4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
2DD5A 1DJ7B 3A8GB 2DXCB 3VYGB 3WVEB 1UGRB 2D0QB 2WSEE 3WVDB 2CZ6B 2DXBB 1AHJB 5L8RE 3X24B 4OB2B 4ZGJB 3VYGA 2ZPFB 4ZGEB 3A8OB 3QYHB 2ZZDA 1QP2A 1PSEA 3LW5E 2PUOB 4L6V5 2ZPIB 3QZ9B 4ZGDB 4OB3B 2ZCFB 2CZ0B 1QP3A 4OB1B 4RKUE 2ZPHB 2PUKB 2DXCA 2DD4B 3QXEB 1JB0E 1V29B 2PVGB 1UGPB 3A8MB 1UGQB 4XK8E 2QDYB 2DXBA 3X25B 3X26B 3QYGB 1IREB 1GXIE 2DD5B 2PU9B 2DPPB 2PVDB 4OB0B 1UGSB 3VYHB 4FM4B 3A8LB 1PSFA 3HHTB 2CZ1B 2CZ7B 2ZPEB 3X20B 4Y28E 2WSCE 2O01E 3QZ5B 2ZPBB 2DD4A 3A8HB 2ZZDB 2AHJB 2WSFE 2ZPGB 3X28B 4KT0E 2CYZB 2PVOB
chains in the Genus database with same CATH superfamily
1JSUB 4QVCA 5GAMf 2CKKA 3EAEA 2QQRA 2DIQA 3C95A 4XTXA 3GTMS 2RK1A 1VQ7Q 5KYYA 1RI9A 3FDRA 5BNJB 3LLRA 1F1BB 3QWXX 2A36A 4CXAB 3FJ5A 5IXFA 2YUPA 5M9OA 2KBTA 4F7UB 2AZVA 3MP8A 2QDJA 2QQSA 2MCNA 1QP2A 1PKSA 1M3BA 4XTWA 4C8QC 3OYGA 4BI8B 2QYZA 2RQWA 1PD0A 1YITQ 2HNIA 3E19A 2KMGA 1ZQ1A 2PQWA 4DBHA 4DQ2A 2YT6A 1UTIA 5LJ5g 4CFWB 4ELZC 2D8HA 1YIJT 2BZYA 1YBYA 2QASA 1P92A 2O88A 1BI1A 4A54A 1VQ6Q 2JZ2A 4PJNA 2DXCA 3RBBB 3CCUQ 2YUNA 5CYIB 3E2UA 3TNHB 1UNGD 2DE0X 3V7CA 1NM7A 4EORB 1XJWB 1VQNA 2QTVA 4JRIA 3JSCA 3SB2A 3JCMe 2LQ8A 5HBJB 3JCMd 2KYBA 3QYGB 1KQSA 2GQIA 4EOMB 3RMQA 5LJ5f 2KI7A 2RMOA 4PFZA 1QCNA 3QJYA 2PU9B 2OTJQ 2CP0A 5CVIA 1K1ZA 2EYWA 2YDLA 4PFOA 4IIOA 3UDCA 2A7YA 4OB0B 2DL5A 4BI4A 2X4WA 2A37A 2QTXA 1ZUYA 5GANh 4JS5A 1VQKA 3A98A 2RA2A 1TUGB 4OMNA 2XDDA 4HT9A 2JM9A 3MEUA 2WSCE 2K3XA 3VS2A 4II1A 4JX5A 1WJQA 1JQQA 2O01E 2ZPBB 3H4CA 1U1TA 3A8HB 3HTRA 4M7DA 2L3SA 1SF9A 2ZPGB 1JXMA 4J5YA 4F7NB 2LDMA 4QSHA 1GCPA 2CYZB 4DA4A 1NLOC 2KT1A 4BBRM 2MIOA 3OYKA 4BCNB 5GANf 2OTLA 2IN3A 1G3SA 2EYXA 1FYNA 1UGRB 4BE0A 3QJ6A 4EMGA 3TQ7P 4BBSM 3MI9B 2X3XD 3M59A 4AG1C 1PM3A 3EG1A 4M77G 2NUTA 1OOTA 4IKFA 1SHFA 1JO8A 2DTIA 1SRMA 5EG2A 2ZPFB 2CP6A 1RUWA 2QA4Q 1R0BG 2DKGA 2ED0A 1KXUA 2EQKA 2M02A 4M75G 2DMEA 1N9RA 2X1NB 4HA8A 1WPYA 4CC3A 3ER0A 1PNJA 2H3JA 2WPAB 2K7AA 2LCLA 3CCVQ 3CCMA 4OB1B 3JB9D 4BD3A 4GLMA 1WGSA 2QEXA 2JMCA 2CUBA 3NTKA 5I5ZB 1KHIA 3VUBA 2LQKA 3OYFA 4VUBA 2FEIA 1UDLA 1D1BA 1W2BS 2WJ9A 2KRMA 1BCMA 5A0GA 5CKFA 4V2SA 4MZMA 4M78E 1X01A 2EYQA 3S6WA 5I21A 1CSKA 2WHBB 3UA6A 2ROTA 5D6YA 3OYYA 3CCET 1H3HA 2G6FX 4IURA 3ULRB 3JB9J 3RNJA 2DYBA 2RHYA 2K3BA 4BCGB 1ENWA 2UZDB 4LNPA 1VQ7T 3PGGA 3EH1A 2MI6A 2CSIA 1GRIA 1BKBA 2HMAA 1W2BP 2VV5A 5AYFA 1U3OA 5KE3A 2OTLQ 3H0HA 1QKXA 2GTJA 2C0OA 2H8HA 1VQ9A 4C92B 3OYAA 1M90R 1GL5A 2E1HA 3SWNA 1YITT 3BG9A 4EOLB 3JCMb 5DY9A 1JXOA 1Q86U 3HRTA 2EJFA 4IUPA 1TD6A 3TN8B 3EGDB 1MV0B 2UZBB 2A0FB 2VGNA 1VQ6T 3CCUT 5GMKe 2PMIB 1ZSGA 2BPMB 4HCKA 3EG0A 6AT1B 2WSEE 3GBQA 4RTZA 1S72A 4RODA 3CCMQ 2DA9A 4MMKA 2DXBB 1E7OA 3O0GD 3MJXA 2BTTA 4CC2A 2QEXQ 4PJOC 4P5NA 4M7AB 2OTJT 1QLBA 1K8AU 2ZZDA 3RDVA 1QVPA 2FZKB 1WXBA 5HVYB 3E9GA 2B86A 2NWMA 4RCBA 5D6WA 1IGQA 2DILA 3JCMJ 3TNIB 3ME9A 3EG9B 2SEMA 2DIGA 4E7JA 3V8JA 4EIKA 1QVGA 2C6TB 1BCOA 5DLQE 2PTKA 2KR6A 1X75C 1I0CA 2BS4A 4EC8B 2FPFA 4A4EA 1C1AA 2HL3A 2DERA 5GAOn 4PJOD 4J9HA 1TTHB 3VKIA 1VYTA 5AT1B 1R8OB 1D1CA 2QDLA 4HVVA 3O8VA 2CCHB 3HO8A 2JM8A 5GAN2 3PVLA 4HXJA 4RTTA 1NLPC 3PTAA 5IF1B 2V26A 4BI3A 1BB9A 2GCXA 3V8KA 5GAOr 2MOXA 2K5IA 1VQ9Q 2EW3A 5EJCA 1Q86C 5KYYB 4HL4A 1TUCA 1OIUB 2ESWA 1N4MA 4X9DA 2XK0A 7AT1B 4IIMA 4F6SB 1W70A 3NHNA 2K5LA 3X20B 1ZX6A 1JRIA 3CC4Q 2R5AA 1M1GA 1WA7A 2E3IA 3HSBA 2F2VA 2QA4T 4C5EA 2VWFA 3PFSA 3CPWS 3CCSA 4WTOB 1W98B 1D1AA 1Q81C 4IUUA 1WIEA 2K5FA 2CH4A 3FLGA 3CCQA 4JPBW 4TVRA 1O9KA 1UNHD 3CCVT 5GAN8 3JCMQ 2KNBB 1N6AA 2ATCB 2DEQA 2A3LA 1WDXA 4C8QF 5DQVA 3VV0A 5IH2A 5L2WB 3CXCS 2DXCB 3POMA 1UFFA 3MP6A 3OB9A 4J9IA 3BE3A 1M2VA 3QBYA 5KYXA 4F7SB 2JOYA 3CPWP 1EZZB 5FRMA 4OF1A 4AI6A 3CEYA 3MCAB 1U06A 1PRMC 4ZNXA 4MFDA 3C0CA 4MMLA 3BG5A 2F5TX 1K73R 4XU1A 1PD1A 2RJCA 3OYMA 2P4TA 5J39A 2AZSA 1OU9A 3MO8A 1IHVA 2DXUA 4LDYA 3S3NA 1UB4A 4A4FA 3CXCP 2CT4A 5IDPB 1OZ3A 3I56A 3INZA 2XG8D 1OGUB 1K9AA 2KRNA 2V1QA 4LD6A 3BLRB 2QFZA 1OYXA 3H9NA 3M56A 4OMLA 2OTLT 4HT8A 2CP3A 3V7RA 1K8AR 3OS1A 1V29B 1FWZA 4M7DB 3QUIA 3HBLA 4CFXB 4RG8A 3A8MB 1EFNA 4BCND 4XK8E 1BIAA 1M1KR 5KCOA 1AZGB 1QW1A 5IDNB 1XQHA 2RQRA 1VOLA 3H8ZA 2FO0A 2I2LA 4J6YA 3OSSC 1YI2Q 3CCSQ 2DL8A 2RI2A 2RJEA 2EQMA 2LJ0A 2JJ9A 2YSQA 3QKJA 2FB7A 5LJ3e 4M75E 2LVMA 1P5EB 1IXDA 5LJ3d 3QDRB 1FVVB 5GAN3 2ZPEB 2NUTB 1Q7YR 3CCMT 3U23A 2LCCA 3RGFB 1N9SA 3REAB 4HCCA 3ZBDA 4MZTA 1LPLA 4JX4A 2QEXT 1WJSA 1ZUKA 5CQYA 4B9XA 2KE9A 5KH6A 1QVFA 3JB9F 3JV3A 4KRCB 1GBRA 1R77A 1VIFA 1KIKA 3QHRB 1JBMA 4Z89A 1YHQA 3LH5A 1YP5A 4X1VA 4M4ZA 5FRNA 5GJWB 4D8KA 1Y07A 4JJCA 1WHLA 2D9TA 1KJWA 1WZOA 1ZSZA 2DEUA 1JJ2A 2KYMA 2DTHA 2CT3A 2MPXC 3I56Q 5L8RE 4AFUC 1GCQA 3EFSA 4JJBA 4C92C 4ZGJB 4ZGEB 4JJDA 3CBMA 1ZA1B 5IHNA 5FLXE 4DEXA 3FJPA 1B34A 1M3AA 3J7AF 2D6FA 1VQ9T 2LX7A 5L23A 1VQ5Q 1MMDA 4A4GA 2PUOB 3RKXA 3M0QA 2M16A 4XQ3A 4M78G 4HVWA 2JTFA 5CKEA 1M2OA 1QP3A 3CC4T 3NDQA 3L2UA 3VS0A 1AOJA 1RAAB 4WF2A 4XTUA 1JB0E 4M77D 1WX6A 4M7AC 1VQPA 2DJZA 3META 1H24B 3SWNB 2DRMA 5GJVB 1M27C 3X26B 3I55A 1XNIA 2HQHA 3KBGA 3G71Q 4M77A 4RTYA 2A08A 2WMBB 4OR5B 3OS2A 3RERA 3QHSA 2OJ2A 2JMAA 1U1SA 4WCIA 2V8IA 4XU2A 4M75A 4FX3B 4M7AD 4PLLA 3EJ1B 5A0DA 2YLCA 2VGMA 4K11A 4JX6A 3CD6A 2X3WD 3CCLA 3OYJA 2DK3A 4NC6A 1EX4A 2ZZDB 3ZEHA 2L5QA 1W1FA 4CC4B 5FU6B 5FW9A 3DB4A 3M0TA 4KH0B 2KSSA 3CMEA 3F5XB 4PJOF 5LQFB 5GAMh 4BE2A 2LMJA 3M0SA 2RHXA 2NUPA 2SRCA 2Y90A 4QT7A 2HD0A 3M03A 4YOSA 1X6BA 1UEBA 1UNLD 3A8GB 1BU1A 4J7IA 3I5RA 4BY6B 1T3SA 1B7TA 1G3NC 2C0TA 3BHVB 4MDXA 1UECA 2DL4A 5CKBA 4EC9B 1G3YA 2CP2A 1WXTA 4AKHA 1D3BA 4OMFB 3VUZA 1I8FA 4F7UF 2RQUA 1YI2T 4BCHB 3CCST 4LUEA 1Y0MA 2IW6B 1FMWA 4FW1A 3DLLA 4C0GA 2GFAA 2DZCA 1HK9A 2EPDA 2JVVA 3JCMg 1MNDA 3S3MA 4HCBA 3JCMc 1FX7A 2XHCA 4C0DB 4RKUE 2EWNA 2COYA 2QQ8A 1AVZC 2RQVA 4CFVB 2O4XA 1GH6B 3CCJA 2C4GB 3MY5B 2EYYA 2NYSA 4BDZA 2EIFA 4E7KA 1SG5A 3P8BB 5LJ5h 4KBMB 3JCMf 1G3TA 1VQMQ 3CD6Q 3CCLQ 1PRLC 2YRCA 3OSVA 1OI9B 2DPPB 2RM4A 1E6HA 4B9WA 1OQKA 2QAZA 2P0QA 1SEMA 1M2VB 2DAQA 1OZ2A 3M54A 3CMEQ 1I4K1 1G8XA 4BY7X 4J9BA 1X69A 3OS5A 4BCFB 3HP9A 2WXVB 1WHJA 3I56T 4M7DC 2RN8A 4FCYA 3DKMA 2FRYA 3EIDB 3TW6A 3I35A 2RJDA 3L2RA 1QKWA 1NJIU 4G6LB 3CMAA 3X28B 2R5MA 1VQ5T 3FB9A 3JB9I 1K76A 3HRSA 1QWFA 3EFOA 5KYNA 3UF4A 1ZBXA 1VA7A 3F70A 2DJQA 5GMKj 4KUIA 1M90U 2RJFA 1RAFB 1XO2A 4BACA 4RG2A 4DEYA 3SEMA 4M7DD 1QWEA 3G6EA 1QQJA 3LGLA 5J26A 1YJNA 5CK9A 1KFZA 5I11A 2J6OA 1AEYA 2FHDA 1KQSS 1M4ZA 3P8DA 4BB7A 2E70A 1M30A 4EOSB 2J6FA 1R0CB 1RAIB 4A4KA 2E65A 3V8LA 3FRNA 2JNGA 3G71T 2K2MA 3RUXA 1BK2A 2KGTA 3VJPA 4ROCA 3H0FA 5KYUA 1SPKA 1FXXA 4JRKA 4ANJA 1H8KA 1H26B 3QZ9B 3H6ZA 1T0HA 2EVRA 4F04B 2QQBA 2LT1A 2RK2A 5KCHA 2X4YA 2YUQA 4E7HA 3M4GA 2ED1A 1BYMA 3VS3A 2MAMA 4QQGA 2EQUA 1B3QA 3DL1A 1MGQA 4AKGA 3JCMX 2DMOA 3MPUB 1UGQB 4OMQA 4KULA 1K4US 1X43A 3MY1B 2HDAA 1KD1R 3X25B 3I9QA 4XU0A 2B9RA 4C0ZA 1VQNQ 2ZGWA 3CQTA 4ZTJA 4ZTFA 1QCFA 2QGFB 1RLPC 1TS9A 1TH7A 1M90C 1W2BA 1I5LA 4DOVA 3CMAQ 3QDFA 3M4YA 1ZSZB 3BHTB 2LJ3A 1V1CA 4DBFA 1EIFA 5GANe 1VQKQ 2XI9A 3CPFA 5GANd 3VRYA 3G6EQ 5FWCA 3GNFB 1VQ8A 3GF5A 2DETA 3JCMW 3SWNC 2M51A 1LOJA 2XICA 1T0JA 2BUDA 2ENMA 1YJNQ 1B34B 4LD9K 1YFNA 4F7LB 3RMSA 4AFSC 2XIDA 4C92F 2L0AA 3P8HA 1VIEA 4LOCA 4M77F 2JXBA 1OX9A 4KRDB 2BKZB 1OU8A 3PIPA 1TUDA 2IVXA 2EKHA 3NMZC 3OYDA 3VYGB 1NJIR 2LNHB 2WIPB 2ROLA 2HQEA 5GAN6 1NE8A 5FU6C 2XMFA 1VQMT 3CD6T 2XDBA 3CCLT 2JN0A 4EMKA 5CIUA 1SRLA 1M3CA 5ECAA 2D0NA 4JLIA 3M0RA 4M77B 4M7AF 1Y96B 4ELYC 3WXMB 1K73U 2CP5A 2J05A 4Z6YA 2QGSA 1PG5B 2P0KA 1C0MA 9ATCB 3CMET 4M75B 4LDXA 2QK0A 3OYHA 4BY6C 2JTMA 2LP5A 1WQ7A 2DF6A 5D7UA 2B8AA 4HKEA 4BCQD 4A4HA 1VQLA 2V8KA 4HNVA 2E6NA 4CC7A 3QIIA 4OGRB 3CC7A 4FYXB 1UGPB 2NUZA 1UE9A 4RTXA 2Z0WA 2F2CA 4AG2C 1YCSB 2CH4W 2DBMA 4M6VA 1HD3A 4BXXX 5LJ3j 3DB3A 3NTIA 1AT1B 2K9GA 2L89A 1M1KU 1IREB 2VC8A 2NUPB 4E7SA 2WEVB 1I5OB 2OX7A 4M78D 5FROA 4C0DC 1H3ZA 3M58A 4O6JA 5CCAA 3A8LB 1HXDA 4F17A 2VB6A 3BLHB 3OMGA 1Q7YU 4M78A 4CFUB 2HAXA 4UN0A 2WSFE 1WI7A 1YJWA 2WFYB 2QI2A 4C8QG 2RD1A 3BHUB 4KT0E 1FMKA 1SSFA 3LWIA 3E1SA 1RACB 2LRQA 1E9HB 5ICPB 1WJRA 3QPHA 1RAEB 2RO0A 1K73C 2CUDA 2DD5A 4IUVA 3JCMP 2M0OA 1B07A 1YWPA 1PWTA 1GUXA 1WQWA 2M9UA 2QGGA 3CPWA 2O4XB 3PMTA 3NTHA 2LT4A 4CRIA 1OIYB 2C0IA 2BKDN 2W9ZA 2I0NA 3NFCA 3B57A 1J3TA 1VQNT 2IVWA 1S72Q 1K8AC 1WHKA 4PLIA 4YTLA 4F14A 1LJOA 3CXCA 2IW9B 1X27A 1X6GA 3CMAT 5HK0A 2D1XA 3CC7Q 2R58A 3LW5E 3G33B 1M1KC 2IW8B 5FU7B 1AZEA 3M9QA 2E5QA 1VQKT 4XTYA 1OKWB 3G6ET 4QQDA 4BCIB 2V8JA 4ZN1A 3OYIA 3OBYA 1YJNT 5LJ3g 2J7IA 4M7DF 4JUVA 5CR2A 4BE1A 1Q7YC 3EFOB 2DTOA 2X4JA 4JLGA 3R6OA 2X35A 1OX8A 4L59A 3D7SB 1JSTB 2VUBA 4F6WB 2PNIA 2EJ9A 1GXIE 4ORZA 4JDSA 3TSWA 2QG9B 4HCZA 1X2KA 2LTOA 4IMYB 4XTZA 4OVAA 2OI3A 3M5AA 3G1JA 5KE2A 3E9FA 1YIJA 3CCRA 2WIHB 5FWBA 2CZ7B 3RR6A 2DO3A 4FSXA 1H28B 1N8RR 1RADB 3JB9G 3HFNA 3KFVA 4KGVB 1MMAA 1K9MR 2KXCA 2L3QA 4LUDA 4YC3B 2JT4A 5KYUB 4GY5A 1Y7XA 1BU2A 4Y72B 2JW4A 1H641 3GPLA 2Y4YA 4AMCA 4MFEA 2OAWA 4ESRA 1KK7A 2HKQB 2P84A 4E2FB 2C5OB 2X4XA 2PVOB 3CCQQ 4XU3A 3ZL7C 1ZSZC 4EOJB 3R6NA 1CKAA 1G2BA 3M0PA 1FINB 5GMKi 2CSQA 4ME7A 8AT1B 5IHKA 3OYLA 4LE9A 2M1HA 5A2QE 1GCQC 3A1PA 2PHGA 3JRZA 2KROA 2D8JA 2ECZA 1RI0A 1BI2A 2F2WA 1Q95G 1WYXA 2CZ6B 4Z8AA 2LQNA 3HPWA 2KQWA 5A0LA 2WMAB 4FSSA 5FGKB 4LDVA 2KAFA 1M1FA 4HNUA 2HL5C 3PO3S 1QMCA 5HK3A 1NBEB 4BUGA 3TSZA 4IUQA 3OW2S 1PHTA 4GLKA 4OP0A 2A28A 1W4SA 3KXTA 3BLQB 2O9SA 2CZ0B 3FIFA 3HFOA 2RH2A 4JZ4A 4E7LA 1SSHA 2XU8A 3CCEQ 1OI1A 5CO7A 2JS2A 1NYFA 4EONB 3G4SA 3QXEB 3EFRA 4PL6A 1YIJQ 3CCRQ 2EAYA 4M77C 3ZFJA 4OGEA 4NSTB 1YCYA 1BI3A 2VXEA 3OW2P 1U5SA 5HCKA 4Z02A 4BCMD 5CKHA 4OMMA 2EKOA 4M75C 1JJ2S 1YJ9A 2LCSA 2IG0A 1RLQC 2X9HA 3JAME 1IGUA 3FEOA 1ACMB 2IIMA 2UZLB 2YLBA 2MWOA 1S72T 4PJOG 2QF7A 2HCKA 3NGPA 1JOWA 1Q82R 1C6VX 4M75D 4PJJA 2K3YA 3M55A 1OKVB 2O2OA 3CC7T 2V22B 1QLYA 4RMOA 5C0MA 1YN8A 1ZLMA 5D6XA 3AHUA 3QG1A 1I1JA 3MEWA 1PC0A 2KR3A 1IO6A 5GAOq 3GLXA 1VQ7A 4FYVB 2CREA 3HRUA 1MHNA 4N4IA 5I2MA 2FZCB 3TREA 1YHQQ 1UHFA 1TFBA 2D0QB 4R56A 3V7SA 4F7UG 3EGDA 4BCJB 2GGRA 1VQOA 4JJNK 3VRZA 2CP7A 4BCQB 1NZ9A 4M78F 2YRDA 4Y91A 4F7JB 4J8OA 3A8OB 4D6WA 4DOWA 1G3WA 5GAN4 5HBHB 4I3ZB 3G4SQ 4QKUA 1YITA 4NL3A 1VYWB 1YNZA 4L6V5 2W2HA 2W99A 4LN2A 3VU3C 3HB9A 4J6XA 5GAN5 3OYNA 4LXCA 4CFUD 2C5XB 1U8RA 4C8QE 1ABQA 1ARKA 1VQ6A 2NLUA 3DDQB 1TU0B 3HL8A 4ROEA 1K0XA 1LNXA 3OYCA 4PJLA 3QHWB 4HNTA 1PKTA 4M78B 3DTOA 1YJ9Q 2JTEA 4ATOA 3REBB 1KC8R 4QVDA 4OGCA 3JCMh 3DLMA 1Z9ZA 1SKUB 2OTJA 4OMOA 1VQPQ 2YHTA 3CCQT 1KD1U 4BCOB 2DD5B 1AWXA 5GANj 4N0AA 5FU7C 3MIAB 2LX9A 3EG2A 1V76A 2PZ1A 3I55Q 1GUXB 4BCPB 3TU4K 1O75A 3VS6A 1JEGA 1M9SA 2RI5A 3QO3A 3LX7A 4J9DA 1VYUA 5HQ0B 3NPFA 3L2WA 4JRQA 4J7FA 1OPLA 1NYGA 2L3RA 1O9KB 3EGXA 3MEVA 1M5Q1 3KHIA 2DD4A 4E7ZA 4PNOA 4HVUA 1WXUA 2MWPA 3CC2A 1QCOA 4J9GA 1HSQA 1VQOQ 1TSFA 2FL7A 3RESA 3QYEA 1RL2A 1H4LD 2LW4A 2KK4A 1M8VA 8ATCB 2LNVA 5KYXB 3PNWC 3TVTA 4FT2A 2VKNA 2YRVA 4UC4A 3C12A 5GAMe 1OV3A 3PIOA 5GAMd 3OYEA 1X2QA 4IUTA 4YOOA 4EDUA 3L2ZA 2F5KA 3UPUA 1QMZB 3WVEB 4ELLA 3M57A 2QQ9A 4KH1B 3DOGB 2L2PA 3CCRT 4AT1B 5GAOl 2JUFA 2BS3A 3A5ZB 3AT1B 3SHWA 2W9FA 3K7AM 2QA4A 2K79A 1K0SA 3X24B 3BDLA 1UHCA 2RPNA 3DJBA 2LJ1A 2RNAA 3QYHB 1RAGB 3MKDA 4C8QD 2BS2A 2H3EB 4J9CA 2RQTA 2ZAEA 1SHGA 1PSEA 1KD1C 3CCVA 2KVQG 2ZCFB 1MMGA 1KSWA 4RTUA 2KMTA 1MMNA 4C8QA 2VASA 2CGHA 3H41A 2PK9B 5GAOp 3JB9H 2ZPHB 4FYYB 4MZPA 2UUEB 4FIBA 2G77A 3G7ZA 3CCJQ 5GANg 3UWNA 2KT8A 4MDWA 1VQ4A 4BY1X 4LDUA 4FYWB 5LJ5e 1ZP2A 4A53A 2F2XA 5LJ5d 2EFIA 5HBEB 4Y92A 4J9FA 1YHQT 1M8MA 5GMKl 2E6ZA 1KQSP 3VYHB 3CC2Q 2E5KA 3GIBA 4FM4B 1UJ0A 1N27A 5KYWA 2KXDA 2LZ6B 3CBPA 2BE9B 4C92G 1H1SB 2EUFA 5GAOm 1NJIC 4O5VA 5LL6S 3BG3A 2EYZA 3G4ST 1VUBA 3L2VA 2AKLA 3PVQA 2F1LA 3M0UA 3QWYA 1CKBA 2XDPA 1IB8A 2GFUA 2MYSA 5GMKh 1OL2B 3RIRA 1AWOA 1YJ9T 1VYVA 2DYIA 3TNWB 2WACA 4C5HA 4EMKC 1UUEA 2YXYA 3EG3A 3LWHA 4M7AG 3QYBA 1AWJA 4RCCA 4C0FA 1OEBA 2DL7A 2RF0A 3GP8A 1VQPT 2DLPA 2EQIA 1F5QB 3VS4A 2DVEA 3BY7A 4PKCC 4RUGA 2BE7D 3I55T 2EGEA 3MP1A 2EQJA 2HZYA 4XAXB 1E6GA 2KEAA 1WLPB 3LYIA 4PJOE 2COZA 2XKOC 5IHIA 2CDTA 1VQ4Q 4BCMB 2QXFA 5GMKm 4M75F 3SDZA 4KUDK 2KDSA 1TOVA 1W6XA 4C5IA 2W10A 2FPDA 4EOOB 2JGZB 2C06A 2FYKA 2CCIB 1BBZA 2PK2A 1RAHB 2YWWA 5HKCA 3H0IA 3KUFA 3UATA 1VQOT 2HQXA 1VOMA 5I22A 4F7UE 3OY9A 2HSPA 3JCMV 3EOCB 2C5VB 1YWOA 1ABOA 1E7PA 1H1RB 4X34A 5ACBA 2R57A 4M78C 3CC4A 3UT1A 4R55A 2UZEB 3L42A 3J81E 5LMKB 2DBKA 1N8RU 3L1AA 4PJMA 4HLQA 1K9MU 1VQ8Q 2BIVA 5IHYA 1H92A 2VXFA 2HKNA 1Q81U 2HEQA 1D3UB 1H25B 4B6MA 4XTVA 3LGFA 1NG2A 2E64A 3MHXA 3M53A 1AD5A 3TCJA 2CS7A 3HKSA 4N4GA 1D3BB 3RKWA 2PJQA 1G5VA 3CCJT 3OYBA 3WVDB 3OA6A 1VINA 1QVGS 4E6RA 1AHJB 4EMHA 1IZ6A 4OB2B 2EGAA 3L2QA 2GQVA 2XD0A 5IT9E 3O5ZA 4BDYA 4LDWA 2FPEA 2VYTA 1H27B 2C5NB 4NL2A 2MMPA 2AK5A 3CC2T 2GF7A 4PJOA 3VS5A 1Y71A 3Q1JA 2EJGA 3LH0A 1I07A 2J06A 4J6WA 1ZUUA 4M7DG 1NPPA 2DM1A 2W0ZA 1QVGP 3EGXB 3PMIA 1HJDA 2DD4B 2K4YA 2VVKA 3IQLA 1VQLQ 4EPCA 4BCKB 2OAUA 1N8RC 1IHWA 3T9NA 3ASKA 1K9MC 3PT9A 1YI2A 4F7UA 3TEEA 3UA7A 3BFMA 2K57A 3EGUA 4RTVA 1D0ZA 5LJ3h 1MUZA 1JKWA 2FZGB 1T3LA 1MNEA 2RHZA 3DDPB 4EOKB 2BZXA 3VS7A 4FU6A 1AWWA 1KHCA 4Z88A 1AD6A 2BZ8A 2E41A 2DNUA 1WHHA 4RTWA 3CBOA 4Y28E 1BI0A 4AKIA 4Q5WA 1PKDB 4AFZC 3OS0A 3EHQA 4CI0C 1WNLA 4CFMB 4JZ3A 1Q82U 2K2VA 1LCKA 2EGCA 4D8DA 3OQ5A 4JRPA 1Q86R 5IN1A 1YJWQ 5EFQB 1VQ4T 5LJ3f 4C8QB 5CAIA 4II5B 1JU5C 1NEGA 5I2SA 4MIMA 1DJ7B 3MEAA 4ELJA 2G3RA 2LC4A 2RHIA 3C4SA 2RI3A 1Q81R 2QQAA 4DBRA 1UGVA 2CJMB 5EC7A 4QVZA 2M0YA 2ABLA 1VQ5A 3LQ5B 4C92E 3GOXA 4OMPA 4X9CA 1ZA2B 3BDUA 2ZPIB 4ZGDB 4OB3B 1S1NA 1WHGA 4M77E 2L8DA 5HY6A 1RABB 5KYWB 1C9BA 2JS0A 2DXTA 4FW2A 2RHUA 1TWBA 3VS1A 4A63B 4FT4A 2X51A 1VQ8T 3THKA 3OW2A 1KC8U 5DM7R 3N5BB 2DFUA 2FG0A 2V1RA 2QDYB 1D0XA 3SFMA 3SD4A 4J83A 3G71A 2K6DA 5HNBB 4EOPB 4PK4A 4M7AE 2O31A 3QWLA 1KQ2A 1PCXA 1Q82C 2GTOA 5C6SA 1H1QB 2Y4XA 1XTDA 4C5GA 2PVDB 1MV3A 1QVFS 1UGSB 1Z9QA 1HYOA 3VKHA 1NPRA 3FC3A 1PSFA 2RB6A 2E10A 2CZ1B 2YUOA 2E12A 4TTHA 5IAYA 4ZN3A 2AKKA 1KQ1A 2HBWA 4DBQA 2IPOB 4NS5A 3RKYA 3QZ5B 1BIBA 1LVKA 4KRTA 2AHJB 1NEBA 1XOVA 1URCB 1KG1A 5GAMj 4F6UB 4CRLB 1WFWA 2KY9A 4FL6A 1Y57A 2P4RA 2COWA 4E7IA 4QQ6A 1QVFP 2MK5A 3I5SA 2L3PA 3J80E 2E4HA 1WHMA 1UJYA 4AFQC 3HZJA 4GBQA 2J6KA 4L5GA 1IRXA 2HBPA 4EMKB 1UG1A 3QSUA 2F69A 2LQWA 4KGZB 1VQLT 4CFNB 3C94A 1GY3B 4C92D 1FMVA 2DL3A 4EOIB 1N5ZA 3CCEA 1OULA 2DRKA 1JJ2P 3VYGA 1KC8C 4EOQB 2GBQA 3OMCA 2W96A 4C92A 5CQXA 3GNGA 1ZBJA 4YOZA 5J3BA 1D09B 2EBPA 5CKDA 4QW2A 1TG0A 1GFDA 2GNCA 1Y96A 4J9EA 2FVUA 2PUKB 2HSEB 1TXQA 1X6OA 2O9VA 3PE0A 4F16A 5LJ5j 1GBQA 2AT1B 2KRSA 5CEIB 2PVGB 3VKGA 1ZHIA 4E47A 1VQMA 4N0AC 4NOYA 1D0YA 4JS4A 1YJWT 2DXBA 1AISB 1GFCA 3BW1A 1H1PB 4PFPA 2FRWA 4M7AA 4F70B 1OPKA 4N4HA 2DX1A 3TW7A 5GAN7 1O9SA 3CCUA 3OBWA 3EG9A 1I81A 2DVJA 4R0KA 3S3OA 3HHTB 3EHRA 5DLOA 4KGXB 2P0PA 1OL1B 1A0NB 3URGA 2R7GA 5GAMg 1G83A 2E3HA 2AIRB 5IXBA 4M7DE 1FKMA 2I40B 2G9XB 5DQWA 3EH2A 4PJOB 2I53A 2DZ9A 2MF2A
chains in the Genus database with same CATH topology
1YHQA 2DD5A 4IUVA 4QVCA 5GMKh 3JCMP 5GAMf 2CKKA 3RIRA 5FRNA 1Y07A 2M0OA 2M9UA 1WQWA 2DIQA 2QQRA 3C95A 3EAEA 4XTXA 1YJ9T 2D9TA 3CPWA 2RK1A 2O4XB 3PMTA 3NTHA 2LT4A 3FDRA 2WACA 3LLRA 4C5HA 4CRIA 1JJ2A 4EMKC 2BKDN 2DTHA 3LWHA 4M7AG 3QYBA 3NFCA 4RCCA 4C0FA 5L8RE 3GP8A 1VQPT 3EFSA 4C92C 4ZGJB 5M9OA 1VQNT 2IVWA 4ZGEB 1K8AC 4F7UB 2DVEA 3BY7A 4PKCC 4PLIA 3CBMA 3MP8A 4YTLA 1H3ZA 1LJOA 5FLXE 2QDJA 2QQSA 1B34A 3FJPA 3I55T 1QP2A 3MP1A 3CXCA 2EQJA 4XAXB 3J7AF 4XTWA 2D6FA 1VQ9T 3LYIA 4C8QC 3CMAT 5HK0A 4PJOE 3OYGA 4A4GA 2R58A 3LW5E 2PUOB 3RKXA 4BI8B 1M1KC 2XKOC 2M16A 4XQ3A 4M78G 5FU7B 2HNIA 3E19A 2KMGA 1ZQ1A 2PQWA 2JTFA 2QXFA 3M9QA 2E5QA 5CKEA 4DQ2A 5GMKm 1QP3A 5LJ5g 1VQKT 4M75F 4ELZC 3SDZA 1YIJT 4XTYA 1YBYA 3CC4T 4KUDK 1P92A 2KDSA 3G6ET 4QQDA 3L2UA 1BI1A 4A54A 2V8JA 2JZ2A 4C5IA 4ZN1A 2DXCA 3OBYA 3OYIA 4WF2A 4XTUA 1YJNT 1JB0E 5LJ3g 2C06A 2FYKA 4M77D 3V7CA 4M7DF 4JUVA 4M7AC 5CR2A 4BE1A 1Q7YC 1VQPA 2DJZA 3KUFA 5HKCA 3META 1VQNA 3SWNB 1VQOT 2DTOA 2HQXA 2X4JA 3JSCA 4JLGA 4JRIA 2LQ8A 2X35A 3R6OA 4L59A 3SB2A 3JCMe 3X26B 2VUBA 4F7UE 3JCMd 3QYGB 3OY9A 3I55A 1XNIA 3KBGA 2EJ9A 3RMQA 5LJ5f 1KQSA 1GXIE 3QJYA 3JCMV 2PU9B 4M77A 4JDSA 5CVIA 1E7PA 4HCZA 2LTOA 3UDCA 3OS2A 4XTZA 3RERA 2A7YA 4OB0B 3M5AA 3QHSA 4OVAA 4X34A 4BI4A 2X4WA 1U1SA 2QTXA 2V8IA 5KE2A 5GANh 4JS5A 2R57A 1VQKA 3E9FA 4M78C 1YIJA 3CC4A 3UT1A 4R55A 3CCRA 4XU2A 4M75A 2RA2A 3L42A 3J81E 2CZ7B 4M7AD 2XDDA 4PLLA 2DO3A 4FSXA 5A0DA 4HT9A 2YLCA 2VGMA 4JX6A 3JB9G 3CD6A 3HFNA 3MEUA 3CCLA 3OYJA 2WSCE 2K3XA 4II1A 1N8RU 4JX5A 1WJQA 2DK3A 2O01E 4NC6A 3L1AA 2ZPBB 3H4CA 1U1TA 3A8HB 4HLQA 2ZZDB 1K9MU 3ZEHA 2L5QA 2BIVA 4M7DA 4GY5A 1Y7XA 5FU6B 2ZPGB 3DB4A 1H641 2VXFA 4J5YA 3GPLA 2KSSA 2Y4YA 1Q81U 2LDMA 3CMEA 4MFEA 4PJOF 4QSHA 4DA4A 2CYZB 5GAMh 2X4XA 4XTVA 4BE2A 2PVOB 4BBRM 3LGFA 4XU3A 3OYKA 2E64A 2RHXA 3MHXA 5GANf 2Y90A 3M53A 2HD0A 5GMKi 2OTLA 3TCJA 1UEBA 2CS7A 1Q82C 4ME7A 3A8GB 3OYLA 1G3SA 4J7IA 2M1HA 3HKSA 5A2QE 4N4GA 1D3BB 4BY6B 3RKWA 1UGRB 3JRZA 3QJ6A 4EMGA 4BE0A 1G5VA 4BBSM 3CCJT 3OYBA 3M59A 3WVDB 3OA6A 1RI0A 4MDXA 1BI2A 4M77G 1QVGS 2CZ6B 4IKFA 5CKBA 1AHJB 2DTIA 1G3YA 3HPWA 5EG2A 4EMHA 1IZ6A 4OB2B 3L2QA 2KQWA 4AKHA 2ZPFB 1D3BA 4OMFB 5A0LA 2GQVA 2XD0A 3VUZA 5IT9E 2DKGA 1I8FA 4LDVA 2KAFA 2EQKA 4F7UF 1M1FA 4HNUA 4BDYA 1YI2T 4LDWA 3CCST 4M75G 1N9RA 2VYTA 5HK3A 4BUGA 3DLLA 4NL2A 2MMPA 4C0GA 2GFAA 4IUQA 2DZCA 2GF7A 3OW2S 3CC2T 4PJOA 4HA8A 1WPYA 4GLKA 1HK9A 1Y71A 2JVVA 3ER0A 1W4SA 3Q1JA 4OP0A 3JCMg 3KXTA 2H3JA 2CZ0B 3FIFA 2EJGA 3HFOA 2LCLA 3LH0A 3S3MA 2RH2A 3CCMA 3JCMc 1FX7A 4HCBA 4E7LA 4OB1B 2XHCA 4J6WA 4BD3A 4C0DB 4RKUE 3JB9D 1NPPA 2EWNA 2XU8A 4M7DG 1WGSA 2QEXA 2QQ8A 1OI1A 3NTKA 5CO7A 2O4XA 1KHIA 3PMIA 2LQKA 3VUBA 3OYFA 4VUBA 2DD4B 3CCJA 3G4SA 3QXEB 3EFRA 2K4YA 1W2BS 2WJ9A 4BDZA 2EIFA 4PL6A 5A0GA 4E7KA 4EPCA 5CKFA 4V2SA 2EAYA 4MZMA 4M78E 4M77C 1X01A 2OAUA 3ZFJA 2EYQA 3P8BB 5LJ5h 1N8RC 4OGEA 4KBMB 3S6WA 3T9NA 3ASKA 1YCYA 3JCMf 5I21A 1K9MC 1BI3A 1G3TA 2VXEA 3PT9A 5D6YA 3OYYA 1YI2A 3CCET 4F7UA 4Z02A 3TEEA 4IURA 3BFMA 3JB9J 2K57A 5CKHA 3OSVA 2DPPB 2RHYA 2RM4A 2EKOA 4M75C 1JJ2S 1YJ9A 4B9WA 5LJ3h 2IG0A 3JAME 1VQ7T 2P0QA 3PGGA 2MI6A 2RHZA 2DAQA 1OZ2A 3M54A 3FEOA 1BKBA 1I4K1 4FU6A 1KHCA 3OS5A 2E41A 3HP9A 2VV5A 2YLBA 3I56T 4M7DC 2MWOA 4Y28E 3CBOA 5AYFA 3DKMA 5KE3A 1S72T 1BI0A 3TW6A 4AKIA 4Q5WA 4PJOG 2QF7A 3OS0A 2RJDA 3L2RA 4CI0C 1NJIU 4M75D 1VQ9A 1WNLA 3CMAA 2K3YA 3X28B 2R5MA 3M55A 4C92B 1Q82U 3FB9A 3JB9I 3OYAA 2K2VA 3HRSA 1VQ5T 3CC7T 2E1HA 4RMOA 1ZBXA 3F70A 3SWNA 3OQ5A 4JRPA 5C0MA 5GMKj 1YITT 5IN1A 4KUIA 5D6XA 2RJFA 3QG1A 1VQ4T 3BG9A 1M90U 3AHUA 3MEWA 3JCMb 5DY9A 1Q86U 5LJ3f 3HRTA 2EJFA 4IUPA 4BACA 4RG2A 5GAOq 3GLXA 4C8QB 5CAIA 1VQ7A 4M7DD 3HRUA 1MHNA 4N4IA 5I2MA 5I2SA 3G6EA 2VGNA 4MIMA 1DJ7B 3LGLA 3MEAA 3TREA 1VQ6T 5J26A 3CCUT 5GMKe 1YJNA 4ELJA 2G3RA 5CK9A 2LC4A 2D0QB 4R56A 2WSEE 3V7SA 2RHIA 4F7UG 3C4SA 2RI3A 2FHDA 1KQSS 2QQAA 1M4ZA 1VQOA 1S72A 3P8DA 4JJNK 4BB7A 2E70A 4MMKA 2DXBB 1NZ9A 4M78F 4A4KA 4QVZA 4Y91A 4J8OA 2E65A 3V8LA 3FRNA 2JNGA 3G71T 3A8OB 4PJOC 4P5NA 4M7AB 3RUXA 1QLBA 4D6WA 4DOWA 2OTJT 1G3WA 5GAN4 1K8AU 2ZZDA 1VQ5A 3VJPA 1QVPA 4C92E 1FXXA 3E9GA 5D6WA 4JRKA 4RCBA 1YITA 4NL3A 3JCMJ 3GOXA 3ME9A 4X9CA 4L6V5 3BDUA 2ZPIB 3QZ9B 4ZGDB 4OB3B 3HB9A 2DIGA 4J6XA 3V8JA 3VU3C 5GAN5 3OYNA 4E7JA 3H6ZA 4M77E 1QVGA 1U8RA 2L8DA 5HY6A 2QQBA 4C8QE 2LT1A 2RK2A 5DLQE 2KR6A 5KCHA 1X75C 1VQ6A 2NLUA 2BS4A 2X4YA 3HL8A 4A4EA 3M4GA 4E7HA 1LNXA 3OYCA 2DXTA 4HNTA 4M78B 1BYMA 2RHUA 5GAOn 2MAMA 4PJOD 4ATOA 4QQGA 2EQUA 3VKIA 4FT4A 4QVDA 3DL1A 1MGQA 1R8OB 4OGCA 1VQ8T 4AKGA 3JCMX 3OW2A 1KC8U 3JCMh 5DM7R 3DLMA 3O8VA 3N5BB 1UGQB 2QDYB 3SFMA 3HO8A 3SD4A 4KULA 4J83A 5GAN2 3G71A 2OTJA 3X25B 4XU0A 2YHTA 3CCQT 4M7AE 4C0ZA 2ZGWA 1KD1U 3PTAA 4BI3A 3QWLA 4ZTJA 1KQ2A 5GAOr 2DD5B 2GCXA 3V8KA 5C6SA 4N0AA 5FU7C 5GANj 2LX9A 4ZTFA 2Y4XA 1XTDA 4C5GA 2PVDB 1TH7A 1M90C 3TU4K 1W2BA 2K5IA 4DOVA 1O75A 1I5LA 5EJCA 1Q86C 3M4YA 1UGSB 4HL4A 1QVFS 3VKHA 1NPRA 3FC3A 4X9DA 1PSFA 2XK0A 1M9SA 2RI5A 2RB6A 3QO3A 1EIFA 2E10A 2CZ1B 3LX7A 5GANe 2K5LA 2E12A 3X20B 2XI9A 3CPFA 5GANd 1JRIA 4JRQA 2R5AA 3L2WA 5IAYA 4ZN3A 1M1GA 4J7FA 3HSBA 3GNFB 1VQ8A 2L3RA 3GF5A 2QA4T 1KQ1A 4C5EA 3JCMW 3SWNC 3MEVA 4NS5A 1M5Q1 3RKYA 3QZ5B 1LOJA 2BUDA 2DD4A 3KHIA 1BIBA 2XICA 3PFSA 4PNOA 1B34B 2AHJB 3CPWS 1XOVA 3CCSA 4LD9K 2MWPA 1KG1A 5GAMj 1Q81C 4IUUA 3RMSA 3CC2A 2K5FA 2XIDA 3FLGA 4C92F 3CCQA 2KY9A 4FL6A 4TVRA 2FL7A 3RESA 3QYEA 1RL2A 4E7IA 3P8HA 4QQ6A 2KK4A 1M8VA 3CCVT 2MF2A 5GAN8 3JCMQ 2LNVA 3PNWC 1VIEA 1N6AA 4LOCA 2DEQA 4FT2A 2A3LA 2YRVA 4M77F 3J80E 4UC4A 3C12A 4C8QF 5GAMe 3VV0A 3HZJA 3PIPA 3PIOA 5GAMd 1VIFA 3OYEA 4IUTA 4L5GA 2HBPA 2DXCB 3MP6A 4EDUA 3OYDA 3CXCS 3L2ZA 3VYGB 2F5KA 4EMKB 3OB9A 2F69A 3WVEB 3UPUA 3QSUA 3M57A 3QBYA 2QQ9A 1VQLT 2JOYA 3C94A 3CCRT 5GAOl 2JUFA 2BS3A 2HQEA 3A5ZB 4OF1A 5FRMA 5GAN6 4C92D 2QA4A 1NE8A 5FU6C 4AI6A 3CEYA 1VQMT 3MCAB 3X24B 3CCEA 3BDLA 2XDBA 3CD6T 3CCLT 4MFDA 2JN0A 3VYGA 4EMKA 5CIUA 1KC8C 4MMLA 3BG5A 3QYHB 2F5TX 4XU1A 4JLIA 4M77B 4M7AF 2RJCA 1Y96B 3OMCA 4C8QD 2BS2A 3WXMB 4ELYC 3OYMA 2P4TA 1K73U 5J39A 4C92A 5CQXA 3GNGA 3MO8A 4Z6YA 1PSEA 2DXUA 4LDYA 3S3NA 1KD1C 3CCVA 5J3BA 2P0KA 5CKDA 3CMET 1UB4A 2KVQG 4QW2A 4A4FA 2ZCFB 4M75B 2KMTA 4LDXA 1OZ3A 3OYHA 4BY6C 1Y96A 2JTMA 3I56A 4C8QA 3INZA 1WQ7A 2CGHA 2XG8D 2B8AA 5GAOp 4LD6A 3JB9H 2FVUA 2ZPHB 2PUKB 4MZPA 2QFZA 1OYXA 4HKEA 1X6OA 3M56A 2OTLT 4A4HA 4HT8A 1VQLA 2V8KA 3V7RA 4HNVA 2E6NA 5LJ5j 3QIIA 3OS1A 4FIBA 1V29B 1FWZA 4M7DB 2PVGB 2G77A 3HBLA 3G7ZA 3QUIA 3VKGA 4RG8A 3CC7A 1UGPB 3A8MB 1ZHIA 5GANg 4E47A 1VQMA 4N0AC 4XK8E 4NOYA 3UWNA 4JS4A 1BIAA 1YJWT 2DXBA 4MDWA 1VQ4A 3BW1A 4M6VA 5KCOA 4LDUA 1QW1A 5LJ3j 3DB3A 3NTIA 5LJ5e 1XQHA 2L89A 1M1KU 1IREB 3H8ZA 2VC8A 4A53A 4N4HA 5GAN7 3TW7A 4M7AA 5LJ5d 2EFIA 2I2LA 4J6YA 3OSSC 1YHQT 1K73C 1O9SA 3CCUA 5GMKl 2RI2A 2E6ZA 2RJEA 2EQMA 3OBWA 4M78D 5FROA 3VYHB 1I81A 4C0DC 3QKJA 3S3OA 3GIBA 4FM4B 2FB7A 3M58A 4O6JA 5CCAA 5LJ3e 4M75E 3A8LB 1HXDA 1N27A 3HHTB 2LVMA 5DLOA 5LJ3d 3QDRB 2P0PA 5GAN3 2ZPEB 3CCMT 3URGA 3CBPA 3OMGA 5GAMg 2LCCA 1N9SA 4HCCA 3ZBDA 4MZTA 4M78A 4C92G 1Q7YU 2QEXT 4JX4A 2HAXA 5GAOm 1WJSA 5CQYA 1NJIC 4O5VA 5LL6S 1FKMA 3BG3A 4B9XA 4M7DE 3G4ST 5KH6A 1VUBA 2WSFE 3L2VA 1QVFA 1YJWA 3JB9F 2QI2A 4C8QG 2RD1A 4PJOB 4KT0E 3LWIA 1SSFA 3E1SA 2LRQA 1WJRA 2XDPA 2RO0A 3QPHA 2DZ9A 2GFUA 1JBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD5 A;  1DJ7 B;  3A8G B;  2DXC B;  3VYG B;  3WVE B;  1UGR B;  2D0Q B;  2WSE E;  3WVD B;  2CZ6 B;  2DXB B;  1AHJ B;  5L8R E;  3X24 B;  4OB2 B;  4ZGJ B;  3VYG A;  2ZPF B;  4ZGE B;  3A8O B;  3QYH B;  2ZZD A;  1QP2 A;  1PSE A;  3LW5 E;  2PUO B;  4L6V 5;  2ZPI B;  3QZ9 B;  4ZGD B;  4OB3 B;  2ZCF B;  2CZ0 B;  1QP3 A;  4OB1 B;  4RKU E;  2ZPH B;  2PUK B;  2DXC A;  2DD4 B;  3QXE B;  1JB0 E;  1V29 B;  2PVG B;  1UGP B;  3A8M B;  1UGQ B;  4XK8 E;  2QDY B;  2DXB A;  3X25 B;  3X26 B;  3QYG B;  1IRE B;  1GXI E;  2DD5 B;  2PU9 B;  2DPP B;  2PVD B;  4OB0 B;  1UGS B;  3VYH B;  4FM4 B;  3A8L B;  1PSF A;  3HHT B;  2CZ1 B;  2CZ7 B;  2ZPE B;  3X20 B;  4Y28 E;  2WSC E;  2O01 E;  3QZ5 B;  2ZPB B;  2DD4 A;  3A8H B;  2ZZD B;  2AHJ B;  2WSF E;  2ZPG B;  3X28 B;  4KT0 E;  2CYZ B;  2PVO B; 
#chains in the Genus database with same CATH topology
 1JSU B;  4QVC A;  5GAM f;  2CKK A;  3EAE A;  2QQR A;  2DIQ A;  3C95 A;  4XTX A;  3GTM S;  2RK1 A;  1VQ7 Q;  5KYY A;  1RI9 A;  3FDR A;  5BNJ B;  3LLR A;  1F1B B;  3QWX X;  2A36 A;  4CXA B;  3FJ5 A;  5IXF A;  2YUP A;  5M9O A;  2KBT A;  4F7U B;  2AZV A;  3MP8 A;  2QDJ A;  2QQS A;  2MCN A;  1QP2 A;  1PKS A;  1M3B A;  4XTW A;  4C8Q C;  3OYG A;  4BI8 B;  2QYZ A;  2RQW A;  1PD0 A;  1YIT Q;  2HNI A;  3E19 A;  2KMG A;  1ZQ1 A;  2PQW A;  4DBH A;  4DQ2 A;  2YT6 A;  1UTI A;  5LJ5 g;  4CFW B;  4ELZ C;  2D8H A;  1YIJ T;  2BZY A;  1YBY A;  2QAS A;  1P92 A;  2O88 A;  1BI1 A;  4A54 A;  1VQ6 Q;  2JZ2 A;  4PJN A;  2DXC A;  3RBB B;  3CCU Q;  2YUN A;  5CYI B;  3E2U A;  3TNH B;  1UNG D;  2DE0 X;  3V7C A;  1NM7 A;  4EOR B;  1XJW B;  1VQN A;  2QTV A;  4JRI A;  3JSC A;  3SB2 A;  3JCM e;  2LQ8 A;  5HBJ B;  3JCM d;  2KYB A;  3QYG B;  1KQS A;  2GQI A;  4EOM B;  3RMQ A;  5LJ5 f;  2KI7 A;  2RMO A;  4PFZ A;  1QCN A;  3QJY A;  2PU9 B;  2OTJ Q;  2CP0 A;  5CVI A;  1K1Z A;  2EYW A;  2YDL A;  4PFO A;  4IIO A;  3UDC A;  2A7Y A;  4OB0 B;  2DL5 A;  4BI4 A;  2X4W A;  2A37 A;  2QTX A;  1ZUY A;  5GAN h;  4JS5 A;  1VQK A;  3A98 A;  2RA2 A;  1TUG B;  4OMN A;  2XDD A;  4HT9 A;  2JM9 A;  3MEU A;  2WSC E;  2K3X A;  3VS2 A;  4II1 A;  4JX5 A;  1WJQ A;  1JQQ A;  2O01 E;  2ZPB B;  3H4C A;  1U1T A;  3A8H B;  3HTR A;  4M7D A;  2L3S A;  1SF9 A;  2ZPG B;  1JXM A;  4J5Y A;  4F7N B;  2LDM A;  4QSH A;  1GCP A;  2CYZ B;  4DA4 A;  1NLO C;  2KT1 A;  4BBR M;  2MIO A;  3OYK A;  4BCN B;  5GAN f;  2OTL A;  2IN3 A;  1G3S A;  2EYX A;  1FYN A;  1UGR B;  4BE0 A;  3QJ6 A;  4EMG A;  3TQ7 P;  4BBS M;  3MI9 B;  2X3X D;  3M59 A;  4AG1 C;  1PM3 A;  3EG1 A;  4M77 G;  2NUT A;  1OOT A;  4IKF A;  1SHF A;  1JO8 A;  2DTI A;  1SRM A;  5EG2 A;  2ZPF B;  2CP6 A;  1RUW A;  2QA4 Q;  1R0B G;  2DKG A;  2ED0 A;  1KXU A;  2EQK A;  2M02 A;  4M75 G;  2DME A;  1N9R A;  2X1N B;  4HA8 A;  1WPY A;  4CC3 A;  3ER0 A;  1PNJ A;  2H3J A;  2WPA B;  2K7A A;  2LCL A;  3CCV Q;  3CCM A;  4OB1 B;  3JB9 D;  4BD3 A;  4GLM A;  1WGS A;  2QEX A;  2JMC A;  2CUB A;  3NTK A;  5I5Z B;  1KHI A;  3VUB A;  2LQK A;  3OYF A;  4VUB A;  2FEI A;  1UDL A;  1D1B A;  1W2B S;  2WJ9 A;  2KRM A;  1BCM A;  5A0G A;  5CKF A;  4V2S A;  4MZM A;  4M78 E;  1X01 A;  2EYQ A;  3S6W A;  5I21 A;  1CSK A;  2WHB B;  3UA6 A;  2ROT A;  5D6Y A;  3OYY A;  3CCE T;  1H3H A;  2G6F X;  4IUR A;  3ULR B;  3JB9 J;  3RNJ A;  2DYB A;  2RHY A;  2K3B A;  4BCG B;  1ENW A;  2UZD B;  4LNP A;  1VQ7 T;  3PGG A;  3EH1 A;  2MI6 A;  2CSI A;  1GRI A;  1BKB A;  2HMA A;  1W2B P;  2VV5 A;  5AYF A;  1U3O A;  5KE3 A;  2OTL Q;  3H0H A;  1QKX A;  2GTJ A;  2C0O A;  2H8H A;  1VQ9 A;  4C92 B;  3OYA A;  1M90 R;  1GL5 A;  2E1H A;  3SWN A;  1YIT T;  3BG9 A;  4EOL B;  3JCM b;  5DY9 A;  1JXO A;  1Q86 U;  3HRT A;  2EJF A;  4IUP A;  1TD6 A;  3TN8 B;  3EGD B;  1MV0 B;  2UZB B;  2A0F B;  2VGN A;  1VQ6 T;  3CCU T;  5GMK e;  2PMI B;  1ZSG A;  2BPM B;  4HCK A;  3EG0 A;  6AT1 B;  2WSE E;  3GBQ A;  4RTZ A;  1S72 A;  4ROD A;  3CCM Q;  2DA9 A;  4MMK A;  2DXB B;  1E7O A;  3O0G D;  3MJX A;  2BTT A;  4CC2 A;  2QEX Q;  4PJO C;  4P5N A;  4M7A B;  2OTJ T;  1QLB A;  1K8A U;  2ZZD A;  3RDV A;  1QVP A;  2FZK B;  1WXB A;  5HVY B;  3E9G A;  2B86 A;  2NWM A;  4RCB A;  5D6W A;  1IGQ A;  2DIL A;  3JCM J;  3TNI B;  3ME9 A;  3EG9 B;  2SEM A;  2DIG A;  4E7J A;  3V8J A;  4EIK A;  1QVG A;  2C6T B;  1BCO A;  5DLQ E;  2PTK A;  2KR6 A;  1X75 C;  1I0C A;  2BS4 A;  4EC8 B;  2FPF A;  4A4E A;  1C1A A;  2HL3 A;  2DER A;  5GAO n;  4PJO D;  4J9H A;  1TTH B;  3VKI A;  1VYT A;  5AT1 B;  1R8O B;  1D1C A;  2QDL A;  4HVV A;  3O8V A;  2CCH B;  3HO8 A;  2JM8 A;  5GAN 2;  3PVL A;  4HXJ A;  4RTT A;  1NLP C;  3PTA A;  5IF1 B;  2V26 A;  4BI3 A;  1BB9 A;  2GCX A;  3V8K A;  5GAO r;  2MOX A;  2K5I A;  1VQ9 Q;  2EW3 A;  5EJC A;  1Q86 C;  5KYY B;  4HL4 A;  1TUC A;  1OIU B;  2ESW A;  1N4M A;  4X9D A;  2XK0 A;  7AT1 B;  4IIM A;  4F6S B;  1W70 A;  3NHN A;  2K5L A;  3X20 B;  1ZX6 A;  1JRI A;  3CC4 Q;  2R5A A;  1M1G A;  1WA7 A;  2E3I A;  3HSB A;  2F2V A;  2QA4 T;  4C5E A;  2VWF A;  3PFS A;  3CPW S;  3CCS A;  4WTO B;  1W98 B;  1D1A A;  1Q81 C;  4IUU A;  1WIE A;  2K5F A;  2CH4 A;  3FLG A;  3CCQ A;  4JPB W;  4TVR A;  1O9K A;  1UNH D;  3CCV T;  5GAN 8;  3JCM Q;  2KNB B;  1N6A A;  2ATC B;  2DEQ A;  2A3L A;  1WDX A;  4C8Q F;  5DQV A;  3VV0 A;  5IH2 A;  5L2W B;  3CXC S;  2DXC B;  3POM A;  1UFF A;  3MP6 A;  3OB9 A;  4J9I A;  3BE3 A;  1M2V A;  3QBY A;  5KYX A;  4F7S B;  2JOY A;  3CPW P;  1EZZ B;  5FRM A;  4OF1 A;  4AI6 A;  3CEY A;  3MCA B;  1U06 A;  1PRM C;  4ZNX A;  4MFD A;  3C0C A;  4MML A;  3BG5 A;  2F5T X;  1K73 R;  4XU1 A;  1PD1 A;  2RJC A;  3OYM A;  2P4T A;  5J39 A;  2AZS A;  1OU9 A;  3MO8 A;  1IHV A;  2DXU A;  4LDY A;  3S3N A;  1UB4 A;  4A4F A;  3CXC P;  2CT4 A;  5IDP B;  1OZ3 A;  3I56 A;  3INZ A;  2XG8 D;  1OGU B;  1K9A A;  2KRN A;  2V1Q A;  4LD6 A;  3BLR B;  2QFZ A;  1OYX A;  3H9N A;  3M56 A;  4OML A;  2OTL T;  4HT8 A;  2CP3 A;  3V7R A;  1K8A R;  3OS1 A;  1V29 B;  1FWZ A;  4M7D B;  3QUI A;  3HBL A;  4CFX B;  4RG8 A;  3A8M B;  1EFN A;  4BCN D;  4XK8 E;  1BIA A;  1M1K R;  5KCO A;  1AZG B;  1QW1 A;  5IDN B;  1XQH A;  2RQR A;  1VOL A;  3H8Z A;  2FO0 A;  2I2L A;  4J6Y A;  3OSS C;  1YI2 Q;  3CCS Q;  2DL8 A;  2RI2 A;  2RJE A;  2EQM A;  2LJ0 A;  2JJ9 A;  2YSQ A;  3QKJ A;  2FB7 A;  5LJ3 e;  4M75 E;  2LVM A;  1P5E B;  1IXD A;  5LJ3 d;  3QDR B;  1FVV B;  5GAN 3;  2ZPE B;  2NUT B;  1Q7Y R;  3CCM T;  3U23 A;  2LCC A;  3RGF B;  1N9S A;  3REA B;  4HCC A;  3ZBD A;  4MZT A;  1LPL A;  4JX4 A;  2QEX T;  1WJS A;  1ZUK A;  5CQY A;  4B9X A;  2KE9 A;  5KH6 A;  1QVF A;  3JB9 F;  3JV3 A;  4KRC B;  1GBR A;  1R77 A;  1VIF A;  1KIK A;  3QHR B;  1JBM A;  4Z89 A;  1YHQ A;  3LH5 A;  1YP5 A;  4X1V A;  4M4Z A;  5FRN A;  5GJW B;  4D8K A;  1Y07 A;  4JJC A;  1WHL A;  2D9T A;  1KJW A;  1WZO A;  1ZSZ A;  2DEU A;  1JJ2 A;  2KYM A;  2DTH A;  2CT3 A;  2MPX C;  3I56 Q;  5L8R E;  4AFU C;  1GCQ A;  3EFS A;  4JJB A;  4C92 C;  4ZGJ B;  4ZGE B;  4JJD A;  3CBM A;  1ZA1 B;  5IHN A;  5FLX E;  4DEX A;  3FJP A;  1B34 A;  1M3A A;  3J7A F;  2D6F A;  1VQ9 T;  2LX7 A;  5L23 A;  1VQ5 Q;  1MMD A;  4A4G A;  2PUO B;  3RKX A;  3M0Q A;  2M16 A;  4XQ3 A;  4M78 G;  4HVW A;  2JTF A;  5CKE A;  1M2O A;  1QP3 A;  3CC4 T;  3NDQ A;  3L2U A;  3VS0 A;  1AOJ A;  1RAA B;  4WF2 A;  4XTU A;  1JB0 E;  4M77 D;  1WX6 A;  4M7A C;  1VQP A;  2DJZ A;  3MET A;  1H24 B;  3SWN B;  2DRM A;  5GJV B;  1M27 C;  3X26 B;  3I55 A;  1XNI A;  2HQH A;  3KBG A;  3G71 Q;  4M77 A;  4RTY A;  2A08 A;  2WMB B;  4OR5 B;  3OS2 A;  3RER A;  3QHS A;  2OJ2 A;  2JMA A;  1U1S A;  4WCI A;  2V8I A;  4XU2 A;  4M75 A;  4FX3 B;  4M7A D;  4PLL A;  3EJ1 B;  5A0D A;  2YLC A;  2VGM A;  4K11 A;  4JX6 A;  3CD6 A;  2X3W D;  3CCL A;  3OYJ A;  2DK3 A;  4NC6 A;  1EX4 A;  2ZZD B;  3ZEH A;  2L5Q A;  1W1F A;  4CC4 B;  5FU6 B;  5FW9 A;  3DB4 A;  3M0T A;  4KH0 B;  2KSS A;  3CME A;  3F5X B;  4PJO F;  5LQF B;  5GAM h;  4BE2 A;  2LMJ A;  3M0S A;  2RHX A;  2NUP A;  2SRC A;  2Y90 A;  4QT7 A;  2HD0 A;  3M03 A;  4YOS A;  1X6B A;  1UEB A;  1UNL D;  3A8G B;  1BU1 A;  4J7I A;  3I5R A;  4BY6 B;  1T3S A;  1B7T A;  1G3N C;  2C0T A;  3BHV B;  4MDX A;  1UEC A;  2DL4 A;  5CKB A;  4EC9 B;  1G3Y A;  2CP2 A;  1WXT A;  4AKH A;  1D3B A;  4OMF B;  3VUZ A;  1I8F A;  4F7U F;  2RQU A;  1YI2 T;  4BCH B;  3CCS T;  4LUE A;  1Y0M A;  2IW6 B;  1FMW A;  4FW1 A;  3DLL A;  4C0G A;  2GFA A;  2DZC A;  1HK9 A;  2EPD A;  2JVV A;  3JCM g;  1MND A;  3S3M A;  4HCB A;  3JCM c;  1FX7 A;  2XHC A;  4C0D B;  4RKU E;  2EWN A;  2COY A;  2QQ8 A;  1AVZ C;  2RQV A;  4CFV B;  2O4X A;  1GH6 B;  3CCJ A;  2C4G B;  3MY5 B;  2EYY A;  2NYS A;  4BDZ A;  2EIF A;  4E7K A;  1SG5 A;  3P8B B;  5LJ5 h;  4KBM B;  3JCM f;  1G3T A;  1VQM Q;  3CD6 Q;  3CCL Q;  1PRL C;  2YRC A;  3OSV A;  1OI9 B;  2DPP B;  2RM4 A;  1E6H A;  4B9W A;  1OQK A;  2QAZ A;  2P0Q A;  1SEM A;  1M2V B;  2DAQ A;  1OZ2 A;  3M54 A;  3CME Q;  1I4K 1;  1G8X A;  4BY7 X;  4J9B A;  1X69 A;  3OS5 A;  4BCF B;  3HP9 A;  2WXV B;  1WHJ A;  3I56 T;  4M7D C;  2RN8 A;  4FCY A;  3DKM A;  2FRY A;  3EID B;  3TW6 A;  3I35 A;  2RJD A;  3L2R A;  1QKW A;  1NJI U;  4G6L B;  3CMA A;  3X28 B;  2R5M A;  1VQ5 T;  3FB9 A;  3JB9 I;  1K76 A;  3HRS A;  1QWF A;  3EFO A;  5KYN A;  3UF4 A;  1ZBX A;  1VA7 A;  3F70 A;  2DJQ A;  5GMK j;  4KUI A;  1M90 U;  2RJF A;  1RAF B;  1XO2 A;  4BAC A;  4RG2 A;  4DEY A;  3SEM A;  4M7D D;  1QWE A;  3G6E A;  1QQJ A;  3LGL A;  5J26 A;  1YJN A;  5CK9 A;  1KFZ A;  5I11 A;  2J6O A;  1AEY A;  2FHD A;  1KQS S;  1M4Z A;  3P8D A;  4BB7 A;  2E70 A;  1M30 A;  4EOS B;  2J6F A;  1R0C B;  1RAI B;  4A4K A;  2E65 A;  3V8L A;  3FRN A;  2JNG A;  3G71 T;  2K2M A;  3RUX A;  1BK2 A;  2KGT A;  3VJP A;  4ROC A;  3H0F A;  5KYU A;  1SPK A;  1FXX A;  4JRK A;  4ANJ A;  1H8K A;  1H26 B;  3QZ9 B;  3H6Z A;  1T0H A;  2EVR A;  4F04 B;  2QQB A;  2LT1 A;  2RK2 A;  5KCH A;  2X4Y A;  2YUQ A;  4E7H A;  3M4G A;  2ED1 A;  1BYM A;  3VS3 A;  2MAM A;  4QQG A;  2EQU A;  1B3Q A;  3DL1 A;  1MGQ A;  4AKG A;  3JCM X;  2DMO A;  3MPU B;  1UGQ B;  4OMQ A;  4KUL A;  1K4U S;  1X43 A;  3MY1 B;  2HDA A;  1KD1 R;  3X25 B;  3I9Q A;  4XU0 A;  2B9R A;  4C0Z A;  1VQN Q;  2ZGW A;  3CQT A;  4ZTJ A;  4ZTF A;  1QCF A;  2QGF B;  1RLP C;  1TS9 A;  1TH7 A;  1M90 C;  1W2B A;  1I5L A;  4DOV A;  3CMA Q;  3QDF A;  3M4Y A;  1ZSZ B;  3BHT B;  2LJ3 A;  1V1C A;  4DBF A;  1EIF A;  5GAN e;  1VQK Q;  2XI9 A;  3CPF A;  5GAN d;  3VRY A;  3G6E Q;  5FWC A;  3GNF B;  1VQ8 A;  3GF5 A;  2DET A;  3JCM W;  3SWN C;  2M51 A;  1LOJ A;  2XIC A;  1T0J A;  2BUD A;  2ENM A;  1YJN Q;  1B34 B;  4LD9 K;  1YFN A;  4F7L B;  3RMS A;  4AFS C;  2XID A;  4C92 F;  2L0A A;  3P8H A;  1VIE A;  4LOC A;  4M77 F;  2JXB A;  1OX9 A;  4KRD B;  2BKZ B;  1OU8 A;  3PIP A;  1TUD A;  2IVX A;  2EKH A;  3NMZ C;  3OYD A;  3VYG B;  1NJI R;  2LNH B;  2WIP B;  2ROL A;  2HQE A;  5GAN 6;  1NE8 A;  5FU6 C;  2XMF A;  1VQM T;  3CD6 T;  2XDB A;  3CCL T;  2JN0 A;  4EMK A;  5CIU A;  1SRL A;  1M3C A;  5ECA A;  2D0N A;  4JLI A;  3M0R A;  4M77 B;  4M7A F;  1Y96 B;  4ELY C;  3WXM B;  1K73 U;  2CP5 A;  2J05 A;  4Z6Y A;  2QGS A;  1PG5 B;  2P0K A;  1C0M A;  9ATC B;  3CME T;  4M75 B;  4LDX A;  2QK0 A;  3OYH A;  4BY6 C;  2JTM A;  2LP5 A;  1WQ7 A;  2DF6 A;  5D7U A;  2B8A A;  4HKE A;  4BCQ D;  4A4H A;  1VQL A;  2V8K A;  4HNV A;  2E6N A;  4CC7 A;  3QII A;  4OGR B;  3CC7 A;  4FYX B;  1UGP B;  2NUZ A;  1UE9 A;  4RTX A;  2Z0W A;  2F2C A;  4AG2 C;  1YCS B;  2CH4 W;  2DBM A;  4M6V A;  1HD3 A;  4BXX X;  5LJ3 j;  3DB3 A;  3NTI A;  1AT1 B;  2K9G A;  2L89 A;  1M1K U;  1IRE B;  2VC8 A;  2NUP B;  4E7S A;  2WEV B;  1I5O B;  2OX7 A;  4M78 D;  5FRO A;  4C0D C;  1H3Z A;  3M58 A;  4O6J A;  5CCA A;  3A8L B;  1HXD A;  4F17 A;  2VB6 A;  3BLH B;  3OMG A;  1Q7Y U;  4M78 A;  4CFU B;  2HAX A;  4UN0 A;  2WSF E;  1WI7 A;  1YJW A;  2WFY B;  2QI2 A;  4C8Q G;  2RD1 A;  3BHU B;  4KT0 E;  1FMK A;  1SSF A;  3LWI A;  3E1S A;  1RAC B;  2LRQ A;  1E9H B;  5ICP B;  1WJR A;  3QPH A;  1RAE B;  2RO0 A;  1K73 C;  2CUD A;  2DD5 A;  4IUV A;  3JCM P;  2M0O A;  1B07 A;  1YWP A;  1PWT A;  1GUX A;  1WQW A;  2M9U A;  2QGG A;  3CPW A;  2O4X B;  3PMT A;  3NTH A;  2LT4 A;  4CRI A;  1OIY B;  2C0I A;  2BKD N;  2W9Z A;  2I0N A;  3NFC A;  3B57 A;  1J3T A;  1VQN T;  2IVW A;  1S72 Q;  1K8A C;  1WHK A;  4PLI A;  4YTL A;  4F14 A;  1LJO A;  3CXC A;  2IW9 B;  1X27 A;  1X6G A;  3CMA T;  5HK0 A;  2D1X A;  3CC7 Q;  2R58 A;  3LW5 E;  3G33 B;  1M1K C;  2IW8 B;  5FU7 B;  1AZE A;  3M9Q A;  2E5Q A;  1VQK T;  4XTY A;  1OKW B;  3G6E T;  4QQD A;  4BCI B;  2V8J A;  4ZN1 A;  3OYI A;  3OBY A;  1YJN T;  5LJ3 g;  2J7I A;  4M7D F;  4JUV A;  5CR2 A;  4BE1 A;  1Q7Y C;  3EFO B;  2DTO A;  2X4J A;  4JLG A;  3R6O A;  2X35 A;  1OX8 A;  4L59 A;  3D7S B;  1JST B;  2VUB A;  4F6W B;  2PNI A;  2EJ9 A;  1GXI E;  4ORZ A;  4JDS A;  3TSW A;  2QG9 B;  4HCZ A;  1X2K A;  2LTO A;  4IMY B;  4XTZ A;  4OVA A;  2OI3 A;  3M5A A;  3G1J A;  5KE2 A;  3E9F A;  1YIJ A;  3CCR A;  2WIH B;  5FWB A;  2CZ7 B;  3RR6 A;  2DO3 A;  4FSX A;  1H28 B;  1N8R R;  1RAD B;  3JB9 G;  3HFN A;  3KFV A;  4KGV B;  1MMA A;  1K9M R;  2KXC A;  2L3Q A;  4LUD A;  4YC3 B;  2JT4 A;  5KYU B;  4GY5 A;  1Y7X A;  1BU2 A;  4Y72 B;  2JW4 A;  1H64 1;  3GPL A;  2Y4Y A;  4AMC A;  4MFE A;  2OAW A;  4ESR A;  1KK7 A;  2HKQ B;  2P84 A;  4E2F B;  2C5O B;  2X4X A;  2PVO B;  3CCQ Q;  4XU3 A;  3ZL7 C;  1ZSZ C;  4EOJ B;  3R6N A;  1CKA A;  1G2B A;  3M0P A;  1FIN B;  5GMK i;  2CSQ A;  4ME7 A;  8AT1 B;  5IHK A;  3OYL A;  4LE9 A;  2M1H A;  5A2Q E;  1GCQ C;  3A1P A;  2PHG A;  3JRZ A;  2KRO A;  2D8J A;  2ECZ A;  1RI0 A;  1BI2 A;  2F2W A;  1Q95 G;  1WYX A;  2CZ6 B;  4Z8A A;  2LQN A;  3HPW A;  2KQW A;  5A0L A;  2WMA B;  4FSS A;  5FGK B;  4LDV A;  2KAF A;  1M1F A;  4HNU A;  2HL5 C;  3PO3 S;  1QMC A;  5HK3 A;  1NBE B;  4BUG A;  3TSZ A;  4IUQ A;  3OW2 S;  1PHT A;  4GLK A;  4OP0 A;  2A28 A;  1W4S A;  3KXT A;  3BLQ B;  2O9S A;  2CZ0 B;  3FIF A;  3HFO A;  2RH2 A;  4JZ4 A;  4E7L A;  1SSH A;  2XU8 A;  3CCE Q;  1OI1 A;  5CO7 A;  2JS2 A;  1NYF A;  4EON B;  3G4S A;  3QXE B;  3EFR A;  4PL6 A;  1YIJ Q;  3CCR Q;  2EAY A;  4M77 C;  3ZFJ A;  4OGE A;  4NST B;  1YCY A;  1BI3 A;  2VXE A;  3OW2 P;  1U5S A;  5HCK A;  4Z02 A;  4BCM D;  5CKH A;  4OMM A;  2EKO A;  4M75 C;  1JJ2 S;  1YJ9 A;  2LCS A;  2IG0 A;  1RLQ C;  2X9H A;  3JAM E;  1IGU A;  3FEO A;  1ACM B;  2IIM A;  2UZL B;  2YLB A;  2MWO A;  1S72 T;  4PJO G;  2QF7 A;  2HCK A;  3NGP A;  1JOW A;  1Q82 R;  1C6V X;  4M75 D;  4PJJ A;  2K3Y A;  3M55 A;  1OKV B;  2O2O A;  3CC7 T;  2V22 B;  1QLY A;  4RMO A;  5C0M A;  1YN8 A;  1ZLM A;  5D6X A;  3AHU A;  3QG1 A;  1I1J A;  3MEW A;  1PC0 A;  2KR3 A;  1IO6 A;  5GAO q;  3GLX A;  1VQ7 A;  4FYV B;  2CRE A;  3HRU A;  1MHN A;  4N4I A;  5I2M A;  2FZC B;  3TRE A;  1YHQ Q;  1UHF A;  1TFB A;  2D0Q B;  4R56 A;  3V7S A;  4F7U G;  3EGD A;  4BCJ B;  2GGR A;  1VQO A;  4JJN K;  3VRZ A;  2CP7 A;  4BCQ B;  1NZ9 A;  4M78 F;  2YRD A;  4Y91 A;  4F7J B;  4J8O A;  3A8O B;  4D6W A;  4DOW A;  1G3W A;  5GAN 4;  5HBH B;  4I3Z B;  3G4S Q;  4QKU A;  1YIT A;  4NL3 A;  1VYW B;  1YNZ A;  4L6V 5;  2W2H A;  2W99 A;  4LN2 A;  3VU3 C;  3HB9 A;  4J6X A;  5GAN 5;  3OYN A;  4LXC A;  4CFU D;  2C5X B;  1U8R A;  4C8Q E;  1ABQ A;  1ARK A;  1VQ6 A;  2NLU A;  3DDQ B;  1TU0 B;  3HL8 A;  4ROE A;  1K0X A;  1LNX A;  3OYC A;  4PJL A;  3QHW B;  4HNT A;  1PKT A;  4M78 B;  3DTO A;  1YJ9 Q;  2JTE A;  4ATO A;  3REB B;  1KC8 R;  4QVD A;  4OGC A;  3JCM h;  3DLM A;  1Z9Z A;  1SKU B;  2OTJ A;  4OMO A;  1VQP Q;  2YHT A;  3CCQ T;  1KD1 U;  4BCO B;  2DD5 B;  1AWX A;  5GAN j;  4N0A A;  5FU7 C;  3MIA B;  2LX9 A;  3EG2 A;  1V76 A;  2PZ1 A;  3I55 Q;  1GUX B;  4BCP B;  3TU4 K;  1O75 A;  3VS6 A;  1JEG A;  1M9S A;  2RI5 A;  3QO3 A;  3LX7 A;  4J9D A;  1VYU A;  5HQ0 B;  3NPF A;  3L2W A;  4JRQ A;  4J7F A;  1OPL A;  1NYG A;  2L3R A;  1O9K B;  3EGX A;  3MEV A;  1M5Q 1;  3KHI A;  2DD4 A;  4E7Z A;  4PNO A;  4HVU A;  1WXU A;  2MWP A;  3CC2 A;  1QCO A;  4J9G A;  1HSQ A;  1VQO Q;  1TSF A;  2FL7 A;  3RES A;  3QYE A;  1RL2 A;  1H4L D;  2LW4 A;  2KK4 A;  1M8V A;  8ATC B;  2LNV A;  5KYX B;  3PNW C;  3TVT A;  4FT2 A;  2VKN A;  2YRV A;  4UC4 A;  3C12 A;  5GAM e;  1OV3 A;  3PIO A;  5GAM d;  3OYE A;  1X2Q A;  4IUT A;  4YOO A;  4EDU A;  3L2Z A;  2F5K A;  3UPU A;  1QMZ B;  3WVE B;  4ELL A;  3M57 A;  2QQ9 A;  4KH1 B;  3DOG B;  2L2P A;  3CCR T;  4AT1 B;  5GAO l;  2JUF A;  2BS3 A;  3A5Z B;  3AT1 B;  3SHW A;  2W9F A;  3K7A M;  2QA4 A;  2K79 A;  1K0S A;  3X24 B;  3BDL A;  1UHC A;  2RPN A;  3DJB A;  2LJ1 A;  2RNA A;  3QYH B;  1RAG B;  3MKD A;  4C8Q D;  2BS2 A;  2H3E B;  4J9C A;  2RQT A;  2ZAE A;  1SHG A;  1PSE A;  1KD1 C;  3CCV A;  2KVQ G;  2ZCF B;  1MMG A;  1KSW A;  4RTU A;  2KMT A;  1MMN A;  4C8Q A;  2VAS A;  2CGH A;  3H41 A;  2PK9 B;  5GAO p;  3JB9 H;  2ZPH B;  4FYY B;  4MZP A;  2UUE B;  4FIB A;  2G77 A;  3G7Z A;  3CCJ Q;  5GAN g;  3UWN A;  2KT8 A;  4MDW A;  1VQ4 A;  4BY1 X;  4LDU A;  4FYW B;  5LJ5 e;  1ZP2 A;  4A53 A;  2F2X A;  5LJ5 d;  2EFI A;  5HBE B;  4Y92 A;  4J9F A;  1YHQ T;  1M8M A;  5GMK l;  2E6Z A;  1KQS P;  3VYH B;  3CC2 Q;  2E5K A;  3GIB A;  4FM4 B;  1UJ0 A;  1N27 A;  5KYW A;  2KXD A;  2LZ6 B;  3CBP A;  2BE9 B;  4C92 G;  1H1S B;  2EUF A;  5GAO m;  1NJI C;  4O5V A;  5LL6 S;  3BG3 A;  2EYZ A;  3G4S T;  1VUB A;  3L2V A;  2AKL A;  3PVQ A;  2F1L A;  3M0U A;  3QWY A;  1CKB A;  2XDP A;  1IB8 A;  2GFU A;  2MYS A;  5GMK h;  1OL2 B;  3RIR A;  1AWO A;  1YJ9 T;  1VYV A;  2DYI A;  3TNW B;  2WAC A;  4C5H A;  4EMK C;  1UUE A;  2YXY A;  3EG3 A;  3LWH A;  4M7A G;  3QYB A;  1AWJ A;  4RCC A;  4C0F A;  1OEB A;  2DL7 A;  2RF0 A;  3GP8 A;  1VQP T;  2DLP A;  2EQI A;  1F5Q B;  3VS4 A;  2DVE A;  3BY7 A;  4PKC C;  4RUG A;  2BE7 D;  3I55 T;  2EGE A;  3MP1 A;  2EQJ A;  2HZY A;  4XAX B;  1E6G A;  2KEA A;  1WLP B;  3LYI A;  4PJO E;  2COZ A;  2XKO C;  5IHI A;  2CDT A;  1VQ4 Q;  4BCM B;  2QXF A;  5GMK m;  4M75 F;  3SDZ A;  4KUD K;  2KDS A;  1TOV A;  1W6X A;  4C5I A;  2W10 A;  2FPD A;  4EOO B;  2JGZ B;  2C06 A;  2FYK A;  2CCI B;  1BBZ A;  2PK2 A;  1RAH B;  2YWW A;  5HKC A;  3H0I A;  3KUF A;  3UAT A;  1VQO T;  2HQX A;  1VOM A;  5I22 A;  4F7U E;  3OY9 A;  2HSP A;  3JCM V;  3EOC B;  2C5V B;  1YWO A;  1ABO A;  1E7P A;  1H1R B;  4X34 A;  5ACB A;  2R57 A;  4M78 C;  3CC4 A;  3UT1 A;  4R55 A;  2UZE B;  3L42 A;  3J81 E;  5LMK B;  2DBK A;  1N8R U;  3L1A A;  4PJM A;  4HLQ A;  1K9M U;  1VQ8 Q;  2BIV A;  5IHY A;  1H92 A;  2VXF A;  2HKN A;  1Q81 U;  2HEQ A;  1D3U B;  1H25 B;  4B6M A;  4XTV A;  3LGF A;  1NG2 A;  2E64 A;  3MHX A;  3M53 A;  1AD5 A;  3TCJ A;  2CS7 A;  3HKS A;  4N4G A;  1D3B B;  3RKW A;  2PJQ A;  1G5V A;  3CCJ T;  3OYB A;  3WVD B;  3OA6 A;  1VIN A;  1QVG S;  4E6R A;  1AHJ B;  4EMH A;  1IZ6 A;  4OB2 B;  2EGA A;  3L2Q A;  2GQV A;  2XD0 A;  5IT9 E;  3O5Z A;  4BDY A;  4LDW A;  2FPE A;  2VYT A;  1H27 B;  2C5N B;  4NL2 A;  2MMP A;  2AK5 A;  3CC2 T;  2GF7 A;  4PJO A;  3VS5 A;  1Y71 A;  3Q1J A;  2EJG A;  3LH0 A;  1I07 A;  2J06 A;  4J6W A;  1ZUU A;  4M7D G;  1NPP A;  2DM1 A;  2W0Z A;  1QVG P;  3EGX B;  3PMI A;  1HJD A;  2DD4 B;  2K4Y A;  2VVK A;  3IQL A;  1VQL Q;  4EPC A;  4BCK B;  2OAU A;  1N8R C;  1IHW A;  3T9N A;  3ASK A;  1K9M C;  3PT9 A;  1YI2 A;  4F7U A;  3TEE A;  3UA7 A;  3BFM A;  2K57 A;  3EGU A;  4RTV A;  1D0Z A;  5LJ3 h;  1MUZ A;  1JKW A;  2FZG B;  1T3L A;  1MNE A;  2RHZ A;  3DDP B;  4EOK B;  2BZX A;  3VS7 A;  4FU6 A;  1AWW A;  1KHC A;  4Z88 A;  1AD6 A;  2BZ8 A;  2E41 A;  2DNU A;  1WHH A;  4RTW A;  3CBO A;  4Y28 E;  1BI0 A;  4AKI A;  4Q5W A;  1PKD B;  4AFZ C;  3OS0 A;  3EHQ A;  4CI0 C;  1WNL A;  4CFM B;  4JZ3 A;  1Q82 U;  2K2V A;  1LCK A;  2EGC A;  4D8D A;  3OQ5 A;  4JRP A;  1Q86 R;  5IN1 A;  1YJW Q;  5EFQ B;  1VQ4 T;  5LJ3 f;  4C8Q B;  5CAI A;  4II5 B;  1JU5 C;  1NEG A;  5I2S A;  4MIM A;  1DJ7 B;  3MEA A;  4ELJ A;  2G3R A;  2LC4 A;  2RHI A;  3C4S A;  2RI3 A;  1Q81 R;  2QQA A;  4DBR A;  1UGV A;  2CJM B;  5EC7 A;  4QVZ A;  2M0Y A;  2ABL A;  1VQ5 A;  3LQ5 B;  4C92 E;  3GOX A;  4OMP A;  4X9C A;  1ZA2 B;  3BDU A;  2ZPI B;  4ZGD B;  4OB3 B;  1S1N A;  1WHG A;  4M77 E;  2L8D A;  5HY6 A;  1RAB B;  5KYW B;  1C9B A;  2JS0 A;  2DXT A;  4FW2 A;  2RHU A;  1TWB A;  3VS1 A;  4A63 B;  4FT4 A;  2X51 A;  1VQ8 T;  3THK A;  3OW2 A;  1KC8 U;  5DM7 R;  3N5B B;  2DFU A;  2FG0 A;  2V1R A;  2QDY B;  1D0X A;  3SFM A;  3SD4 A;  4J83 A;  3G71 A;  2K6D A;  5HNB B;  4EOP B;  4PK4 A;  4M7A E;  2O31 A;  3QWL A;  1KQ2 A;  1PCX A;  1Q82 C;  2GTO A;  5C6S A;  1H1Q B;  2Y4X A;  1XTD A;  4C5G A;  2PVD B;  1MV3 A;  1QVF S;  1UGS B;  1Z9Q A;  1HYO A;  3VKH A;  1NPR A;  3FC3 A;  1PSF A;  2RB6 A;  2E10 A;  2CZ1 B;  2YUO A;  2E12 A;  4TTH A;  5IAY A;  4ZN3 A;  2AKK A;  1KQ1 A;  2HBW A;  4DBQ A;  2IPO B;  4NS5 A;  3RKY A;  3QZ5 B;  1BIB A;  1LVK A;  4KRT A;  2AHJ B;  1NEB A;  1XOV A;  1URC B;  1KG1 A;  5GAM j;  4F6U B;  4CRL B;  1WFW A;  2KY9 A;  4FL6 A;  1Y57 A;  2P4R A;  2COW A;  4E7I A;  4QQ6 A;  1QVF P;  2MK5 A;  3I5S A;  2L3P A;  3J80 E;  2E4H A;  1WHM A;  1UJY A;  4AFQ C;  3HZJ A;  4GBQ A;  2J6K A;  4L5G A;  1IRX A;  2HBP A;  4EMK B;  1UG1 A;  3QSU A;  2F69 A;  2LQW A;  4KGZ B;  1VQL T;  4CFN B;  3C94 A;  1GY3 B;  4C92 D;  1FMV A;  2DL3 A;  4EOI B;  1N5Z A;  3CCE A;  1OUL A;  2DRK A;  1JJ2 P;  3VYG A;  1KC8 C;  4EOQ B;  2GBQ A;  3OMC A;  2W96 A;  4C92 A;  5CQX A;  3GNG A;  1ZBJ A;  4YOZ A;  5J3B A;  1D09 B;  2EBP A;  5CKD A;  4QW2 A;  1TG0 A;  1GFD A;  2GNC A;  1Y96 A;  4J9E A;  2FVU A;  2PUK B;  2HSE B;  1TXQ A;  1X6O A;  2O9V A;  3PE0 A;  4F16 A;  5LJ5 j;  1GBQ A;  2AT1 B;  2KRS A;  5CEI B;  2PVG B;  3VKG A;  1ZHI A;  4E47 A;  1VQM A;  4N0A C;  4NOY A;  1D0Y A;  4JS4 A;  1YJW T;  2DXB A;  1AIS B;  1GFC A;  3BW1 A;  1H1P B;  4PFP A;  2FRW A;  4M7A A;  4F70 B;  1OPK A;  4N4H A;  2DX1 A;  3TW7 A;  5GAN 7;  1O9S A;  3CCU A;  3OBW A;  3EG9 A;  1I81 A;  2DVJ A;  4R0K A;  3S3O A;  3HHT B;  3EHR A;  5DLO A;  4KGX B;  2P0P A;  1OL1 B;  1A0N B;  3URG A;  2R7G A;  5GAM g;  1G83 A;  2E3H A;  2AIR B;  5IXB A;  4M7D E;  1FKM A;  2I40 B;  2G9X B;  5DQW A;  3EH2 A;  4PJO B;  2I53 A;  2DZ9 A;  2MF2 A; 
#chains in the Genus database with same CATH homology
 1YHQ A;  2DD5 A;  4IUV A;  4QVC A;  5GMK h;  3JCM P;  5GAM f;  2CKK A;  3RIR A;  5FRN A;  1Y07 A;  2M0O A;  2M9U A;  1WQW A;  2DIQ A;  2QQR A;  3C95 A;  3EAE A;  4XTX A;  1YJ9 T;  2D9T A;  3CPW A;  2RK1 A;  2O4X B;  3PMT A;  3NTH A;  2LT4 A;  3FDR A;  2WAC A;  3LLR A;  4C5H A;  4CRI A;  1JJ2 A;  4EMK C;  2BKD N;  2DTH A;  3LWH A;  4M7A G;  3QYB A;  3NFC A;  4RCC A;  4C0F A;  5L8R E;  3GP8 A;  1VQP T;  3EFS A;  4C92 C;  4ZGJ B;  5M9O A;  1VQN T;  2IVW A;  4ZGE B;  1K8A C;  4F7U B;  2DVE A;  3BY7 A;  4PKC C;  4PLI A;  3CBM A;  3MP8 A;  4YTL A;  1H3Z A;  1LJO A;  5FLX E;  2QDJ A;  2QQS A;  1B34 A;  3FJP A;  3I55 T;  1QP2 A;  3MP1 A;  3CXC A;  2EQJ A;  4XAX B;  3J7A F;  4XTW A;  2D6F A;  1VQ9 T;  3LYI A;  4C8Q C;  3CMA T;  5HK0 A;  4PJO E;  3OYG A;  4A4G A;  2R58 A;  3LW5 E;  2PUO B;  3RKX A;  4BI8 B;  1M1K C;  2XKO C;  2M16 A;  4XQ3 A;  4M78 G;  5FU7 B;  2HNI A;  3E19 A;  2KMG A;  1ZQ1 A;  2PQW A;  2JTF A;  2QXF A;  3M9Q A;  2E5Q A;  5CKE A;  4DQ2 A;  5GMK m;  1QP3 A;  5LJ5 g;  1VQK T;  4M75 F;  4ELZ C;  3SDZ A;  1YIJ T;  4XTY A;  1YBY A;  3CC4 T;  4KUD K;  1P92 A;  2KDS A;  3G6E T;  4QQD A;  3L2U A;  1BI1 A;  4A54 A;  2V8J A;  2JZ2 A;  4C5I A;  4ZN1 A;  2DXC A;  3OBY A;  3OYI A;  4WF2 A;  4XTU A;  1YJN T;  1JB0 E;  5LJ3 g;  2C06 A;  2FYK A;  4M77 D;  3V7C A;  4M7D F;  4JUV A;  4M7A C;  5CR2 A;  4BE1 A;  1Q7Y C;  1VQP A;  2DJZ A;  3KUF A;  5HKC A;  3MET A;  1VQN A;  3SWN B;  1VQO T;  2DTO A;  2HQX A;  2X4J A;  3JSC A;  4JLG A;  4JRI A;  2LQ8 A;  2X35 A;  3R6O A;  4L59 A;  3SB2 A;  3JCM e;  3X26 B;  2VUB A;  4F7U E;  3JCM d;  3QYG B;  3OY9 A;  3I55 A;  1XNI A;  3KBG A;  2EJ9 A;  3RMQ A;  5LJ5 f;  1KQS A;  1GXI E;  3QJY A;  3JCM V;  2PU9 B;  4M77 A;  4JDS A;  5CVI A;  1E7P A;  4HCZ A;  2LTO A;  3UDC A;  3OS2 A;  4XTZ A;  3RER A;  2A7Y A;  4OB0 B;  3M5A A;  3QHS A;  4OVA A;  4X34 A;  4BI4 A;  2X4W A;  1U1S A;  2QTX A;  2V8I A;  5KE2 A;  5GAN h;  4JS5 A;  2R57 A;  1VQK A;  3E9F A;  4M78 C;  1YIJ A;  3CC4 A;  3UT1 A;  4R55 A;  3CCR A;  4XU2 A;  4M75 A;  2RA2 A;  3L42 A;  3J81 E;  2CZ7 B;  4M7A D;  2XDD A;  4PLL A;  2DO3 A;  4FSX A;  5A0D A;  4HT9 A;  2YLC A;  2VGM A;  4JX6 A;  3JB9 G;  3CD6 A;  3HFN A;  3MEU A;  3CCL A;  3OYJ A;  2WSC E;  2K3X A;  4II1 A;  1N8R U;  4JX5 A;  1WJQ A;  2DK3 A;  2O01 E;  4NC6 A;  3L1A A;  2ZPB B;  3H4C A;  1U1T A;  3A8H B;  4HLQ A;  2ZZD B;  1K9M U;  3ZEH A;  2L5Q A;  2BIV A;  4M7D A;  4GY5 A;  1Y7X A;  5FU6 B;  2ZPG B;  3DB4 A;  1H64 1;  2VXF A;  4J5Y A;  3GPL A;  2KSS A;  2Y4Y A;  1Q81 U;  2LDM A;  3CME A;  4MFE A;  4PJO F;  4QSH A;  4DA4 A;  2CYZ B;  5GAM h;  2X4X A;  4XTV A;  4BE2 A;  2PVO B;  4BBR M;  3LGF A;  4XU3 A;  3OYK A;  2E64 A;  2RHX A;  3MHX A;  5GAN f;  2Y90 A;  3M53 A;  2HD0 A;  5GMK i;  2OTL A;  3TCJ A;  1UEB A;  2CS7 A;  1Q82 C;  4ME7 A;  3A8G B;  3OYL A;  1G3S A;  4J7I A;  2M1H A;  3HKS A;  5A2Q E;  4N4G A;  1D3B B;  4BY6 B;  3RKW A;  1UGR B;  3JRZ A;  3QJ6 A;  4EMG A;  4BE0 A;  1G5V A;  4BBS M;  3CCJ T;  3OYB A;  3M59 A;  3WVD B;  3OA6 A;  1RI0 A;  4MDX A;  1BI2 A;  4M77 G;  1QVG S;  2CZ6 B;  4IKF A;  5CKB A;  1AHJ B;  2DTI A;  1G3Y A;  3HPW A;  5EG2 A;  4EMH A;  1IZ6 A;  4OB2 B;  3L2Q A;  2KQW A;  4AKH A;  2ZPF B;  1D3B A;  4OMF B;  5A0L A;  2GQV A;  2XD0 A;  3VUZ A;  5IT9 E;  2DKG A;  1I8F A;  4LDV A;  2KAF A;  2EQK A;  4F7U F;  1M1F A;  4HNU A;  4BDY A;  1YI2 T;  4LDW A;  3CCS T;  4M75 G;  1N9R A;  2VYT A;  5HK3 A;  4BUG A;  3DLL A;  4NL2 A;  2MMP A;  4C0G A;  2GFA A;  4IUQ A;  2DZC A;  2GF7 A;  3OW2 S;  3CC2 T;  4PJO A;  4HA8 A;  1WPY A;  4GLK A;  1HK9 A;  1Y71 A;  2JVV A;  3ER0 A;  1W4S A;  3Q1J A;  4OP0 A;  3JCM g;  3KXT A;  2H3J A;  2CZ0 B;  3FIF A;  2EJG A;  3HFO A;  2LCL A;  3LH0 A;  3S3M A;  2RH2 A;  3CCM A;  3JCM c;  1FX7 A;  4HCB A;  4E7L A;  4OB1 B;  2XHC A;  4J6W A;  4BD3 A;  4C0D B;  4RKU E;  3JB9 D;  1NPP A;  2EWN A;  2XU8 A;  4M7D G;  1WGS A;  2QEX A;  2QQ8 A;  1OI1 A;  3NTK A;  5CO7 A;  2O4X A;  1KHI A;  3PMI A;  2LQK A;  3VUB A;  3OYF A;  4VUB A;  2DD4 B;  3CCJ A;  3G4S A;  3QXE B;  3EFR A;  2K4Y A;  1W2B S;  2WJ9 A;  4BDZ A;  2EIF A;  4PL6 A;  5A0G A;  4E7K A;  4EPC A;  5CKF A;  4V2S A;  2EAY A;  4MZM A;  4M78 E;  4M77 C;  1X01 A;  2OAU A;  3ZFJ A;  2EYQ A;  3P8B B;  5LJ5 h;  1N8R C;  4OGE A;  4KBM B;  3S6W A;  3T9N A;  3ASK A;  1YCY A;  3JCM f;  5I21 A;  1K9M C;  1BI3 A;  1G3T A;  2VXE A;  3PT9 A;  5D6Y A;  3OYY A;  1YI2 A;  3CCE T;  4F7U A;  4Z02 A;  3TEE A;  4IUR A;  3BFM A;  3JB9 J;  2K57 A;  5CKH A;  3OSV A;  2DPP B;  2RHY A;  2RM4 A;  2EKO A;  4M75 C;  1JJ2 S;  1YJ9 A;  4B9W A;  5LJ3 h;  2IG0 A;  3JAM E;  1VQ7 T;  2P0Q A;  3PGG A;  2MI6 A;  2RHZ A;  2DAQ A;  1OZ2 A;  3M54 A;  3FEO A;  1BKB A;  1I4K 1;  4FU6 A;  1KHC A;  3OS5 A;  2E41 A;  3HP9 A;  2VV5 A;  2YLB A;  3I56 T;  4M7D C;  2MWO A;  4Y28 E;  3CBO A;  5AYF A;  3DKM A;  5KE3 A;  1S72 T;  1BI0 A;  3TW6 A;  4AKI A;  4Q5W A;  4PJO G;  2QF7 A;  3OS0 A;  2RJD A;  3L2R A;  4CI0 C;  1NJI U;  4M75 D;  1VQ9 A;  1WNL A;  3CMA A;  2K3Y A;  3X28 B;  2R5M A;  3M55 A;  4C92 B;  1Q82 U;  3FB9 A;  3JB9 I;  3OYA A;  2K2V A;  3HRS A;  1VQ5 T;  3CC7 T;  2E1H A;  4RMO A;  1ZBX A;  3F70 A;  3SWN A;  3OQ5 A;  4JRP A;  5C0M A;  5GMK j;  1YIT T;  5IN1 A;  4KUI A;  5D6X A;  2RJF A;  3QG1 A;  1VQ4 T;  3BG9 A;  1M90 U;  3AHU A;  3MEW A;  3JCM b;  5DY9 A;  1Q86 U;  5LJ3 f;  3HRT A;  2EJF A;  4IUP A;  4BAC A;  4RG2 A;  5GAO q;  3GLX A;  4C8Q B;  5CAI A;  1VQ7 A;  4M7D D;  3HRU A;  1MHN A;  4N4I A;  5I2M A;  5I2S A;  3G6E A;  2VGN A;  4MIM A;  1DJ7 B;  3LGL A;  3MEA A;  3TRE A;  1VQ6 T;  5J26 A;  3CCU T;  5GMK e;  1YJN A;  4ELJ A;  2G3R A;  5CK9 A;  2LC4 A;  2D0Q B;  4R56 A;  2WSE E;  3V7S A;  2RHI A;  4F7U G;  3C4S A;  2RI3 A;  2FHD A;  1KQS S;  2QQA A;  1M4Z A;  1VQO A;  1S72 A;  3P8D A;  4JJN K;  4BB7 A;  2E70 A;  4MMK A;  2DXB B;  1NZ9 A;  4M78 F;  4A4K A;  4QVZ A;  4Y91 A;  4J8O A;  2E65 A;  3V8L A;  3FRN A;  2JNG A;  3G71 T;  3A8O B;  4PJO C;  4P5N A;  4M7A B;  3RUX A;  1QLB A;  4D6W A;  4DOW A;  2OTJ T;  1G3W A;  5GAN 4;  1K8A U;  2ZZD A;  1VQ5 A;  3VJP A;  1QVP A;  4C92 E;  1FXX A;  3E9G A;  5D6W A;  4JRK A;  4RCB A;  1YIT A;  4NL3 A;  3JCM J;  3GOX A;  3ME9 A;  4X9C A;  4L6V 5;  3BDU A;  2ZPI B;  3QZ9 B;  4ZGD B;  4OB3 B;  3HB9 A;  2DIG A;  4J6X A;  3V8J A;  3VU3 C;  5GAN 5;  3OYN A;  4E7J A;  3H6Z A;  4M77 E;  1QVG A;  1U8R A;  2L8D A;  5HY6 A;  2QQB A;  4C8Q E;  2LT1 A;  2RK2 A;  5DLQ E;  2KR6 A;  5KCH A;  1X75 C;  1VQ6 A;  2NLU A;  2BS4 A;  2X4Y A;  3HL8 A;  4A4E A;  3M4G A;  4E7H A;  1LNX A;  3OYC A;  2DXT A;  4HNT A;  4M78 B;  1BYM A;  2RHU A;  5GAO n;  2MAM A;  4PJO D;  4ATO A;  4QQG A;  2EQU A;  3VKI A;  4FT4 A;  4QVD A;  3DL1 A;  1MGQ A;  1R8O B;  4OGC A;  1VQ8 T;  4AKG A;  3JCM X;  3OW2 A;  1KC8 U;  3JCM h;  5DM7 R;  3DLM A;  3O8V A;  3N5B B;  1UGQ B;  2QDY B;  3SFM A;  3HO8 A;  3SD4 A;  4KUL A;  4J83 A;  5GAN 2;  3G71 A;  2OTJ A;  3X25 B;  4XU0 A;  2YHT A;  3CCQ T;  4M7A E;  4C0Z A;  2ZGW A;  1KD1 U;  3PTA A;  4BI3 A;  3QWL A;  4ZTJ A;  1KQ2 A;  5GAO r;  2DD5 B;  2GCX A;  3V8K A;  5C6S A;  4N0A A;  5FU7 C;  5GAN j;  2LX9 A;  4ZTF A;  2Y4X A;  1XTD A;  4C5G A;  2PVD B;  1TH7 A;  1M90 C;  3TU4 K;  1W2B A;  2K5I A;  4DOV A;  1O75 A;  1I5L A;  5EJC A;  1Q86 C;  3M4Y A;  1UGS B;  4HL4 A;  1QVF S;  3VKH A;  1NPR A;  3FC3 A;  4X9D A;  1PSF A;  2XK0 A;  1M9S A;  2RI5 A;  2RB6 A;  3QO3 A;  1EIF A;  2E10 A;  2CZ1 B;  3LX7 A;  5GAN e;  2K5L A;  2E12 A;  3X20 B;  2XI9 A;  3CPF A;  5GAN d;  1JRI A;  4JRQ A;  2R5A A;  3L2W A;  5IAY A;  4ZN3 A;  1M1G A;  4J7F A;  3HSB A;  3GNF B;  1VQ8 A;  2L3R A;  3GF5 A;  2QA4 T;  1KQ1 A;  4C5E A;  3JCM W;  3SWN C;  3MEV A;  4NS5 A;  1M5Q 1;  3RKY A;  3QZ5 B;  1LOJ A;  2BUD A;  2DD4 A;  3KHI A;  1BIB A;  2XIC A;  3PFS A;  4PNO A;  1B34 B;  2AHJ B;  3CPW S;  1XOV A;  3CCS A;  4LD9 K;  2MWP A;  1KG1 A;  5GAM j;  1Q81 C;  4IUU A;  3RMS A;  3CC2 A;  2K5F A;  2XID A;  3FLG A;  4C92 F;  3CCQ A;  2KY9 A;  4FL6 A;  4TVR A;  2FL7 A;  3RES A;  3QYE A;  1RL2 A;  4E7I A;  3P8H A;  4QQ6 A;  2KK4 A;  1M8V A;  3CCV T;  2MF2 A;  5GAN 8;  3JCM Q;  2LNV A;  3PNW C;  1VIE A;  1N6A A;  4LOC A;  2DEQ A;  4FT2 A;  2A3L A;  2YRV A;  4M77 F;  3J80 E;  4UC4 A;  3C12 A;  4C8Q F;  5GAM e;  3VV0 A;  3HZJ A;  3PIP A;  3PIO A;  5GAM d;  1VIF A;  3OYE A;  4IUT A;  4L5G A;  2HBP A;  2DXC B;  3MP6 A;  4EDU A;  3OYD A;  3CXC S;  3L2Z A;  3VYG B;  2F5K A;  4EMK B;  3OB9 A;  2F69 A;  3WVE B;  3UPU A;  3QSU A;  3M57 A;  3QBY A;  2QQ9 A;  1VQL T;  2JOY A;  3C94 A;  3CCR T;  5GAO l;  2JUF A;  2BS3 A;  2HQE A;  3A5Z B;  4OF1 A;  5FRM A;  5GAN 6;  4C92 D;  2QA4 A;  1NE8 A;  5FU6 C;  4AI6 A;  3CEY A;  1VQM T;  3MCA B;  3X24 B;  3CCE A;  3BDL A;  2XDB A;  3CD6 T;  3CCL T;  4MFD A;  2JN0 A;  3VYG A;  4EMK A;  5CIU A;  1KC8 C;  4MML A;  3BG5 A;  3QYH B;  2F5T X;  4XU1 A;  4JLI A;  4M77 B;  4M7A F;  2RJC A;  1Y96 B;  3OMC A;  4C8Q D;  2BS2 A;  3WXM B;  4ELY C;  3OYM A;  2P4T A;  1K73 U;  5J39 A;  4C92 A;  5CQX A;  3GNG A;  3MO8 A;  4Z6Y A;  1PSE A;  2DXU A;  4LDY A;  3S3N A;  1KD1 C;  3CCV A;  5J3B A;  2P0K A;  5CKD A;  3CME T;  1UB4 A;  2KVQ G;  4QW2 A;  4A4F A;  2ZCF B;  4M75 B;  2KMT A;  4LDX A;  1OZ3 A;  3OYH A;  4BY6 C;  1Y96 A;  2JTM A;  3I56 A;  4C8Q A;  3INZ A;  1WQ7 A;  2CGH A;  2XG8 D;  2B8A A;  5GAO p;  4LD6 A;  3JB9 H;  2FVU A;  2ZPH B;  2PUK B;  4MZP A;  2QFZ A;  1OYX A;  4HKE A;  1X6O A;  3M56 A;  2OTL T;  4A4H A;  4HT8 A;  1VQL A;  2V8K A;  3V7R A;  4HNV A;  2E6N A;  5LJ5 j;  3QII A;  3OS1 A;  4FIB A;  1V29 B;  1FWZ A;  4M7D B;  2PVG B;  2G77 A;  3HBL A;  3G7Z A;  3QUI A;  3VKG A;  4RG8 A;  3CC7 A;  1UGP B;  3A8M B;  1ZHI A;  5GAN g;  4E47 A;  1VQM A;  4N0A C;  4XK8 E;  4NOY A;  3UWN A;  4JS4 A;  1BIA A;  1YJW T;  2DXB A;  4MDW A;  1VQ4 A;  3BW1 A;  4M6V A;  5KCO A;  4LDU A;  1QW1 A;  5LJ3 j;  3DB3 A;  3NTI A;  5LJ5 e;  1XQH A;  2L89 A;  1M1K U;  1IRE B;  3H8Z A;  2VC8 A;  4A53 A;  4N4H A;  5GAN 7;  3TW7 A;  4M7A A;  5LJ5 d;  2EFI A;  2I2L A;  4J6Y A;  3OSS C;  1YHQ T;  1K73 C;  1O9S A;  3CCU A;  5GMK l;  2RI2 A;  2E6Z A;  2RJE A;  2EQM A;  3OBW A;  4M78 D;  5FRO A;  3VYH B;  1I81 A;  4C0D C;  3QKJ A;  3S3O A;  3GIB A;  4FM4 B;  2FB7 A;  3M58 A;  4O6J A;  5CCA A;  5LJ3 e;  4M75 E;  3A8L B;  1HXD A;  1N27 A;  3HHT B;  2LVM A;  5DLO A;  5LJ3 d;  3QDR B;  2P0P A;  5GAN 3;  2ZPE B;  3CCM T;  3URG A;  3CBP A;  3OMG A;  5GAM g;  2LCC A;  1N9S A;  4HCC A;  3ZBD A;  4MZT A;  4M78 A;  4C92 G;  1Q7Y U;  2QEX T;  4JX4 A;  2HAX A;  5GAO m;  1WJS A;  5CQY A;  1NJI C;  4O5V A;  5LL6 S;  1FKM A;  3BG3 A;  4B9X A;  4M7D E;  3G4S T;  5KH6 A;  1VUB A;  2WSF E;  3L2V A;  1QVF A;  1YJW A;  3JB9 F;  2QI2 A;  4C8Q G;  2RD1 A;  4PJO B;  4KT0 E;  3LWI A;  1SSF A;  3E1S A;  2LRQ A;  1WJR A;  2XDP A;  2RO0 A;  3QPH A;  2DZ9 A;  2GFU A;  1JBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...