4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
1UGPB 2ZPEB 4OB3B 2PVDB 3A8MB 3X25B 3QZ9B 1UGQB 4OB0B 4XK8E 2PU9B 2CZ6B 2QDYB 2PUKB 3QYHB 2DD5B 2ZCFB 3A8HB 1UGSB 2PVOB 1GXIE 2ZZDA 4KT0E 2PVGB 2DXBA 3A8OB 3VYHB 2ZPGB 3A8LB 4ZGDB 3VYGB 4OB1B 2ZPFB 4ZGEB 1PSFA 3X26B 2CYZB 2DXCA 1QP3A 2ZPIB 2WSCE 2DD4B 4ZGJB 2WSFE 2ZZDB 1JB0E 3WVDB 3X24B 2CZ1B 2DD5A 4L6V5 3WVEB 4RKUE 1AHJB 1QP2A 2CZ7B 1IREB 1UGRB 2PUOB 2ZPHB 3HHTB 3A8GB 2CZ0B 2WSEE 2DXCB 4OB2B 2AHJB 3QYGB 5L8RE 3VYGA 4Y28E 3LW5E 2DXBB 3QXEB 1DJ7B 1V29B 1PSEA 2O01E 2DPPB 2D0QB 3X28B 3QZ5B 2DD4A 2ZPBB 3X20B 4FM4B
chains in the Genus database with same CATH superfamily
2LW4A 4LDUA 4MDWA 4X34A 5I22A 5KE2A 2JN0A 1PRMC 3HRTA 3OBWA 1O9SA 1BCOA 5I21A 1X43A 2C6TB 5IN1A 2EYWA 1TUDA 2C5NB 1BKBA 2AKKA 2I53A 3M0RA 2YUQA 3M03A 1UUEA 2J6KA 1UTIA 3JCMJ 2DM1A 2DF6A 4KT0E 1KC8R 4NL2A 2VKNA 2COWA 3QHRB 1MNDA 1FXXA 2VC8A 4AG2C 4QVZA 3EHRA 4M77D 3J7AF 2VVKA 3BDLA 4E7KA 2O2OA 4MFEA 1KG1A 3NTIA 4FYVB 4N4IA 4LDWA 3NHNA 1JEGA 1OX8A 3SB2A 3I56T 1G3NC 3G1JA 4LD6A 1VQ4A 3CC7A 3A1PA 3HKSA 1X2KA 2JM8A 2MK5A 4HNVA 1ZSZC 1CKAA 3META 5CO7A 2XI9A 2D9TA 4PJOD 1I07A 2L3RA 3H0FA 3M55A 2JS0A 4EMKB 1GUXB 2VXEA 5ICPB 1H641 2KMGA 4PNOA 3BY7A 3M4YA 2D8HA 3C0CA 4J9CA 3KBGA 1K9MU 2DX1A 2BS3A 2P0QA 4CFVB 2BUDA 2G77A 1QMZB 4F16A 1B34B 4PK4A 3L2RA 2AK5A 4KGVB 2IIMA 5AYFA 2W96A 2BS4A 1VQOT 4CC7A 3L2WA 1FX7A 1I5OB 2CJMB 5KYNA 5D6WA 4A4HA 5HK3A 1WHGA 1S72Q 2OTLA 1QVFS 1AZGB 1KSWA 3CC2Q 1VQ8Q 3PVLA 4C8QB 3N5BB 4J6WA 2EGCA 1UGPB 4OB3B 4IIOA 4MZPA 3DKMA 2FRWA 4JJNK 1VQ6T 3ZL7C 1UECA 2DVJA 1IO6A 4DOVA 2XG8D 3C4SA 1K9AA 3VS3A 1JU5C 3CPWP 1R8OB 3H4CA 2Z0WA 2QAZA 4GLKA 3CCRT 5A2QE 4XTXA 3A8HB 2JT4A 2QASA 3CCQA 3JV3A 4M7DD 1IHWA 3QJYA 2DA9A 2ZZDA 3HO8A 3RKWA 3UF4A 1VQ9Q 5CR2A 3OYJA 2RMOA 4A4FA 1CSKA 3CCLA 3LH5A 1AWWA 2EUFA 1WZOA 1VQLT 1N8RC 4ZN1A 4MDXA 3JCMQ 2ZPFB 1MMGA 2OI3A 3CCJA 2QEXT 3V7CA 2WMAB 2HDAA 3JRZA 4HCCA 1VINA 3CCVQ 4M75B 4R56A 1FKMA 1YITA 2DKGA 4J83A 4RTXA 4DEYA 3QG1A 2UZDB 2DERA 2B86A 2RI3A 3OS5A 3OYKA 4DBQA 3F70A 1UFFA 4PKCC 2NUPA 4TTHA 1Q81C 1K4US 4B6MA 3THKA 1D3BB 4HVVA 2PMIB 4M77C 4N4GA 4M6VA 4FT4A 3OA6A 1H26B 1M8MA 4F7UF 1GH6B 3EAEA 4M77G 4XAXB 2KAFA 2O9VA 3OYFA 4YOZA 3RKXA 4CC3A 2DLPA 2RHXA 1Q86R 2LQNA 1OPKA 3LW5E 1PHTA 1CKBA 3C12A 2DXBB 4J7FA 4BACA 4M77A 4QVDA 4GBQA 4EORB 1RUWA 1UNLD 5GMKi 4PJOC 4M78E 4BY6C 3MEUA 4A53A 5J39A 4KRDB 4GLMA 3JCMe 4M7DF 4PJOG 3CD6T 2DMOA 5KYUA 5ECAA 3V7SA 2E70A 2VB6A 3TSZA 2KXDA 1NLPC 2JJ9A 3SDZA 4HLQA 5GAN3 4HT9A 4XK8E 3TNHB 1TSFA 2KT8A 2RH2A 1ARKA 2D0NA 4ME7A 4HA8A 2QQAA 1N9SA 1FMKA 4JS4A 1C0MA 2YWWA 1MV0B 1HK9A 1M1KC 4A4KA 2JS2A 1OU9A 2O4XB 3H0HA 1NPPA 1D1AA 3RBBB 3TREA 3G4ST 2DFUA 1WXTA 3A98A 3M57A 3CBMA 4F7UG 4EIKA 5I11A 1XO2A 1UHCA 2E64A 2K9GA 2W0ZA 4LXCA 3VS7A 3CCQT 2K4YA 3REBB 2J6FA 2DEQA 3BG3A 2DXCA 1N9RA 2WACA 2M16A 1M90R 4M7AE 1WHHA 4BY7X 1B3QA 1PC0A 3V8KA 3M53A 4F7UA 2DD4B 2L2PA 2OAUA 3JB9J 1SKUB 4AMCA 2D6FA 4EDUA 2P0PA 3PIOA 1RL2A 3OS0A 2CZ1B 2R5MA 1BU1A 5IHYA 5FWCA 1AHJB 1YN8A 2BZYA 1QWFA 1S72A 1W2BP 4YOSA 1H25B 2C0IA 1YJ9T 3CC2A 3C94A 4AKGA 1OL2B 3EG1A 4QVCA 3OYDA 2EQKA 4M7DA 4C5GA 2RM4A 3TU4K 2GF7A 1JKWA 4DBFA 3D7SB 3AT1B 1LPLA 3I55T 3CCMA 4Y28E 2HMAA 3R6OA 1IGQA 1NLOC 1G3YA 4C0DC 4PLLA 4FCYA 3HTRA 2M1HA 4TVRA 3OY9A 5IXFA 2RA2A 3RNJA 1I5LA 2K5LA 4JZ4A 3EFOB 2ROTA 4RG8A 2QDJA 3VS1A 5KYXB 4QQDA 1VQ9A 5IDPB 3JCMf 4FM4B 3G6EA 4CRLB 5GAOr 2D8JA 2QYZA 4C92B 1Q82C 3HRSA 1D1CA 1SRLA 2NLUA 1G3WA 2C5OB 1TD6A 2C5VB 1QKXA 2EQMA 4CI0C 5HVYB 1Q7YR 4EOIB 2QFZA 3EFRA 1H27B 3FJPA 3I5SA 4RODA 3HFNA 3PIPA 3HSBA 2GCXA 2IVWA 2KY9A 2K5FA 1M9SA 1GXIE 5LQFB 2ED0A 3TN8B 3WXMB 2YUPA 4F70B 3GOXA 1QQJA 2LX9A 1SPKA 1M3CA 2QA4A 4ZGDB 1E9HB 2QTXA 4JX4A 1YWPA 1K73R 3CEYA 2GQVA 3FJ5A 4HXJA 2OTJQ 3JCMg 2O9SA 2I40B 2VASA 4E7LA 3EG9A 4MMKA 2WFYB 3BHVB 4F6SB 1JBMA 4IIMA 1Y96B 2MYSA 2CZ7B 2EBPA 5GANd 2LT4A 1Q86U 2EYZA 1FINB 1QWEA 3LQ5B 4J7IA 2LCCA 3NFCA 2DIGA 1KD1C 5FLXE 3JCMP 3DB4A 1E6GA 2FZKB 2JOYA 1V76A 1M5Q1 5GAN8 4AFZC 1KQSA 2B9RA 2A36A 1TWBA 4O6JA 1X6GA 3MP8A 1JQQA 3FB9A 3JB9D 1VQ8T 4V2SA 4XQ3A 1UNGD 2RJEA 2DPPB 4C8QD 2LRQA 1XNIA 1OYXA 4E6RA 1WXBA 1M1GA 3HZJA 3QWYA 2X4YA 1H3ZA 1PKDB 4BE0A 3VKIA 2K3BA 3MO8A 2XHCA 3SWNC 2MI6A 2PVDB 1Q82U 5KYYA 2I0NA 1AD6A 4LDVA 4RTUA 4WF2A 1NJIR 2GTJA 1VYTA 3LWHA 1BCMA 2MWPA 3PFSA 1ABQA 2PUKB 2LT1A 3ZFJA 2YLCA 2XMFA 4C0ZA 1AOJA 2DL4A 1WLPB 2CP0A 2RB6A 3DLMA 5EFQB 3MY1B 3E2UA 4J9IA 3MJXA 3TVTA 5CCAA 2HKQB 3CCVT 4M77E 3RIRA 2K2MA 4A4EA 4F04B 2M9UA 1O9KA 3OSSC 3P8BB 2KYBA 7AT1B 4I3ZB 3VYGB 4M75D 5FU7C 1K8AR 2CP6A 2LTOA 2PJQA 2DMEA 4XU1A 4IURA 1URCB 2AT1B 1QKWA 3UT1A 4BCMB 2OTLQ 2F1LA 1O75A 5GAN6 5IH2A 3S3MA 4PJOE 4F6UB 2DXTA 4CC4B 4EOLB 3OQ5A 3OS1A 3GTMS 2F2WA 2JGZB 5IDNB 4C8QF 5CKFA 1JJ2A 2CZ0B 2DL7A 1UEBA 5HBEB 5L2WB 1W6XA 4F7SB 1BI1A 1RAAB 4X9DA 2FPFA 3CBOA 2CUBA 3TNWB 1X75C 4OMLA 1W4SA 1X2QA 3LWIA 3TQ7P 3GNFB 2HD0A 2BZXA 2RK2A 3JCMV 4EMKC 1VQPA 3M0QA 3SEMA 4PJMA 3ZBDA 3NGPA 1RAGB 4L59A 3VS2A 3CCJQ 4IUPA 3VKGA 2XKOC 3GP8A 2DETA 2JZ2A 3CXCA 2UZEB 4II5B 2ECZA 1YITQ 1Z9QA 2J7IA 3K7AM 1YCSB 1AWXA 1WHJA 2JNGA 2VWFA 3HRUA 3ER0A 2CT3A 2IW8B 4L5GA 5CK9A 2L5QA 2YT6A 2HQEA 4EMKA 1GUXA 1E7OA 2FRYA 4DBHA 2V1RA 4M75F 1VOLA 3TSWA 5GMKm 2DL3A 4AFQC 2ED1A 1JSTB 5LMKB 1QLYA 3HL8A 3JB9G 1K73U 5FRMA 2YLBA 2DJZA 4IKFA 3I35A 1B34A 4RTVA 2YUNA 4JLGA 1QVFP 2QQBA 4K11A 1N5ZA 3OSVA 3PT9A 2R58A 3A8LB 3VS4A 5ACBA 1RAFB 1JJ2P 4EMGA 2KNBB 2HCKA 5LJ5d 1MV3A 3VJPA 1SRMA 2R7GA 3BW1A 1BIAA 3MP1A 1KQSS 4KH1B 4C8QA 2RQUA 2X51A 3INZA 1SSFA 3UPUA 2KT1A 2EJFA 3OYYA 4BI3A 2LJ0A 2KK4A 1NYGA 1UNHD 9ATCB 2M0YA 4E7HA 5GMKh 3UDCA 1VQKQ 5CKHA 1UGRB 4C5HA 3MEWA 3H41A 2IN3A 2HKNA 4OMNA 4EOSB 2X4WA 4HVUA 3EIDB 4HNUA 2QF7A 4EPCA 2EJGA 1RI9A 1ZX6A 4YTLA 5GANh 1OI1A 4M78B 1SEMA 3A5ZB 2CP7A 2PNIA 1VA7A 2EYQA 3EGDB 3V8LA 2F5KA 1PSEA 3OYLA 1Y07A 3OYHA 4M75A 3DTOA 1VQNA 3O0GD 1NJIU 5I2SA 2E12A 1YCYA 2LNVA 5EC7A 3KXTA 2DVEA 1VIFA 4RCBA 8AT1B 3FRNA 3BG5A 1R0CB 4OMFB 1H92A 4HL4A 4KRTA 3RDVA 2DBKA 2RHYA 2PU9B 4XTZA 1D3BA 3PTAA 5C0MA 2DD5B 2ZCFB 3GF5A 3ME9A 4VUBA 3CMAA 1SHGA 1PKSA 3NPFA 2EFIA 1K8AU 5GAOn 4D8DA 3FC3A 1JJ2S 2DXBA 4M7AB 1UDLA 1KC8C 4CFUB 4IUTA 2OTJT 2ESWA 5CKEA 3CCMQ 2QQSA 3DJBA 2CYZB 4LD9K 4JLIA 5BNJB 2K57A 1P5EB 3BHUB 1YIJA 4ROCA 2BS2A 2LQKA 2A7YA 2DIQA 3G6EQ 1YHQA 2DNUA 5LJ5j 3R6NA 3OW2A 4E7JA 2ATCB 3CXCS 1FYNA 1SF9A 1Y71A 1H1PB 4YOOA 1I1JA 1YI2A 4ELJA 5CVIA 1H28B 3DDPB 2QTVA 4C92F 3VUBA 5GAOm 3GPLA 4C0GA 4ELZC 2IW6B 4BXXX 5AT1B 4EC9B 3QYGB 2G6FX 3JCMW 1MMAA 4QQGA 4CXAB 1WPYA 4OMPA 1DJ7B 1X27A 4BCQD 1VUBA 3CCEQ 4NOYA 2QDLA 2JUFA 2QA4Q 2WMBB 2F69A 2DD4A 2ZPBB 2M0OA 4JX6A 1VQ4T 1GL5A 3CC7T 1OPLA 4KUIA 4A4GA 4N4HA 4E7IA 4ZN3A 4XTYA 3BG9A 4QSHA 5I2MA 2E4HA 4BCOB 1JSUB 2C0TA 1MNEA 1ACMB 2E5QA 3HP9A 4HCZA 1H1SB 4RTTA 1ZSZB 2K6DA 3MPUB 3EH1A 2HQXA 2HBWA 2VGNA 1I0CA 2XIDA 1E6HA 1HXDA 2DJQA 1AVZC 8ATCB 3M58A 3PE0A 4ZTJA 3RERA 2BIVA 2RK1A 2VYTA 2XICA 4IUVA 3VKHA 1VQKA 2EPDA 3CCUQ 2BE7D 1U8RA 5KCOA 3L42A 2CGHA 2WHBB 4MFDA 3I9QA 1KC8U 2I2LA 3QHSA 2DBMA 1G83A 3EFOA 4AT1B 2OTLT 3CMEQ 5KYXA 1WYXA 1PSFA 4BE1A 1G3SA 1YJWQ 4RUGA 1GCQC 2EYYA 3O8VA 3VS5A 3GIBA 3QYBA 2CCIB 4J9DA 1PG5B 2ZPIB 3EG0A 1QVGA 3M9QA 2ZZDB 5LJ5h 4LDXA 2X4JA 1VQMA 1G8XA 2QXFA 2LCLA 4ZTFA 1RAIB 2CSQA 2KDSA 2FL7A 1T3SA 1JOWA 4DOWA 5FU6C 2EIFA 1GCQA 4LN2A 2AZVA 2KROA 3EGXB 4BE2A 2FPEA 4Y91A 2RHUA 4ESRA 2EGEA 2EQJA 3JAME 4J5YA 4J6YA 3CCLT 4E47A 1PD1A 1NBEB 3MCAB 2LCSA 4M7DC 2MF2A 4Y92A 5L8RE 3E1SA 1OKVB 4XTUA 4M7DG 3CCJT 1Q86C 2L3QA 1YITT 1IB8A 4DEXA 3CCSA 3QZ5B 2HSPA 3P8HA 2MCNA 4D8KA 1EX4A 2PZ1A 5GAOq 4BCJB 2QGSA 2RQWA 1D0YA 2X4XA 4IUQA 2CH4W 3X25B 3M54A 4PL6A 1GCPA 3GBQA 2CSIA 2HL3A 2L3SA 5A0LA 3QWLA 2KMTA 3REAB 4M77B 3ULRB 1D0XA 3OW2S 1UGSB 1U1TA 1AZEA 1ZUKA 2XDDA 1I8FA 1VIEA 4AFUC 2IVXA 1M2VB 4G6LB 3DB3A 4Q5WA 5FW9A 4OMOA 4HNTA 2PVGB 4FYWB 1F5QB 2EJ9A 2H3EB 1MMDA 2P0KA 2ZAEA 4BCFB 1RLPC 4F14A 4E2FB 2AZSA 2DZ9A 4ZGEB 2B8AA 4HT8A 4RMOA 1S1NA 2QQ9A 4R0KA 5GAMd 3C95A 4PJOB 1OIUB 1VQPQ 4X1VA 1AT1B 2K5IA 4BY6B 4EOOB 4XU0A 2X35A 5LJ3d 1M90C 1X01A 3EFSA 2DXUA 1WIEA 1MMNA 4FW1A 3RESA 3WVDB 4JRQA 3CCEA 1ZBXA 1IGUA 2Y4YA 1J3TA 2A28A 4Z6YA 2PHGA 2JMAA 3OMCA 5DM7R 3RGFB 3QO3A 1IHVA 1TG0A 2DXCB 4KULA 2EVRA 3LGLA 3UA7A 2ENMA 3M56A 3OYBA 1N4MA 3OYAA 1YFNA 2OX7A 2F2XA 5D6XA 3VYGA 3S3NA 2W99A 4PLIA 2XDPA 1K0XA 5LL6S 5GJVB 3OYNA 2A0FB 1OIYB 3LYIA 4OP0A 2VXFA 2QGFB 3DDQB 3QYEA 4J9FA 2D0QB 3MP6A 1HD3A 3X20B 3TNIB 2KRMA 2KRSA 1X6BA 5CKDA 3E9GA 4HCKA 2COZA 3CCUA 2K7AA 2MOXA 2LQ8A 1P92A 3M0PA 3TEEA 3OYCA 4AFSC 4BCHB 3QZ9B 1M1FA 1NEBA 3G71A 2HL5C 1S72T 3CMEA 3PMIA 1YJWA 3CC2T 2DTOA 1WHMA 4CFWB 1VYUA 2JTFA 3BLHB 2UZLB 2F2VA 3M5AA 2G3RA 4D6WA 1TOVA 4FSSA 1YBYA 1Q7YC 4M7AD 1BYMA 2FVUA 2DYBA 4XU2A 3CCMT 2QEXQ 1QVPA 1VYVA 3Q1JA 3F5XB 1OGUB 1G3TA 1BBZA 1OU8A 2ZPGB 2KEAA 1VQ5A 1W70A 2DYIA 3KHIA 5GAN4 2SRCA 1VQ9T 4JJDA 2DILA 3G6ET 1KXUA 5FRNA 2W9FA 1VQ7A 1K73C 1VQNQ 1OZ3A 3M0TA 4B9XA 1XQHA 5KYWB 4M78F 4LUDA 4ZGJB 3NTKA 1JRIA 1M90U 2SEMA 1T3LA 2MIOA 2G9XB 3PO3S 5CQYA 4OVAA 3X24B 2OAWA 3HFOA 3HBLA 2M51A 4FU6A 3DOGB 2V8JA 2LQWA 3SD4A 4P5NA 1K9MR 3L1AA 1ZUUA 2ZPHB 3HHTB 4BBRM 4XTWA 3OYGA 1UB4A 1YWOA 5LJ3j 2KRNA 5CYIB 3B57A 2E65A 2WSEE 1WNLA 1KQSP 1ENWA 3CMAQ 3KUFA 5HQ0B 3OYEA 2QA4T 1OZ2A 5DQWA 2O31A 3CD6Q 2PTKA 1TUCA 5GMKj 3U23A 1OOTA 5IHNA 4JX5A 1F1BB 2K3YA 2RI2A 4EC8B 4BDYA 1BK2A 4KGZB 1TS9A 1BB9A 4KH0B 3MI9B 1H24B 1PRLC 4M7AF 3QBYA 4EMHA 4JRPA 5IT9E 3OBYA 2BKZB 4RTZA 3I56A 3A8MB 2PK9B 4LOCA 2DAQA 2A37A 4EOKB 1YIJQ 1UGQB 1C9BA 2HNIA 5GANf 5GANj 1YHQQ 2E3IA 1YP5A 3S6WA 4DA4A 2L3PA 3QYHB 1NJIC 4F7UE 2NUTB 1GBRA 4Z89A 5CQXA 1D1BA 3L2ZA 3RUXA 1TU0B 1JXOA 1YI2Q 1Q7YU 2E10A 4M78A 1LCKA 1NM7A 1H3HA 4II1A 2E5KA 3VS0A 4Y72B 4OR5B 3EGDA 1PWTA 2GQIA 3VYHB 2MWOA 4N0AA 1BIBA 1Q95G 2CT4A 1KQ1A 4BCIB 3FEOA 4Z8AA 3JB9I 4M7DE 1VQOA 2JMCA 1MHNA 2R57A 4F17A 2UZBB 3UATA 4C8QC 2DK3A 2WSCE 5GJWB 1PD0A 2BPMB 1K8AC 3CC4Q 2DRMA 5A0GA 4C8QG 3EHQA 2IPOB 2EKOA 3SWNB 2WXVB 2BKDN 1ZA1B 5J26A 1LJOA 5GANg 2UUEB 2DD5A 5GAMh 3WVEB 1TFBA 3CQTA 5CKBA 4HKEA 1VQ6A 4EOQB 2K3XA 2F2CA 1IZ6A 4J9EA 5LJ3h 1A0NB 1R0BG 3OYMA 4ELYC 2BZ8A 2FB7A 1ZBJA 2EKHA 1WHKA 5GAN2 3CCRA 1TH7A 4M7AA 1KIKA 2AHJB 3S3OA 2E41A 2WEVB 1M8VA 5LJ5e 2FYKA 2RJFA 3E9FA 1WJSA 4A54A 4HCBA 3G7ZA 3DL1A 2O01E 3H8ZA 1VQLA 5FU7B 2DTHA 2P4RA 2V26A 3CXCP 4M75C 3JCMc 2QG9B 2QEXA 3SHWA 1EIFA 1EZZB 2EW3A 2D1XA 2LJ3A 4R55A 1LOJA 4M75G 3URGA 4QKUA 2YDLA 1OULA 2P4TA 3O5ZA 1BU2A 2JXBA 1W1FA 3JB9H 2CZ6B 3QDRB 1VQMQ 3J81E 4MZTA 2F5TX 4KBMB 1LVKA 3IQLA 3CPWA 2KBTA 4C92D 1U5SA 5IXBA 5HCKA 3VS6A 2PVOB 1D09B 1RAEB 2LJ1A 2L89A 2LP5A 1RADB 3VUZA 1N8RR 2NYSA 1ZA2B 2FZGB 4OGCA 1VQPT 5J3BA 4JJCA 4A63B 2X3XD 1K76A 1Y7XA 1G2BA 2CUDA 1WFWA 4OB1B 1WXUA 4O5VA 4JZ3A 2VV5A 3I5RA 4OMQA 4FL6A 2KXCA 2NUZA 5EG2A 3QIIA 2FZCB 3MIAB 3CCSQ 4JUVA 4FT2A 1ZSZA 5EJCA 4M4ZA 3CD6A 5I5ZB 4Z02A 1Q81R 2DO3A 2LC4A 2EAYA 4ORZA 2A3LA 3EGUA 3MEVA 4BCNB 4KUDK 1M30A 1IREB 2YSQA 1KK7A 4RTYA 5GMKl 2XDBA 4BI8B 3ASKA 2CS7A 5FGKB 2KQWA 2WIHB 3BHTB 2XD0A 1UG1A 3TCJA 4CRIA 4ROEA 3FDRA 4E7SA 3G4SA 1W98B 5LJ5f 5DY9A 2XK0A 4MZMA 3NMZC 2CREA 4LUEA 1FMVA 3H9NA 2JM9A 4M77F 3VRYA 4EOMB 2EWNA 2OJ2A 2ZGWA 4JRKA 2BTTA 4WTOB 1PM3A 3MY5B 2O4XA 2E3HA 1MGQA 3OMGA 3T9NA 2RHZA 5D7UA 1GRIA 3M0UA 2RF0A 2C4GB 1M3AA 3QKJA 4NSTB 2DZCA 1K1ZA 2X9HA 1B7TA 1RLQC 2RHIA 1V1CA 3GLXA 4B9WA 2KYMA 2ABLA 1H4LD 3BDUA 1Z9ZA 2V8KA 4JJBA 1GFCA 3EGXA 4XU3A 4PJOF 1M1KR 4QW2A 1FWZA 1SG5A 3KFVA 1FMWA 3LX7A 2GGRA 3QWXX 1WQ7A 2HBPA 4Z88A 2MPXC 3CC4A 2MAMA 2JTEA 1YJ9A 3TW6A 3BLQB 2AIRB 1AWOA 3BFMA 2W9ZA 4C5IA 1HJDA 5LJ5g 4UN0A 1VQNT 4AI6A 1QCNA 2J06A 3I55A 1BI0A 1OL1B 1C6VX 2MMPA 4J9GA 3BE3A 2DE0X 2CP2A 3HB9A 1YJNQ 1KHCA 1AD5A 1WDXA 5GAN5 4F7LB 2V22B 4LNPA 3OW2P 4C92C 3JCMd 3EG2A 3SFMA 2LNHB 4WCIA 4C92G 2C06A 1OV3A 3BLRB 3PMTA 3QDFA 3G71Q 3CMAT 1K0SA 2KGTA 3V8JA 1KJWA 3OB9A 1WA7A 1ZLMA 1QCOA 1M2VA 1UJYA 1NZ9A 4BCMD 1W2BA 4IMYB 4C92A 5HKCA 4OB2B 1HYOA 3RMQA 2KSSA 2GFAA 2RN8A 1D3UB 4DBRA 3CPWS 1KQ2A 1QW1A 3AHUA 2X3WD 5IHIA 2P84A 2YRVA 1VYWB 1U1SA 1U3OA 2IG0A 4YC3B 2E1HA 2HZYA 4PJOA 3NDQA 1VQ5Q 4C0FA 3L2UA 3QHWB 4FW2A 4AKIA 2Y90A 2DEUA 1T0JA 4FIBA 1M2OA 1YIJT 2IW9B 1R77A 2Y4XA 1Q82R 1PCXA 3EH2A 1YHQT 2E6NA 1GY3B 3MKDA 4AG1C 2WPAB 1ZSGA 2ZPEB 2PQWA 4AKHA 1VQ7Q 3RMSA 4PJNA 2EQUA 1TXQA 3H6ZA 1SHFA 1TUGB 3PVQA 5IHKA 3L2VA 2JW4A 3GNGA 1YI2T 5IAYA 3OYIA 1N8RU 4OGEA 4J6XA 4C8QE 1ABOA 4NL3A 3JSCA 2QQRA 4CC2A 2NUPB 2ROLA 4BCKB 3QJ6A 5GAOl 1ZP2A 2CP5A 1UE9A 4EOJB 1VOMA 4ELLA 1Y96A 4OGRB 5CIUA 1XOVA 1X69A 4GY5A 2FPDA 3CC4T 4QQ6A 1AISB 1Q81U 2DRKA 4J8OA 4BCGB 2HAXA 2CCHB 1VQ8A 3UWNA 2GBQA 1QVGP 3QSUA 1GBQA 2GFUA 2LMJA 4C5EA 4X9CA 4NS5A 2C5XB 5KYUB 2EQIA 1JB0E 4J9HA 4M75E 2CKKA 3DLLA 3I56Q 1Y0MA 1QP2A 5GAOp 1KD1R 2W10A 1WI7A 4OMMA 3HPWA 4BCPB 1UGVA 5DLOA 4F7NB 2C0OA 1VQKT 2GNCA 2V8IA 3OS2A 4CFNB 1WQWA 2WJ9A 3POMA 3PNWC 2FEIA 2L0AA 2X1NB 3H0IA 4OF1A 2DTIA 4XTVA 1H1QB 2LZ6B 4JDSA 4BB7A 3CBPA 4F7JB 2QQ8A 3QXEB 4PJJA 3EOCB 1N6AA 5GAMe 3CCVA 2RPNA 1AWJA 1X6OA 4BDZA 4F6WB 2J6OA 4RTWA 1NG2A 5KYWA 4ATOA 1C1AA 2XU8A 1M1KU 5LJ3e 4DQ2A 1NPRA 2J05A 1VQMT 5C6SA 4M78D 1VQOQ 1ZHIA 4NC6A 4CFXB 2LVMA 2RQTA 1WX6A 2VUBA 4F7UB 3E19A 2BE9B 2RD1A 5KH6A 2JVVA 3QPHA 5IF1B 5KE3A 1OKWB 4FSXA 5FU6B 5GMKe 1QLBA 2DL5A 4PFPA 4LE9A 2CP3A 1YJNA 2V1QA 1VQ6Q 1BI3A 4ZNXA 5CAIA 2KR3A 5HY6A 1YNZA 5HNBB 3UA6A 5L23A 1RAHB 4M7DB 1PKTA 4RCCA 3CCRQ 3A8OB 1T0HA 2RI5A 2COYA 1W2BS 1N27A 2YRDA 5GANe 2QK0A 4JRIA 4BUGA 3CCST 1GFDA 1QVGS 4E7ZA 3PGGA 2RQVA 3G33B 2RJDA 2RJCA 4MIMA 3MHXA 1VQLQ 1QP3A 4JPBW 2A08A 2WIPB 3FIFA 4CFUD 4BCND 3EJ1B 2NWMA 2KE9A 1NEGA 1JXMA 1HSQA 3FLGA 4PFOA 1XJWB 4L6V5 4BI4A 2W2HA 2NUTA 1ZUYA 4C0DB 5FROA 2VGMA 2CDTA 2E6ZA 4HVWA 1M4ZA 4FYYB 3A8GB 1LNXA 4BCQB 3JCMh 3V7RA 1XTDA 3MEAA 2GTOA 4UC4A 1JO8A 1OQKA 1VQ4Q 2YRCA 3CC7Q 4KGXB 3LLRA 3L2QA 1FVVB 4EOPB 3EG3A 3CPFA 1RI0A 2YXYA 1RACB 4EONB 5GAMf 3J80E 5GAMj 3NTHA 2YHTA 3X28B 2H8HA 1AEYA 1H1RB 1IXDA 2HSEB 5LJ3f 1G5VA 3P8DA 5HBHB 1WGSA 2JTMA 3SWNA 1NYFA 1NE8A 3JCMb 5GAN7 5FWBA 5KCHA 2CH4A 3CCET 1B07A 1OI9B 6AT1B 2RNAA 4OB0B 3EG9B 2AKLA 1EFNA 2FHDA 5CEIB 4FYXB 2QDYB 4BY1X 3LH0A 2FG0A 4C92E 1OX9A 4CFMB 4JS5A 1M27C 2KR6A 4PJLA 1M3BA 3TW7A 2EGAA 4ANJA 4QT7A 2DL8A 1TTHB 1UHFA 5D6YA 1ZQ1A 2YUOA 4M78C 2RQRA 1YJNT 1H8KA 5HBJB 1QVFA 4M78G 1PNJA 1IRXA 3JB9F 1WHLA 3M4GA 3G4SQ 4N0AC 2H3JA 1RABB 4LDYA 1I4K1 5GAMg 3X26B 1MUZA 2EYXA 3CCUT 1WJRA 5HK0A 1I81A 1KD1U 2O88A 5LJ3g 1QCFA 5DLQE 4KRCB 3CCQQ 1QMCA 3G71T 3ZEHA 2WSFE 3CMET 4BD3A 2LX7A 2QI2A 5M9OA 1YJWT 1KHIA 1BI2A 2HEQA 1WJQA 2M02A 3JCMX 3CCLQ 5KYYB 2L8DA 4RKUE 4BBSM 2HQHA 1SSHA 1UJ0A 3M59A 2PUOB 3VRZA 2KI7A 3VV0A 5A0DA 2KVQG 2FO0A 4J9BA 1K9MC 1E7PA 2PK2A 3RR6A 3RKYA 4MMLA 5DQVA 1VQ5T 2K79A 4M7AC 2K2VA 4PFZA 1YJ9Q 2RO0A 3LGFA 4RG2A 4M7AG 2QGGA 4IUUA 4FX3B 1OEBA 1V29B 1Y57A 3VU3C 1U06A 2LDMA 1D0ZA 1VQ7T 1O9KB 2R5AA 2OTJA 3I55Q 3M0SA 3QUIA 1KFZA
chains in the Genus database with same CATH topology
4LDUA 1H3ZA 4BE0A 3QKJA 4MDWA 4X34A 2DZCA 3VKIA 2JN0A 5KE2A 3MO8A 5GAOq 2XHCA 3SWNC 2MI6A 2PVDB 2RHIA 3GLXA 3HRTA 4B9WA 2X4XA 1Q82U 3OBWA 1O9SA 3M54A 3X25B 4IUQA 4PL6A 3BDUA 5I21A 2V8KA 5IN1A 3G6EA 4LDVA 4WF2A 3LWHA 4XU3A 2MWPA 3PFSA 4PJOF 2PUKB 1BKBA 4QW2A 1FWZA 2LT1A 5A0LA 3QWLA 2KMTA 3ZFJA 3LX7A 2YLCA 4M77B 4C0ZA 1WQ7A 2HBPA 3OW2S 3JCMJ 1UGSB 1U1TA 3CC4A 2XDDA 1I8FA 2RB6A 1VIEA 2MAMA 1YJ9A 3DLMA 3TW6A 3DB3A 4Q5WA 4KT0E 4HNTA 2PVGB 3BFMA 4NL2A 4C5IA 2EJ9A 5CCAA 2P0KA 3CCVT 4M77E 3RIRA 5LJ5g 4A4EA 2M9UA 1VQNT 1FXXA 4AI6A 2VC8A 3OSSC 3P8BB 3I55A 4QVZA 3VYGB 4M77D 4M75D 1BI0A 2DZ9A 4ZGEB 2B8AA 5FU7C 3J7AF 2MMPA 4HT8A 4RMOA 2QQ9A 3BDLA 4E7KA 5GAMd 3C95A 4PJOB 3HB9A 4MFEA 2LTOA 3NTIA 1KG1A 4N4IA 2K5IA 4LDWA 4BY6B 1KHCA 4XU1A 4IURA 3SB2A 4XU0A 5GAN5 3I56T 2X35A 5LJ3d 4LD6A 3UT1A 4C92C 1VQ4A 1M90C 3JCMd 3CC7A 3HKSA 3SFMA 1X01A 3EFSA 2DXUA 1O75A 4C92G 5GAN6 3RESA 2C06A 3WVDB 4HNVA 3META 4JRQA 3S3MA 3PMTA 5CO7A 3CCEA 4PJOE 2DXTA 2XI9A 1ZBXA 3OQ5A 3OS1A 2D9TA 4PJOD 2L3RA 2Y4YA 3M55A 3CMAT 4Z6YA 4EMKB 3OMCA 2VXEA 3V8JA 5DM7R 1H641 4C8QF 3OB9A 5CKFA 1JJ2A 3QO3A 2KMGA 2CZ0B 1NZ9A 4PNOA 3BY7A 1W2BA 3M4YA 1UEBA 2DXCB 4C92A 5HKCA 4OB2B 3KBGA 4KULA 3RMQA 1K9MU 1BI1A 3LGLA 3OYBA 3M56A 4X9DA 2KSSA 2BS3A 3CBOA 2GFAA 2P0QA 3OYAA 2BUDA 2G77A 3CPWS 5D6XA 3VYGA 1B34B 3L2RA 3S3NA 4PLIA 1QW1A 2XDPA 1KQ2A 5LL6S 1X75C 3AHUA 3OYNA 1W4SA 3LWIA 2YRVA 5AYFA 1U1SA 2IG0A 3LYIA 4OP0A 3GNFB 2BS4A 2HD0A 2RK2A 2E1HA 1VQOT 3JCMV 4EMKC 2VXFA 1VQPA 4PJOA 3L2WA 3QYEA 1FX7A 3ZBDA 2D0QB 3MP6A 4C0FA 3L2UA 5D6WA 4AKIA 3X20B 2Y90A 4A4HA 5HK3A 2OTLA 4L59A 4FIBA 1YIJT 1QVFS 2Y4XA 4IUPA 5CKDA 3E9GA 3VKGA 2XKOC 3GP8A 4C8QB 2JZ2A 3N5BB 4J6WA 2E6NA 3CXCA 3CCUA 1YHQT 1UGPB 2ZPEB 2PQWA 2LQ8A 4AKHA 4OB3B 1P92A 3RMSA 4MZPA 3TEEA 3OYCA 3DKMA 2JNGA 3HRUA 4JJNK 1VQ6T 3ER0A 3QZ9B 2EQUA 1M1FA 3G71A 3H6ZA 5CK9A 4L5GA 4DOVA 2L5QA 1S72T 2XG8D 2HQEA 3C4SA 4EMKA 3GNGA 3L2VA 3CMEA 1YI2T 5IAYA 3OYIA 3PMIA 4OGEA 1YJWA 1N8RU 3CC2T 2DTOA 4J6XA 4C8QE 4NL3A 1R8OB 4M75F 3JSCA 3H4CA 5GMKm 2QQRA 2JTFA 4GLKA 3CCRT 5A2QE 4XTXA 3A8HB 3M5AA 3HL8A 3CCQA 2G3RA 4M7DD 4D6WA 3JB9G 1YBYA 1K73U 1Q7YC 3QJ6A 5FRMA 4M7AD 2YLBA 2DJZA 2ZZDA 3QJYA 2FVUA 3HO8A 5GAOl 4IKFA 1BYMA 3RKWA 1B34A 4XU2A 3CCMT 4JLGA 1QVPA 5CR2A 2QQBA 3OYJA 3Q1JA 3OSVA 4A4FA 1G3TA 3PT9A 3CCLA 2R58A 1Y96A 2ZPGB 3A8LB 5CIUA 1XOVA 1VQLT 1VQ5A 4EMGA 4GY5A 4ZN1A 5LJ5d 3JCMQ 1N8RC 4MDXA 3VJPA 3KHIA 5GAN4 2ZPFB 3CC4T 4QQ6A 3BW1A 1Q81U 3CCJA 1BIAA 4J8OA 2QEXT 1VQ9T 2HAXA 3V7CA 3MP1A 1KQSS 1VQ8A 3JRZA 3UWNA 3G6ET 4C8QA 4HCCA 5FRNA 3INZA 1SSFA 3UPUA 4M75B 4R56A 1FKMA 1VQ7A 2EJFA 1YITA 3OYYA 1K73C 3QSUA 1OZ3A 4B9XA 4BI3A 1XQHA 2DKGA 4J83A 4M78F 2GFUA 4C5EA 4ZGJB 3NTKA 1JRIA 3QG1A 4X9CA 4NS5A 1M90U 2KK4A 2RI3A 1JB0E 5CQYA 4E7HA 4OVAA 5GMKh 3UDCA 3X24B 3OS5A 4M75E 3OYKA 3HFOA 3HBLA 2CKKA 3DLLA 4FU6A 3F70A 1QP2A 4PKCC 5CKHA 2V8JA 5GAOp 1Q81C 1UGRB 3SD4A 4P5NA 4C5HA 3MEWA 1D3BB 3L1AA 2ZPHB 3HHTB 4BBRM 4M77C 4N4GA 3HPWA 4XTWA 3OYGA 4M6VA 4FT4A 5DLOA 3OA6A 1UB4A 2X4WA 5LJ3j 2WSEE 4HNUA 2E65A 4F7UF 2V8IA 3EAEA 1WNLA 4M77G 2QF7A 4XAXB 4EPCA 2EJGA 1VQKT 2KAFA 3OS2A 3OYFA 1WQWA 2WJ9A 3KUFA 3PNWC 3OYEA 4YTLA 3RKXA 4OF1A 2QA4T 5GANh 1OI1A 1OZ2A 2DTIA 2RHXA 4M78B 4XTVA 4JDSA 3A5ZB 4BB7A 2EYQA 3CBPA 3LW5E 2QQ8A 3C12A 2DXBB 3QXEB 5GMKj 4J7FA 1N6AA 3V8LA 2F5KA 5GAMe 4JX5A 1PSEA 3OYLA 1Y07A 4M77A 2K3YA 2RI2A 1X6OA 4M75A 4QVDA 3OYHA 4BACA 4BDZA 1VQNA 3CCVA 1NJIU 5GMKi 4BDYA 4PJOC 5I2SA 4ATOA 2E12A 1YCYA 2LNVA 2XU8A 4M78E 3MEUA 4A53A 4BY6C 2DVEA 5J39A 5LJ3e 3KXTA 1M1KU 1VIFA 3JCMe 4RCBA 4PJOG 4DQ2A 4M7DF 1NPRA 3FRNA 1VQMT 3BG5A 5C6SA 4M78D 4OMFB 3CD6T 1ZHIA 4M7AF 3QBYA 2E70A 3V7SA 4EMHA 4NC6A 4JRPA 5IT9E 3OBYA 2LVMA 2VUBA 4HL4A 4F7UB 3SDZA 3I56A 3A8MB 2RD1A 3E19A 5KH6A 4LOCA 2JVVA 3QPHA 4HLQA 2DAQA 5GAN3 4HT9A 1UGQB 2HNIA 4XK8E 5KE3A 2RHYA 2PU9B 4XTZA 4FSXA 5GANf 5GANj 1D3BA 3PTAA 5C0MA 2RH2A 4ME7A 5FU6B 5GMKe 3S6WA 4HA8A 1QLBA 4DA4A 2QQAA 1N9SA 1YJNA 3QYHB 2DD5B 4JS4A 1NJIC 2ZCFB 4F7UE 1HK9A 3GF5A 1BI3A 3ME9A 4VUBA 5CQXA 3L2ZA 3RUXA 4A4KA 5CAIA 5HY6A 3CMAA 1M1KC 2O4XB 1NPPA 1Q7YU 2E10A 4M78A 3TREA 3G4ST 2EFIA 4II1A 1K8AU 5GAOn 3FC3A 3M57A 4M7DB 1JJ2S 2DXBA 3CBMA 3A8OB 4RCCA 4M7AB 2RI5A 4F7UG 3VYHB 2MWOA 1W2BS 4N0AA 1KC8C 1N27A 1BIBA 2E64A 4IUTA 5GANe 2OTJT 4JRIA 5CKEA 4BUGA 3CCST 3CCQT 1KQ1A 1QVGS 2K4YA 3FEOA 3PGGA 2QQSA 2CYZB 2DEQA 3JB9I 3BG3A 2DXCA 1N9RA 2RJDA 2RJCA 2WACA 1MHNA 2M16A 4JLIA 2K57A 2R57A 4M7AE 4MIMA 3MHXA 3V8KA 1QP3A 4C8QC 3M53A 4F7UA 2DK3A 2WSCE 2DD4B 2OAUA 1K8AC 3FIFA 1YIJA 3JB9J 5A0GA 4C8QG 1VQOA 2BS2A 2A7YA 2DIQA 2EKOA 2LQKA 2P0PA 3SWNB 4EDUA 1YHQA 2D6FA 5LJ5j 2BKDN 3FLGA 3PIOA 1RL2A 3OS0A 3OW2A 5J26A 4E7JA 2CZ1B 1LJOA 2R5MA 5GANg 2DD5A 5GAMh 4L6V5 3WVEB 5CKBA 4HKEA 4BI4A 3CXCS 1VQ6A 1AHJB 4C0DB 5FROA 2VGMA 1S72A 2K3XA 1Y71A 2E6ZA 1M4ZA 1YI2A 1IZ6A 3A8GB 5LJ3h 1YJ9T 3CC2A 1LNXA 4ELJA 3JCMh 3C94A 5CVIA 4ELYC 3OYMA 4AKGA 3V7RA 4C92F 2FB7A 4QVCA 3OYDA 3VUBA 1XTDA 2EQKA 5GAN2 5GAOm 3GPLA 3CCRA 3MEAA 4C0GA 4M7DA 4C5GA 4ELZC 1TH7A 4M7AA 2RM4A 3TU4K 2GF7A 2AHJB 3S3OA 2E41A 3QYGB 4UC4A 3I55T 1M8VA 5LJ5e 3CCMA 4Y28E 3JCMW 2FYKA 3LLRA 3R6OA 2RJFA 3E9FA 1G3YA 4QQGA 3L2QA 4C0DC 1WJSA 1WPYA 4PLLA 3CPFA 1DJ7B 1RI0A 4A54A 4TVRA 2M1HA 4HCBA 1VUBA 3J80E 5GAMf 3G7ZA 3DL1A 5GAMj 3OY9A 2O01E 3H8ZA 4NOYA 3NTHA 1VQLA 2YHTA 5FU7B 3X28B 2JUFA 2RA2A 1I5LA 2K5LA 2DTHA 2F69A 2DD4A 2ZPBB 2M0OA 4M75C 4JX6A 4RG8A 1VQ4T 2QDJA 3JCMc 4QQDA 2QEXA 5LJ3f 1VQ9A 1EIFA 3CC7T 3P8DA 1G5VA 3JCMf 4FM4B 1WGSA 4KUIA 2JTMA 4N4HA 3SWNA 4A4GA 1LOJA 4M75G 3URGA 4R55A 4ZN3A 1NE8A 4XTYA 3JCMb 3BG9A 5GAN7 4E7IA 5GAOr 4C92B 4QSHA 1Q82C 3HRSA 5KCHA 5I2MA 3CCET 4M7DE 2P4TA 2NLUA 2E5QA 3HP9A 4HCZA 4OB0B 3JB9H 1G3WA 2CZ6B 2FHDA 3QDRB 2HQXA 2QDYB 3J81E 4MZTA 3LH0A 2EQMA 4CI0C 2VGNA 4C92E 2F5TX 2XIDA 2QFZA 3EFRA 4JS5A 4KBMB 1HXDA 2KR6A 3FJPA 3CPWA 3HFNA 4C92D 3PIPA 3HSBA 3TW7A 2GCXA 2IVWA 2KY9A 2K5FA 1M9SA 2PVOB 3M58A 1GXIE 4ZTJA 3RERA 2BIVA 2RK1A 2VYTA 2L89A 2XICA 4IUVA 3VUZA 5D6YA 3VKHA 1VQKA 1ZQ1A 4M78C 3WXMB 1U8RA 5KCOA 3L42A 4OGCA 1VQPT 2CGHA 1YJNT 3GOXA 5J3BA 1QVFA 2LX9A 4MFDA 4M78G 2QA4A 1KC8U 4ZGDB 1Y7XA 3JB9F 2I2LA 3M4GA 3QHSA 2QTXA 4OB1B 4N0AC 4JX4A 2H3JA 2OTLT 4LDYA 1I4K1 5GAMg 4LD9K 1PSFA 4O5VA 4BE1A 3X26B 1G3SA 2GQVA 3CEYA 2VV5A 3CCUT 1WJRA 4FL6A 1I81A 3O8VA 5HK0A 1KD1U 3GIBA 3QYBA 5LJ3g 2ZPIB 5EG2A 3QIIA 3JCMg 5DLQE 4JUVA 3G71T 1QVGA 4FT2A 3ZEHA 2WSFE 2ZZDB 5EJCA 3M9QA 5LJ5h 3CMET 4MMKA 4E7LA 4LDXA 2X4JA 4BD3A 2QXFA 1VQMA 5M9OA 2LCLA 2QI2A 1YJWT 3CD6A 1KHIA 1BI2A 4Z02A 4ZTFA 1WJQA 2DO3A 2LC4A 2KDSA 2EAYA 1JBMA 2FL7A 3JCMX 2A3LA 3MEVA 2L8DA 2EIFA 4RKUE 1Y96B 4BBSM 5FU6C 2CZ7B 4DOWA 5GANd 1IREB 2LT4A 4KUDK 1Q86U 3M59A 2PUOB 5GMKl 4J7IA 2XDBA 3VV0A 4BE2A 4BI8B 5A0DA 4Y91A 2LCCA 2RHUA 2DIGA 2KVQG 3NFCA 1KD1C 3ASKA 5FLXE 2EQJA 3JAME 3JCMP 1E7PA 1K9MC 2CS7A 2KQWA 3DB4A 4J5YA 3RKYA 4J6YA 3CCLT 2XD0A 2JOYA 4MMLA 4E47A 1M5Q1 3MCAB 3TCJA 4M7DC 2MF2A 1VQ5T 5L8RE 4CRIA 3E1SA 3FDRA 2K2VA 5GAN8 4M7AC 1KQSA 3G4SA 2RO0A 5LJ5f 4O6JA 4XTUA 5DY9A 3MP8A 4M7DG 2XK0A 4MZMA 3LGFA 3CCJT 4RG2A 4M7AG 3FB9A 4IUUA 3JB9D 1VQ8T 4V2SA 4M77F 1V29B 1Q86C 3VU3C 2LDMA 4XQ3A 2EWNA 2RJEA 1YITT 1VQ7T 2DPPB 4C8QD 2R5AA 2LRQA 2ZGWA 1XNIA 4JRKA 1OYXA 3QUIA 2OTJA 3CCSA 3QZ5B 2O4XA 1MGQA 3OMGA 3P8HA 1M1GA 3T9NA 2RHZA 3HZJA 2X4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGP B;  2ZPE B;  4OB3 B;  2PVD B;  3A8M B;  3X25 B;  3QZ9 B;  1UGQ B;  4OB0 B;  4XK8 E;  2PU9 B;  2CZ6 B;  2QDY B;  2PUK B;  3QYH B;  2DD5 B;  2ZCF B;  3A8H B;  1UGS B;  2PVO B;  1GXI E;  2ZZD A;  4KT0 E;  2PVG B;  2DXB A;  3A8O B;  3VYH B;  2ZPG B;  3A8L B;  4ZGD B;  3VYG B;  4OB1 B;  2ZPF B;  4ZGE B;  1PSF A;  3X26 B;  2CYZ B;  2DXC A;  1QP3 A;  2ZPI B;  2WSC E;  2DD4 B;  4ZGJ B;  2WSF E;  2ZZD B;  1JB0 E;  3WVD B;  3X24 B;  2CZ1 B;  2DD5 A;  4L6V 5;  3WVE B;  4RKU E;  1AHJ B;  1QP2 A;  2CZ7 B;  1IRE B;  1UGR B;  2PUO B;  2ZPH B;  3HHT B;  3A8G B;  2CZ0 B;  2WSE E;  2DXC B;  4OB2 B;  2AHJ B;  3QYG B;  5L8R E;  3VYG A;  4Y28 E;  3LW5 E;  2DXB B;  3QXE B;  1DJ7 B;  1V29 B;  1PSE A;  2O01 E;  2DPP B;  2D0Q B;  3X28 B;  3QZ5 B;  2DD4 A;  2ZPB B;  3X20 B;  4FM4 B; 
#chains in the Genus database with same CATH topology
 2LW4 A;  4LDU A;  4MDW A;  4X34 A;  5I22 A;  5KE2 A;  2JN0 A;  1PRM C;  3HRT A;  3OBW A;  1O9S A;  1BCO A;  5I21 A;  1X43 A;  2C6T B;  5IN1 A;  2EYW A;  1TUD A;  2C5N B;  1BKB A;  2AKK A;  2I53 A;  3M0R A;  2YUQ A;  3M03 A;  1UUE A;  2J6K A;  1UTI A;  3JCM J;  2DM1 A;  2DF6 A;  4KT0 E;  1KC8 R;  4NL2 A;  2VKN A;  2COW A;  3QHR B;  1MND A;  1FXX A;  2VC8 A;  4AG2 C;  4QVZ A;  3EHR A;  4M77 D;  3J7A F;  2VVK A;  3BDL A;  4E7K A;  2O2O A;  4MFE A;  1KG1 A;  3NTI A;  4FYV B;  4N4I A;  4LDW A;  3NHN A;  1JEG A;  1OX8 A;  3SB2 A;  3I56 T;  1G3N C;  3G1J A;  4LD6 A;  1VQ4 A;  3CC7 A;  3A1P A;  3HKS A;  1X2K A;  2JM8 A;  2MK5 A;  4HNV A;  1ZSZ C;  1CKA A;  3MET A;  5CO7 A;  2XI9 A;  2D9T A;  4PJO D;  1I07 A;  2L3R A;  3H0F A;  3M55 A;  2JS0 A;  4EMK B;  1GUX B;  2VXE A;  5ICP B;  1H64 1;  2KMG A;  4PNO A;  3BY7 A;  3M4Y A;  2D8H A;  3C0C A;  4J9C A;  3KBG A;  1K9M U;  2DX1 A;  2BS3 A;  2P0Q A;  4CFV B;  2BUD A;  2G77 A;  1QMZ B;  4F16 A;  1B34 B;  4PK4 A;  3L2R A;  2AK5 A;  4KGV B;  2IIM A;  5AYF A;  2W96 A;  2BS4 A;  1VQO T;  4CC7 A;  3L2W A;  1FX7 A;  1I5O B;  2CJM B;  5KYN A;  5D6W A;  4A4H A;  5HK3 A;  1WHG A;  1S72 Q;  2OTL A;  1QVF S;  1AZG B;  1KSW A;  3CC2 Q;  1VQ8 Q;  3PVL A;  4C8Q B;  3N5B B;  4J6W A;  2EGC A;  1UGP B;  4OB3 B;  4IIO A;  4MZP A;  3DKM A;  2FRW A;  4JJN K;  1VQ6 T;  3ZL7 C;  1UEC A;  2DVJ A;  1IO6 A;  4DOV A;  2XG8 D;  3C4S A;  1K9A A;  3VS3 A;  1JU5 C;  3CPW P;  1R8O B;  3H4C A;  2Z0W A;  2QAZ A;  4GLK A;  3CCR T;  5A2Q E;  4XTX A;  3A8H B;  2JT4 A;  2QAS A;  3CCQ A;  3JV3 A;  4M7D D;  1IHW A;  3QJY A;  2DA9 A;  2ZZD A;  3HO8 A;  3RKW A;  3UF4 A;  1VQ9 Q;  5CR2 A;  3OYJ A;  2RMO A;  4A4F A;  1CSK A;  3CCL A;  3LH5 A;  1AWW A;  2EUF A;  1WZO A;  1VQL T;  1N8R C;  4ZN1 A;  4MDX A;  3JCM Q;  2ZPF B;  1MMG A;  2OI3 A;  3CCJ A;  2QEX T;  3V7C A;  2WMA B;  2HDA A;  3JRZ A;  4HCC A;  1VIN A;  3CCV Q;  4M75 B;  4R56 A;  1FKM A;  1YIT A;  2DKG A;  4J83 A;  4RTX A;  4DEY A;  3QG1 A;  2UZD B;  2DER A;  2B86 A;  2RI3 A;  3OS5 A;  3OYK A;  4DBQ A;  3F70 A;  1UFF A;  4PKC C;  2NUP A;  4TTH A;  1Q81 C;  1K4U S;  4B6M A;  3THK A;  1D3B B;  4HVV A;  2PMI B;  4M77 C;  4N4G A;  4M6V A;  4FT4 A;  3OA6 A;  1H26 B;  1M8M A;  4F7U F;  1GH6 B;  3EAE A;  4M77 G;  4XAX B;  2KAF A;  2O9V A;  3OYF A;  4YOZ A;  3RKX A;  4CC3 A;  2DLP A;  2RHX A;  1Q86 R;  2LQN A;  1OPK A;  3LW5 E;  1PHT A;  1CKB A;  3C12 A;  2DXB B;  4J7F A;  4BAC A;  4M77 A;  4QVD A;  4GBQ A;  4EOR B;  1RUW A;  1UNL D;  5GMK i;  4PJO C;  4M78 E;  4BY6 C;  3MEU A;  4A53 A;  5J39 A;  4KRD B;  4GLM A;  3JCM e;  4M7D F;  4PJO G;  3CD6 T;  2DMO A;  5KYU A;  5ECA A;  3V7S A;  2E70 A;  2VB6 A;  3TSZ A;  2KXD A;  1NLP C;  2JJ9 A;  3SDZ A;  4HLQ A;  5GAN 3;  4HT9 A;  4XK8 E;  3TNH B;  1TSF A;  2KT8 A;  2RH2 A;  1ARK A;  2D0N A;  4ME7 A;  4HA8 A;  2QQA A;  1N9S A;  1FMK A;  4JS4 A;  1C0M A;  2YWW A;  1MV0 B;  1HK9 A;  1M1K C;  4A4K A;  2JS2 A;  1OU9 A;  2O4X B;  3H0H A;  1NPP A;  1D1A A;  3RBB B;  3TRE A;  3G4S T;  2DFU A;  1WXT A;  3A98 A;  3M57 A;  3CBM A;  4F7U G;  4EIK A;  5I11 A;  1XO2 A;  1UHC A;  2E64 A;  2K9G A;  2W0Z A;  4LXC A;  3VS7 A;  3CCQ T;  2K4Y A;  3REB B;  2J6F A;  2DEQ A;  3BG3 A;  2DXC A;  1N9R A;  2WAC A;  2M16 A;  1M90 R;  4M7A E;  1WHH A;  4BY7 X;  1B3Q A;  1PC0 A;  3V8K A;  3M53 A;  4F7U A;  2DD4 B;  2L2P A;  2OAU A;  3JB9 J;  1SKU B;  4AMC A;  2D6F A;  4EDU A;  2P0P A;  3PIO A;  1RL2 A;  3OS0 A;  2CZ1 B;  2R5M A;  1BU1 A;  5IHY A;  5FWC A;  1AHJ B;  1YN8 A;  2BZY A;  1QWF A;  1S72 A;  1W2B P;  4YOS A;  1H25 B;  2C0I A;  1YJ9 T;  3CC2 A;  3C94 A;  4AKG A;  1OL2 B;  3EG1 A;  4QVC A;  3OYD A;  2EQK A;  4M7D A;  4C5G A;  2RM4 A;  3TU4 K;  2GF7 A;  1JKW A;  4DBF A;  3D7S B;  3AT1 B;  1LPL A;  3I55 T;  3CCM A;  4Y28 E;  2HMA A;  3R6O A;  1IGQ A;  1NLO C;  1G3Y A;  4C0D C;  4PLL A;  4FCY A;  3HTR A;  2M1H A;  4TVR A;  3OY9 A;  5IXF A;  2RA2 A;  3RNJ A;  1I5L A;  2K5L A;  4JZ4 A;  3EFO B;  2ROT A;  4RG8 A;  2QDJ A;  3VS1 A;  5KYX B;  4QQD A;  1VQ9 A;  5IDP B;  3JCM f;  4FM4 B;  3G6E A;  4CRL B;  5GAO r;  2D8J A;  2QYZ A;  4C92 B;  1Q82 C;  3HRS A;  1D1C A;  1SRL A;  2NLU A;  1G3W A;  2C5O B;  1TD6 A;  2C5V B;  1QKX A;  2EQM A;  4CI0 C;  5HVY B;  1Q7Y R;  4EOI B;  2QFZ A;  3EFR A;  1H27 B;  3FJP A;  3I5S A;  4ROD A;  3HFN A;  3PIP A;  3HSB A;  2GCX A;  2IVW A;  2KY9 A;  2K5F A;  1M9S A;  1GXI E;  5LQF B;  2ED0 A;  3TN8 B;  3WXM B;  2YUP A;  4F70 B;  3GOX A;  1QQJ A;  2LX9 A;  1SPK A;  1M3C A;  2QA4 A;  4ZGD B;  1E9H B;  2QTX A;  4JX4 A;  1YWP A;  1K73 R;  3CEY A;  2GQV A;  3FJ5 A;  4HXJ A;  2OTJ Q;  3JCM g;  2O9S A;  2I40 B;  2VAS A;  4E7L A;  3EG9 A;  4MMK A;  2WFY B;  3BHV B;  4F6S B;  1JBM A;  4IIM A;  1Y96 B;  2MYS A;  2CZ7 B;  2EBP A;  5GAN d;  2LT4 A;  1Q86 U;  2EYZ A;  1FIN B;  1QWE A;  3LQ5 B;  4J7I A;  2LCC A;  3NFC A;  2DIG A;  1KD1 C;  5FLX E;  3JCM P;  3DB4 A;  1E6G A;  2FZK B;  2JOY A;  1V76 A;  1M5Q 1;  5GAN 8;  4AFZ C;  1KQS A;  2B9R A;  2A36 A;  1TWB A;  4O6J A;  1X6G A;  3MP8 A;  1JQQ A;  3FB9 A;  3JB9 D;  1VQ8 T;  4V2S A;  4XQ3 A;  1UNG D;  2RJE A;  2DPP B;  4C8Q D;  2LRQ A;  1XNI A;  1OYX A;  4E6R A;  1WXB A;  1M1G A;  3HZJ A;  3QWY A;  2X4Y A;  1H3Z A;  1PKD B;  4BE0 A;  3VKI A;  2K3B A;  3MO8 A;  2XHC A;  3SWN C;  2MI6 A;  2PVD B;  1Q82 U;  5KYY A;  2I0N A;  1AD6 A;  4LDV A;  4RTU A;  4WF2 A;  1NJI R;  2GTJ A;  1VYT A;  3LWH A;  1BCM A;  2MWP A;  3PFS A;  1ABQ A;  2PUK B;  2LT1 A;  3ZFJ A;  2YLC A;  2XMF A;  4C0Z A;  1AOJ A;  2DL4 A;  1WLP B;  2CP0 A;  2RB6 A;  3DLM A;  5EFQ B;  3MY1 B;  3E2U A;  4J9I A;  3MJX A;  3TVT A;  5CCA A;  2HKQ B;  3CCV T;  4M77 E;  3RIR A;  2K2M A;  4A4E A;  4F04 B;  2M9U A;  1O9K A;  3OSS C;  3P8B B;  2KYB A;  7AT1 B;  4I3Z B;  3VYG B;  4M75 D;  5FU7 C;  1K8A R;  2CP6 A;  2LTO A;  2PJQ A;  2DME A;  4XU1 A;  4IUR A;  1URC B;  2AT1 B;  1QKW A;  3UT1 A;  4BCM B;  2OTL Q;  2F1L A;  1O75 A;  5GAN 6;  5IH2 A;  3S3M A;  4PJO E;  4F6U B;  2DXT A;  4CC4 B;  4EOL B;  3OQ5 A;  3OS1 A;  3GTM S;  2F2W A;  2JGZ B;  5IDN B;  4C8Q F;  5CKF A;  1JJ2 A;  2CZ0 B;  2DL7 A;  1UEB A;  5HBE B;  5L2W B;  1W6X A;  4F7S B;  1BI1 A;  1RAA B;  4X9D A;  2FPF A;  3CBO A;  2CUB A;  3TNW B;  1X75 C;  4OML A;  1W4S A;  1X2Q A;  3LWI A;  3TQ7 P;  3GNF B;  2HD0 A;  2BZX A;  2RK2 A;  3JCM V;  4EMK C;  1VQP A;  3M0Q A;  3SEM A;  4PJM A;  3ZBD A;  3NGP A;  1RAG B;  4L59 A;  3VS2 A;  3CCJ Q;  4IUP A;  3VKG A;  2XKO C;  3GP8 A;  2DET A;  2JZ2 A;  3CXC A;  2UZE B;  4II5 B;  2ECZ A;  1YIT Q;  1Z9Q A;  2J7I A;  3K7A M;  1YCS B;  1AWX A;  1WHJ A;  2JNG A;  2VWF A;  3HRU A;  3ER0 A;  2CT3 A;  2IW8 B;  4L5G A;  5CK9 A;  2L5Q A;  2YT6 A;  2HQE A;  4EMK A;  1GUX A;  1E7O A;  2FRY A;  4DBH A;  2V1R A;  4M75 F;  1VOL A;  3TSW A;  5GMK m;  2DL3 A;  4AFQ C;  2ED1 A;  1JST B;  5LMK B;  1QLY A;  3HL8 A;  3JB9 G;  1K73 U;  5FRM A;  2YLB A;  2DJZ A;  4IKF A;  3I35 A;  1B34 A;  4RTV A;  2YUN A;  4JLG A;  1QVF P;  2QQB A;  4K11 A;  1N5Z A;  3OSV A;  3PT9 A;  2R58 A;  3A8L B;  3VS4 A;  5ACB A;  1RAF B;  1JJ2 P;  4EMG A;  2KNB B;  2HCK A;  5LJ5 d;  1MV3 A;  3VJP A;  1SRM A;  2R7G A;  3BW1 A;  1BIA A;  3MP1 A;  1KQS S;  4KH1 B;  4C8Q A;  2RQU A;  2X51 A;  3INZ A;  1SSF A;  3UPU A;  2KT1 A;  2EJF A;  3OYY A;  4BI3 A;  2LJ0 A;  2KK4 A;  1NYG A;  1UNH D;  9ATC B;  2M0Y A;  4E7H A;  5GMK h;  3UDC A;  1VQK Q;  5CKH A;  1UGR B;  4C5H A;  3MEW A;  3H41 A;  2IN3 A;  2HKN A;  4OMN A;  4EOS B;  2X4W A;  4HVU A;  3EID B;  4HNU A;  2QF7 A;  4EPC A;  2EJG A;  1RI9 A;  1ZX6 A;  4YTL A;  5GAN h;  1OI1 A;  4M78 B;  1SEM A;  3A5Z B;  2CP7 A;  2PNI A;  1VA7 A;  2EYQ A;  3EGD B;  3V8L A;  2F5K A;  1PSE A;  3OYL A;  1Y07 A;  3OYH A;  4M75 A;  3DTO A;  1VQN A;  3O0G D;  1NJI U;  5I2S A;  2E12 A;  1YCY A;  2LNV A;  5EC7 A;  3KXT A;  2DVE A;  1VIF A;  4RCB A;  8AT1 B;  3FRN A;  3BG5 A;  1R0C B;  4OMF B;  1H92 A;  4HL4 A;  4KRT A;  3RDV A;  2DBK A;  2RHY A;  2PU9 B;  4XTZ A;  1D3B A;  3PTA A;  5C0M A;  2DD5 B;  2ZCF B;  3GF5 A;  3ME9 A;  4VUB A;  3CMA A;  1SHG A;  1PKS A;  3NPF A;  2EFI A;  1K8A U;  5GAO n;  4D8D A;  3FC3 A;  1JJ2 S;  2DXB A;  4M7A B;  1UDL A;  1KC8 C;  4CFU B;  4IUT A;  2OTJ T;  2ESW A;  5CKE A;  3CCM Q;  2QQS A;  3DJB A;  2CYZ B;  4LD9 K;  4JLI A;  5BNJ B;  2K57 A;  1P5E B;  3BHU B;  1YIJ A;  4ROC A;  2BS2 A;  2LQK A;  2A7Y A;  2DIQ A;  3G6E Q;  1YHQ A;  2DNU A;  5LJ5 j;  3R6N A;  3OW2 A;  4E7J A;  2ATC B;  3CXC S;  1FYN A;  1SF9 A;  1Y71 A;  1H1P B;  4YOO A;  1I1J A;  1YI2 A;  4ELJ A;  5CVI A;  1H28 B;  3DDP B;  2QTV A;  4C92 F;  3VUB A;  5GAO m;  3GPL A;  4C0G A;  4ELZ C;  2IW6 B;  4BXX X;  5AT1 B;  4EC9 B;  3QYG B;  2G6F X;  3JCM W;  1MMA A;  4QQG A;  4CXA B;  1WPY A;  4OMP A;  1DJ7 B;  1X27 A;  4BCQ D;  1VUB A;  3CCE Q;  4NOY A;  2QDL A;  2JUF A;  2QA4 Q;  2WMB B;  2F69 A;  2DD4 A;  2ZPB B;  2M0O A;  4JX6 A;  1VQ4 T;  1GL5 A;  3CC7 T;  1OPL A;  4KUI A;  4A4G A;  4N4H A;  4E7I A;  4ZN3 A;  4XTY A;  3BG9 A;  4QSH A;  5I2M A;  2E4H A;  4BCO B;  1JSU B;  2C0T A;  1MNE A;  1ACM B;  2E5Q A;  3HP9 A;  4HCZ A;  1H1S B;  4RTT A;  1ZSZ B;  2K6D A;  3MPU B;  3EH1 A;  2HQX A;  2HBW A;  2VGN A;  1I0C A;  2XID A;  1E6H A;  1HXD A;  2DJQ A;  1AVZ C;  8ATC B;  3M58 A;  3PE0 A;  4ZTJ A;  3RER A;  2BIV A;  2RK1 A;  2VYT A;  2XIC A;  4IUV A;  3VKH A;  1VQK A;  2EPD A;  3CCU Q;  2BE7 D;  1U8R A;  5KCO A;  3L42 A;  2CGH A;  2WHB B;  4MFD A;  3I9Q A;  1KC8 U;  2I2L A;  3QHS A;  2DBM A;  1G83 A;  3EFO A;  4AT1 B;  2OTL T;  3CME Q;  5KYX A;  1WYX A;  1PSF A;  4BE1 A;  1G3S A;  1YJW Q;  4RUG A;  1GCQ C;  2EYY A;  3O8V A;  3VS5 A;  3GIB A;  3QYB A;  2CCI B;  4J9D A;  1PG5 B;  2ZPI B;  3EG0 A;  1QVG A;  3M9Q A;  2ZZD B;  5LJ5 h;  4LDX A;  2X4J A;  1VQM A;  1G8X A;  2QXF A;  2LCL A;  4ZTF A;  1RAI B;  2CSQ A;  2KDS A;  2FL7 A;  1T3S A;  1JOW A;  4DOW A;  5FU6 C;  2EIF A;  1GCQ A;  4LN2 A;  2AZV A;  2KRO A;  3EGX B;  4BE2 A;  2FPE A;  4Y91 A;  2RHU A;  4ESR A;  2EGE A;  2EQJ A;  3JAM E;  4J5Y A;  4J6Y A;  3CCL T;  4E47 A;  1PD1 A;  1NBE B;  3MCA B;  2LCS A;  4M7D C;  2MF2 A;  4Y92 A;  5L8R E;  3E1S A;  1OKV B;  4XTU A;  4M7D G;  3CCJ T;  1Q86 C;  2L3Q A;  1YIT T;  1IB8 A;  4DEX A;  3CCS A;  3QZ5 B;  2HSP A;  3P8H A;  2MCN A;  4D8K A;  1EX4 A;  2PZ1 A;  5GAO q;  4BCJ B;  2QGS A;  2RQW A;  1D0Y A;  2X4X A;  4IUQ A;  2CH4 W;  3X25 B;  3M54 A;  4PL6 A;  1GCP A;  3GBQ A;  2CSI A;  2HL3 A;  2L3S A;  5A0L A;  3QWL A;  2KMT A;  3REA B;  4M77 B;  3ULR B;  1D0X A;  3OW2 S;  1UGS B;  1U1T A;  1AZE A;  1ZUK A;  2XDD A;  1I8F A;  1VIE A;  4AFU C;  2IVX A;  1M2V B;  4G6L B;  3DB3 A;  4Q5W A;  5FW9 A;  4OMO A;  4HNT A;  2PVG B;  4FYW B;  1F5Q B;  2EJ9 A;  2H3E B;  1MMD A;  2P0K A;  2ZAE A;  4BCF B;  1RLP C;  4F14 A;  4E2F B;  2AZS A;  2DZ9 A;  4ZGE B;  2B8A A;  4HT8 A;  4RMO A;  1S1N A;  2QQ9 A;  4R0K A;  5GAM d;  3C95 A;  4PJO B;  1OIU B;  1VQP Q;  4X1V A;  1AT1 B;  2K5I A;  4BY6 B;  4EOO B;  4XU0 A;  2X35 A;  5LJ3 d;  1M90 C;  1X01 A;  3EFS A;  2DXU A;  1WIE A;  1MMN A;  4FW1 A;  3RES A;  3WVD B;  4JRQ A;  3CCE A;  1ZBX A;  1IGU A;  2Y4Y A;  1J3T A;  2A28 A;  4Z6Y A;  2PHG A;  2JMA A;  3OMC A;  5DM7 R;  3RGF B;  3QO3 A;  1IHV A;  1TG0 A;  2DXC B;  4KUL A;  2EVR A;  3LGL A;  3UA7 A;  2ENM A;  3M56 A;  3OYB A;  1N4M A;  3OYA A;  1YFN A;  2OX7 A;  2F2X A;  5D6X A;  3VYG A;  3S3N A;  2W99 A;  4PLI A;  2XDP A;  1K0X A;  5LL6 S;  5GJV B;  3OYN A;  2A0F B;  1OIY B;  3LYI A;  4OP0 A;  2VXF A;  2QGF B;  3DDQ B;  3QYE A;  4J9F A;  2D0Q B;  3MP6 A;  1HD3 A;  3X20 B;  3TNI B;  2KRM A;  2KRS A;  1X6B A;  5CKD A;  3E9G A;  4HCK A;  2COZ A;  3CCU A;  2K7A A;  2MOX A;  2LQ8 A;  1P92 A;  3M0P A;  3TEE A;  3OYC A;  4AFS C;  4BCH B;  3QZ9 B;  1M1F A;  1NEB A;  3G71 A;  2HL5 C;  1S72 T;  3CME A;  3PMI A;  1YJW A;  3CC2 T;  2DTO A;  1WHM A;  4CFW B;  1VYU A;  2JTF A;  3BLH B;  2UZL B;  2F2V A;  3M5A A;  2G3R A;  4D6W A;  1TOV A;  4FSS A;  1YBY A;  1Q7Y C;  4M7A D;  1BYM A;  2FVU A;  2DYB A;  4XU2 A;  3CCM T;  2QEX Q;  1QVP A;  1VYV A;  3Q1J A;  3F5X B;  1OGU B;  1G3T A;  1BBZ A;  1OU8 A;  2ZPG B;  2KEA A;  1VQ5 A;  1W70 A;  2DYI A;  3KHI A;  5GAN 4;  2SRC A;  1VQ9 T;  4JJD A;  2DIL A;  3G6E T;  1KXU A;  5FRN A;  2W9F A;  1VQ7 A;  1K73 C;  1VQN Q;  1OZ3 A;  3M0T A;  4B9X A;  1XQH A;  5KYW B;  4M78 F;  4LUD A;  4ZGJ B;  3NTK A;  1JRI A;  1M90 U;  2SEM A;  1T3L A;  2MIO A;  2G9X B;  3PO3 S;  5CQY A;  4OVA A;  3X24 B;  2OAW A;  3HFO A;  3HBL A;  2M51 A;  4FU6 A;  3DOG B;  2V8J A;  2LQW A;  3SD4 A;  4P5N A;  1K9M R;  3L1A A;  1ZUU A;  2ZPH B;  3HHT B;  4BBR M;  4XTW A;  3OYG A;  1UB4 A;  1YWO A;  5LJ3 j;  2KRN A;  5CYI B;  3B57 A;  2E65 A;  2WSE E;  1WNL A;  1KQS P;  1ENW A;  3CMA Q;  3KUF A;  5HQ0 B;  3OYE A;  2QA4 T;  1OZ2 A;  5DQW A;  2O31 A;  3CD6 Q;  2PTK A;  1TUC A;  5GMK j;  3U23 A;  1OOT A;  5IHN A;  4JX5 A;  1F1B B;  2K3Y A;  2RI2 A;  4EC8 B;  4BDY A;  1BK2 A;  4KGZ B;  1TS9 A;  1BB9 A;  4KH0 B;  3MI9 B;  1H24 B;  1PRL C;  4M7A F;  3QBY A;  4EMH A;  4JRP A;  5IT9 E;  3OBY A;  2BKZ B;  4RTZ A;  3I56 A;  3A8M B;  2PK9 B;  4LOC A;  2DAQ A;  2A37 A;  4EOK B;  1YIJ Q;  1UGQ B;  1C9B A;  2HNI A;  5GAN f;  5GAN j;  1YHQ Q;  2E3I A;  1YP5 A;  3S6W A;  4DA4 A;  2L3P A;  3QYH B;  1NJI C;  4F7U E;  2NUT B;  1GBR A;  4Z89 A;  5CQX A;  1D1B A;  3L2Z A;  3RUX A;  1TU0 B;  1JXO A;  1YI2 Q;  1Q7Y U;  2E10 A;  4M78 A;  1LCK A;  1NM7 A;  1H3H A;  4II1 A;  2E5K A;  3VS0 A;  4Y72 B;  4OR5 B;  3EGD A;  1PWT A;  2GQI A;  3VYH B;  2MWO A;  4N0A A;  1BIB A;  1Q95 G;  2CT4 A;  1KQ1 A;  4BCI B;  3FEO A;  4Z8A A;  3JB9 I;  4M7D E;  1VQO A;  2JMC A;  1MHN A;  2R57 A;  4F17 A;  2UZB B;  3UAT A;  4C8Q C;  2DK3 A;  2WSC E;  5GJW B;  1PD0 A;  2BPM B;  1K8A C;  3CC4 Q;  2DRM A;  5A0G A;  4C8Q G;  3EHQ A;  2IPO B;  2EKO A;  3SWN B;  2WXV B;  2BKD N;  1ZA1 B;  5J26 A;  1LJO A;  5GAN g;  2UUE B;  2DD5 A;  5GAM h;  3WVE B;  1TFB A;  3CQT A;  5CKB A;  4HKE A;  1VQ6 A;  4EOQ B;  2K3X A;  2F2C A;  1IZ6 A;  4J9E A;  5LJ3 h;  1A0N B;  1R0B G;  3OYM A;  4ELY C;  2BZ8 A;  2FB7 A;  1ZBJ A;  2EKH A;  1WHK A;  5GAN 2;  3CCR A;  1TH7 A;  4M7A A;  1KIK A;  2AHJ B;  3S3O A;  2E41 A;  2WEV B;  1M8V A;  5LJ5 e;  2FYK A;  2RJF A;  3E9F A;  1WJS A;  4A54 A;  4HCB A;  3G7Z A;  3DL1 A;  2O01 E;  3H8Z A;  1VQL A;  5FU7 B;  2DTH A;  2P4R A;  2V26 A;  3CXC P;  4M75 C;  3JCM c;  2QG9 B;  2QEX A;  3SHW A;  1EIF A;  1EZZ B;  2EW3 A;  2D1X A;  2LJ3 A;  4R55 A;  1LOJ A;  4M75 G;  3URG A;  4QKU A;  2YDL A;  1OUL A;  2P4T A;  3O5Z A;  1BU2 A;  2JXB A;  1W1F A;  3JB9 H;  2CZ6 B;  3QDR B;  1VQM Q;  3J81 E;  4MZT A;  2F5T X;  4KBM B;  1LVK A;  3IQL A;  3CPW A;  2KBT A;  4C92 D;  1U5S A;  5IXB A;  5HCK A;  3VS6 A;  2PVO B;  1D09 B;  1RAE B;  2LJ1 A;  2L89 A;  2LP5 A;  1RAD B;  3VUZ A;  1N8R R;  2NYS A;  1ZA2 B;  2FZG B;  4OGC A;  1VQP T;  5J3B A;  4JJC A;  4A63 B;  2X3X D;  1K76 A;  1Y7X A;  1G2B A;  2CUD A;  1WFW A;  4OB1 B;  1WXU A;  4O5V A;  4JZ3 A;  2VV5 A;  3I5R A;  4OMQ A;  4FL6 A;  2KXC A;  2NUZ A;  5EG2 A;  3QII A;  2FZC B;  3MIA B;  3CCS Q;  4JUV A;  4FT2 A;  1ZSZ A;  5EJC A;  4M4Z A;  3CD6 A;  5I5Z B;  4Z02 A;  1Q81 R;  2DO3 A;  2LC4 A;  2EAY A;  4ORZ A;  2A3L A;  3EGU A;  3MEV A;  4BCN B;  4KUD K;  1M30 A;  1IRE B;  2YSQ A;  1KK7 A;  4RTY A;  5GMK l;  2XDB A;  4BI8 B;  3ASK A;  2CS7 A;  5FGK B;  2KQW A;  2WIH B;  3BHT B;  2XD0 A;  1UG1 A;  3TCJ A;  4CRI A;  4ROE A;  3FDR A;  4E7S A;  3G4S A;  1W98 B;  5LJ5 f;  5DY9 A;  2XK0 A;  4MZM A;  3NMZ C;  2CRE A;  4LUE A;  1FMV A;  3H9N A;  2JM9 A;  4M77 F;  3VRY A;  4EOM B;  2EWN A;  2OJ2 A;  2ZGW A;  4JRK A;  2BTT A;  4WTO B;  1PM3 A;  3MY5 B;  2O4X A;  2E3H A;  1MGQ A;  3OMG A;  3T9N A;  2RHZ A;  5D7U A;  1GRI A;  3M0U A;  2RF0 A;  2C4G B;  1M3A A;  3QKJ A;  4NST B;  2DZC A;  1K1Z A;  2X9H A;  1B7T A;  1RLQ C;  2RHI A;  1V1C A;  3GLX A;  4B9W A;  2KYM A;  2ABL A;  1H4L D;  3BDU A;  1Z9Z A;  2V8K A;  4JJB A;  1GFC A;  3EGX A;  4XU3 A;  4PJO F;  1M1K R;  4QW2 A;  1FWZ A;  1SG5 A;  3KFV A;  1FMW A;  3LX7 A;  2GGR A;  3QWX X;  1WQ7 A;  2HBP A;  4Z88 A;  2MPX C;  3CC4 A;  2MAM A;  2JTE A;  1YJ9 A;  3TW6 A;  3BLQ B;  2AIR B;  1AWO A;  3BFM A;  2W9Z A;  4C5I A;  1HJD A;  5LJ5 g;  4UN0 A;  1VQN T;  4AI6 A;  1QCN A;  2J06 A;  3I55 A;  1BI0 A;  1OL1 B;  1C6V X;  2MMP A;  4J9G A;  3BE3 A;  2DE0 X;  2CP2 A;  3HB9 A;  1YJN Q;  1KHC A;  1AD5 A;  1WDX A;  5GAN 5;  4F7L B;  2V22 B;  4LNP A;  3OW2 P;  4C92 C;  3JCM d;  3EG2 A;  3SFM A;  2LNH B;  4WCI A;  4C92 G;  2C06 A;  1OV3 A;  3BLR B;  3PMT A;  3QDF A;  3G71 Q;  3CMA T;  1K0S A;  2KGT A;  3V8J A;  1KJW A;  3OB9 A;  1WA7 A;  1ZLM A;  1QCO A;  1M2V A;  1UJY A;  1NZ9 A;  4BCM D;  1W2B A;  4IMY B;  4C92 A;  5HKC A;  4OB2 B;  1HYO A;  3RMQ A;  2KSS A;  2GFA A;  2RN8 A;  1D3U B;  4DBR A;  3CPW S;  1KQ2 A;  1QW1 A;  3AHU A;  2X3W D;  5IHI A;  2P84 A;  2YRV A;  1VYW B;  1U1S A;  1U3O A;  2IG0 A;  4YC3 B;  2E1H A;  2HZY A;  4PJO A;  3NDQ A;  1VQ5 Q;  4C0F A;  3L2U A;  3QHW B;  4FW2 A;  4AKI A;  2Y90 A;  2DEU A;  1T0J A;  4FIB A;  1M2O A;  1YIJ T;  2IW9 B;  1R77 A;  2Y4X A;  1Q82 R;  1PCX A;  3EH2 A;  1YHQ T;  2E6N A;  1GY3 B;  3MKD A;  4AG1 C;  2WPA B;  1ZSG A;  2ZPE B;  2PQW A;  4AKH A;  1VQ7 Q;  3RMS A;  4PJN A;  2EQU A;  1TXQ A;  3H6Z A;  1SHF A;  1TUG B;  3PVQ A;  5IHK A;  3L2V A;  2JW4 A;  3GNG A;  1YI2 T;  5IAY A;  3OYI A;  1N8R U;  4OGE A;  4J6X A;  4C8Q E;  1ABO A;  4NL3 A;  3JSC A;  2QQR A;  4CC2 A;  2NUP B;  2ROL A;  4BCK B;  3QJ6 A;  5GAO l;  1ZP2 A;  2CP5 A;  1UE9 A;  4EOJ B;  1VOM A;  4ELL A;  1Y96 A;  4OGR B;  5CIU A;  1XOV A;  1X69 A;  4GY5 A;  2FPD A;  3CC4 T;  4QQ6 A;  1AIS B;  1Q81 U;  2DRK A;  4J8O A;  4BCG B;  2HAX A;  2CCH B;  1VQ8 A;  3UWN A;  2GBQ A;  1QVG P;  3QSU A;  1GBQ A;  2GFU A;  2LMJ A;  4C5E A;  4X9C A;  4NS5 A;  2C5X B;  5KYU B;  2EQI A;  1JB0 E;  4J9H A;  4M75 E;  2CKK A;  3DLL A;  3I56 Q;  1Y0M A;  1QP2 A;  5GAO p;  1KD1 R;  2W10 A;  1WI7 A;  4OMM A;  3HPW A;  4BCP B;  1UGV A;  5DLO A;  4F7N B;  2C0O A;  1VQK T;  2GNC A;  2V8I A;  3OS2 A;  4CFN B;  1WQW A;  2WJ9 A;  3POM A;  3PNW C;  2FEI A;  2L0A A;  2X1N B;  3H0I A;  4OF1 A;  2DTI A;  4XTV A;  1H1Q B;  2LZ6 B;  4JDS A;  4BB7 A;  3CBP A;  4F7J B;  2QQ8 A;  3QXE B;  4PJJ A;  3EOC B;  1N6A A;  5GAM e;  3CCV A;  2RPN A;  1AWJ A;  1X6O A;  4BDZ A;  4F6W B;  2J6O A;  4RTW A;  1NG2 A;  5KYW A;  4ATO A;  1C1A A;  2XU8 A;  1M1K U;  5LJ3 e;  4DQ2 A;  1NPR A;  2J05 A;  1VQM T;  5C6S A;  4M78 D;  1VQO Q;  1ZHI A;  4NC6 A;  4CFX B;  2LVM A;  2RQT A;  1WX6 A;  2VUB A;  4F7U B;  3E19 A;  2BE9 B;  2RD1 A;  5KH6 A;  2JVV A;  3QPH A;  5IF1 B;  5KE3 A;  1OKW B;  4FSX A;  5FU6 B;  5GMK e;  1QLB A;  2DL5 A;  4PFP A;  4LE9 A;  2CP3 A;  1YJN A;  2V1Q A;  1VQ6 Q;  1BI3 A;  4ZNX A;  5CAI A;  2KR3 A;  5HY6 A;  1YNZ A;  5HNB B;  3UA6 A;  5L23 A;  1RAH B;  4M7D B;  1PKT A;  4RCC A;  3CCR Q;  3A8O B;  1T0H A;  2RI5 A;  2COY A;  1W2B S;  1N27 A;  2YRD A;  5GAN e;  2QK0 A;  4JRI A;  4BUG A;  3CCS T;  1GFD A;  1QVG S;  4E7Z A;  3PGG A;  2RQV A;  3G33 B;  2RJD A;  2RJC A;  4MIM A;  3MHX A;  1VQL Q;  1QP3 A;  4JPB W;  2A08 A;  2WIP B;  3FIF A;  4CFU D;  4BCN D;  3EJ1 B;  2NWM A;  2KE9 A;  1NEG A;  1JXM A;  1HSQ A;  3FLG A;  4PFO A;  1XJW B;  4L6V 5;  4BI4 A;  2W2H A;  2NUT A;  1ZUY A;  4C0D B;  5FRO A;  2VGM A;  2CDT A;  2E6Z A;  4HVW A;  1M4Z A;  4FYY B;  3A8G B;  1LNX A;  4BCQ B;  3JCM h;  3V7R A;  1XTD A;  3MEA A;  2GTO A;  4UC4 A;  1JO8 A;  1OQK A;  1VQ4 Q;  2YRC A;  3CC7 Q;  4KGX B;  3LLR A;  3L2Q A;  1FVV B;  4EOP B;  3EG3 A;  3CPF A;  1RI0 A;  2YXY A;  1RAC B;  4EON B;  5GAM f;  3J80 E;  5GAM j;  3NTH A;  2YHT A;  3X28 B;  2H8H A;  1AEY A;  1H1R B;  1IXD A;  2HSE B;  5LJ3 f;  1G5V A;  3P8D A;  5HBH B;  1WGS A;  2JTM A;  3SWN A;  1NYF A;  1NE8 A;  3JCM b;  5GAN 7;  5FWB A;  5KCH A;  2CH4 A;  3CCE T;  1B07 A;  1OI9 B;  6AT1 B;  2RNA A;  4OB0 B;  3EG9 B;  2AKL A;  1EFN A;  2FHD A;  5CEI B;  4FYX B;  2QDY B;  4BY1 X;  3LH0 A;  2FG0 A;  4C92 E;  1OX9 A;  4CFM B;  4JS5 A;  1M27 C;  2KR6 A;  4PJL A;  1M3B A;  3TW7 A;  2EGA A;  4ANJ A;  4QT7 A;  2DL8 A;  1TTH B;  1UHF A;  5D6Y A;  1ZQ1 A;  2YUO A;  4M78 C;  2RQR A;  1YJN T;  1H8K A;  5HBJ B;  1QVF A;  4M78 G;  1PNJ A;  1IRX A;  3JB9 F;  1WHL A;  3M4G A;  3G4S Q;  4N0A C;  2H3J A;  1RAB B;  4LDY A;  1I4K 1;  5GAM g;  3X26 B;  1MUZ A;  2EYX A;  3CCU T;  1WJR A;  5HK0 A;  1I81 A;  1KD1 U;  2O88 A;  5LJ3 g;  1QCF A;  5DLQ E;  4KRC B;  3CCQ Q;  1QMC A;  3G71 T;  3ZEH A;  2WSF E;  3CME T;  4BD3 A;  2LX7 A;  2QI2 A;  5M9O A;  1YJW T;  1KHI A;  1BI2 A;  2HEQ A;  1WJQ A;  2M02 A;  3JCM X;  3CCL Q;  5KYY B;  2L8D A;  4RKU E;  4BBS M;  2HQH A;  1SSH A;  1UJ0 A;  3M59 A;  2PUO B;  3VRZ A;  2KI7 A;  3VV0 A;  5A0D A;  2KVQ G;  2FO0 A;  4J9B A;  1K9M C;  1E7P A;  2PK2 A;  3RR6 A;  3RKY A;  4MML A;  5DQV A;  1VQ5 T;  2K79 A;  4M7A C;  2K2V A;  4PFZ A;  1YJ9 Q;  2RO0 A;  3LGF A;  4RG2 A;  4M7A G;  2QGG A;  4IUU A;  4FX3 B;  1OEB A;  1V29 B;  1Y57 A;  3VU3 C;  1U06 A;  2LDM A;  1D0Z A;  1VQ7 T;  1O9K B;  2R5A A;  2OTJ A;  3I55 Q;  3M0S A;  3QUI A;  1KFZ A; 
#chains in the Genus database with same CATH homology
 4LDU A;  1H3Z A;  4BE0 A;  3QKJ A;  4MDW A;  4X34 A;  2DZC A;  3VKI A;  2JN0 A;  5KE2 A;  3MO8 A;  5GAO q;  2XHC A;  3SWN C;  2MI6 A;  2PVD B;  2RHI A;  3GLX A;  3HRT A;  4B9W A;  2X4X A;  1Q82 U;  3OBW A;  1O9S A;  3M54 A;  3X25 B;  4IUQ A;  4PL6 A;  3BDU A;  5I21 A;  2V8K A;  5IN1 A;  3G6E A;  4LDV A;  4WF2 A;  3LWH A;  4XU3 A;  2MWP A;  3PFS A;  4PJO F;  2PUK B;  1BKB A;  4QW2 A;  1FWZ A;  2LT1 A;  5A0L A;  3QWL A;  2KMT A;  3ZFJ A;  3LX7 A;  2YLC A;  4M77 B;  4C0Z A;  1WQ7 A;  2HBP A;  3OW2 S;  3JCM J;  1UGS B;  1U1T A;  3CC4 A;  2XDD A;  1I8F A;  2RB6 A;  1VIE A;  2MAM A;  1YJ9 A;  3DLM A;  3TW6 A;  3DB3 A;  4Q5W A;  4KT0 E;  4HNT A;  2PVG B;  3BFM A;  4NL2 A;  4C5I A;  2EJ9 A;  5CCA A;  2P0K A;  3CCV T;  4M77 E;  3RIR A;  5LJ5 g;  4A4E A;  2M9U A;  1VQN T;  1FXX A;  4AI6 A;  2VC8 A;  3OSS C;  3P8B B;  3I55 A;  4QVZ A;  3VYG B;  4M77 D;  4M75 D;  1BI0 A;  2DZ9 A;  4ZGE B;  2B8A A;  5FU7 C;  3J7A F;  2MMP A;  4HT8 A;  4RMO A;  2QQ9 A;  3BDL A;  4E7K A;  5GAM d;  3C95 A;  4PJO B;  3HB9 A;  4MFE A;  2LTO A;  3NTI A;  1KG1 A;  4N4I A;  2K5I A;  4LDW A;  4BY6 B;  1KHC A;  4XU1 A;  4IUR A;  3SB2 A;  4XU0 A;  5GAN 5;  3I56 T;  2X35 A;  5LJ3 d;  4LD6 A;  3UT1 A;  4C92 C;  1VQ4 A;  1M90 C;  3JCM d;  3CC7 A;  3HKS A;  3SFM A;  1X01 A;  3EFS A;  2DXU A;  1O75 A;  4C92 G;  5GAN 6;  3RES A;  2C06 A;  3WVD B;  4HNV A;  3MET A;  4JRQ A;  3S3M A;  3PMT A;  5CO7 A;  3CCE A;  4PJO E;  2DXT A;  2XI9 A;  1ZBX A;  3OQ5 A;  3OS1 A;  2D9T A;  4PJO D;  2L3R A;  2Y4Y A;  3M55 A;  3CMA T;  4Z6Y A;  4EMK B;  3OMC A;  2VXE A;  3V8J A;  5DM7 R;  1H64 1;  4C8Q F;  3OB9 A;  5CKF A;  1JJ2 A;  3QO3 A;  2KMG A;  2CZ0 B;  1NZ9 A;  4PNO A;  3BY7 A;  1W2B A;  3M4Y A;  1UEB A;  2DXC B;  4C92 A;  5HKC A;  4OB2 B;  3KBG A;  4KUL A;  3RMQ A;  1K9M U;  1BI1 A;  3LGL A;  3OYB A;  3M56 A;  4X9D A;  2KSS A;  2BS3 A;  3CBO A;  2GFA A;  2P0Q A;  3OYA A;  2BUD A;  2G77 A;  3CPW S;  5D6X A;  3VYG A;  1B34 B;  3L2R A;  3S3N A;  4PLI A;  1QW1 A;  2XDP A;  1KQ2 A;  5LL6 S;  1X75 C;  3AHU A;  3OYN A;  1W4S A;  3LWI A;  2YRV A;  5AYF A;  1U1S A;  2IG0 A;  3LYI A;  4OP0 A;  3GNF B;  2BS4 A;  2HD0 A;  2RK2 A;  2E1H A;  1VQO T;  3JCM V;  4EMK C;  2VXF A;  1VQP A;  4PJO A;  3L2W A;  3QYE A;  1FX7 A;  3ZBD A;  2D0Q B;  3MP6 A;  4C0F A;  3L2U A;  5D6W A;  4AKI A;  3X20 B;  2Y90 A;  4A4H A;  5HK3 A;  2OTL A;  4L59 A;  4FIB A;  1YIJ T;  1QVF S;  2Y4X A;  4IUP A;  5CKD A;  3E9G A;  3VKG A;  2XKO C;  3GP8 A;  4C8Q B;  2JZ2 A;  3N5B B;  4J6W A;  2E6N A;  3CXC A;  3CCU A;  1YHQ T;  1UGP B;  2ZPE B;  2PQW A;  2LQ8 A;  4AKH A;  4OB3 B;  1P92 A;  3RMS A;  4MZP A;  3TEE A;  3OYC A;  3DKM A;  2JNG A;  3HRU A;  4JJN K;  1VQ6 T;  3ER0 A;  3QZ9 B;  2EQU A;  1M1F A;  3G71 A;  3H6Z A;  5CK9 A;  4L5G A;  4DOV A;  2L5Q A;  1S72 T;  2XG8 D;  2HQE A;  3C4S A;  4EMK A;  3GNG A;  3L2V A;  3CME A;  1YI2 T;  5IAY A;  3OYI A;  3PMI A;  4OGE A;  1YJW A;  1N8R U;  3CC2 T;  2DTO A;  4J6X A;  4C8Q E;  4NL3 A;  1R8O B;  4M75 F;  3JSC A;  3H4C A;  5GMK m;  2QQR A;  2JTF A;  4GLK A;  3CCR T;  5A2Q E;  4XTX A;  3A8H B;  3M5A A;  3HL8 A;  3CCQ A;  2G3R A;  4M7D D;  4D6W A;  3JB9 G;  1YBY A;  1K73 U;  1Q7Y C;  3QJ6 A;  5FRM A;  4M7A D;  2YLB A;  2DJZ A;  2ZZD A;  3QJY A;  2FVU A;  3HO8 A;  5GAO l;  4IKF A;  1BYM A;  3RKW A;  1B34 A;  4XU2 A;  3CCM T;  4JLG A;  1QVP A;  5CR2 A;  2QQB A;  3OYJ A;  3Q1J A;  3OSV A;  4A4F A;  1G3T A;  3PT9 A;  3CCL A;  2R58 A;  1Y96 A;  2ZPG B;  3A8L B;  5CIU A;  1XOV A;  1VQL T;  1VQ5 A;  4EMG A;  4GY5 A;  4ZN1 A;  5LJ5 d;  3JCM Q;  1N8R C;  4MDX A;  3VJP A;  3KHI A;  5GAN 4;  2ZPF B;  3CC4 T;  4QQ6 A;  3BW1 A;  1Q81 U;  3CCJ A;  1BIA A;  4J8O A;  2QEX T;  1VQ9 T;  2HAX A;  3V7C A;  3MP1 A;  1KQS S;  1VQ8 A;  3JRZ A;  3UWN A;  3G6E T;  4C8Q A;  4HCC A;  5FRN A;  3INZ A;  1SSF A;  3UPU A;  4M75 B;  4R56 A;  1FKM A;  1VQ7 A;  2EJF A;  1YIT A;  3OYY A;  1K73 C;  3QSU A;  1OZ3 A;  4B9X A;  4BI3 A;  1XQH A;  2DKG A;  4J83 A;  4M78 F;  2GFU A;  4C5E A;  4ZGJ B;  3NTK A;  1JRI A;  3QG1 A;  4X9C A;  4NS5 A;  1M90 U;  2KK4 A;  2RI3 A;  1JB0 E;  5CQY A;  4E7H A;  4OVA A;  5GMK h;  3UDC A;  3X24 B;  3OS5 A;  4M75 E;  3OYK A;  3HFO A;  3HBL A;  2CKK A;  3DLL A;  4FU6 A;  3F70 A;  1QP2 A;  4PKC C;  5CKH A;  2V8J A;  5GAO p;  1Q81 C;  1UGR B;  3SD4 A;  4P5N A;  4C5H A;  3MEW A;  1D3B B;  3L1A A;  2ZPH B;  3HHT B;  4BBR M;  4M77 C;  4N4G A;  3HPW A;  4XTW A;  3OYG A;  4M6V A;  4FT4 A;  5DLO A;  3OA6 A;  1UB4 A;  2X4W A;  5LJ3 j;  2WSE E;  4HNU A;  2E65 A;  4F7U F;  2V8I A;  3EAE A;  1WNL A;  4M77 G;  2QF7 A;  4XAX B;  4EPC A;  2EJG A;  1VQK T;  2KAF A;  3OS2 A;  3OYF A;  1WQW A;  2WJ9 A;  3KUF A;  3PNW C;  3OYE A;  4YTL A;  3RKX A;  4OF1 A;  2QA4 T;  5GAN h;  1OI1 A;  1OZ2 A;  2DTI A;  2RHX A;  4M78 B;  4XTV A;  4JDS A;  3A5Z B;  4BB7 A;  2EYQ A;  3CBP A;  3LW5 E;  2QQ8 A;  3C12 A;  2DXB B;  3QXE B;  5GMK j;  4J7F A;  1N6A A;  3V8L A;  2F5K A;  5GAM e;  4JX5 A;  1PSE A;  3OYL A;  1Y07 A;  4M77 A;  2K3Y A;  2RI2 A;  1X6O A;  4M75 A;  4QVD A;  3OYH A;  4BAC A;  4BDZ A;  1VQN A;  3CCV A;  1NJI U;  5GMK i;  4BDY A;  4PJO C;  5I2S A;  4ATO A;  2E12 A;  1YCY A;  2LNV A;  2XU8 A;  4M78 E;  3MEU A;  4A53 A;  4BY6 C;  2DVE A;  5J39 A;  5LJ3 e;  3KXT A;  1M1K U;  1VIF A;  3JCM e;  4RCB A;  4PJO G;  4DQ2 A;  4M7D F;  1NPR A;  3FRN A;  1VQM T;  3BG5 A;  5C6S A;  4M78 D;  4OMF B;  3CD6 T;  1ZHI A;  4M7A F;  3QBY A;  2E70 A;  3V7S A;  4EMH A;  4NC6 A;  4JRP A;  5IT9 E;  3OBY A;  2LVM A;  2VUB A;  4HL4 A;  4F7U B;  3SDZ A;  3I56 A;  3A8M B;  2RD1 A;  3E19 A;  5KH6 A;  4LOC A;  2JVV A;  3QPH A;  4HLQ A;  2DAQ A;  5GAN 3;  4HT9 A;  1UGQ B;  2HNI A;  4XK8 E;  5KE3 A;  2RHY A;  2PU9 B;  4XTZ A;  4FSX A;  5GAN f;  5GAN j;  1D3B A;  3PTA A;  5C0M A;  2RH2 A;  4ME7 A;  5FU6 B;  5GMK e;  3S6W A;  4HA8 A;  1QLB A;  4DA4 A;  2QQA A;  1N9S A;  1YJN A;  3QYH B;  2DD5 B;  4JS4 A;  1NJI C;  2ZCF B;  4F7U E;  1HK9 A;  3GF5 A;  1BI3 A;  3ME9 A;  4VUB A;  5CQX A;  3L2Z A;  3RUX A;  4A4K A;  5CAI A;  5HY6 A;  3CMA A;  1M1K C;  2O4X B;  1NPP A;  1Q7Y U;  2E10 A;  4M78 A;  3TRE A;  3G4S T;  2EFI A;  4II1 A;  1K8A U;  5GAO n;  3FC3 A;  3M57 A;  4M7D B;  1JJ2 S;  2DXB A;  3CBM A;  3A8O B;  4RCC A;  4M7A B;  2RI5 A;  4F7U G;  3VYH B;  2MWO A;  1W2B S;  4N0A A;  1KC8 C;  1N27 A;  1BIB A;  2E64 A;  4IUT A;  5GAN e;  2OTJ T;  4JRI A;  5CKE A;  4BUG A;  3CCS T;  3CCQ T;  1KQ1 A;  1QVG S;  2K4Y A;  3FEO A;  3PGG A;  2QQS A;  2CYZ B;  2DEQ A;  3JB9 I;  3BG3 A;  2DXC A;  1N9R A;  2RJD A;  2RJC A;  2WAC A;  1MHN A;  2M16 A;  4JLI A;  2K57 A;  2R57 A;  4M7A E;  4MIM A;  3MHX A;  3V8K A;  1QP3 A;  4C8Q C;  3M53 A;  4F7U A;  2DK3 A;  2WSC E;  2DD4 B;  2OAU A;  1K8A C;  3FIF A;  1YIJ A;  3JB9 J;  5A0G A;  4C8Q G;  1VQO A;  2BS2 A;  2A7Y A;  2DIQ A;  2EKO A;  2LQK A;  2P0P A;  3SWN B;  4EDU A;  1YHQ A;  2D6F A;  5LJ5 j;  2BKD N;  3FLG A;  3PIO A;  1RL2 A;  3OS0 A;  3OW2 A;  5J26 A;  4E7J A;  2CZ1 B;  1LJO A;  2R5M A;  5GAN g;  2DD5 A;  5GAM h;  4L6V 5;  3WVE B;  5CKB A;  4HKE A;  4BI4 A;  3CXC S;  1VQ6 A;  1AHJ B;  4C0D B;  5FRO A;  2VGM A;  1S72 A;  2K3X A;  1Y71 A;  2E6Z A;  1M4Z A;  1YI2 A;  1IZ6 A;  3A8G B;  5LJ3 h;  1YJ9 T;  3CC2 A;  1LNX A;  4ELJ A;  3JCM h;  3C94 A;  5CVI A;  4ELY C;  3OYM A;  4AKG A;  3V7R A;  4C92 F;  2FB7 A;  4QVC A;  3OYD A;  3VUB A;  1XTD A;  2EQK A;  5GAN 2;  5GAO m;  3GPL A;  3CCR A;  3MEA A;  4C0G A;  4M7D A;  4C5G A;  4ELZ C;  1TH7 A;  4M7A A;  2RM4 A;  3TU4 K;  2GF7 A;  2AHJ B;  3S3O A;  2E41 A;  3QYG B;  4UC4 A;  3I55 T;  1M8V A;  5LJ5 e;  3CCM A;  4Y28 E;  3JCM W;  2FYK A;  3LLR A;  3R6O A;  2RJF A;  3E9F A;  1G3Y A;  4QQG A;  3L2Q A;  4C0D C;  1WJS A;  1WPY A;  4PLL A;  3CPF A;  1DJ7 B;  1RI0 A;  4A54 A;  4TVR A;  2M1H A;  4HCB A;  1VUB A;  3J80 E;  5GAM f;  3G7Z A;  3DL1 A;  5GAM j;  3OY9 A;  2O01 E;  3H8Z A;  4NOY A;  3NTH A;  1VQL A;  2YHT A;  5FU7 B;  3X28 B;  2JUF A;  2RA2 A;  1I5L A;  2K5L A;  2DTH A;  2F69 A;  2DD4 A;  2ZPB B;  2M0O A;  4M75 C;  4JX6 A;  4RG8 A;  1VQ4 T;  2QDJ A;  3JCM c;  4QQD A;  2QEX A;  5LJ3 f;  1VQ9 A;  1EIF A;  3CC7 T;  3P8D A;  1G5V A;  3JCM f;  4FM4 B;  1WGS A;  4KUI A;  2JTM A;  4N4H A;  3SWN A;  4A4G A;  1LOJ A;  4M75 G;  3URG A;  4R55 A;  4ZN3 A;  1NE8 A;  4XTY A;  3JCM b;  3BG9 A;  5GAN 7;  4E7I A;  5GAO r;  4C92 B;  4QSH A;  1Q82 C;  3HRS A;  5KCH A;  5I2M A;  3CCE T;  4M7D E;  2P4T A;  2NLU A;  2E5Q A;  3HP9 A;  4HCZ A;  4OB0 B;  3JB9 H;  1G3W A;  2CZ6 B;  2FHD A;  3QDR B;  2HQX A;  2QDY B;  3J81 E;  4MZT A;  3LH0 A;  2EQM A;  4CI0 C;  2VGN A;  4C92 E;  2F5T X;  2XID A;  2QFZ A;  3EFR A;  4JS5 A;  4KBM B;  1HXD A;  2KR6 A;  3FJP A;  3CPW A;  3HFN A;  4C92 D;  3PIP A;  3HSB A;  3TW7 A;  2GCX A;  2IVW A;  2KY9 A;  2K5F A;  1M9S A;  2PVO B;  3M58 A;  1GXI E;  4ZTJ A;  3RER A;  2BIV A;  2RK1 A;  2VYT A;  2L89 A;  2XIC A;  4IUV A;  3VUZ A;  5D6Y A;  3VKH A;  1VQK A;  1ZQ1 A;  4M78 C;  3WXM B;  1U8R A;  5KCO A;  3L42 A;  4OGC A;  1VQP T;  2CGH A;  1YJN T;  3GOX A;  5J3B A;  1QVF A;  2LX9 A;  4MFD A;  4M78 G;  2QA4 A;  1KC8 U;  4ZGD B;  1Y7X A;  3JB9 F;  2I2L A;  3M4G A;  3QHS A;  2QTX A;  4OB1 B;  4N0A C;  4JX4 A;  2H3J A;  2OTL T;  4LDY A;  1I4K 1;  5GAM g;  4LD9 K;  1PSF A;  4O5V A;  4BE1 A;  3X26 B;  1G3S A;  2GQV A;  3CEY A;  2VV5 A;  3CCU T;  1WJR A;  4FL6 A;  1I81 A;  3O8V A;  5HK0 A;  1KD1 U;  3GIB A;  3QYB A;  5LJ3 g;  2ZPI B;  5EG2 A;  3QII A;  3JCM g;  5DLQ E;  4JUV A;  3G71 T;  1QVG A;  4FT2 A;  3ZEH A;  2WSF E;  2ZZD B;  5EJC A;  3M9Q A;  5LJ5 h;  3CME T;  4MMK A;  4E7L A;  4LDX A;  2X4J A;  4BD3 A;  2QXF A;  1VQM A;  5M9O A;  2LCL A;  2QI2 A;  1YJW T;  3CD6 A;  1KHI A;  1BI2 A;  4Z02 A;  4ZTF A;  1WJQ A;  2DO3 A;  2LC4 A;  2KDS A;  2EAY A;  1JBM A;  2FL7 A;  3JCM X;  2A3L A;  3MEV A;  2L8D A;  2EIF A;  4RKU E;  1Y96 B;  4BBS M;  5FU6 C;  2CZ7 B;  4DOW A;  5GAN d;  1IRE B;  2LT4 A;  4KUD K;  1Q86 U;  3M59 A;  2PUO B;  5GMK l;  4J7I A;  2XDB A;  3VV0 A;  4BE2 A;  4BI8 B;  5A0D A;  4Y91 A;  2LCC A;  2RHU A;  2DIG A;  2KVQ G;  3NFC A;  1KD1 C;  3ASK A;  5FLX E;  2EQJ A;  3JAM E;  3JCM P;  1E7P A;  1K9M C;  2CS7 A;  2KQW A;  3DB4 A;  4J5Y A;  3RKY A;  4J6Y A;  3CCL T;  2XD0 A;  2JOY A;  4MML A;  4E47 A;  1M5Q 1;  3MCA B;  3TCJ A;  4M7D C;  2MF2 A;  1VQ5 T;  5L8R E;  4CRI A;  3E1S A;  3FDR A;  2K2V A;  5GAN 8;  4M7A C;  1KQS A;  3G4S A;  2RO0 A;  5LJ5 f;  4O6J A;  4XTU A;  5DY9 A;  3MP8 A;  4M7D G;  2XK0 A;  4MZM A;  3LGF A;  3CCJ T;  4RG2 A;  4M7A G;  3FB9 A;  4IUU A;  3JB9 D;  1VQ8 T;  4V2S A;  4M77 F;  1V29 B;  1Q86 C;  3VU3 C;  2LDM A;  4XQ3 A;  2EWN A;  2RJE A;  1YIT T;  1VQ7 T;  2DPP B;  4C8Q D;  2R5A A;  2LRQ A;  2ZGW A;  1XNI A;  4JRK A;  1OYX A;  3QUI A;  2OTJ A;  3CCS A;  3QZ5 B;  2O4X A;  1MGQ A;  3OMG A;  3P8H A;  1M1G A;  3T9N A;  2RHZ A;  3HZJ A;  2X4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...