4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
2WSFE 4ZGEB 2CZ7B 1DJ7B 2ZPBB 2PUKB 2CZ1B 2ZPGB 1JB0E 4RKUE 1UGPB 2ZPIB 3X28B 2CZ6B 3A8MB 3VYGA 4ZGJB 2PVDB 2ZCFB 2D0QB 4ZGDB 1V29B 2DXBB 2O01E 2DD4A 2WSEE 3LW5E 4OB0B 3QYGB 4OB1B 3VYGB 2ZZDA 2DXCB 1GXIE 1UGQB 2ZPHB 4KT0E 2ZPFB 5L8RE 1QP3A 2DD5A 2DD4B 3VYHB 3QYHB 3A8OB 3X24B 2QDYB 2PVOB 1PSFA 2ZPEB 1AHJB 2DPPB 2PU9B 2AHJB 2PVGB 2PUOB 3WVDB 3QZ9B 4OB3B 2ZZDB 4L6V5 3A8LB 3X20B 2WSCE 2CZ0B 3A8GB 3A8HB 3HHTB 4FM4B 3QXEB 2DXBA 4XK8E 1IREB 2DD5B 3X25B 3WVEB 4OB2B 2DXCA 3X26B 1QP2A 3QZ5B 1UGSB 2CYZB 1UGRB 4Y28E 1PSEA
chains in the Genus database with same CATH superfamily
2OTLA 2EYXA 3CPWA 1OL2B 2YUOA 2X4WA 1OPLA 2RF0A 5HBJB 1I8FA 4C92A 3CCMA 4M77D 1K73R 2LMJA 4CI0C 4F7LB 4FSSA 4DEYA 4F7UE 4A54A 4RTUA 3X28B 3OYYA 4F7JB 1MMGA 2JM8A 4RCBA 2JTMA 3E2UA 1VA7A 2L0AA 3CCLT 3UT1A 3I55T 2VASA 2D0QB 5C0MA 4BBRM 2B86A 2M1HA 2RQTA 3OMCA 4GY5A 4BCMD 1VQMA 3VS2A 1TU0B 3LW5E 3QYGB 2MWOA 1JXMA 4OMOA 1Q7YU 5FROA 1YJNT 1ZBJA 3DJBA 4PFOA 1EFNA 4JX4A 2EW3A 2DD5A 2KEAA 2AIRB 1X69A 2UZDB 1FWZA 2COWA 3CPWS 4EOLB 5IHKA 2K6DA 2RK2A 3L1AA 4OGRB 2RA2A 3BLHB 4M7AA 3H9NA 4M77G 2LT1A 2YUQA 1K73C 3I56A 2FO0A 4PFZA 1XNIA 1FMKA 4XTZA 1U06A 1VQLA 3OYLA 2XI9A 3TW7A 3QZ9B 2UZBB 3VS1A 3VKIA 1WQWA 5FRMA 1H3ZA 1KHCA 4WF2A 5IHIA 1KG1A 3A8LB 1W2BP 5IAYA 4M78F 3HRSA 2P0KA 3CC4A 3K7AM 4XK8E 1AWJA 1X6BA 4PJOE 1YJ9T 1VQ8A 3F5XB 3RMQA 3QBYA 2QQRA 1OOTA 1PM3A 1PHTA 1KHIA 2DTHA 1H1PB 3P8DA 1Y0MA 2D9TA 2VV5A 4A63B 2O2OA 1BKBA 2L8DA 3M53A 3JB9I 4ROEA 2J6OA 3GBQA 2PUKB 2QF7A 3VS3A 1SSHA 3AT1B 1U1TA 3G71Q 1YI2Q 1VQ6Q 3A1PA 2B8AA 3OYBA 1VQ5Q 3ZEHA 5GMKl 1YBYA 5KYXB 1S72A 4HXJA 1Y96B 3RGFB 4J9EA 3ZL7C 4FYXB 3TEEA 4C92C 5L23A 2F2XA 5FLXE 4BCJB 4BCND 2EAYA 2BS3A 1H24B 2PTKA 3NHNA 2LDMA 5CYIB 2VKNA 3CCQT 2DJQA 2HAXA 2EJ9A 2BPMB 4OB0B 2KI7A 1N8RR 1FVVB 5GAOm 3EFOA 2QGSA 4E47A 1OI9B 5CQXA 2K5FA 4ZN3A 4J8OA 1ZUUA 4EMKA 3M59A 1OZ2A 1M2VA 1ZX6A 2X1NB 2YWWA 3VYHB 2E6ZA 3NTKA 1ENWA 2ZPEB 2RHIA 4QVCA 2D8HA 1I4K1 1WGSA 1AOJA 2P0QA 4CFVB 1WXTA 1T0JA 4M75A 1YHQA 4IMYB 2A0FB 2QQBA 3BE3A 4PNOA 1M30A 4A4GA 4HNVA 1WIEA 1GY3B 3CCLQ 3IQLA 4KRTA 3I55Q 2HBPA 2YRVA 4M7AC 1ZBXA 3ASKA 1Y57A 4HNUA 1ARKA 2CGHA 2EJFA 4OMFB 1WXUA 1NE8A 4PLIA 4F04B 4YOZA 1RAFB 1BBZA 1GL5A 2DM1A 1UG1A 2DERA 4E7IA 1YJNQ 4ELYC 1N8RC 2QGFB 2P84A 3HBLA 5HKCA 3OW2P 2MYSA 2FHDA 2K2VA 2WEVB 4HCZA 1ZLMA 2B9RA 4QQ6A 4AG1C 4KUIA 4BCFB 3JSCA 5DQVA 3RMSA 2WIHB 1YP5A 1C6VX 2PQWA 2EYYA 2NYSA 5HNBB 1K9MR 2QAZA 1GFDA 2KRMA 4JPBW 4ZGJB 2OTJA 4BB7A 3BHVB 5GANd 1TSFA 1X75C 1TWBA 2FZCB 3MHXA 3CMAA 3CBPA 1KSWA 2DEQA 1KQ1A 2L3PA 2OAUA 3OYCA 2F2VA 3OQ5A 5D6YA 1ABOA 4Q5WA 2IW8B 1GUXB 2JMAA 4M7DD 1D0ZA 2F1LA 3EOCB 1C0MA 2DXCB 2EJGA 4IUUA 1YJ9Q 3KUFA 2LQWA 4C8QE 1LJOA 2CT4A 3G1JA 5CQYA 1K8AR 2YUNA 1X27A 3QYHB 4UC4A 3CC4T 5KYWA 1VQ8T 2O4XB 3LWIA 3GOXA 2RI2A 1RUWA 1ACMB 3QO3A 4IURA 1H27B 1OU9A 4EMKC 4HKEA 2X3WD 2PU9B 3D7SB 4BE1A 2FRWA 3LQ5B 1KJWA 1AWXA 5FU6C 1TFBA 4FSXA 3CMET 1MGQA 3M0TA 3O0GD 2RQRA 4A4EA 4C92G 4M75C 5FGKB 4RG8A 3X20B 2SRCA 3CCQQ 1MMNA 5GAOr 3VUZA 4M7DG 1VINA 2LTOA 5LJ3e 1UECA 1IREB 1N9SA 1JSUB 5FRNA 4IIOA 1SKUB 1PKDB 2QEXT 2HKQB 3V7SA 2DL3A 2VGNA 2EFIA 1XJWB 3U23A 2GQVA 1OIUB 3JB9D 3M55A 4ZGEB 5EG2A 1VIEA 4F7UG 3UA7A 1K8AC 3CBMA 2W99A 4YC3B 3HSBA 2ZPGB 1JB0E 5LJ3h 3M56A 4DOWA 3VV0A 4JLIA 1WFWA 3ME9A 4R56A 1OQKA 4OMPA 3A98A 1OPKA 3G71A 4M77A 1YI2A 2UZEB 2C0OA 2XHCA 2XMFA 3JCMf 3CCVA 2M0YA 4CC2A 5HBEB 3NMZC 1OX9A 1XOVA 2FRYA 2EPDA 1D09B 1MUZA 2L89A 3HB9A 1YHQT 4PJOD 3VKGA 2YRDA 3PNWC 1UJ0A 2CP0A 2QDLA 2LQ8A 2YXYA 2KR3A 2YLBA 1Q81C 3GF5A 2KY9A 3F70A 5GAOn 3E19A 3TN8B 4M78B 3CD6T 1GBRA 3QUIA 4J9HA 1YCYA 3QYEA 3G6ET 1QP3A 1RLQC 2NUPB 2V26A 2QA4A 3URGA 3CC7T 1AT1B 1KD1R 5GAMg 2KDSA 2XG8D 2RO0A 3JB9G 3KBGA 2YLCA 2BTTA 1WHGA 4QQGA 1H26B 3GNFB 3L2VA 4BUGA 2E3HA 4JJNK 4BD3A 3JAME 3DDPB 4FYWB 1CKBA 3HFOA 1RABB 3TSWA 4XU1A 3WVDB 3SB2A 3RERA 3MEUA 1P5EB 3EGDA 4WTOB 1UNLD 4LN2A 4RTXA 3L2WA 4PJOG 3V7RA 4DOVA 3CCLA 2I0NA 2OTJT 3LH5A 3OY9A 3I55A 3QIIA 3HHTB 1MV0B 1H1RB 2PNIA 4RTWA 4C5GA 2KXDA 3CMAT 3EAEA 1UEBA 3BHUB 3DDQB 3CCUA 3RKXA 4ESRA 1X6GA 4BI3A 1X6OA 1JKWA 5CEIB 1TS9A 2DLPA 2H3EB 4JRKA 2WSFE 3DOGB 1QKWA 1H8KA 3CC4Q 1YJNA 1RAIB 3A5ZB 1VQ8Q 1KD1C 4FW1A 2KXCA 3DLMA 3TCJA 2ZPIB 2MOXA 2QTXA 1T3LA 1R0CB 4HVWA 2GFUA 3V8JA 4RTTA 3EG3A 1NM7A 3CMEQ 3CXCP 4ROCA 2DETA 1VQ9T 2FPEA 2R5MA 3S3OA 1S72Q 3SEMA 2YDLA 4M77C 1AWOA 1N4MA 1SSFA 4C0FA 2DZ9A 4JZ3A 2KROA 5D6XA 1JJ2P 1IRXA 4F17A 2FVUA 2R7GA 2OX7A 5KYUA 2BS4A 2DZCA 2QEXQ 3OYGA 2BKZB 2YSQA 2GGRA 2KQWA 4KUDK 1M2OA 3A8OB 3G33B 1YNZA 1M4ZA 1N6AA 2WPAB 3JV3A 1NYGA 1X2QA 3J80E 1H25B 4CC3A 3QHWB 3DLLA 5GAOq 2JS0A 1SEMA 2QG9B 5LJ3j 3O8VA 2JM9A 2OJ2A 2L3RA 3QG1A 4LDVA 3VS6A 2DNUA 1YHQQ 4LDWA 4HT9A 1OGUB 3E9FA 4CFWB 2WSCE 3NFCA 1SF9A 3CCVT 2RJCA 3OB9A 5CIUA 1QWFA 2D6FA 1K76A 4EOKB 2A08A 3CCQA 4M4ZA 1M1KR 2JJ9A 4XU0A 5I22A 2D1XA 2X51A 1UGSB 3CD6Q 1JXOA 1G2BA 3S3NA 1M90R 1JEGA 4WCIA 3G6EQ 3JB9J 1W70A 2CS7A 1WYXA 5LJ3f 3C0CA 3RKWA 1NJIU 4HLQA 2UZLB 3CC7Q 4N4IA 5CR2A 5A0DA 2CZ1B 4AFZC 5CCAA 2RHYA 3RIRA 2CDTA 3UPUA 2PK9B 2A28A 1VIFA 2BZYA 2WFYB 3TW6A 3EGXA 2QA4T 5EFQB 3QDFA 5GJVB 2LW4A 1Y7XA 1UB4A 3OYJA 2F5TX 4EORB 3ER0A 1K0XA 1E7OA 3UWNA 4LNPA 1HXDA 4BI4A 3UDCA 4CC7A 1XO2A 2C6TB 2E5QA 2RK1A 5ICPB 4HCKA 4BCQB 2O01E 4ZNXA 3FLGA 3INZA 2RQVA 4XU2A 2OTJQ 2LX7A 1WJRA 3EG9B 1VQ7T 2E41A 3POMA 2JTEA 4C8QG 3ZBDA 3O5ZA 2H3JA 1QLYA 2V8JA 1B07A 3OSVA 3CMAQ 1WA7A 5IXBA 3GLXA 4M7DA 1YIJT 4CFUB 4FIBA 3M0UA 3EHQA 4AFUC 1M1KC 4M78E 1VQNT 4J9FA 2GQIA 4KBMB 2W2HA 1M90C 2HKNA 2R57A 2HCKA 2KRNA 2QGGA 5KH6A 1AZEA 5KYYA 1BCMA 4DBFA 3SHWA 2AK5A 2KYMA 4ZN1A 3CCUT 1HD3A 4F7UA 2QQSA 2JXBA 4E7JA 4CRLB 4F6WB 2KVQG 1FKMA 2X4XA 4EC9B 1T3SA 1WNLA 1O9KA 3NTIA 1RAEB 4RTVA 5KYNA 4NC6A 4BCKB 2GF7A 1KXUA 2DVJA 1WHKA 4D6WA 2L3QA 3BDUA 4D8KA 2K2MA 3PIOA 1E7PA 1VQ9Q 2J7IA 4C5HA 1H92A 5HQ0B 4BBSM 1FXXA 3A8HB 2DXBA 1AWWA 4QVZA 2YHTA 2BIVA 4FU6A 3OBWA 1HJDA 4C92F 3LWHA 4AT1B 1FINB 4ELJA 1QP2A 4Y92A 2AT1B 2CREA 3VS4A 3JCMP 1NYFA 4LE9A 1IZ6A 3JCMJ 4J7FA 3PO3S 2A3LA 5LJ3d 2G9XB 3BG9A 5CO7A 4B9WA 2ROTA 2E6NA 1I5OB 1Q86R 2X9HA 3L42A 4IKFA 2HQHA 2RI5A 2C5NB 4B9XA 1UTIA 2FZGB 2ABLA 2DYBA 1G5VA 5GANj 5GAN5 2KYBA 2W96A 2DX1A 3JCMV 1JRIA 2EYWA 4FCYA 4OF1A 1PD1A 3H6ZA 4XTYA 4YOOA 3OYAA 1QMZB 2PZ1A 5GAN2 2DA9A 2DE0X 3CMEA 4PJLA 1Q81U 5I11A 1YWOA 1Q82R 4M77B 4PJOA 3CCVQ 5J26A 2ZPFB 2BUDA 1WI7A 1UHFA 4AI6A 5GAN4 3E1SA 5FU7C 4M7AF 3QKJA 4F6UB 5GANf 2DBMA 2MPXC 2KMGA 3V7CA 4FW2A 4J9BA 2F5KA 2Y90A 1H4LD 1IHWA 3QDRB 4JDSA 4MFDA 4X34A 4BCMB 2V8KA 2LCSA 2QEXA 4M7DC 5DLOA 4KULA 5LJ5e 1PKTA 1Q86C 3CPFA 1TTHB 2QA4Q 4RG2A 4NSTB 3GIBA 2M9UA 2DIGA 1QWEA 4EMHA 4N4GA 1SG5A 2Z0WA 3HL8A 2DO3A 5GMKm 4VUBA 3HPWA 3KHIA 3NTHA 4J6XA 5LJ5h 1QKXA 3QSUA 4IUTA 1VQ4T 2W10A 1VOMA 1BI1A 1O9SA 2F69A 3MKDA 1VQ7Q 2NLUA 1H1QB 2WMBB 4MZMA 1W98B 3WVEB 2CH4W 3EGDB 1Q82C 4J9GA 1YIJQ 2IPOB 4CC4B 1WPYA 5GAOp 3EJ1B 3QYBA 2R58A 1X01A 1B34A 3VS7A 4NL3A 1VQNQ 2C0TA 5IHNA 1KFZA 3CD6A 5KCOA 1E9HB 3G6EA 3M58A 2JMCA 4QQDA 4CFXB 4ATOA 1OZ3A 3CCUQ 1VOLA 3CC7A 4NS5A 1R8OB 5HVYB 1GCPA 1VQPT 3A8MB 4EOIB 4LDXA 5EC7A 1W2BA 4J6YA 3S3MA 2K9GA 2FL7A 3TQ7P 1YCSB 4KRCB 2G77A 2DD4A 2VB6A 4EPCA 2EKOA 3RR6A 4OB1B 3M03A 5CKBA 1ZHIA 2COZA 4A4KA 5IN1A 2QASA 3C95A 1T0HA 4JRQA 3DL1A 1IB8A 1VYTA 3OYKA 2X4YA 4M75F 1ZSZA 2CP5A 2CH4A 1D0YA 4C0DC 4PJOC 4NL2A 2A37A 1KQSP 1Z9ZA 2QDYB 1FMWA 4XQ3A 1QVPA 4XTWA 4FYYB 2G6FX 1D0XA 5KYUB 5GAN3 4Z6YA 4G6LB 1OEBA 2I53A 2JNGA 5CKFA 2EUFA 3P8BB 5ACBA 4PFPA 1W2BS 1WX6A 1SHFA 2DK3A 3QHRB 4Y91A 2ZZDB 2A36A 2M02A 4MMKA 1LNXA 4L5GA 2MWPA 3FIFA 3S6WA 3A8GB 1VUBA 1Y71A 3E9GA 3CCJA 5CKEA 1TOVA 3PFSA 3EG1A 4M78D 4CRIA 1VQ9A 3I9QA 4CFMB 1I81A 2ZAEA 2CP3A 4C8QA 3M5AA 2FPDA 2CYZB 1K9MC 2K79A 5FW9A 2HEQA 1DJ7B 2DKGA 2W9FA 2V1RA 2KT1A 4HA8A 1URCB 2LJ3A 3EH1A 4E7ZA 1R77A 5IHYA 5CKHA 2LCCA 4K11A 3P8HA 1WJSA 2C5XB 3EFRA 2BKDN 1YFNA 2OI3A 3R6NA 3V8KA 2JT4A 2RD1A 4QW2A 1VYUA 1QVGP 2HMAA 2FZKB 3GP8A 4OR5B 3L2RA 1VQ4Q 3VJPA 1VYVA 3OW2A 3OS5A 5LJ5j 1NLOC 1W6XA 1OL1B 1QVFP 1S1NA 2LT4A 5HBHB 2KAFA 1SHGA 1UJYA 5J39A 1UFFA 5FU7B 5ECAA 1TXQA 4JJBA 5GAN6 4C8QF 1HK9A 1M90U 1MMAA 3EH2A 4C92B 4PJJA 2E12A 4O5VA 3HP9A 4F7NB 1G83A 4C0ZA 1ZA1B 2BE9B 4NOYA 2DPPB 2DYIA 4M7DB 4BE2A 1ZSZC 4LOCA 1D3BA 4BCOB 2AHJB 1N9RA 2RHXA 1VQPQ 2PVGB 2HL3A 5I5ZB 4Z02A 1I07A 5KYXA 4EOMB 5DY9A 1Y96A 1GRIA 3PVLA 1R0BG 4EOJB 3MP1A 4E7HA 3MEVA 4F7UB 4F7SB 1UNGD 3C4SA 3MY5B 4PLLA 2CUDA 2BZXA 1GFCA 2E70A 2EQKA 3QXEB 1BU1A 1OI1A 1O9KB 5A2QE 2HL5C 3OW2S 4FT2A 2DD5B 5I2MA 1MV3A 1K73U 3DB4A 3NDQA 3QJYA 1GBQA 4BY6C 1H28B 3RUXA 3VRYA 1QW1A 1RI0A 2I2LA 1VQ7A 2EBPA 4II1A 4XTUA 4HL4A 2RPNA 3TU4K 4M77F 5HY6A 5EJCA 1YIJA 4M7AB 3OYEA 2YRCA 4RTZA 3OBYA 4C8QC 2ED1A 2CT3A 1VQNA 2XICA 2KGTA 2CP6A 4A4HA 2LJ1A 4EOSB 3H4CA 2MF2A 5IF1B 2FEIA 2JUFA 3KXTA 2EGCA 2K3XA 2EQJA 4TVRA 2I40B 4N4HA 1NEGA 2ENMA 2QTVA 1KC8R 1U3OA 4E6RA 3HRUA 1IO6A 4PL6A 1ZQ1A 1UGQB 4KT0E 2GNCA 1QVGA 1U8RA 1BIBA 2O9VA 3PT9A 2C5OB 2KMTA 1ZUYA 4ANJA 2EQMA 2ATCB 3CCJT 4PJMA 1BB9A 3NGPA 5J3BA 2RM4A 4C0GA 4C0DB 4YTLA 1PG5B 5DLQE 4PJOB 5GMKi 1U5SA 2DFUA 2LNVA 1NLPC 3CPWP 2GFAA 2JW4A 3FB9A 3REBB 3MIAB 1NBEB 2QQ8A 1EX4A 3TVTA 3FJ5A 4EMGA 1E6GA 2K7AA 3OYDA 5LJ5d 4UN0A 4BCQD 2J06A 4JRPA 3QJ6A 4KRDB 5CKDA 2CSIA 3EFOB 3I5SA 3OYHA 3H0IA 3RESA 2DEUA 1GUXA 2DL4A 3L2QA 1KC8C 1HSQA 4DBHA 2DMOA 4EMKB 4P5NA 1M2VB 5IH2A 1Q95G 4HVVA 1QVGS 2DXCA 4BY7X 2NUZA 2DAQA 5D7UA 4A53A 1G3TA 2X3XD 3LGLA 4ZTFA 3I35A 2E5KA 1RADB 3OYIA 5FU6B 2COYA 2X4JA 2J6KA 3V8LA 3RKYA 1I5LA 4M75B 5DM7R 3THKA 2QQ9A 2M16A 1BI3A 2GBQA 2O4XA 1CKAA 2D0NA 2J05A 2JVVA 4F6SB 1O75A 3ULRB 3G4ST 4KGXB 1B34B 5GAMe 1N8RU 2XIDA 4QT7A 1M8MA 3H0FA 3NPFA 2EYQA 1PNJA 2LJ0A 2FB7A 4J83A 3BLQB 5GAN7 3CCRA 3JCMQ 1VQKT 2DBKA 3H41A 1M27C 4XTVA 1SRLA 3BG3A 3LGFA 1X43A 1G3SA 2BZ8A 4OP0A 2G3RA 2ZPHB 5GAMh 3M0RA 4DEXA 2GTOA 1RACB 3JCMg 5HCKA 6AT1B 2EKHA 3QPHA 4GLMA 1VQ4A 1K0SA 4JJCA 2JN0A 2DD4B 1N27A 2VYTA 2RB6A 2XDBA 2DVEA 3JRZA 1D1BA 1ZA2B 2KRSA 4X1VA 4C92E 3OYFA 8ATCB 4MZPA 2HSPA 1ABQA 3CXCA 1JOWA 2GCXA 1PC0A 1Z9QA 4OMLA 1JU5C 2K3YA 4BE0A 4HCCA 4J6WA 4JUVA 1VQPA 4HCBA 2P4TA 1YWPA 1P92A 1WLPB 2VGMA 3VS5A 3MP8A 4BCHB 1JJ2A 1UDLA 2PJQA 5GAN8 4IIMA 1TD6A 2CZ0B 3PE0A 4RODA 3CCSA 4BACA 4LUDA 2DIQA 3EHRA 2XDPA 1KIKA 3MCAB 2EVRA 2F2WA 1K9MU 1JBMA 4M78A 4BY6B 5KYWB 3GPLA 4BI8B 1GCQA 1M1GA 2NUPA 3CCJQ 2V8IA 3M54A 4E2FB 5CK9A 1QMCA 2RJEA 4CXAB 2XK0A 1OV3A 4RKUE 2JOYA 3H0HA 2NWMA 4C8QB 4M7AE 2L5QA 1QQJA 1UNHD 1YN8A 1M5Q1 1PKSA 4JRIA 2J6FA 3VYGA 3CXCS 3MO8A 2VWFA 4ORZA 3VRZA 4E7KA 2DMEA 2ZCFB 3TNIB 2RN8A 3TNWB 1W4SA 2FYKA 5IDNB 4XU3A 2VXEA 1XQHA 4M7DF 2RMOA 4ZGDB 3PMIA 4O6JA 2KT8A 1K8AU 2E10A 1JJ2S 1OKVB 2K57A 4PJNA 4PK4A 3CBOA 3BW1A 2HDAA 1GXIE 2RQWA 2PK2A 3RNJA 2LP5A 4F70B 1WXBA 5A0LA 1YITT 4F7UF 2BS2A 1N5ZA 2RNAA 5L8RE 2X35A 4RCCA 4R0KA 2R5AA 1TG0A 4LUEA 1Y07A 1PD0A 1RAGB 3FEOA 5FWCA 3FJPA 4MDWA 3EFSA 2C5VB 3LYIA 5GMKe 2K5IA 5KE2A 4GBQA 3HKSA 1BI2A 5IXFA 1OU8A 5M9OA 3SD4A 1OKWB 1OIYB 2DILA 2CCIB 4AKIA 4C5IA 1NEBA 3PTAA 3G4SQ 3AHUA 2M51A 2DXUA 4X9CA 4HVUA 1UGVA 3CCEA 4EOQB 2C4GB 5GMKh 2LX9A 4OB3B 1WDXA 1NPRA 2QXFA 3TREA 4GLKA 9ATCB 3JCMW 3SFMA 5GAOl 4V2SA 2K4YA 1VQKQ 2HZYA 2IVXA 3GTMS 1D3BB 3JCMe 2BE7D 1ZP2A 2PMIB 4FM4B 1NG2A 2MI6A 4FYVB 5HK3A 2F2CA 4CFNB 1WHMA 1WQ7A 2NUTA 3M0QA 5C6SA 3CCRT 2E4HA 2MIOA 3JB9F 2JGZB 4KGVB 1YJWT 2M0OA 3BG5A 5GAMj 4EOOB 1QCNA 2KNBB 2IW9B 1VQOT 1TUDA 1BI0A 2ECZA 3JCMh 4J5YA 3Q1JA 1B7TA 1SPKA 3DB3A 4IUQA 1C9BA 5I2SA 4B6MA 4M78C 2ED0A 4M75E 1AD6A 5CVIA 3WXMB 5LMKB 3EG0A 4HT8A 1GCQC 2CZ6B 4RTYA 1NJIR 3VS0A 2QDJA 5LJ3g 4PJOF 4AMCA 2QK0A 1D1CA 1B3QA 2HQXA 2JS2A 2Y4XA 4JX6A 5GAMf 1JQQA 3OSSC 7AT1B 3M9QA 5D6WA 4J9IA 2RJDA 2WSEE 1KD1U 1OX8A 5KE3A 2OTLT 4TTHA 5LL6S 2EGAA 3SWNA 1H1SB 2CSQA 1TUCA 4OGCA 4ELZC 4EONB 1KK7A 3CCMT 2LQNA 2HQEA 2RHZA 1X2KA 2AKLA 3R6OA 3CCST 3X24B 2HD0A 5A0GA 1M3AA 3OS2A 3CC2A 4PKCC 2ESWA 3MEWA 1E6HA 3B57A 2EIFA 2EQUA 5HK0A 1WZOA 2C06A 1C1AA 1VQMT 3VKHA 3OYMA 1JO8A 3QWLA 1NJIC 1FMVA 2LVMA 4MDXA 5BNJB 1M3CA 2E3IA 3RBBB 2WMAB 4MIMA 2KBTA 1G8XA 1AD5A 4BCNB 3FDRA 4FT4A 3DKMA 1Q7YR 2WHBB 4MZTA 2CP7A 4LD9K 1HYOA 1LPLA 1MNDA 4DQ2A 2DXTA 3EGUA 3HFNA 1KC8U 2DTIA 1XTDA 3EIDB 3EG9A 2D8JA 5AT1B 2CJMB 4BCPB 3GNGA 2XKOC 3MPUB 3PVQA 2YT6A 1YITQ 3QZ5B 2FG0A 3VUBA 4C92D 1PSEA 2WXVB 2JTFA 4OMMA 5CAIA 3MI9B 1M9SA 4F14A 1BCOA 4AFSC 1ZSGA 1A0NB 3I56T 1D1AA 1W1FA 4EOPB 2AKKA 1VQLT 1F5QB 1UGPB 3M0SA 2A7YA 2LQKA 2QI2A 1K4US 1WHHA 4BY1X 3M4GA 2Y4YA 3QHSA 4Z88A 5I21A 5LQFB 2L2PA 1IGQA 1NZ9A 5AYFA 3OMGA 4OMQA 5GAMd 4HNTA 5DQWA 5GMKj 1H3HA 2EWNA 1Q7YC 3CCET 2RH2A 2DRKA 4JX5A 3L2UA 2MAMA 2KR6A 1EZZB 3META 3CCRQ 4X9DA 4MFEA 1NPPA 4JS5A 1UE9A 1YJWQ 4M7AD 1LCKA 1Q81R 2MK5A 1S72T 4LDYA 2KK4A 1VQOQ 2PVOB 1AZGB 3SWNC 3FC3A 3EGXB 1QLBA 1GH6B 1UHCA 2DRMA 3DTOA 1V76A 3KFVA 1WHJA 4A4FA 1G3NC 5GANg 4M78G 4QSHA 2AZVA 2EGEA 4M77E 3T9NA 4Y72B 1FX7A 3PGGA 4AFQC 2VC8A 4OMNA 1M1KU 5L2WB 4RMOA 2WIPB 4FX3B 3BY7A 3G4SA 2MCNA 2E64A 4L6V5 2RQUA 3MEAA 4BCGB 1K1ZA 4Z89A 4E7LA 1LOJA 1IHVA 2OTLQ 2RJFA 1VQKA 2ROLA 1BYMA 3X25B 1VQ6A 1D3UB 3M4YA 3OS0A 3C94A 1G3WA 1KQSA 1VQ5A 3BLRB 3MP6A 4BXXX 3LH0A 5LJ5f 4LD6A 3MJXA 3CCMQ 1AEYA 5KCHA 3I5RA 4QVDA 5KYYB 4YOSA 1PRMC 3CCSQ 2CZ7B 2LZ6B 3JCMX 4M7AG 1M8VA 3REAB 1IGUA 2EYZA 4M6VA 4J9CA 3MY1B 1LVKA 2QYZA 2PVDB 1VQMQ 3CC2T 4EDUA 1MMDA 3N5BB 3UF4A 3HO8A 4BDYA 3OA6A 3BDLA 3CQTA 1V29B 2IG0A 2KSSA 2DXBB 2WACA 3VYGB 5IDPB 1IXDA 1PRLC 4N0AA 3M0PA 2SEMA 4L59A 3TSZA 2UUEB 2VUBA 2H8HA 2K3BA 5FWBA 3LX7A 1KQSS 1TUGB 3JCMb 2JZ2A 3UA6A 4J7IA 3UATA 1PCXA 2DF6A 4M75D 3LLRA 2DJZA 1PSFA 2C0IA 3I56Q 2L3SA 4KGZB 1I0CA 2K5LA 2LC4A 4FL6A 1H641 4QKUA 1VQLQ 3EG2A 2O9SA 1RLPC 4R55A 1G3YA 2HBWA 4D8DA 4AG2C 1BK2A 3JCMc 2QFZA 3HZJA 3RDVA 1TH7A 1EIFA 2DL8A 3SDZA 1M3BA 2CUBA 2O88A 1ZUKA 1QVFA 1I1JA 4E7SA 1Q86U 3CCEQ 3PMTA 1K9AA 3OS1A 2HSEB 3BHTB 4RUGA 2IIMA 3JCMd 4Y28E 1AVZC 1FYNA 2QQAA 2P0PA 3G7ZA 2ZPBB 1YITA 1WJQA 2XU8A 4EIKA 4M75G 2W0ZA 4LXCA 2V22B 5GANe 4KH0B 2NUTB 2LRQA 2XDDA 3M57A 1WHLA 2FPFA 3VU3C 4LDUA 1QCFA 3PIPA 3QWXX 3FRNA 4CFUD 2V1QA 2EQIA 4Z8AA 4F16A 4AKGA 1Q82U 2CCHB 1QCOA 4JZ4A 4OGEA 2W9ZA 3J7AF 1YJ9A 4JLGA 1RL2A 5IT9E 1CSKA 3C12A 1VYWB 5GANh 2MMPA 2VXFA 3OYNA 4KH1B 2DL7A 2RHUA 4DBRA 4OVAA 4JS4A 1QVFS 4IUVA 2ZZDA 5GJWB 3QWYA 3BFMA 2LNHB 2AZSA 2LCLA 1OYXA 3CEYA 2PHGA 2IVWA 4JJDA 2WJ9A 2P4RA 1RI9A 4ZTJA 1BIAA 2HNIA 4DA4A 1RAAB 2XD0A 4N0AC 4II5B 4ME7A 1M1FA 1OULA 4XAXB 4BDZA 1BU2A 1UUEA 3G71T 1YI2T 1VQ6T 4C8QD 1AHJB 3SWNB 1YJWA 4I3ZB 8AT1B 1U1SA 1VQ5T 2E65A 1JSTB 4DBQA 1J3TA 1VQOA 3ZFJA 2VVKA 4IUPA 2CKKA 2PUOB 4BCIB 1F1BB 3HTRA 2CP2A 4EC8B 4AKHA 1KQ2A 3CC2Q 3H8ZA 2DTOA 2RI3A 1AISB 2OAWA 1PWTA 1RAHB 4ELLA 2ZGWA 4MMLA 1SRMA 3HRTA 2KE9A 1MHNA 1MNEA 2O31A 3JB9H 3TNHB 1V1CA 2IW6B 2DL5A 5LJ5g 4C5EA 4J9DA 4XTXA 1ZSZB 4OB2B 4M7DE 3X26B 2YUPA 3J81E 2IN3A 2E1HA 1UGRB 3L2ZA 2GTJA
chains in the Genus database with same CATH topology
5GAMj 2OTLA 2WSFE 1YJNA 1VQOT 3CPWA 1BI0A 1DJ7B 2DKGA 2X4WA 3JCMh 3A5ZB 1I8FA 4J5YA 3Q1JA 4C92A 3CCMA 1KD1C 4M77D 3DB3A 4CI0C 4HA8A 4IUQA 4F7UE 5I2SA 4A54A 4M78C 3DLMA 3TCJA 2ZPIB 2LCCA 3X28B 2QTXA 3OYYA 4M75E 5CKHA 5CVIA 3WXMB 4HT8A 2CZ6B 2GFUA 3P8HA 1WJSA 3EFRA 4RCBA 2QDJA 2BKDN 2JTMA 3V8JA 3CCLT 5LJ3g 4PJOF 3V8KA 3UT1A 3I55T 2RD1A 4QW2A 2D0QB 5C0MA 4BBRM 2M1HA 3OMCA 1VQ9T 2HQXA 4GY5A 2Y4XA 1VQMA 4JX6A 2R5MA 5GAMf 3OSSC 3S3OA 3M9QA 5D6WA 4M7DA 2RJDA 2WSEE 4M77C 3GP8A 1KD1U 3LW5E 3L2RA 3QYGB 2MWOA 3VJPA 1SSFA 5KE3A 1Q7YU 4C0FA 2DZ9A 5FROA 2OTLT 3OW2A 5D6XA 3OS5A 1YJNT 5LJ5j 5LL6S 3SWNA 2FVUA 4OGCA 2LT4A 2BS4A 2KAFA 2DZCA 4ELZC 4JX4A 3CCMT 2DD5A 3OYGA 5J39A 2HQEA 5FU7B 2RHZA 2KQWA 3R6OA 5GAN6 4KUDK 1FWZA 4C8QF 1HK9A 3CCST 4C92B 3A8OB 1M90U 1M4ZA 3CPWS 3X24B 1N6AA 2HD0A 5A0GA 2E12A 2RK2A 4O5VA 3L1AA 3OS2A 3HP9A 3CC2A 2RA2A 4PKCC 3MEWA 4C0ZA 4NOYA 2DPPB 4M7DB 4M7AA 3J80E 4M77G 2LT1A 4BE2A 2EIFA 2EQUA 5HK0A 4LOCA 1D3BA 1K73C 3I56A 1N9RA 2AHJB 2RHXA 5GAOq 3DLLA 2C06A 2PVGB 1VQMT 3VKHA 1XNIA 4XTZA 4Z02A 5LJ3j 1VQLA 3OYMA 5DY9A 1Y96A 3OYLA 3QWLA 3TW7A 2XI9A 3QZ9B 1NJIC 2LVMA 4MDXA 3O8VA 3VKIA 1WQWA 3MP1A 4E7HA 3MEVA 5FRMA 4MIMA 2L3RA 4F7UB 1H3ZA 1KHCA 3QG1A 4LDVA 4WF2A 1KG1A 3FDRA 4FT4A 3A8LB 3DKMA 4LDWA 4HT9A 3E9FA 5IAYA 4M78F 3C4SA 4MZTA 3HRSA 4PLLA 2EQKA 2E70A 2P0KA 2WSCE 3NFCA 3CC4A 4LD9K 3QXEB 4DQ2A 3CCVT 2RJCA 2DXTA 3OB9A 1OI1A 3HFNA 4XK8E 5CIUA 1KC8U 2DTIA 2D6FA 5A2QE 4PJOE 1XTDA 3OW2S 1YJ9T 1VQ8A 4FT2A 2DD5B 5I2MA 1K73U 3RMQA 3DB4A 3CCQA 3QBYA 2QQRA 2XKOC 3GNGA 4XU0A 3QJYA 3QZ5B 4BY6C 3RUXA 1UGSB 1KHIA 2DTHA 3VUBA 1QW1A 3S3NA 2I2LA 1RI0A 3P8DA 1VQ7A 2D9TA 4C92D 2VV5A 3JB9J 2CS7A 4II1A 3RKWA 5LJ3f 1PSEA 1NJIU 4XTUA 2JTFA 4HL4A 4HLQA 1BKBA 2L8DA 3M53A 1M9SA 4M77F 5CAIA 3TU4K 5HY6A 5EJCA 4N4IA 3JB9I 5CR2A 1YIJA 2PUKB 5A0DA 2QF7A 3I56T 4M7AB 3OYEA 2CZ1B 1U1TA 5CCAA 2RHYA 3OBYA 4C8QC 3RIRA 1VQLT 3UPUA 2B8AA 1UGPB 1VQNA 3OYBA 1VIFA 2A7YA 2XICA 3ZEHA 3TW6A 5GMKl 4A4HA 2QA4T 2LQKA 1YBYA 3H4CA 2QI2A 1S72A 1Y96B 1Y7XA 1UB4A 2MF2A 2JUFA 3OYJA 3M4GA 2F5TX 3ER0A 3KXTA 3TEEA 2Y4YA 3UWNA 3QHSA 4C92C 1HXDA 5FLXE 2K3XA 4BI4A 5I21A 3UDCA 2EQJA 2EAYA 4TVRA 2E5QA 2RK1A 1VQKT 2BS3A 1NZ9A 4N4HA 5AYFA 3OMGA 2LDMA 2O01E 3FLGA 3INZA 3CCQT 5GAMd 4XU2A 2HAXA 2EJ9A 4HNTA 3HRUA 4OB0B 1WJRA 4PL6A 1VQ7T 2E41A 5GMKj 4C8QG 2EWNA 1ZQ1A 1Q7YC 3CCET 1UGQB 2RH2A 3ZBDA 5GAOm 4KT0E 4JX5A 2H3JA 4E47A 2V8JA 3L2UA 2MAMA 3OSVA 2KR6A 3GLXA 5CQXA 1YIJT 1BIBA 2K5FA 4FIBA 4ZN3A 1U8RA 1QVGA 4J8OA 4EMKA 3META 3M59A 3PT9A 1OZ2A 4X9DA 2KMTA 4MFEA 1NPPA 4JS5A 3VYHB 1M1KC 4M78E 1VQNT 2EQMA 4KBMB 2E6ZA 3CCJT 4M7AD 1M90C 3NTKA 2R57A 1S72T 5KH6A 4LDYA 2KK4A 5J3BA 2RM4A 2PVOB 4C0GA 3SWNC 4YTLA 5DLQE 4C0DB 4PJOB 3FC3A 2ZPEB 2RHIA 5GMKi 4QVCA 4ZN1A 3CCUT 1QLBA 1I4K1 1WGSA 4F7UA 2LNVA 2P0QA 2QQSA 4E7JA 2GFAA 2KVQG 3FB9A 4M75A 1FKMA 1YHQA 2QQ8A 4A4FA 2X4XA 4EMGA 2QQBA 5GANg 4M78G 4QSHA 4PNOA 4M77E 1WNLA 3T9NA 4A4GA 4HNVA 3NTIA 1FX7A 3PGGA 3OYDA 5LJ5d 4NC6A 2VC8A 1M1KU 2GF7A 4RMOA 2HBPA 2YRVA 4D6WA 4JRPA 1ZBXA 3ASKA 3BDUA 3BY7A 4M7AC 3G4SA 3PIOA 3QJ6A 2E64A 1E7PA 4L6V5 4C5HA 5CKDA 3MEAA 4HNUA 4BBSM 2CGHA 2EJFA 1FXXA 3A8HB 1NE8A 2DXBA 4OMFB 4PLIA 4QVZA 3OYHA 1LOJA 4E7LA 2YHTA 3RESA 3L2QA 1KC8C 2BIVA 4E7IA 4EMKB 4FU6A 2RJFA 3OBWA 4P5NA 1VQKA 1BYMA 4C92F 4ELYC 3X25B 3LWHA 1VQ6A 3M4YA 1QVGS 1N8RC 2DXCA 3OS0A 1G3WA 2DAQA 3C94A 4ELJA 3HBLA 1QP2A 4A53A 1KQSA 1VQ5A 1G3TA 5HKCA 3MP6A 3LGLA 3LH0A 5LJ5f 4LD6A 3JCMP 4ZTFA 2FHDA 1IZ6A 3JCMJ 3OYIA 2K2VA 5KCHA 4J7FA 4PJOD 4HCZA 4QVDA 5FU6B 2A3LA 5LJ3d 2X4JA 3BG9A 2CZ7B 4QQ6A 3V8LA 3JCMX 3RKYA 4M7AG 1M8VA 5CO7A 4B9WA 1I5LA 4KUIA 2E6NA 3JSCA 4M75B 5DM7R 3L42A 4IKFA 2QQ9A 2M16A 1BI3A 2RI5A 2O4XA 3RMSA 4B9XA 2JVVA 4M6VA 1O75A 2PQWA 1G5VA 3G4ST 5GANj 5GAN5 4ZGJB 2PVDB 2OTJA 1B34B 3JCMV 5GAMe 1N8RU 1JRIA 2XIDA 4BB7A 3CC2T 4EDUA 5GANd 4OF1A 2EYQA 3N5BB 3H6ZA 4XTYA 1X75C 2FB7A 3HO8A 3MHXA 4J83A 3CMAA 4BDYA 3OA6A 3OYAA 3BDLA 3CBPA 2DEQA 1KQ1A 2OAUA 5GAN7 3CCRA 1V29B 3JCMQ 2IG0A 2KSSA 2DXBB 4XTVA 3OQ5A 5D6YA 5GAN2 3OYCA 4Q5WA 3BG3A 4M7DD 3CMEA 1Q81U 2WACA 3VYGB 3LGFA 3I55A 4M77B 4PJOA 4OP0A 1G3SA 2DXCB 4N0AA 5J26A 2G3RA 2ZPHB 5GAMh 2ZPFB 2BUDA 4L59A 2EJGA 4IUUA 4AI6A 3KUFA 2VUBA 3JCMg 5GAN4 3E1SA 3QPHA 3LX7A 5FU7C 1LJOA 3QKJA 4C8QE 5GANf 1VQ4A 1KQSS 4M7AF 3JCMb 2JZ2A 5CQYA 2KMGA 2JN0A 2DD4B 1N27A 2VYTA 3QYHB 4J7IA 4UC4A 3CC4T 3V7CA 2F5KA 2Y90A 2RB6A 3QDRB 4M75D 4JDSA 4MFDA 2DVEA 2XDBA 4X34A 3LLRA 2DJZA 1VQ8T 1PSFA 2O4XB 2V8KA 3JRZA 2QEXA 3LWIA 3GOXA 4M7DC 2RI2A 2K5LA 2LC4A 5DLOA 3QO3A 4KULA 4FL6A 4C92E 5LJ5e 4IURA 1H641 4EMKC 4HKEA 3OYFA 4R55A 4MZPA 1Q86C 3CPFA 1G3YA 2PU9B 4RG2A 4BE1A 3GIBA 3CXCA 2M9UA 2DIGA 2GCXA 4EMHA 5FU6C 4N4GA 4FSXA 3HL8A 2DO3A 5GMKm 4VUBA 3CMET 1MGQA 3JCMc 2QFZA 2K3YA 3HZJA 4BE0A 3HPWA 1TH7A 4J6WA 4JUVA 4A4EA 1VQPA 4HCCA 1EIFA 4HCBA 2P4TA 3KHIA 4M75C 4C92G 3SDZA 3NTHA 1P92A 4RG8A 4J6XA 5LJ5h 2VGMA 3MP8A 3X20B 1JJ2A 5GAN8 1QVFA 4IUTA 1VQ4T 3QSUA 5GAOr 2CZ0B 1O9SA 1BI1A 2F69A 3VUZA 4M7DG 3CCSA 2NLUA 2LTOA 5LJ3e 4BACA 4V2SA 1IREB 1N9SA 1Q86U 4MZMA 5FRNA 2DIQA 3PMTA 3OS1A 3WVEB 1Q82C 2XDPA 3MCAB 2QEXT 1WPYA 5GAOp 3V7SA 2VGNA 1K9MU 3JCMd 1JBMA 4Y28E 2EFIA 3QYBA 4M78A 4BY6B 2R58A 1X01A 3GPLA 1B34A 4NL3A 2QQAA 2P0PA 4BI8B 1M1GA 2GQVA 3JB9D 3M55A 4ZGEB 5EG2A 1VIEA 2V8IA 3G7ZA 3M54A 4F7UG 2ZPBB 3CBMA 5CK9A 1YITA 1K8AC 1WJQA 3CD6A 2XU8A 2RJEA 4M75G 3HSBA 2ZPGB 5KCOA 3G6EA 3M58A 2XK0A 4QQDA 1JB0E 4RKUE 5LJ3h 5GANe 1OZ3A 2JOYA 4ATOA 3M56A 2LRQA 2XDDA 3M57A 3VU3C 4C8QB 4DOWA 3CC7A 2L5QA 4M7AE 4LDUA 3VV0A 4JLIA 4NS5A 1R8OB 3PIPA 3FRNA 3ME9A 1VQPT 4R56A 1M5Q1 3A8MB 4JRIA 3VYGA 3CXCS 3MO8A 3G71A 1YI2A 4AKGA 4M77A 1Q82U 4E7KA 2ZCFB 2XHCA 3JCMf 3CCVA 4LDXA 1W4SA 1W2BA 4J6YA 4OGEA 3S3MA 2FYKA 3J7AF 1XOVA 1YJ9A 4JLGA 1RL2A 2VXEA 1XQHA 4XU3A 4M7DF 5IT9E 2L89A 3HB9A 4ZGDB 2FL7A 3C12A 3VKGA 3PMIA 3PNWC 5GANh 1YHQT 4O6JA 1K8AU 2MMPA 2G77A 2DD4A 2VXFA 2LQ8A 2E10A 3OYNA 1JJ2S 4EPCA 2RHUA 2K57A 2EKOA 4OVAA 4JS4A 1QVFS 4IUVA 4OB1B 2ZZDA 5CKBA 1Q81C 2YLBA 3GF5A 2KY9A 1ZHIA 3CBOA 3BFMA 3BW1A 4A4KA 2LCLA 1GXIE 3F70A 5GAOn 3E19A 5IN1A 1OYXA 3CEYA 3C95A 2IVWA 4M78B 5A0LA 1YITT 4F7UF 2BS2A 3CD6T 2WJ9A 3QUIA 4JRQA 1YCYA 3DL1A 3QYEA 5L8RE 2X35A 3OYKA 1QP3A 4RCCA 2X4YA 3G6ET 4M75F 2R5AA 2QA4A 4ZTJA 3URGA 1BIAA 1Y07A 2HNIA 4DA4A 3CC7T 3FEOA 5GAMg 2XD0A 4C0DC 4PJOC 3FJPA 2KDSA 2XG8D 4MDWA 3EFSA 4ME7A 1M1FA 3LYIA 4N0AC 4NL2A 4XAXB 2QDYB 2RO0A 4XQ3A 2K5IA 5GMKe 4BDZA 3KBGA 5KE2A 2YLCA 3G71T 3JB9G 1YI2T 1VQ6T 4C8QD 4QQGA 1QVPA 3HKSA 1AHJB 3GNFB 4XTWA 3SWNB 4BUGA 3L2VA 1U1SA 1YJWA 1VQ5T 4JJNK 2E65A 1BI2A 5GAN3 4BD3A 3JAME 4Z6YA 1VQOA 3ZFJA 5M9OA 3SD4A 4C5IA 4IUPA 4AKIA 3PTAA 2CKKA 2PUOB 3HFOA 3AHUA 2JNGA 5CKFA 4AKHA 3P8BB 4XU1A 3WVDB 2DXUA 4X9CA 1KQ2A 3SB2A 3H8ZA 3CCEA 1W2BS 3RERA 3MEUA 5GMKh 2DK3A 2LX9A 2DTOA 4OB3B 2RI3A 4Y91A 1NPRA 2QXFA 3TREA 2ZZDB 4GLKA 2ZGWA 4MMKA 3SFMA 5GAOl 3JCMW 1LNXA 2K4YA 4L5GA 2MWPA 4PJOG 3FIFA 4MMLA 3V7RA 4DOVA 3L2WA 1D3BB 3CCLA 2OTJT 3JCMe 3HRTA 3OY9A 3QIIA 1VUBA 1Y71A 3A8GB 3HHTB 4FM4B 1MHNA 2MI6A 3E9GA 3S6WA 3CCJA 5CKEA 5HK3A 3PFSA 4M78D 4CRIA 1VQ9A 4C5GA 3JB9H 3CMAT 1WQ7A 3EAEA 1I81A 1UEBA 4C5EA 5LJ5g 5C6SA 4XTXA 3CCUA 4OB2B 4C8QA 3RKXA 3CCRT 3X26B 4BI3A 3M5AA 4M7DE 1X6OA 3J81E 3JB9F 2E1HA 2CYZB 1UGRB 3L2ZA 1K9MC 1YJWT 2M0OA 3BG5A 4JRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF E;  4ZGE B;  2CZ7 B;  1DJ7 B;  2ZPB B;  2PUK B;  2CZ1 B;  2ZPG B;  1JB0 E;  4RKU E;  1UGP B;  2ZPI B;  3X28 B;  2CZ6 B;  3A8M B;  3VYG A;  4ZGJ B;  2PVD B;  2ZCF B;  2D0Q B;  4ZGD B;  1V29 B;  2DXB B;  2O01 E;  2DD4 A;  2WSE E;  3LW5 E;  4OB0 B;  3QYG B;  4OB1 B;  3VYG B;  2ZZD A;  2DXC B;  1GXI E;  1UGQ B;  2ZPH B;  4KT0 E;  2ZPF B;  5L8R E;  1QP3 A;  2DD5 A;  2DD4 B;  3VYH B;  3QYH B;  3A8O B;  3X24 B;  2QDY B;  2PVO B;  1PSF A;  2ZPE B;  1AHJ B;  2DPP B;  2PU9 B;  2AHJ B;  2PVG B;  2PUO B;  3WVD B;  3QZ9 B;  4OB3 B;  2ZZD B;  4L6V 5;  3A8L B;  3X20 B;  2WSC E;  2CZ0 B;  3A8G B;  3A8H B;  3HHT B;  4FM4 B;  3QXE B;  2DXB A;  4XK8 E;  1IRE B;  2DD5 B;  3X25 B;  3WVE B;  4OB2 B;  2DXC A;  3X26 B;  1QP2 A;  3QZ5 B;  1UGS B;  2CYZ B;  1UGR B;  4Y28 E;  1PSE A; 
#chains in the Genus database with same CATH topology
 2OTL A;  2EYX A;  3CPW A;  1OL2 B;  2YUO A;  2X4W A;  1OPL A;  2RF0 A;  5HBJ B;  1I8F A;  4C92 A;  3CCM A;  4M77 D;  1K73 R;  2LMJ A;  4CI0 C;  4F7L B;  4FSS A;  4DEY A;  4F7U E;  4A54 A;  4RTU A;  3X28 B;  3OYY A;  4F7J B;  1MMG A;  2JM8 A;  4RCB A;  2JTM A;  3E2U A;  1VA7 A;  2L0A A;  3CCL T;  3UT1 A;  3I55 T;  2VAS A;  2D0Q B;  5C0M A;  4BBR M;  2B86 A;  2M1H A;  2RQT A;  3OMC A;  4GY5 A;  4BCM D;  1VQM A;  3VS2 A;  1TU0 B;  3LW5 E;  3QYG B;  2MWO A;  1JXM A;  4OMO A;  1Q7Y U;  5FRO A;  1YJN T;  1ZBJ A;  3DJB A;  4PFO A;  1EFN A;  4JX4 A;  2EW3 A;  2DD5 A;  2KEA A;  2AIR B;  1X69 A;  2UZD B;  1FWZ A;  2COW A;  3CPW S;  4EOL B;  5IHK A;  2K6D A;  2RK2 A;  3L1A A;  4OGR B;  2RA2 A;  3BLH B;  4M7A A;  3H9N A;  4M77 G;  2LT1 A;  2YUQ A;  1K73 C;  3I56 A;  2FO0 A;  4PFZ A;  1XNI A;  1FMK A;  4XTZ A;  1U06 A;  1VQL A;  3OYL A;  2XI9 A;  3TW7 A;  3QZ9 B;  2UZB B;  3VS1 A;  3VKI A;  1WQW A;  5FRM A;  1H3Z A;  1KHC A;  4WF2 A;  5IHI A;  1KG1 A;  3A8L B;  1W2B P;  5IAY A;  4M78 F;  3HRS A;  2P0K A;  3CC4 A;  3K7A M;  4XK8 E;  1AWJ A;  1X6B A;  4PJO E;  1YJ9 T;  1VQ8 A;  3F5X B;  3RMQ A;  3QBY A;  2QQR A;  1OOT A;  1PM3 A;  1PHT A;  1KHI A;  2DTH A;  1H1P B;  3P8D A;  1Y0M A;  2D9T A;  2VV5 A;  4A63 B;  2O2O A;  1BKB A;  2L8D A;  3M53 A;  3JB9 I;  4ROE A;  2J6O A;  3GBQ A;  2PUK B;  2QF7 A;  3VS3 A;  1SSH A;  3AT1 B;  1U1T A;  3G71 Q;  1YI2 Q;  1VQ6 Q;  3A1P A;  2B8A A;  3OYB A;  1VQ5 Q;  3ZEH A;  5GMK l;  1YBY A;  5KYX B;  1S72 A;  4HXJ A;  1Y96 B;  3RGF B;  4J9E A;  3ZL7 C;  4FYX B;  3TEE A;  4C92 C;  5L23 A;  2F2X A;  5FLX E;  4BCJ B;  4BCN D;  2EAY A;  2BS3 A;  1H24 B;  2PTK A;  3NHN A;  2LDM A;  5CYI B;  2VKN A;  3CCQ T;  2DJQ A;  2HAX A;  2EJ9 A;  2BPM B;  4OB0 B;  2KI7 A;  1N8R R;  1FVV B;  5GAO m;  3EFO A;  2QGS A;  4E47 A;  1OI9 B;  5CQX A;  2K5F A;  4ZN3 A;  4J8O A;  1ZUU A;  4EMK A;  3M59 A;  1OZ2 A;  1M2V A;  1ZX6 A;  2X1N B;  2YWW A;  3VYH B;  2E6Z A;  3NTK A;  1ENW A;  2ZPE B;  2RHI A;  4QVC A;  2D8H A;  1I4K 1;  1WGS A;  1AOJ A;  2P0Q A;  4CFV B;  1WXT A;  1T0J A;  4M75 A;  1YHQ A;  4IMY B;  2A0F B;  2QQB A;  3BE3 A;  4PNO A;  1M30 A;  4A4G A;  4HNV A;  1WIE A;  1GY3 B;  3CCL Q;  3IQL A;  4KRT A;  3I55 Q;  2HBP A;  2YRV A;  4M7A C;  1ZBX A;  3ASK A;  1Y57 A;  4HNU A;  1ARK A;  2CGH A;  2EJF A;  4OMF B;  1WXU A;  1NE8 A;  4PLI A;  4F04 B;  4YOZ A;  1RAF B;  1BBZ A;  1GL5 A;  2DM1 A;  1UG1 A;  2DER A;  4E7I A;  1YJN Q;  4ELY C;  1N8R C;  2QGF B;  2P84 A;  3HBL A;  5HKC A;  3OW2 P;  2MYS A;  2FHD A;  2K2V A;  2WEV B;  4HCZ A;  1ZLM A;  2B9R A;  4QQ6 A;  4AG1 C;  4KUI A;  4BCF B;  3JSC A;  5DQV A;  3RMS A;  2WIH B;  1YP5 A;  1C6V X;  2PQW A;  2EYY A;  2NYS A;  5HNB B;  1K9M R;  2QAZ A;  1GFD A;  2KRM A;  4JPB W;  4ZGJ B;  2OTJ A;  4BB7 A;  3BHV B;  5GAN d;  1TSF A;  1X75 C;  1TWB A;  2FZC B;  3MHX A;  3CMA A;  3CBP A;  1KSW A;  2DEQ A;  1KQ1 A;  2L3P A;  2OAU A;  3OYC A;  2F2V A;  3OQ5 A;  5D6Y A;  1ABO A;  4Q5W A;  2IW8 B;  1GUX B;  2JMA A;  4M7D D;  1D0Z A;  2F1L A;  3EOC B;  1C0M A;  2DXC B;  2EJG A;  4IUU A;  1YJ9 Q;  3KUF A;  2LQW A;  4C8Q E;  1LJO A;  2CT4 A;  3G1J A;  5CQY A;  1K8A R;  2YUN A;  1X27 A;  3QYH B;  4UC4 A;  3CC4 T;  5KYW A;  1VQ8 T;  2O4X B;  3LWI A;  3GOX A;  2RI2 A;  1RUW A;  1ACM B;  3QO3 A;  4IUR A;  1H27 B;  1OU9 A;  4EMK C;  4HKE A;  2X3W D;  2PU9 B;  3D7S B;  4BE1 A;  2FRW A;  3LQ5 B;  1KJW A;  1AWX A;  5FU6 C;  1TFB A;  4FSX A;  3CME T;  1MGQ A;  3M0T A;  3O0G D;  2RQR A;  4A4E A;  4C92 G;  4M75 C;  5FGK B;  4RG8 A;  3X20 B;  2SRC A;  3CCQ Q;  1MMN A;  5GAO r;  3VUZ A;  4M7D G;  1VIN A;  2LTO A;  5LJ3 e;  1UEC A;  1IRE B;  1N9S A;  1JSU B;  5FRN A;  4IIO A;  1SKU B;  1PKD B;  2QEX T;  2HKQ B;  3V7S A;  2DL3 A;  2VGN A;  2EFI A;  1XJW B;  3U23 A;  2GQV A;  1OIU B;  3JB9 D;  3M55 A;  4ZGE B;  5EG2 A;  1VIE A;  4F7U G;  3UA7 A;  1K8A C;  3CBM A;  2W99 A;  4YC3 B;  3HSB A;  2ZPG B;  1JB0 E;  5LJ3 h;  3M56 A;  4DOW A;  3VV0 A;  4JLI A;  1WFW A;  3ME9 A;  4R56 A;  1OQK A;  4OMP A;  3A98 A;  1OPK A;  3G71 A;  4M77 A;  1YI2 A;  2UZE B;  2C0O A;  2XHC A;  2XMF A;  3JCM f;  3CCV A;  2M0Y A;  4CC2 A;  5HBE B;  3NMZ C;  1OX9 A;  1XOV A;  2FRY A;  2EPD A;  1D09 B;  1MUZ A;  2L89 A;  3HB9 A;  1YHQ T;  4PJO D;  3VKG A;  2YRD A;  3PNW C;  1UJ0 A;  2CP0 A;  2QDL A;  2LQ8 A;  2YXY A;  2KR3 A;  2YLB A;  1Q81 C;  3GF5 A;  2KY9 A;  3F70 A;  5GAO n;  3E19 A;  3TN8 B;  4M78 B;  3CD6 T;  1GBR A;  3QUI A;  4J9H A;  1YCY A;  3QYE A;  3G6E T;  1QP3 A;  1RLQ C;  2NUP B;  2V26 A;  2QA4 A;  3URG A;  3CC7 T;  1AT1 B;  1KD1 R;  5GAM g;  2KDS A;  2XG8 D;  2RO0 A;  3JB9 G;  3KBG A;  2YLC A;  2BTT A;  1WHG A;  4QQG A;  1H26 B;  3GNF B;  3L2V A;  4BUG A;  2E3H A;  4JJN K;  4BD3 A;  3JAM E;  3DDP B;  4FYW B;  1CKB A;  3HFO A;  1RAB B;  3TSW A;  4XU1 A;  3WVD B;  3SB2 A;  3RER A;  3MEU A;  1P5E B;  3EGD A;  4WTO B;  1UNL D;  4LN2 A;  4RTX A;  3L2W A;  4PJO G;  3V7R A;  4DOV A;  3CCL A;  2I0N A;  2OTJ T;  3LH5 A;  3OY9 A;  3I55 A;  3QII A;  3HHT B;  1MV0 B;  1H1R B;  2PNI A;  4RTW A;  4C5G A;  2KXD A;  3CMA T;  3EAE A;  1UEB A;  3BHU B;  3DDQ B;  3CCU A;  3RKX A;  4ESR A;  1X6G A;  4BI3 A;  1X6O A;  1JKW A;  5CEI B;  1TS9 A;  2DLP A;  2H3E B;  4JRK A;  2WSF E;  3DOG B;  1QKW A;  1H8K A;  3CC4 Q;  1YJN A;  1RAI B;  3A5Z B;  1VQ8 Q;  1KD1 C;  4FW1 A;  2KXC A;  3DLM A;  3TCJ A;  2ZPI B;  2MOX A;  2QTX A;  1T3L A;  1R0C B;  4HVW A;  2GFU A;  3V8J A;  4RTT A;  3EG3 A;  1NM7 A;  3CME Q;  3CXC P;  4ROC A;  2DET A;  1VQ9 T;  2FPE A;  2R5M A;  3S3O A;  1S72 Q;  3SEM A;  2YDL A;  4M77 C;  1AWO A;  1N4M A;  1SSF A;  4C0F A;  2DZ9 A;  4JZ3 A;  2KRO A;  5D6X A;  1JJ2 P;  1IRX A;  4F17 A;  2FVU A;  2R7G A;  2OX7 A;  5KYU A;  2BS4 A;  2DZC A;  2QEX Q;  3OYG A;  2BKZ B;  2YSQ A;  2GGR A;  2KQW A;  4KUD K;  1M2O A;  3A8O B;  3G33 B;  1YNZ A;  1M4Z A;  1N6A A;  2WPA B;  3JV3 A;  1NYG A;  1X2Q A;  3J80 E;  1H25 B;  4CC3 A;  3QHW B;  3DLL A;  5GAO q;  2JS0 A;  1SEM A;  2QG9 B;  5LJ3 j;  3O8V A;  2JM9 A;  2OJ2 A;  2L3R A;  3QG1 A;  4LDV A;  3VS6 A;  2DNU A;  1YHQ Q;  4LDW A;  4HT9 A;  1OGU B;  3E9F A;  4CFW B;  2WSC E;  3NFC A;  1SF9 A;  3CCV T;  2RJC A;  3OB9 A;  5CIU A;  1QWF A;  2D6F A;  1K76 A;  4EOK B;  2A08 A;  3CCQ A;  4M4Z A;  1M1K R;  2JJ9 A;  4XU0 A;  5I22 A;  2D1X A;  2X51 A;  1UGS B;  3CD6 Q;  1JXO A;  1G2B A;  3S3N A;  1M90 R;  1JEG A;  4WCI A;  3G6E Q;  3JB9 J;  1W70 A;  2CS7 A;  1WYX A;  5LJ3 f;  3C0C A;  3RKW A;  1NJI U;  4HLQ A;  2UZL B;  3CC7 Q;  4N4I A;  5CR2 A;  5A0D A;  2CZ1 B;  4AFZ C;  5CCA A;  2RHY A;  3RIR A;  2CDT A;  3UPU A;  2PK9 B;  2A28 A;  1VIF A;  2BZY A;  2WFY B;  3TW6 A;  3EGX A;  2QA4 T;  5EFQ B;  3QDF A;  5GJV B;  2LW4 A;  1Y7X A;  1UB4 A;  3OYJ A;  2F5T X;  4EOR B;  3ER0 A;  1K0X A;  1E7O A;  3UWN A;  4LNP A;  1HXD A;  4BI4 A;  3UDC A;  4CC7 A;  1XO2 A;  2C6T B;  2E5Q A;  2RK1 A;  5ICP B;  4HCK A;  4BCQ B;  2O01 E;  4ZNX A;  3FLG A;  3INZ A;  2RQV A;  4XU2 A;  2OTJ Q;  2LX7 A;  1WJR A;  3EG9 B;  1VQ7 T;  2E41 A;  3POM A;  2JTE A;  4C8Q G;  3ZBD A;  3O5Z A;  2H3J A;  1QLY A;  2V8J A;  1B07 A;  3OSV A;  3CMA Q;  1WA7 A;  5IXB A;  3GLX A;  4M7D A;  1YIJ T;  4CFU B;  4FIB A;  3M0U A;  3EHQ A;  4AFU C;  1M1K C;  4M78 E;  1VQN T;  4J9F A;  2GQI A;  4KBM B;  2W2H A;  1M90 C;  2HKN A;  2R57 A;  2HCK A;  2KRN A;  2QGG A;  5KH6 A;  1AZE A;  5KYY A;  1BCM A;  4DBF A;  3SHW A;  2AK5 A;  2KYM A;  4ZN1 A;  3CCU T;  1HD3 A;  4F7U A;  2QQS A;  2JXB A;  4E7J A;  4CRL B;  4F6W B;  2KVQ G;  1FKM A;  2X4X A;  4EC9 B;  1T3S A;  1WNL A;  1O9K A;  3NTI A;  1RAE B;  4RTV A;  5KYN A;  4NC6 A;  4BCK B;  2GF7 A;  1KXU A;  2DVJ A;  1WHK A;  4D6W A;  2L3Q A;  3BDU A;  4D8K A;  2K2M A;  3PIO A;  1E7P A;  1VQ9 Q;  2J7I A;  4C5H A;  1H92 A;  5HQ0 B;  4BBS M;  1FXX A;  3A8H B;  2DXB A;  1AWW A;  4QVZ A;  2YHT A;  2BIV A;  4FU6 A;  3OBW A;  1HJD A;  4C92 F;  3LWH A;  4AT1 B;  1FIN B;  4ELJ A;  1QP2 A;  4Y92 A;  2AT1 B;  2CRE A;  3VS4 A;  3JCM P;  1NYF A;  4LE9 A;  1IZ6 A;  3JCM J;  4J7F A;  3PO3 S;  2A3L A;  5LJ3 d;  2G9X B;  3BG9 A;  5CO7 A;  4B9W A;  2ROT A;  2E6N A;  1I5O B;  1Q86 R;  2X9H A;  3L42 A;  4IKF A;  2HQH A;  2RI5 A;  2C5N B;  4B9X A;  1UTI A;  2FZG B;  2ABL A;  2DYB A;  1G5V A;  5GAN j;  5GAN 5;  2KYB A;  2W96 A;  2DX1 A;  3JCM V;  1JRI A;  2EYW A;  4FCY A;  4OF1 A;  1PD1 A;  3H6Z A;  4XTY A;  4YOO A;  3OYA A;  1QMZ B;  2PZ1 A;  5GAN 2;  2DA9 A;  2DE0 X;  3CME A;  4PJL A;  1Q81 U;  5I11 A;  1YWO A;  1Q82 R;  4M77 B;  4PJO A;  3CCV Q;  5J26 A;  2ZPF B;  2BUD A;  1WI7 A;  1UHF A;  4AI6 A;  5GAN 4;  3E1S A;  5FU7 C;  4M7A F;  3QKJ A;  4F6U B;  5GAN f;  2DBM A;  2MPX C;  2KMG A;  3V7C A;  4FW2 A;  4J9B A;  2F5K A;  2Y90 A;  1H4L D;  1IHW A;  3QDR B;  4JDS A;  4MFD A;  4X34 A;  4BCM B;  2V8K A;  2LCS A;  2QEX A;  4M7D C;  5DLO A;  4KUL A;  5LJ5 e;  1PKT A;  1Q86 C;  3CPF A;  1TTH B;  2QA4 Q;  4RG2 A;  4NST B;  3GIB A;  2M9U A;  2DIG A;  1QWE A;  4EMH A;  4N4G A;  1SG5 A;  2Z0W A;  3HL8 A;  2DO3 A;  5GMK m;  4VUB A;  3HPW A;  3KHI A;  3NTH A;  4J6X A;  5LJ5 h;  1QKX A;  3QSU A;  4IUT A;  1VQ4 T;  2W10 A;  1VOM A;  1BI1 A;  1O9S A;  2F69 A;  3MKD A;  1VQ7 Q;  2NLU A;  1H1Q B;  2WMB B;  4MZM A;  1W98 B;  3WVE B;  2CH4 W;  3EGD B;  1Q82 C;  4J9G A;  1YIJ Q;  2IPO B;  4CC4 B;  1WPY A;  5GAO p;  3EJ1 B;  3QYB A;  2R58 A;  1X01 A;  1B34 A;  3VS7 A;  4NL3 A;  1VQN Q;  2C0T A;  5IHN A;  1KFZ A;  3CD6 A;  5KCO A;  1E9H B;  3G6E A;  3M58 A;  2JMC A;  4QQD A;  4CFX B;  4ATO A;  1OZ3 A;  3CCU Q;  1VOL A;  3CC7 A;  4NS5 A;  1R8O B;  5HVY B;  1GCP A;  1VQP T;  3A8M B;  4EOI B;  4LDX A;  5EC7 A;  1W2B A;  4J6Y A;  3S3M A;  2K9G A;  2FL7 A;  3TQ7 P;  1YCS B;  4KRC B;  2G77 A;  2DD4 A;  2VB6 A;  4EPC A;  2EKO A;  3RR6 A;  4OB1 B;  3M03 A;  5CKB A;  1ZHI A;  2COZ A;  4A4K A;  5IN1 A;  2QAS A;  3C95 A;  1T0H A;  4JRQ A;  3DL1 A;  1IB8 A;  1VYT A;  3OYK A;  2X4Y A;  4M75 F;  1ZSZ A;  2CP5 A;  2CH4 A;  1D0Y A;  4C0D C;  4PJO C;  4NL2 A;  2A37 A;  1KQS P;  1Z9Z A;  2QDY B;  1FMW A;  4XQ3 A;  1QVP A;  4XTW A;  4FYY B;  2G6F X;  1D0X A;  5KYU B;  5GAN 3;  4Z6Y A;  4G6L B;  1OEB A;  2I53 A;  2JNG A;  5CKF A;  2EUF A;  3P8B B;  5ACB A;  4PFP A;  1W2B S;  1WX6 A;  1SHF A;  2DK3 A;  3QHR B;  4Y91 A;  2ZZD B;  2A36 A;  2M02 A;  4MMK A;  1LNX A;  4L5G A;  2MWP A;  3FIF A;  3S6W A;  3A8G B;  1VUB A;  1Y71 A;  3E9G A;  3CCJ A;  5CKE A;  1TOV A;  3PFS A;  3EG1 A;  4M78 D;  4CRI A;  1VQ9 A;  3I9Q A;  4CFM B;  1I81 A;  2ZAE A;  2CP3 A;  4C8Q A;  3M5A A;  2FPD A;  2CYZ B;  1K9M C;  2K79 A;  5FW9 A;  2HEQ A;  1DJ7 B;  2DKG A;  2W9F A;  2V1R A;  2KT1 A;  4HA8 A;  1URC B;  2LJ3 A;  3EH1 A;  4E7Z A;  1R77 A;  5IHY A;  5CKH A;  2LCC A;  4K11 A;  3P8H A;  1WJS A;  2C5X B;  3EFR A;  2BKD N;  1YFN A;  2OI3 A;  3R6N A;  3V8K A;  2JT4 A;  2RD1 A;  4QW2 A;  1VYU A;  1QVG P;  2HMA A;  2FZK B;  3GP8 A;  4OR5 B;  3L2R A;  1VQ4 Q;  3VJP A;  1VYV A;  3OW2 A;  3OS5 A;  5LJ5 j;  1NLO C;  1W6X A;  1OL1 B;  1QVF P;  1S1N A;  2LT4 A;  5HBH B;  2KAF A;  1SHG A;  1UJY A;  5J39 A;  1UFF A;  5FU7 B;  5ECA A;  1TXQ A;  4JJB A;  5GAN 6;  4C8Q F;  1HK9 A;  1M90 U;  1MMA A;  3EH2 A;  4C92 B;  4PJJ A;  2E12 A;  4O5V A;  3HP9 A;  4F7N B;  1G83 A;  4C0Z A;  1ZA1 B;  2BE9 B;  4NOY A;  2DPP B;  2DYI A;  4M7D B;  4BE2 A;  1ZSZ C;  4LOC A;  1D3B A;  4BCO B;  2AHJ B;  1N9R A;  2RHX A;  1VQP Q;  2PVG B;  2HL3 A;  5I5Z B;  4Z02 A;  1I07 A;  5KYX A;  4EOM B;  5DY9 A;  1Y96 A;  1GRI A;  3PVL A;  1R0B G;  4EOJ B;  3MP1 A;  4E7H A;  3MEV A;  4F7U B;  4F7S B;  1UNG D;  3C4S A;  3MY5 B;  4PLL A;  2CUD A;  2BZX A;  1GFC A;  2E70 A;  2EQK A;  3QXE B;  1BU1 A;  1OI1 A;  1O9K B;  5A2Q E;  2HL5 C;  3OW2 S;  4FT2 A;  2DD5 B;  5I2M A;  1MV3 A;  1K73 U;  3DB4 A;  3NDQ A;  3QJY A;  1GBQ A;  4BY6 C;  1H28 B;  3RUX A;  3VRY A;  1QW1 A;  1RI0 A;  2I2L A;  1VQ7 A;  2EBP A;  4II1 A;  4XTU A;  4HL4 A;  2RPN A;  3TU4 K;  4M77 F;  5HY6 A;  5EJC A;  1YIJ A;  4M7A B;  3OYE A;  2YRC A;  4RTZ A;  3OBY A;  4C8Q C;  2ED1 A;  2CT3 A;  1VQN A;  2XIC A;  2KGT A;  2CP6 A;  4A4H A;  2LJ1 A;  4EOS B;  3H4C A;  2MF2 A;  5IF1 B;  2FEI A;  2JUF A;  3KXT A;  2EGC A;  2K3X A;  2EQJ A;  4TVR A;  2I40 B;  4N4H A;  1NEG A;  2ENM A;  2QTV A;  1KC8 R;  1U3O A;  4E6R A;  3HRU A;  1IO6 A;  4PL6 A;  1ZQ1 A;  1UGQ B;  4KT0 E;  2GNC A;  1QVG A;  1U8R A;  1BIB A;  2O9V A;  3PT9 A;  2C5O B;  2KMT A;  1ZUY A;  4ANJ A;  2EQM A;  2ATC B;  3CCJ T;  4PJM A;  1BB9 A;  3NGP A;  5J3B A;  2RM4 A;  4C0G A;  4C0D B;  4YTL A;  1PG5 B;  5DLQ E;  4PJO B;  5GMK i;  1U5S A;  2DFU A;  2LNV A;  1NLP C;  3CPW P;  2GFA A;  2JW4 A;  3FB9 A;  3REB B;  3MIA B;  1NBE B;  2QQ8 A;  1EX4 A;  3TVT A;  3FJ5 A;  4EMG A;  1E6G A;  2K7A A;  3OYD A;  5LJ5 d;  4UN0 A;  4BCQ D;  2J06 A;  4JRP A;  3QJ6 A;  4KRD B;  5CKD A;  2CSI A;  3EFO B;  3I5S A;  3OYH A;  3H0I A;  3RES A;  2DEU A;  1GUX A;  2DL4 A;  3L2Q A;  1KC8 C;  1HSQ A;  4DBH A;  2DMO A;  4EMK B;  4P5N A;  1M2V B;  5IH2 A;  1Q95 G;  4HVV A;  1QVG S;  2DXC A;  4BY7 X;  2NUZ A;  2DAQ A;  5D7U A;  4A53 A;  1G3T A;  2X3X D;  3LGL A;  4ZTF A;  3I35 A;  2E5K A;  1RAD B;  3OYI A;  5FU6 B;  2COY A;  2X4J A;  2J6K A;  3V8L A;  3RKY A;  1I5L A;  4M75 B;  5DM7 R;  3THK A;  2QQ9 A;  2M16 A;  1BI3 A;  2GBQ A;  2O4X A;  1CKA A;  2D0N A;  2J05 A;  2JVV A;  4F6S B;  1O75 A;  3ULR B;  3G4S T;  4KGX B;  1B34 B;  5GAM e;  1N8R U;  2XID A;  4QT7 A;  1M8M A;  3H0F A;  3NPF A;  2EYQ A;  1PNJ A;  2LJ0 A;  2FB7 A;  4J83 A;  3BLQ B;  5GAN 7;  3CCR A;  3JCM Q;  1VQK T;  2DBK A;  3H41 A;  1M27 C;  4XTV A;  1SRL A;  3BG3 A;  3LGF A;  1X43 A;  1G3S A;  2BZ8 A;  4OP0 A;  2G3R A;  2ZPH B;  5GAM h;  3M0R A;  4DEX A;  2GTO A;  1RAC B;  3JCM g;  5HCK A;  6AT1 B;  2EKH A;  3QPH A;  4GLM A;  1VQ4 A;  1K0S A;  4JJC A;  2JN0 A;  2DD4 B;  1N27 A;  2VYT A;  2RB6 A;  2XDB A;  2DVE A;  3JRZ A;  1D1B A;  1ZA2 B;  2KRS A;  4X1V A;  4C92 E;  3OYF A;  8ATC B;  4MZP A;  2HSP A;  1ABQ A;  3CXC A;  1JOW A;  2GCX A;  1PC0 A;  1Z9Q A;  4OML A;  1JU5 C;  2K3Y A;  4BE0 A;  4HCC A;  4J6W A;  4JUV A;  1VQP A;  4HCB A;  2P4T A;  1YWP A;  1P92 A;  1WLP B;  2VGM A;  3VS5 A;  3MP8 A;  4BCH B;  1JJ2 A;  1UDL A;  2PJQ A;  5GAN 8;  4IIM A;  1TD6 A;  2CZ0 B;  3PE0 A;  4ROD A;  3CCS A;  4BAC A;  4LUD A;  2DIQ A;  3EHR A;  2XDP A;  1KIK A;  3MCA B;  2EVR A;  2F2W A;  1K9M U;  1JBM A;  4M78 A;  4BY6 B;  5KYW B;  3GPL A;  4BI8 B;  1GCQ A;  1M1G A;  2NUP A;  3CCJ Q;  2V8I A;  3M54 A;  4E2F B;  5CK9 A;  1QMC A;  2RJE A;  4CXA B;  2XK0 A;  1OV3 A;  4RKU E;  2JOY A;  3H0H A;  2NWM A;  4C8Q B;  4M7A E;  2L5Q A;  1QQJ A;  1UNH D;  1YN8 A;  1M5Q 1;  1PKS A;  4JRI A;  2J6F A;  3VYG A;  3CXC S;  3MO8 A;  2VWF A;  4ORZ A;  3VRZ A;  4E7K A;  2DME A;  2ZCF B;  3TNI B;  2RN8 A;  3TNW B;  1W4S A;  2FYK A;  5IDN B;  4XU3 A;  2VXE A;  1XQH A;  4M7D F;  2RMO A;  4ZGD B;  3PMI A;  4O6J A;  2KT8 A;  1K8A U;  2E10 A;  1JJ2 S;  1OKV B;  2K57 A;  4PJN A;  4PK4 A;  3CBO A;  3BW1 A;  2HDA A;  1GXI E;  2RQW A;  2PK2 A;  3RNJ A;  2LP5 A;  4F70 B;  1WXB A;  5A0L A;  1YIT T;  4F7U F;  2BS2 A;  1N5Z A;  2RNA A;  5L8R E;  2X35 A;  4RCC A;  4R0K A;  2R5A A;  1TG0 A;  4LUE A;  1Y07 A;  1PD0 A;  1RAG B;  3FEO A;  5FWC A;  3FJP A;  4MDW A;  3EFS A;  2C5V B;  3LYI A;  5GMK e;  2K5I A;  5KE2 A;  4GBQ A;  3HKS A;  1BI2 A;  5IXF A;  1OU8 A;  5M9O A;  3SD4 A;  1OKW B;  1OIY B;  2DIL A;  2CCI B;  4AKI A;  4C5I A;  1NEB A;  3PTA A;  3G4S Q;  3AHU A;  2M51 A;  2DXU A;  4X9C A;  4HVU A;  1UGV A;  3CCE A;  4EOQ B;  2C4G B;  5GMK h;  2LX9 A;  4OB3 B;  1WDX A;  1NPR A;  2QXF A;  3TRE A;  4GLK A;  9ATC B;  3JCM W;  3SFM A;  5GAO l;  4V2S A;  2K4Y A;  1VQK Q;  2HZY A;  2IVX A;  3GTM S;  1D3B B;  3JCM e;  2BE7 D;  1ZP2 A;  2PMI B;  4FM4 B;  1NG2 A;  2MI6 A;  4FYV B;  5HK3 A;  2F2C A;  4CFN B;  1WHM A;  1WQ7 A;  2NUT A;  3M0Q A;  5C6S A;  3CCR T;  2E4H A;  2MIO A;  3JB9 F;  2JGZ B;  4KGV B;  1YJW T;  2M0O A;  3BG5 A;  5GAM j;  4EOO B;  1QCN A;  2KNB B;  2IW9 B;  1VQO T;  1TUD A;  1BI0 A;  2ECZ A;  3JCM h;  4J5Y A;  3Q1J A;  1B7T A;  1SPK A;  3DB3 A;  4IUQ A;  1C9B A;  5I2S A;  4B6M A;  4M78 C;  2ED0 A;  4M75 E;  1AD6 A;  5CVI A;  3WXM B;  5LMK B;  3EG0 A;  4HT8 A;  1GCQ C;  2CZ6 B;  4RTY A;  1NJI R;  3VS0 A;  2QDJ A;  5LJ3 g;  4PJO F;  4AMC A;  2QK0 A;  1D1C A;  1B3Q A;  2HQX A;  2JS2 A;  2Y4X A;  4JX6 A;  5GAM f;  1JQQ A;  3OSS C;  7AT1 B;  3M9Q A;  5D6W A;  4J9I A;  2RJD A;  2WSE E;  1KD1 U;  1OX8 A;  5KE3 A;  2OTL T;  4TTH A;  5LL6 S;  2EGA A;  3SWN A;  1H1S B;  2CSQ A;  1TUC A;  4OGC A;  4ELZ C;  4EON B;  1KK7 A;  3CCM T;  2LQN A;  2HQE A;  2RHZ A;  1X2K A;  2AKL A;  3R6O A;  3CCS T;  3X24 B;  2HD0 A;  5A0G A;  1M3A A;  3OS2 A;  3CC2 A;  4PKC C;  2ESW A;  3MEW A;  1E6H A;  3B57 A;  2EIF A;  2EQU A;  5HK0 A;  1WZO A;  2C06 A;  1C1A A;  1VQM T;  3VKH A;  3OYM A;  1JO8 A;  3QWL A;  1NJI C;  1FMV A;  2LVM A;  4MDX A;  5BNJ B;  1M3C A;  2E3I A;  3RBB B;  2WMA B;  4MIM A;  2KBT A;  1G8X A;  1AD5 A;  4BCN B;  3FDR A;  4FT4 A;  3DKM A;  1Q7Y R;  2WHB B;  4MZT A;  2CP7 A;  4LD9 K;  1HYO A;  1LPL A;  1MND A;  4DQ2 A;  2DXT A;  3EGU A;  3HFN A;  1KC8 U;  2DTI A;  1XTD A;  3EID B;  3EG9 A;  2D8J A;  5AT1 B;  2CJM B;  4BCP B;  3GNG A;  2XKO C;  3MPU B;  3PVQ A;  2YT6 A;  1YIT Q;  3QZ5 B;  2FG0 A;  3VUB A;  4C92 D;  1PSE A;  2WXV B;  2JTF A;  4OMM A;  5CAI A;  3MI9 B;  1M9S A;  4F14 A;  1BCO A;  4AFS C;  1ZSG A;  1A0N B;  3I56 T;  1D1A A;  1W1F A;  4EOP B;  2AKK A;  1VQL T;  1F5Q B;  1UGP B;  3M0S A;  2A7Y A;  2LQK A;  2QI2 A;  1K4U S;  1WHH A;  4BY1 X;  3M4G A;  2Y4Y A;  3QHS A;  4Z88 A;  5I21 A;  5LQF B;  2L2P A;  1IGQ A;  1NZ9 A;  5AYF A;  3OMG A;  4OMQ A;  5GAM d;  4HNT A;  5DQW A;  5GMK j;  1H3H A;  2EWN A;  1Q7Y C;  3CCE T;  2RH2 A;  2DRK A;  4JX5 A;  3L2U A;  2MAM A;  2KR6 A;  1EZZ B;  3MET A;  3CCR Q;  4X9D A;  4MFE A;  1NPP A;  4JS5 A;  1UE9 A;  1YJW Q;  4M7A D;  1LCK A;  1Q81 R;  2MK5 A;  1S72 T;  4LDY A;  2KK4 A;  1VQO Q;  2PVO B;  1AZG B;  3SWN C;  3FC3 A;  3EGX B;  1QLB A;  1GH6 B;  1UHC A;  2DRM A;  3DTO A;  1V76 A;  3KFV A;  1WHJ A;  4A4F A;  1G3N C;  5GAN g;  4M78 G;  4QSH A;  2AZV A;  2EGE A;  4M77 E;  3T9N A;  4Y72 B;  1FX7 A;  3PGG A;  4AFQ C;  2VC8 A;  4OMN A;  1M1K U;  5L2W B;  4RMO A;  2WIP B;  4FX3 B;  3BY7 A;  3G4S A;  2MCN A;  2E64 A;  4L6V 5;  2RQU A;  3MEA A;  4BCG B;  1K1Z A;  4Z89 A;  4E7L A;  1LOJ A;  1IHV A;  2OTL Q;  2RJF A;  1VQK A;  2ROL A;  1BYM A;  3X25 B;  1VQ6 A;  1D3U B;  3M4Y A;  3OS0 A;  3C94 A;  1G3W A;  1KQS A;  1VQ5 A;  3BLR B;  3MP6 A;  4BXX X;  3LH0 A;  5LJ5 f;  4LD6 A;  3MJX A;  3CCM Q;  1AEY A;  5KCH A;  3I5R A;  4QVD A;  5KYY B;  4YOS A;  1PRM C;  3CCS Q;  2CZ7 B;  2LZ6 B;  3JCM X;  4M7A G;  1M8V A;  3REA B;  1IGU A;  2EYZ A;  4M6V A;  4J9C A;  3MY1 B;  1LVK A;  2QYZ A;  2PVD B;  1VQM Q;  3CC2 T;  4EDU A;  1MMD A;  3N5B B;  3UF4 A;  3HO8 A;  4BDY A;  3OA6 A;  3BDL A;  3CQT A;  1V29 B;  2IG0 A;  2KSS A;  2DXB B;  2WAC A;  3VYG B;  5IDP B;  1IXD A;  1PRL C;  4N0A A;  3M0P A;  2SEM A;  4L59 A;  3TSZ A;  2UUE B;  2VUB A;  2H8H A;  2K3B A;  5FWB A;  3LX7 A;  1KQS S;  1TUG B;  3JCM b;  2JZ2 A;  3UA6 A;  4J7I A;  3UAT A;  1PCX A;  2DF6 A;  4M75 D;  3LLR A;  2DJZ A;  1PSF A;  2C0I A;  3I56 Q;  2L3S A;  4KGZ B;  1I0C A;  2K5L A;  2LC4 A;  4FL6 A;  1H64 1;  4QKU A;  1VQL Q;  3EG2 A;  2O9S A;  1RLP C;  4R55 A;  1G3Y A;  2HBW A;  4D8D A;  4AG2 C;  1BK2 A;  3JCM c;  2QFZ A;  3HZJ A;  3RDV A;  1TH7 A;  1EIF A;  2DL8 A;  3SDZ A;  1M3B A;  2CUB A;  2O88 A;  1ZUK A;  1QVF A;  1I1J A;  4E7S A;  1Q86 U;  3CCE Q;  3PMT A;  1K9A A;  3OS1 A;  2HSE B;  3BHT B;  4RUG A;  2IIM A;  3JCM d;  4Y28 E;  1AVZ C;  1FYN A;  2QQA A;  2P0P A;  3G7Z A;  2ZPB B;  1YIT A;  1WJQ A;  2XU8 A;  4EIK A;  4M75 G;  2W0Z A;  4LXC A;  2V22 B;  5GAN e;  4KH0 B;  2NUT B;  2LRQ A;  2XDD A;  3M57 A;  1WHL A;  2FPF A;  3VU3 C;  4LDU A;  1QCF A;  3PIP A;  3QWX X;  3FRN A;  4CFU D;  2V1Q A;  2EQI A;  4Z8A A;  4F16 A;  4AKG A;  1Q82 U;  2CCH B;  1QCO A;  4JZ4 A;  4OGE A;  2W9Z A;  3J7A F;  1YJ9 A;  4JLG A;  1RL2 A;  5IT9 E;  1CSK A;  3C12 A;  1VYW B;  5GAN h;  2MMP A;  2VXF A;  3OYN A;  4KH1 B;  2DL7 A;  2RHU A;  4DBR A;  4OVA A;  4JS4 A;  1QVF S;  4IUV A;  2ZZD A;  5GJW B;  3QWY A;  3BFM A;  2LNH B;  2AZS A;  2LCL A;  1OYX A;  3CEY A;  2PHG A;  2IVW A;  4JJD A;  2WJ9 A;  2P4R A;  1RI9 A;  4ZTJ A;  1BIA A;  2HNI A;  4DA4 A;  1RAA B;  2XD0 A;  4N0A C;  4II5 B;  4ME7 A;  1M1F A;  1OUL A;  4XAX B;  4BDZ A;  1BU2 A;  1UUE A;  3G71 T;  1YI2 T;  1VQ6 T;  4C8Q D;  1AHJ B;  3SWN B;  1YJW A;  4I3Z B;  8AT1 B;  1U1S A;  1VQ5 T;  2E65 A;  1JST B;  4DBQ A;  1J3T A;  1VQO A;  3ZFJ A;  2VVK A;  4IUP A;  2CKK A;  2PUO B;  4BCI B;  1F1B B;  3HTR A;  2CP2 A;  4EC8 B;  4AKH A;  1KQ2 A;  3CC2 Q;  3H8Z A;  2DTO A;  2RI3 A;  1AIS B;  2OAW A;  1PWT A;  1RAH B;  4ELL A;  2ZGW A;  4MML A;  1SRM A;  3HRT A;  2KE9 A;  1MHN A;  1MNE A;  2O31 A;  3JB9 H;  3TNH B;  1V1C A;  2IW6 B;  2DL5 A;  5LJ5 g;  4C5E A;  4J9D A;  4XTX A;  1ZSZ B;  4OB2 B;  4M7D E;  3X26 B;  2YUP A;  3J81 E;  2IN3 A;  2E1H A;  1UGR B;  3L2Z A;  2GTJ A; 
#chains in the Genus database with same CATH homology
 5GAM j;  2OTL A;  2WSF E;  1YJN A;  1VQO T;  3CPW A;  1BI0 A;  1DJ7 B;  2DKG A;  2X4W A;  3JCM h;  3A5Z B;  1I8F A;  4J5Y A;  3Q1J A;  4C92 A;  3CCM A;  1KD1 C;  4M77 D;  3DB3 A;  4CI0 C;  4HA8 A;  4IUQ A;  4F7U E;  5I2S A;  4A54 A;  4M78 C;  3DLM A;  3TCJ A;  2ZPI B;  2LCC A;  3X28 B;  2QTX A;  3OYY A;  4M75 E;  5CKH A;  5CVI A;  3WXM B;  4HT8 A;  2CZ6 B;  2GFU A;  3P8H A;  1WJS A;  3EFR A;  4RCB A;  2QDJ A;  2BKD N;  2JTM A;  3V8J A;  3CCL T;  5LJ3 g;  4PJO F;  3V8K A;  3UT1 A;  3I55 T;  2RD1 A;  4QW2 A;  2D0Q B;  5C0M A;  4BBR M;  2M1H A;  3OMC A;  1VQ9 T;  2HQX A;  4GY5 A;  2Y4X A;  1VQM A;  4JX6 A;  2R5M A;  5GAM f;  3OSS C;  3S3O A;  3M9Q A;  5D6W A;  4M7D A;  2RJD A;  2WSE E;  4M77 C;  3GP8 A;  1KD1 U;  3LW5 E;  3L2R A;  3QYG B;  2MWO A;  3VJP A;  1SSF A;  5KE3 A;  1Q7Y U;  4C0F A;  2DZ9 A;  5FRO A;  2OTL T;  3OW2 A;  5D6X A;  3OS5 A;  1YJN T;  5LJ5 j;  5LL6 S;  3SWN A;  2FVU A;  4OGC A;  2LT4 A;  2BS4 A;  2KAF A;  2DZC A;  4ELZ C;  4JX4 A;  3CCM T;  2DD5 A;  3OYG A;  5J39 A;  2HQE A;  5FU7 B;  2RHZ A;  2KQW A;  3R6O A;  5GAN 6;  4KUD K;  1FWZ A;  4C8Q F;  1HK9 A;  3CCS T;  4C92 B;  3A8O B;  1M90 U;  1M4Z A;  3CPW S;  3X24 B;  1N6A A;  2HD0 A;  5A0G A;  2E12 A;  2RK2 A;  4O5V A;  3L1A A;  3OS2 A;  3HP9 A;  3CC2 A;  2RA2 A;  4PKC C;  3MEW A;  4C0Z A;  4NOY A;  2DPP B;  4M7D B;  4M7A A;  3J80 E;  4M77 G;  2LT1 A;  4BE2 A;  2EIF A;  2EQU A;  5HK0 A;  4LOC A;  1D3B A;  1K73 C;  3I56 A;  1N9R A;  2AHJ B;  2RHX A;  5GAO q;  3DLL A;  2C06 A;  2PVG B;  1VQM T;  3VKH A;  1XNI A;  4XTZ A;  4Z02 A;  5LJ3 j;  1VQL A;  3OYM A;  5DY9 A;  1Y96 A;  3OYL A;  3QWL A;  3TW7 A;  2XI9 A;  3QZ9 B;  1NJI C;  2LVM A;  4MDX A;  3O8V A;  3VKI A;  1WQW A;  3MP1 A;  4E7H A;  3MEV A;  5FRM A;  4MIM A;  2L3R A;  4F7U B;  1H3Z A;  1KHC A;  3QG1 A;  4LDV A;  4WF2 A;  1KG1 A;  3FDR A;  4FT4 A;  3A8L B;  3DKM A;  4LDW A;  4HT9 A;  3E9F A;  5IAY A;  4M78 F;  3C4S A;  4MZT A;  3HRS A;  4PLL A;  2EQK A;  2E70 A;  2P0K A;  2WSC E;  3NFC A;  3CC4 A;  4LD9 K;  3QXE B;  4DQ2 A;  3CCV T;  2RJC A;  2DXT A;  3OB9 A;  1OI1 A;  3HFN A;  4XK8 E;  5CIU A;  1KC8 U;  2DTI A;  2D6F A;  5A2Q E;  4PJO E;  1XTD A;  3OW2 S;  1YJ9 T;  1VQ8 A;  4FT2 A;  2DD5 B;  5I2M A;  1K73 U;  3RMQ A;  3DB4 A;  3CCQ A;  3QBY A;  2QQR A;  2XKO C;  3GNG A;  4XU0 A;  3QJY A;  3QZ5 B;  4BY6 C;  3RUX A;  1UGS B;  1KHI A;  2DTH A;  3VUB A;  1QW1 A;  3S3N A;  2I2L A;  1RI0 A;  3P8D A;  1VQ7 A;  2D9T A;  4C92 D;  2VV5 A;  3JB9 J;  2CS7 A;  4II1 A;  3RKW A;  5LJ3 f;  1PSE A;  1NJI U;  4XTU A;  2JTF A;  4HL4 A;  4HLQ A;  1BKB A;  2L8D A;  3M53 A;  1M9S A;  4M77 F;  5CAI A;  3TU4 K;  5HY6 A;  5EJC A;  4N4I A;  3JB9 I;  5CR2 A;  1YIJ A;  2PUK B;  5A0D A;  2QF7 A;  3I56 T;  4M7A B;  3OYE A;  2CZ1 B;  1U1T A;  5CCA A;  2RHY A;  3OBY A;  4C8Q C;  3RIR A;  1VQL T;  3UPU A;  2B8A A;  1UGP B;  1VQN A;  3OYB A;  1VIF A;  2A7Y A;  2XIC A;  3ZEH A;  3TW6 A;  5GMK l;  4A4H A;  2QA4 T;  2LQK A;  1YBY A;  3H4C A;  2QI2 A;  1S72 A;  1Y96 B;  1Y7X A;  1UB4 A;  2MF2 A;  2JUF A;  3OYJ A;  3M4G A;  2F5T X;  3ER0 A;  3KXT A;  3TEE A;  2Y4Y A;  3UWN A;  3QHS A;  4C92 C;  1HXD A;  5FLX E;  2K3X A;  4BI4 A;  5I21 A;  3UDC A;  2EQJ A;  2EAY A;  4TVR A;  2E5Q A;  2RK1 A;  1VQK T;  2BS3 A;  1NZ9 A;  4N4H A;  5AYF A;  3OMG A;  2LDM A;  2O01 E;  3FLG A;  3INZ A;  3CCQ T;  5GAM d;  4XU2 A;  2HAX A;  2EJ9 A;  4HNT A;  3HRU A;  4OB0 B;  1WJR A;  4PL6 A;  1VQ7 T;  2E41 A;  5GMK j;  4C8Q G;  2EWN A;  1ZQ1 A;  1Q7Y C;  3CCE T;  1UGQ B;  2RH2 A;  3ZBD A;  5GAO m;  4KT0 E;  4JX5 A;  2H3J A;  4E47 A;  2V8J A;  3L2U A;  2MAM A;  3OSV A;  2KR6 A;  3GLX A;  5CQX A;  1YIJ T;  1BIB A;  2K5F A;  4FIB A;  4ZN3 A;  1U8R A;  1QVG A;  4J8O A;  4EMK A;  3MET A;  3M59 A;  3PT9 A;  1OZ2 A;  4X9D A;  2KMT A;  4MFE A;  1NPP A;  4JS5 A;  3VYH B;  1M1K C;  4M78 E;  1VQN T;  2EQM A;  4KBM B;  2E6Z A;  3CCJ T;  4M7A D;  1M90 C;  3NTK A;  2R57 A;  1S72 T;  5KH6 A;  4LDY A;  2KK4 A;  5J3B A;  2RM4 A;  2PVO B;  4C0G A;  3SWN C;  4YTL A;  5DLQ E;  4C0D B;  4PJO B;  3FC3 A;  2ZPE B;  2RHI A;  5GMK i;  4QVC A;  4ZN1 A;  3CCU T;  1QLB A;  1I4K 1;  1WGS A;  4F7U A;  2LNV A;  2P0Q A;  2QQS A;  4E7J A;  2GFA A;  2KVQ G;  3FB9 A;  4M75 A;  1FKM A;  1YHQ A;  2QQ8 A;  4A4F A;  2X4X A;  4EMG A;  2QQB A;  5GAN g;  4M78 G;  4QSH A;  4PNO A;  4M77 E;  1WNL A;  3T9N A;  4A4G A;  4HNV A;  3NTI A;  1FX7 A;  3PGG A;  3OYD A;  5LJ5 d;  4NC6 A;  2VC8 A;  1M1K U;  2GF7 A;  4RMO A;  2HBP A;  2YRV A;  4D6W A;  4JRP A;  1ZBX A;  3ASK A;  3BDU A;  3BY7 A;  4M7A C;  3G4S A;  3PIO A;  3QJ6 A;  2E64 A;  1E7P A;  4L6V 5;  4C5H A;  5CKD A;  3MEA A;  4HNU A;  4BBS M;  2CGH A;  2EJF A;  1FXX A;  3A8H B;  1NE8 A;  2DXB A;  4OMF B;  4PLI A;  4QVZ A;  3OYH A;  1LOJ A;  4E7L A;  2YHT A;  3RES A;  3L2Q A;  1KC8 C;  2BIV A;  4E7I A;  4EMK B;  4FU6 A;  2RJF A;  3OBW A;  4P5N A;  1VQK A;  1BYM A;  4C92 F;  4ELY C;  3X25 B;  3LWH A;  1VQ6 A;  3M4Y A;  1QVG S;  1N8R C;  2DXC A;  3OS0 A;  1G3W A;  2DAQ A;  3C94 A;  4ELJ A;  3HBL A;  1QP2 A;  4A53 A;  1KQS A;  1VQ5 A;  1G3T A;  5HKC A;  3MP6 A;  3LGL A;  3LH0 A;  5LJ5 f;  4LD6 A;  3JCM P;  4ZTF A;  2FHD A;  1IZ6 A;  3JCM J;  3OYI A;  2K2V A;  5KCH A;  4J7F A;  4PJO D;  4HCZ A;  4QVD A;  5FU6 B;  2A3L A;  5LJ3 d;  2X4J A;  3BG9 A;  2CZ7 B;  4QQ6 A;  3V8L A;  3JCM X;  3RKY A;  4M7A G;  1M8V A;  5CO7 A;  4B9W A;  1I5L A;  4KUI A;  2E6N A;  3JSC A;  4M75 B;  5DM7 R;  3L42 A;  4IKF A;  2QQ9 A;  2M16 A;  1BI3 A;  2RI5 A;  2O4X A;  3RMS A;  4B9X A;  2JVV A;  4M6V A;  1O75 A;  2PQW A;  1G5V A;  3G4S T;  5GAN j;  5GAN 5;  4ZGJ B;  2PVD B;  2OTJ A;  1B34 B;  3JCM V;  5GAM e;  1N8R U;  1JRI A;  2XID A;  4BB7 A;  3CC2 T;  4EDU A;  5GAN d;  4OF1 A;  2EYQ A;  3N5B B;  3H6Z A;  4XTY A;  1X75 C;  2FB7 A;  3HO8 A;  3MHX A;  4J83 A;  3CMA A;  4BDY A;  3OA6 A;  3OYA A;  3BDL A;  3CBP A;  2DEQ A;  1KQ1 A;  2OAU A;  5GAN 7;  3CCR A;  1V29 B;  3JCM Q;  2IG0 A;  2KSS A;  2DXB B;  4XTV A;  3OQ5 A;  5D6Y A;  5GAN 2;  3OYC A;  4Q5W A;  3BG3 A;  4M7D D;  3CME A;  1Q81 U;  2WAC A;  3VYG B;  3LGF A;  3I55 A;  4M77 B;  4PJO A;  4OP0 A;  1G3S A;  2DXC B;  4N0A A;  5J26 A;  2G3R A;  2ZPH B;  5GAM h;  2ZPF B;  2BUD A;  4L59 A;  2EJG A;  4IUU A;  4AI6 A;  3KUF A;  2VUB A;  3JCM g;  5GAN 4;  3E1S A;  3QPH A;  3LX7 A;  5FU7 C;  1LJO A;  3QKJ A;  4C8Q E;  5GAN f;  1VQ4 A;  1KQS S;  4M7A F;  3JCM b;  2JZ2 A;  5CQY A;  2KMG A;  2JN0 A;  2DD4 B;  1N27 A;  2VYT A;  3QYH B;  4J7I A;  4UC4 A;  3CC4 T;  3V7C A;  2F5K A;  2Y90 A;  2RB6 A;  3QDR B;  4M75 D;  4JDS A;  4MFD A;  2DVE A;  2XDB A;  4X34 A;  3LLR A;  2DJZ A;  1VQ8 T;  1PSF A;  2O4X B;  2V8K A;  3JRZ A;  2QEX A;  3LWI A;  3GOX A;  4M7D C;  2RI2 A;  2K5L A;  2LC4 A;  5DLO A;  3QO3 A;  4KUL A;  4FL6 A;  4C92 E;  5LJ5 e;  4IUR A;  1H64 1;  4EMK C;  4HKE A;  3OYF A;  4R55 A;  4MZP A;  1Q86 C;  3CPF A;  1G3Y A;  2PU9 B;  4RG2 A;  4BE1 A;  3GIB A;  3CXC A;  2M9U A;  2DIG A;  2GCX A;  4EMH A;  5FU6 C;  4N4G A;  4FSX A;  3HL8 A;  2DO3 A;  5GMK m;  4VUB A;  3CME T;  1MGQ A;  3JCM c;  2QFZ A;  2K3Y A;  3HZJ A;  4BE0 A;  3HPW A;  1TH7 A;  4J6W A;  4JUV A;  4A4E A;  1VQP A;  4HCC A;  1EIF A;  4HCB A;  2P4T A;  3KHI A;  4M75 C;  4C92 G;  3SDZ A;  3NTH A;  1P92 A;  4RG8 A;  4J6X A;  5LJ5 h;  2VGM A;  3MP8 A;  3X20 B;  1JJ2 A;  5GAN 8;  1QVF A;  4IUT A;  1VQ4 T;  3QSU A;  5GAO r;  2CZ0 B;  1O9S A;  1BI1 A;  2F69 A;  3VUZ A;  4M7D G;  3CCS A;  2NLU A;  2LTO A;  5LJ3 e;  4BAC A;  4V2S A;  1IRE B;  1N9S A;  1Q86 U;  4MZM A;  5FRN A;  2DIQ A;  3PMT A;  3OS1 A;  3WVE B;  1Q82 C;  2XDP A;  3MCA B;  2QEX T;  1WPY A;  5GAO p;  3V7S A;  2VGN A;  1K9M U;  3JCM d;  1JBM A;  4Y28 E;  2EFI A;  3QYB A;  4M78 A;  4BY6 B;  2R58 A;  1X01 A;  3GPL A;  1B34 A;  4NL3 A;  2QQA A;  2P0P A;  4BI8 B;  1M1G A;  2GQV A;  3JB9 D;  3M55 A;  4ZGE B;  5EG2 A;  1VIE A;  2V8I A;  3G7Z A;  3M54 A;  4F7U G;  2ZPB B;  3CBM A;  5CK9 A;  1YIT A;  1K8A C;  1WJQ A;  3CD6 A;  2XU8 A;  2RJE A;  4M75 G;  3HSB A;  2ZPG B;  5KCO A;  3G6E A;  3M58 A;  2XK0 A;  4QQD A;  1JB0 E;  4RKU E;  5LJ3 h;  5GAN e;  1OZ3 A;  2JOY A;  4ATO A;  3M56 A;  2LRQ A;  2XDD A;  3M57 A;  3VU3 C;  4C8Q B;  4DOW A;  3CC7 A;  2L5Q A;  4M7A E;  4LDU A;  3VV0 A;  4JLI A;  4NS5 A;  1R8O B;  3PIP A;  3FRN A;  3ME9 A;  1VQP T;  4R56 A;  1M5Q 1;  3A8M B;  4JRI A;  3VYG A;  3CXC S;  3MO8 A;  3G71 A;  1YI2 A;  4AKG A;  4M77 A;  1Q82 U;  4E7K A;  2ZCF B;  2XHC A;  3JCM f;  3CCV A;  4LDX A;  1W4S A;  1W2B A;  4J6Y A;  4OGE A;  3S3M A;  2FYK A;  3J7A F;  1XOV A;  1YJ9 A;  4JLG A;  1RL2 A;  2VXE A;  1XQH A;  4XU3 A;  4M7D F;  5IT9 E;  2L89 A;  3HB9 A;  4ZGD B;  2FL7 A;  3C12 A;  3VKG A;  3PMI A;  3PNW C;  5GAN h;  1YHQ T;  4O6J A;  1K8A U;  2MMP A;  2G77 A;  2DD4 A;  2VXF A;  2LQ8 A;  2E10 A;  3OYN A;  1JJ2 S;  4EPC A;  2RHU A;  2K57 A;  2EKO A;  4OVA A;  4JS4 A;  1QVF S;  4IUV A;  4OB1 B;  2ZZD A;  5CKB A;  1Q81 C;  2YLB A;  3GF5 A;  2KY9 A;  1ZHI A;  3CBO A;  3BFM A;  3BW1 A;  4A4K A;  2LCL A;  1GXI E;  3F70 A;  5GAO n;  3E19 A;  5IN1 A;  1OYX A;  3CEY A;  3C95 A;  2IVW A;  4M78 B;  5A0L A;  1YIT T;  4F7U F;  2BS2 A;  3CD6 T;  2WJ9 A;  3QUI A;  4JRQ A;  1YCY A;  3DL1 A;  3QYE A;  5L8R E;  2X35 A;  3OYK A;  1QP3 A;  4RCC A;  2X4Y A;  3G6E T;  4M75 F;  2R5A A;  2QA4 A;  4ZTJ A;  3URG A;  1BIA A;  1Y07 A;  2HNI A;  4DA4 A;  3CC7 T;  3FEO A;  5GAM g;  2XD0 A;  4C0D C;  4PJO C;  3FJP A;  2KDS A;  2XG8 D;  4MDW A;  3EFS A;  4ME7 A;  1M1F A;  3LYI A;  4N0A C;  4NL2 A;  4XAX B;  2QDY B;  2RO0 A;  4XQ3 A;  2K5I A;  5GMK e;  4BDZ A;  3KBG A;  5KE2 A;  2YLC A;  3G71 T;  3JB9 G;  1YI2 T;  1VQ6 T;  4C8Q D;  4QQG A;  1QVP A;  3HKS A;  1AHJ B;  3GNF B;  4XTW A;  3SWN B;  4BUG A;  3L2V A;  1U1S A;  1YJW A;  1VQ5 T;  4JJN K;  2E65 A;  1BI2 A;  5GAN 3;  4BD3 A;  3JAM E;  4Z6Y A;  1VQO A;  3ZFJ A;  5M9O A;  3SD4 A;  4C5I A;  4IUP A;  4AKI A;  3PTA A;  2CKK A;  2PUO B;  3HFO A;  3AHU A;  2JNG A;  5CKF A;  4AKH A;  3P8B B;  4XU1 A;  3WVD B;  2DXU A;  4X9C A;  1KQ2 A;  3SB2 A;  3H8Z A;  3CCE A;  1W2B S;  3RER A;  3MEU A;  5GMK h;  2DK3 A;  2LX9 A;  2DTO A;  4OB3 B;  2RI3 A;  4Y91 A;  1NPR A;  2QXF A;  3TRE A;  2ZZD B;  4GLK A;  2ZGW A;  4MMK A;  3SFM A;  5GAO l;  3JCM W;  1LNX A;  2K4Y A;  4L5G A;  2MWP A;  4PJO G;  3FIF A;  4MML A;  3V7R A;  4DOV A;  3L2W A;  1D3B B;  3CCL A;  2OTJ T;  3JCM e;  3HRT A;  3OY9 A;  3QII A;  1VUB A;  1Y71 A;  3A8G B;  3HHT B;  4FM4 B;  1MHN A;  2MI6 A;  3E9G A;  3S6W A;  3CCJ A;  5CKE A;  5HK3 A;  3PFS A;  4M78 D;  4CRI A;  1VQ9 A;  4C5G A;  3JB9 H;  3CMA T;  1WQ7 A;  3EAE A;  1I81 A;  1UEB A;  4C5E A;  5LJ5 g;  5C6S A;  4XTX A;  3CCU A;  4OB2 B;  4C8Q A;  3RKX A;  3CCR T;  3X26 B;  4BI3 A;  3M5A A;  4M7D E;  1X6O A;  3J81 E;  3JB9 F;  2E1H A;  2CYZ B;  1UGR B;  3L2Z A;  1K9M C;  1YJW T;  2M0O A;  3BG5 A;  4JRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...