4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
2DD4B 3X24B 2ZZDA 2WSFE 2CZ0B 2PVGB 2CZ7B 4L6V5 2CZ1B 2DD5B 3VYHB 4KT0E 2PVOB 3A8OB 3X20B 2DXCA 4OB3B 4RKUE 2ZPIB 1QP2A 3WVDB 3QXEB 2CZ6B 3X25B 2ZCFB 2ZPHB 2ZPFB 4ZGJB 4ZGEB 1JB0E 2WSCE 2ZZDB 1UGQB 1GXIE 4Y28E 1V29B 4OB2B 2O01E 2DPPB 3VYGA 3A8GB 3QZ5B 1AHJB 1UGRB 3LW5E 2DXCB 2DD5A 4XK8E 2PUKB 5L8RE 3X28B 2AHJB 3A8HB 1PSEA 2D0QB 3QYGB 1UGPB 2PU9B 3HHTB 2PVDB 2WSEE 3WVEB 2DD4A 1PSFA 1UGSB 2CYZB 1QP3A 2ZPEB 3A8MB 2ZPBB 2DXBA 4ZGDB 3A8LB 2PUOB 4OB1B 3X26B 2ZPGB 3VYGB 3QYHB 4FM4B 1IREB 2QDYB 3QZ9B 2DXBB 4OB0B 1DJ7B
chains in the Genus database with same CATH superfamily
3H6ZA 2ZZDA 3QYEA 3HBLA 1UNGD 1AVZC 5DM7R 4CXAB 4DBRA 5CKDA 3JV3A 4C5EA 3M5AA 3V7RA 1Q82C 2P0KA 3SD4A 1JJ2P 2W99A 1KD1C 1BU1A 2OTJA 2QGSA 2J6OA 2B86A 1M90R 2E41A 1NE8A 3VKGA 2K5LA 1C9BA 3L2WA 1VQ9T 3DLLA 3BG5A 2DK3A 4CI0C 1CKBA 4JJBA 4M78F 2LCCA 2VYTA 1G2BA 2ZPHB 1S1NA 2DL5A 1X2QA 2H3JA 2C0OA 5IN1A 5GAN3 4A4EA 2KI7A 3ME9A 1WJSA 1HJDA 4PJOE 3C0CA 3JCMc 1PWTA 2L3PA 3G4ST 1YBYA 2Y4YA 4BB7A 1AWOA 2DBMA 2ED0A 1JXOA 2HD0A 1WFWA 4MZMA 2V8IA 4F7SB 4JJCA 1KIKA 2BS2A 3UF4A 3CCLA 1ZSZC 4F7LB 2BE9B 2PUKB 3G6EA 1D09B 3E9FA 3OW2P 4LNPA 4L59A 1NZ9A 3EGXB 4JLGA 2LZ6B 1A0NB 1H1RB 2VXFA 4C0ZA 1WZOA 2HQXA 2DVJA 4NSTB 1BI1A 2MWOA 5LJ5h 2YXYA 2KQWA 2BUDA 3CCET 2YWWA 2QQSA 3MEAA 4KGZB 2DXBA 1AEYA 2W10A 1KC8R 2LRQA 3X26B 4C8QC 3CPFA 1Q86R 4J7FA 2AIRB 1JSUB 4DEYA 3DL1A 4KBMB 1FWZA 4UC4A 1W2BP 3I56Q 4GBQA 2MMPA 4M77F 4DBFA 1RAGB 4M7AF 3CMEQ 1OEBA 4ZNXA 4BXXX 3LLRA 3NTHA 2M0OA 5ACBA 2C6TB 1G3TA 3POMA 1ENWA 3J81E 2PVOB 2RI3A 5GJVB 4EOOB 3IQLA 3OQ5A 1G3SA 2CZ6B 1I0CA 3L2UA 3QKJA 2XICA 1AZGB 1GH6B 5GMKm 3OYHA 3GBQA 4ZGEB 3JCMd 3VS1A 3JCMe 4C0GA 4HT8A 3CCRA 1WI7A 3LGFA 5D6WA 2L8DA 3UA7A 4RTWA 4RODA 2QF7A 2EAYA 2VGNA 3QUIA 4HL4A 1FMKA 2C0TA 2FZCB 4F7JB 4OB2B 3A5ZB 3KFVA 2K6DA 5CKEA 5CEIB 2WFYB 1QCFA 3KXTA 1AHJB 4GY5A 2OTLA 1PKSA 6AT1B 1IRXA 3ULRB 2BZYA 2DXCB 3REAB 5CR2A 4M77E 4R56A 3TNHB 1B07A 2X4WA 2DILA 1PSEA 2RA2A 3BFMA 2SEMA 1PD1A 1U8RA 3HHTB 1H28B 1JXMA 4M7DG 1VQ8A 1QKWA 1N5ZA 4MDWA 3OS0A 3G4SQ 1UNHD 4YC3B 1Z9QA 2WEVB 2R5MA 1MV0B 1UEBA 1NPRA 3KUFA 3GF5A 4N0AA 2RF0A 3DKMA 1K9MU 3SFMA 1OI1A 2L89A 1KD1R 2PJQA 3J7AF 4IUTA 2M0YA 3CCJT 2D8HA 2X1NB 1E9HB 1C6VX 4A4GA 3L2QA 3CBOA 2XU8A 2F5KA 4OMLA 4BY6C 4BBRM 2FRYA 5GAMf 4CFWB 3OSVA 5C6SA 3C95A 2LX9A 2H8HA 4KRCB 2XIDA 3CCQQ 4C92G 5GANf 1J3TA 3CCRT 2E3IA 4M78D 4YOSA 3SHWA 3CC4T 3CCVA 1D0ZA 2HL3A 5L23A 2AT1B 1G3YA 1X2KA 2GBQA 2W9ZA 3RKYA 1UUEA 5FLXE 3TSWA 4DA4A 1GUXA 1PC0A 2ZCFB 4ME7A 2R57A 2KMTA 4CRLB 4ZGJB 1S72Q 2W96A 2QQRA 1YJNQ 1AD5A 1UGQB 2L2PA 3CC2A 1YCYA 4IKFA 2QQBA 2LNHB 4MDXA 1H25B 2DRMA 4IUVA 2I40B 3A8GB 2YT6A 1H3ZA 4C92F 1I4K1 3BW1A 2DXUA 2V8KA 1OI9B 2OAWA 3JB9J 3JRZA 4RCCA 1QVGA 2BIVA 1K1ZA 4LN2A 4XU0A 4A63B 1NBEB 3MY5B 2RHYA 4ANJA 1VQOT 3PMTA 2HKQB 1GBQA 2FPEA 1KQSS 5GMKe 4BCQB 4GLMA 2DEQA 4B9WA 5LJ3j 1Q95G 5CYIB 4DBQA 3CPWA 2VV5A 2DTOA 4R55A 5AYFA 4AT1B 4JRQA 5HBHB 4JZ4A 1ZA2B 1FKMA 4JZ3A 1RAHB 4ZGDB 2RJEA 5EFQB 2CJMB 1B34A 2O88A 4LUEA 3VYGB 4HNVA 1N27A 3EGXA 1N9SA 3VS6A 4CFUB 4J6WA 1K8AU 3QZ9B 2DO3A 4ELZC 1WHJA 1H27B 3UPUA 1VQ9A 4F70B 3ASKA 1QCOA 3RESA 2PVGB 2BPMB 3EG9B 4C8QE 2DE0X 1TS9A 3MEUA 3CEYA 5FRNA 3EFOB 3L1AA 3QHSA 4Y92A 1ZUKA 4DOVA 2QEXQ 3H0HA 2CCIB 2BE7D 3QDFA 1BBZA 1YJ9Q 2AK5A 2LQKA 4F6WB 4X1VA 1T0HA 3JB9F 2QASA 2FG0A 1SHGA 4M7DE 2W9FA 1ZLMA 1NEBA 3LGLA 3CCLT 1RI9A 2A36A 3G33B 5GAOn 2VC8A 3M0QA 1VQ8Q 3PO3S 3S3NA 4GLKA 2RB6A 3E9GA 5HNBB 1VQ7Q 3SDZA 4F14A 1YNZA 3WXMB 2OTJQ 5CIUA 1OULA 1WNLA 1WJRA 4Z88A 3RMSA 2XMFA 3CCQT 4EOSB 4PJOG 1WHMA 4HCZA 1K73R 2M02A 1OGUB 2HKNA 2FVUA 1F5QB 3H41A 1VUBA 1T0JA 3A1PA 3TVTA 4JDSA 1BI3A 4FCYA 2F5TX 2DL3A 1M3CA 3OW2A 3VRYA 1NM7A 1Y0MA 2HBWA 3TCJA 1H8KA 2GFUA 5KH6A 3TNWB 4XAXB 4J9HA 3SWNA 5I2SA 1MGQA 1PNJA 1K73C 1WQ7A 3FRNA 2EQJA 4J9GA 4X9CA 4BD3A 1Y71A 5I21A 1OKWB 1OX8A 5LJ3d 3CC7Q 4A53A 3EH1A 2JNGA 4LDUA 2O2OA 1FX7A 1TTHB 2C06A 2C5XB 3OMCA 3HL8A 2EGAA 1UE9A 2HCKA 1ZQ1A 3M9QA 3BLHB 1KSWA 1SRMA 3OBYA 4M77D 1VQMA 4BUGA 1SSFA 5M9OA 2BS3A 3OS1A 1KQ1A 1Q7YU 4BCOB 4AG2C 4OB0B 4M75B 4NOYA 4RMOA 1V1CA 1Q81C 4KRDB 3OYCA 3VKHA 2HDAA 3EG9A 5KYYA 4E2FB 1LNXA 1TWBA 3DJBA 2V26A 4ZN3A 4NC6A 1JQQA 3RNJA 1YHQQ 1VQKT 3CC4A 5ICPB 2VVKA 2QTXA 4HKEA 4CC2A 3CD6A 4RKUE 2LVMA 2H3EB 2PNIA 3E2UA 1C1AA 1YITT 4PFZA 1Y07A 1KQSA 2LCSA 4LXCA 3RGFB 3CXCS 4UN0A 2NUPB 2JXBA 2MOXA 3HRTA 3I35A 2M16A 5LJ3h 2D0NA 5FRMA 3QIIA 4HVWA 2PQWA 9ATCB 2GTJA 1R77A 1Y57A 2RN8A 1CKAA 2YSQA 3OYLA 1G3WA 4C0DC 1QLBA 3HFOA 4IURA 1GCPA 3G6EQ 2RK2A 2G9XB 4OVAA 1D0YA 1X01A 3PE0A 3CMAA 1VQ5T 4OF1A 2I2LA 4DOWA 3EG2A 2JN0A 1VQ4Q 3QHWB 2DLPA 3I56T 2DAQA 2KXDA 4NS5A 4ROEA 1UJYA 1UG1A 4ELYC 4C92B 3RERA 2Z0WA 4EOKB 1TUGB 2FHDA 1NYFA 1VYTA 3CCJA 2CDTA 3OS5A 4FYXB 3TSZA 1VQ6Q 5GANg 4BDYA 3QYBA 2QDLA 1KD1U 1H24B 3QO3A 3VS4A 4M6VA 4IMYB 2DEUA 3OSSC 1BCOA 3JCMJ 3MEWA 1TSFA 1X43A 4YTLA 4M75E 4JJNK 2O4XB 1PCXA 1R8OB 2QI2A 2AZSA 2W0ZA 1YI2Q 2QYZA 1I5OB 4M78G 5CVIA 1MUZA 1YJ9T 1K76A 1G8XA 1UGVA 2E12A 5CK9A 2QEXA 2DTHA 2I53A 2QEXT 4RTUA 4E7ZA 2K57A 4EC8B 4RTVA 2MWPA 2K3BA 2CZ1B 3CC7T 2F69A 1M30A 3VYHB 2L5QA 3TN8B 1RI0A 1HD3A 2JTEA 3P8HA 5ECAA 3CCUA 3HSBA 3M0RA 5GAMh 2RJCA 1M1FA 1WQWA 4TVRA 4A4KA 2XK0A 5KYYB 2KEAA 4B9XA 1KFZA 2NUPA 4ELLA 1SPKA 3CQTA 3OA6A 2D6FA 3VS2A 2RJDA 5GJWB 1B34B 1WXBA 2P0QA 4OMOA 5A0DA 1UJ0A 1JSTB 2UZBB 4PJOD 1M8VA 2QA4Q 4BI8B 5IF1B 1NPPA 3CCSQ 2PK9B 3EG0A 1WLPB 1GXIE 2KDSA 2PTKA 3D7SB 3NPFA 4OMMA 2E64A 1YHQT 1P5EB 1U06A 1YITA 4PLIA 3CPWP 5CO7A 2R7GA 4IUQA 5GAN4 4BCGB 4FX3B 4TTHA 3PIPA 3C12A 4J9EA 3F70A 1RL2A 1QLYA 1ZA1B 3MI9B 4PL6A 5KYXA 3LH5A 1GCQA 2DL8A 4JS5A 2MI6A 2ZAEA 3UATA 1D3UB 4J9CA 2DMOA 2G3RA 3C94A 1JO8A 4P5NA 4AKGA 4RCBA 1W2BS 1OIUB 1NJIC 4M77G 4BY7X 3GP8A 2HAXA 1K8AR 2KRNA 2WPAB 4JS4A 1QVPA 4D6WA 1QVFP 2G77A 4C5GA 4EMGA 3L2VA 3QDRB 4FM4B 1BI0A 5CQYA 5FU6B 2EYWA 1HYOA 4A4HA 2DFUA 1LVKA 1H3HA 4F04B 2RHXA 3H4CA 3V8LA 3QYGB 2A08A 2A7YA 4M4ZA 1MNDA 1VQ6T 1D1BA 1QVGP 1OV3A 2V8JA 4E7IA 5C0MA 4NL3A 1PG5B 5HY6A 2PHGA 1VQLQ 3HFNA 4KUIA 4XTUA 4ROCA 5GAOl 4C8QD 4EOMB 2DXTA 1WHLA 1QP2A 4RG2A 3NHNA 1JRIA 1EFNA 1YIJT 4FIBA 4EOLB 2GTOA 1VQ7A 2FPDA 1TUCA 3UDCA 2K4YA 2CUDA 2DTIA 2QQAA 4D8DA 4EMKB 2JM9A 4C0FA 1XQHA 3OY9A 3CCUQ 2P4RA 2ROTA 1VQMT 3G71Q 4J9BA 1OZ3A 1HXDA 3G4SA 1K9MC 3CCUT 4F6UB 2C4GB 5IHKA 1URCB 2JMAA 1VQ8T 1H1PB 1ZUUA 2WACA 3LW5E 2KR6A 3URGA 5HVYB 2DM1A 1X6OA 2E65A 4BY6B 3OYAA 2E6ZA 3JB9G 3X28B 2YUQA 5L8RE 5A0GA 5GAOr 4HLQA 3A8HB 1I5LA 1YI2A 3QHRB 4AFUC 2GQIA 2RHIA 4O6JA 1OKVB 4RTYA 2GGRA 4X9DA 4CC7A 3R6NA 1RADB 2HZYA 3JCMQ 1ZP2A 2KRSA 4F7UB 2Y90A 1E7PA 5GAMj 3DB4A 2JVVA 5GMKj 2LX7A 3VV0A 5GAOm 1VQNQ 2XI9A 2L0AA 3AT1B 1H4LD 5DQVA 3HZJA 2X9HA 1VQ6A 2RMOA 1ACMB 2EJFA 1WIEA 2EJGA 3EFOA 1KK7A 3QWXX 5A2QE 1IZ6A 2YUNA 2EFIA 5GAMg 1O75A 4CC3A 1YJWT 2DKGA 3QWLA 2CP7A 2IVXA 1KJWA 4XU1A 1VOMA 4E7JA 3OYKA 1AZEA 2JGZB 5CKHA 3ZFJA 2QA4T 5IT9E 4BCND 5LJ3g 1OIYB 2ENMA 4AG1C 2QTVA 4HNUA 1M90C 2ZPIB 5LJ3f 2COZA 3BDLA 3QXEB 4EC9B 5J3BA 2BS4A 3EGDA 3EFSA 1VQKQ 2DIQA 2X35A 1M4ZA 2FZKB 4FYYB 1YJNT 1W2BA 1JB0E 1ZBXA 4M78E 3CD6Q 2ZZDB 4E7LA 3VUZA 4C92D 1GBRA 3CD6T 2RI2A 5KYXB 2DX1A 2QGFB 1YHQA 2NUTB 4E7HA 2E3HA 4CFMB 2O01E 4MIMA 3GLXA 3L2ZA 3OS2A 1K0SA 2ABLA 3V7CA 2EBPA 1EX4A 1UGRB 3BHVB 2LW4A 2O31A 1W98B 3LH0A 2XG8D 4F7NB 2JMCA 3CCEA 2RK1A 4XTXA 3V8KA 5GANh 1XJWB 3TW7A 3REBB 1OOTA 5IXBA 3PVQA 3CCLQ 2E10A 1D1CA 3UA6A 1YN8A 4J9IA 5KYWB 4F7UG 2L3RA 2L3SA 3BHTB 2PVDB 3OYIA 3LWHA 3S3OA 3I9QA 5CAIA 1W1FA 4M75A 3GNFB 3LWIA 4FL6A 1OX9A 5IHIA 4PKCC 1UNLD 1KQ2A 2MIOA 3EIDB 2KGTA 2ZPBB 3RKXA 4EDUA 1YWOA 3FIFA 5D6XA 3H0FA 1GY3B 3NGPA 4BCMB 2CH4W 1XTDA 5A0LA 1DJ7B 3CBPA 2ROLA 4FSSA 1U3OA 3CXCA 1Z9ZA 1IHWA 4BCMD 4JRIA 3BE3A 2KVQG 5CKBA 4F16A 5I22A 4C92C 4M7AA 3K7AM 1VQNT 2KROA 2DD5B 3FEOA 1M90U 5EG2A 4PJOA 2VB6A 2LJ1A 1BB9A 1H1SB 2A0FB 2OAUA 2PZ1A 1GCQC 1JJ2A 5GAMd 1VQ5Q 1OU8A 2EYYA 4RG8A 2IIMA 1YFNA 1AOJA 2DERA 1M1KU 2CKKA 2C0IA 2JUFA 5GAOp 1HSQA 4F7UF 3M54A 2WSCE 4AFZC 4ZTJA 4J9DA 2JZ2A 5DY9A 2JS0A 2MF2A 2E1HA 2X4YA 4Y28E 3TU4K 4BCNB 1RAAB 1X6GA 1B3QA 1X6BA 5CQXA 5EC7A 4OGRB 3GTMS 2DZCA 2DIGA 1OU9A 2DNUA 1D3BB 2DPPB 2E5QA 1VQ4A 3VRZA 2ESWA 3M0SA 3I55A 3PTAA 2J05A 5LJ5d 1AWWA 1MMGA 1ZBJA 3META 2EGCA 3EGDB 1Q82R 1RUWA 2AHJB 1OQKA 3CMEA 1HK9A 1N4MA 3MCAB 4F7UA 2RQTA 4M77B 4KRTA 4XTWA 2DL7A 2DRKA 4LDVA 2G6FX 2WSEE 4I3ZB 2QQ8A 2M51A 2DD4A 1UGSB 2CS7A 1I8FA 2X3XD 4QVCA 2FZGB 4XTZA 4BCQD 1M3AA 2IN3A 1AD6A 1VIEA 1D0XA 2IW6B 2KMGA 1Y96B 1X75C 4OGCA 1Q86U 1NEGA 1FINB 3QYHB 2IW8B 5I11A 3H0IA 1VQKA 3NTIA 1V76A 4HT9A 3CC4Q 2UUEB 3DTOA 4QKUA 3JCMW 4MZPA 2DD4B 4ESRA 4EIKA 3NDQA 4HXJA 4ATOA 1D1AA 2CZ0B 4FYVB 2VUBA 1D3BA 2YLBA 3M0TA 3DDQB 1ZSZB 1U1SA 3A98A 3EH2A 1OZ2A 4PJJA 1Q82U 5GAN6 3RKWA 4HCKA 4YOZA 3BY7A 3QWYA 5GANj 1FYNA 3SB2A 1PRLC 4X34A 2LQWA 1KHCA 2BKZB 4XQ3A 3GPLA 1VQLT 3QBYA 1YWPA 4BCHB 5FWBA 3M59A 3BG9A 1SF9A 2IG0A 3I55T 4RTTA 2XDDA 5BNJB 2RD1A 1VQPA 3M53A 3JAME 2NUTA 4QQGA 2KRMA 4AKHA 1KC8C 1ZHIA 2DJQA 2NYSA 3Q1JA 2QDJA 3OYGA 3CCVQ 3R6OA 3M4YA 1RAIB 1FVVB 2K5IA 3CCVT 5DLOA 1GL5A 1MMNA 3CCQA 1M27C 4ZN1A 1ZUYA 2HQEA 1KXUA 1KHIA 3ZBDA 2X51A 1GRIA 2Y4XA 2QQ9A 4J6YA 5IH2A 4HA8A 3DOGB 2IW9B 3HB9A 2EQKA 3MIAB 2LCLA 4KH1B 4M7AC 1R0BG 3JCMg 3VUBA 1B7TA 4J83A 1O9KA 4JJDA 4M77C 3TNIB 2D0QB 2PU9B 4BI3A 4FW1A 3GNGA 4A4FA 1IB8A 8AT1B 1QMZB 5HBEB 4Z8AA 3VS7A 1JOWA 1FMVA 3CCMT 5LJ3e 2CYZB 4C8QF 2CP6A 5HBJB 2YUOA 3JCMP 1BCMA 4PK4A 2EKHA 3THKA 1YI2T 1Q81U 2RQWA 4AI6A 4JRKA 2K79A 1NLPC 1FMWA 1OL2B 2JOYA 3QJYA 1YIJQ 2YHTA 4L5GA 4BCJB 1MV3A 4C92A 2RPNA 2DYBA 1YCSB 3HRUA 3CBMA 4M7DD 1VQLA 4Q5WA 2XDBA 3VU3C 4CFXB 2DZ9A 1N8RU 1TD6A 3B57A 1UECA 2DL4A 2IVWA 4M75G 4M75D 5J26A 1WPYA 1WHKA 3CCEQ 3JB9I 4BCIB 3H8ZA 1XNIA 4J8OA 2C5NB 1TXQA 2OTJT 3X20B 1R0CB 1VQOA 3CCRQ 3QJ6A 4OB3B 4DBHA 4QSHA 4KH0B 1Q7YC 1VQPQ 4RUGA 4Z6YA 4XU3A 2HMAA 2YLCA 1XOVA 3TW6A 4EMKA 1N9RA 4II5B 1M1GA 1QWFA 1JU5C 2HQHA 4M78C 5GAN7 2SRCA 3OYNA 3RMQA 2RM4A 4M7AE 3FJ5A 4PJNA 1QVFA 2MPXC 1TOVA 2MK5A 2WXVB 4C0DB 3CC2T 2K5FA 2XHCA 5KCOA 5IHYA 2GFAA 5CCAA 3M0PA 4C5HA 5LJ5g 1G83A 2BZ8A 2QXFA 1BK2A 2FB7A 1PM3A 4XTVA 4PJOB 3G6ET 2YRCA 1ABQA 3I56A 5FGKB 1WXTA 1UGPB 1RLPC 3ER0A 4WF2A 1ARKA 1LOJA 2P0PA 1JBMA 3RR6A 4C5IA 5L2WB 3MP8A 2R5AA 1S72A 4Z02A 5HK3A 3HTRA 2QFZA 4KUDK 4A54A 2M9UA 1GFCA 3PVLA 2LMJA 3O8VA 5IDPB 2IPOB 5GAMe 2LC4A 4C8QG 1VQNA 3I5RA 1F1BB 2HSPA 4QW2A 5FU6C 3OMGA 2J6KA 4JUVA 2WMBB 1YJWA 4PJOF 2I0NA 2WSFE 4JX6A 2VASA 4EOQB 4JLIA 4N4IA 3I55Q 1RLQC 2CSQA 2NLUA 2COYA 4M77A 4N0AC 2HBPA 2HEQA 5KYWA 2EQMA 1G5VA 2KNBB 1QW1A 1H26B 2NUZA 2LTOA 3OYMA 1C0MA 1ZX6A 3QG1A 2DXCA 1M1KR 3WVDB 1NLOC 2AKKA 4BE2A 4XU2A 1VA7A 2O4XA 2ED1A 1AWXA 3E1SA 1T3LA 2LNVA 5GAOq 1NG2A 1K4US 2BZXA 2K2MA 1VQ5A 2EVRA 4C92E 4PFOA 3CMAT 2KXCA 2F2VA 3SWNC 1CSKA 5HKCA 3OYEA 2KBTA 4JPBW 3U23A 4E7KA 2HL5C 5KCHA 3HPWA 1M9SA 3DDPB 2C5OB 4RTZA 2LT4A 4HVVA 1SHFA 3J80E 1Q81R 1G3NC 1E6GA 3LX7A 1LCKA 3OYFA 3M57A 3MO8A 3JCMV 5LJ5j 5FW9A 5GAN8 2DD5A 1P92A 1KG1A 2YDLA 2J06A 4E7SA 2RQRA 5GMKi 3QSUA 1SSHA 4WCIA 4BCFB 1JEGA 1RAFB 5AT1B 2KT8A 2VKNA 4R0KA 4N4GA 1WGSA 8ATCB 1MMDA 4LD9K 2EIFA 3P8BB 2DVEA 3L2RA 3ZEHA 5LJ5f 1PSFA 2J7IA 2KY9A 4QVDA 3RIRA 2RHZA 2K3YA 2FO0A 2OJ2A 5LJ5e 2KAFA 1JKWA 3HP9A 3TQ7P 5LMKB 2D8JA 2CP5A 3JCMf 3MJXA 4QT7A 4EMKC 4IUUA 2EW3A 2DXBB 4EONB 2JTMA 1Q7YR 3N5BB 5GMKh 4Y91A 1U1TA 4CC4B 2GF7A 5KE2A 5LQFB 1O9SA 3G7ZA 3OYJA 4HVUA 3VS0A 2VGMA 3FC3A 1VQPT 5D6YA 4KULA 2WIHB 2P4TA 4J5YA 3E19A 4KT0E 3CCST 4M7DA 4M7AD 4EOJB 2EYQA 3RDVA 4J6XA 4FU6A 2KYBA 3FB9A 4EOPB 3INZA 5FROA 3CXCP 2EYZA 4HCCA 1Y96A 3M03A 1X27A 4C8QB 1EZZB 4M7DC 1NYGA 2RHUA 2QA4A 5IDNB 2F2WA 1YP5A 4M7DB 3MEVA 1KQSP 2HNIA 2PK2A 2HSEB 3M55A 3T9NA 3H9NA 1H1QB 4OMNA 3SEMA 4ZTFA 3MHXA 4BCKB 3PGGA 5I2MA 5KYUB 3EFRA 4EPCA 1WJQA 4BE1A 4DQ2A 3VYGA 1OL1B 2F2XA 2FPFA 5HQ0B 3OYDA 3BLRB 5HK0A 1LPLA 4AMCA 2O9VA 1M2VB 1Y7XA 2CCHB 2O9SA 1SKUB 3BLQB 3MP1A 2YUPA 1TH7A 5EJCA 1N8RC 1BKBA 5KYNA 4M75F 1IXDA 1W6XA 3M56A 1AISB 1NJIU 1IGUA 4MMLA 2OTLT 2EWNA 2RQUA 2LQ8A 1K9AA 2JJ9A 2C5VB 3FDRA 3VKIA 2K7AA 2E70A 1MNEA 4O5VA 1IREB 2V22B 2X4XA 4G6LB 3KHIA 1M2VA 4HNTA 2JS2A 1M1KC 5GAN5 5GAN2 4HCBA 2JW4A 3CCJQ 1QWEA 2AZVA 1UDLA 1O9KB 4LDWA 2CGHA 1SG5A 3V7SA 3V8JA 4V2SA 4IUPA 4II1A 2EPDA 4PLLA 1PD0A 4L6V5 3VS5A 2L3QA 1EIFA 1WHHA 3VS3A 4RTXA 4MFEA 2CSIA 3G71A 2K9GA 3M58A 3G71T 1VQ9Q 2DYIA 4JRPA 2CT4A 2EUFA 1BIAA 3PT9A 1YJWQ 2DA9A 1VIFA 4C8QA 2AKLA 4F7UE 4CFVB 3G1JA 3O5ZA 1QKXA 3NMZC 3FJPA 2WHBB 2M1HA 5FWCA 2LP5A 2DETA 1PRMC 3JCMb 2BTTA 3CMET 2GQVA 4CFNB 1SEMA 3PMIA 2CP0A 1K9MR 1WA7A 2X3WD 3TREA 3EHRA 1UB4A 4QVZA 3F5XB 2UZLB 2UZDB 3S3MA 5CKFA 4IIOA 2ATCB 3EAEA 2XD0A 4XK8E 2KT1A 2FEIA 1BIBA 5D7UA 3RBBB 3HO8A 4EORB 1I1JA 3NFCA 2P84A 3HKSA 4EOIB 1H92A 5IAYA 1E7OA 1WX6A 2RJFA 2LQNA 1OYXA 3OYYA 2EQUA 3EJ1B 3PNWC 3JB9H 4F6SB 1T3SA 1LJOA 1UTIA 4OGEA 2OX7A 1WYXA 2OI3A 2W2HA 2ZPEB 4BDZA 3JCMh 4LOCA 3SWNB 7AT1B 2NWMA 5FU7B 3OBWA 4PNOA 4FYWB 4F17A 3BG3A 3CC7A 5I5ZB 4OMQA 4M75C 5GMKl 2CT3A 2RNAA 3EGUA 4KGXB 1KC8U 4BE0A 3DLMA 3X24B 1MMAA 3JSCA 1PKDB 2KK4A 4ORZA 3UWNA 3HRSA 2EKOA 4MFDA 2VWFA 1ZSZA 1OPKA 1FXXA 1RACB 2EYXA 1I81A 1I07A 1UHFA 1YITQ 2CZ7B 2F2CA 1XO2A 3MY1B 2WJ9A 1W70A 3JCMX 3A8OB 4OMPA 1TU0B 1VYUA 1VOLA 4LD6A 1BU2A 5LL6S 4NL2A 3EG1A 4M78B 1YIJA 2EJ9A 2R58A 2KR3A 1UHCA 1ZSGA 3O0GD 1M5Q1 2BKDN 4M7DF 5GANd 3MPUB 1K8AC 2ZPFB 4LUDA 4CRIA 4QQDA 1GUXB 1QMCA 3NTKA 2UZEB 5FU7C 3EOCB 1N6AA 2X4JA 4J9FA 3OW2S 4XTYA 2E6NA 4VUBA 3MKDA 1GFDA 4MZTA 4D8KA 1N8RR 1PKTA 2VXEA 2DJZA 2CH4A 1IGQA 4OP0A 3CCMA 1YJ9A 4M78A 4M7AB 3GIBA 3LQ5B 4E6RA 3QZ5B 1QCNA 1M3BA 2MYSA 2DBKA 4FW2A 5IXFA 2EQIA 2LDMA 4LDYA 4Z89A 3CCMQ 2LJ3A 1WHGA 2JT4A 1PHTA 2OTLQ 4PJMA 2CUBA 1W4SA 2LJ0A 1QVGS 3VJPA 3EHQA 3UT1A 4IIMA 4OMFB 1RABB 1QP3A 2QG9B 2XDPA 4OR5B 4BI4A 4LE9A 2GCXA 1NJIR 2RO0A 2A3LA 4JX4A 2ECZA 2QK0A 3L42A 3A8LB 2PUOB 4OB1B 2E4HA 2ZPGB 2CP3A 2FRWA 3ZL7C 2QDYB 3S6WA 4E47A 2XKOC 3RUXA 5J39A 2B9RA 4JX5A 2K2VA 4B6MA 3AHUA 4DEXA 4CFUD 4FSXA 3CMAQ 2FL7A 1RAEB 2K3XA 5KE3A 1TG0A 1VQ7T 1ABOA 2D1XA 1MHNA 2JM8A 3TEEA 1M2OA 2KE9A 1VINA 1K73U 5DQWA 1BI2A 1AT1B 1IHVA 2B8AA 2LT1A 4PFPA 1Q86C 4BCPB 3DB3A 2WIPB 2A28A 3MP6A 1X69A 2A37A 3BHUB 4AKIA 4KGVB 1S72T 2RH2A 3M0UA 1H641 5KYUA 1OPLA 3X25B 2YRVA 3CC2Q 1SRLA 4BY1X 2CP2A 2PMIB 1BYMA 1YJNA 2WMAB 4AFSC 1IO6A 2KSSA 2QAZA 4EMHA 4PJLA 5DLQE 3LYIA 4MMKA 3PFSA 1E6HA 2D9TA 4AFQC 1QQJA 2ZGWA 2JTFA 4QQ6A 3GOXA 1V29B 1TFBA 1UFFA 1WDXA 2COWA 2MAMA 2RQVA 1VQOQ 3OB9A 3PIOA 2FYKA 3I5SA 4M7AG 4K11A 3JB9D 2DF6A 2YRDA 4Y72B 5GANe 2GNCA 2V1RA 4N4HA 2DMEA 1M8MA 4PJOC 1VQMQ 2E5KA 4WTOB 2EGEA 3CCSA 1WXUA 2F1LA 1U5SA 3CPWS 3WVEB 4ELJA 1VQ4T 2MCNA 4YOOA 3FLGA 5HCKA 3KBGA 1VYVA 3P8DA 4BBSM 3A8MB 1VYWB 2KYMA 2V1QA 3M4GA 1AWJA 2RI5A 2QGGA 2J6FA 3QPHA 3OYBA 1JJ2S 4FT2A 4J7IA 4BACA 3C4SA 4LDXA 1QVFS 2CREA 3EG3A 4FT4A 1TUDA 3BDUA 5IHNA 1K0XA
chains in the Genus database with same CATH topology
3CBPA 4M75B 4NOYA 3H6ZA 3N5BB 4RMOA 5GMKh 4Y91A 2ZZDA 3QYEA 1Q81C 3HBLA 1U1TA 3OYCA 3CXCA 3VKHA 2GF7A 4A4GA 5KE2A 1O9SA 5DM7R 3G7ZA 4JRIA 5CKDA 1LNXA 3OYJA 4C5EA 3M5AA 2KVQG 4ZN3A 3V7RA 1Q82C 5CKBA 4NC6A 2VGMA 3FC3A 1VQPT 2P0KA 4C92C 5D6YA 4M7AA 1VQNT 3SD4A 4KULA 2P4TA 1VQKT 2DD5B 3E19A 4J5YA 4KT0E 3CCST 1KD1C 3CC4A 4M7DA 4M7AD 4HKEA 2EYQA 2QTXA 3FEOA 5EG2A 4J6XA 1M90U 2OTJA 4PJOA 4FU6A 2E41A 3FB9A 1NE8A 3CD6A 4RKUE 3VKGA 2OAUA 2K5LA 2LVMA 3INZA 5FROA 3L2WA 1VQ9T 3DLLA 1YITT 1JJ2A 5GAMd 3BG5A 1Y07A 2DK3A 4CI0C 1KQSA 4HCCA 1Y96A 4RG8A 3CXCS 4M78F 2LCCA 2VYTA 4C8QB 2ZPHB 1M1KU 2CKKA 2JUFA 3HRTA 2M16A 5LJ3h 5GAOp 2H3JA 2RHUA 2QA4A 5FRMA 3QIIA 4M7DB 4F7UF 3M54A 2PQWA 2WSCE 3MEVA 5IN1A 5GAN3 2HNIA 4A4EA 4ZTJA 2JZ2A 3ME9A 3M55A 5DY9A 3T9NA 2MF2A 1WJSA 2E1HA 2X4YA 4Y28E 3TU4K 4PJOE 3JCMc 3OYLA 1G3WA 4ZTFA 3G4ST 3MHXA 4C0DC 1QLBA 1YBYA 3PGGA 3HFOA 2Y4YA 5CQXA 4BB7A 5I2MA 4IURA 2DZCA 3EFRA 2DIGA 1WJQA 2HD0A 4DQ2A 4EPCA 2E5QA 1D3BB 2DPPB 4BE1A 1VQ4A 2RK2A 4MZMA 3VYGA 2V8IA 3I55A 3PTAA 5LJ5d 4OVAA 2BS2A 1X01A 3CCLA 3CMAA 4LD9K 3META 4OF1A 2I2LA 4DOWA 1VQ5T 2JN0A 3OYDA 5HK0A 3G6EA 2PUKB 2AHJB 3I56T 1Y7XA 2DAQA 3E9FA 4NS5A 1HK9A 3CMEA 3MCAB 4L59A 1NZ9A 4JLGA 4F7UA 4M77B 3MP1A 1TH7A 5EJCA 4XTWA 4LDVA 4ELYC 2VXFA 4C92B 3RERA 4C0ZA 2FHDA 3CCJA 1N8RC 1BKBA 2HQXA 2WSEE 3OS5A 4M75F 2QQ8A 5GANg 2DD4A 1BI1A 1UGSB 2MWOA 4BDYA 3QYBA 5LJ5h 2CS7A 3M56A 1Q81U 1NJIU 4MMLA 1I8FA 2KQWA 2OTLT 2BUDA 4QVCA 3QO3A 1KD1U 2EWNA 2QQSA 3MEAA 4M6VA 3CCET 4XTZA 3OSSC 2LQ8A 1VIEA 2DXBA 3FDRA 2KMGA 1Y96B 3VKIA 3JCMJ 3MEWA 2E70A 1X75C 2LRQA 4OGCA 1Q86U 3X26B 4YTLA 4C8QC 4O5VA 3CPFA 3QYHB 2O4XB 4J7FA 4M75E 4JJNK 1IREB 1R8OB 2QI2A 1VQKA 2X4XA 3KHIA 3NTIA 3DL1A 4HNTA 4KBMB 1FWZA 4UC4A 4M78G 4HT9A 5CVIA 1M1KC 5GAN5 5GAN2 4HCBA 1YJ9T 2MMPA 3JCMW 4MZPA 2DD4B 2E12A 4M77F 5CK9A 2QEXA 4LDWA 4ATOA 2CZ0B 2DTHA 2QEXT 2CGHA 3V7SA 2VUBA 1D3BA 2YLBA 4M7AF 3LLRA 3NTHA 3V8JA 2M0OA 2K57A 4V2SA 1U1SA 4IUPA 4II1A 4PLLA 3L2RA 1OZ2A 4L6V5 2MWPA 1Q82U 1EIFA 1G3TA 5GAN6 2CZ1B 3RKWA 2F69A 3CC7T 3VYHB 2L5QA 3BY7A 4MFEA 3J81E 5GANj 3G71A 2PVOB 1RI0A 2RI3A 3SB2A 3M58A 4X34A 3G71T 1KHCA 3P8HA 4JRPA 3CCUA 3HSBA 5GAMh 2RJCA 1BIAA 1M1FA 1WQWA 3PT9A 4TVRA 4XQ3A 3OQ5A 4A4KA 1G3SA 2XK0A 4B9XA 3GPLA 1VQLT 3QBYA 1VIFA 4C8QA 2CZ6B 4F7UE 3L2UA 3QKJA 3OA6A 2XICA 2D6FA 3M59A 3BG9A 2RJDA 3FJPA 1B34B 2IG0A 2M1HA 2P0QA 3I55T 2XDDA 5A0DA 5GMKm 2RD1A 1VQPA 3OYHA 4PJOD 3M53A 3JAME 1M8VA 4QQGA 1YIJA 4BI8B 4ZGEB 4AKHA 3JCMd 1KC8C 1ZHIA 3JCMe 1NPPA 3Q1JA 4C0GA 2QDJA 3JCMb 3OYGA 3CCRA 4HT8A 3R6OA 3CMET 3LGFA 2GQVA 2L8DA 3M4YA 5D6WA 1GXIE 2KDSA 2QF7A 2K5IA 2EAYA 2VGNA 3PMIA 5DLOA 3CCVT 2E64A 3QUIA 4HL4A 3CCQA 3TREA 1YHQT 4ZN1A 4OB2B 2HQEA 1YITA 1UB4A 4PLIA 3A5ZB 4QVZA 5CKEA 1KHIA 3ZBDA 5CO7A 3S3MA 3KXTA 1AHJB 2Y4XA 4IUQA 2QQ9A 4GY5A 4J6YA 5CKFA 5GAN4 2OTLA 4HA8A 2DXCB 3HB9A 2EQKA 2LCLA 3PIPA 5CR2A 4M7AC 3C12A 4M77E 3EAEA 3F70A 3JCMg 4R56A 1RL2A 4XK8E 2XD0A 3VUBA 1BIBA 4J83A 3HO8A 4M77C 3NFCA 2X4WA 4PL6A 2RA2A 1PSEA 3BFMA 3HKSA 2D0QB 5IAYA 2RJFA 2PU9B 4BI3A 1OYXA 3GNGA 3OYYA 4A4FA 1U8RA 3HHTB 2EQUA 4JS5A 2MI6A 3PNWC 4M7DG 3JB9H 3CCMT 1VQ8A 5LJ3e 2CYZB 1LJOA 4MDWA 4OGEA 4C8QF 2G3RA 3C94A 3OS0A 4P5NA 4AKGA 4RCBA 1W2BS 2ZPEB 2R5MA 1NJIC 1UEBA 4M77G 4BDZA 1NPRA 3KUFA 3GP8A 2HAXA 3GF5A 3JCMP 4N0AA 3DKMA 3JCMh 4LOCA 3SWNB 1K9MU 4JS4A 1QVPA 5FU7B 4D6WA 3SFMA 1OI1A 3OBWA 2G77A 4PNOA 4C5GA 4EMGA 4AI6A 3L2VA 3BG3A 3QDRB 4JRKA 4FM4B 1BI0A 2L89A 3CC7A 5CQYA 5FU6B 3QJYA 2JOYA 4M75C 5GMKl 3J7AF 2YHTA 4L5GA 4IUTA 4A4HA 3CCJT 4C92A 2RHXA 1KC8U 4BE0A 3H4CA 3V8LA 3QYGB 3DLMA 3CBMA 3X24B 3CBOA 2XU8A 3HRUA 2F5KA 3JSCA 2KK4A 3UWNA 2A7YA 3HRSA 2EKOA 4M7DD 1VQLA 4BY6C 4MFDA 4BBRM 5GAMf 4Q5WA 2XDBA 1Q7YU 1FXXA 3OSVA 3VU3C 2DZ9A 5C6SA 3C95A 2LX9A 1N8RU 1VQ6T 1I81A 2IVWA 4M75G 4M7DC 2XIDA 4M75D 2V8JA 5J26A 1WPYA 2CZ7B 4E7IA 4C92G 3JB9I 5GANf 2WJ9A 5C0MA 3CCRT 3H8ZA 3JCMX 1XNIA 4M78D 4J8OA 5HY6A 4NL3A 3CC4T 3A8OB 2OTJT 3X20B 1VQOA 3HFNA 4KUIA 4XTUA 5GAOl 3CCVA 4C8QD 3QJ6A 4OB3B 1G3YA 2DXTA 1QP2A 4RG2A 1JRIA 4QSHA 3RKYA 4LD6A 1Q7YC 5LL6S 4NL2A 1YI2T 1YIJT 4M78B 4Z6YA 5FLXE 2EJ9A 2R58A 2YLCA 4XU3A 1XOVA 4DA4A 3TW6A 4FIBA 1N9RA 4EMKA 2ZCFB 4ME7A 1M5Q1 2R57A 1VQ7A 2BKDN 2KMTA 4M7DF 1M1GA 5GANd 1K73C 3UDCA 1K8AC 4M78C 2ZPFB 2K4YA 4ZGJB 2DTIA 2QQAA 4CRIA 5GAN7 4QQDA 4EMKB 3OYNA 3RMQA 2RM4A 3NTKA 4M7AE 2QQRA 5FU7C 4C0FA 1QVFA 1N6AA 1XQHA 1UGQB 2X4JA 3OY9A 3OW2S 1VQMT 4XTYA 3CC2A 2E6NA 4VUBA 1YCYA 4C0DB 1OZ3A 1HXDA 3G4SA 1K9MC 3CCUT 4MZTA 3CC2T 4IKFA 2QQBA 2VXEA 2K5FA 2DJZA 4MDXA 2XHCA 4OP0A 4IUVA 5KCOA 3CCMA 2GFAA 5CCAA 1YJ9A 1VQ8T 4M78A 4M7AB 3A8GB 3GIBA 4C5HA 4C92F 1H3ZA 3QZ5B 1I4K1 3BW1A 5LJ5g 2DXUA 2V8KA 2WACA 3LW5E 2KR6A 2QXFA 2LDMA 2FB7A 4LDYA 3JB9J 3JRZA 4RCCA 3URGA 1QVGA 2BIVA 1X6OA 2E65A 4BY6B 3OYAA 4XTVA 2E6ZA 4XU0A 3X28B 5L8RE 5A0GA 3G6ET 5GAOr 4HLQA 3JB9G 4PJOB 3A8HB 1I5LA 3I56A 2RHYA 1VQOT 3PMTA 1YI2A 1UGPB 1KQSS 3ER0A 1W4SA 4WF2A 1QVGS 2RHIA 3VJPA 5GMKe 4O6JA 1LOJA 2P0PA 1JBMA 3UT1A 4X9DA 1VQ4T 4C5IA 2DEQA 3MP8A 4B9WA 2R5AA 1S72A 4Z02A 4OMFB 5HK3A 3JCMQ 5LJ3j 2QFZA 4F7UB 1QP3A 4KUDK 2Y90A 4A54A 1E7PA 5GAMj 3CPWA 2XDPA 4BI4A 3DB4A 2JVVA 2GCXA 2DTOA 2VV5A 2RO0A 2M9UA 3VV0A 2A3LA 5AYFA 4JX4A 5GMKj 2XI9A 5GAOm 4R55A 4JRQA 1FKMA 3L42A 3O8VA 2RJEA 4ZGDB 3HZJA 1VQ6A 3A8LB 2PUOB 4OB1B 2EJFA 1B34A 2ZPGB 5GAMe 3VYGB 2LC4A 4HNVA 1N27A 2EJGA 4C8QG 1VQNA 1N9SA 4J6WA 4E47A 2QDYB 4QW2A 3S6WA 5A2QE 1IZ6A 5FU6C 2XKOC 3QZ9B 1K8AU 3RUXA 2DO3A 3OMGA 4ELZC 5J39A 4JUVA 4JX5A 2EFIA 2K2VA 5GAMg 1YJWA 5CAIA 1O75A 1YJWT 2DKGA 3AHUA 3QWLA 4PJOF 3UPUA 1VQ9A 2WSFE 4FSXA 2FL7A 3ASKA 4JX6A 3L2QA 4XU1A 2K3XA 3RESA 5KE3A 3OYKA 4E7JA 4JLIA 2PVGB 4N4IA 1VQ7T 3TEEA 1MHNA 2NLUA 4M77A 5CKHA 4N0AC 2HBPA 3ZFJA 4C8QE 1K73U 2EQMA 1G5VA 1BI2A 1QW1A 3MEUA 2QA4T 3CEYA 5FRNA 5IT9E 2B8AA 2LT1A 3L1AA 1Q86C 3QHSA 3DB3A 2LTOA 4DOVA 3OYMA 3MP6A 5LJ3g 4AKIA 3QG1A 4HNUA 2DXCA 1M90C 2LQKA 1S72T 2ZPIB 5LJ3f 2RH2A 3BDLA 3WVDB 3JB9F 3QXEB 4XU2A 4BE2A 1H641 2O4XA 5J3BA 2BS4A 3EFSA 3X25B 2YRVA 2DIQA 4M7DE 2X35A 1M4ZA 3E1SA 2LNVA 3LGLA 5GAOq 3CCLT 1BYMA 1YJNA 1YJNT 1W2BA 1VQ5A 4C92E 5GAOn 2KSSA 3CMAT 2VC8A 3SWNC 3S3NA 1JB0E 1ZBXA 4GLKA 4M78E 4EMHA 2RB6A 2ZZDB 3E9GA 5HKCA 5DLQE 3LYIA 4MMKA 3VUZA 3SDZA 4E7LA 3OYEA 4C92D 3WXMB 3PFSA 4E7KA 3CD6T 2RI2A 2D9TA 5CIUA 3HPWA 1M9SA 5KCHA 3RMSA 1WNLA 1WJRA 2ZGWA 3CCQT 1YHQA 4PJOG 4E7HA 2JTFA 4QQ6A 3GOXA 1V29B 2LT4A 3J80E 2O01E 4HCZA 4MIMA 2MAMA 3GLXA 3L2ZA 2FVUA 3LX7A 3OB9A 3V7CA 3PIOA 2FYKA 3OS2A 1UGRB 3OYFA 1VUBA 3LH0A 3M57A 2XG8D 3MO8A 3JCMV 5LJ5j 4M7AG 3JB9D 5GAN8 3CCEA 2DD5A 2RK1A 4JDSA 4XTXA 1P92A 3V8KA 5GANh 1BI3A 1KG1A 5GANe 3TW7A 2F5TX 4N4HA 3OW2A 5GMKi 4PJOC 3QSUA 2E10A 3TCJA 2GFUA 5KH6A 4F7UG 3CCSA 2L3RA 2PVDB 3OYIA 3LWHA 4XAXB 3S3OA 3SWNA 4N4GA 1MGQA 1WGSA 5I2SA 3CPWS 3WVEB 4ELJA 1WQ7A 2DVEA 2EIFA 2EQJA 3FRNA 3P8BB 4M75A 4X9CA 1Y71A 1PSFA 3ZEHA 4BD3A 5LJ5f 3GNFB 2KY9A 3FLGA 3KBGA 4QVDA 4FL6A 3RIRA 2RHZA 5I21A 2K3YA 3LWIA 3P8DA 5LJ3d 4PKCC 4A53A 4BBSM 2JNGA 4LDUA 1KQ2A 3A8MB 5LJ5e 2ZPBB 1FX7A 2KAFA 2C06A 3HP9A 3OMCA 3HL8A 1ZQ1A 3M4GA 2RI5A 3RKXA 4EDUA 3M9QA 3FIFA 5D6XA 3JCMf 3QPHA 3OYBA 1JJ2S 4FT2A 4J7IA 3OBYA 3C4SA 4EMKC 4M77D 4IUUA 4BACA 4LDXA 1QVFS 1VQMA 2DXBB 1SSFA 2JTMA 4BUGA 2BS3A 1XTDA 4FT4A 5M9OA 3OS1A 5A0LA 1KQ1A 3BDUA 4OB0B 1DJ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 B;  3X24 B;  2ZZD A;  2WSF E;  2CZ0 B;  2PVG B;  2CZ7 B;  4L6V 5;  2CZ1 B;  2DD5 B;  3VYH B;  4KT0 E;  2PVO B;  3A8O B;  3X20 B;  2DXC A;  4OB3 B;  4RKU E;  2ZPI B;  1QP2 A;  3WVD B;  3QXE B;  2CZ6 B;  3X25 B;  2ZCF B;  2ZPH B;  2ZPF B;  4ZGJ B;  4ZGE B;  1JB0 E;  2WSC E;  2ZZD B;  1UGQ B;  1GXI E;  4Y28 E;  1V29 B;  4OB2 B;  2O01 E;  2DPP B;  3VYG A;  3A8G B;  3QZ5 B;  1AHJ B;  1UGR B;  3LW5 E;  2DXC B;  2DD5 A;  4XK8 E;  2PUK B;  5L8R E;  3X28 B;  2AHJ B;  3A8H B;  1PSE A;  2D0Q B;  3QYG B;  1UGP B;  2PU9 B;  3HHT B;  2PVD B;  2WSE E;  3WVE B;  2DD4 A;  1PSF A;  1UGS B;  2CYZ B;  1QP3 A;  2ZPE B;  3A8M B;  2ZPB B;  2DXB A;  4ZGD B;  3A8L B;  2PUO B;  4OB1 B;  3X26 B;  2ZPG B;  3VYG B;  3QYH B;  4FM4 B;  1IRE B;  2QDY B;  3QZ9 B;  2DXB B;  4OB0 B;  1DJ7 B; 
#chains in the Genus database with same CATH topology
 3H6Z A;  2ZZD A;  3QYE A;  3HBL A;  1UNG D;  1AVZ C;  5DM7 R;  4CXA B;  4DBR A;  5CKD A;  3JV3 A;  4C5E A;  3M5A A;  3V7R A;  1Q82 C;  2P0K A;  3SD4 A;  1JJ2 P;  2W99 A;  1KD1 C;  1BU1 A;  2OTJ A;  2QGS A;  2J6O A;  2B86 A;  1M90 R;  2E41 A;  1NE8 A;  3VKG A;  2K5L A;  1C9B A;  3L2W A;  1VQ9 T;  3DLL A;  3BG5 A;  2DK3 A;  4CI0 C;  1CKB A;  4JJB A;  4M78 F;  2LCC A;  2VYT A;  1G2B A;  2ZPH B;  1S1N A;  2DL5 A;  1X2Q A;  2H3J A;  2C0O A;  5IN1 A;  5GAN 3;  4A4E A;  2KI7 A;  3ME9 A;  1WJS A;  1HJD A;  4PJO E;  3C0C A;  3JCM c;  1PWT A;  2L3P A;  3G4S T;  1YBY A;  2Y4Y A;  4BB7 A;  1AWO A;  2DBM A;  2ED0 A;  1JXO A;  2HD0 A;  1WFW A;  4MZM A;  2V8I A;  4F7S B;  4JJC A;  1KIK A;  2BS2 A;  3UF4 A;  3CCL A;  1ZSZ C;  4F7L B;  2BE9 B;  2PUK B;  3G6E A;  1D09 B;  3E9F A;  3OW2 P;  4LNP A;  4L59 A;  1NZ9 A;  3EGX B;  4JLG A;  2LZ6 B;  1A0N B;  1H1R B;  2VXF A;  4C0Z A;  1WZO A;  2HQX A;  2DVJ A;  4NST B;  1BI1 A;  2MWO A;  5LJ5 h;  2YXY A;  2KQW A;  2BUD A;  3CCE T;  2YWW A;  2QQS A;  3MEA A;  4KGZ B;  2DXB A;  1AEY A;  2W10 A;  1KC8 R;  2LRQ A;  3X26 B;  4C8Q C;  3CPF A;  1Q86 R;  4J7F A;  2AIR B;  1JSU B;  4DEY A;  3DL1 A;  4KBM B;  1FWZ A;  4UC4 A;  1W2B P;  3I56 Q;  4GBQ A;  2MMP A;  4M77 F;  4DBF A;  1RAG B;  4M7A F;  3CME Q;  1OEB A;  4ZNX A;  4BXX X;  3LLR A;  3NTH A;  2M0O A;  5ACB A;  2C6T B;  1G3T A;  3POM A;  1ENW A;  3J81 E;  2PVO B;  2RI3 A;  5GJV B;  4EOO B;  3IQL A;  3OQ5 A;  1G3S A;  2CZ6 B;  1I0C A;  3L2U A;  3QKJ A;  2XIC A;  1AZG B;  1GH6 B;  5GMK m;  3OYH A;  3GBQ A;  4ZGE B;  3JCM d;  3VS1 A;  3JCM e;  4C0G A;  4HT8 A;  3CCR A;  1WI7 A;  3LGF A;  5D6W A;  2L8D A;  3UA7 A;  4RTW A;  4ROD A;  2QF7 A;  2EAY A;  2VGN A;  3QUI A;  4HL4 A;  1FMK A;  2C0T A;  2FZC B;  4F7J B;  4OB2 B;  3A5Z B;  3KFV A;  2K6D A;  5CKE A;  5CEI B;  2WFY B;  1QCF A;  3KXT A;  1AHJ B;  4GY5 A;  2OTL A;  1PKS A;  6AT1 B;  1IRX A;  3ULR B;  2BZY A;  2DXC B;  3REA B;  5CR2 A;  4M77 E;  4R56 A;  3TNH B;  1B07 A;  2X4W A;  2DIL A;  1PSE A;  2RA2 A;  3BFM A;  2SEM A;  1PD1 A;  1U8R A;  3HHT B;  1H28 B;  1JXM A;  4M7D G;  1VQ8 A;  1QKW A;  1N5Z A;  4MDW A;  3OS0 A;  3G4S Q;  1UNH D;  4YC3 B;  1Z9Q A;  2WEV B;  2R5M A;  1MV0 B;  1UEB A;  1NPR A;  3KUF A;  3GF5 A;  4N0A A;  2RF0 A;  3DKM A;  1K9M U;  3SFM A;  1OI1 A;  2L89 A;  1KD1 R;  2PJQ A;  3J7A F;  4IUT A;  2M0Y A;  3CCJ T;  2D8H A;  2X1N B;  1E9H B;  1C6V X;  4A4G A;  3L2Q A;  3CBO A;  2XU8 A;  2F5K A;  4OML A;  4BY6 C;  4BBR M;  2FRY A;  5GAM f;  4CFW B;  3OSV A;  5C6S A;  3C95 A;  2LX9 A;  2H8H A;  4KRC B;  2XID A;  3CCQ Q;  4C92 G;  5GAN f;  1J3T A;  3CCR T;  2E3I A;  4M78 D;  4YOS A;  3SHW A;  3CC4 T;  3CCV A;  1D0Z A;  2HL3 A;  5L23 A;  2AT1 B;  1G3Y A;  1X2K A;  2GBQ A;  2W9Z A;  3RKY A;  1UUE A;  5FLX E;  3TSW A;  4DA4 A;  1GUX A;  1PC0 A;  2ZCF B;  4ME7 A;  2R57 A;  2KMT A;  4CRL B;  4ZGJ B;  1S72 Q;  2W96 A;  2QQR A;  1YJN Q;  1AD5 A;  1UGQ B;  2L2P A;  3CC2 A;  1YCY A;  4IKF A;  2QQB A;  2LNH B;  4MDX A;  1H25 B;  2DRM A;  4IUV A;  2I40 B;  3A8G B;  2YT6 A;  1H3Z A;  4C92 F;  1I4K 1;  3BW1 A;  2DXU A;  2V8K A;  1OI9 B;  2OAW A;  3JB9 J;  3JRZ A;  4RCC A;  1QVG A;  2BIV A;  1K1Z A;  4LN2 A;  4XU0 A;  4A63 B;  1NBE B;  3MY5 B;  2RHY A;  4ANJ A;  1VQO T;  3PMT A;  2HKQ B;  1GBQ A;  2FPE A;  1KQS S;  5GMK e;  4BCQ B;  4GLM A;  2DEQ A;  4B9W A;  5LJ3 j;  1Q95 G;  5CYI B;  4DBQ A;  3CPW A;  2VV5 A;  2DTO A;  4R55 A;  5AYF A;  4AT1 B;  4JRQ A;  5HBH B;  4JZ4 A;  1ZA2 B;  1FKM A;  4JZ3 A;  1RAH B;  4ZGD B;  2RJE A;  5EFQ B;  2CJM B;  1B34 A;  2O88 A;  4LUE A;  3VYG B;  4HNV A;  1N27 A;  3EGX A;  1N9S A;  3VS6 A;  4CFU B;  4J6W A;  1K8A U;  3QZ9 B;  2DO3 A;  4ELZ C;  1WHJ A;  1H27 B;  3UPU A;  1VQ9 A;  4F70 B;  3ASK A;  1QCO A;  3RES A;  2PVG B;  2BPM B;  3EG9 B;  4C8Q E;  2DE0 X;  1TS9 A;  3MEU A;  3CEY A;  5FRN A;  3EFO B;  3L1A A;  3QHS A;  4Y92 A;  1ZUK A;  4DOV A;  2QEX Q;  3H0H A;  2CCI B;  2BE7 D;  3QDF A;  1BBZ A;  1YJ9 Q;  2AK5 A;  2LQK A;  4F6W B;  4X1V A;  1T0H A;  3JB9 F;  2QAS A;  2FG0 A;  1SHG A;  4M7D E;  2W9F A;  1ZLM A;  1NEB A;  3LGL A;  3CCL T;  1RI9 A;  2A36 A;  3G33 B;  5GAO n;  2VC8 A;  3M0Q A;  1VQ8 Q;  3PO3 S;  3S3N A;  4GLK A;  2RB6 A;  3E9G A;  5HNB B;  1VQ7 Q;  3SDZ A;  4F14 A;  1YNZ A;  3WXM B;  2OTJ Q;  5CIU A;  1OUL A;  1WNL A;  1WJR A;  4Z88 A;  3RMS A;  2XMF A;  3CCQ T;  4EOS B;  4PJO G;  1WHM A;  4HCZ A;  1K73 R;  2M02 A;  1OGU B;  2HKN A;  2FVU A;  1F5Q B;  3H41 A;  1VUB A;  1T0J A;  3A1P A;  3TVT A;  4JDS A;  1BI3 A;  4FCY A;  2F5T X;  2DL3 A;  1M3C A;  3OW2 A;  3VRY A;  1NM7 A;  1Y0M A;  2HBW A;  3TCJ A;  1H8K A;  2GFU A;  5KH6 A;  3TNW B;  4XAX B;  4J9H A;  3SWN A;  5I2S A;  1MGQ A;  1PNJ A;  1K73 C;  1WQ7 A;  3FRN A;  2EQJ A;  4J9G A;  4X9C A;  4BD3 A;  1Y71 A;  5I21 A;  1OKW B;  1OX8 A;  5LJ3 d;  3CC7 Q;  4A53 A;  3EH1 A;  2JNG A;  4LDU A;  2O2O A;  1FX7 A;  1TTH B;  2C06 A;  2C5X B;  3OMC A;  3HL8 A;  2EGA A;  1UE9 A;  2HCK A;  1ZQ1 A;  3M9Q A;  3BLH B;  1KSW A;  1SRM A;  3OBY A;  4M77 D;  1VQM A;  4BUG A;  1SSF A;  5M9O A;  2BS3 A;  3OS1 A;  1KQ1 A;  1Q7Y U;  4BCO B;  4AG2 C;  4OB0 B;  4M75 B;  4NOY A;  4RMO A;  1V1C A;  1Q81 C;  4KRD B;  3OYC A;  3VKH A;  2HDA A;  3EG9 A;  5KYY A;  4E2F B;  1LNX A;  1TWB A;  3DJB A;  2V26 A;  4ZN3 A;  4NC6 A;  1JQQ A;  3RNJ A;  1YHQ Q;  1VQK T;  3CC4 A;  5ICP B;  2VVK A;  2QTX A;  4HKE A;  4CC2 A;  3CD6 A;  4RKU E;  2LVM A;  2H3E B;  2PNI A;  3E2U A;  1C1A A;  1YIT T;  4PFZ A;  1Y07 A;  1KQS A;  2LCS A;  4LXC A;  3RGF B;  3CXC S;  4UN0 A;  2NUP B;  2JXB A;  2MOX A;  3HRT A;  3I35 A;  2M16 A;  5LJ3 h;  2D0N A;  5FRM A;  3QII A;  4HVW A;  2PQW A;  9ATC B;  2GTJ A;  1R77 A;  1Y57 A;  2RN8 A;  1CKA A;  2YSQ A;  3OYL A;  1G3W A;  4C0D C;  1QLB A;  3HFO A;  4IUR A;  1GCP A;  3G6E Q;  2RK2 A;  2G9X B;  4OVA A;  1D0Y A;  1X01 A;  3PE0 A;  3CMA A;  1VQ5 T;  4OF1 A;  2I2L A;  4DOW A;  3EG2 A;  2JN0 A;  1VQ4 Q;  3QHW B;  2DLP A;  3I56 T;  2DAQ A;  2KXD A;  4NS5 A;  4ROE A;  1UJY A;  1UG1 A;  4ELY C;  4C92 B;  3RER A;  2Z0W A;  4EOK B;  1TUG B;  2FHD A;  1NYF A;  1VYT A;  3CCJ A;  2CDT A;  3OS5 A;  4FYX B;  3TSZ A;  1VQ6 Q;  5GAN g;  4BDY A;  3QYB A;  2QDL A;  1KD1 U;  1H24 B;  3QO3 A;  3VS4 A;  4M6V A;  4IMY B;  2DEU A;  3OSS C;  1BCO A;  3JCM J;  3MEW A;  1TSF A;  1X43 A;  4YTL A;  4M75 E;  4JJN K;  2O4X B;  1PCX A;  1R8O B;  2QI2 A;  2AZS A;  2W0Z A;  1YI2 Q;  2QYZ A;  1I5O B;  4M78 G;  5CVI A;  1MUZ A;  1YJ9 T;  1K76 A;  1G8X A;  1UGV A;  2E12 A;  5CK9 A;  2QEX A;  2DTH A;  2I53 A;  2QEX T;  4RTU A;  4E7Z A;  2K57 A;  4EC8 B;  4RTV A;  2MWP A;  2K3B A;  2CZ1 B;  3CC7 T;  2F69 A;  1M30 A;  3VYH B;  2L5Q A;  3TN8 B;  1RI0 A;  1HD3 A;  2JTE A;  3P8H A;  5ECA A;  3CCU A;  3HSB A;  3M0R A;  5GAM h;  2RJC A;  1M1F A;  1WQW A;  4TVR A;  4A4K A;  2XK0 A;  5KYY B;  2KEA A;  4B9X A;  1KFZ A;  2NUP A;  4ELL A;  1SPK A;  3CQT A;  3OA6 A;  2D6F A;  3VS2 A;  2RJD A;  5GJW B;  1B34 B;  1WXB A;  2P0Q A;  4OMO A;  5A0D A;  1UJ0 A;  1JST B;  2UZB B;  4PJO D;  1M8V A;  2QA4 Q;  4BI8 B;  5IF1 B;  1NPP A;  3CCS Q;  2PK9 B;  3EG0 A;  1WLP B;  1GXI E;  2KDS A;  2PTK A;  3D7S B;  3NPF A;  4OMM A;  2E64 A;  1YHQ T;  1P5E B;  1U06 A;  1YIT A;  4PLI A;  3CPW P;  5CO7 A;  2R7G A;  4IUQ A;  5GAN 4;  4BCG B;  4FX3 B;  4TTH A;  3PIP A;  3C12 A;  4J9E A;  3F70 A;  1RL2 A;  1QLY A;  1ZA1 B;  3MI9 B;  4PL6 A;  5KYX A;  3LH5 A;  1GCQ A;  2DL8 A;  4JS5 A;  2MI6 A;  2ZAE A;  3UAT A;  1D3U B;  4J9C A;  2DMO A;  2G3R A;  3C94 A;  1JO8 A;  4P5N A;  4AKG A;  4RCB A;  1W2B S;  1OIU B;  1NJI C;  4M77 G;  4BY7 X;  3GP8 A;  2HAX A;  1K8A R;  2KRN A;  2WPA B;  4JS4 A;  1QVP A;  4D6W A;  1QVF P;  2G77 A;  4C5G A;  4EMG A;  3L2V A;  3QDR B;  4FM4 B;  1BI0 A;  5CQY A;  5FU6 B;  2EYW A;  1HYO A;  4A4H A;  2DFU A;  1LVK A;  1H3H A;  4F04 B;  2RHX A;  3H4C A;  3V8L A;  3QYG B;  2A08 A;  2A7Y A;  4M4Z A;  1MND A;  1VQ6 T;  1D1B A;  1QVG P;  1OV3 A;  2V8J A;  4E7I A;  5C0M A;  4NL3 A;  1PG5 B;  5HY6 A;  2PHG A;  1VQL Q;  3HFN A;  4KUI A;  4XTU A;  4ROC A;  5GAO l;  4C8Q D;  4EOM B;  2DXT A;  1WHL A;  1QP2 A;  4RG2 A;  3NHN A;  1JRI A;  1EFN A;  1YIJ T;  4FIB A;  4EOL B;  2GTO A;  1VQ7 A;  2FPD A;  1TUC A;  3UDC A;  2K4Y A;  2CUD A;  2DTI A;  2QQA A;  4D8D A;  4EMK B;  2JM9 A;  4C0F A;  1XQH A;  3OY9 A;  3CCU Q;  2P4R A;  2ROT A;  1VQM T;  3G71 Q;  4J9B A;  1OZ3 A;  1HXD A;  3G4S A;  1K9M C;  3CCU T;  4F6U B;  2C4G B;  5IHK A;  1URC B;  2JMA A;  1VQ8 T;  1H1P B;  1ZUU A;  2WAC A;  3LW5 E;  2KR6 A;  3URG A;  5HVY B;  2DM1 A;  1X6O A;  2E65 A;  4BY6 B;  3OYA A;  2E6Z A;  3JB9 G;  3X28 B;  2YUQ A;  5L8R E;  5A0G A;  5GAO r;  4HLQ A;  3A8H B;  1I5L A;  1YI2 A;  3QHR B;  4AFU C;  2GQI A;  2RHI A;  4O6J A;  1OKV B;  4RTY A;  2GGR A;  4X9D A;  4CC7 A;  3R6N A;  1RAD B;  2HZY A;  3JCM Q;  1ZP2 A;  2KRS A;  4F7U B;  2Y90 A;  1E7P A;  5GAM j;  3DB4 A;  2JVV A;  5GMK j;  2LX7 A;  3VV0 A;  5GAO m;  1VQN Q;  2XI9 A;  2L0A A;  3AT1 B;  1H4L D;  5DQV A;  3HZJ A;  2X9H A;  1VQ6 A;  2RMO A;  1ACM B;  2EJF A;  1WIE A;  2EJG A;  3EFO A;  1KK7 A;  3QWX X;  5A2Q E;  1IZ6 A;  2YUN A;  2EFI A;  5GAM g;  1O75 A;  4CC3 A;  1YJW T;  2DKG A;  3QWL A;  2CP7 A;  2IVX A;  1KJW A;  4XU1 A;  1VOM A;  4E7J A;  3OYK A;  1AZE A;  2JGZ B;  5CKH A;  3ZFJ A;  2QA4 T;  5IT9 E;  4BCN D;  5LJ3 g;  1OIY B;  2ENM A;  4AG1 C;  2QTV A;  4HNU A;  1M90 C;  2ZPI B;  5LJ3 f;  2COZ A;  3BDL A;  3QXE B;  4EC9 B;  5J3B A;  2BS4 A;  3EGD A;  3EFS A;  1VQK Q;  2DIQ A;  2X35 A;  1M4Z A;  2FZK B;  4FYY B;  1YJN T;  1W2B A;  1JB0 E;  1ZBX A;  4M78 E;  3CD6 Q;  2ZZD B;  4E7L A;  3VUZ A;  4C92 D;  1GBR A;  3CD6 T;  2RI2 A;  5KYX B;  2DX1 A;  2QGF B;  1YHQ A;  2NUT B;  4E7H A;  2E3H A;  4CFM B;  2O01 E;  4MIM A;  3GLX A;  3L2Z A;  3OS2 A;  1K0S A;  2ABL A;  3V7C A;  2EBP A;  1EX4 A;  1UGR B;  3BHV B;  2LW4 A;  2O31 A;  1W98 B;  3LH0 A;  2XG8 D;  4F7N B;  2JMC A;  3CCE A;  2RK1 A;  4XTX A;  3V8K A;  5GAN h;  1XJW B;  3TW7 A;  3REB B;  1OOT A;  5IXB A;  3PVQ A;  3CCL Q;  2E10 A;  1D1C A;  3UA6 A;  1YN8 A;  4J9I A;  5KYW B;  4F7U G;  2L3R A;  2L3S A;  3BHT B;  2PVD B;  3OYI A;  3LWH A;  3S3O A;  3I9Q A;  5CAI A;  1W1F A;  4M75 A;  3GNF B;  3LWI A;  4FL6 A;  1OX9 A;  5IHI A;  4PKC C;  1UNL D;  1KQ2 A;  2MIO A;  3EID B;  2KGT A;  2ZPB B;  3RKX A;  4EDU A;  1YWO A;  3FIF A;  5D6X A;  3H0F A;  1GY3 B;  3NGP A;  4BCM B;  2CH4 W;  1XTD A;  5A0L A;  1DJ7 B;  3CBP A;  2ROL A;  4FSS A;  1U3O A;  3CXC A;  1Z9Z A;  1IHW A;  4BCM D;  4JRI A;  3BE3 A;  2KVQ G;  5CKB A;  4F16 A;  5I22 A;  4C92 C;  4M7A A;  3K7A M;  1VQN T;  2KRO A;  2DD5 B;  3FEO A;  1M90 U;  5EG2 A;  4PJO A;  2VB6 A;  2LJ1 A;  1BB9 A;  1H1S B;  2A0F B;  2OAU A;  2PZ1 A;  1GCQ C;  1JJ2 A;  5GAM d;  1VQ5 Q;  1OU8 A;  2EYY A;  4RG8 A;  2IIM A;  1YFN A;  1AOJ A;  2DER A;  1M1K U;  2CKK A;  2C0I A;  2JUF A;  5GAO p;  1HSQ A;  4F7U F;  3M54 A;  2WSC E;  4AFZ C;  4ZTJ A;  4J9D A;  2JZ2 A;  5DY9 A;  2JS0 A;  2MF2 A;  2E1H A;  2X4Y A;  4Y28 E;  3TU4 K;  4BCN B;  1RAA B;  1X6G A;  1B3Q A;  1X6B A;  5CQX A;  5EC7 A;  4OGR B;  3GTM S;  2DZC A;  2DIG A;  1OU9 A;  2DNU A;  1D3B B;  2DPP B;  2E5Q A;  1VQ4 A;  3VRZ A;  2ESW A;  3M0S A;  3I55 A;  3PTA A;  2J05 A;  5LJ5 d;  1AWW A;  1MMG A;  1ZBJ A;  3MET A;  2EGC A;  3EGD B;  1Q82 R;  1RUW A;  2AHJ B;  1OQK A;  3CME A;  1HK9 A;  1N4M A;  3MCA B;  4F7U A;  2RQT A;  4M77 B;  4KRT A;  4XTW A;  2DL7 A;  2DRK A;  4LDV A;  2G6F X;  2WSE E;  4I3Z B;  2QQ8 A;  2M51 A;  2DD4 A;  1UGS B;  2CS7 A;  1I8F A;  2X3X D;  4QVC A;  2FZG B;  4XTZ A;  4BCQ D;  1M3A A;  2IN3 A;  1AD6 A;  1VIE A;  1D0X A;  2IW6 B;  2KMG A;  1Y96 B;  1X75 C;  4OGC A;  1Q86 U;  1NEG A;  1FIN B;  3QYH B;  2IW8 B;  5I11 A;  3H0I A;  1VQK A;  3NTI A;  1V76 A;  4HT9 A;  3CC4 Q;  2UUE B;  3DTO A;  4QKU A;  3JCM W;  4MZP A;  2DD4 B;  4ESR A;  4EIK A;  3NDQ A;  4HXJ A;  4ATO A;  1D1A A;  2CZ0 B;  4FYV B;  2VUB A;  1D3B A;  2YLB A;  3M0T A;  3DDQ B;  1ZSZ B;  1U1S A;  3A98 A;  3EH2 A;  1OZ2 A;  4PJJ A;  1Q82 U;  5GAN 6;  3RKW A;  4HCK A;  4YOZ A;  3BY7 A;  3QWY A;  5GAN j;  1FYN A;  3SB2 A;  1PRL C;  4X34 A;  2LQW A;  1KHC A;  2BKZ B;  4XQ3 A;  3GPL A;  1VQL T;  3QBY A;  1YWP A;  4BCH B;  5FWB A;  3M59 A;  3BG9 A;  1SF9 A;  2IG0 A;  3I55 T;  4RTT A;  2XDD A;  5BNJ B;  2RD1 A;  1VQP A;  3M53 A;  3JAM E;  2NUT A;  4QQG A;  2KRM A;  4AKH A;  1KC8 C;  1ZHI A;  2DJQ A;  2NYS A;  3Q1J A;  2QDJ A;  3OYG A;  3CCV Q;  3R6O A;  3M4Y A;  1RAI B;  1FVV B;  2K5I A;  3CCV T;  5DLO A;  1GL5 A;  1MMN A;  3CCQ A;  1M27 C;  4ZN1 A;  1ZUY A;  2HQE A;  1KXU A;  1KHI A;  3ZBD A;  2X51 A;  1GRI A;  2Y4X A;  2QQ9 A;  4J6Y A;  5IH2 A;  4HA8 A;  3DOG B;  2IW9 B;  3HB9 A;  2EQK A;  3MIA B;  2LCL A;  4KH1 B;  4M7A C;  1R0B G;  3JCM g;  3VUB A;  1B7T A;  4J83 A;  1O9K A;  4JJD A;  4M77 C;  3TNI B;  2D0Q B;  2PU9 B;  4BI3 A;  4FW1 A;  3GNG A;  4A4F A;  1IB8 A;  8AT1 B;  1QMZ B;  5HBE B;  4Z8A A;  3VS7 A;  1JOW A;  1FMV A;  3CCM T;  5LJ3 e;  2CYZ B;  4C8Q F;  2CP6 A;  5HBJ B;  2YUO A;  3JCM P;  1BCM A;  4PK4 A;  2EKH A;  3THK A;  1YI2 T;  1Q81 U;  2RQW A;  4AI6 A;  4JRK A;  2K79 A;  1NLP C;  1FMW A;  1OL2 B;  2JOY A;  3QJY A;  1YIJ Q;  2YHT A;  4L5G A;  4BCJ B;  1MV3 A;  4C92 A;  2RPN A;  2DYB A;  1YCS B;  3HRU A;  3CBM A;  4M7D D;  1VQL A;  4Q5W A;  2XDB A;  3VU3 C;  4CFX B;  2DZ9 A;  1N8R U;  1TD6 A;  3B57 A;  1UEC A;  2DL4 A;  2IVW A;  4M75 G;  4M75 D;  5J26 A;  1WPY A;  1WHK A;  3CCE Q;  3JB9 I;  4BCI B;  3H8Z A;  1XNI A;  4J8O A;  2C5N B;  1TXQ A;  2OTJ T;  3X20 B;  1R0C B;  1VQO A;  3CCR Q;  3QJ6 A;  4OB3 B;  4DBH A;  4QSH A;  4KH0 B;  1Q7Y C;  1VQP Q;  4RUG A;  4Z6Y A;  4XU3 A;  2HMA A;  2YLC A;  1XOV A;  3TW6 A;  4EMK A;  1N9R A;  4II5 B;  1M1G A;  1QWF A;  1JU5 C;  2HQH A;  4M78 C;  5GAN 7;  2SRC A;  3OYN A;  3RMQ A;  2RM4 A;  4M7A E;  3FJ5 A;  4PJN A;  1QVF A;  2MPX C;  1TOV A;  2MK5 A;  2WXV B;  4C0D B;  3CC2 T;  2K5F A;  2XHC A;  5KCO A;  5IHY A;  2GFA A;  5CCA A;  3M0P A;  4C5H A;  5LJ5 g;  1G83 A;  2BZ8 A;  2QXF A;  1BK2 A;  2FB7 A;  1PM3 A;  4XTV A;  4PJO B;  3G6E T;  2YRC A;  1ABQ A;  3I56 A;  5FGK B;  1WXT A;  1UGP B;  1RLP C;  3ER0 A;  4WF2 A;  1ARK A;  1LOJ A;  2P0P A;  1JBM A;  3RR6 A;  4C5I A;  5L2W B;  3MP8 A;  2R5A A;  1S72 A;  4Z02 A;  5HK3 A;  3HTR A;  2QFZ A;  4KUD K;  4A54 A;  2M9U A;  1GFC A;  3PVL A;  2LMJ A;  3O8V A;  5IDP B;  2IPO B;  5GAM e;  2LC4 A;  4C8Q G;  1VQN A;  3I5R A;  1F1B B;  2HSP A;  4QW2 A;  5FU6 C;  3OMG A;  2J6K A;  4JUV A;  2WMB B;  1YJW A;  4PJO F;  2I0N A;  2WSF E;  4JX6 A;  2VAS A;  4EOQ B;  4JLI A;  4N4I A;  3I55 Q;  1RLQ C;  2CSQ A;  2NLU A;  2COY A;  4M77 A;  4N0A C;  2HBP A;  2HEQ A;  5KYW A;  2EQM A;  1G5V A;  2KNB B;  1QW1 A;  1H26 B;  2NUZ A;  2LTO A;  3OYM A;  1C0M A;  1ZX6 A;  3QG1 A;  2DXC A;  1M1K R;  3WVD B;  1NLO C;  2AKK A;  4BE2 A;  4XU2 A;  1VA7 A;  2O4X A;  2ED1 A;  1AWX A;  3E1S A;  1T3L A;  2LNV A;  5GAO q;  1NG2 A;  1K4U S;  2BZX A;  2K2M A;  1VQ5 A;  2EVR A;  4C92 E;  4PFO A;  3CMA T;  2KXC A;  2F2V A;  3SWN C;  1CSK A;  5HKC A;  3OYE A;  2KBT A;  4JPB W;  3U23 A;  4E7K A;  2HL5 C;  5KCH A;  3HPW A;  1M9S A;  3DDP B;  2C5O B;  4RTZ A;  2LT4 A;  4HVV A;  1SHF A;  3J80 E;  1Q81 R;  1G3N C;  1E6G A;  3LX7 A;  1LCK A;  3OYF A;  3M57 A;  3MO8 A;  3JCM V;  5LJ5 j;  5FW9 A;  5GAN 8;  2DD5 A;  1P92 A;  1KG1 A;  2YDL A;  2J06 A;  4E7S A;  2RQR A;  5GMK i;  3QSU A;  1SSH A;  4WCI A;  4BCF B;  1JEG A;  1RAF B;  5AT1 B;  2KT8 A;  2VKN A;  4R0K A;  4N4G A;  1WGS A;  8ATC B;  1MMD A;  4LD9 K;  2EIF A;  3P8B B;  2DVE A;  3L2R A;  3ZEH A;  5LJ5 f;  1PSF A;  2J7I A;  2KY9 A;  4QVD A;  3RIR A;  2RHZ A;  2K3Y A;  2FO0 A;  2OJ2 A;  5LJ5 e;  2KAF A;  1JKW A;  3HP9 A;  3TQ7 P;  5LMK B;  2D8J A;  2CP5 A;  3JCM f;  3MJX A;  4QT7 A;  4EMK C;  4IUU A;  2EW3 A;  2DXB B;  4EON B;  2JTM A;  1Q7Y R;  3N5B B;  5GMK h;  4Y91 A;  1U1T A;  4CC4 B;  2GF7 A;  5KE2 A;  5LQF B;  1O9S A;  3G7Z A;  3OYJ A;  4HVU A;  3VS0 A;  2VGM A;  3FC3 A;  1VQP T;  5D6Y A;  4KUL A;  2WIH B;  2P4T A;  4J5Y A;  3E19 A;  4KT0 E;  3CCS T;  4M7D A;  4M7A D;  4EOJ B;  2EYQ A;  3RDV A;  4J6X A;  4FU6 A;  2KYB A;  3FB9 A;  4EOP B;  3INZ A;  5FRO A;  3CXC P;  2EYZ A;  4HCC A;  1Y96 A;  3M03 A;  1X27 A;  4C8Q B;  1EZZ B;  4M7D C;  1NYG A;  2RHU A;  2QA4 A;  5IDN B;  2F2W A;  1YP5 A;  4M7D B;  3MEV A;  1KQS P;  2HNI A;  2PK2 A;  2HSE B;  3M55 A;  3T9N A;  3H9N A;  1H1Q B;  4OMN A;  3SEM A;  4ZTF A;  3MHX A;  4BCK B;  3PGG A;  5I2M A;  5KYU B;  3EFR A;  4EPC A;  1WJQ A;  4BE1 A;  4DQ2 A;  3VYG A;  1OL1 B;  2F2X A;  2FPF A;  5HQ0 B;  3OYD A;  3BLR B;  5HK0 A;  1LPL A;  4AMC A;  2O9V A;  1M2V B;  1Y7X A;  2CCH B;  2O9S A;  1SKU B;  3BLQ B;  3MP1 A;  2YUP A;  1TH7 A;  5EJC A;  1N8R C;  1BKB A;  5KYN A;  4M75 F;  1IXD A;  1W6X A;  3M56 A;  1AIS B;  1NJI U;  1IGU A;  4MML A;  2OTL T;  2EWN A;  2RQU A;  2LQ8 A;  1K9A A;  2JJ9 A;  2C5V B;  3FDR A;  3VKI A;  2K7A A;  2E70 A;  1MNE A;  4O5V A;  1IRE B;  2V22 B;  2X4X A;  4G6L B;  3KHI A;  1M2V A;  4HNT A;  2JS2 A;  1M1K C;  5GAN 5;  5GAN 2;  4HCB A;  2JW4 A;  3CCJ Q;  1QWE A;  2AZV A;  1UDL A;  1O9K B;  4LDW A;  2CGH A;  1SG5 A;  3V7S A;  3V8J A;  4V2S A;  4IUP A;  4II1 A;  2EPD A;  4PLL A;  1PD0 A;  4L6V 5;  3VS5 A;  2L3Q A;  1EIF A;  1WHH A;  3VS3 A;  4RTX A;  4MFE A;  2CSI A;  3G71 A;  2K9G A;  3M58 A;  3G71 T;  1VQ9 Q;  2DYI A;  4JRP A;  2CT4 A;  2EUF A;  1BIA A;  3PT9 A;  1YJW Q;  2DA9 A;  1VIF A;  4C8Q A;  2AKL A;  4F7U E;  4CFV B;  3G1J A;  3O5Z A;  1QKX A;  3NMZ C;  3FJP A;  2WHB B;  2M1H A;  5FWC A;  2LP5 A;  2DET A;  1PRM C;  3JCM b;  2BTT A;  3CME T;  2GQV A;  4CFN B;  1SEM A;  3PMI A;  2CP0 A;  1K9M R;  1WA7 A;  2X3W D;  3TRE A;  3EHR A;  1UB4 A;  4QVZ A;  3F5X B;  2UZL B;  2UZD B;  3S3M A;  5CKF A;  4IIO A;  2ATC B;  3EAE A;  2XD0 A;  4XK8 E;  2KT1 A;  2FEI A;  1BIB A;  5D7U A;  3RBB B;  3HO8 A;  4EOR B;  1I1J A;  3NFC A;  2P84 A;  3HKS A;  4EOI B;  1H92 A;  5IAY A;  1E7O A;  1WX6 A;  2RJF A;  2LQN A;  1OYX A;  3OYY A;  2EQU A;  3EJ1 B;  3PNW C;  3JB9 H;  4F6S B;  1T3S A;  1LJO A;  1UTI A;  4OGE A;  2OX7 A;  1WYX A;  2OI3 A;  2W2H A;  2ZPE B;  4BDZ A;  3JCM h;  4LOC A;  3SWN B;  7AT1 B;  2NWM A;  5FU7 B;  3OBW A;  4PNO A;  4FYW B;  4F17 A;  3BG3 A;  3CC7 A;  5I5Z B;  4OMQ A;  4M75 C;  5GMK l;  2CT3 A;  2RNA A;  3EGU A;  4KGX B;  1KC8 U;  4BE0 A;  3DLM A;  3X24 B;  1MMA A;  3JSC A;  1PKD B;  2KK4 A;  4ORZ A;  3UWN A;  3HRS A;  2EKO A;  4MFD A;  2VWF A;  1ZSZ A;  1OPK A;  1FXX A;  1RAC B;  2EYX A;  1I81 A;  1I07 A;  1UHF A;  1YIT Q;  2CZ7 B;  2F2C A;  1XO2 A;  3MY1 B;  2WJ9 A;  1W70 A;  3JCM X;  3A8O B;  4OMP A;  1TU0 B;  1VYU A;  1VOL A;  4LD6 A;  1BU2 A;  5LL6 S;  4NL2 A;  3EG1 A;  4M78 B;  1YIJ A;  2EJ9 A;  2R58 A;  2KR3 A;  1UHC A;  1ZSG A;  3O0G D;  1M5Q 1;  2BKD N;  4M7D F;  5GAN d;  3MPU B;  1K8A C;  2ZPF B;  4LUD A;  4CRI A;  4QQD A;  1GUX B;  1QMC A;  3NTK A;  2UZE B;  5FU7 C;  3EOC B;  1N6A A;  2X4J A;  4J9F A;  3OW2 S;  4XTY A;  2E6N A;  4VUB A;  3MKD A;  1GFD A;  4MZT A;  4D8K A;  1N8R R;  1PKT A;  2VXE A;  2DJZ A;  2CH4 A;  1IGQ A;  4OP0 A;  3CCM A;  1YJ9 A;  4M78 A;  4M7A B;  3GIB A;  3LQ5 B;  4E6R A;  3QZ5 B;  1QCN A;  1M3B A;  2MYS A;  2DBK A;  4FW2 A;  5IXF A;  2EQI A;  2LDM A;  4LDY A;  4Z89 A;  3CCM Q;  2LJ3 A;  1WHG A;  2JT4 A;  1PHT A;  2OTL Q;  4PJM A;  2CUB A;  1W4S A;  2LJ0 A;  1QVG S;  3VJP A;  3EHQ A;  3UT1 A;  4IIM A;  4OMF B;  1RAB B;  1QP3 A;  2QG9 B;  2XDP A;  4OR5 B;  4BI4 A;  4LE9 A;  2GCX A;  1NJI R;  2RO0 A;  2A3L A;  4JX4 A;  2ECZ A;  2QK0 A;  3L42 A;  3A8L B;  2PUO B;  4OB1 B;  2E4H A;  2ZPG B;  2CP3 A;  2FRW A;  3ZL7 C;  2QDY B;  3S6W A;  4E47 A;  2XKO C;  3RUX A;  5J39 A;  2B9R A;  4JX5 A;  2K2V A;  4B6M A;  3AHU A;  4DEX A;  4CFU D;  4FSX A;  3CMA Q;  2FL7 A;  1RAE B;  2K3X A;  5KE3 A;  1TG0 A;  1VQ7 T;  1ABO A;  2D1X A;  1MHN A;  2JM8 A;  3TEE A;  1M2O A;  2KE9 A;  1VIN A;  1K73 U;  5DQW A;  1BI2 A;  1AT1 B;  1IHV A;  2B8A A;  2LT1 A;  4PFP A;  1Q86 C;  4BCP B;  3DB3 A;  2WIP B;  2A28 A;  3MP6 A;  1X69 A;  2A37 A;  3BHU B;  4AKI A;  4KGV B;  1S72 T;  2RH2 A;  3M0U A;  1H64 1;  5KYU A;  1OPL A;  3X25 B;  2YRV A;  3CC2 Q;  1SRL A;  4BY1 X;  2CP2 A;  2PMI B;  1BYM A;  1YJN A;  2WMA B;  4AFS C;  1IO6 A;  2KSS A;  2QAZ A;  4EMH A;  4PJL A;  5DLQ E;  3LYI A;  4MMK A;  3PFS A;  1E6H A;  2D9T A;  4AFQ C;  1QQJ A;  2ZGW A;  2JTF A;  4QQ6 A;  3GOX A;  1V29 B;  1TFB A;  1UFF A;  1WDX A;  2COW A;  2MAM A;  2RQV A;  1VQO Q;  3OB9 A;  3PIO A;  2FYK A;  3I5S A;  4M7A G;  4K11 A;  3JB9 D;  2DF6 A;  2YRD A;  4Y72 B;  5GAN e;  2GNC A;  2V1R A;  4N4H A;  2DME A;  1M8M A;  4PJO C;  1VQM Q;  2E5K A;  4WTO B;  2EGE A;  3CCS A;  1WXU A;  2F1L A;  1U5S A;  3CPW S;  3WVE B;  4ELJ A;  1VQ4 T;  2MCN A;  4YOO A;  3FLG A;  5HCK A;  3KBG A;  1VYV A;  3P8D A;  4BBS M;  3A8M B;  1VYW B;  2KYM A;  2V1Q A;  3M4G A;  1AWJ A;  2RI5 A;  2QGG A;  2J6F A;  3QPH A;  3OYB A;  1JJ2 S;  4FT2 A;  4J7I A;  4BAC A;  3C4S A;  4LDX A;  1QVF S;  2CRE A;  3EG3 A;  4FT4 A;  1TUD A;  3BDU A;  5IHN A;  1K0X A; 
#chains in the Genus database with same CATH homology
 3CBP A;  4M75 B;  4NOY A;  3H6Z A;  3N5B B;  4RMO A;  5GMK h;  4Y91 A;  2ZZD A;  3QYE A;  1Q81 C;  3HBL A;  1U1T A;  3OYC A;  3CXC A;  3VKH A;  2GF7 A;  4A4G A;  5KE2 A;  1O9S A;  5DM7 R;  3G7Z A;  4JRI A;  5CKD A;  1LNX A;  3OYJ A;  4C5E A;  3M5A A;  2KVQ G;  4ZN3 A;  3V7R A;  1Q82 C;  5CKB A;  4NC6 A;  2VGM A;  3FC3 A;  1VQP T;  2P0K A;  4C92 C;  5D6Y A;  4M7A A;  1VQN T;  3SD4 A;  4KUL A;  2P4T A;  1VQK T;  2DD5 B;  3E19 A;  4J5Y A;  4KT0 E;  3CCS T;  1KD1 C;  3CC4 A;  4M7D A;  4M7A D;  4HKE A;  2EYQ A;  2QTX A;  3FEO A;  5EG2 A;  4J6X A;  1M90 U;  2OTJ A;  4PJO A;  4FU6 A;  2E41 A;  3FB9 A;  1NE8 A;  3CD6 A;  4RKU E;  3VKG A;  2OAU A;  2K5L A;  2LVM A;  3INZ A;  5FRO A;  3L2W A;  1VQ9 T;  3DLL A;  1YIT T;  1JJ2 A;  5GAM d;  3BG5 A;  1Y07 A;  2DK3 A;  4CI0 C;  1KQS A;  4HCC A;  1Y96 A;  4RG8 A;  3CXC S;  4M78 F;  2LCC A;  2VYT A;  4C8Q B;  2ZPH B;  1M1K U;  2CKK A;  2JUF A;  3HRT A;  2M16 A;  5LJ3 h;  5GAO p;  2H3J A;  2RHU A;  2QA4 A;  5FRM A;  3QII A;  4M7D B;  4F7U F;  3M54 A;  2PQW A;  2WSC E;  3MEV A;  5IN1 A;  5GAN 3;  2HNI A;  4A4E A;  4ZTJ A;  2JZ2 A;  3ME9 A;  3M55 A;  5DY9 A;  3T9N A;  2MF2 A;  1WJS A;  2E1H A;  2X4Y A;  4Y28 E;  3TU4 K;  4PJO E;  3JCM c;  3OYL A;  1G3W A;  4ZTF A;  3G4S T;  3MHX A;  4C0D C;  1QLB A;  1YBY A;  3PGG A;  3HFO A;  2Y4Y A;  5CQX A;  4BB7 A;  5I2M A;  4IUR A;  2DZC A;  3EFR A;  2DIG A;  1WJQ A;  2HD0 A;  4DQ2 A;  4EPC A;  2E5Q A;  1D3B B;  2DPP B;  4BE1 A;  1VQ4 A;  2RK2 A;  4MZM A;  3VYG A;  2V8I A;  3I55 A;  3PTA A;  5LJ5 d;  4OVA A;  2BS2 A;  1X01 A;  3CCL A;  3CMA A;  4LD9 K;  3MET A;  4OF1 A;  2I2L A;  4DOW A;  1VQ5 T;  2JN0 A;  3OYD A;  5HK0 A;  3G6E A;  2PUK B;  2AHJ B;  3I56 T;  1Y7X A;  2DAQ A;  3E9F A;  4NS5 A;  1HK9 A;  3CME A;  3MCA B;  4L59 A;  1NZ9 A;  4JLG A;  4F7U A;  4M77 B;  3MP1 A;  1TH7 A;  5EJC A;  4XTW A;  4LDV A;  4ELY C;  2VXF A;  4C92 B;  3RER A;  4C0Z A;  2FHD A;  3CCJ A;  1N8R C;  1BKB A;  2HQX A;  2WSE E;  3OS5 A;  4M75 F;  2QQ8 A;  5GAN g;  2DD4 A;  1BI1 A;  1UGS B;  2MWO A;  4BDY A;  3QYB A;  5LJ5 h;  2CS7 A;  3M56 A;  1Q81 U;  1NJI U;  4MML A;  1I8F A;  2KQW A;  2OTL T;  2BUD A;  4QVC A;  3QO3 A;  1KD1 U;  2EWN A;  2QQS A;  3MEA A;  4M6V A;  3CCE T;  4XTZ A;  3OSS C;  2LQ8 A;  1VIE A;  2DXB A;  3FDR A;  2KMG A;  1Y96 B;  3VKI A;  3JCM J;  3MEW A;  2E70 A;  1X75 C;  2LRQ A;  4OGC A;  1Q86 U;  3X26 B;  4YTL A;  4C8Q C;  4O5V A;  3CPF A;  3QYH B;  2O4X B;  4J7F A;  4M75 E;  4JJN K;  1IRE B;  1R8O B;  2QI2 A;  1VQK A;  2X4X A;  3KHI A;  3NTI A;  3DL1 A;  4HNT A;  4KBM B;  1FWZ A;  4UC4 A;  4M78 G;  4HT9 A;  5CVI A;  1M1K C;  5GAN 5;  5GAN 2;  4HCB A;  1YJ9 T;  2MMP A;  3JCM W;  4MZP A;  2DD4 B;  2E12 A;  4M77 F;  5CK9 A;  2QEX A;  4LDW A;  4ATO A;  2CZ0 B;  2DTH A;  2QEX T;  2CGH A;  3V7S A;  2VUB A;  1D3B A;  2YLB A;  4M7A F;  3LLR A;  3NTH A;  3V8J A;  2M0O A;  2K57 A;  4V2S A;  1U1S A;  4IUP A;  4II1 A;  4PLL A;  3L2R A;  1OZ2 A;  4L6V 5;  2MWP A;  1Q82 U;  1EIF A;  1G3T A;  5GAN 6;  2CZ1 B;  3RKW A;  2F69 A;  3CC7 T;  3VYH B;  2L5Q A;  3BY7 A;  4MFE A;  3J81 E;  5GAN j;  3G71 A;  2PVO B;  1RI0 A;  2RI3 A;  3SB2 A;  3M58 A;  4X34 A;  3G71 T;  1KHC A;  3P8H A;  4JRP A;  3CCU A;  3HSB A;  5GAM h;  2RJC A;  1BIA A;  1M1F A;  1WQW A;  3PT9 A;  4TVR A;  4XQ3 A;  3OQ5 A;  4A4K A;  1G3S A;  2XK0 A;  4B9X A;  3GPL A;  1VQL T;  3QBY A;  1VIF A;  4C8Q A;  2CZ6 B;  4F7U E;  3L2U A;  3QKJ A;  3OA6 A;  2XIC A;  2D6F A;  3M59 A;  3BG9 A;  2RJD A;  3FJP A;  1B34 B;  2IG0 A;  2M1H A;  2P0Q A;  3I55 T;  2XDD A;  5A0D A;  5GMK m;  2RD1 A;  1VQP A;  3OYH A;  4PJO D;  3M53 A;  3JAM E;  1M8V A;  4QQG A;  1YIJ A;  4BI8 B;  4ZGE B;  4AKH A;  3JCM d;  1KC8 C;  1ZHI A;  3JCM e;  1NPP A;  3Q1J A;  4C0G A;  2QDJ A;  3JCM b;  3OYG A;  3CCR A;  4HT8 A;  3R6O A;  3CME T;  3LGF A;  2GQV A;  2L8D A;  3M4Y A;  5D6W A;  1GXI E;  2KDS A;  2QF7 A;  2K5I A;  2EAY A;  2VGN A;  3PMI A;  5DLO A;  3CCV T;  2E64 A;  3QUI A;  4HL4 A;  3CCQ A;  3TRE A;  1YHQ T;  4ZN1 A;  4OB2 B;  2HQE A;  1YIT A;  1UB4 A;  4PLI A;  3A5Z B;  4QVZ A;  5CKE A;  1KHI A;  3ZBD A;  5CO7 A;  3S3M A;  3KXT A;  1AHJ B;  2Y4X A;  4IUQ A;  2QQ9 A;  4GY5 A;  4J6Y A;  5CKF A;  5GAN 4;  2OTL A;  4HA8 A;  2DXC B;  3HB9 A;  2EQK A;  2LCL A;  3PIP A;  5CR2 A;  4M7A C;  3C12 A;  4M77 E;  3EAE A;  3F70 A;  3JCM g;  4R56 A;  1RL2 A;  4XK8 E;  2XD0 A;  3VUB A;  1BIB A;  4J83 A;  3HO8 A;  4M77 C;  3NFC A;  2X4W A;  4PL6 A;  2RA2 A;  1PSE A;  3BFM A;  3HKS A;  2D0Q B;  5IAY A;  2RJF A;  2PU9 B;  4BI3 A;  1OYX A;  3GNG A;  3OYY A;  4A4F A;  1U8R A;  3HHT B;  2EQU A;  4JS5 A;  2MI6 A;  3PNW C;  4M7D G;  3JB9 H;  3CCM T;  1VQ8 A;  5LJ3 e;  2CYZ B;  1LJO A;  4MDW A;  4OGE A;  4C8Q F;  2G3R A;  3C94 A;  3OS0 A;  4P5N A;  4AKG A;  4RCB A;  1W2B S;  2ZPE B;  2R5M A;  1NJI C;  1UEB A;  4M77 G;  4BDZ A;  1NPR A;  3KUF A;  3GP8 A;  2HAX A;  3GF5 A;  3JCM P;  4N0A A;  3DKM A;  3JCM h;  4LOC A;  3SWN B;  1K9M U;  4JS4 A;  1QVP A;  5FU7 B;  4D6W A;  3SFM A;  1OI1 A;  3OBW A;  2G77 A;  4PNO A;  4C5G A;  4EMG A;  4AI6 A;  3L2V A;  3BG3 A;  3QDR B;  4JRK A;  4FM4 B;  1BI0 A;  2L89 A;  3CC7 A;  5CQY A;  5FU6 B;  3QJY A;  2JOY A;  4M75 C;  5GMK l;  3J7A F;  2YHT A;  4L5G A;  4IUT A;  4A4H A;  3CCJ T;  4C92 A;  2RHX A;  1KC8 U;  4BE0 A;  3H4C A;  3V8L A;  3QYG B;  3DLM A;  3CBM A;  3X24 B;  3CBO A;  2XU8 A;  3HRU A;  2F5K A;  3JSC A;  2KK4 A;  3UWN A;  2A7Y A;  3HRS A;  2EKO A;  4M7D D;  1VQL A;  4BY6 C;  4MFD A;  4BBR M;  5GAM f;  4Q5W A;  2XDB A;  1Q7Y U;  1FXX A;  3OSV A;  3VU3 C;  2DZ9 A;  5C6S A;  3C95 A;  2LX9 A;  1N8R U;  1VQ6 T;  1I81 A;  2IVW A;  4M75 G;  4M7D C;  2XID A;  4M75 D;  2V8J A;  5J26 A;  1WPY A;  2CZ7 B;  4E7I A;  4C92 G;  3JB9 I;  5GAN f;  2WJ9 A;  5C0M A;  3CCR T;  3H8Z A;  3JCM X;  1XNI A;  4M78 D;  4J8O A;  5HY6 A;  4NL3 A;  3CC4 T;  3A8O B;  2OTJ T;  3X20 B;  1VQO A;  3HFN A;  4KUI A;  4XTU A;  5GAO l;  3CCV A;  4C8Q D;  3QJ6 A;  4OB3 B;  1G3Y A;  2DXT A;  1QP2 A;  4RG2 A;  1JRI A;  4QSH A;  3RKY A;  4LD6 A;  1Q7Y C;  5LL6 S;  4NL2 A;  1YI2 T;  1YIJ T;  4M78 B;  4Z6Y A;  5FLX E;  2EJ9 A;  2R58 A;  2YLC A;  4XU3 A;  1XOV A;  4DA4 A;  3TW6 A;  4FIB A;  1N9R A;  4EMK A;  2ZCF B;  4ME7 A;  1M5Q 1;  2R57 A;  1VQ7 A;  2BKD N;  2KMT A;  4M7D F;  1M1G A;  5GAN d;  1K73 C;  3UDC A;  1K8A C;  4M78 C;  2ZPF B;  2K4Y A;  4ZGJ B;  2DTI A;  2QQA A;  4CRI A;  5GAN 7;  4QQD A;  4EMK B;  3OYN A;  3RMQ A;  2RM4 A;  3NTK A;  4M7A E;  2QQR A;  5FU7 C;  4C0F A;  1QVF A;  1N6A A;  1XQH A;  1UGQ B;  2X4J A;  3OY9 A;  3OW2 S;  1VQM T;  4XTY A;  3CC2 A;  2E6N A;  4VUB A;  1YCY A;  4C0D B;  1OZ3 A;  1HXD A;  3G4S A;  1K9M C;  3CCU T;  4MZT A;  3CC2 T;  4IKF A;  2QQB A;  2VXE A;  2K5F A;  2DJZ A;  4MDX A;  2XHC A;  4OP0 A;  4IUV A;  5KCO A;  3CCM A;  2GFA A;  5CCA A;  1YJ9 A;  1VQ8 T;  4M78 A;  4M7A B;  3A8G B;  3GIB A;  4C5H A;  4C92 F;  1H3Z A;  3QZ5 B;  1I4K 1;  3BW1 A;  5LJ5 g;  2DXU A;  2V8K A;  2WAC A;  3LW5 E;  2KR6 A;  2QXF A;  2LDM A;  2FB7 A;  4LDY A;  3JB9 J;  3JRZ A;  4RCC A;  3URG A;  1QVG A;  2BIV A;  1X6O A;  2E65 A;  4BY6 B;  3OYA A;  4XTV A;  2E6Z A;  4XU0 A;  3X28 B;  5L8R E;  5A0G A;  3G6E T;  5GAO r;  4HLQ A;  3JB9 G;  4PJO B;  3A8H B;  1I5L A;  3I56 A;  2RHY A;  1VQO T;  3PMT A;  1YI2 A;  1UGP B;  1KQS S;  3ER0 A;  1W4S A;  4WF2 A;  1QVG S;  2RHI A;  3VJP A;  5GMK e;  4O6J A;  1LOJ A;  2P0P A;  1JBM A;  3UT1 A;  4X9D A;  1VQ4 T;  4C5I A;  2DEQ A;  3MP8 A;  4B9W A;  2R5A A;  1S72 A;  4Z02 A;  4OMF B;  5HK3 A;  3JCM Q;  5LJ3 j;  2QFZ A;  4F7U B;  1QP3 A;  4KUD K;  2Y90 A;  4A54 A;  1E7P A;  5GAM j;  3CPW A;  2XDP A;  4BI4 A;  3DB4 A;  2JVV A;  2GCX A;  2DTO A;  2VV5 A;  2RO0 A;  2M9U A;  3VV0 A;  2A3L A;  5AYF A;  4JX4 A;  5GMK j;  2XI9 A;  5GAO m;  4R55 A;  4JRQ A;  1FKM A;  3L42 A;  3O8V A;  2RJE A;  4ZGD B;  3HZJ A;  1VQ6 A;  3A8L B;  2PUO B;  4OB1 B;  2EJF A;  1B34 A;  2ZPG B;  5GAM e;  3VYG B;  2LC4 A;  4HNV A;  1N27 A;  2EJG A;  4C8Q G;  1VQN A;  1N9S A;  4J6W A;  4E47 A;  2QDY B;  4QW2 A;  3S6W A;  5A2Q E;  1IZ6 A;  5FU6 C;  2XKO C;  3QZ9 B;  1K8A U;  3RUX A;  2DO3 A;  3OMG A;  4ELZ C;  5J39 A;  4JUV A;  4JX5 A;  2EFI A;  2K2V A;  5GAM g;  1YJW A;  5CAI A;  1O75 A;  1YJW T;  2DKG A;  3AHU A;  3QWL A;  4PJO F;  3UPU A;  1VQ9 A;  2WSF E;  4FSX A;  2FL7 A;  3ASK A;  4JX6 A;  3L2Q A;  4XU1 A;  2K3X A;  3RES A;  5KE3 A;  3OYK A;  4E7J A;  4JLI A;  2PVG B;  4N4I A;  1VQ7 T;  3TEE A;  1MHN A;  2NLU A;  4M77 A;  5CKH A;  4N0A C;  2HBP A;  3ZFJ A;  4C8Q E;  1K73 U;  2EQM A;  1G5V A;  1BI2 A;  1QW1 A;  3MEU A;  2QA4 T;  3CEY A;  5FRN A;  5IT9 E;  2B8A A;  2LT1 A;  3L1A A;  1Q86 C;  3QHS A;  3DB3 A;  2LTO A;  4DOV A;  3OYM A;  3MP6 A;  5LJ3 g;  4AKI A;  3QG1 A;  4HNU A;  2DXC A;  1M90 C;  2LQK A;  1S72 T;  2ZPI B;  5LJ3 f;  2RH2 A;  3BDL A;  3WVD B;  3JB9 F;  3QXE B;  4XU2 A;  4BE2 A;  1H64 1;  2O4X A;  5J3B A;  2BS4 A;  3EFS A;  3X25 B;  2YRV A;  2DIQ A;  4M7D E;  2X35 A;  1M4Z A;  3E1S A;  2LNV A;  3LGL A;  5GAO q;  3CCL T;  1BYM A;  1YJN A;  1YJN T;  1W2B A;  1VQ5 A;  4C92 E;  5GAO n;  2KSS A;  3CMA T;  2VC8 A;  3SWN C;  3S3N A;  1JB0 E;  1ZBX A;  4GLK A;  4M78 E;  4EMH A;  2RB6 A;  2ZZD B;  3E9G A;  5HKC A;  5DLQ E;  3LYI A;  4MMK A;  3VUZ A;  3SDZ A;  4E7L A;  3OYE A;  4C92 D;  3WXM B;  3PFS A;  4E7K A;  3CD6 T;  2RI2 A;  2D9T A;  5CIU A;  3HPW A;  1M9S A;  5KCH A;  3RMS A;  1WNL A;  1WJR A;  2ZGW A;  3CCQ T;  1YHQ A;  4PJO G;  4E7H A;  2JTF A;  4QQ6 A;  3GOX A;  1V29 B;  2LT4 A;  3J80 E;  2O01 E;  4HCZ A;  4MIM A;  2MAM A;  3GLX A;  3L2Z A;  2FVU A;  3LX7 A;  3OB9 A;  3V7C A;  3PIO A;  2FYK A;  3OS2 A;  1UGR B;  3OYF A;  1VUB A;  3LH0 A;  3M57 A;  2XG8 D;  3MO8 A;  3JCM V;  5LJ5 j;  4M7A G;  3JB9 D;  5GAN 8;  3CCE A;  2DD5 A;  2RK1 A;  4JDS A;  4XTX A;  1P92 A;  3V8K A;  5GAN h;  1BI3 A;  1KG1 A;  5GAN e;  3TW7 A;  2F5T X;  4N4H A;  3OW2 A;  5GMK i;  4PJO C;  3QSU A;  2E10 A;  3TCJ A;  2GFU A;  5KH6 A;  4F7U G;  3CCS A;  2L3R A;  2PVD B;  3OYI A;  3LWH A;  4XAX B;  3S3O A;  3SWN A;  4N4G A;  1MGQ A;  1WGS A;  5I2S A;  3CPW S;  3WVE B;  4ELJ A;  1WQ7 A;  2DVE A;  2EIF A;  2EQJ A;  3FRN A;  3P8B B;  4M75 A;  4X9C A;  1Y71 A;  1PSF A;  3ZEH A;  4BD3 A;  5LJ5 f;  3GNF B;  2KY9 A;  3FLG A;  3KBG A;  4QVD A;  4FL6 A;  3RIR A;  2RHZ A;  5I21 A;  2K3Y A;  3LWI A;  3P8D A;  5LJ3 d;  4PKC C;  4A53 A;  4BBS M;  2JNG A;  4LDU A;  1KQ2 A;  3A8M B;  5LJ5 e;  2ZPB B;  1FX7 A;  2KAF A;  2C06 A;  3HP9 A;  3OMC A;  3HL8 A;  1ZQ1 A;  3M4G A;  2RI5 A;  3RKX A;  4EDU A;  3M9Q A;  3FIF A;  5D6X A;  3JCM f;  3QPH A;  3OYB A;  1JJ2 S;  4FT2 A;  4J7I A;  3OBY A;  3C4S A;  4EMK C;  4M77 D;  4IUU A;  4BAC A;  4LDX A;  1QVF S;  1VQM A;  2DXB B;  1SSF A;  2JTM A;  4BUG A;  2BS3 A;  1XTD A;  4FT4 A;  5M9O A;  3OS1 A;  5A0L A;  1KQ1 A;  3BDU A;  4OB0 B;  1DJ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...