 3RGFB 2I40B 1G3NC 2B9RA 3DOGB 3TNIB 4F7JB 1VYWB 5HQ0B 4EOJB 1OKWB 4F70B 3BHTB 1H24B 3QHRB 4BCIB 4BCND 4EOLB 4EOQB 2I53A 1FVVB 1TFBA 2X1NB 3F5XB 4IMYB 3EOCB 4EORB 3M03A 4CXAB 3POMA 1VOLA 2C5NB 4CFMB 4FX3B 1H28B 4OGRB 5I5ZB 3MY5B 4EOMB 1BU2A 1H4LD 3EJ1B 4CFNB 2C6TB 1GUXB 1QMZB 4G6LB 2QDJA 4EOKB 5HVYB 4Y72B 4CFVB 2UZDB 2IW8B 3BHVB 1OKVB 4I3ZB 5EFQB 2W9ZA 1H1RB 1AD6A 2WMBB 1H27B 3QHWB 2CCIB 5BNJB 2CJMB 2BPMB 4ELJA 4F7SB 5CEIB 4CFXB 4EOSB 1UNLD 2IW6B 4BCPB 4BCNB 4EC8B 1AISB 5HNBB 1JKWA 1URCB 3TNHB 2WIPB 4TTHA 3K7AM 5IDNB 1GY3B 2UUEB 2WHBB 2IW9B 1O9KA 3MY1B 2WMAB 1W98B 1O9KB 1E9HB 5CYIB 2IVXA 4ROEA 4KRCB 4EC9B 1H1SB 1JSTB 2JGZB 3BLHB 4F7LB 5IF1B 4NSTB 5HBHB 1H1PB 1H26B 4BCGB 5ACBA 4CFWB 4F6UB 5IDPB 1XO2A 1JOWA 4BCMD 1OIYB 3MI9B 2BKZB 3TNWB 4ROCA 2PMIB 2WFYB 2C5VB 3G33B 2R7GA 1UNHD 4YOZA 1F5QB 1ZP2A 2CCHB 1OL2B 4BCFB 1N4MA 2W96A 4CFUD 1C9BA 4BCQD 4BCJB 5ICPB 1KXUA 2UZBB 3BLQB 3EIDB 1PKDB 2PK2A 2C4GB 3MIAB 4KRDB 2EUFA 2W9FA 2UZEB 4F6SB 1JSUB 4OR5B 5LQFB 3LQ5B 1FINB 4ELLA 3TN8B 1H1QB 1OI9B 4II5B 3H4CA 4CRLB 1OGUB 4BCKB 4BCMB 5HBEB 1D3UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCO B;  2C5O B;  2W99 A;  1P5E B;  1VIN A;  2G9X B;  2C5X B;  4BCH B;  2W2H A;  4EOO B;  5L2W B;  4F6W B;  1OIU B;  2F2C A;  4YC3 B;  1GUX A;  2UZL B;  3BHU B;  4UN0 A;  4BCQ B;  4CFU B;  5LMK B;  4F7N B;  2PK9 B;  2V22 B;  2WIH B;  4YOS A;  1GH6 B;  1UNG D;  4EOP B;  3O0G D;  5HBJ B;  5FGK B;  1H25 B;  4YOO A;  2WPA B;  4EOI B;  2WXV B;  3BLR B;  3DDP B;  4ROD A;  2PHG A;  2WEV B;  3DDQ B;  4EON B;  1OL1 B;  3RGF B;  2I40 B;  1G3N C;  2B9R A;  3DOG B;  3TNI B;  4F7J B;  1VYW B;  5HQ0 B;  4EOJ B;  1OKW B;  4F70 B;  3BHT B;  1H24 B;  3QHR B;  4BCI B;  4BCN D;  4EOL B;  4EOQ B;  2I53 A;  1FVV B;  1TFB A;  2X1N B;  3F5X B;  4IMY B;  3EOC B;  4EOR B;  3M03 A;  4CXA B;  3POM A;  1VOL A;  2C5N B;  4CFM B;  4FX3 B;  1H28 B;  4OGR B;  5I5Z B;  3MY5 B;  4EOM B;  1BU2 A;  1H4L D;  3EJ1 B;  4CFN B;  2C6T B;  1GUX B;  1QMZ B;  4G6L B;  2QDJ A;  4EOK B;  5HVY B;  4Y72 B;  4CFV B;  2UZD B;  2IW8 B;  3BHV B;  1OKV B;  4I3Z B;  5EFQ B;  2W9Z A;  1H1R B;  1AD6 A;  2WMB B;  1H27 B;  3QHW B;  2CCI B;  5BNJ B;  2CJM B;  2BPM B;  4ELJ A;  4F7S B;  5CEI B;  4CFX B;  4EOS B;  1UNL D;  2IW6 B;  4BCP B;  4BCN B;  4EC8 B;  1AIS B;  5HNB B;  1JKW A;  1URC B;  3TNH B;  2WIP B;  4TTH A;  3K7A M;  5IDN B;  1GY3 B;  2UUE B;  2WHB B;  2IW9 B;  1O9K A;  3MY1 B;  2WMA B;  1W98 B;  1O9K B;  1E9H B;  5CYI B;  2IVX A;  4ROE A;  4KRC B;  4EC9 B;  1H1S B;  1JST B;  2JGZ B;  3BLH B;  4F7L B;  5IF1 B;  4NST B;  5HBH B;  1H1P B;  1H26 B;  4BCG B;  5ACB A;  4CFW B;  4F6U B;  5IDP B;  1XO2 A;  1JOW A;  4BCM D;  1OIY B;  3MI9 B;  2BKZ B;  3TNW B;  4ROC A;  2PMI B;  2WFY B;  2C5V B;  3G33 B;  2R7G A;  1UNH D;  4YOZ A;  1F5Q B;  1ZP2 A;  2CCH B;  1OL2 B;  4BCF B;  1N4M A;  2W96 A;  4CFU D;  1C9B A;  4BCQ D;  4BCJ B;  5ICP B;  1KXU A;  2UZB B;  3BLQ B;  3EID B;  1PKD B;  2PK2 A;  2C4G B;  3MIA B;  4KRD B;  2EUF A;  2W9F A;  2UZE B;  4F6S B;  1JSU B;  4OR5 B;  5LQF B;  3LQ5 B;  1FIN B;  4ELL A;  3TN8 B;  1H1Q B;  1OI9 B;  4II5 B;  3H4C A;  4CRL B;  1OGU B;  4BCK B;  4BCM B;  5HBE B;  1D3U B; 
#chains in the Genus database with same CATH topology
 2C5O B;  2W99 A;  1VIN A;  4BCH B;  4F6W B;  1GUX A;  4CFU B;  5LMK B;  4BCQ B;  2PK9 B;  4OB2 B;  5EJC A;  1UNG D;  1H25 B;  4HL4 A;  4YOO A;  2DD4 B;  3BLR B;  4ROD A;  3X20 B;  2CZ7 B;  4EON B;  4HNU A;  3X25 B;  2B9R A;  3TNI B;  2DPP B;  5HQ0 B;  1OKW B;  4F70 B;  3A8G B;  3QHR B;  4AKI A;  4EOL B;  4ZGD B;  1TFB A;  3F5X B;  3M03 A;  3QZ9 B;  3POM A;  1H28 B;  4OGR B;  2DXB B;  2IW8 B;  3BHV B;  1OKV B;  4I3Z B;  2WMB B;  3QHW B;  2CCI B;  3DL1 A;  4ELJ A;  5DQW A;  3VYH B;  4Z6Y A;  4MFE A;  2DD5 B;  3MY1 B;  2WMA B;  1JST B;  3BLH B;  2WJ9 A;  5HBH B;  1H26 B;  1JOW A;  4ROC A;  2PMI B;  1F5Q B;  2CCH B;  4BCF B;  3X28 B;  5ICP B;  2UZB B;  3BLQ B;  3EID B;  2PJQ A;  4ZGJ B;  2PK2 A;  3MIA B;  3A8O B;  4F6S B;  1JSU B;  2QQ8 A;  3NDQ A;  4CRL B;  1OGU B;  2LW4 A;  2C5X B;  4EOO B;  2F2C A;  3VKH A;  3BHU B;  4UN0 A;  5HBJ B;  3QWL A;  2CZ6 B;  2WPA B;  2WXV B;  2WEV B;  3DDQ B;  3HBL A;  3TW6 A;  1OL1 B;  3RGF B;  1G3N C;  4F7J B;  4EOJ B;  3A8M B;  4EOQ B;  2I53 A;  1FVV B;  2X1N B;  3EOC B;  4CXA B;  1VOL A;  2C5N B;  4FX3 B;  1UGR B;  3MY5 B;  4EOM B;  1H4L D;  4CFN B;  2C6T B;  3HZJ A;  2AHJ B;  2CZ1 B;  2KMG A;  5HVY B;  5EFQ B;  4AI6 A;  4MIM A;  4MFD A;  1AD6 A;  2BPM B;  4F7S B;  5CEI B;  2QF7 A;  4CFX B;  1AIS B;  4LOC A;  2WIP B;  1ENW A;  3K7A M;  5IDN B;  1GY3 B;  2CZ0 B;  2IW9 B;  2ZPI B;  1W98 B;  1O9K B;  1E9H B;  4EC9 B;  4KRC B;  2JGZ B;  5IF1 B;  4NST B;  1H1P B;  4F6U B;  3DTO A;  1OIY B;  2BKZ B;  2ZPF B;  2WFY B;  3BG3 A;  4BBR M;  4YOZ A;  4OB1 B;  1OL2 B;  2DXC B;  1N4M A;  1E7P A;  1IRE B;  1UGP B;  4JX6 A;  5LQF B;  4OR5 B;  3LQ5 B;  4ELL A;  1H1Q B;  1AHJ B;  1OI9 B;  3X26 B;  2CYZ B;  4BCO B;  2W2H A;  1P5E B;  2G9X B;  3QXE B;  4HNT A;  5L2W B;  2ZCF B;  4YC3 B;  4F7N B;  2V22 B;  2WIH B;  5FGK B;  2BS2 A;  2G77 A;  2I40 B;  3DOG B;  1VYW B;  4HLQ A;  4JX4 A;  1H24 B;  4BCN D;  4BCI B;  1TD6 A;  4IMY B;  4CFM B;  3KHI A;  5I5Z B;  1BU2 A;  1QMZ B;  2QDJ A;  4JX5 A;  1UGQ B;  4Y72 B;  2D0Q B;  2UZD B;  2W9Z A;  1H1R B;  1H27 B;  4QSH A;  2CJM B;  2IW6 B;  2ZPG B;  4BCN B;  5HNB B;  1JKW A;  1URC B;  2DME A;  4TTH A;  2UUE B;  3X24 B;  4BY7 X;  3BG9 A;  5CYI B;  2IVX A;  3PO3 S;  1H1S B;  4BCG B;  5ACB A;  5IDP B;  3VKG A;  4BCM D;  3HB9 A;  3TNW B;  3QZ5 B;  2C5V B;  2IN3 A;  3G33 B;  3B57 A;  1UNH D;  1ZP2 A;  2W96 A;  1C9B A;  4BCJ B;  2BS3 A;  1KXU A;  1UGS B;  3A8L B;  2C4G B;  4KRD B;  2BS4 A;  2EUF A;  4HNV A;  3VYG B;  3QYB A;  3GTM S;  4II5 B;  3H4C A;  3DJB A;  3QYE A;  4BCK B;  4BCM B;  3HHT B;  1OIU B;  3BG5 A;  2UZL B;  4YOS A;  1GH6 B;  4EOP B;  3O0G D;  2ZPE B;  4OB0 B;  3WVE B;  3QYG B;  4EOI B;  3DDP B;  2PHG A;  4OB3 B;  2ZPB B;  3BHT B;  4EOR B;  1V29 B;  2ZPH B;  3WVD B;  3EJ1 B;  4ZGE B;  1GUX B;  4G6L B;  4EOK B;  4CFV B;  4BY1 X;  5BNJ B;  4BBS M;  2QGS A;  5IHY A;  4EOS B;  4FM4 B;  1UNL D;  4BCP B;  4EC8 B;  2KR6 A;  3TNH B;  2WHB B;  4AKH A;  1O9K A;  4M6V A;  2QDY B;  4ROE A;  4F7L B;  4AKG A;  3A8H B;  4CFW B;  1XO2 A;  4NC6 A;  3MI9 B;  4BXX X;  2ZZD B;  3QYH B;  2R7G A;  5DQV A;  1FKM A;  2QFZ A;  4CFU D;  4BCQ D;  1PKD B;  1QLB A;  2W9F A;  2UZE B;  1FIN B;  3TN8 B;  3HO8 A;  3TW7 A;  5HBE B;  1D3U B; 
#chains in the Genus database with same CATH homology
 4BCO B;  2C5O B;  2W99 A;  1P5E B;  1VIN A;  2G9X B;  2C5X B;  4BCH B;  2W2H A;  4EOO B;  5L2W B;  4F6W B;  1OIU B;  2F2C A;  4YC3 B;  1GUX A;  2UZL B;  3BHU B;  4UN0 A;  4BCQ B;  4CFU B;  5LMK B;  4F7N B;  2PK9 B;  2V22 B;  2WIH B;  4YOS A;  1GH6 B;  1UNG D;  4EOP B;  3O0G D;  5HBJ B;  5FGK B;  1H25 B;  4YOO A;  2WPA B;  4EOI B;  2WXV B;  3BLR B;  3DDP B;  4ROD A;  2PHG A;  2WEV B;  3DDQ B;  4EON B;  1OL1 B;  3RGF B;  2I40 B;  1G3N C;  2B9R A;  3DOG B;  3TNI B;  4F7J B;  1VYW B;  5HQ0 B;  4EOJ B;  1OKW B;  4F70 B;  3BHT B;  1H24 B;  3QHR B;  4BCI B;  4BCN D;  4EOL B;  4EOQ B;  2I53 A;  1FVV B;  1TFB A;  2X1N B;  3F5X B;  4IMY B;  3EOC B;  4EOR B;  3M03 A;  4CXA B;  3POM A;  1VOL A;  2C5N B;  4CFM B;  4FX3 B;  1H28 B;  4OGR B;  5I5Z B;  3MY5 B;  4EOM B;  1BU2 A;  1H4L D;  3EJ1 B;  4CFN B;  2C6T B;  1GUX B;  1QMZ B;  4G6L B;  2QDJ A;  4EOK B;  5HVY B;  4Y72 B;  4CFV B;  2UZD B;  2IW8 B;  3BHV B;  1OKV B;  4I3Z B;  5EFQ B;  2W9Z A;  1H1R B;  1AD6 A;  2WMB B;  1H27 B;  3QHW B;  2CCI B;  5BNJ B;  2CJM B;  2BPM B;  4ELJ A;  4F7S B;  5CEI B;  4CFX B;  4EOS B;  1UNL D;  2IW6 B;  4BCP B;  4BCN B;  4EC8 B;  1AIS B;  5HNB B;  1JKW A;  1URC B;  3TNH B;  2WIP B;  4TTH A;  3K7A M;  5IDN B;  1GY3 B;  2UUE B;  2WHB B;  2IW9 B;  1O9K A;  3MY1 B;  2WMA B;  1W98 B;  1O9K B;  1E9H B;  5CYI B;  2IVX A;  4ROE A;  4KRC B;  4EC9 B;  1H1S B;  1JST B;  2JGZ B;  3BLH B;  4F7L B;  5IF1 B;  4NST B;  5HBH B;  1H1P B;  1H26 B;  4BCG B;  5ACB A;  4CFW B;  4F6U B;  5IDP B;  1XO2 A;  1JOW A;  4BCM D;  1OIY B;  3MI9 B;  2BKZ B;  3TNW B;  4ROC A;  2PMI B;  2WFY B;  2C5V B;  3G33 B;  2R7G A;  1UNH D;  4YOZ A;  1F5Q B;  1ZP2 A;  2CCH B;  1OL2 B;  4BCF B;  1N4M A;  2W96 A;  4CFU D;  1C9B A;  4BCQ D;  4BCJ B;  5ICP B;  1KXU A;  2UZB B;  3BLQ B;  3EID B;  1PKD B;  2PK2 A;  2C4G B;  3MIA B;  4KRD B;  2EUF A;  2W9F A;  2UZE B;  4F6S B;  1JSU B;  4OR5 B;  5LQF B;  3LQ5 B;  1FIN B;  4ELL A;  3TN8 B;  1H1Q B;  1OI9 B;  4II5 B;  3H4C A;  4CRL B;  1OGU B;  4BCK B;  4BCM B;  5HBE B;  1D3U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...