2B9RA

Crystal structure of human cyclin b1
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
254
structure length
254
Chain Sequence
VKDIYAYLRQLEAAQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNSVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFSLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Human cyclin B1
publication title The Crystal Structure of Human Cyclin B.
pubmed rcsb
source organism Homo sapiens
total genus 73
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00134 Cyclin_N Cyclin, N-terminal domain
A PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2b9rA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2b9rA01
1AD6A 2B9RA 4F7NB 1OI9B 5HQ0B 1H24B 2R7GA 3EOCB 4BCGB 4OR5B 4ELJA 1AISB 4NSTB 4EOQB 4F6SB 4ROCA 3O0GD 3QHRB 5HBEB 1OKVB 3DDQB 3EJ1B 2W9ZA 4BCFB 4F6UB 2V22B 3MI9B 5BNJB 4EC9B 4BCND 3MY1B 2IVXA 2IW8B 2W9FA 4BCKB 4F6WB 1GH6B 3BLRB 4II5B 4CFNB 1P5EB 4BCMD 4YOOA 1H28B 5HVYB 5I5ZB 4ELLA 2C5NB 1VINA 2C6TB 2UZEB 4EOPB 1O9KB 4F7JB 2JGZB 5FGKB 2C5XB 1QMZB 2I53A 1UNGD 5HBHB 3BLQB 3K7AM 1FVVB 4F7SB 1G3NC 4CFWB 4F70B 5CEIB 1E9HB 1VOLA 2W2HA 3BHVB 3LQ5B 4UN0A 2X1NB 1H1SB 2UUEB 1BU2A 3QHWB 4BCQB 3BLHB 1GY3B 2UZLB 1OL1B 1OIUB 2W99A 1OIYB 2QDJA 3TNWB 1D3UB 1JKWA 2UZBB 1H1PB 2WMBB 1H26B 1VYWB 2G9XB 3TNHB 2C5OB 4F7LB 2WEVB 2UZDB 5IF1B 1H27B 5L2WB 4YOSA 4CFMB 1JSTB 1H4LD 4EORB 1PKDB 4CFVB 4BCQD 2PK2A 4YC3B 4EOLB 3MY5B 1H25B 2WMAB 3TN8B 2F2CA 4TTHA 2BKZB 2BPMB 5HBJB 4BCNB 4CXAB 1URCB 2I40B 1W98B 1JSUB 2WHBB 2WPAB 3DOGB 4EOKB 4CFUB 3BHUB 3MIAB 5EFQB 1H1QB 4EOSB 4EC8B 2PMIB 2CCIB 2IW9B 4G6LB 2W96A 3RGFB 4KRDB 1F5QB 3H4CA 2CCHB 4FX3B 2PHGA 2PK9B 1GUXA 4BCJB 3TNIB 4EOOB 4I3ZB 1JOWA 2C5VB 2C4GB 5ICPB 4CRLB 3M03A 1OL2B 4Y72B 4CFUD 2WXVB 5ACBA 1UNLD 4EOJB 4BCPB 4EOMB 1H1RB 4IMYB 4BCMB 5IDPB 1ZP2A 2CJMB 4KRCB 1TFBA 4EONB 2IW6B 3G33B 1FINB 5HNBB 1C9BA 4ROEA 4BCIB 5LMKB 5LQFB 3POMA 1OKWB 4OGRB 4BCOB 2WFYB 4CFXB 4BCHB 1XO2A 2WIHB 2WIPB 1KXUA 3F5XB 4YOZA 1O9KA 5IDNB 5CYIB 4RODA 1OGUB 4EOIB 3DDPB 3EIDB 1GUXB 1UNHD 1N4MA 3BHTB 2EUFA
chains in the Genus database with same CATH superfamily
3A8MB 1OI9B 1H24B 3BG5A 4ELJA 4BBSM 4OR5B 4AKHA 2QQ8A 4F6SB 2IN3A 3O0GD 4MFDA 1OKVB 4F6UB 2W9ZA 4EC9B 3MY1B 4OB3B 1GH6B 3BLRB 4II5B 4YOOA 2C5NB 3QYEA 4EOPB 1O9KB 4F7SB 4F70B 2ZZDB 5CEIB 1VOLA 3A8OB 3LQ5B 1IREB 2CYZB 2W99A 4FM4B 4BBRM 3VKHA 2WEVB 2UZDB 5L2WB 2PJQA 4YOSA 5IHYA 1H4LD 1PKDB 3X20B 4YC3B 1H25B 1UGPB 2WMAB 3BG9A 3KHIA 4TTHA 1W98B 2WHBB 2WPAB 4CFUB 3QZ5B 3PO3S 1H1QB 4EOSB 4G6LB 2CCHB 4ZGDB 4BY7X 1AHJB 2C5VB 5DQWA 3M03A 1OL2B 4CFUD 4HNTA 4MFEA 5ACBA 4BCPB 4KRCB 4EONB 5LMKB 5LQFB 3X28B 1OKWB 4OGRB 4BCOB 4BCHB 2WIPB 3HO8A 2DXCB 4YOZA 4EOIB 1GUXB 3HHTB 2R7GA 3EOCB 4NSTB 3EJ1B 2V22B 2DPPB 2KR6A 2IW8B 1H28B 5I5ZB 4ELLA 1VINA 2C6TB 2UZEB 4F7JB 1V29B 5HBHB 3K7AM 1FVVB 1G3NC 1E9HB 4UN0A 2UUEB 3QHWB 3BLHB 2ZCFB 4NC6A 1TD6A 1H26B 2G9XB 3TNHB 2QDYB 5IF1B 3HZJA 2WJ9A 2QFZA 2CZ7B 4EORB 1ENWA 4EOLB 3MY5B 2BPMB 1URCB 2I40B 3A8HB 2PMIB 2CCIB 2W96A 4HLQA 1F5QB 2PHGA 2DMEA 4AKIA 4I3ZB 4EOJB 1H1RB 4BCMB 4HNVA 3X24B 2IW6B 3G33B 1C9BA 4BCIB 3POMA 4CFXB 2BS3A 2ZPIB 3DTOA 1UGQB 3A8LB 1O9KA 4RODA 1OGUB 3DDPB 1N4MA 4AI6A 3BHTB 3VYHB 2BS2A 3VYGB 2B9RA 4JX6A 4F7NB 4BXXX 5HQ0B 4OB0B 4BCGB 1QLBA 4ROCA 3QHRB 3BG3A 3QYBA 3QWLA 5HBEB 4JX4A 3MI9B 2IVXA 4OB1B 4F6WB 4CFNB 5HVYB 2ZPBB 5FGKB 1QMZB 2I53A 1UNGD 1UGRB 2CZ6B 4CFWB 4JX5A 2W2HA 2X1NB 4BCQB 2QF7A 1GY3B 2UZLB 3TNWB 2AHJB 1D3UB 2QDJA 4OB2B 2UZBB 1H1PB 2WMBB 1VYWB 3B57A 4F7LB 2D0QB 3QYHB 4M6VA 4BCQD 2F2CA 3QZ9B 4Z6YA 5HBJB 4CXAB 4BCNB 3DOGB 4EOKB 4AKGA 3BHUB 5EFQB 4EC8B 3RGFB 4KRDB 3WVEB 4FX3B 3TW6A 1E7PA 1GUXA 3QYGB 4BCJB 4EOOB 1FKMA 2C4GB 2KMGA 4Y72B 3TW7A 3QXEB 2WXVB 1UNLD 4EOMB 4IMYB 5IDPB 3HB9A 2CJMB 1FINB 5IDNB 5CYIB 4LOCA 2BS4A 3EIDB 1UNHD 2EUFA 1AD6A 1AISB 3DJBA 4EOQB 2ZPGB 3DDQB 4BCFB 2QGSA 5BNJB 2W9FA 4BCKB 2ZPHB 1P5EB 4BCMD 5DQVA 2JGZB 2C5XB 3BLQB 3BHVB 1H1SB 1BU2A 2CZ1B 1OL1B 5EJCA 1OIUB 1OIYB 4HL4A 4ZGEB 1JKWA 2C5OB 3GTMS 1H27B 4CFMB 1JSTB 2DXBB 3A8GB 2ZPFB 4CFVB 2PK2A 2ZPEB 3DL1A 2LW4A 3TN8B 2BKZB 1JSUB 2G77A 4MIMA 2CZ0B 3MIAB 2IW9B 4ZGJB 3H4CA 2DD4B 1UGSB 2PK9B 3TNIB 4BY1X 1JOWA 5ICPB 4CRLB 4HNUA 1ZP2A 1TFBA 3WVDB 4QSHA 3NDQA 5HNBB 4ROEA 3X26B 3VKGA 2WFYB 1XO2A 2WIHB 2DD5B 3X25B 1KXUA 3HBLA 3F5XB 4BCND
chains in the Genus database with same CATH topology
1AD6A 2B9RA 4F7NB 1OI9B 5HQ0B 1H24B 2R7GA 3EOCB 4BCGB 4OR5B 4ELJA 1AISB 4NSTB 4EOQB 4F6SB 4ROCA 3O0GD 3QHRB 5HBEB 1OKVB 3DDQB 3EJ1B 2W9ZA 4BCFB 4F6UB 2V22B 3MI9B 5BNJB 4EC9B 4BCND 3MY1B 2IVXA 2IW8B 2W9FA 4BCKB 4F6WB 1GH6B 3BLRB 4II5B 4CFNB 1P5EB 4BCMD 4YOOA 1H28B 5HVYB 5I5ZB 4ELLA 2C5NB 1VINA 2C6TB 2UZEB 4EOPB 1O9KB 4F7JB 2JGZB 5FGKB 2C5XB 1QMZB 2I53A 1UNGD 5HBHB 3BLQB 3K7AM 1FVVB 4F7SB 1G3NC 4CFWB 4F70B 5CEIB 1E9HB 1VOLA 2W2HA 3BHVB 3LQ5B 4UN0A 2X1NB 1H1SB 2UUEB 1BU2A 3QHWB 4BCQB 3BLHB 1GY3B 2UZLB 1OL1B 1OIUB 2W99A 1OIYB 2QDJA 3TNWB 1D3UB 1JKWA 2UZBB 1H1PB 2WMBB 1H26B 1VYWB 2G9XB 3TNHB 2C5OB 4F7LB 2WEVB 2UZDB 5IF1B 1H27B 5L2WB 4YOSA 4CFMB 1JSTB 1H4LD 4EORB 1PKDB 4CFVB 4BCQD 2PK2A 4YC3B 4EOLB 3MY5B 1H25B 2WMAB 3TN8B 2F2CA 4TTHA 2BKZB 2BPMB 5HBJB 4BCNB 4CXAB 1URCB 2I40B 1W98B 1JSUB 2WHBB 2WPAB 3DOGB 4EOKB 4CFUB 3BHUB 3MIAB 5EFQB 1H1QB 4EOSB 4EC8B 2PMIB 2CCIB 2IW9B 4G6LB 2W96A 3RGFB 4KRDB 1F5QB 3H4CA 2CCHB 4FX3B 2PHGA 2PK9B 1GUXA 4BCJB 3TNIB 4EOOB 4I3ZB 1JOWA 2C5VB 2C4GB 5ICPB 4CRLB 3M03A 1OL2B 4Y72B 4CFUD 2WXVB 5ACBA 1UNLD 4EOJB 4BCPB 4EOMB 1H1RB 4IMYB 4BCMB 5IDPB 1ZP2A 2CJMB 4KRCB 1TFBA 4EONB 2IW6B 3G33B 1FINB 5HNBB 1C9BA 4ROEA 4BCIB 5LMKB 5LQFB 3POMA 1OKWB 4OGRB 4BCOB 2WFYB 4CFXB 4BCHB 1XO2A 2WIHB 2WIPB 1KXUA 3F5XB 4YOZA 1O9KA 5IDNB 5CYIB 4RODA 1OGUB 4EOIB 3DDPB 3EIDB 1GUXB 1UNHD 1N4MA 3BHTB 2EUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AD6 A;  2B9R A;  4F7N B;  1OI9 B;  5HQ0 B;  1H24 B;  2R7G A;  3EOC B;  4BCG B;  4OR5 B;  4ELJ A;  1AIS B;  4NST B;  4EOQ B;  4F6S B;  4ROC A;  3O0G D;  3QHR B;  5HBE B;  1OKV B;  3DDQ B;  3EJ1 B;  2W9Z A;  4BCF B;  4F6U B;  2V22 B;  3MI9 B;  5BNJ B;  4EC9 B;  4BCN D;  3MY1 B;  2IVX A;  2IW8 B;  2W9F A;  4BCK B;  4F6W B;  1GH6 B;  3BLR B;  4II5 B;  4CFN B;  1P5E B;  4BCM D;  4YOO A;  1H28 B;  5HVY B;  5I5Z B;  4ELL A;  2C5N B;  1VIN A;  2C6T B;  2UZE B;  4EOP B;  1O9K B;  4F7J B;  2JGZ B;  5FGK B;  2C5X B;  1QMZ B;  2I53 A;  1UNG D;  5HBH B;  3BLQ B;  3K7A M;  1FVV B;  4F7S B;  1G3N C;  4CFW B;  4F70 B;  5CEI B;  1E9H B;  1VOL A;  2W2H A;  3BHV B;  3LQ5 B;  4UN0 A;  2X1N B;  1H1S B;  2UUE B;  1BU2 A;  3QHW B;  4BCQ B;  3BLH B;  1GY3 B;  2UZL B;  1OL1 B;  1OIU B;  2W99 A;  1OIY B;  2QDJ A;  3TNW B;  1D3U B;  1JKW A;  2UZB B;  1H1P B;  2WMB B;  1H26 B;  1VYW B;  2G9X B;  3TNH B;  2C5O B;  4F7L B;  2WEV B;  2UZD B;  5IF1 B;  1H27 B;  5L2W B;  4YOS A;  4CFM B;  1JST B;  1H4L D;  4EOR B;  1PKD B;  4CFV B;  4BCQ D;  2PK2 A;  4YC3 B;  4EOL B;  3MY5 B;  1H25 B;  2WMA B;  3TN8 B;  2F2C A;  4TTH A;  2BKZ B;  2BPM B;  5HBJ B;  4BCN B;  4CXA B;  1URC B;  2I40 B;  1W98 B;  1JSU B;  2WHB B;  2WPA B;  3DOG B;  4EOK B;  4CFU B;  3BHU B;  3MIA B;  5EFQ B;  1H1Q B;  4EOS B;  4EC8 B;  2PMI B;  2CCI B;  2IW9 B;  4G6L B;  2W96 A;  3RGF B;  4KRD B;  1F5Q B;  3H4C A;  2CCH B;  4FX3 B;  2PHG A;  2PK9 B;  1GUX A;  4BCJ B;  3TNI B;  4EOO B;  4I3Z B;  1JOW A;  2C5V B;  2C4G B;  5ICP B;  4CRL B;  3M03 A;  1OL2 B;  4Y72 B;  4CFU D;  2WXV B;  5ACB A;  1UNL D;  4EOJ B;  4BCP B;  4EOM B;  1H1R B;  4IMY B;  4BCM B;  5IDP B;  1ZP2 A;  2CJM B;  4KRC B;  1TFB A;  4EON B;  2IW6 B;  3G33 B;  1FIN B;  5HNB B;  1C9B A;  4ROE A;  4BCI B;  5LMK B;  5LQF B;  3POM A;  1OKW B;  4OGR B;  4BCO B;  2WFY B;  4CFX B;  4BCH B;  1XO2 A;  2WIH B;  2WIP B;  1KXU A;  3F5X B;  4YOZ A;  1O9K A;  5IDN B;  5CYI B;  4ROD A;  1OGU B;  4EOI B;  3DDP B;  3EID B;  1GUX B;  1UNH D;  1N4M A;  3BHT B;  2EUF A; 
#chains in the Genus database with same CATH topology
 3A8M B;  1OI9 B;  1H24 B;  3BG5 A;  4ELJ A;  4BBS M;  4OR5 B;  4AKH A;  2QQ8 A;  4F6S B;  2IN3 A;  3O0G D;  4MFD A;  1OKV B;  4F6U B;  2W9Z A;  4EC9 B;  3MY1 B;  4OB3 B;  1GH6 B;  3BLR B;  4II5 B;  4YOO A;  2C5N B;  3QYE A;  4EOP B;  1O9K B;  4F7S B;  4F70 B;  2ZZD B;  5CEI B;  1VOL A;  3A8O B;  3LQ5 B;  1IRE B;  2CYZ B;  2W99 A;  4FM4 B;  4BBR M;  3VKH A;  2WEV B;  2UZD B;  5L2W B;  2PJQ A;  4YOS A;  5IHY A;  1H4L D;  1PKD B;  3X20 B;  4YC3 B;  1H25 B;  1UGP B;  2WMA B;  3BG9 A;  3KHI A;  4TTH A;  1W98 B;  2WHB B;  2WPA B;  4CFU B;  3QZ5 B;  3PO3 S;  1H1Q B;  4EOS B;  4G6L B;  2CCH B;  4ZGD B;  4BY7 X;  1AHJ B;  2C5V B;  5DQW A;  3M03 A;  1OL2 B;  4CFU D;  4HNT A;  4MFE A;  5ACB A;  4BCP B;  4KRC B;  4EON B;  5LMK B;  5LQF B;  3X28 B;  1OKW B;  4OGR B;  4BCO B;  4BCH B;  2WIP B;  3HO8 A;  2DXC B;  4YOZ A;  4EOI B;  1GUX B;  3HHT B;  2R7G A;  3EOC B;  4NST B;  3EJ1 B;  2V22 B;  2DPP B;  2KR6 A;  2IW8 B;  1H28 B;  5I5Z B;  4ELL A;  1VIN A;  2C6T B;  2UZE B;  4F7J B;  1V29 B;  5HBH B;  3K7A M;  1FVV B;  1G3N C;  1E9H B;  4UN0 A;  2UUE B;  3QHW B;  3BLH B;  2ZCF B;  4NC6 A;  1TD6 A;  1H26 B;  2G9X B;  3TNH B;  2QDY B;  5IF1 B;  3HZJ A;  2WJ9 A;  2QFZ A;  2CZ7 B;  4EOR B;  1ENW A;  4EOL B;  3MY5 B;  2BPM B;  1URC B;  2I40 B;  3A8H B;  2PMI B;  2CCI B;  2W96 A;  4HLQ A;  1F5Q B;  2PHG A;  2DME A;  4AKI A;  4I3Z B;  4EOJ B;  1H1R B;  4BCM B;  4HNV A;  3X24 B;  2IW6 B;  3G33 B;  1C9B A;  4BCI B;  3POM A;  4CFX B;  2BS3 A;  2ZPI B;  3DTO A;  1UGQ B;  3A8L B;  1O9K A;  4ROD A;  1OGU B;  3DDP B;  1N4M A;  4AI6 A;  3BHT B;  3VYH B;  2BS2 A;  3VYG B;  2B9R A;  4JX6 A;  4F7N B;  4BXX X;  5HQ0 B;  4OB0 B;  4BCG B;  1QLB A;  4ROC A;  3QHR B;  3BG3 A;  3QYB A;  3QWL A;  5HBE B;  4JX4 A;  3MI9 B;  2IVX A;  4OB1 B;  4F6W B;  4CFN B;  5HVY B;  2ZPB B;  5FGK B;  1QMZ B;  2I53 A;  1UNG D;  1UGR B;  2CZ6 B;  4CFW B;  4JX5 A;  2W2H A;  2X1N B;  4BCQ B;  2QF7 A;  1GY3 B;  2UZL B;  3TNW B;  2AHJ B;  1D3U B;  2QDJ A;  4OB2 B;  2UZB B;  1H1P B;  2WMB B;  1VYW B;  3B57 A;  4F7L B;  2D0Q B;  3QYH B;  4M6V A;  4BCQ D;  2F2C A;  3QZ9 B;  4Z6Y A;  5HBJ B;  4CXA B;  4BCN B;  3DOG B;  4EOK B;  4AKG A;  3BHU B;  5EFQ B;  4EC8 B;  3RGF B;  4KRD B;  3WVE B;  4FX3 B;  3TW6 A;  1E7P A;  1GUX A;  3QYG B;  4BCJ B;  4EOO B;  1FKM A;  2C4G B;  2KMG A;  4Y72 B;  3TW7 A;  3QXE B;  2WXV B;  1UNL D;  4EOM B;  4IMY B;  5IDP B;  3HB9 A;  2CJM B;  1FIN B;  5IDN B;  5CYI B;  4LOC A;  2BS4 A;  3EID B;  1UNH D;  2EUF A;  1AD6 A;  1AIS B;  3DJB A;  4EOQ B;  2ZPG B;  3DDQ B;  4BCF B;  2QGS A;  5BNJ B;  2W9F A;  4BCK B;  2ZPH B;  1P5E B;  4BCM D;  5DQV A;  2JGZ B;  2C5X B;  3BLQ B;  3BHV B;  1H1S B;  1BU2 A;  2CZ1 B;  1OL1 B;  5EJC A;  1OIU B;  1OIY B;  4HL4 A;  4ZGE B;  1JKW A;  2C5O B;  3GTM S;  1H27 B;  4CFM B;  1JST B;  2DXB B;  3A8G B;  2ZPF B;  4CFV B;  2PK2 A;  2ZPE B;  3DL1 A;  2LW4 A;  3TN8 B;  2BKZ B;  1JSU B;  2G77 A;  4MIM A;  2CZ0 B;  3MIA B;  2IW9 B;  4ZGJ B;  3H4C A;  2DD4 B;  1UGS B;  2PK9 B;  3TNI B;  4BY1 X;  1JOW A;  5ICP B;  4CRL B;  4HNU A;  1ZP2 A;  1TFB A;  3WVD B;  4QSH A;  3NDQ A;  5HNB B;  4ROE A;  3X26 B;  3VKG A;  2WFY B;  1XO2 A;  2WIH B;  2DD5 B;  3X25 B;  1KXU A;  3HBL A;  3F5X B;  4BCN D; 
#chains in the Genus database with same CATH homology
 1AD6 A;  2B9R A;  4F7N B;  1OI9 B;  5HQ0 B;  1H24 B;  2R7G A;  3EOC B;  4BCG B;  4OR5 B;  4ELJ A;  1AIS B;  4NST B;  4EOQ B;  4F6S B;  4ROC A;  3O0G D;  3QHR B;  5HBE B;  1OKV B;  3DDQ B;  3EJ1 B;  2W9Z A;  4BCF B;  4F6U B;  2V22 B;  3MI9 B;  5BNJ B;  4EC9 B;  4BCN D;  3MY1 B;  2IVX A;  2IW8 B;  2W9F A;  4BCK B;  4F6W B;  1GH6 B;  3BLR B;  4II5 B;  4CFN B;  1P5E B;  4BCM D;  4YOO A;  1H28 B;  5HVY B;  5I5Z B;  4ELL A;  2C5N B;  1VIN A;  2C6T B;  2UZE B;  4EOP B;  1O9K B;  4F7J B;  2JGZ B;  5FGK B;  2C5X B;  1QMZ B;  2I53 A;  1UNG D;  5HBH B;  3BLQ B;  3K7A M;  1FVV B;  4F7S B;  1G3N C;  4CFW B;  4F70 B;  5CEI B;  1E9H B;  1VOL A;  2W2H A;  3BHV B;  3LQ5 B;  4UN0 A;  2X1N B;  1H1S B;  2UUE B;  1BU2 A;  3QHW B;  4BCQ B;  3BLH B;  1GY3 B;  2UZL B;  1OL1 B;  1OIU B;  2W99 A;  1OIY B;  2QDJ A;  3TNW B;  1D3U B;  1JKW A;  2UZB B;  1H1P B;  2WMB B;  1H26 B;  1VYW B;  2G9X B;  3TNH B;  2C5O B;  4F7L B;  2WEV B;  2UZD B;  5IF1 B;  1H27 B;  5L2W B;  4YOS A;  4CFM B;  1JST B;  1H4L D;  4EOR B;  1PKD B;  4CFV B;  4BCQ D;  2PK2 A;  4YC3 B;  4EOL B;  3MY5 B;  1H25 B;  2WMA B;  3TN8 B;  2F2C A;  4TTH A;  2BKZ B;  2BPM B;  5HBJ B;  4BCN B;  4CXA B;  1URC B;  2I40 B;  1W98 B;  1JSU B;  2WHB B;  2WPA B;  3DOG B;  4EOK B;  4CFU B;  3BHU B;  3MIA B;  5EFQ B;  1H1Q B;  4EOS B;  4EC8 B;  2PMI B;  2CCI B;  2IW9 B;  4G6L B;  2W96 A;  3RGF B;  4KRD B;  1F5Q B;  3H4C A;  2CCH B;  4FX3 B;  2PHG A;  2PK9 B;  1GUX A;  4BCJ B;  3TNI B;  4EOO B;  4I3Z B;  1JOW A;  2C5V B;  2C4G B;  5ICP B;  4CRL B;  3M03 A;  1OL2 B;  4Y72 B;  4CFU D;  2WXV B;  5ACB A;  1UNL D;  4EOJ B;  4BCP B;  4EOM B;  1H1R B;  4IMY B;  4BCM B;  5IDP B;  1ZP2 A;  2CJM B;  4KRC B;  1TFB A;  4EON B;  2IW6 B;  3G33 B;  1FIN B;  5HNB B;  1C9B A;  4ROE A;  4BCI B;  5LMK B;  5LQF B;  3POM A;  1OKW B;  4OGR B;  4BCO B;  2WFY B;  4CFX B;  4BCH B;  1XO2 A;  2WIH B;  2WIP B;  1KXU A;  3F5X B;  4YOZ A;  1O9K A;  5IDN B;  5CYI B;  4ROD A;  1OGU B;  4EOI B;  3DDP B;  3EID B;  1GUX B;  1UNH D;  1N4M A;  3BHT B;  2EUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...