4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
4ZGDB 2DPPB 2ZZDB 2ZZDA 4OB2B 2DXBB 2ZPBB 2PU9B 2WSFE 2DXCA 1AHJB 2DD4A 2DD4B 2QDYB 2CYZB 1DJ7B 2ZPGB 1QP2A 1GXIE 4FM4B 1UGQB 2DXCB 2ZPEB 3LW5E 2PVDB 4ZGJB 3QZ5B 3HHTB 3A8LB 2DXBA 4Y28E 2DD5B 3X20B 2PUOB 1V29B 4XK8E 2ZPHB 2D0QB 2WSEE 2ZCFB 3QYGB 2ZPFB 1UGSB 3A8HB 1QP3A 2ZPIB 3QZ9B 4OB3B 4KT0E 5L8RE 2O01E 4RKUE 3A8OB 1JB0E 1PSFA 2PUKB 4OB1B 3VYGB 3A8GB 3VYHB 1UGRB 3VYGA 3X28B 3X26B 2DD5A 2PVOB 3WVDB 2CZ0B 3QXEB 2CZ1B 4ZGEB 3A8MB 4L6V5 2PVGB 3QYHB 3X24B 2WSCE 1IREB 1UGPB 2AHJB 2CZ6B 2CZ7B 4OB0B 1PSEA 3WVEB 3X25B
chains in the Genus database with same CATH superfamily
2FEIA 4HXJA 2K7AA 4J9IA 2ENMA 3QJ6A 3CMAA 3CD6A 4Y91A 4OMOA 2QI2A 2F2VA 2PZ1A 5CKHA 3CCLQ 1PRMC 4M78B 4GLKA 2O9VA 2K6DA 2PMIB 3QG1A 1TUGB 2D1XA 2CGHA 3VRZA 2XIDA 3OW2S 5HK3A 2DEQA 4HVWA 1K4US 2JUFA 2COZA 5GAMj 3LWIA 3H9NA 1WHHA 5DLOA 4QQDA 1H26B 1C0MA 3JB9F 2LT1A 4JJBA 1UNLD 2BZXA 3RBBB 4V2SA 5I5ZB 3WXMB 2W9FA 4PJOC 4RTUA 2HNIA 2EBPA 5KYWB 2EYYA 4BCNB 2PTKA 3V7RA 2GFUA 4PJOE 2A0FB 4WF2A 3CCET 2DIQA 5IHIA 3MKDA 2CT3A 2K2VA 4J8OA 2DVEA 4F04B 4AKHA 3DTOA 1H25B 3QYEA 2XI9A 2RHZA 3DB3A 1Y7XA 1K8AU 1UJ0A 1WHKA 3VYGA 1O9SA 2HMAA 4C5IA 4QVCA 2KRNA 4MFEA 2X4YA 3OBYA 1IHVA 4BCOB 1SHGA 3G71Q 2CZ0B 4JRKA 1M2VA 4C0FA 1UDLA 2CZ1B 3CCLA 1M8MA 2DXTA 2OX7A 1YHQT 3P8DA 3CCJT 1YJ9A 2M1HA 5IDPB 2E5KA 1B34B 2RQRA 1X6BA 5GAMh 3OYHA 1SHFA 2NUZA 3LGFA 3SFMA 1BI3A 3CQTA 5GAMe 2KY9A 1OQKA 3M55A 3B57A 4M75G 1AWOA 2DD4A 4KGXB 1JEGA 4HNTA 3G4ST 1OI9B 4F7NB 4F7JB 4OMPA 1IXDA 1BI1A 2QGFB 1Z9ZA 2CKKA 3CPWA 5CKFA 1YWPA 3HKSA 3L2QA 1YIJT 2E3HA 2C5NB 3L1AA 1VQNA 3GBQA 1AISB 4PLLA 2I53A 3SWNC 2FRYA 5IHYA 2DZCA 1RLQC 4EDUA 5KYXA 3HHTB 1JQQA 3H0HA 5D6WA 2YRDA 5EG2A 1IHWA 4OR5B 2GQVA 2MWOA 4J9FA 2BE7D 1W1FA 1V76A 2ZAEA 1SKUB 4J83A 1GUXB 2QQ8A 4XK8E 4J9HA 2ZPHB 1KD1U 2XDDA 3META 2O88A 1NJIU 1TXQA 3VV0A 3TU4K 4HKEA 4PJOD 2X4JA 4ROEA 1VQPQ 5IH2A 1WJRA 1D0ZA 2NUTB 1VQ8A 4M7AD 1RACB 2VVKA 3G6EA 1I5OB 4CRIA 4C8QG 1KHCA 2KEAA 2K2MA 4OB3B 3OMGA 4CFXB 3JCMW 4J9BA 4LDUA 3J7AF 5C0MA 1RAIB 3C4SA 5CQXA 3FEOA 3OYBA 1BKBA 4M7DB 2UZDB 1NE8A 1Q81U 1KD1R 2LCCA 4OMNA 3X28B 4EMGA 2JOYA 4C92C 4EONB 3EGUA 2PVOB 5EC7A 4F70B 1LVKA 1X6OA 3IQLA 4IUQA 2HL3A 1IGQA 1ZA2B 3PVLA 2BS2A 4C92A 3CCVA 4ESRA 1MV0B 2DVJA 3FLGA 4J9DA 2Z0WA 1YITQ 4A4GA 2HZYA 4DBQA 1O75A 4OB2B 1Q86U 2ED0A 1ABQA 2RJDA 1UJYA 2E1HA 2FPDA 5GAN8 2MWPA 2YLCA 4C8QD 2IW9B 3QDFA 5ACBA 4M7DG 1ZA1B 3BG3A 3CCQA 2DRKA 3PVQA 2OI3A 4M78C 3MJXA 4R56A 2J6OA 1BU2A 1ZUUA 2KNBB 1QP2A 2GQIA 3HP9A 1RAFB 2CP6A 1K73U 1AZEA 4HCCA 2BTTA 2COYA 4YOZA 2KYBA 1WJQA 2C06A 2EQUA 5AT1B 2C5XB 3GF5A 4BD3A 4X9CA 3JV3A 1WHMA 1K0XA 1RABB 1AWXA 4NS5A 3M9QA 4BCGB 1GFCA 4OGCA 2W9ZA 4J6WA 1VQPT 2MIOA 1ZUYA 1K76A 3EG2A 3SWNA 1BYMA 5IHNA 1GCQA 1UB4A 1WA7A 4C0DC 2VUBA 1TUDA 4II1A 3M58A 3QYGB 3I55T 2LC4A 2RQTA 2P4TA 1YFNA 1Z9QA 5FRMA 1OIYB 2W96A 4BCPB 2D8JA 1Y96A 1QVGP 4C8QF 1OL2B 3RKXA 2OAUA 2QQSA 1M1KC 3A8OB 1JB0E 1I8FA 4J9GA 2KR3A 2QQRA 2F5TX 2ZGWA 4BY6C 1H24B 3DLLA 3SEMA 5HBEB 4E7SA 3OS1A 2M51A 2DXUA 5CQYA 3V7CA 1VQ7T 5GMKm 2HQHA 1KQSP 2VKNA 2FPEA 3KUFA 2NWMA 4X9DA 1VQ9Q 1S72Q 2JMCA 2KK4A 1YJWA 4A63B 4A4KA 2KMTA 3MY1B 2RI2A 4RTTA 2EGAA 4M78F 2CREA 1VIEA 1GH6B 1UGPB 2FZKB 1O9KB 3ASKA 2KYMA 1NPPA 2DTHA 2BPMB 4KRDB 2G77A 1Q81R 2DXBB 4BCMB 1Q95G 3MP1A 2YUPA 1KK7A 2DJQA 5CVIA 2QA4Q 1BIAA 1U06A 4PJOA 1LJOA 3EH2A 2LDMA 1M3BA 1MHNA 4MFDA 4LOCA 2BUDA 2KE9A 3BE3A 3CCEQ 2P4RA 4EOSB 3L2WA 5LL6S 1QWFA 1H92A 5BNJB 3A5ZB 2ROLA 2AKLA 3DL1A 4A54A 2PJQA 1VQ6A 4B9WA 1VIFA 5LJ5e 1O9KA 9ATCB 3H0IA 4D8DA 4PFOA 5EFQB 3V8JA 4C92G 2GTOA 4F7UF 4FU6A 3DDQB 3LWHA 3MP8A 2A3LA 4XTXA 1IO6A 2EYWA 2VGNA 4N4HA 4PL6A 4PJMA 3SHWA 3FJPA 2FO0A 3HRUA 4FIBA 5GAN3 2M9UA 2QEXQ 5EJCA 3EJ1B 3AT1B 3A8HB 4PNOA 3C0CA 1OEBA 1NG2A 3QZ9B 1X6GA 1QMZB 3EAEA 4J7FA 2D0NA 2JVVA 1PG5B 3L2RA 1H28B 4RKUE 3TREA 3I35A 4FL6A 2XD0A 3BDUA 3CCRT 1NYGA 4BY7X 1Q86C 4C8QA 5HKCA 2COWA 4WTOB 1UECA 4OGEA 4F6UB 1ARKA 3SB2A 4BI4A 4E7ZA 2DNUA 5CO7A 1HJDA 5LJ3e 3OYYA 5FGKB 1N6AA 1VYUA 2F2XA 2O4XB 1X2QA 1M9SA 2WSCE 1VQMQ 2RN8A 1M27C 2FG0A 3CCUQ 3CCVQ 3VKGA 4OB0B 4EMKB 3WVEB 2J7IA 3URGA 4B6MA 5GANg 2CP5A 2WMBB 3FDRA 3RUXA 5CCAA 3CC7A 2FZCB 2ESWA 3PGGA 2RHUA 3CBOA 1M90U 2QDYB 3HBLA 3U23A 4BACA 4JZ3A 2X4XA 4C0ZA 4AFZC 3OW2P 1Q82U 1QWEA 1KSWA 1JSUB 3GNGA 2RQVA 3HZJA 4M75A 5IF1B 3HL8A 3RKYA 2AT1B 1GUXA 2RJCA 1FKMA 3PTAA 1YIJA 4IMYB 1YCYA 2IIMA 5GMKe 1M8VA 4AFUC 2GTJA 4N4GA 1VQNT 2KMGA 1D3BB 4EPCA 2XKOC 5KYYB 1W4SA 1GBQA 1UE9A 2RK2A 4ZN1A 1NJIR 4AT1B 3HB9A 4HCBA 4KH0B 2HCKA 4F6WB 2FHDA 5GANj 3G71T 2H3JA 2RD1A 1OPLA 4EMKC 2QTXA 4RODA 2GFAA 4QT7A 1D3UB 5GANf 1W70A 2HKQB 4JS4A 3MIAB 2ZPFB 5IT9E 4AI6A 2EKHA 4OGRB 1TTHB 3TW6A 2L3PA 1YI2T 3CC7Q 3ZFJA 4LE9A 2YUOA 4BCKB 1YBYA 1ZHIA 3CBPA 1H27B 5CIUA 1N8RR 1HYOA 2YT6A 2KXDA 4PJOF 1VQ8T 3L2VA 4F7UE 1GY3B 1U1SA 4O6JA 2HQXA 1JXOA 4AG2C 2CCIB 1QVFA 3X26B 4IUPA 3QSUA 4KGZB 1JSTB 2QK0A 4Q5WA 2MCNA 8AT1B 2A36A 3OBWA 4NC6A 4XU1A 2CP7A 1QMCA 3MEVA 2ATCB 2PVGB 4RTZA 4LUDA 3X24B 2CUDA 1M1FA 2Y4YA 4JDSA 5GMKj 5CKBA 4C0DB 1MGQA 3X25B 4GY5A 3RR6A 2CP2A 1KJWA 2XK0A 1QCNA 3CCUT 1U8RA 1AHJB 1SRLA 1FMWA 5LMKB 2C0IA 2DD4B 3QHSA 4J9EA 2WIPB 1YWOA 1NYFA 2BZ8A 1Q86R 4YOOA 1VUBA 2F1LA 4C5GA 2JS0A 3J80E 8ATCB 4C8QE 2I40B 4TTHA 1H3ZA 1AD6A 2VASA 1QVFS 2LJ3A 4FW2A 3LLRA 2R58A 2K57A 4M75B 1ZBXA 2LP5A 4EIKA 2K3XA 3OSVA 3M54A 3CPWP 4ZTFA 3NFCA 4FYXB 3CCMQ 4C92D 1IRXA 1AEYA 4BE0A 4FSXA 5LJ5d 4KGVB 1W98B 1T0HA 5IDNB 4LUEA 3X20B 1RI0A 3OB9A 3OY9A 2KSSA 3L2UA 2QGGA 1BU1A 4RMOA 1WHJA 3LGLA 2QXFA 3TSWA 2KR6A 3TNIB 3C95A 1MV3A 1BCOA 1R8OB 1T0JA 2HBWA 3UA6A 2BS4A 3DLMA 1VQLA 5L8RE 1OX8A 2EYZA 3JB9H 1PHTA 2DKGA 2DO3A 1M90C 3CC7T 1IB8A 5J39A 4Z8AA 2OTJT 1SG5A 3EG9A 5GJWB 1VQMA 3A8GB 4E7JA 4HT9A 2L3SA 3RDVA 1H1RB 3EFOB 4K11A 4RUGA 1KD1C 3DOGB 2QQ9A 4PLIA 2EWNA 4JUVA 3QXEB 3GNFB 3OMCA 3BHTB 2L89A 1WJSA 2X1NB 2RI3A 2OJ2A 3V8KA 2WEVB 4M7AB 2DETA 2MI6A 4JRPA 1ABOA 2VB6A 3EFOA 1JXMA 3I55Q 1NLPC 4BBSM 1U3OA 4AFQC 4C8QB 2ED1A 4A4HA 4R55A 2RO0A 2C5VB 1S1NA 2JN0A 4HL4A 2RJEA 1ZBJA 2AZSA 1W2BA 5J3BA 4D6WA 3TN8B 1C9BA 4WCIA 1QVFP 2AK5A 2RK1A 4PJOG 1YITA 3G4SQ 2KBTA 1KG1A 4MZPA 2PNIA 2QA4A 1PNJA 3M56A 2CT4A 4HNVA 4BY6B 4J7IA 5DQVA 3OYGA 3HRSA 3M03A 3R6NA 3QDRB 4BCMD 1T3LA 4EOIB 3BY7A 1VQKQ 4EC8B 3MO8A 4CI0C 3UT1A 4MMKA 2KI7A 1KIKA 1OYXA 3OYDA 4YTLA 1N8RU 4Y92A 2LJ1A 5ECAA 4BCQD 2X4WA 5GAOq 5IAYA 1FYNA 2GNCA 5KE2A 3M0UA 4F16A 4A4FA 5DLQE 2X3WD 3SWNB 2FZGB 5GAOn 3CMEA 1YHQA 2MMPA 2MK5A 4FT4A 1LPLA 3G33B 3NMZC 3CXCP 2DFUA 3NGPA 4ZTJA 4M77F 3UDCA 1FX7A 2CSQA 5I2MA 4JPBW 2M02A 2DTIA 1VQ9T 1XO2A 1FXXA 4BB7A 2XU8A 3CC4Q 6AT1B 1SF9A 1PD0A 1EZZB 2E5QA 3F70A 3CXCA 1QKXA 1H8KA 2AKKA 1XOVA 1ZSZC 3G1JA 4N4IA 2K5IA 3PO3S 1H1PB 1ZSZA 5D7UA 1PC0A 1OV3A 2H8HA 1X27A 4A4EA 3WVDB 1PCXA 1KC8R 5LJ3f 2C6TB 3GP8A 4JRIA 2JGZB 2JTMA 2LQNA 3EG1A 2DL7A 3BW1A 3NTKA 5D6YA 2HSEB 2QDJA 2J6FA 4M77A 5LJ5f 1IREB 2CZ7B 2L3QA 2VC8A 3E9FA 2EFIA 2J05A 4QVZA 4M77E 4BE2A 4BCFB 1S72A 3V7SA 5FWCA 4OMQA 1D1AA 1QW1A 1E6HA 2EAYA 2RM4A 2E6ZA 3I56Q 4BDYA 2L2PA 3BG9A 1WYXA 2JJ9A 2DTOA 1D0XA 2KDSA 2AZVA 1OZ3A 1VQ8Q 3MP6A 2ZPEB 3UWNA 1N27A 2XDBA 3OYCA 5A0DA 2OTLT 2HD0A 3G7ZA 3L42A 3MEWA 2CSIA 1WX6A 1MMGA 5CAIA 1N5ZA 4ELZC 3PIOA 5LJ3g 2PK2A 3NHNA 4RTXA 4II5B 3I9QA 3M57A 2IW6B 4RCCA 1X43A 1UTIA 1KFZA 4M78G 1PKTA 1N4MA 2K4YA 1QVGS 1OI1A 1RADB 2QQBA 2V1RA 3JCMP 4AFSC 2CH4A 5GANe 3EGXA 3CCVT 5GANd 4EMHA 3G71A 2K79A 4M77G 1RL2A 2QF7A 2Y90A 2ZPIB 2KQWA 5GAMd 1BI2A 2RB6A 3OYIA 5IXBA 4BY1X 3R6OA 3NTIA 3QUIA 4R0KA 1OIUB 1YI2A 3CPFA 1OKWB 1EIFA 2LRQA 4BBRM 2DD5A 2JS2A 2EYXA 1I5LA 1E7OA 1URCB 1M4ZA 1UUEA 2P0QA 1RAAB 2CS7A 4BI8B 5A0GA 1Y71A 2RMOA 4KRCB 4M78D 4MZTA 3JCMX 2V8KA 2CZ6B 1FWZA 5M9OA 1N9RA 4M6VA 1WGSA 1D1CA 2YDLA 2J6KA 4ZGDB 2RNAA 3HO8A 1YJ9T 1B7TA 1WQ7A 4UC4A 2DXCA 1NLOC 4M75F 4BCND 4JS5A 5KH6A 3H8ZA 1SRMA 2EIFA 5GAOr 4DOWA 3EH1A 2G6FX 3C94A 2PHGA 3M59A 3TNHB 4JLGA 1BIBA 2LJ0A 4EORB 2GBQA 2DXCB 3OQ5A 2G3RA 3UATA 3OS2A 1R0BG 4LDYA 4NL3A 2WACA 2QASA 2LX7A 5HNBB 4CFUB 5LJ5h 1QVGA 5FU6C 2BS3A 2ECZA 1AWJA 2WIHB 5GAN5 2MYSA 4F7SB 2OAWA 5KYWA 4DEYA 4F6SB 3GOXA 3GTMS 5FRNA 4KULA 3JCMf 4LD9K 2R7GA 4Y28E 3J81E 3INZA 2MAMA 1VYWB 1M5Q1 5DQWA 2V8JA 1XTDA 1BK2A 3REAB 2LMJA 1A0NB 3OYJA 1OX9A 1ZSGA 2EJGA 4M77D 2VXEA 1LCKA 2DLPA 1AOJA 4CFMB 2FYKA 2K5FA 1JJ2S 4XU3A 5FW9A 1WPYA 2PQWA 1VQ4A 1VQLQ 4LD6A 3JCMV 1VQLT 3O0GD 1M1GA 3KHIA 4ELLA 5I2SA 3RIRA 2NYSA 5L23A 3VUBA 5HBJB 4J9CA 2E70A 5KE3A 3JCMJ 3M4YA 2WHBB 2LVMA 1CSKA 4XTYA 3CMAT 3CD6T 3ULRB 2DILA 2XG8D 3UA7A 2C0TA 2DX1A 2DPPB 4M4ZA 3CCQQ 2DF6A 1WXBA 4I3ZB 1Y96B 5CEIB 1FVVB 2C4GB 3TVTA 4BCJB 2UZBB 1MNDA 3OW2A 4M7DF 1JBMA 2LCLA 3E1SA 1XNIA 1VQKA 4ORZA 4QSHA 1OPKA 3CCSA 2XHCA 3PFSA 3L2ZA 2EJFA 3PNWC 3CCQT 3QWLA 2A7YA 4M75C 4ZGJB 2M0YA 1N9SA 1Q82R 1VOMA 2W2HA 3VS6A 3OS0A 2QA4T 1AVZC 4M7AF 4E7HA 1WHGA 4EOJB 4ROCA 2E65A 3H4CA 3OA6A 1YCSB 2E64A 5I22A 4LDXA 2JMAA 4JRQA 2M0OA 2K5LA 3GLXA 4IIMA 1RUWA 5HCKA 3KXTA 2ZCFB 3QBYA 5FU6B 3DDPB 1VQPA 3BDLA 5FWBA 3G6EQ 4CFWB 1Q82C 2SRCA 5ICPB 2YRCA 1BCMA 3CMEQ 4LDVA 4DBFA 3OYAA 1K9MR 1Y0MA 1WQWA 5KYXB 3F5XB 3C12A 2A37A 3VYGB 2DL3A 1MMAA 4ZN3A 1NEGA 2LZ6B 5A0LA 2L5QA 2YWWA 4CC7A 1UGRB 2DA9A 1BI0A 3EHQA 4NOYA 1VQ9A 5IN1A 4EOOB 1H1QB 2E10A 4JJDA 4L5GA 2HBPA 3D7SB 2D6FA 1SSFA 5IXFA 3TNWB 3O5ZA 2JNGA 3QYHB 1UGVA 2F69A 3JCMe 5GAMg 1VQ7A 4E7IA 3JCMd 1SPKA 2L8DA 1PRLC 2V22B 2AHJB 4F14A 5LJ3j 4G6LB 1I4K1 4IKFA 3I5RA 2DIGA 4Z02A 1K8AR 2WSFE 2EVRA 3E19A 3MEUA 4HA8A 1DJ7B 4ZNXA 2DBMA 3H6ZA 3CC2A 1NJIC 4BXXX 1RAHB 2HDAA 3FIFA 2YHTA 3Q1JA 1GXIE 3I56A 1UNHD 2UZEB 1TG0A 1G3WA 4AMCA 2V8IA 1VQ5A 1UGQB 3CPWS 2W10A 1ZSZB 1JO8A 5GAOm 1TUCA 5GAN2 1Q7YU 4BCQB 4RTVA 5FU7C 1OZ2A 2YRVA 3PT9A 2WMAB 4XAXB 4YOSA 2MOXA 4J5YA 4BCIB 5L2WB 1M2VB 1N8RC 1NZ9A 1Q7YR 1C6VX 1I07A 3NDQA 2JT4A 2FL7A 4RTYA 4QQGA 2FPFA 3ME9A 3EG9B 5GAMf 1KQ1A 3VS1A 5GAOp 1MMDA 4HLQA 4EOPB 1M1KU 4ELJA 5KCOA 4RG2A 1M2OA 3RKWA 2QYZA 1P92A 4X1VA 1XQHA 1UFFA 4CFUD 1WZOA 1VINA 2BE9B 2HL5C 2FVUA 4BCHB 4XTWA 3BHUB 2OTJQ 4KT0E 2RHYA 2RQUA 1WI7A 4HCZA 3BFMA 5HK0A 2GF7A 4IUVA 2O01E 3CCUA 2VV5A 1YN8A 2DYBA 3KFVA 2PUKB 3VKHA 1H641 3VS4A 2KRMA 5I11A 4QW2A 1WDXA 4M77C 5KYNA 5LQFB 1VQ5Q 2KROA 1VQKT 3HRTA 4PK4A 2UZLB 1KC8C 3CCST 1W2BP 4JJCA 4MMLA 3VJPA 1AWWA 4QVDA 4OMMA 5GANh 4D8KA 3RMQA 3ZEHA 3CC2Q 3SDZA 4KBMB 4ZGEB 2LT4A 1KQ2A 1IZ6A 3RGFB 1WHLA 3REBB 4PJJA 4Y72B 1OULA 2FB7A 2EUFA 3HSBA 4ANJA 4M7DD 5J26A 2PK9B 1UNGD 1FINB 1D0YA 1G83A 4IURA 3CCEA 4PJLA 4EOLB 1GCQC 3HFNA 4OVAA 2L3RA 2GGRA 3A1PA 1QCFA 5DM7R 3THKA 1I1JA 5CK9A 1HD3A 3CCRQ 2CP3A 3CCSQ 4DEXA 2VGMA 2B9RA 2HQEA 3OYKA 3PIPA 1K0SA 2O31A 3QZ5B 3CCJA 2EGCA 4FYVB 4IUTA 5CR2A 2P84A 4TVRA 3JAME 4HT8A 1KQSA 3A8LB 2BZYA 2XMFA 3HFOA 4E7LA 2OTJA 4QQ6A 1VQMT 1D09B 4GLMA 2HSPA 3AHUA 2LQKA 1PWTA 4X34A 2DXBA 4M78A 3VRYA 3I55A 1E9HB 2M16A 1YJNA 3JSCA 3CXCS 2PUOB 4EOMB 4DQ2A 5FROA 3RNJA 4DBRA 4ELYC 3I5SA 1WIEA 2JZ2A 2J06A 4ATOA 4KUIA 3EIDB 2YLBA 3RERA 4AKIA 5DY9A 5FU7B 3TCJA 2EW3A 3BG5A 1B07A 4LN2A 4J6YA 4C0GA 4BDZA 2O4XA 3EG0A 2DM1A 3S3NA 4PFZA 5HVYB 1K9MC 1VQ7Q 4OP0A 3MY5B 3JCMh 2GCXA 3MEAA 5HBHB 2L0AA 3QKJA 1YJWT 2B8AA 2D9TA 3TQ7P 3CCJQ 2EQJA 1M3AA 1JU5C 4JJNK 1VQOT 1M30A 1VQOQ 1Y07A 4IIOA 2RHXA 4B9XA 4C92F 1X75C 3TEEA 4M7AC 1QVPA 1G3YA 3LX7A 3QYBA 2KT1A 4JX4A 1K9AA 3HTRA 4OMFB 1YJWQ 2LNVA 1YJNQ 3P8BB 1NBEB 4F7UB 2E12A 3DJBA 1QLYA 4UN0A 2IG0A 2JW4A 4PJOB 1YI2Q 2AIRB 1D3BA 4BI3A 3M0QA 5KYYA 1YIJQ 3MI9B 3CC4A 3VS2A 3QWYA 1MNEA 2RHIA 2CP0A 1U1TA 2X51A 2R5AA 2R5MA 4F7UA 4E2FB 2V1QA 2YUNA 3MHXA 3LH5A 4MZMA 1VQ6T 1TD6A 3OS5A 2PVDB 1ZP2A 3BLRB 2JM9A 4M7AG 2KT8A 3SD4A 5GAN4 1ZQ1A 1LNXA 2YSQA 2OTLQ 2JXBA 4E7KA 2KVQG 1G2BA 4M7DA 3QJYA 4JLIA 2I2LA 4L59A 1J3TA 4LXCA 2WSEE 4M7DC 2IW8B 2K3YA 2RF0A 3M53A 4M7DE 1ZUKA 4Z6YA 2HEQA 4P5NA 1WLPB 3ZL7C 1JJ2P 4FT2A 2WPAB 2DAQA 3BHVB 2RH2A 1OOTA 5GMKl 1TS9A 4O5VA 1I0CA 1UHCA 1GL5A 1GCPA 3GPLA 1PKSA 2A28A 2K3BA 1VYVA 2VXFA 1UG1A 2X3XD 5HY6A 3V8LA 2G9XB 1SEMA 1OU9A 5KYUB 3VYHB 2O9SA 1E6GA 3QPHA 3QWXX 3M0PA 4E47A 1MUZA 3JB9J 1X69A 2QEXA 3VS7A 5A2QE 3VKIA 1OU8A 3PE0A 4EC9B 1AT1B 2X9HA 4CC3A 1QLBA 1D1BA 4HVUA 3E2UA 3QHWB 2EPDA 1F1BB 1HXDA 4RCBA 3VS3A 3EFSA 1JKWA 3ZBDA 3JB9G 3EHRA 4YC3B 1AD5A 3S3OA 4M7AA 2IVWA 4RG8A 4PJNA 2ZPBB 3HPWA 1WNLA 2PU9B 1H1SB 2K9GA 3EGDA 1YJNT 4OF1A 1OKVB 1ACMB 1W6XA 4QKUA 1T3SA 1H3HA 1KHIA 1I81A 2RJFA 2LQWA 3H41A 4CRLB 2KRSA 2ZPGB 4FYYB 2E41A 5GAN6 2KAFA 2DL4A 2E4HA 3EGDB 1JRIA 1R0CB 2V26A 3LW5E 2UUEB 3CC2T 5LJ5j 5FLXE 4N0AA 1YITT 3T9NA 1NM7A 4CXAB 3I56T 1VQ5T 1GRIA 4IUUA 2BIVA 3E9GA 1QCOA 1M90R 4DOVA 2ROTA 1QKWA 1M1KR 4C92E 3OYLA 4PFPA 2RPNA 2LTOA 2RQWA 1V29B 1CKAA 3QO3A 3JB9D 4DBHA 4C5EA 2DMOA 4FYWB 4XU0A 3CBMA 2KXCA 1UGSB 3PMTA 1BB9A 3FRNA 4GBQA 3CMET 1NPRA 2CJMB 2B86A 1XJWB 1PSFA 5LJ5g 3NPFA 1G3TA 4CFVB 2IN3A 4LNPA 1VQ6Q 2LQ8A 1KXUA 5HQ0B 2H3EB 5KYUA 2DL8A 3LH0A 3CC4T 1V1CA 2VYTA 2QGSA 4KH1B 1U5SA 3LYIA 2EQMA 4FW1A 3UPUA 4XU2A 4MDWA 3GIBA 1PD1A 3JCMc 4A53A 5GMKh 4CFNB 4M75D 4EOQB 2C5OB 2DL5A 2CDTA 1KQSS 4C8QC 3G4SA 3VS0A 2NUPB 3OYFA 4JZ4A 1WXTA 3EG3A 1YJ9Q 2ZZDB 3OYMA 3LQ5B 2NLUA 3CCRA 2DERA 4JX5A 3VUZA 2WXVB 3H0FA 3MPUB 4J6XA 4DA4A 2E3IA 5GJVB 2WJ9A 2JTFA 2XDPA 2C0OA 3N5BB 4XQ3A 1S72T 2LNHB 3FJ5A 1HSQA 4Z89A 1VYTA 3JRZA 4LDWA 2CCHB 3O8VA 5CYIB 2BKZB 2DMEA 2DRMA 1VOLA 5I21A 4E6RA 2F5KA 2YXYA 3CCMT 1VQNQ 2MF2A 3TSZA 3KBGA 1JJ2A 2CH4W 1FMVA 2IVXA 4RTWA 4JX6A 3DKMA 2OTLA 7AT1B 1TU0B 2XICA 2JM8A 4FCYA 3BLHB 1Q7YC 1K73C 2HKNA 4BUGA 4BE1A 2YUQA 3EFRA 4C5HA 1Q81C 1G3SA 4CC4B 1FMKA 3A98A 1H4LD 3POMA 3TW7A 4HVVA 2QQAA 1TOVA 2EJ9A 4FSSA 1QP3A 3FC3A 2A08A 3RESA 3EGXB 3QHRB 1B34A 1EX4A 2DBKA 3VS5A 2RI5A 4Z88A 5IHKA 1M3CA 3MCAB 1RI9A 1IGUA 4MIMA 5CKEA 5KCHA 4OB1B 2HAXA 3M0RA 2WFYB 4XTZA 2DEUA 3NTHA 3P8HA 2NUTA 2EQIA 2QFZA 1X01A 1OGUB 2EQKA 1G3NC 1ENWA 5CKDA 3RMSA 3JCMb 4XTVA 4OMLA 3M0SA 3M5AA 2O2OA 3CEYA 3PMIA 1P5EB 2P0PA 5GAN7 1ZX6A 1G8XA 1EFNA 4ME7A 1KC8U 2X35A 3S6WA 2F2CA 1WFWA 3UF4A 2NUPA 1VQOA 5D6XA 2LX9A 2QTVA 2EKOA 1NEBA 4HNUA 2ZZDA 2D8HA 4EOKB 2QDLA 3DB4A 4NSTB 4F7LB 3JB9I 1RAGB 2ABLA 1WXUA 4AKGA 4CC2A 4M7AE 1PM3A 5GAOl 2CYZB 3BLQB 3JCMg 1OL1B 3ER0A 2QG9B 1G5VA 5LJ3h 1E7PA 4FM4B 2DK3A 4M77B 4N0AC 1K1ZA 2FRWA 2DJZA 3CCLT 4EMKA 2DYIA 1TH7A 2I0NA 1K73R 3QIIA 4KRTA 1GBRA 1RAEB 4VUBA 4C92B 1YNZA 4M78E 2W0ZA 1UHFA 1CKBA 2IPOB 1SSHA 1R77A 3CMAQ 3CD6Q 1QQJA 2R57A 3M0TA 3OYEA 1B3QA 2DD5B 2LW4A 1VQ4Q 5LJ3d 1PKDB 3M4GA 2D0QB 2P0KA 1MMNA 1LOJA 4PKCC 4MDXA 1YP5A 2CUBA 4XTUA 2DE0X 1ZLMA 3EOCB 1Y57A 1K9MU 2BKDN 2MPXC 2SEMA 4F17A 2JTEA 1TSFA 4FX3B 2LCSA 3K7AM 1TWBA 1W2BS 1X2KA 2F2WA 2E6NA 3OSSC 3S3MA 4M75E 4AG1C 5C6SA 2EGEA 1C1AA 1YHQQ 1UEBA 3VU3C 1HK9A 2QAZA 1TFBA 1VQ4T 2KGTA 5AYFA 3JCMQ 2VWFA 1K8AC 5GMKi 4HCKA 3A8MB 4L6V5 4F7UG 3CCMA 2DZ9A 1JOWA 2QEXT 4NL2A 2RA2A 3G6ET 1F5QB 3FB9A 2W99A 1AZGB 4KUDK 1RLPC 3OYNA 1GFDA 2Y4XA 1PSEA 2EYQA 1BBZA 1VA7A
chains in the Genus database with same CATH topology
4ZGDB 5CCAA 3HO8A 1YJ9T 1WQ7A 4UC4A 3CC7A 2DXCA 2IG0A 4M75F 3QJ6A 4JS5A 3CMAA 3CD6A 4PJOB 5KH6A 1D3BA 2RHUA 3CBOA 3H8ZA 2QDYB 3PGGA 4Y91A 4BI3A 2EIFA 2QI2A 3HBLA 5GAOr 1M90U 3RUXA 4DOWA 5CKHA 4BACA 3CC4A 3C94A 2X4XA 4M78B 4GLKA 2RHIA 4C0ZA 1U1TA 3M59A 2R5AA 2R5MA 4F7UA 4JLGA 1Q82U 3MHXA 1BIBA 4MZMA 1VQ6T 2DXCB 3OQ5A 3QG1A 2G3RA 3OS5A 3OS2A 2CGHA 3GNGA 4LDYA 2WACA 2XIDA 4NL3A 3HZJA 2PVDB 3HL8A 4M75A 3RKYA 5LJ5h 1QVGA 2RJCA 3OW2S 5FU6C 1FKMA 2BS3A 5HK3A 3PTAA 1YIJA 1YCYA 2DEQA 5GMKe 4M7AG 1M8VA 2JUFA 4N4GA 3SD4A 5GAN5 1VQNT 5GAMj 3LWIA 2KMGA 1D3BB 4EPCA 3GOXA 2XKOC 1W4SA 5GAN4 4KULA 1ZQ1A 5FRNA 1LNXA 2RK2A 4ZN1A 4E7KA 3HB9A 3JCMf 2KVQG 4HCBA 4LD9K 2FHDA 5GANj 4Y28E 5DLOA 4M7DA 4QQDA 3J81E 3G71T 3QJYA 2LT1A 3JB9F 3INZA 4JLIA 2H3JA 2RD1A 2I2LA 4L59A 2MAMA 4EMKC 2QTXA 1M5Q1 2WSEE 4M7DC 2V8JA 2GFAA 1XTDA 2K3YA 3M53A 4M7DE 4V2SA 4Z6YA 4P5NA 5GANf 4FT2A 4JS4A 2DAQA 3WXMB 2ZPFB 3OYJA 5IT9E 4AI6A 2RH2A 4PJOC 2EJGA 3TW6A 4M77D 5GMKl 2VXEA 2HNIA 4O5VA 1YI2T 3ZFJA 3V7RA 2FYKA 2GFUA 4PJOE 2K5FA 3GPLA 4WF2A 3CCET 1JJ2S 1YBYA 1ZHIA 2DIQA 2VXFA 3CBPA 5CIUA 4XU3A 4PJOF 1Q86C 1VQ8T 5HY6A 3L2VA 2K2VA 1WPYA 4F7UE 2PQWA 4J8OA 3V8LA 1VQ4A 2DVEA 1U1SA 4LD6A 3JCMV 4AKHA 3VYHB 1M1GA 3QYEA 3KHIA 2XI9A 4O6JA 1VQLT 2RHZA 3DB3A 1Y7XA 5I2SA 3QPHA 2HQXA 1K8AU 3RIRA 3VYGA 1QVFA 4E47A 3X26B 4IUPA 1O9SA 4C5IA 4QVCA 3QSUA 3VUBA 3JB9J 4MFEA 2X4YA 3OBYA 2QEXA 4Q5WA 5A2QE 2CZ0B 4JRKA 3VKIA 4C0FA 3CCLA 2CZ1B 2E70A 3OBWA 4NC6A 4XU1A 2DXTA 3MEVA 1YHQT 3P8DA 3CCJT 2PVGB 2M1HA 1QLBA 1YJ9A 5KE3A 3JCMJ 1B34B 3X24B 3M4YA 1M1FA 2LVMA 5GAMh 4XTYA 3OYHA 1HXDA 3CMAT 4RCBA 2Y4YA 3CD6T 3LGFA 3SFMA 4JDSA 2XG8D 3EFSA 1BI3A 3ZBDA 5GMKj 5CKBA 4C0DB 1MGQA 3JB9G 5GAMe 3S3OA 3X25B 4GY5A 4M7AA 2KY9A 2IVWA 2DPPB 2XK0A 4RG8A 3M55A 2ZPBB 3HPWA 4M75G 1WNLA 2PU9B 3CCUT 1U8RA 1AHJB 1YJNT 1Y96B 4OF1A 2DD4A 5GANg 2DD4B 3QHSA 4HNTA 3G4ST 3OW2A 1KHIA 1I81A 1BI1A 2RJFA 4M7DF 1JBMA 2CKKA 2LCLA 1VUBA 1XNIA 3E1SA 3CPWA 1VQKA 4C5GA 2ZPGB 5CKFA 3HKSA 4QSHA 3J80E 2E41A 5GAN6 3L2QA 4C8QE 1YIJT 3CCSA 2KAFA 2XHCA 3L1AA 1VQNA 1H3ZA 3PFSA 3L2ZA 4PLLA 1JRIA 2EJFA 3LW5E 3PNWC 3CCQT 3QWLA 3SWNC 2A7YA 5LJ5j 3CC2T 1QVFS 2DZCA 5FLXE 4N0AA 3LLRA 4M75C 2R58A 4ZGJB 2K57A 4M75B 1YITT 1N9SA 4EDUA 1ZBXA 3T9NA 3HHTB 3OS0A 2K3XA 3I56T 2QA4T 4M7AF 3OSVA 4E7HA 3M54A 1VQ5T 4IUUA 5D6WA 2BIVA 4ZTFA 5EG2A 3E9GA 3NFCA 2GQVA 4C92D 2E65A 2MWOA 4DOVA 4FSXA 5LJ5d 4C92E 4BE0A 3H4CA 3OYLA 3OA6A 2LTOA 3X20B 1RI0A 2E64A 3OB9A 4J83A 1V29B 2QQ8A 2EYQA 2KSSA 4XK8E 2ZPHB 3OY9A 4LDXA 3L2UA 4JRQA 3QO3A 2XDDA 2M0OA 3META 3JB9D 1KD1U 2K5LA 3GLXA 4C5EA 1NJIU 3VV0A 4RMOA 3KXTA 3LGLA 2QXFA 4HKEA 3TU4K 4PJOD 2ZCFB 2KR6A 2X4JA 3QBYA 5FU6B 4XU0A 1WJRA 3C95A 1VQPA 1VQ8A 1R8OB 3BDLA 3CBMA 4M7AD 1Q82C 1UGSB 3G6EA 4CRIA 4C8QG 1KHCA 2BS4A 3DLMA 3PMTA 1VQLA 4OB3B 3FRNA 3OMGA 5L8RE 4LDVA 3JCMW 3JB9H 3CMET 1NPRA 4LDUA 2DKGA 2DO3A 3OYAA 3J7AF 1WQWA 1M90C 3C12A 5C0MA 1PSFA 5LJ5g 3CC7T 1G3TA 5J39A 3VYGB 3C4SA 5CQXA 3FEOA 2OTJT 2LQ8A 4ZN3A 3OYBA 5A0LA 1BKBA 1VQMA 3A8GB 4E7JA 4HT9A 2L5QA 4M7DB 3LH0A 1NE8A 1Q81U 1UGRB 3CC4T 2VYTA 1BI0A 2LCCA 5KCHA 4NOYA 1VQ9A 3X28B 3LYIA 2EQMA 5IN1A 1KD1C 4EMGA 3UPUA 2JOYA 4C92C 4XU2A 2E10A 2QQ9A 4L5GA 2EWNA 4MDWA 4JUVA 4PLIA 3GIBA 2HBPA 2PVOB 2D6FA 3QXEB 1X6OA 3GNFB 4IUQA 3OMCA 2L89A 1WJSA 3JCMc 2RI3A 1SSFA 4A53A 5GMKh 2JNGA 3QYHB 4M75D 2F69A 3V8KA 3JCMe 5GAMg 1VQ7A 4M7AB 4C92A 2BS2A 2MI6A 3CCVA 4JRPA 3JCMd 4E7IA 1KQSS 2L8DA 4C8QC 2AHJB 3FLGA 5LJ3j 4BBSM 3G4SA 1I4K1 3OYFA 4IKFA 4A4GA 1O75A 4C8QB 4R55A 4A4HA 2ZZDB 3OYMA 2RO0A 4OB2B 2DIGA 2JN0A 4HL4A 4Z02A 1Q86U 2WSFE 2RJDA 2RJEA 2E1HA 1W2BA 2NLUA 5J3BA 5GAN8 3CCRA 4JX5A 2MWPA 2YLCA 3E19A 4J6XA 3VUZA 4C8QD 4D6WA 4DA4A 3MEUA 4M7DG 2WJ9A 3BG3A 4HA8A 3CCQA 1DJ7B 2JTFA 3H6ZA 3CC2A 2XDPA 4M78C 4R56A 1NJIC 2RK1A 4PJOG 3N5BB 1YITA 4XQ3A 3FIFA 2YHTA 1QP2A 3Q1JA 1S72T 1KG1A 1GXIE 3HP9A 4MZPA 1K73U 3I56A 2QA4A 3M56A 4HCCA 1G3WA 4HNVA 2V8IA 4BY6B 3JRZA 1UGQB 4J7IA 1VQ5A 3OYGA 3HRSA 4LDWA 3CPWS 3O8VA 3QDRB 1WJQA 3BY7A 5I21A 2C06A 3MO8A 2F5KA 4CI0C 3UT1A 5GAOm 2EQUA 3CCMT 3GF5A 4BD3A 4X9CA 5GAN2 1Q7YU 4MMKA 5FU7C 1OYXA 1OZ2A 2YRVA 3PT9A 4XAXB 3OYDA 2MF2A 3KBGA 4J5YA 4YTLA 1N8RU 1JJ2A 4NS5A 3M9QA 1N8RC 4JX6A 3DKMA 1NZ9A 2OTLA 2XICA 2X4WA 5GAOq 4OGCA 5IAYA 4J6WA 2FL7A 1VQPT 5KE2A 4QQGA 3ME9A 1Q7YC 5GAMf 1K73C 1KQ1A 5GAOp 4A4FA 5DLQE 3SWNA 1BYMA 4HLQA 3SWNB 1M1KU 4BUGA 4BE1A 1UB4A 4ELJA 4C0DC 5KCOA 4RG2A 2VUBA 5GAOn 3EFRA 4C5HA 3CMEA 4II1A 3RKWA 1YHQA 1Q81C 1P92A 3M58A 1G3SA 1XQHA 3QYGB 2MMPA 2LC4A 3I55T 4FT4A 2P4TA 3TW7A 2QQAA 2FVUA 4XTWA 5FRMA 2EJ9A 3FC3A 1QP3A 3RESA 1Y96A 4ZTJA 4KT0E 2RHYA 4M77F 4C8QF 4HCZA 3UDCA 3RKXA 1FX7A 3BFMA 5HK0A 1B34A 2GF7A 5I2MA 2OAUA 4IUVA 2O01E 2QQSA 2RI5A 2DTIA 1M1KC 1VQ9T 3MCAB 3CCUA 1FXXA 3A8OB 2VV5A 4MIMA 1JB0E 2PUKB 1I8FA 2XU8A 5CKEA 2QQRA 4OB1B 3VKHA 1H641 2F5TX 2ZGWA 4BY6C 2HAXA 2E5QA 3DLLA 3F70A 4XTZA 3CXCA 3NTHA 3P8HA 4QW2A 4M77C 2QFZA 1X01A 1XOVA 4N4IA 2K5IA 2EQKA 3OS1A 1VQKT 5CQYA 2DXUA 3V7CA 3HRTA 5CKDA 1VQ7T 5GMKm 1KC8C 4F7UB 3RMSA 3JCMb 3KUFA 4A4EA 3CCST 3WVDB 4XTVA 3M5AA 4X9DA 3CEYA 4MMLA 3PMIA 5LJ3f 2P0PA 3VJPA 4QVDA 5GANh 3RMQA 3ZEHA 3GP8A 4JRIA 3SDZA 4KBMB 4ZGEB 2JTMA 2KK4A 5GAN7 1YJWA 2LT4A 1KQ2A 4A4KA 2KMTA 1IZ6A 2RI2A 3BW1A 3NTKA 4M78F 5D6YA 2QDJA 4ME7A 1KC8U 1VIEA 4M77A 5LJ5f 1IREB 1UGPB 2X35A 2CZ7B 3S6WA 2FB7A 2VC8A 3E9FA 3HSBA 3ASKA 2EFIA 5J26A 1VQOA 1NPPA 4BB7A 4M7DD 4QVZA 2DTHA 5D6XA 2LX9A 2G77A 4IURA 2EKOA 3CCEA 4HNUA 2ZZDA 4M77E 2DXBB 4BE2A 1S72A 3V7SA 3HFNA 3DB4A 4OVAA 3JB9I 2L3RA 1QW1A 3MP1A 4AKGA 4M7AE 5CVIA 5GAOl 2CYZB 2EAYA 2E6ZA 2RM4A 3JCMg 5DM7R 4BDYA 3BG9A 3ER0A 5CK9A 1G5VA 1BIAA 5LJ3h 4PJOA 1LJOA 2DTOA 2LDMA 2KDSA 1OZ3A 1E7PA 1MHNA 4FM4B 4MFDA 2DK3A 4M77B 3MP6A 4N0AC 4LOCA 2DJZA 2ZPEB 2BUDA 3UWNA 2VGMA 3CCLT 1N27A 4EMKA 2XDBA 3L2WA 5LL6S 2HQEA 3OYCA 3OYKA 3PIPA 1TH7A 3QZ5B 5A0DA 3CCJA 2OTLT 3QIIA 2HD0A 3A5ZB 4IUTA 5CR2A 3G7ZA 3L42A 3MEWA 4TVRA 4VUBA 4C92B 3JAME 1KQSA 4HT8A 3A8LB 3DL1A 4M78E 3HFOA 4A54A 4E7LA 5CAIA 1VQ6A 4QQ6A 2OTJA 4B9WA 1VQMT 1VIFA 3AHUA 5LJ5e 3V8JA 2LQKA 4ELZC 3PIOA 4C92G 4X34A 5LJ3g 2R57A 4F7UF 2DXBA 3M57A 4FU6A 4M78A 3I55A 3OYEA 3LWHA 4RCCA 3MP8A 2M16A 2DD5B 1YJNA 2A3LA 3JSCA 3CXCS 2PUOB 4XTXA 5LJ3d 2VGNA 3M4GA 4M78G 4N4HA 4DQ2A 5FROA 4ELYC 2K4YA 4PL6A 1QVGS 2D0QB 2P0KA 2JZ2A 1OI1A 1LOJA 3FJPA 4PKCC 4ATOA 2QQBA 4KUIA 2YLBA 4XTUA 3JCMP 4MDXA 4FIBA 3HRUA 5GAN3 5GANe 3RERA 2M9UA 3CCVT 5EJCA 4AKIA 2BKDN 1K9MU 5GANd 4EMHA 5DY9A 5FU7B 3G71A 3A8HB 4PNOA 4M77G 1RL2A 2QF7A 2Y90A 3TCJA 2ZPIB 3QZ9B 3BG5A 2KQWA 3EAEA 4J7FA 4BDZA 4J6YA 4C0GA 5GAMd 1BI2A 2JVVA 2O4XA 2RB6A 3L2RA 4RKUE 3OYIA 3TREA 3R6OA 3S3NA 3NTIA 3QUIA 4FL6A 2XD0A 3BDUA 3CCRT 1W2BS 1K9MC 2E6NA 4OP0A 4C8QA 3OSSC 3S3MA 1YI2A 3CPFA 3JCMh 5HKCA 4M75E 2GCXA 3MEAA 1EIFA 3QKJA 1YJWT 2B8AA 5C6SA 2D9TA 4BBRM 2LRQA 4OGEA 2DD5A 3SB2A 1UEBA 3VU3C 1HK9A 4BI4A 1I5LA 1VQ4T 2EQJA 5CO7A 1M4ZA 5LJ3e 3OYYA 5AYFA 2P0QA 4JJNK 1VQOT 1N6AA 2CS7A 3JCMQ 1K8AC 4BI8B 5A0GA 1Y07A 5GMKi 3A8MB 4L6V5 2RHXA 1Y71A 2O4XB 4B9XA 4C92F 1X75C 3TEEA 4M7AC 1QVPA 1M9SA 2WSCE 4F7UG 2DZ9A 1G3YA 3CCMA 3QYBA 3LX7A 2QEXT 4JX4A 4NL2A 3VKGA 4M78D 4MZTA 2RA2A 2V8KA 2CZ6B 1FWZA 4OMFB 3JCMX 5M9OA 3FB9A 3G6ET 4OB0B 1N9RA 2LNVA 4M6VA 3OYNA 4KUDK 2Y4XA 3P8BB 1PSEA 4EMKB 3WVEB 1WGSA 3URGA 2E12A 3FDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZGD B;  2DPP B;  2ZZD B;  2ZZD A;  4OB2 B;  2DXB B;  2ZPB B;  2PU9 B;  2WSF E;  2DXC A;  1AHJ B;  2DD4 A;  2DD4 B;  2QDY B;  2CYZ B;  1DJ7 B;  2ZPG B;  1QP2 A;  1GXI E;  4FM4 B;  1UGQ B;  2DXC B;  2ZPE B;  3LW5 E;  2PVD B;  4ZGJ B;  3QZ5 B;  3HHT B;  3A8L B;  2DXB A;  4Y28 E;  2DD5 B;  3X20 B;  2PUO B;  1V29 B;  4XK8 E;  2ZPH B;  2D0Q B;  2WSE E;  2ZCF B;  3QYG B;  2ZPF B;  1UGS B;  3A8H B;  1QP3 A;  2ZPI B;  3QZ9 B;  4OB3 B;  4KT0 E;  5L8R E;  2O01 E;  4RKU E;  3A8O B;  1JB0 E;  1PSF A;  2PUK B;  4OB1 B;  3VYG B;  3A8G B;  3VYH B;  1UGR B;  3VYG A;  3X28 B;  3X26 B;  2DD5 A;  2PVO B;  3WVD B;  2CZ0 B;  3QXE B;  2CZ1 B;  4ZGE B;  3A8M B;  4L6V 5;  2PVG B;  3QYH B;  3X24 B;  2WSC E;  1IRE B;  1UGP B;  2AHJ B;  2CZ6 B;  2CZ7 B;  4OB0 B;  1PSE A;  3WVE B;  3X25 B; 
#chains in the Genus database with same CATH topology
 2FEI A;  4HXJ A;  2K7A A;  4J9I A;  2ENM A;  3QJ6 A;  3CMA A;  3CD6 A;  4Y91 A;  4OMO A;  2QI2 A;  2F2V A;  2PZ1 A;  5CKH A;  3CCL Q;  1PRM C;  4M78 B;  4GLK A;  2O9V A;  2K6D A;  2PMI B;  3QG1 A;  1TUG B;  2D1X A;  2CGH A;  3VRZ A;  2XID A;  3OW2 S;  5HK3 A;  2DEQ A;  4HVW A;  1K4U S;  2JUF A;  2COZ A;  5GAM j;  3LWI A;  3H9N A;  1WHH A;  5DLO A;  4QQD A;  1H26 B;  1C0M A;  3JB9 F;  2LT1 A;  4JJB A;  1UNL D;  2BZX A;  3RBB B;  4V2S A;  5I5Z B;  3WXM B;  2W9F A;  4PJO C;  4RTU A;  2HNI A;  2EBP A;  5KYW B;  2EYY A;  4BCN B;  2PTK A;  3V7R A;  2GFU A;  4PJO E;  2A0F B;  4WF2 A;  3CCE T;  2DIQ A;  5IHI A;  3MKD A;  2CT3 A;  2K2V A;  4J8O A;  2DVE A;  4F04 B;  4AKH A;  3DTO A;  1H25 B;  3QYE A;  2XI9 A;  2RHZ A;  3DB3 A;  1Y7X A;  1K8A U;  1UJ0 A;  1WHK A;  3VYG A;  1O9S A;  2HMA A;  4C5I A;  4QVC A;  2KRN A;  4MFE A;  2X4Y A;  3OBY A;  1IHV A;  4BCO B;  1SHG A;  3G71 Q;  2CZ0 B;  4JRK A;  1M2V A;  4C0F A;  1UDL A;  2CZ1 B;  3CCL A;  1M8M A;  2DXT A;  2OX7 A;  1YHQ T;  3P8D A;  3CCJ T;  1YJ9 A;  2M1H A;  5IDP B;  2E5K A;  1B34 B;  2RQR A;  1X6B A;  5GAM h;  3OYH A;  1SHF A;  2NUZ A;  3LGF A;  3SFM A;  1BI3 A;  3CQT A;  5GAM e;  2KY9 A;  1OQK A;  3M55 A;  3B57 A;  4M75 G;  1AWO A;  2DD4 A;  4KGX B;  1JEG A;  4HNT A;  3G4S T;  1OI9 B;  4F7N B;  4F7J B;  4OMP A;  1IXD A;  1BI1 A;  2QGF B;  1Z9Z A;  2CKK A;  3CPW A;  5CKF A;  1YWP A;  3HKS A;  3L2Q A;  1YIJ T;  2E3H A;  2C5N B;  3L1A A;  1VQN A;  3GBQ A;  1AIS B;  4PLL A;  2I53 A;  3SWN C;  2FRY A;  5IHY A;  2DZC A;  1RLQ C;  4EDU A;  5KYX A;  3HHT B;  1JQQ A;  3H0H A;  5D6W A;  2YRD A;  5EG2 A;  1IHW A;  4OR5 B;  2GQV A;  2MWO A;  4J9F A;  2BE7 D;  1W1F A;  1V76 A;  2ZAE A;  1SKU B;  4J83 A;  1GUX B;  2QQ8 A;  4XK8 E;  4J9H A;  2ZPH B;  1KD1 U;  2XDD A;  3MET A;  2O88 A;  1NJI U;  1TXQ A;  3VV0 A;  3TU4 K;  4HKE A;  4PJO D;  2X4J A;  4ROE A;  1VQP Q;  5IH2 A;  1WJR A;  1D0Z A;  2NUT B;  1VQ8 A;  4M7A D;  1RAC B;  2VVK A;  3G6E A;  1I5O B;  4CRI A;  4C8Q G;  1KHC A;  2KEA A;  2K2M A;  4OB3 B;  3OMG A;  4CFX B;  3JCM W;  4J9B A;  4LDU A;  3J7A F;  5C0M A;  1RAI B;  3C4S A;  5CQX A;  3FEO A;  3OYB A;  1BKB A;  4M7D B;  2UZD B;  1NE8 A;  1Q81 U;  1KD1 R;  2LCC A;  4OMN A;  3X28 B;  4EMG A;  2JOY A;  4C92 C;  4EON B;  3EGU A;  2PVO B;  5EC7 A;  4F70 B;  1LVK A;  1X6O A;  3IQL A;  4IUQ A;  2HL3 A;  1IGQ A;  1ZA2 B;  3PVL A;  2BS2 A;  4C92 A;  3CCV A;  4ESR A;  1MV0 B;  2DVJ A;  3FLG A;  4J9D A;  2Z0W A;  1YIT Q;  4A4G A;  2HZY A;  4DBQ A;  1O75 A;  4OB2 B;  1Q86 U;  2ED0 A;  1ABQ A;  2RJD A;  1UJY A;  2E1H A;  2FPD A;  5GAN 8;  2MWP A;  2YLC A;  4C8Q D;  2IW9 B;  3QDF A;  5ACB A;  4M7D G;  1ZA1 B;  3BG3 A;  3CCQ A;  2DRK A;  3PVQ A;  2OI3 A;  4M78 C;  3MJX A;  4R56 A;  2J6O A;  1BU2 A;  1ZUU A;  2KNB B;  1QP2 A;  2GQI A;  3HP9 A;  1RAF B;  2CP6 A;  1K73 U;  1AZE A;  4HCC A;  2BTT A;  2COY A;  4YOZ A;  2KYB A;  1WJQ A;  2C06 A;  2EQU A;  5AT1 B;  2C5X B;  3GF5 A;  4BD3 A;  4X9C A;  3JV3 A;  1WHM A;  1K0X A;  1RAB B;  1AWX A;  4NS5 A;  3M9Q A;  4BCG B;  1GFC A;  4OGC A;  2W9Z A;  4J6W A;  1VQP T;  2MIO A;  1ZUY A;  1K76 A;  3EG2 A;  3SWN A;  1BYM A;  5IHN A;  1GCQ A;  1UB4 A;  1WA7 A;  4C0D C;  2VUB A;  1TUD A;  4II1 A;  3M58 A;  3QYG B;  3I55 T;  2LC4 A;  2RQT A;  2P4T A;  1YFN A;  1Z9Q A;  5FRM A;  1OIY B;  2W96 A;  4BCP B;  2D8J A;  1Y96 A;  1QVG P;  4C8Q F;  1OL2 B;  3RKX A;  2OAU A;  2QQS A;  1M1K C;  3A8O B;  1JB0 E;  1I8F A;  4J9G A;  2KR3 A;  2QQR A;  2F5T X;  2ZGW A;  4BY6 C;  1H24 B;  3DLL A;  3SEM A;  5HBE B;  4E7S A;  3OS1 A;  2M51 A;  2DXU A;  5CQY A;  3V7C A;  1VQ7 T;  5GMK m;  2HQH A;  1KQS P;  2VKN A;  2FPE A;  3KUF A;  2NWM A;  4X9D A;  1VQ9 Q;  1S72 Q;  2JMC A;  2KK4 A;  1YJW A;  4A63 B;  4A4K A;  2KMT A;  3MY1 B;  2RI2 A;  4RTT A;  2EGA A;  4M78 F;  2CRE A;  1VIE A;  1GH6 B;  1UGP B;  2FZK B;  1O9K B;  3ASK A;  2KYM A;  1NPP A;  2DTH A;  2BPM B;  4KRD B;  2G77 A;  1Q81 R;  2DXB B;  4BCM B;  1Q95 G;  3MP1 A;  2YUP A;  1KK7 A;  2DJQ A;  5CVI A;  2QA4 Q;  1BIA A;  1U06 A;  4PJO A;  1LJO A;  3EH2 A;  2LDM A;  1M3B A;  1MHN A;  4MFD A;  4LOC A;  2BUD A;  2KE9 A;  3BE3 A;  3CCE Q;  2P4R A;  4EOS B;  3L2W A;  5LL6 S;  1QWF A;  1H92 A;  5BNJ B;  3A5Z B;  2ROL A;  2AKL A;  3DL1 A;  4A54 A;  2PJQ A;  1VQ6 A;  4B9W A;  1VIF A;  5LJ5 e;  1O9K A;  9ATC B;  3H0I A;  4D8D A;  4PFO A;  5EFQ B;  3V8J A;  4C92 G;  2GTO A;  4F7U F;  4FU6 A;  3DDQ B;  3LWH A;  3MP8 A;  2A3L A;  4XTX A;  1IO6 A;  2EYW A;  2VGN A;  4N4H A;  4PL6 A;  4PJM A;  3SHW A;  3FJP A;  2FO0 A;  3HRU A;  4FIB A;  5GAN 3;  2M9U A;  2QEX Q;  5EJC A;  3EJ1 B;  3AT1 B;  3A8H B;  4PNO A;  3C0C A;  1OEB A;  1NG2 A;  3QZ9 B;  1X6G A;  1QMZ B;  3EAE A;  4J7F A;  2D0N A;  2JVV A;  1PG5 B;  3L2R A;  1H28 B;  4RKU E;  3TRE A;  3I35 A;  4FL6 A;  2XD0 A;  3BDU A;  3CCR T;  1NYG A;  4BY7 X;  1Q86 C;  4C8Q A;  5HKC A;  2COW A;  4WTO B;  1UEC A;  4OGE A;  4F6U B;  1ARK A;  3SB2 A;  4BI4 A;  4E7Z A;  2DNU A;  5CO7 A;  1HJD A;  5LJ3 e;  3OYY A;  5FGK B;  1N6A A;  1VYU A;  2F2X A;  2O4X B;  1X2Q A;  1M9S A;  2WSC E;  1VQM Q;  2RN8 A;  1M27 C;  2FG0 A;  3CCU Q;  3CCV Q;  3VKG A;  4OB0 B;  4EMK B;  3WVE B;  2J7I A;  3URG A;  4B6M A;  5GAN g;  2CP5 A;  2WMB B;  3FDR A;  3RUX A;  5CCA A;  3CC7 A;  2FZC B;  2ESW A;  3PGG A;  2RHU A;  3CBO A;  1M90 U;  2QDY B;  3HBL A;  3U23 A;  4BAC A;  4JZ3 A;  2X4X A;  4C0Z A;  4AFZ C;  3OW2 P;  1Q82 U;  1QWE A;  1KSW A;  1JSU B;  3GNG A;  2RQV A;  3HZJ A;  4M75 A;  5IF1 B;  3HL8 A;  3RKY A;  2AT1 B;  1GUX A;  2RJC A;  1FKM A;  3PTA A;  1YIJ A;  4IMY B;  1YCY A;  2IIM A;  5GMK e;  1M8V A;  4AFU C;  2GTJ A;  4N4G A;  1VQN T;  2KMG A;  1D3B B;  4EPC A;  2XKO C;  5KYY B;  1W4S A;  1GBQ A;  1UE9 A;  2RK2 A;  4ZN1 A;  1NJI R;  4AT1 B;  3HB9 A;  4HCB A;  4KH0 B;  2HCK A;  4F6W B;  2FHD A;  5GAN j;  3G71 T;  2H3J A;  2RD1 A;  1OPL A;  4EMK C;  2QTX A;  4ROD A;  2GFA A;  4QT7 A;  1D3U B;  5GAN f;  1W70 A;  2HKQ B;  4JS4 A;  3MIA B;  2ZPF B;  5IT9 E;  4AI6 A;  2EKH A;  4OGR B;  1TTH B;  3TW6 A;  2L3P A;  1YI2 T;  3CC7 Q;  3ZFJ A;  4LE9 A;  2YUO A;  4BCK B;  1YBY A;  1ZHI A;  3CBP A;  1H27 B;  5CIU A;  1N8R R;  1HYO A;  2YT6 A;  2KXD A;  4PJO F;  1VQ8 T;  3L2V A;  4F7U E;  1GY3 B;  1U1S A;  4O6J A;  2HQX A;  1JXO A;  4AG2 C;  2CCI B;  1QVF A;  3X26 B;  4IUP A;  3QSU A;  4KGZ B;  1JST B;  2QK0 A;  4Q5W A;  2MCN A;  8AT1 B;  2A36 A;  3OBW A;  4NC6 A;  4XU1 A;  2CP7 A;  1QMC A;  3MEV A;  2ATC B;  2PVG B;  4RTZ A;  4LUD A;  3X24 B;  2CUD A;  1M1F A;  2Y4Y A;  4JDS A;  5GMK j;  5CKB A;  4C0D B;  1MGQ A;  3X25 B;  4GY5 A;  3RR6 A;  2CP2 A;  1KJW A;  2XK0 A;  1QCN A;  3CCU T;  1U8R A;  1AHJ B;  1SRL A;  1FMW A;  5LMK B;  2C0I A;  2DD4 B;  3QHS A;  4J9E A;  2WIP B;  1YWO A;  1NYF A;  2BZ8 A;  1Q86 R;  4YOO A;  1VUB A;  2F1L A;  4C5G A;  2JS0 A;  3J80 E;  8ATC B;  4C8Q E;  2I40 B;  4TTH A;  1H3Z A;  1AD6 A;  2VAS A;  1QVF S;  2LJ3 A;  4FW2 A;  3LLR A;  2R58 A;  2K57 A;  4M75 B;  1ZBX A;  2LP5 A;  4EIK A;  2K3X A;  3OSV A;  3M54 A;  3CPW P;  4ZTF A;  3NFC A;  4FYX B;  3CCM Q;  4C92 D;  1IRX A;  1AEY A;  4BE0 A;  4FSX A;  5LJ5 d;  4KGV B;  1W98 B;  1T0H A;  5IDN B;  4LUE A;  3X20 B;  1RI0 A;  3OB9 A;  3OY9 A;  2KSS A;  3L2U A;  2QGG A;  1BU1 A;  4RMO A;  1WHJ A;  3LGL A;  2QXF A;  3TSW A;  2KR6 A;  3TNI B;  3C95 A;  1MV3 A;  1BCO A;  1R8O B;  1T0J A;  2HBW A;  3UA6 A;  2BS4 A;  3DLM A;  1VQL A;  5L8R E;  1OX8 A;  2EYZ A;  3JB9 H;  1PHT A;  2DKG A;  2DO3 A;  1M90 C;  3CC7 T;  1IB8 A;  5J39 A;  4Z8A A;  2OTJ T;  1SG5 A;  3EG9 A;  5GJW B;  1VQM A;  3A8G B;  4E7J A;  4HT9 A;  2L3S A;  3RDV A;  1H1R B;  3EFO B;  4K11 A;  4RUG A;  1KD1 C;  3DOG B;  2QQ9 A;  4PLI A;  2EWN A;  4JUV A;  3QXE B;  3GNF B;  3OMC A;  3BHT B;  2L89 A;  1WJS A;  2X1N B;  2RI3 A;  2OJ2 A;  3V8K A;  2WEV B;  4M7A B;  2DET A;  2MI6 A;  4JRP A;  1ABO A;  2VB6 A;  3EFO A;  1JXM A;  3I55 Q;  1NLP C;  4BBS M;  1U3O A;  4AFQ C;  4C8Q B;  2ED1 A;  4A4H A;  4R55 A;  2RO0 A;  2C5V B;  1S1N A;  2JN0 A;  4HL4 A;  2RJE A;  1ZBJ A;  2AZS A;  1W2B A;  5J3B A;  4D6W A;  3TN8 B;  1C9B A;  4WCI A;  1QVF P;  2AK5 A;  2RK1 A;  4PJO G;  1YIT A;  3G4S Q;  2KBT A;  1KG1 A;  4MZP A;  2PNI A;  2QA4 A;  1PNJ A;  3M56 A;  2CT4 A;  4HNV A;  4BY6 B;  4J7I A;  5DQV A;  3OYG A;  3HRS A;  3M03 A;  3R6N A;  3QDR B;  4BCM D;  1T3L A;  4EOI B;  3BY7 A;  1VQK Q;  4EC8 B;  3MO8 A;  4CI0 C;  3UT1 A;  4MMK A;  2KI7 A;  1KIK A;  1OYX A;  3OYD A;  4YTL A;  1N8R U;  4Y92 A;  2LJ1 A;  5ECA A;  4BCQ D;  2X4W A;  5GAO q;  5IAY A;  1FYN A;  2GNC A;  5KE2 A;  3M0U A;  4F16 A;  4A4F A;  5DLQ E;  2X3W D;  3SWN B;  2FZG B;  5GAO n;  3CME A;  1YHQ A;  2MMP A;  2MK5 A;  4FT4 A;  1LPL A;  3G33 B;  3NMZ C;  3CXC P;  2DFU A;  3NGP A;  4ZTJ A;  4M77 F;  3UDC A;  1FX7 A;  2CSQ A;  5I2M A;  4JPB W;  2M02 A;  2DTI A;  1VQ9 T;  1XO2 A;  1FXX A;  4BB7 A;  2XU8 A;  3CC4 Q;  6AT1 B;  1SF9 A;  1PD0 A;  1EZZ B;  2E5Q A;  3F70 A;  3CXC A;  1QKX A;  1H8K A;  2AKK A;  1XOV A;  1ZSZ C;  3G1J A;  4N4I A;  2K5I A;  3PO3 S;  1H1P B;  1ZSZ A;  5D7U A;  1PC0 A;  1OV3 A;  2H8H A;  1X27 A;  4A4E A;  3WVD B;  1PCX A;  1KC8 R;  5LJ3 f;  2C6T B;  3GP8 A;  4JRI A;  2JGZ B;  2JTM A;  2LQN A;  3EG1 A;  2DL7 A;  3BW1 A;  3NTK A;  5D6Y A;  2HSE B;  2QDJ A;  2J6F A;  4M77 A;  5LJ5 f;  1IRE B;  2CZ7 B;  2L3Q A;  2VC8 A;  3E9F A;  2EFI A;  2J05 A;  4QVZ A;  4M77 E;  4BE2 A;  4BCF B;  1S72 A;  3V7S A;  5FWC A;  4OMQ A;  1D1A A;  1QW1 A;  1E6H A;  2EAY A;  2RM4 A;  2E6Z A;  3I56 Q;  4BDY A;  2L2P A;  3BG9 A;  1WYX A;  2JJ9 A;  2DTO A;  1D0X A;  2KDS A;  2AZV A;  1OZ3 A;  1VQ8 Q;  3MP6 A;  2ZPE B;  3UWN A;  1N27 A;  2XDB A;  3OYC A;  5A0D A;  2OTL T;  2HD0 A;  3G7Z A;  3L42 A;  3MEW A;  2CSI A;  1WX6 A;  1MMG A;  5CAI A;  1N5Z A;  4ELZ C;  3PIO A;  5LJ3 g;  2PK2 A;  3NHN A;  4RTX A;  4II5 B;  3I9Q A;  3M57 A;  2IW6 B;  4RCC A;  1X43 A;  1UTI A;  1KFZ A;  4M78 G;  1PKT A;  1N4M A;  2K4Y A;  1QVG S;  1OI1 A;  1RAD B;  2QQB A;  2V1R A;  3JCM P;  4AFS C;  2CH4 A;  5GAN e;  3EGX A;  3CCV T;  5GAN d;  4EMH A;  3G71 A;  2K79 A;  4M77 G;  1RL2 A;  2QF7 A;  2Y90 A;  2ZPI B;  2KQW A;  5GAM d;  1BI2 A;  2RB6 A;  3OYI A;  5IXB A;  4BY1 X;  3R6O A;  3NTI A;  3QUI A;  4R0K A;  1OIU B;  1YI2 A;  3CPF A;  1OKW B;  1EIF A;  2LRQ A;  4BBR M;  2DD5 A;  2JS2 A;  2EYX A;  1I5L A;  1E7O A;  1URC B;  1M4Z A;  1UUE A;  2P0Q A;  1RAA B;  2CS7 A;  4BI8 B;  5A0G A;  1Y71 A;  2RMO A;  4KRC B;  4M78 D;  4MZT A;  3JCM X;  2V8K A;  2CZ6 B;  1FWZ A;  5M9O A;  1N9R A;  4M6V A;  1WGS A;  1D1C A;  2YDL A;  2J6K A;  4ZGD B;  2RNA A;  3HO8 A;  1YJ9 T;  1B7T A;  1WQ7 A;  4UC4 A;  2DXC A;  1NLO C;  4M75 F;  4BCN D;  4JS5 A;  5KH6 A;  3H8Z A;  1SRM A;  2EIF A;  5GAO r;  4DOW A;  3EH1 A;  2G6F X;  3C94 A;  2PHG A;  3M59 A;  3TNH B;  4JLG A;  1BIB A;  2LJ0 A;  4EOR B;  2GBQ A;  2DXC B;  3OQ5 A;  2G3R A;  3UAT A;  3OS2 A;  1R0B G;  4LDY A;  4NL3 A;  2WAC A;  2QAS A;  2LX7 A;  5HNB B;  4CFU B;  5LJ5 h;  1QVG A;  5FU6 C;  2BS3 A;  2ECZ A;  1AWJ A;  2WIH B;  5GAN 5;  2MYS A;  4F7S B;  2OAW A;  5KYW A;  4DEY A;  4F6S B;  3GOX A;  3GTM S;  5FRN A;  4KUL A;  3JCM f;  4LD9 K;  2R7G A;  4Y28 E;  3J81 E;  3INZ A;  2MAM A;  1VYW B;  1M5Q 1;  5DQW A;  2V8J A;  1XTD A;  1BK2 A;  3REA B;  2LMJ A;  1A0N B;  3OYJ A;  1OX9 A;  1ZSG A;  2EJG A;  4M77 D;  2VXE A;  1LCK A;  2DLP A;  1AOJ A;  4CFM B;  2FYK A;  2K5F A;  1JJ2 S;  4XU3 A;  5FW9 A;  1WPY A;  2PQW A;  1VQ4 A;  1VQL Q;  4LD6 A;  3JCM V;  1VQL T;  3O0G D;  1M1G A;  3KHI A;  4ELL A;  5I2S A;  3RIR A;  2NYS A;  5L23 A;  3VUB A;  5HBJ B;  4J9C A;  2E70 A;  5KE3 A;  3JCM J;  3M4Y A;  2WHB B;  2LVM A;  1CSK A;  4XTY A;  3CMA T;  3CD6 T;  3ULR B;  2DIL A;  2XG8 D;  3UA7 A;  2C0T A;  2DX1 A;  2DPP B;  4M4Z A;  3CCQ Q;  2DF6 A;  1WXB A;  4I3Z B;  1Y96 B;  5CEI B;  1FVV B;  2C4G B;  3TVT A;  4BCJ B;  2UZB B;  1MND A;  3OW2 A;  4M7D F;  1JBM A;  2LCL A;  3E1S A;  1XNI A;  1VQK A;  4ORZ A;  4QSH A;  1OPK A;  3CCS A;  2XHC A;  3PFS A;  3L2Z A;  2EJF A;  3PNW C;  3CCQ T;  3QWL A;  2A7Y A;  4M75 C;  4ZGJ B;  2M0Y A;  1N9S A;  1Q82 R;  1VOM A;  2W2H A;  3VS6 A;  3OS0 A;  2QA4 T;  1AVZ C;  4M7A F;  4E7H A;  1WHG A;  4EOJ B;  4ROC A;  2E65 A;  3H4C A;  3OA6 A;  1YCS B;  2E64 A;  5I22 A;  4LDX A;  2JMA A;  4JRQ A;  2M0O A;  2K5L A;  3GLX A;  4IIM A;  1RUW A;  5HCK A;  3KXT A;  2ZCF B;  3QBY A;  5FU6 B;  3DDP B;  1VQP A;  3BDL A;  5FWB A;  3G6E Q;  4CFW B;  1Q82 C;  2SRC A;  5ICP B;  2YRC A;  1BCM A;  3CME Q;  4LDV A;  4DBF A;  3OYA A;  1K9M R;  1Y0M A;  1WQW A;  5KYX B;  3F5X B;  3C12 A;  2A37 A;  3VYG B;  2DL3 A;  1MMA A;  4ZN3 A;  1NEG A;  2LZ6 B;  5A0L A;  2L5Q A;  2YWW A;  4CC7 A;  1UGR B;  2DA9 A;  1BI0 A;  3EHQ A;  4NOY A;  1VQ9 A;  5IN1 A;  4EOO B;  1H1Q B;  2E10 A;  4JJD A;  4L5G A;  2HBP A;  3D7S B;  2D6F A;  1SSF A;  5IXF A;  3TNW B;  3O5Z A;  2JNG A;  3QYH B;  1UGV A;  2F69 A;  3JCM e;  5GAM g;  1VQ7 A;  4E7I A;  3JCM d;  1SPK A;  2L8D A;  1PRL C;  2V22 B;  2AHJ B;  4F14 A;  5LJ3 j;  4G6L B;  1I4K 1;  4IKF A;  3I5R A;  2DIG A;  4Z02 A;  1K8A R;  2WSF E;  2EVR A;  3E19 A;  3MEU A;  4HA8 A;  1DJ7 B;  4ZNX A;  2DBM A;  3H6Z A;  3CC2 A;  1NJI C;  4BXX X;  1RAH B;  2HDA A;  3FIF A;  2YHT A;  3Q1J A;  1GXI E;  3I56 A;  1UNH D;  2UZE B;  1TG0 A;  1G3W A;  4AMC A;  2V8I A;  1VQ5 A;  1UGQ B;  3CPW S;  2W10 A;  1ZSZ B;  1JO8 A;  5GAO m;  1TUC A;  5GAN 2;  1Q7Y U;  4BCQ B;  4RTV A;  5FU7 C;  1OZ2 A;  2YRV A;  3PT9 A;  2WMA B;  4XAX B;  4YOS A;  2MOX A;  4J5Y A;  4BCI B;  5L2W B;  1M2V B;  1N8R C;  1NZ9 A;  1Q7Y R;  1C6V X;  1I07 A;  3NDQ A;  2JT4 A;  2FL7 A;  4RTY A;  4QQG A;  2FPF A;  3ME9 A;  3EG9 B;  5GAM f;  1KQ1 A;  3VS1 A;  5GAO p;  1MMD A;  4HLQ A;  4EOP B;  1M1K U;  4ELJ A;  5KCO A;  4RG2 A;  1M2O A;  3RKW A;  2QYZ A;  1P92 A;  4X1V A;  1XQH A;  1UFF A;  4CFU D;  1WZO A;  1VIN A;  2BE9 B;  2HL5 C;  2FVU A;  4BCH B;  4XTW A;  3BHU B;  2OTJ Q;  4KT0 E;  2RHY A;  2RQU A;  1WI7 A;  4HCZ A;  3BFM A;  5HK0 A;  2GF7 A;  4IUV A;  2O01 E;  3CCU A;  2VV5 A;  1YN8 A;  2DYB A;  3KFV A;  2PUK B;  3VKH A;  1H64 1;  3VS4 A;  2KRM A;  5I11 A;  4QW2 A;  1WDX A;  4M77 C;  5KYN A;  5LQF B;  1VQ5 Q;  2KRO A;  1VQK T;  3HRT A;  4PK4 A;  2UZL B;  1KC8 C;  3CCS T;  1W2B P;  4JJC A;  4MML A;  3VJP A;  1AWW A;  4QVD A;  4OMM A;  5GAN h;  4D8K A;  3RMQ A;  3ZEH A;  3CC2 Q;  3SDZ A;  4KBM B;  4ZGE B;  2LT4 A;  1KQ2 A;  1IZ6 A;  3RGF B;  1WHL A;  3REB B;  4PJJ A;  4Y72 B;  1OUL A;  2FB7 A;  2EUF A;  3HSB A;  4ANJ A;  4M7D D;  5J26 A;  2PK9 B;  1UNG D;  1FIN B;  1D0Y A;  1G83 A;  4IUR A;  3CCE A;  4PJL A;  4EOL B;  1GCQ C;  3HFN A;  4OVA A;  2L3R A;  2GGR A;  3A1P A;  1QCF A;  5DM7 R;  3THK A;  1I1J A;  5CK9 A;  1HD3 A;  3CCR Q;  2CP3 A;  3CCS Q;  4DEX A;  2VGM A;  2B9R A;  2HQE A;  3OYK A;  3PIP A;  1K0S A;  2O31 A;  3QZ5 B;  3CCJ A;  2EGC A;  4FYV B;  4IUT A;  5CR2 A;  2P84 A;  4TVR A;  3JAM E;  4HT8 A;  1KQS A;  3A8L B;  2BZY A;  2XMF A;  3HFO A;  4E7L A;  2OTJ A;  4QQ6 A;  1VQM T;  1D09 B;  4GLM A;  2HSP A;  3AHU A;  2LQK A;  1PWT A;  4X34 A;  2DXB A;  4M78 A;  3VRY A;  3I55 A;  1E9H B;  2M16 A;  1YJN A;  3JSC A;  3CXC S;  2PUO B;  4EOM B;  4DQ2 A;  5FRO A;  3RNJ A;  4DBR A;  4ELY C;  3I5S A;  1WIE A;  2JZ2 A;  2J06 A;  4ATO A;  4KUI A;  3EID B;  2YLB A;  3RER A;  4AKI A;  5DY9 A;  5FU7 B;  3TCJ A;  2EW3 A;  3BG5 A;  1B07 A;  4LN2 A;  4J6Y A;  4C0G A;  4BDZ A;  2O4X A;  3EG0 A;  2DM1 A;  3S3N A;  4PFZ A;  5HVY B;  1K9M C;  1VQ7 Q;  4OP0 A;  3MY5 B;  3JCM h;  2GCX A;  3MEA A;  5HBH B;  2L0A A;  3QKJ A;  1YJW T;  2B8A A;  2D9T A;  3TQ7 P;  3CCJ Q;  2EQJ A;  1M3A A;  1JU5 C;  4JJN K;  1VQO T;  1M30 A;  1VQO Q;  1Y07 A;  4IIO A;  2RHX A;  4B9X A;  4C92 F;  1X75 C;  3TEE A;  4M7A C;  1QVP A;  1G3Y A;  3LX7 A;  3QYB A;  2KT1 A;  4JX4 A;  1K9A A;  3HTR A;  4OMF B;  1YJW Q;  2LNV A;  1YJN Q;  3P8B B;  1NBE B;  4F7U B;  2E12 A;  3DJB A;  1QLY A;  4UN0 A;  2IG0 A;  2JW4 A;  4PJO B;  1YI2 Q;  2AIR B;  1D3B A;  4BI3 A;  3M0Q A;  5KYY A;  1YIJ Q;  3MI9 B;  3CC4 A;  3VS2 A;  3QWY A;  1MNE A;  2RHI A;  2CP0 A;  1U1T A;  2X51 A;  2R5A A;  2R5M A;  4F7U A;  4E2F B;  2V1Q A;  2YUN A;  3MHX A;  3LH5 A;  4MZM A;  1VQ6 T;  1TD6 A;  3OS5 A;  2PVD B;  1ZP2 A;  3BLR B;  2JM9 A;  4M7A G;  2KT8 A;  3SD4 A;  5GAN 4;  1ZQ1 A;  1LNX A;  2YSQ A;  2OTL Q;  2JXB A;  4E7K A;  2KVQ G;  1G2B A;  4M7D A;  3QJY A;  4JLI A;  2I2L A;  4L59 A;  1J3T A;  4LXC A;  2WSE E;  4M7D C;  2IW8 B;  2K3Y A;  2RF0 A;  3M53 A;  4M7D E;  1ZUK A;  4Z6Y A;  2HEQ A;  4P5N A;  1WLP B;  3ZL7 C;  1JJ2 P;  4FT2 A;  2WPA B;  2DAQ A;  3BHV B;  2RH2 A;  1OOT A;  5GMK l;  1TS9 A;  4O5V A;  1I0C A;  1UHC A;  1GL5 A;  1GCP A;  3GPL A;  1PKS A;  2A28 A;  2K3B A;  1VYV A;  2VXF A;  1UG1 A;  2X3X D;  5HY6 A;  3V8L A;  2G9X B;  1SEM A;  1OU9 A;  5KYU B;  3VYH B;  2O9S A;  1E6G A;  3QPH A;  3QWX X;  3M0P A;  4E47 A;  1MUZ A;  3JB9 J;  1X69 A;  2QEX A;  3VS7 A;  5A2Q E;  3VKI A;  1OU8 A;  3PE0 A;  4EC9 B;  1AT1 B;  2X9H A;  4CC3 A;  1QLB A;  1D1B A;  4HVU A;  3E2U A;  3QHW B;  2EPD A;  1F1B B;  1HXD A;  4RCB A;  3VS3 A;  3EFS A;  1JKW A;  3ZBD A;  3JB9 G;  3EHR A;  4YC3 B;  1AD5 A;  3S3O A;  4M7A A;  2IVW A;  4RG8 A;  4PJN A;  2ZPB B;  3HPW A;  1WNL A;  2PU9 B;  1H1S B;  2K9G A;  3EGD A;  1YJN T;  4OF1 A;  1OKV B;  1ACM B;  1W6X A;  4QKU A;  1T3S A;  1H3H A;  1KHI A;  1I81 A;  2RJF A;  2LQW A;  3H41 A;  4CRL B;  2KRS A;  2ZPG B;  4FYY B;  2E41 A;  5GAN 6;  2KAF A;  2DL4 A;  2E4H A;  3EGD B;  1JRI A;  1R0C B;  2V26 A;  3LW5 E;  2UUE B;  3CC2 T;  5LJ5 j;  5FLX E;  4N0A A;  1YIT T;  3T9N A;  1NM7 A;  4CXA B;  3I56 T;  1VQ5 T;  1GRI A;  4IUU A;  2BIV A;  3E9G A;  1QCO A;  1M90 R;  4DOV A;  2ROT A;  1QKW A;  1M1K R;  4C92 E;  3OYL A;  4PFP A;  2RPN A;  2LTO A;  2RQW A;  1V29 B;  1CKA A;  3QO3 A;  3JB9 D;  4DBH A;  4C5E A;  2DMO A;  4FYW B;  4XU0 A;  3CBM A;  2KXC A;  1UGS B;  3PMT A;  1BB9 A;  3FRN A;  4GBQ A;  3CME T;  1NPR A;  2CJM B;  2B86 A;  1XJW B;  1PSF A;  5LJ5 g;  3NPF A;  1G3T A;  4CFV B;  2IN3 A;  4LNP A;  1VQ6 Q;  2LQ8 A;  1KXU A;  5HQ0 B;  2H3E B;  5KYU A;  2DL8 A;  3LH0 A;  3CC4 T;  1V1C A;  2VYT A;  2QGS A;  4KH1 B;  1U5S A;  3LYI A;  2EQM A;  4FW1 A;  3UPU A;  4XU2 A;  4MDW A;  3GIB A;  1PD1 A;  3JCM c;  4A53 A;  5GMK h;  4CFN B;  4M75 D;  4EOQ B;  2C5O B;  2DL5 A;  2CDT A;  1KQS S;  4C8Q C;  3G4S A;  3VS0 A;  2NUP B;  3OYF A;  4JZ4 A;  1WXT A;  3EG3 A;  1YJ9 Q;  2ZZD B;  3OYM A;  3LQ5 B;  2NLU A;  3CCR A;  2DER A;  4JX5 A;  3VUZ A;  2WXV B;  3H0F A;  3MPU B;  4J6X A;  4DA4 A;  2E3I A;  5GJV B;  2WJ9 A;  2JTF A;  2XDP A;  2C0O A;  3N5B B;  4XQ3 A;  1S72 T;  2LNH B;  3FJ5 A;  1HSQ A;  4Z89 A;  1VYT A;  3JRZ A;  4LDW A;  2CCH B;  3O8V A;  5CYI B;  2BKZ B;  2DME A;  2DRM A;  1VOL A;  5I21 A;  4E6R A;  2F5K A;  2YXY A;  3CCM T;  1VQN Q;  2MF2 A;  3TSZ A;  3KBG A;  1JJ2 A;  2CH4 W;  1FMV A;  2IVX A;  4RTW A;  4JX6 A;  3DKM A;  2OTL A;  7AT1 B;  1TU0 B;  2XIC A;  2JM8 A;  4FCY A;  3BLH B;  1Q7Y C;  1K73 C;  2HKN A;  4BUG A;  4BE1 A;  2YUQ A;  3EFR A;  4C5H A;  1Q81 C;  1G3S A;  4CC4 B;  1FMK A;  3A98 A;  1H4L D;  3POM A;  3TW7 A;  4HVV A;  2QQA A;  1TOV A;  2EJ9 A;  4FSS A;  1QP3 A;  3FC3 A;  2A08 A;  3RES A;  3EGX B;  3QHR B;  1B34 A;  1EX4 A;  2DBK A;  3VS5 A;  2RI5 A;  4Z88 A;  5IHK A;  1M3C A;  3MCA B;  1RI9 A;  1IGU A;  4MIM A;  5CKE A;  5KCH A;  4OB1 B;  2HAX A;  3M0R A;  2WFY B;  4XTZ A;  2DEU A;  3NTH A;  3P8H A;  2NUT A;  2EQI A;  2QFZ A;  1X01 A;  1OGU B;  2EQK A;  1G3N C;  1ENW A;  5CKD A;  3RMS A;  3JCM b;  4XTV A;  4OML A;  3M0S A;  3M5A A;  2O2O A;  3CEY A;  3PMI A;  1P5E B;  2P0P A;  5GAN 7;  1ZX6 A;  1G8X A;  1EFN A;  4ME7 A;  1KC8 U;  2X35 A;  3S6W A;  2F2C A;  1WFW A;  3UF4 A;  2NUP A;  1VQO A;  5D6X A;  2LX9 A;  2QTV A;  2EKO A;  1NEB A;  4HNU A;  2ZZD A;  2D8H A;  4EOK B;  2QDL A;  3DB4 A;  4NST B;  4F7L B;  3JB9 I;  1RAG B;  2ABL A;  1WXU A;  4AKG A;  4CC2 A;  4M7A E;  1PM3 A;  5GAO l;  2CYZ B;  3BLQ B;  3JCM g;  1OL1 B;  3ER0 A;  2QG9 B;  1G5V A;  5LJ3 h;  1E7P A;  4FM4 B;  2DK3 A;  4M77 B;  4N0A C;  1K1Z A;  2FRW A;  2DJZ A;  3CCL T;  4EMK A;  2DYI A;  1TH7 A;  2I0N A;  1K73 R;  3QII A;  4KRT A;  1GBR A;  1RAE B;  4VUB A;  4C92 B;  1YNZ A;  4M78 E;  2W0Z A;  1UHF A;  1CKB A;  2IPO B;  1SSH A;  1R77 A;  3CMA Q;  3CD6 Q;  1QQJ A;  2R57 A;  3M0T A;  3OYE A;  1B3Q A;  2DD5 B;  2LW4 A;  1VQ4 Q;  5LJ3 d;  1PKD B;  3M4G A;  2D0Q B;  2P0K A;  1MMN A;  1LOJ A;  4PKC C;  4MDX A;  1YP5 A;  2CUB A;  4XTU A;  2DE0 X;  1ZLM A;  3EOC B;  1Y57 A;  1K9M U;  2BKD N;  2MPX C;  2SEM A;  4F17 A;  2JTE A;  1TSF A;  4FX3 B;  2LCS A;  3K7A M;  1TWB A;  1W2B S;  1X2K A;  2F2W A;  2E6N A;  3OSS C;  3S3M A;  4M75 E;  4AG1 C;  5C6S A;  2EGE A;  1C1A A;  1YHQ Q;  1UEB A;  3VU3 C;  1HK9 A;  2QAZ A;  1TFB A;  1VQ4 T;  2KGT A;  5AYF A;  3JCM Q;  2VWF A;  1K8A C;  5GMK i;  4HCK A;  3A8M B;  4L6V 5;  4F7U G;  3CCM A;  2DZ9 A;  1JOW A;  2QEX T;  4NL2 A;  2RA2 A;  3G6E T;  1F5Q B;  3FB9 A;  2W99 A;  1AZG B;  4KUD K;  1RLP C;  3OYN A;  1GFD A;  2Y4X A;  1PSE A;  2EYQ A;  1BBZ A;  1VA7 A; 
#chains in the Genus database with same CATH homology
 4ZGD B;  5CCA A;  3HO8 A;  1YJ9 T;  1WQ7 A;  4UC4 A;  3CC7 A;  2DXC A;  2IG0 A;  4M75 F;  3QJ6 A;  4JS5 A;  3CMA A;  3CD6 A;  4PJO B;  5KH6 A;  1D3B A;  2RHU A;  3CBO A;  3H8Z A;  2QDY B;  3PGG A;  4Y91 A;  4BI3 A;  2EIF A;  2QI2 A;  3HBL A;  5GAO r;  1M90 U;  3RUX A;  4DOW A;  5CKH A;  4BAC A;  3CC4 A;  3C94 A;  2X4X A;  4M78 B;  4GLK A;  2RHI A;  4C0Z A;  1U1T A;  3M59 A;  2R5A A;  2R5M A;  4F7U A;  4JLG A;  1Q82 U;  3MHX A;  1BIB A;  4MZM A;  1VQ6 T;  2DXC B;  3OQ5 A;  3QG1 A;  2G3R A;  3OS5 A;  3OS2 A;  2CGH A;  3GNG A;  4LDY A;  2WAC A;  2XID A;  4NL3 A;  3HZJ A;  2PVD B;  3HL8 A;  4M75 A;  3RKY A;  5LJ5 h;  1QVG A;  2RJC A;  3OW2 S;  5FU6 C;  1FKM A;  2BS3 A;  5HK3 A;  3PTA A;  1YIJ A;  1YCY A;  2DEQ A;  5GMK e;  4M7A G;  1M8V A;  2JUF A;  4N4G A;  3SD4 A;  5GAN 5;  1VQN T;  5GAM j;  3LWI A;  2KMG A;  1D3B B;  4EPC A;  3GOX A;  2XKO C;  1W4S A;  5GAN 4;  4KUL A;  1ZQ1 A;  5FRN A;  1LNX A;  2RK2 A;  4ZN1 A;  4E7K A;  3HB9 A;  3JCM f;  2KVQ G;  4HCB A;  4LD9 K;  2FHD A;  5GAN j;  4Y28 E;  5DLO A;  4M7D A;  4QQD A;  3J81 E;  3G71 T;  3QJY A;  2LT1 A;  3JB9 F;  3INZ A;  4JLI A;  2H3J A;  2RD1 A;  2I2L A;  4L59 A;  2MAM A;  4EMK C;  2QTX A;  1M5Q 1;  2WSE E;  4M7D C;  2V8J A;  2GFA A;  1XTD A;  2K3Y A;  3M53 A;  4M7D E;  4V2S A;  4Z6Y A;  4P5N A;  5GAN f;  4FT2 A;  4JS4 A;  2DAQ A;  3WXM B;  2ZPF B;  3OYJ A;  5IT9 E;  4AI6 A;  2RH2 A;  4PJO C;  2EJG A;  3TW6 A;  4M77 D;  5GMK l;  2VXE A;  2HNI A;  4O5V A;  1YI2 T;  3ZFJ A;  3V7R A;  2FYK A;  2GFU A;  4PJO E;  2K5F A;  3GPL A;  4WF2 A;  3CCE T;  1JJ2 S;  1YBY A;  1ZHI A;  2DIQ A;  2VXF A;  3CBP A;  5CIU A;  4XU3 A;  4PJO F;  1Q86 C;  1VQ8 T;  5HY6 A;  3L2V A;  2K2V A;  1WPY A;  4F7U E;  2PQW A;  4J8O A;  3V8L A;  1VQ4 A;  2DVE A;  1U1S A;  4LD6 A;  3JCM V;  4AKH A;  3VYH B;  1M1G A;  3QYE A;  3KHI A;  2XI9 A;  4O6J A;  1VQL T;  2RHZ A;  3DB3 A;  1Y7X A;  5I2S A;  3QPH A;  2HQX A;  1K8A U;  3RIR A;  3VYG A;  1QVF A;  4E47 A;  3X26 B;  4IUP A;  1O9S A;  4C5I A;  4QVC A;  3QSU A;  3VUB A;  3JB9 J;  4MFE A;  2X4Y A;  3OBY A;  2QEX A;  4Q5W A;  5A2Q E;  2CZ0 B;  4JRK A;  3VKI A;  4C0F A;  3CCL A;  2CZ1 B;  2E70 A;  3OBW A;  4NC6 A;  4XU1 A;  2DXT A;  3MEV A;  1YHQ T;  3P8D A;  3CCJ T;  2PVG B;  2M1H A;  1QLB A;  1YJ9 A;  5KE3 A;  3JCM J;  1B34 B;  3X24 B;  3M4Y A;  1M1F A;  2LVM A;  5GAM h;  4XTY A;  3OYH A;  1HXD A;  3CMA T;  4RCB A;  2Y4Y A;  3CD6 T;  3LGF A;  3SFM A;  4JDS A;  2XG8 D;  3EFS A;  1BI3 A;  3ZBD A;  5GMK j;  5CKB A;  4C0D B;  1MGQ A;  3JB9 G;  5GAM e;  3S3O A;  3X25 B;  4GY5 A;  4M7A A;  2KY9 A;  2IVW A;  2DPP B;  2XK0 A;  4RG8 A;  3M55 A;  2ZPB B;  3HPW A;  4M75 G;  1WNL A;  2PU9 B;  3CCU T;  1U8R A;  1AHJ B;  1YJN T;  1Y96 B;  4OF1 A;  2DD4 A;  5GAN g;  2DD4 B;  3QHS A;  4HNT A;  3G4S T;  3OW2 A;  1KHI A;  1I81 A;  1BI1 A;  2RJF A;  4M7D F;  1JBM A;  2CKK A;  2LCL A;  1VUB A;  1XNI A;  3E1S A;  3CPW A;  1VQK A;  4C5G A;  2ZPG B;  5CKF A;  3HKS A;  4QSH A;  3J80 E;  2E41 A;  5GAN 6;  3L2Q A;  4C8Q E;  1YIJ T;  3CCS A;  2KAF A;  2XHC A;  3L1A A;  1VQN A;  1H3Z A;  3PFS A;  3L2Z A;  4PLL A;  1JRI A;  2EJF A;  3LW5 E;  3PNW C;  3CCQ T;  3QWL A;  3SWN C;  2A7Y A;  5LJ5 j;  3CC2 T;  1QVF S;  2DZC A;  5FLX E;  4N0A A;  3LLR A;  4M75 C;  2R58 A;  4ZGJ B;  2K57 A;  4M75 B;  1YIT T;  1N9S A;  4EDU A;  1ZBX A;  3T9N A;  3HHT B;  3OS0 A;  2K3X A;  3I56 T;  2QA4 T;  4M7A F;  3OSV A;  4E7H A;  3M54 A;  1VQ5 T;  4IUU A;  5D6W A;  2BIV A;  4ZTF A;  5EG2 A;  3E9G A;  3NFC A;  2GQV A;  4C92 D;  2E65 A;  2MWO A;  4DOV A;  4FSX A;  5LJ5 d;  4C92 E;  4BE0 A;  3H4C A;  3OYL A;  3OA6 A;  2LTO A;  3X20 B;  1RI0 A;  2E64 A;  3OB9 A;  4J83 A;  1V29 B;  2QQ8 A;  2EYQ A;  2KSS A;  4XK8 E;  2ZPH B;  3OY9 A;  4LDX A;  3L2U A;  4JRQ A;  3QO3 A;  2XDD A;  2M0O A;  3MET A;  3JB9 D;  1KD1 U;  2K5L A;  3GLX A;  4C5E A;  1NJI U;  3VV0 A;  4RMO A;  3KXT A;  3LGL A;  2QXF A;  4HKE A;  3TU4 K;  4PJO D;  2ZCF B;  2KR6 A;  2X4J A;  3QBY A;  5FU6 B;  4XU0 A;  1WJR A;  3C95 A;  1VQP A;  1VQ8 A;  1R8O B;  3BDL A;  3CBM A;  4M7A D;  1Q82 C;  1UGS B;  3G6E A;  4CRI A;  4C8Q G;  1KHC A;  2BS4 A;  3DLM A;  3PMT A;  1VQL A;  4OB3 B;  3FRN A;  3OMG A;  5L8R E;  4LDV A;  3JCM W;  3JB9 H;  3CME T;  1NPR A;  4LDU A;  2DKG A;  2DO3 A;  3OYA A;  3J7A F;  1WQW A;  1M90 C;  3C12 A;  5C0M A;  1PSF A;  5LJ5 g;  3CC7 T;  1G3T A;  5J39 A;  3VYG B;  3C4S A;  5CQX A;  3FEO A;  2OTJ T;  2LQ8 A;  4ZN3 A;  3OYB A;  5A0L A;  1BKB A;  1VQM A;  3A8G B;  4E7J A;  4HT9 A;  2L5Q A;  4M7D B;  3LH0 A;  1NE8 A;  1Q81 U;  1UGR B;  3CC4 T;  2VYT A;  1BI0 A;  2LCC A;  5KCH A;  4NOY A;  1VQ9 A;  3X28 B;  3LYI A;  2EQM A;  5IN1 A;  1KD1 C;  4EMG A;  3UPU A;  2JOY A;  4C92 C;  4XU2 A;  2E10 A;  2QQ9 A;  4L5G A;  2EWN A;  4MDW A;  4JUV A;  4PLI A;  3GIB A;  2HBP A;  2PVO B;  2D6F A;  3QXE B;  1X6O A;  3GNF B;  4IUQ A;  3OMC A;  2L89 A;  1WJS A;  3JCM c;  2RI3 A;  1SSF A;  4A53 A;  5GMK h;  2JNG A;  3QYH B;  4M75 D;  2F69 A;  3V8K A;  3JCM e;  5GAM g;  1VQ7 A;  4M7A B;  4C92 A;  2BS2 A;  2MI6 A;  3CCV A;  4JRP A;  3JCM d;  4E7I A;  1KQS S;  2L8D A;  4C8Q C;  2AHJ B;  3FLG A;  5LJ3 j;  4BBS M;  3G4S A;  1I4K 1;  3OYF A;  4IKF A;  4A4G A;  1O75 A;  4C8Q B;  4R55 A;  4A4H A;  2ZZD B;  3OYM A;  2RO0 A;  4OB2 B;  2DIG A;  2JN0 A;  4HL4 A;  4Z02 A;  1Q86 U;  2WSF E;  2RJD A;  2RJE A;  2E1H A;  1W2B A;  2NLU A;  5J3B A;  5GAN 8;  3CCR A;  4JX5 A;  2MWP A;  2YLC A;  3E19 A;  4J6X A;  3VUZ A;  4C8Q D;  4D6W A;  4DA4 A;  3MEU A;  4M7D G;  2WJ9 A;  3BG3 A;  4HA8 A;  3CCQ A;  1DJ7 B;  2JTF A;  3H6Z A;  3CC2 A;  2XDP A;  4M78 C;  4R56 A;  1NJI C;  2RK1 A;  4PJO G;  3N5B B;  1YIT A;  4XQ3 A;  3FIF A;  2YHT A;  1QP2 A;  3Q1J A;  1S72 T;  1KG1 A;  1GXI E;  3HP9 A;  4MZP A;  1K73 U;  3I56 A;  2QA4 A;  3M56 A;  4HCC A;  1G3W A;  4HNV A;  2V8I A;  4BY6 B;  3JRZ A;  1UGQ B;  4J7I A;  1VQ5 A;  3OYG A;  3HRS A;  4LDW A;  3CPW S;  3O8V A;  3QDR B;  1WJQ A;  3BY7 A;  5I21 A;  2C06 A;  3MO8 A;  2F5K A;  4CI0 C;  3UT1 A;  5GAO m;  2EQU A;  3CCM T;  3GF5 A;  4BD3 A;  4X9C A;  5GAN 2;  1Q7Y U;  4MMK A;  5FU7 C;  1OYX A;  1OZ2 A;  2YRV A;  3PT9 A;  4XAX B;  3OYD A;  2MF2 A;  3KBG A;  4J5Y A;  4YTL A;  1N8R U;  1JJ2 A;  4NS5 A;  3M9Q A;  1N8R C;  4JX6 A;  3DKM A;  1NZ9 A;  2OTL A;  2XIC A;  2X4W A;  5GAO q;  4OGC A;  5IAY A;  4J6W A;  2FL7 A;  1VQP T;  5KE2 A;  4QQG A;  3ME9 A;  1Q7Y C;  5GAM f;  1K73 C;  1KQ1 A;  5GAO p;  4A4F A;  5DLQ E;  3SWN A;  1BYM A;  4HLQ A;  3SWN B;  1M1K U;  4BUG A;  4BE1 A;  1UB4 A;  4ELJ A;  4C0D C;  5KCO A;  4RG2 A;  2VUB A;  5GAO n;  3EFR A;  4C5H A;  3CME A;  4II1 A;  3RKW A;  1YHQ A;  1Q81 C;  1P92 A;  3M58 A;  1G3S A;  1XQH A;  3QYG B;  2MMP A;  2LC4 A;  3I55 T;  4FT4 A;  2P4T A;  3TW7 A;  2QQA A;  2FVU A;  4XTW A;  5FRM A;  2EJ9 A;  3FC3 A;  1QP3 A;  3RES A;  1Y96 A;  4ZTJ A;  4KT0 E;  2RHY A;  4M77 F;  4C8Q F;  4HCZ A;  3UDC A;  3RKX A;  1FX7 A;  3BFM A;  5HK0 A;  1B34 A;  2GF7 A;  5I2M A;  2OAU A;  4IUV A;  2O01 E;  2QQS A;  2RI5 A;  2DTI A;  1M1K C;  1VQ9 T;  3MCA B;  3CCU A;  1FXX A;  3A8O B;  2VV5 A;  4MIM A;  1JB0 E;  2PUK B;  1I8F A;  2XU8 A;  5CKE A;  2QQR A;  4OB1 B;  3VKH A;  1H64 1;  2F5T X;  2ZGW A;  4BY6 C;  2HAX A;  2E5Q A;  3DLL A;  3F70 A;  4XTZ A;  3CXC A;  3NTH A;  3P8H A;  4QW2 A;  4M77 C;  2QFZ A;  1X01 A;  1XOV A;  4N4I A;  2K5I A;  2EQK A;  3OS1 A;  1VQK T;  5CQY A;  2DXU A;  3V7C A;  3HRT A;  5CKD A;  1VQ7 T;  5GMK m;  1KC8 C;  4F7U B;  3RMS A;  3JCM b;  3KUF A;  4A4E A;  3CCS T;  3WVD B;  4XTV A;  3M5A A;  4X9D A;  3CEY A;  4MML A;  3PMI A;  5LJ3 f;  2P0P A;  3VJP A;  4QVD A;  5GAN h;  3RMQ A;  3ZEH A;  3GP8 A;  4JRI A;  3SDZ A;  4KBM B;  4ZGE B;  2JTM A;  2KK4 A;  5GAN 7;  1YJW A;  2LT4 A;  1KQ2 A;  4A4K A;  2KMT A;  1IZ6 A;  2RI2 A;  3BW1 A;  3NTK A;  4M78 F;  5D6Y A;  2QDJ A;  4ME7 A;  1KC8 U;  1VIE A;  4M77 A;  5LJ5 f;  1IRE B;  1UGP B;  2X35 A;  2CZ7 B;  3S6W A;  2FB7 A;  2VC8 A;  3E9F A;  3HSB A;  3ASK A;  2EFI A;  5J26 A;  1VQO A;  1NPP A;  4BB7 A;  4M7D D;  4QVZ A;  2DTH A;  5D6X A;  2LX9 A;  2G77 A;  4IUR A;  2EKO A;  3CCE A;  4HNU A;  2ZZD A;  4M77 E;  2DXB B;  4BE2 A;  1S72 A;  3V7S A;  3HFN A;  3DB4 A;  4OVA A;  3JB9 I;  2L3R A;  1QW1 A;  3MP1 A;  4AKG A;  4M7A E;  5CVI A;  5GAO l;  2CYZ B;  2EAY A;  2E6Z A;  2RM4 A;  3JCM g;  5DM7 R;  4BDY A;  3BG9 A;  3ER0 A;  5CK9 A;  1G5V A;  1BIA A;  5LJ3 h;  4PJO A;  1LJO A;  2DTO A;  2LDM A;  2KDS A;  1OZ3 A;  1E7P A;  1MHN A;  4FM4 B;  4MFD A;  2DK3 A;  4M77 B;  3MP6 A;  4N0A C;  4LOC A;  2DJZ A;  2ZPE B;  2BUD A;  3UWN A;  2VGM A;  3CCL T;  1N27 A;  4EMK A;  2XDB A;  3L2W A;  5LL6 S;  2HQE A;  3OYC A;  3OYK A;  3PIP A;  1TH7 A;  3QZ5 B;  5A0D A;  3CCJ A;  2OTL T;  3QII A;  2HD0 A;  3A5Z B;  4IUT A;  5CR2 A;  3G7Z A;  3L42 A;  3MEW A;  4TVR A;  4VUB A;  4C92 B;  3JAM E;  1KQS A;  4HT8 A;  3A8L B;  3DL1 A;  4M78 E;  3HFO A;  4A54 A;  4E7L A;  5CAI A;  1VQ6 A;  4QQ6 A;  2OTJ A;  4B9W A;  1VQM T;  1VIF A;  3AHU A;  5LJ5 e;  3V8J A;  2LQK A;  4ELZ C;  3PIO A;  4C92 G;  4X34 A;  5LJ3 g;  2R57 A;  4F7U F;  2DXB A;  3M57 A;  4FU6 A;  4M78 A;  3I55 A;  3OYE A;  3LWH A;  4RCC A;  3MP8 A;  2M16 A;  2DD5 B;  1YJN A;  2A3L A;  3JSC A;  3CXC S;  2PUO B;  4XTX A;  5LJ3 d;  2VGN A;  3M4G A;  4M78 G;  4N4H A;  4DQ2 A;  5FRO A;  4ELY C;  2K4Y A;  4PL6 A;  1QVG S;  2D0Q B;  2P0K A;  2JZ2 A;  1OI1 A;  1LOJ A;  3FJP A;  4PKC C;  4ATO A;  2QQB A;  4KUI A;  2YLB A;  4XTU A;  3JCM P;  4MDX A;  4FIB A;  3HRU A;  5GAN 3;  5GAN e;  3RER A;  2M9U A;  3CCV T;  5EJC A;  4AKI A;  2BKD N;  1K9M U;  5GAN d;  4EMH A;  5DY9 A;  5FU7 B;  3G71 A;  3A8H B;  4PNO A;  4M77 G;  1RL2 A;  2QF7 A;  2Y90 A;  3TCJ A;  2ZPI B;  3QZ9 B;  3BG5 A;  2KQW A;  3EAE A;  4J7F A;  4BDZ A;  4J6Y A;  4C0G A;  5GAM d;  1BI2 A;  2JVV A;  2O4X A;  2RB6 A;  3L2R A;  4RKU E;  3OYI A;  3TRE A;  3R6O A;  3S3N A;  3NTI A;  3QUI A;  4FL6 A;  2XD0 A;  3BDU A;  3CCR T;  1W2B S;  1K9M C;  2E6N A;  4OP0 A;  4C8Q A;  3OSS C;  3S3M A;  1YI2 A;  3CPF A;  3JCM h;  5HKC A;  4M75 E;  2GCX A;  3MEA A;  1EIF A;  3QKJ A;  1YJW T;  2B8A A;  5C6S A;  2D9T A;  4BBR M;  2LRQ A;  4OGE A;  2DD5 A;  3SB2 A;  1UEB A;  3VU3 C;  1HK9 A;  4BI4 A;  1I5L A;  1VQ4 T;  2EQJ A;  5CO7 A;  1M4Z A;  5LJ3 e;  3OYY A;  5AYF A;  2P0Q A;  4JJN K;  1VQO T;  1N6A A;  2CS7 A;  3JCM Q;  1K8A C;  4BI8 B;  5A0G A;  1Y07 A;  5GMK i;  3A8M B;  4L6V 5;  2RHX A;  1Y71 A;  2O4X B;  4B9X A;  4C92 F;  1X75 C;  3TEE A;  4M7A C;  1QVP A;  1M9S A;  2WSC E;  4F7U G;  2DZ9 A;  1G3Y A;  3CCM A;  3QYB A;  3LX7 A;  2QEX T;  4JX4 A;  4NL2 A;  3VKG A;  4M78 D;  4MZT A;  2RA2 A;  2V8K A;  2CZ6 B;  1FWZ A;  4OMF B;  3JCM X;  5M9O A;  3FB9 A;  3G6E T;  4OB0 B;  1N9R A;  2LNV A;  4M6V A;  3OYN A;  4KUD K;  2Y4X A;  3P8B B;  1PSE A;  4EMK B;  3WVE B;  1WGS A;  3URG A;  2E12 A;  3FDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...