4ZGJB

Double mutant h80a/h81a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
206
structure length
206
Chain Sequence
b'MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 55
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgjB02
3QXEB 2CZ6B 1IREB 2CZ7B 2PU9B 2PVGB 3X28B 2ZZDB 4Y28E 4OB0B 2ZZDA 3VYGB 2ZPIB 4L6V5 4ZGDB 3VYGA 2CYZB 2QDYB 3QYGB 2CZ0B 2DXBB 2WSFE 2DXBA 4OB3B 2O01E 5L8RE 2DD5B 1QP3A 3A8HB 3A8OB 3QZ9B 2ZCFB 2DPPB 3X26B 1AHJB 3X24B 2AHJB 4FM4B 1UGPB 1UGRB 2DXCB 4RKUE 2DXCA 2DD4B 1DJ7B 2DD4A 3HHTB 4XK8E 3VYHB 2DD5A 2WSCE 2ZPFB 3X25B 4KT0E 2PVOB 1QP2A 3LW5E 2PUKB 1PSEA 3WVDB 3X20B 3A8GB 2CZ1B 3A8LB 4ZGJB 2D0QB 3A8MB 3QYHB 2ZPGB 1PSFA 2PVDB 3WVEB 4OB1B 2ZPEB 3QZ5B 2ZPBB 1V29B 1UGSB 2PUOB 4ZGEB 2WSEE 4OB2B 1GXIE 1UGQB 2ZPHB 1JB0E
chains in the Genus database with same CATH superfamily
2JTMA 4JJNK 4I3ZB 1OL1B 3G71Q 2PU9B 3EHQA 4MZTA 3REAB 3FC3A 8ATCB 3RGFB 3M54A 1KQSS 1E6GA 2M16A 1M1KU 2CH4A 3S6WA 1VQKA 2YLCA 2K7AA 1GFDA 2J05A 3JCMc 4AFSC 4M78G 3BG3A 4IUTA 3NMZC 4BI3A 5A0LA 4K11A 3E9GA 5GANf 2JMCA 2W2HA 2YWWA 4EMHA 4PJOB 1YCSB 2A28A 1RADB 3L2RA 5KE2A 2MF2A 1Y57A 1D3BB 3A8OB 4KH1B 2XU8A 2P4RA 4B9WA 2SEMA 2VGMA 2MYSA 2XICA 1WHHA 2Y4YA 1W70A 3FRNA 2K3YA 3LWHA 5ACBA 3I55Q 3VKIA 1JKWA 3OBYA 1QMZB 1ZA2B 4XTZA 3NDQA 2YRCA 3M57A 1YIJT 3VKGA 5GAOp 4BCMD 3LGFA 2QI2A 1H1PB 2PMIB 4AI6A 2LJ3A 3MP6A 4EC8B 2EAYA 4MDXA 3LW5E 4RTZA 2VXFA 1ZSZC 3TW7A 1MNEA 3PO3S 1SHFA 2F2VA 2JTEA 2KT1A 3NPFA 2QQRA 2EVRA 3C12A 3TCJA 2X1NB 3CCQQ 2IW6B 2IG0A 4ZGJB 2BS4A 3CC2A 1WXUA 2XIDA 2DJQA 2C5XB 2MCNA 3V8LA 2F2WA 1VQPT 4DBHA 4EMKA 1TH7A 5CVIA 5KYWA 2G77A 1QLBA 4M77G 1JXOA 3THKA 1E7PA 4ZTFA 3M03A 3EFOB 3HL8A 2ZPHB 4R0KA 1Q86R 3TNIB 3FB9A 1W2BP 2COWA 2PNIA 2X9HA 4M7AD 2CZ7B 4E7SA 3ER0A 2QEXT 1VQ8Q 3OYYA 3CCVQ 3X28B 3VJPA 4C5EA 5LJ5j 2I2LA 3BLQB 2D9TA 1YJWA 3M5AA 2WHBB 2QGFB 2E12A 1FMWA 2D6FA 4CFWB 4M75C 1SHGA 3QYGB 1YJ9A 2LVMA 1GY3B 4JRQA 2KVQG 2HBPA 5KYYA 3CEYA 4E7ZA 5CKBA 2WMAB 2B86A 1K9AA 3CCJQ 1KIKA 2GNCA 5DLQE 3UA6A 1RI9A 1Q82R 1HYOA 2J6FA 3J7AF 4II5B 3MO8A 1GUXB 2R58A 4CFMB 4M78E 5A0DA 1JEGA 3BFMA 4C8QD 1JO8A 5GANd 2ECZA 1ZSZB 2LNVA 5KCHA 1RAIB 1WX6A 4A4KA 3EG9B 1Q86C 1X43A 2F2XA 2LQNA 3CBPA 4J83A 1H28B 1M30A 4M7DA 3KBGA 2DD5A 5CKEA 4A4GA 1VYTA 2X3XD 3QDRB 2HMAA 4XU0A 1VINA 1PSEA 4HCBA 2EFIA 5LJ3j 4F7UG 1VQ7A 4M75F 4PKCC 2LTOA 3G7ZA 3M53A 3JCMJ 3CCUT 4J9HA 3QHRB 2FEIA 4OGEA 2PVDB 4LUDA 2LT4A 1B7TA 4JJDA 1QW1A 1RAAB 1Q82C 1OZ3A 3OS2A 1KC8U 2OTJT 1V29B 1C9BA 2JUFA 3MEVA 4CFXB 3HSBA 4WCIA 5DLOA 1JXMA 4A4HA 3RMSA 2O88A 3E19A 3QKJA 4NSTB 4M75B 3ZFJA 2CZ6B 1BIBA 4F70B 1YNZA 2MPXC 2DZCA 9ATCB 3TQ7P 4WTOB 3CMAT 1MHNA 1IO6A 3CD6A 4AKIA 2BZXA 2E3HA 1B34B 4M77E 2ZPIB 4L6V5 4PFPA 1QVGS 5GAOr 3OSVA 3TW6A 1TG0A 1X2KA 1K9MU 2KGTA 4EOIB 3TN8B 1G83A 1LCKA 2O01E 4B6MA 1YI2A 5D6WA 2ZGWA 1AVZC 3DDPB 2DAQA 1VQOA 3EGDA 1YCYA 4EIKA 2ROLA 2DPPB 3MY5B 4IKFA 2COZA 5KCOA 1N4MA 2LT1A 1NJIR 2A0FB 1AEYA 2DXCB 2KXDA 4RKUE 1PKDB 2M02A 2RB6A 4M7DC 4UN0A 1GRIA 2W96A 1C1AA 4QVZA 1MMGA 1WHJA 1Q95G 1SSHA 3V7CA 3OB9A 4A54A 5KYWB 2EJGA 2DXTA 3HRSA 2KXCA 1KQSP 1D0YA 2DBMA 1O9KA 1OU8A 4BCPB 1TXQA 2EKOA 3OMGA 2MAMA 1VQKQ 2AIRB 2RM4A 4IUUA 3RNJA 3VRYA 1I8FA 1S1NA 2BTTA 4HCZA 3CCLA 1RAHB 3PIPA 2DL4A 3HFNA 1Y7XA 1VQ9Q 2GGRA 1TOVA 2X4XA 2YXYA 1KK7A 3GLXA 3M0SA 5HQ0B 2DE0X 4YOOA 3CC7T 5GAMe 3MP1A 4X9DA 4M7AA 3VS4A 4CC7A 3BG5A 1BKBA 4DOVA 1LOJA 1NJIC 2GQIA 3VS2A 4F7UE 2FVUA 3CCMA 4OB2B 4AKGA 2FB7A 2MWPA 1PCXA 2V8JA 3EJ1B 1G5VA 2CP7A 1RACB 4QQDA 3EFSA 4ZNXA 1TUGB 5DY9A 3L2UA 5FWBA 5IHIA 5GMKl 3GTMS 1I5OB 4J9DA 5GANg 2PVGB 2COYA 2IPOB 2IW8B 1UNGD 2YUQA 2WIHB 4LD9K 2LP5A 4Z89A 4PFOA 5DQWA 1NYGA 1Z9QA 2NUPA 2XG8D 1VQ6T 1VQMT 2NLUA 1GCQA 4NS5A 2DMEA 5IXFA 2PK2A 1E6HA 5FWCA 2KT8A 1TTHB 5FROA 5L8RE 4M7DB 2DD5B 1WLPB 4JRIA 4EOPB 5IDPB 3BLHB 1H24B 2XDPA 4ZN3A 2DEUA 1YJNQ 2P84A 3PMIA 1MMAA 4Z8AA 2P0QA 2NUTB 3CMET 4J6XA 3HFOA 5FU7C 5KH6A 1UNHD 2M0YA 5M9OA 1N8RR 2KYMA 2V26A 1PNJA 4G6LB 3BDUA 2DKGA 5CEIB 4C0ZA 2KE9A 2AT1B 3EHRA 4BCKB 2DMOA 2E5QA 2BE7D 1I5LA 4PJOE 5LMKB 5CKHA 3KXTA 2HDAA 1Q81R 1R0CB 3CCRQ 2KK4A 1OKWB 1ZQ1A 4KT0E 4MMLA 1ABQA 4F7JB 1M2VA 3SD4A 4BCGB 1YJWQ 1M90C 5GAN8 2OX7A 1PD1A 2KYBA 2I0NA 3BLRB 4R55A 1BI2A 4PJJA 3X20B 3OS1A 3A5ZB 2VC8A 4M7AC 1M3CA 3OYJA 2XHCA 1UGVA 3OW2A 2EQIA 2RHIA 2KR6A 2JM9A 4ORZA 3VKHA 5FRNA 3VUZA 1IGUA 2WMBB 4F6UB 2BS3A 2DL8A 1UGSB 1VYVA 1VIFA 3VS5A 1BI0A 3HRUA 4PL6A 3M0RA 1N9SA 2YRDA 4JJCA 2E4HA 1N8RC 3PVQA 2X4YA 4IUVA 1K8AU 5IHKA 3G4SA 3EH2A 3MY1B 2QTXA 1WZOA 4M75G 2ROTA 2DL3A 3EGDB 2VVKA 4OVAA 2C5OB 1F5QB 4BCMB 1G3YA 1Q81C 2CSIA 2ZZDB 3KUFA 2WPAB 3HZJA 4C8QC 4A4FA 1U1TA 3RIRA 3A98A 4HVVA 3G71T 4PLIA 2K5LA 1U3OA 2L3SA 4XQ3A 5FU7B 2O9SA 1Q7YR 3GP8A 4LE9A 3GIBA 3RKYA 2ED0A 3JCMQ 2QA4Q 3A8HB 2VUBA 5GAN2 1JJ2P 4MFEA 1O9KB 2EQKA 2OAWA 4C5IA 2LQWA 1HD3A 4BCHB 4ATOA 3VU3C 1NM7A 2XKOC 2D0NA 4J9BA 2PQWA 5KE3A 4YOZA 4HCCA 2MWOA 2O4XA 2UZLB 4LDVA 4A4EA 1OOTA 4M7AB 4HNTA 1YIJA 2X51A 1KQ2A 2H3JA 1RABB 2EQJA 1UJYA 2VYTA 4EC9B 1OU9A 3I55T 3FEOA 1WHGA 3MCAB 3PIOA 5GMKh 4FW1A 3JRZA 1Y07A 4JZ4A 1Z9ZA 4C8QF 3QWYA 1QVGP 3WVDB 2HBWA 2DL7A 1SKUB 2BUDA 4BCIB 1UUEA 2RHXA 3AT1B 2CZ1B 2EWNA 1Q7YC 2GTJA 4PJNA 4BUGA 4M4ZA 1PSFA 4EOMB 3G33B 4C5GA 2RMOA 1ARKA 4XU2A 1GBRA 3DOGB 4QVCA 4BDYA 1VQPA 2LMJA 5J39A 3UWNA 3CCQT 3H4CA 2YT6A 2DXUA 3CCSA 1QCNA 1PWTA 2W9FA 3DB4A 4C8QB 1VQ4T 4QQGA 2C5VB 4C92A 3K7AM 1JB0E 4CRIA 1X6BA 1IREB 1OGUB 1OKVB 4YOSA 5IN1A 4JLIA 4GLKA 2QEXA 5CQXA 4JRKA 2QFZA 4AFZC 5KYUB 4DBQA 2NYSA 3V8KA 4CFNB 5IDNB 1M1KR 4N0AA 3ZL7C 1VQ8T 1M1GA 3CCVT 3M0PA 2BPMB 1G3TA 4LDWA 4M75E 4PJOF 2JM8A 1OYXA 2CCHB 4FX3B 3L2VA 4GBQA 5IH2A 4PNOA 4E7HA 4BI4A 4F7LB 3QZ9B 2D8HA 2FYKA 5LJ5f 1M8VA 4RTXA 1CKBA 2HKNA 1C6VX 1BCMA 3I5SA 2RQUA 3O5ZA 1JJ2A 2DERA 3CCJT 3CCMQ 3TEEA 1YHQQ 1IHVA 3MIAB 1BU2A 3UATA 3MJXA 4RTVA 1SSFA 4RUGA 1JOWA 3GPLA 1T0HA 3N5BB 3NHNA 3TSWA 3E9FA 2EGCA 3QBYA 1M1KC 5D6XA 1YN8A 3MI9B 2A37A 5CK9A 2FPDA 5GAOq 3VS0A 2JGZB 1D1CA 3V8JA 5A2QE 1EX4A 3CCUA 2YUOA 3PVLA 2VXEA 4JRPA 2RJFA 4LN2A 1QVGA 1U5SA 2DTIA 1ZX6A 3MPUB 2OTJA 3DTOA 2ZAEA 1ACMB 2EQUA 2FRYA 2G6FX 5LJ3f 2DZ9A 3CCEQ 2JN0A 2UUEB 5IT9E 2L3QA 3JB9D 1KD1U 1O9SA 5KYXA 1GH6B 2JVVA 3SFMA 3CMAA 3CPWS 4Y28E 4N0AC 1VQLQ 2QK0A 4J9FA 4FYYB 1CKAA 4XAXB 3VYGA 4PK4A 2G9XB 3CC4A 2C0IA 5ECAA 4KH0B 3MEUA 2L0AA 2KNBB 2OTLQ 1YITA 1TFBA 1W6XA 2AK5A 4C0GA 4RG8A 2QDJA 4RMOA 1RLQC 2CCIB 1IGQA 1K4US 2C0TA 5DM7R 2KMGA 2ZCFB 2X3WD 2EQMA 4QVDA 4LDXA 1A0NB 2RA2A 1JSUB 4BCJB 2RHUA 2CP5A 1HXDA 4F7SB 2QF7A 3HTRA 3H41A 2DK3A 2W9ZA 3C4SA 2F69A 5CAIA 1ZHIA 4CXAB 1B3QA 1M5Q1 4FCYA 5CCAA 5LJ5d 2UZEB 2LJ0A 4DBRA 4KGXB 4M7DE 2ZPFB 1V1CA 3OYFA 3OYKA 1BU1A 2RQRA 1I1JA 4QQ6A 5GAOm 1AWJA 4OGRB 3LLRA 1XJWB 2DJZA 2FO0A 4HVUA 2RK1A 3Q1JA 4HCKA 1BK2A 4LDUA 2DF6A 1PC0A 2PZ1A 1Y96A 2WXVB 4OB1B 4CFUD 2DX1A 4MZPA 3REBB 3CC7A 2EKHA 1NLOC 1YFNA 2QGGA 1WXTA 1OX9A 4E7LA 3EG2A 3GF5A 4E7KA 1VQ9T 2M0OA 1R77A 3JV3A 1GXIE 2RQWA 1UGQB 1KC8R 2GBQA 1H4LD 4V2SA 1F1BB 2LW4A 2GCXA 3QXEB 4C8QG 2A36A 1VA7A 4EMKC 1D3UB 1PKSA 4IMYB 1FYNA 4E6RA 1U8RA 3SWNA 1W4SA 2DRKA 4M78A 1SEMA 2WJ9A 5LJ3d 2CJMB 4VUBA 4P5NA 2K57A 1VQNQ 1E9HB 2EUFA 3M9QA 1VQ6A 1VQMA 2DXBA 4OB3B 4OP0A 2V1RA 5D6YA 2FZCB 3RBBB 1Y71A 2LNHB 2QTVA 2RF0A 3HRTA 2C4GB 4CC2A 2DL5A 5CKFA 1ZSGA 1P92A 5GANe 1S72A 3X26B 1AHJB 1W2BA 2PTKA 3CMEA 1VQ5Q 1LJOA 3RDVA 1WHMA 4KUDK 1UGPB 2RJEA 2FPFA 5GAN4 4Z6YA 5GAMj 3PMTA 1D1BA 1UE9A 4GY5A 3CCSQ 1KC8C 2DETA 3QIIA 1QVPA 2RI5A 2DD4A 1YJNT 2ESWA 2F2CA 3FDRA 5FU6C 4DEXA 3CXCP 5LJ5h 2A7YA 2EYYA 4Z88A 3JSCA 1OZ2A 4PJOG 1M3AA 2DYIA 4DA4A 1O75A 2PUKB 1WGSA 3CQTA 4LOCA 2K4YA 2KDSA 3OBWA 2FHDA 1IB8A 5GANh 1IXDA 3DDQB 1WDXA 4MMKA 5AYFA 4BCND 4QW2A 4IURA 1H1SB 4DEYA 3CCRT 1M4ZA 2K5FA 4AG1C 2RJDA 3WVEB 2OJ2A 1K1ZA 3OYIA 3JB9J 4EMKB 1YJWT 4M7AE 4M77A 3QYEA 4MDWA 1M9SA 2JZ2A 2QXFA 2HQEA 4IUPA 4BE2A 2ED1A 3OYCA 1QWFA 4ZGEB 3JB9I 4QKUA 4NOYA 4PJMA 2LJ1A 3IQLA 3SEMA 4FT4A 2RD1A 4HXJA 1N6AA 2KMTA 4JLGA 5FW9A 1MMNA 3SWNC 1RAEB 1X6GA 1XQHA 4RCBA 2EYQA 4J9CA 1UFFA 3H6ZA 4OF1A 3M56A 1NEBA 4JDSA 1SRLA 4CC4B 2JW4A 5LJ5g 3HKSA 4FW2A 2HSPA 2QYZA 4JS4A 2NWMA 1WHKA 2KRNA 4D8KA 3DJBA 2LCCA 3G71A 2K2VA 2K79A 4X1VA 4C8QE 3BG9A 4EOKB 1PD0A 3QPHA 5KYYB 2O31A 2KAFA 1YWPA 4M7DF 4BXXX 4RG2A 5EJCA 3L42A 2EBPA 2KQWA 2LZ6B 5FU6B 4CRLB 5A0GA 4JX5A 3UDCA 4JX4A 1VYUA 2E41A 3L1AA 3J80E 5IAYA 2RQVA 4FM4B 1YBYA 4C0DC 4C92D 2BKZB 2DRMA 1WFWA 4HVWA 4X34A 2QA4T 3P8HA 1BI3A 4RTUA 2FZKB 3LGLA 5GMKi 2J6KA 1Y96B 3OYBA 5HBJB 2RQTA 3JCMf 3ZBDA 2Z0WA 2LX7A 3CC2Q 2AKKA 5HY6A 3RUXA 1QP2A 1G3SA 2OI3A 3U23A 3EGXA 3I55A 4F7UA 3CXCA 1NPPA 3PGGA 6AT1B 3CC4Q 4EDUA 3VS6A 3BDLA 3VS1A 4R56A 2C5NB 3OQ5A 3BHVB 1BIAA 5LJ3g 2LCLA 2CUBA 1X6OA 4F6SB 1WPYA 4D6WA 3URGA 2QQAA 1H3ZA 2ZPGB 3JCMW 1M90U 4J6YA 3SWNB 1YITQ 3I56A 2QQSA 1J3TA 3OYAA 2YLBA 2DLPA 2HCKA 1ZLMA 3CCQA 4RCCA 4KBMB 4MIMA 4F6WB 2HL5C 1VQ4A 5FGKB 3J81E 2C0OA 4YC3B 2RI2A 3H9NA 5HK0A 2EYWA 4BI8B 1KQSA 2LQ8A 3TSZA 4DQ2A 1YJ9Q 2IW9B 3I9QA 4BY7X 1G8XA 1K8AR 1N8RU 2JJ9A 3GNGA 3G6EA 2DVEA 2AKLA 4HNVA 2X4WA 2FZGB 1VQ8A 1BYMA 3OSSC 3CCVA 1Q81U 1HSQA 2D1XA 2MOXA 1VOLA 1FWZA 4AT1B 2YSQA 3I35A 1Y0MA 5LQFB 1SPKA 1OIUB 1EZZB 3UPUA 5CQYA 5HKCA 1I07A 1GCQC 2LDMA 3QWXX 2D8JA 4BBSM 3GNFB 3R6NA 3M4GA 1RLPC 4LDYA 1FVVB 1WYXA 3H0IA 2M9UA 3QO3A 2V22B 4C0FA 3CCJA 4FYVB 2K3XA 1VQ7Q 4BCFB 4PJLA 3JCMV 1FKMA 4HNUA 3V7SA 4M7AF 2MI6A 4KRCB 1X75C 2WSCE 5GMKe 3L2ZA 1K8AC 4Q5WA 4XTVA 3QDFA 2PVOB 1K73U 1SRMA 2GQVA 3CCMT 4FIBA 2JMAA 3BHTB 1NE8A 3PNWC 1YHQT 3META 4RTYA 1WXBA 5CR2A 3JCMd 1W98B 3O0GD 4M6VA 1WJQA 1OULA 3OMCA 2Y4XA 1GCPA 2X35A 2YHTA 4ESRA 2W99A 4E47A 1P5EB 4A53A 3WXMB 3S3MA 3OYLA 3OA6A 1IHWA 3CD6Q 1OEBA 2P0PA 2DIGA 2VKNA 3RR6A 4XU3A 1QCFA 2PUOB 5HVYB 2AZVA 4Y92A 4NC6A 3H0FA 4ZN1A 1S72Q 4LXCA 1QQJA 2RHZA 4Y72B 2R5AA 1PRMC 1K76A 2J7IA 3JCMX 3C94A 2WEVB 1UG1A 2QQ9A 1X69A 1NPRA 4XTYA 2XDBA 1G2BA 1YI2Q 5AT1B 3CCET 5GJVB 2NUPB 1GL5A 1VQOQ 3INZA 1UNLD 1SG5A 1G3WA 4Y91A 1UTIA 2QQ8A 4RTTA 1FXXA 2CT4A 5GAN7 1VQLT 5KYNA 2YRVA 1QKXA 1G3NC 3H0HA 1BBZA 4OMQA 1HK9A 3EG1A 4CFUB 1AISB 3EGXB 2XD0A 3POMA 3VS7A 1X27A 1M8MA 1GUXA 2AHJB 2OTLT 5J3BA 1JSTB 1UGRB 3JCMb 1VIEA 3L2QA 1KSWA 1VUBA 1ZSZA 1RI0A 4E2FB 2IN3A 1OQKA 2ATCB 3EG9A 1H25B 1I0CA 3KHIA 4KGZB 3CCLQ 1AOJA 1LVKA 2E1HA 1KQ1A 4IIMA 2DILA 1WQ7A 4M78D 4MZMA 2MMPA 1AWOA 4OMLA 3EG0A 1T3SA 4F7NB 3X25B 4IUQA 1M2VB 4M7DG 1NG2A 4QT7A 1EFNA 5GAOn 3JB9H 1M2OA 2QQBA 5CO7A 3R6OA 2K2MA 3QJYA 2RJCA 1H3HA 1YWOA 2GTOA 2BKDN 1NZ9A 3HP9A 4EORB 4AKHA 2JT4A 5IHYA 3OW2S 1AD5A 5FLXE 4XU1A 3NFCA 3QSUA 2RNAA 3FJPA 1XNIA 2YDLA 2E6ZA 8AT1B 1QCOA 1VQ9A 3QG1A 4ME7A 4M75A 1ZBXA 4BE1A 5D7UA 4CC3A 3P8BB 4YTLA 4ELYC 1HJDA 2DVJA 3PTAA 1H8KA 1OL2B 2KEAA 1KD1R 4A63B 1B34A 1OPKA 2G3RA 2E6NA 3HO8A 4DBFA 3NTHA 5EFQB 4C92C 2W0ZA 4F16A 3CPFA 3LQ5B 3MKDA 5L2WB 1K0SA 3EGUA 2RK2A 3VRZA 4BCNB 4AG2C 4GLMA 2KRSA 1KHCA 3T9NA 5GAOl 2ENMA 2L5QA 4M77D 2F1LA 4J9EA 1OV3A 2HQHA 3JCMg 1NEGA 2RN8A 1VQNT 1UEBA 3JCMP 3GBQA 2IIMA 4OGCA 4FYXB 5L23A 3I56Q 3QJ6A 4RTWA 4QSHA 3C95A 5EC7A 2DXCA 2DTHA 4JZ3A 4CI0C 4EMGA 3F70A 2O4XB 2DEQA 4ELJA 5HNBB 3A1PA 3ULRB 5ICPB 1VQ4Q 1YJNA 2HEQA 3CBOA 4JJBA 2DA9A 1VQ5T 4O6JA 2BZYA 2V8IA 2CP6A 5GAN5 3KFVA 1KJWA 2KSSA 2QG9B 3JB9G 1KD1C 1QVFS 1N5ZA 3CCST 1ZUKA 2QDLA 4C5HA 1VOMA 2XMFA 3G6EQ 4C92F 5GAMf 5IXBA 3L2WA 3MEAA 2QASA 4TTHA 2DNUA 2BIVA 3EOCB 2D0QB 3CCRA 3DB3A 1QLYA 2HL3A 4EOQB 3FLGA 3MEWA 2J06A 3NTIA 1TS9A 3G4SQ 4HKEA 1I81A 1KHIA 4UC4A 2LCSA 4M7AG 2ZPBB 1Q86U 2IVWA 1JU5C 1OI9B 2AZSA 2WSEE 1T3LA 3OS0A 2RO0A 1D1AA 5I22A 5IHNA 1UHCA 2R5MA 4C92B 4J8OA 4N4IA 1UHFA 5GANj 5CKDA 3AHUA 5HBEB 5GAN3 1AZGB 4FT2A 1N9RA 3I5RA 1FMKA 1ENWA 1RAGB 2W10A 2E65A 1VQKT 4J5YA 4OB0B 3EFRA 1UJ0A 1JBMA 4BCQD 1KFZA 3CBMA 1H1QB 5CIUA 2FPEA 2RI3A 2HZYA 2CZ0B 2WSFE 4AFUC 3EG3A 3GOXA 1Q82U 2I40B 1QKWA 2HNIA 1ZP2A 4ELLA 3D7SB 2EJ9A 4KUIA 3EIDB 2JNGA 3OY9A 2WACA 1YIJQ 1KG1A 4HLQA 1BB9A 3OYMA 2NUTA 4EPCA 1OPLA 3C0CA 2CH4W 3SHWA 5LJ5e 4AFQC 2EIFA 2QA4A 1WNLA 3M4YA 2E64A 4LNPA 2KR3A 4ELZC 1N27A 3LX7A 1JJ2S 1SF9A 4NL3A 2WIPB 1PHTA 2E10A 1K0XA 1K9MR 2NUZA 4DOWA 1M3BA 2V8KA 1WJSA 3MP8A 3LH5A 2JTFA 4EONB 3PFSA 1LPLA 2CGHA 2B8AA 3SDZA 5I2SA 2HKQB 1VQPQ 1W1FA 4PLLA 4PJOD 1T0JA 2HSEB 3S3NA 3CC2T 2V1QA 3QUIA 2CP2A 4N4HA 4F17A 2CREA 5I5ZB 1MV0B 4HT9A 3HBLA 2BZ8A 2CSQA 3TREA 3CC4T 5GJWB 3M0TA 2QEXQ 5GAMd 5DQVA 4J7FA 2VGNA 3TNWB 1RUWA 2BE9B 4L5GA 1YITT 4OMFB 4XTWA 2DIQA 1LNXA 3UA7A 2EYZA 2WFYB 5KYXB 2IVXA 1YP5A 2KRMA 3G1JA 5LJ3e 1K9MC 4L59A 1M27C 2ZZDA 3VYGB 2VV5A 1AWXA 1TUCA 5FRMA 4KRDB 1AWWA 1YJ9T 3HPWA 1R0BG 7AT1B 1AT1B 2PK9B 3LWIA 3QHWB 3S3OA 1PKTA 3M58A 4M78C 1NJIU 1KXUA 3FIFA 4Z02A 4J9IA 1X01A 2FG0A 3OW2P 1E7OA 5LJ3h 2XDDA 4ANJA 1H92A 1WQWA 2JXBA 2DFUA 2LX9A 1XTDA 5HBHB 4OMNA 2JS0A 2P0KA 2C6TB 4KRTA 3QYBA 4FSSA 1QWEA 2F5KA 4FL6A 3TNHB 4XK8E 1EIFA 2E5KA 3P8DA 3CCUQ 2I53A 4BY6C 2RPNA 4BACA 4J7IA 4E7IA 2PJQA 1H641 2DO3A 2OAUA 4AMCA 2GFAA 3BY7A 4BY1X 1VQ7T 1YHQA 2DYBA 2CP0A 1GFCA 5HK3A 4BCOB 2OTJQ 2K6DA 4KGVB 3DLLA 2JOYA 1AD6A 4KULA 4HT8A 1TD6A 1H26B 2X4JA 2ZPEB 3FJ5A 2YUPA 3ME9A 4M78F 1UDLA 2ABLA 3LYIA 3ASKA 4F04B 3CPWP 3QZ5B 3CMAQ 2CP3A 3DL1A 1R8OB 5GAMh 1M90R 3TU4K 2JS2A 1V76A 3VUBA 2MK5A 2P4TA 3EH1A 4C8QA 3VV0A 2CS7A 1NLPC 3HB9A 1ZA1B 1PM3A 2DTOA 4C92G 4M77C 3CD6T 1H1RB 5IF1B 2KROA 4RODA 2MIOA 2O2OA 3QWLA 4EOSB 1PRLC 4BDZA 1S72T 4M78B 1I4K1 1IZ6A 1MGQA 3NGPA 3VS3A 2SRCA 3CCEA 5KYUA 5GAN6 1NBEB 3MHXA 4XTXA 3DLMA 1QVFP 3O8VA 1GBQA 2CKKA 3B57A 5GMKj 2DBKA 2DXBB 2UZBB 2EPDA 4N4GA 3SB2A 1NYFA 4HL4A 1MV3A 4FYWB 1YI2T 2FL7A 1VQLA 4LUEA 1VQOT 4FSXA 2HQXA 3OYEA 1AZEA 4EOLB 1D09B 2EW3A 5GMKm 2PHGA 4PFZA 4JUVA 4ROEA 2GFUA 3PE0A 3RKWA 4BY6B 2OTLA 4M75D 1W2BS 1CSKA 2A3LA 5LL6S 2DD4B 2R57A 4C0DB 1WJRA 1FINB 3F5XB 2RH2A 5GAMg 2RHYA 4X9CA 2HAXA 2E3IA 3JB9F 1WI7A 4OMMA 1WHLA 4PJOA 2CUDA 2VB6A 2Y90A 4M77F 4JS5A 3DKMA 4JPBW 1U06A 1ZBJA 1D3BA 4BE0A 4ZTJA 1U1SA 3E1SA 3LH0A 3CC7Q 3UF4A 2KI7A 1JQQA 2EGEA 3CCLT 4EOOB 1K73R 2O9VA 1MNDA 3M59A 1QMCA 2L8DA 2M51A 3A8MB 3QYHB 1TUDA 3OYNA 4MFDA 2LQKA 2QAZA 1FMVA 4M77B 3M0UA 4CFVB 2EYXA 1OIYB 5I2MA 4BB7A 1WIEA 3ZEHA 4TVRA 1JRIA 1WA7A 3EAEA 2KY9A 2QGSA 1ZUYA 3H8ZA 5J26A 2M1HA 2KBTA 2L89A 4LD6A 2L3RA 2C06A 2EGAA 1RL2A 1C0MA 3CPWA 4OMPA 1VQ6Q 1ZUUA 1VQMQ 3V7RA 2VWFA 4HA8A 2DM1A 2UZDB 3UT1A 1H27B 2J6OA 3JAME 1X2QA 2B9RA 2LC4A 4FU6A 2A08A 4F14A 4ZGDB 4II1A 4WF2A 2FRWA 4OMOA 2CYZB 1ABOA 5HCKA 2QDYB 1IRXA 3BHUB 1Q7YU 3OYDA 1MMDA 4J9GA 4JX6A 3M0QA 3CMEQ 1K73C 2F5TX 3EFOA 1FX7A 2YUNA 2BS2A 4C92E 1D0XA 3QHSA 1QVFA 3RERA 1QP3A 1UECA 1VYWB 5I21A 2K5IA 1VQNA 4F7UF 1TU0B 2L2PA 2VASA 3X24B 5I11A 3M55A 4OR5B 2XK0A 4XTUA 3PT9A 1UB4A 4J6WA 4PJOC 2L3PA 1DJ7B 4NL2A 1BCOA 3BW1A 4E7JA 4IIOA 1OX8A 1M1FA 1B07A 4B9XA 3HHTB 3I56T 2EJFA 3VYHB 5C0MA 2XI9A 1URCB 1VQ5A 2GF7A 3RESA 3TVTA 1TSFA 1OI1A 5BNJB 4F7UB 2K9GA 1D0ZA 1MUZA 3JCMe 2H8HA 2K3BA 1RAFB 3BE3A 4BCQB 2CDTA 3OYHA 1XOVA 3CXCS 4EOJB 4M7DD 3A8GB 3E2UA 3A8LB 2R7GA 5CYIB 5EG2A 3OS5A 4BBRM 3RKXA 3G6ET 5C6SA 2HD0A 1TWBA 1XO2A 4ROCA 2H3EB 1BI1A 3NTKA 4D8DA 3RMQA 2CT3A 1PG5B 3OYGA 2LRQA 4O5VA 2E70A 4BD3A 3JCMh 3G4ST
chains in the Genus database with same CATH topology
1N6AA 2JTMA 2KMTA 4JLGA 5CKDA 4IUVA 4JJNK 1K8AU 3G4SA 3AHUA 3SWNC 5GAN3 2QTXA 4FT2A 1N9RA 2PU9B 4M75G 1XQHA 4MZTA 3FC3A 4RCBA 4OVAA 3M54A 1G3YA 2EYQA 1KQSS 1Q81C 2M16A 2ZZDB 2E65A 3H6ZA 3S6WA 4J5YA 1M1KU 4OF1A 4OB0B 1VQKT 3M56A 3KUFA 1VQKA 2YLCA 4JDSA 3HZJA 3EFRA 4A4FA 4C8QC 3JCMc 3HKSA 1U1TA 1JBMA 5LJ5g 3CBMA 4M78G 3BG3A 4IUTA 5CIUA 3RIRA 4BI3A 2RI3A 4JS4A 5A0LA 3G71T 2CZ0B 2WSFE 4PLIA 2LCCA 3G71A 2K2VA 2K5LA 4C8QE 3BG9A 3E9GA 3QPHA 4XQ3A 5FU7B 5GANf 3GOXA 1Q82U 4EMHA 2KAFA 3GP8A 4PJOB 4CI0C 3GIBA 4M7DF 3RKYA 2HNIA 4RG2A 3JCMQ 5EJCA 3L42A 3L2RA 5KE2A 3A8HB 2EJ9A 2MF2A 2VUBA 5GAN2 1D3BB 2KQWA 5FU6B 3A8OB 5A0GA 4KUIA 4MFEA 2JNGA 3OY9A 2WACA 2EQKA 2XU8A 4JX5A 1KG1A 4C5IA 3UDCA 4JX4A 2E41A 4B9WA 4HLQA 3OYMA 3L1AA 4EPCA 3J80E 2VGMA 5IAYA 4ATOA 2XICA 4FM4B 1YBYA 2Y4YA 3VU3C 4C0DC 2XKOC 4C92D 3FRNA 2PQWA 2K3YA 3LWHA 2QA4T 4X34A 3VKIA 5KE3A 5LJ5e 3P8HA 3OBYA 2EIFA 4XTZA 1BI3A 2QA4A 4HCCA 1WNLA 3M57A 2MWOA 3LGLA 5GMKi 1Y96B 3M4YA 2E64A 2O4XA 3OYBA 4ELZC 3VKGA 1N27A 3LX7A 3JCMf 1YIJT 4LDVA 1JJ2S 5GAOp 4A4EA 4NL3A 4M7AB 3ZBDA 4HNTA 1YIJA 1KQ2A 4M7DE 2H3JA 3LGFA 2E10A 2QI2A 4AI6A 2EQJA 3MP6A 4DOWA 5HY6A 2V8KA 2VYTA 1WJSA 3MP8A 3RUXA 2EAYA 3I55T 4MDXA 3FEOA 1QP2A 1G3SA 3LW5E 2JTFA 2VXFA 3MCAB 2CGHA 3PFSA 2B8AA 3TW7A 3SDZA 4F7UA 5GMKh 3PIOA 3I55A 3JRZA 3CXCA 1NPPA 1Y07A 5I2SA 4C8QF 3PGGA 2QQRA 4EDUA 3WVDB 3C12A 3TCJA 3BDLA 2BUDA 2IG0A 4PLLA 4PJOD 4R56A 3S3NA 3CC2T 2RHXA 3QUIA 3OQ5A 2CZ1B 1BIAA 4ZGJB 2BS4A 2EWNA 2LCLA 1X6OA 4N4HA 5LJ3g 1Q7YC 1WPYA 3CC2A 4D6WA 4BUGA 3URGA 2QQAA 2XIDA 1H3ZA 2ZPGB 1PSFA 3JCMW 1M90U 4HT9A 4J6YA 3SWNB 4C5GA 3HBLA 3V8LA 4XU2A 2QQSA 3I56A 3OYAA 2YLBA 3TREA 4EMKA 1VQPT 1TH7A 5CVIA 4QVCA 3CC4T 4BDYA 1VQPA 5J39A 3UWNA 2G77A 3CCQT 5GAMd 3H4CA 1QLBA 4M77G 2DXUA 3CCQA 4RCCA 3CCSA 4J7FA 1E7PA 2VGNA 4MIMA 4KBMB 4ZTFA 3DB4A 4C8QB 3HL8A 1VQ4T 4QQGA 2ZPHB 1VQ4A 3J81E 4C92A 4L5GA 2RI2A 3FB9A 5HK0A 1JB0E 1YITT 4CRIA 4OMFB 4BI8B 4XTWA 2DIQA 1IREB 1LNXA 2LQ8A 1KQSA 4DQ2A 4M7AD 2CZ7B 4JLIA 5IN1A 3ER0A 2QEXT 3OYYA 3X28B 4GLKA 2QEXA 3VJPA 4C5EA 5CQXA 5LJ3e 5LJ5j 1K9MC 4JRKA 2I2LA 4L59A 2ZZDA 3VYGB 2QFZA 2D9TA 2VV5A 1YJWA 1N8RU 3M5AA 5FRMA 3G6EA 3GNGA 3V8KA 2E12A 2DVEA 2D6FA 4M75C 4N0AA 4HNVA 3QYGB 1YJ9T 1M1GA 3HPWA 1VQ8T 3CCVT 2X4WA 1YJ9A 1VQ8A 1BYMA 2LVMA 3OSSC 3CCVA 1Q81U 4JRQA 2KVQG 2HBPA 1G3TA 4LDWA 4M75E 4PJOF 3LWIA 1FWZA 3S3OA 3CEYA 3M58A 1OYXA 4M78C 5CKBA 3L2VA 4E7HA 4PNOA 1NJIU 4BI4A 3FIFA 4Z02A 5DLQE 3QZ9B 2FYKA 5LJ5f 3UPUA 3J7AF 5CQYA 1X01A 5HKCA 2LDMA 1M8VA 3MO8A 2R58A 4M78E 4BBSM 3GNFB 5A0DA 3BFMA 3M4GA 5LJ3h 4C8QD 4LDYA 2XDDA 1WQWA 5GANd 2LX9A 2LNVA 1XTDA 1JJ2A 2M9UA 5KCHA 4A4KA 3CCJT 3QO3A 2P0KA 1Q86C 4C0FA 3CCJA 3TEEA 3QYBA 2K3XA 3CBPA 3JCMV 1FKMA 4HNUA 4J83A 3V7SA 2F5KA 4FL6A 4XK8E 4M7AF 1EIFA 2MI6A 4M7DA 1X75C 3KBGA 2DD5A 2WSCE 5CKEA 5GMKe 3L2ZA 3P8DA 4Q5WA 4A4GA 1K8AC 3QDRB 1SSFA 4XTVA 4BY6C 4BACA 2PVOB 4J7IA 4E7IA 1H641 1K73U 3GPLA 4XU0A 2DO3A 2GQVA 2OAUA 3N5BB 4FIBA 3CCMT 3E9FA 1PSEA 1NE8A 4HCBA 2GFAA 3PNWC 3BY7A 3QBYA 1YHQT 1M1KC 5D6XA 2EFIA 1VQ7T 3META 1YHQA 5LJ3j 4F7UG 5CK9A 1VQ7A 5CR2A 4M75F 4PKCC 2LTOA 5HK3A 3JCMd 4M6VA 5GAOq 1WJQA 3G7ZA 3M53A 3DLLA 3OMCA 3JCMJ 2JOYA 3CCUT 2Y4XA 3V8JA 5A2QE 4KULA 4HT8A 2X35A 2YHTA 3CCUA 4JRPA 2VXEA 4OGEA 2PVDB 2RJFA 4E47A 2LT4A 4A53A 1QW1A 2X4JA 2ZPEB 3WXMB 1QVGA 3ME9A 4M78F 3S3MA 1Q82C 3OYLA 1OZ3A 3OS2A 3OA6A 3LYIA 2P0PA 1KC8U 3ASKA 2DIGA 3QZ5B 4XU3A 2OTJT 1V29B 2PUOB 3DL1A 1R8OB 2DTIA 5GAMh 2OTJA 2JUFA 3MEVA 3TU4K 2EQUA 4NC6A 4ZN1A 5DLOA 4A4HA 3HSBA 3RMSA 3VUBA 3E19A 2P4TA 5LJ3f 2DZ9A 2JN0A 2RHZA 3QKJA 4C8QA 4M75B 3VV0A 5IT9E 2CS7A 3ZFJA 3HB9A 3JB9D 2R5AA 2CZ6B 1BIBA 2DTOA 1KD1U 2DZCA 4M77C 4C92G 3CD6T 1O9SA 3JCMX 3CMAT 1MHNA 3C94A 3CD6A 2JVVA 3SFMA 3CMAA 4AKIA 3CPWS 3QWLA 2QQ9A 4BDZA 1NPRA 4XTYA 4Y28E 1B34B 4N0AC 1S72T 4M78B 1I4K1 2XDBA 1IZ6A 1MGQA 4M77E 2ZPIB 4L6V5 3CCET 4XAXB 3VYGA 3CCEA 5GAN6 1QVGS 3CC4A 5GAOr 3INZA 3MHXA 3DLMA 4XTXA 3O8VA 3OSVA 2CKKA 4Y91A 1G3WA 5GMKj 2DXBB 2QQ8A 1FXXA 3TW6A 4N4GA 3SB2A 1K9MU 5GAN7 4HL4A 3MEUA 1VQLT 2YRVA 1YI2T 2FL7A 1VQLA 2O01E 1YITA 1YI2A 5D6WA 2ZGWA 4C0GA 4RG8A 1VQOT 2QDJA 4FSXA 4RMOA 2HQXA 2DAQA 1HK9A 3OYEA 1VQOA 5DM7R 2KMGA 2ZCFB 2EQMA 4QVDA 5GMKm 1YCYA 4LDXA 2DPPB 2RA2A 2XD0A 4IKFA 4JUVA 2GFUA 5KCOA 2RHUA 2LT1A 3RKWA 2AHJB 1HXDA 2QF7A 4BY6B 2OTLT 5J3BA 1UGRB 3JCMb 2DXCB 2DK3A 4RKUE 1VIEA 4M75D 3C4SA 3L2QA 1W2BS 2OTLA 2F69A 1VUBA 2A3LA 5LL6S 2DD4B 2RB6A 2R57A 1RI0A 4M7DC 4C0DB 1ZHIA 5CAIA 1M5Q1 1WJRA 5GAMg 2RH2A 2RHYA 3KHIA 4X9CA 5CCAA 2HAXA 5LJ5d 3JB9F 4QVZA 2E1HA 4PJOA 1KQ1A 4MZMA 2Y90A 1WQ7A 4M77F 4M78D 2MMPA 3V7CA 3OB9A 3DKMA 2ZPFB 4JS5A 4A54A 3OYFA 2EJGA 3X25B 2DXTA 3HRSA 1D3BA 4IUQA 3OYKA 1U1SA 3E1SA 4BE0A 4ZTJA 4M7DG 4QQ6A 5GAOm 3LH0A 5GAOn 2QQBA 3JB9H 2EKOA 3OMGA 5CO7A 2MAMA 3R6OA 2RM4A 4IUUA 3QJYA 3LLRA 1I8FA 2DJZA 3CCLT 2RJCA 2RK1A 4HCZA 3CCLA 3PIPA 3M59A 2BKDN 2L8DA 3Q1JA 3HFNA 1Y7XA 2X4XA 3A8MB 3QYHB 4LDUA 1NZ9A 3HP9A 4AKHA 1Y96A 3OYNA 4MFDA 3GLXA 2LQKA 4OB1B 3CC7T 5GAMe 3MP1A 4M77B 4MZPA 4X9DA 3OW2S 4M7AA 3CC7A 5FLXE 5I2MA 4BB7A 3BG5A 1BKBA 4XU1A 4TVRA 1LOJA 3NFCA 1JRIA 3FJPA 3ZEHA 4DOVA 3EAEA 4E7LA 1NJIC 3QSUA 3GF5A 4E7KA 1XNIA 2KY9A 4F7UE 1VQ9T 2FVUA 3CCMA 4OB2B 2E6ZA 3H8ZA 4AKGA 2FB7A 2M0OA 2MWPA 5J26A 3QG1A 1VQ9A 2V8JA 1G5VA 2M1HA 1GXIE 1UGQB 4ME7A 2L89A 4QQDA 3EFSA 5DY9A 3L2UA 4LD6A 2L3RA 2C06A 5GMKl 4V2SA 2GCXA 4M75A 3QXEB 1RL2A 1ZBXA 3CPWA 4C8QG 4EMKC 3V7RA 4BE1A 4HA8A 5GANg 3P8BB 2PVGB 3UT1A 4YTLA 4ELYC 3PTAA 3JAME 1U8RA 4LD9K 2LC4A 4FU6A 3SWNA 1W4SA 1B34A 2G3RA 4M78A 2E6NA 4ZGDB 3HO8A 2WJ9A 4II1A 5LJ3d 3NTHA 4WF2A 2CYZB 4C92C 2XG8D 2QDYB 4VUBA 3CPFA 1VQ6T 4P5NA 1Q7YU 2K57A 2NLUA 3OYDA 1VQMT 3M9QA 1VQ6A 1VQMA 4JX6A 1K73C 2F5TX 4NS5A 1FX7A 2DXBA 2RK2A 4OB3B 4OP0A 2BS2A 4C92E 3QHSA 5D6YA 1KHCA 3T9NA 5FROA 5GAOl 5L8RE 1Y71A 4M7DB 2DD5B 1QVFA 2L5QA 4JRIA 4M77D 3RERA 1QP3A 3HRTA 2XDPA 4ZN3A 3JCMg 5I21A 1VQNT 1UEBA 5CKFA 3PMIA 3JCMP 2K5IA 1P92A 5GANe 2P0QA 1VQNA 4F7UF 3CMET 4OGCA 1S72A 3X26B 1AHJB 1W2BA 3CMEA 4J6XA 3QJ6A 3X24B 1LJOA 3HFOA 4KUDK 1UGPB 2RJEA 3M55A 3JCMh 2XK0A 4XTUA 5FU7C 5KH6A 5GAN4 4Z6YA 4QSHA 3C95A 3PMTA 5GAMj 3PT9A 4GY5A 2DXCA 1UB4A 2DTHA 4J6WA 5M9OA 1KC8C 4PJOC 3BDUA 3QIIA 1QVPA 2DKGA 1DJ7B 2RI5A 4NL2A 3BW1A 2DD4A 3F70A 2O4XB 2DEQA 4ELJA 4C0ZA 4EMGA 4E7JA 1YJNT 1M1FA 1YJNA 3FDRA 5FU6C 2E5QA 3HHTB 4B9XA 5LJ5h 1I5LA 3CBOA 2A7YA 3I56T 2EJFA 4PJOE 1VQ5T 3VYHB 5C0MA 2XI9A 5CKHA 3JSCA 4O6JA 3KXTA 1VQ5A 2GF7A 3RESA 1OZ2A 2V8IA 4PJOG 2KK4A 1OI1A 2KSSA 5GAN5 1ZQ1A 3JB9G 1KD1C 1QVFS 4KT0E 3CCST 4MMLA 4F7UB 1O75A 4DA4A 2PUKB 3SD4A 3JCMe 1WGSA 4C5HA 1M90C 5GAN8 4R55A 4LOCA 2K4YA 2KDSA 3OBWA 2FHDA 4C92F 5GANh 1BI2A 5GAMf 3OYHA 5AYFA 4MMKA 4QW2A 3X20B 1XOVA 4IURA 3OS1A 3L2WA 3CXCS 3MEAA 3A5ZB 2VC8A 4M7AC 2BIVA 4M7DD 3A8GB 3OYJA 3CCRT 3A8LB 2XHCA 1M4ZA 2D0QB 3CCRA 3DB3A 3OW2A 2RHIA 2K5FA 2KR6A 5GANj 2RJDA 5EG2A 3VKHA 3OS5A 3FLGA 5FRNA 3WVEB 4BBRM 3MEWA 3OYIA 3NTIA 3RKXA 4EMKB 3JB9J 1YJWT 4M7AE 3VUZA 4HKEA 3G6ET 1I81A 4M77A 3QYEA 5C6SA 2HD0A 4MDWA 1M9SA 1BI1A 1KHIA 2JZ2A 2QXFA 4UC4A 4M7AG 3NTKA 2HQEA 2BS3A 2ZPBB 4IUPA 1UGSB 3OYCA 4BE2A 2IVWA 3RMQA 4ZGEB 1Q86U 2WSEE 1VIFA 3OS0A 2RO0A 1BI0A 3HRUA 3JB9I 3OYGA 2R5MA 4NOYA 4PL6A 1N9SA 2LRQA 4J8OA 4N4IA 4C92B 1N8RC 4O5VA 2E70A 4BD3A 4FT4A 2RD1A 3G4ST 2X4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QXE B;  2CZ6 B;  1IRE B;  2CZ7 B;  2PU9 B;  2PVG B;  3X28 B;  2ZZD B;  4Y28 E;  4OB0 B;  2ZZD A;  3VYG B;  2ZPI B;  4L6V 5;  4ZGD B;  3VYG A;  2CYZ B;  2QDY B;  3QYG B;  2CZ0 B;  2DXB B;  2WSF E;  2DXB A;  4OB3 B;  2O01 E;  5L8R E;  2DD5 B;  1QP3 A;  3A8H B;  3A8O B;  3QZ9 B;  2ZCF B;  2DPP B;  3X26 B;  1AHJ B;  3X24 B;  2AHJ B;  4FM4 B;  1UGP B;  1UGR B;  2DXC B;  4RKU E;  2DXC A;  2DD4 B;  1DJ7 B;  2DD4 A;  3HHT B;  4XK8 E;  3VYH B;  2DD5 A;  2WSC E;  2ZPF B;  3X25 B;  4KT0 E;  2PVO B;  1QP2 A;  3LW5 E;  2PUK B;  1PSE A;  3WVD B;  3X20 B;  3A8G B;  2CZ1 B;  3A8L B;  4ZGJ B;  2D0Q B;  3A8M B;  3QYH B;  2ZPG B;  1PSF A;  2PVD B;  3WVE B;  4OB1 B;  2ZPE B;  3QZ5 B;  2ZPB B;  1V29 B;  1UGS B;  2PUO B;  4ZGE B;  2WSE E;  4OB2 B;  1GXI E;  1UGQ B;  2ZPH B;  1JB0 E; 
#chains in the Genus database with same CATH topology
 2JTM A;  4JJN K;  4I3Z B;  1OL1 B;  3G71 Q;  2PU9 B;  3EHQ A;  4MZT A;  3REA B;  3FC3 A;  8ATC B;  3RGF B;  3M54 A;  1KQS S;  1E6G A;  2M16 A;  1M1K U;  2CH4 A;  3S6W A;  1VQK A;  2YLC A;  2K7A A;  1GFD A;  2J05 A;  3JCM c;  4AFS C;  4M78 G;  3BG3 A;  4IUT A;  3NMZ C;  4BI3 A;  5A0L A;  4K11 A;  3E9G A;  5GAN f;  2JMC A;  2W2H A;  2YWW A;  4EMH A;  4PJO B;  1YCS B;  2A28 A;  1RAD B;  3L2R A;  5KE2 A;  2MF2 A;  1Y57 A;  1D3B B;  3A8O B;  4KH1 B;  2XU8 A;  2P4R A;  4B9W A;  2SEM A;  2VGM A;  2MYS A;  2XIC A;  1WHH A;  2Y4Y A;  1W70 A;  3FRN A;  2K3Y A;  3LWH A;  5ACB A;  3I55 Q;  3VKI A;  1JKW A;  3OBY A;  1QMZ B;  1ZA2 B;  4XTZ A;  3NDQ A;  2YRC A;  3M57 A;  1YIJ T;  3VKG A;  5GAO p;  4BCM D;  3LGF A;  2QI2 A;  1H1P B;  2PMI B;  4AI6 A;  2LJ3 A;  3MP6 A;  4EC8 B;  2EAY A;  4MDX A;  3LW5 E;  4RTZ A;  2VXF A;  1ZSZ C;  3TW7 A;  1MNE A;  3PO3 S;  1SHF A;  2F2V A;  2JTE A;  2KT1 A;  3NPF A;  2QQR A;  2EVR A;  3C12 A;  3TCJ A;  2X1N B;  3CCQ Q;  2IW6 B;  2IG0 A;  4ZGJ B;  2BS4 A;  3CC2 A;  1WXU A;  2XID A;  2DJQ A;  2C5X B;  2MCN A;  3V8L A;  2F2W A;  1VQP T;  4DBH A;  4EMK A;  1TH7 A;  5CVI A;  5KYW A;  2G77 A;  1QLB A;  4M77 G;  1JXO A;  3THK A;  1E7P A;  4ZTF A;  3M03 A;  3EFO B;  3HL8 A;  2ZPH B;  4R0K A;  1Q86 R;  3TNI B;  3FB9 A;  1W2B P;  2COW A;  2PNI A;  2X9H A;  4M7A D;  2CZ7 B;  4E7S A;  3ER0 A;  2QEX T;  1VQ8 Q;  3OYY A;  3CCV Q;  3X28 B;  3VJP A;  4C5E A;  5LJ5 j;  2I2L A;  3BLQ B;  2D9T A;  1YJW A;  3M5A A;  2WHB B;  2QGF B;  2E12 A;  1FMW A;  2D6F A;  4CFW B;  4M75 C;  1SHG A;  3QYG B;  1YJ9 A;  2LVM A;  1GY3 B;  4JRQ A;  2KVQ G;  2HBP A;  5KYY A;  3CEY A;  4E7Z A;  5CKB A;  2WMA B;  2B86 A;  1K9A A;  3CCJ Q;  1KIK A;  2GNC A;  5DLQ E;  3UA6 A;  1RI9 A;  1Q82 R;  1HYO A;  2J6F A;  3J7A F;  4II5 B;  3MO8 A;  1GUX B;  2R58 A;  4CFM B;  4M78 E;  5A0D A;  1JEG A;  3BFM A;  4C8Q D;  1JO8 A;  5GAN d;  2ECZ A;  1ZSZ B;  2LNV A;  5KCH A;  1RAI B;  1WX6 A;  4A4K A;  3EG9 B;  1Q86 C;  1X43 A;  2F2X A;  2LQN A;  3CBP A;  4J83 A;  1H28 B;  1M30 A;  4M7D A;  3KBG A;  2DD5 A;  5CKE A;  4A4G A;  1VYT A;  2X3X D;  3QDR B;  2HMA A;  4XU0 A;  1VIN A;  1PSE A;  4HCB A;  2EFI A;  5LJ3 j;  4F7U G;  1VQ7 A;  4M75 F;  4PKC C;  2LTO A;  3G7Z A;  3M53 A;  3JCM J;  3CCU T;  4J9H A;  3QHR B;  2FEI A;  4OGE A;  2PVD B;  4LUD A;  2LT4 A;  1B7T A;  4JJD A;  1QW1 A;  1RAA B;  1Q82 C;  1OZ3 A;  3OS2 A;  1KC8 U;  2OTJ T;  1V29 B;  1C9B A;  2JUF A;  3MEV A;  4CFX B;  3HSB A;  4WCI A;  5DLO A;  1JXM A;  4A4H A;  3RMS A;  2O88 A;  3E19 A;  3QKJ A;  4NST B;  4M75 B;  3ZFJ A;  2CZ6 B;  1BIB A;  4F70 B;  1YNZ A;  2MPX C;  2DZC A;  9ATC B;  3TQ7 P;  4WTO B;  3CMA T;  1MHN A;  1IO6 A;  3CD6 A;  4AKI A;  2BZX A;  2E3H A;  1B34 B;  4M77 E;  2ZPI B;  4L6V 5;  4PFP A;  1QVG S;  5GAO r;  3OSV A;  3TW6 A;  1TG0 A;  1X2K A;  1K9M U;  2KGT A;  4EOI B;  3TN8 B;  1G83 A;  1LCK A;  2O01 E;  4B6M A;  1YI2 A;  5D6W A;  2ZGW A;  1AVZ C;  3DDP B;  2DAQ A;  1VQO A;  3EGD A;  1YCY A;  4EIK A;  2ROL A;  2DPP B;  3MY5 B;  4IKF A;  2COZ A;  5KCO A;  1N4M A;  2LT1 A;  1NJI R;  2A0F B;  1AEY A;  2DXC B;  2KXD A;  4RKU E;  1PKD B;  2M02 A;  2RB6 A;  4M7D C;  4UN0 A;  1GRI A;  2W96 A;  1C1A A;  4QVZ A;  1MMG A;  1WHJ A;  1Q95 G;  1SSH A;  3V7C A;  3OB9 A;  4A54 A;  5KYW B;  2EJG A;  2DXT A;  3HRS A;  2KXC A;  1KQS P;  1D0Y A;  2DBM A;  1O9K A;  1OU8 A;  4BCP B;  1TXQ A;  2EKO A;  3OMG A;  2MAM A;  1VQK Q;  2AIR B;  2RM4 A;  4IUU A;  3RNJ A;  3VRY A;  1I8F A;  1S1N A;  2BTT A;  4HCZ A;  3CCL A;  1RAH B;  3PIP A;  2DL4 A;  3HFN A;  1Y7X A;  1VQ9 Q;  2GGR A;  1TOV A;  2X4X A;  2YXY A;  1KK7 A;  3GLX A;  3M0S A;  5HQ0 B;  2DE0 X;  4YOO A;  3CC7 T;  5GAM e;  3MP1 A;  4X9D A;  4M7A A;  3VS4 A;  4CC7 A;  3BG5 A;  1BKB A;  4DOV A;  1LOJ A;  1NJI C;  2GQI A;  3VS2 A;  4F7U E;  2FVU A;  3CCM A;  4OB2 B;  4AKG A;  2FB7 A;  2MWP A;  1PCX A;  2V8J A;  3EJ1 B;  1G5V A;  2CP7 A;  1RAC B;  4QQD A;  3EFS A;  4ZNX A;  1TUG B;  5DY9 A;  3L2U A;  5FWB A;  5IHI A;  5GMK l;  3GTM S;  1I5O B;  4J9D A;  5GAN g;  2PVG B;  2COY A;  2IPO B;  2IW8 B;  1UNG D;  2YUQ A;  2WIH B;  4LD9 K;  2LP5 A;  4Z89 A;  4PFO A;  5DQW A;  1NYG A;  1Z9Q A;  2NUP A;  2XG8 D;  1VQ6 T;  1VQM T;  2NLU A;  1GCQ A;  4NS5 A;  2DME A;  5IXF A;  2PK2 A;  1E6H A;  5FWC A;  2KT8 A;  1TTH B;  5FRO A;  5L8R E;  4M7D B;  2DD5 B;  1WLP B;  4JRI A;  4EOP B;  5IDP B;  3BLH B;  1H24 B;  2XDP A;  4ZN3 A;  2DEU A;  1YJN Q;  2P84 A;  3PMI A;  1MMA A;  4Z8A A;  2P0Q A;  2NUT B;  3CME T;  4J6X A;  3HFO A;  5FU7 C;  5KH6 A;  1UNH D;  2M0Y A;  5M9O A;  1N8R R;  2KYM A;  2V26 A;  1PNJ A;  4G6L B;  3BDU A;  2DKG A;  5CEI B;  4C0Z A;  2KE9 A;  2AT1 B;  3EHR A;  4BCK B;  2DMO A;  2E5Q A;  2BE7 D;  1I5L A;  4PJO E;  5LMK B;  5CKH A;  3KXT A;  2HDA A;  1Q81 R;  1R0C B;  3CCR Q;  2KK4 A;  1OKW B;  1ZQ1 A;  4KT0 E;  4MML A;  1ABQ A;  4F7J B;  1M2V A;  3SD4 A;  4BCG B;  1YJW Q;  1M90 C;  5GAN 8;  2OX7 A;  1PD1 A;  2KYB A;  2I0N A;  3BLR B;  4R55 A;  1BI2 A;  4PJJ A;  3X20 B;  3OS1 A;  3A5Z B;  2VC8 A;  4M7A C;  1M3C A;  3OYJ A;  2XHC A;  1UGV A;  3OW2 A;  2EQI A;  2RHI A;  2KR6 A;  2JM9 A;  4ORZ A;  3VKH A;  5FRN A;  3VUZ A;  1IGU A;  2WMB B;  4F6U B;  2BS3 A;  2DL8 A;  1UGS B;  1VYV A;  1VIF A;  3VS5 A;  1BI0 A;  3HRU A;  4PL6 A;  3M0R A;  1N9S A;  2YRD A;  4JJC A;  2E4H A;  1N8R C;  3PVQ A;  2X4Y A;  4IUV A;  1K8A U;  5IHK A;  3G4S A;  3EH2 A;  3MY1 B;  2QTX A;  1WZO A;  4M75 G;  2ROT A;  2DL3 A;  3EGD B;  2VVK A;  4OVA A;  2C5O B;  1F5Q B;  4BCM B;  1G3Y A;  1Q81 C;  2CSI A;  2ZZD B;  3KUF A;  2WPA B;  3HZJ A;  4C8Q C;  4A4F A;  1U1T A;  3RIR A;  3A98 A;  4HVV A;  3G71 T;  4PLI A;  2K5L A;  1U3O A;  2L3S A;  4XQ3 A;  5FU7 B;  2O9S A;  1Q7Y R;  3GP8 A;  4LE9 A;  3GIB A;  3RKY A;  2ED0 A;  3JCM Q;  2QA4 Q;  3A8H B;  2VUB A;  5GAN 2;  1JJ2 P;  4MFE A;  1O9K B;  2EQK A;  2OAW A;  4C5I A;  2LQW A;  1HD3 A;  4BCH B;  4ATO A;  3VU3 C;  1NM7 A;  2XKO C;  2D0N A;  4J9B A;  2PQW A;  5KE3 A;  4YOZ A;  4HCC A;  2MWO A;  2O4X A;  2UZL B;  4LDV A;  4A4E A;  1OOT A;  4M7A B;  4HNT A;  1YIJ A;  2X51 A;  1KQ2 A;  2H3J A;  1RAB B;  2EQJ A;  1UJY A;  2VYT A;  4EC9 B;  1OU9 A;  3I55 T;  3FEO A;  1WHG A;  3MCA B;  3PIO A;  5GMK h;  4FW1 A;  3JRZ A;  1Y07 A;  4JZ4 A;  1Z9Z A;  4C8Q F;  3QWY A;  1QVG P;  3WVD B;  2HBW A;  2DL7 A;  1SKU B;  2BUD A;  4BCI B;  1UUE A;  2RHX A;  3AT1 B;  2CZ1 B;  2EWN A;  1Q7Y C;  2GTJ A;  4PJN A;  4BUG A;  4M4Z A;  1PSF A;  4EOM B;  3G33 B;  4C5G A;  2RMO A;  1ARK A;  4XU2 A;  1GBR A;  3DOG B;  4QVC A;  4BDY A;  1VQP A;  2LMJ A;  5J39 A;  3UWN A;  3CCQ T;  3H4C A;  2YT6 A;  2DXU A;  3CCS A;  1QCN A;  1PWT A;  2W9F A;  3DB4 A;  4C8Q B;  1VQ4 T;  4QQG A;  2C5V B;  4C92 A;  3K7A M;  1JB0 E;  4CRI A;  1X6B A;  1IRE B;  1OGU B;  1OKV B;  4YOS A;  5IN1 A;  4JLI A;  4GLK A;  2QEX A;  5CQX A;  4JRK A;  2QFZ A;  4AFZ C;  5KYU B;  4DBQ A;  2NYS A;  3V8K A;  4CFN B;  5IDN B;  1M1K R;  4N0A A;  3ZL7 C;  1VQ8 T;  1M1G A;  3CCV T;  3M0P A;  2BPM B;  1G3T A;  4LDW A;  4M75 E;  4PJO F;  2JM8 A;  1OYX A;  2CCH B;  4FX3 B;  3L2V A;  4GBQ A;  5IH2 A;  4PNO A;  4E7H A;  4BI4 A;  4F7L B;  3QZ9 B;  2D8H A;  2FYK A;  5LJ5 f;  1M8V A;  4RTX A;  1CKB A;  2HKN A;  1C6V X;  1BCM A;  3I5S A;  2RQU A;  3O5Z A;  1JJ2 A;  2DER A;  3CCJ T;  3CCM Q;  3TEE A;  1YHQ Q;  1IHV A;  3MIA B;  1BU2 A;  3UAT A;  3MJX A;  4RTV A;  1SSF A;  4RUG A;  1JOW A;  3GPL A;  1T0H A;  3N5B B;  3NHN A;  3TSW A;  3E9F A;  2EGC A;  3QBY A;  1M1K C;  5D6X A;  1YN8 A;  3MI9 B;  2A37 A;  5CK9 A;  2FPD A;  5GAO q;  3VS0 A;  2JGZ B;  1D1C A;  3V8J A;  5A2Q E;  1EX4 A;  3CCU A;  2YUO A;  3PVL A;  2VXE A;  4JRP A;  2RJF A;  4LN2 A;  1QVG A;  1U5S A;  2DTI A;  1ZX6 A;  3MPU B;  2OTJ A;  3DTO A;  2ZAE A;  1ACM B;  2EQU A;  2FRY A;  2G6F X;  5LJ3 f;  2DZ9 A;  3CCE Q;  2JN0 A;  2UUE B;  5IT9 E;  2L3Q A;  3JB9 D;  1KD1 U;  1O9S A;  5KYX A;  1GH6 B;  2JVV A;  3SFM A;  3CMA A;  3CPW S;  4Y28 E;  4N0A C;  1VQL Q;  2QK0 A;  4J9F A;  4FYY B;  1CKA A;  4XAX B;  3VYG A;  4PK4 A;  2G9X B;  3CC4 A;  2C0I A;  5ECA A;  4KH0 B;  3MEU A;  2L0A A;  2KNB B;  2OTL Q;  1YIT A;  1TFB A;  1W6X A;  2AK5 A;  4C0G A;  4RG8 A;  2QDJ A;  4RMO A;  1RLQ C;  2CCI B;  1IGQ A;  1K4U S;  2C0T A;  5DM7 R;  2KMG A;  2ZCF B;  2X3W D;  2EQM A;  4QVD A;  4LDX A;  1A0N B;  2RA2 A;  1JSU B;  4BCJ B;  2RHU A;  2CP5 A;  1HXD A;  4F7S B;  2QF7 A;  3HTR A;  3H41 A;  2DK3 A;  2W9Z A;  3C4S A;  2F69 A;  5CAI A;  1ZHI A;  4CXA B;  1B3Q A;  1M5Q 1;  4FCY A;  5CCA A;  5LJ5 d;  2UZE B;  2LJ0 A;  4DBR A;  4KGX B;  4M7D E;  2ZPF B;  1V1C A;  3OYF A;  3OYK A;  1BU1 A;  2RQR A;  1I1J A;  4QQ6 A;  5GAO m;  1AWJ A;  4OGR B;  3LLR A;  1XJW B;  2DJZ A;  2FO0 A;  4HVU A;  2RK1 A;  3Q1J A;  4HCK A;  1BK2 A;  4LDU A;  2DF6 A;  1PC0 A;  2PZ1 A;  1Y96 A;  2WXV B;  4OB1 B;  4CFU D;  2DX1 A;  4MZP A;  3REB B;  3CC7 A;  2EKH A;  1NLO C;  1YFN A;  2QGG A;  1WXT A;  1OX9 A;  4E7L A;  3EG2 A;  3GF5 A;  4E7K A;  1VQ9 T;  2M0O A;  1R77 A;  3JV3 A;  1GXI E;  2RQW A;  1UGQ B;  1KC8 R;  2GBQ A;  1H4L D;  4V2S A;  1F1B B;  2LW4 A;  2GCX A;  3QXE B;  4C8Q G;  2A36 A;  1VA7 A;  4EMK C;  1D3U B;  1PKS A;  4IMY B;  1FYN A;  4E6R A;  1U8R A;  3SWN A;  1W4S A;  2DRK A;  4M78 A;  1SEM A;  2WJ9 A;  5LJ3 d;  2CJM B;  4VUB A;  4P5N A;  2K57 A;  1VQN Q;  1E9H B;  2EUF A;  3M9Q A;  1VQ6 A;  1VQM A;  2DXB A;  4OB3 B;  4OP0 A;  2V1R A;  5D6Y A;  2FZC B;  3RBB B;  1Y71 A;  2LNH B;  2QTV A;  2RF0 A;  3HRT A;  2C4G B;  4CC2 A;  2DL5 A;  5CKF A;  1ZSG A;  1P92 A;  5GAN e;  1S72 A;  3X26 B;  1AHJ B;  1W2B A;  2PTK A;  3CME A;  1VQ5 Q;  1LJO A;  3RDV A;  1WHM A;  4KUD K;  1UGP B;  2RJE A;  2FPF A;  5GAN 4;  4Z6Y A;  5GAM j;  3PMT A;  1D1B A;  1UE9 A;  4GY5 A;  3CCS Q;  1KC8 C;  2DET A;  3QII A;  1QVP A;  2RI5 A;  2DD4 A;  1YJN T;  2ESW A;  2F2C A;  3FDR A;  5FU6 C;  4DEX A;  3CXC P;  5LJ5 h;  2A7Y A;  2EYY A;  4Z88 A;  3JSC A;  1OZ2 A;  4PJO G;  1M3A A;  2DYI A;  4DA4 A;  1O75 A;  2PUK B;  1WGS A;  3CQT A;  4LOC A;  2K4Y A;  2KDS A;  3OBW A;  2FHD A;  1IB8 A;  5GAN h;  1IXD A;  3DDQ B;  1WDX A;  4MMK A;  5AYF A;  4BCN D;  4QW2 A;  4IUR A;  1H1S B;  4DEY A;  3CCR T;  1M4Z A;  2K5F A;  4AG1 C;  2RJD A;  3WVE B;  2OJ2 A;  1K1Z A;  3OYI A;  3JB9 J;  4EMK B;  1YJW T;  4M7A E;  4M77 A;  3QYE A;  4MDW A;  1M9S A;  2JZ2 A;  2QXF A;  2HQE A;  4IUP A;  4BE2 A;  2ED1 A;  3OYC A;  1QWF A;  4ZGE B;  3JB9 I;  4QKU A;  4NOY A;  4PJM A;  2LJ1 A;  3IQL A;  3SEM A;  4FT4 A;  2RD1 A;  4HXJ A;  1N6A A;  2KMT A;  4JLG A;  5FW9 A;  1MMN A;  3SWN C;  1RAE B;  1X6G A;  1XQH A;  4RCB A;  2EYQ A;  4J9C A;  1UFF A;  3H6Z A;  4OF1 A;  3M56 A;  1NEB A;  4JDS A;  1SRL A;  4CC4 B;  2JW4 A;  5LJ5 g;  3HKS A;  4FW2 A;  2HSP A;  2QYZ A;  4JS4 A;  2NWM A;  1WHK A;  2KRN A;  4D8K A;  3DJB A;  2LCC A;  3G71 A;  2K2V A;  2K79 A;  4X1V A;  4C8Q E;  3BG9 A;  4EOK B;  1PD0 A;  3QPH A;  5KYY B;  2O31 A;  2KAF A;  1YWP A;  4M7D F;  4BXX X;  4RG2 A;  5EJC A;  3L42 A;  2EBP A;  2KQW A;  2LZ6 B;  5FU6 B;  4CRL B;  5A0G A;  4JX5 A;  3UDC A;  4JX4 A;  1VYU A;  2E41 A;  3L1A A;  3J80 E;  5IAY A;  2RQV A;  4FM4 B;  1YBY A;  4C0D C;  4C92 D;  2BKZ B;  2DRM A;  1WFW A;  4HVW A;  4X34 A;  2QA4 T;  3P8H A;  1BI3 A;  4RTU A;  2FZK B;  3LGL A;  5GMK i;  2J6K A;  1Y96 B;  3OYB A;  5HBJ B;  2RQT A;  3JCM f;  3ZBD A;  2Z0W A;  2LX7 A;  3CC2 Q;  2AKK A;  5HY6 A;  3RUX A;  1QP2 A;  1G3S A;  2OI3 A;  3U23 A;  3EGX A;  3I55 A;  4F7U A;  3CXC A;  1NPP A;  3PGG A;  6AT1 B;  3CC4 Q;  4EDU A;  3VS6 A;  3BDL A;  3VS1 A;  4R56 A;  2C5N B;  3OQ5 A;  3BHV B;  1BIA A;  5LJ3 g;  2LCL A;  2CUB A;  1X6O A;  4F6S B;  1WPY A;  4D6W A;  3URG A;  2QQA A;  1H3Z A;  2ZPG B;  3JCM W;  1M90 U;  4J6Y A;  3SWN B;  1YIT Q;  3I56 A;  2QQS A;  1J3T A;  3OYA A;  2YLB A;  2DLP A;  2HCK A;  1ZLM A;  3CCQ A;  4RCC A;  4KBM B;  4MIM A;  4F6W B;  2HL5 C;  1VQ4 A;  5FGK B;  3J81 E;  2C0O A;  4YC3 B;  2RI2 A;  3H9N A;  5HK0 A;  2EYW A;  4BI8 B;  1KQS A;  2LQ8 A;  3TSZ A;  4DQ2 A;  1YJ9 Q;  2IW9 B;  3I9Q A;  4BY7 X;  1G8X A;  1K8A R;  1N8R U;  2JJ9 A;  3GNG A;  3G6E A;  2DVE A;  2AKL A;  4HNV A;  2X4W A;  2FZG B;  1VQ8 A;  1BYM A;  3OSS C;  3CCV A;  1Q81 U;  1HSQ A;  2D1X A;  2MOX A;  1VOL A;  1FWZ A;  4AT1 B;  2YSQ A;  3I35 A;  1Y0M A;  5LQF B;  1SPK A;  1OIU B;  1EZZ B;  3UPU A;  5CQY A;  5HKC A;  1I07 A;  1GCQ C;  2LDM A;  3QWX X;  2D8J A;  4BBS M;  3GNF B;  3R6N A;  3M4G A;  1RLP C;  4LDY A;  1FVV B;  1WYX A;  3H0I A;  2M9U A;  3QO3 A;  2V22 B;  4C0F A;  3CCJ A;  4FYV B;  2K3X A;  1VQ7 Q;  4BCF B;  4PJL A;  3JCM V;  1FKM A;  4HNU A;  3V7S A;  4M7A F;  2MI6 A;  4KRC B;  1X75 C;  2WSC E;  5GMK e;  3L2Z A;  1K8A C;  4Q5W A;  4XTV A;  3QDF A;  2PVO B;  1K73 U;  1SRM A;  2GQV A;  3CCM T;  4FIB A;  2JMA A;  3BHT B;  1NE8 A;  3PNW C;  1YHQ T;  3MET A;  4RTY A;  1WXB A;  5CR2 A;  3JCM d;  1W98 B;  3O0G D;  4M6V A;  1WJQ A;  1OUL A;  3OMC A;  2Y4X A;  1GCP A;  2X35 A;  2YHT A;  4ESR A;  2W99 A;  4E47 A;  1P5E B;  4A53 A;  3WXM B;  3S3M A;  3OYL A;  3OA6 A;  1IHW A;  3CD6 Q;  1OEB A;  2P0P A;  2DIG A;  2VKN A;  3RR6 A;  4XU3 A;  1QCF A;  2PUO B;  5HVY B;  2AZV A;  4Y92 A;  4NC6 A;  3H0F A;  4ZN1 A;  1S72 Q;  4LXC A;  1QQJ A;  2RHZ A;  4Y72 B;  2R5A A;  1PRM C;  1K76 A;  2J7I A;  3JCM X;  3C94 A;  2WEV B;  1UG1 A;  2QQ9 A;  1X69 A;  1NPR A;  4XTY A;  2XDB A;  1G2B A;  1YI2 Q;  5AT1 B;  3CCE T;  5GJV B;  2NUP B;  1GL5 A;  1VQO Q;  3INZ A;  1UNL D;  1SG5 A;  1G3W A;  4Y91 A;  1UTI A;  2QQ8 A;  4RTT A;  1FXX A;  2CT4 A;  5GAN 7;  1VQL T;  5KYN A;  2YRV A;  1QKX A;  1G3N C;  3H0H A;  1BBZ A;  4OMQ A;  1HK9 A;  3EG1 A;  4CFU B;  1AIS B;  3EGX B;  2XD0 A;  3POM A;  3VS7 A;  1X27 A;  1M8M A;  1GUX A;  2AHJ B;  2OTL T;  5J3B A;  1JST B;  1UGR B;  3JCM b;  1VIE A;  3L2Q A;  1KSW A;  1VUB A;  1ZSZ A;  1RI0 A;  4E2F B;  2IN3 A;  1OQK A;  2ATC B;  3EG9 A;  1H25 B;  1I0C A;  3KHI A;  4KGZ B;  3CCL Q;  1AOJ A;  1LVK A;  2E1H A;  1KQ1 A;  4IIM A;  2DIL A;  1WQ7 A;  4M78 D;  4MZM A;  2MMP A;  1AWO A;  4OML A;  3EG0 A;  1T3S A;  4F7N B;  3X25 B;  4IUQ A;  1M2V B;  4M7D G;  1NG2 A;  4QT7 A;  1EFN A;  5GAO n;  3JB9 H;  1M2O A;  2QQB A;  5CO7 A;  3R6O A;  2K2M A;  3QJY A;  2RJC A;  1H3H A;  1YWO A;  2GTO A;  2BKD N;  1NZ9 A;  3HP9 A;  4EOR B;  4AKH A;  2JT4 A;  5IHY A;  3OW2 S;  1AD5 A;  5FLX E;  4XU1 A;  3NFC A;  3QSU A;  2RNA A;  3FJP A;  1XNI A;  2YDL A;  2E6Z A;  8AT1 B;  1QCO A;  1VQ9 A;  3QG1 A;  4ME7 A;  4M75 A;  1ZBX A;  4BE1 A;  5D7U A;  4CC3 A;  3P8B B;  4YTL A;  4ELY C;  1HJD A;  2DVJ A;  3PTA A;  1H8K A;  1OL2 B;  2KEA A;  1KD1 R;  4A63 B;  1B34 A;  1OPK A;  2G3R A;  2E6N A;  3HO8 A;  4DBF A;  3NTH A;  5EFQ B;  4C92 C;  2W0Z A;  4F16 A;  3CPF A;  3LQ5 B;  3MKD A;  5L2W B;  1K0S A;  3EGU A;  2RK2 A;  3VRZ A;  4BCN B;  4AG2 C;  4GLM A;  2KRS A;  1KHC A;  3T9N A;  5GAO l;  2ENM A;  2L5Q A;  4M77 D;  2F1L A;  4J9E A;  1OV3 A;  2HQH A;  3JCM g;  1NEG A;  2RN8 A;  1VQN T;  1UEB A;  3JCM P;  3GBQ A;  2IIM A;  4OGC A;  4FYX B;  5L23 A;  3I56 Q;  3QJ6 A;  4RTW A;  4QSH A;  3C95 A;  5EC7 A;  2DXC A;  2DTH A;  4JZ3 A;  4CI0 C;  4EMG A;  3F70 A;  2O4X B;  2DEQ A;  4ELJ A;  5HNB B;  3A1P A;  3ULR B;  5ICP B;  1VQ4 Q;  1YJN A;  2HEQ A;  3CBO A;  4JJB A;  2DA9 A;  1VQ5 T;  4O6J A;  2BZY A;  2V8I A;  2CP6 A;  5GAN 5;  3KFV A;  1KJW A;  2KSS A;  2QG9 B;  3JB9 G;  1KD1 C;  1QVF S;  1N5Z A;  3CCS T;  1ZUK A;  2QDL A;  4C5H A;  1VOM A;  2XMF A;  3G6E Q;  4C92 F;  5GAM f;  5IXB A;  3L2W A;  3MEA A;  2QAS A;  4TTH A;  2DNU A;  2BIV A;  3EOC B;  2D0Q B;  3CCR A;  3DB3 A;  1QLY A;  2HL3 A;  4EOQ B;  3FLG A;  3MEW A;  2J06 A;  3NTI A;  1TS9 A;  3G4S Q;  4HKE A;  1I81 A;  1KHI A;  4UC4 A;  2LCS A;  4M7A G;  2ZPB B;  1Q86 U;  2IVW A;  1JU5 C;  1OI9 B;  2AZS A;  2WSE E;  1T3L A;  3OS0 A;  2RO0 A;  1D1A A;  5I22 A;  5IHN A;  1UHC A;  2R5M A;  4C92 B;  4J8O A;  4N4I A;  1UHF A;  5GAN j;  5CKD A;  3AHU A;  5HBE B;  5GAN 3;  1AZG B;  4FT2 A;  1N9R A;  3I5R A;  1FMK A;  1ENW A;  1RAG B;  2W10 A;  2E65 A;  1VQK T;  4J5Y A;  4OB0 B;  3EFR A;  1UJ0 A;  1JBM A;  4BCQ D;  1KFZ A;  3CBM A;  1H1Q B;  5CIU A;  2FPE A;  2RI3 A;  2HZY A;  2CZ0 B;  2WSF E;  4AFU C;  3EG3 A;  3GOX A;  1Q82 U;  2I40 B;  1QKW A;  2HNI A;  1ZP2 A;  4ELL A;  3D7S B;  2EJ9 A;  4KUI A;  3EID B;  2JNG A;  3OY9 A;  2WAC A;  1YIJ Q;  1KG1 A;  4HLQ A;  1BB9 A;  3OYM A;  2NUT A;  4EPC A;  1OPL A;  3C0C A;  2CH4 W;  3SHW A;  5LJ5 e;  4AFQ C;  2EIF A;  2QA4 A;  1WNL A;  3M4Y A;  2E64 A;  4LNP A;  2KR3 A;  4ELZ C;  1N27 A;  3LX7 A;  1JJ2 S;  1SF9 A;  4NL3 A;  2WIP B;  1PHT A;  2E10 A;  1K0X A;  1K9M R;  2NUZ A;  4DOW A;  1M3B A;  2V8K A;  1WJS A;  3MP8 A;  3LH5 A;  2JTF A;  4EON B;  3PFS A;  1LPL A;  2CGH A;  2B8A A;  3SDZ A;  5I2S A;  2HKQ B;  1VQP Q;  1W1F A;  4PLL A;  4PJO D;  1T0J A;  2HSE B;  3S3N A;  3CC2 T;  2V1Q A;  3QUI A;  2CP2 A;  4N4H A;  4F17 A;  2CRE A;  5I5Z B;  1MV0 B;  4HT9 A;  3HBL A;  2BZ8 A;  2CSQ A;  3TRE A;  3CC4 T;  5GJW B;  3M0T A;  2QEX Q;  5GAM d;  5DQV A;  4J7F A;  2VGN A;  3TNW B;  1RUW A;  2BE9 B;  4L5G A;  1YIT T;  4OMF B;  4XTW A;  2DIQ A;  1LNX A;  3UA7 A;  2EYZ A;  2WFY B;  5KYX B;  2IVX A;  1YP5 A;  2KRM A;  3G1J A;  5LJ3 e;  1K9M C;  4L59 A;  1M27 C;  2ZZD A;  3VYG B;  2VV5 A;  1AWX A;  1TUC A;  5FRM A;  4KRD B;  1AWW A;  1YJ9 T;  3HPW A;  1R0B G;  7AT1 B;  1AT1 B;  2PK9 B;  3LWI A;  3QHW B;  3S3O A;  1PKT A;  3M58 A;  4M78 C;  1NJI U;  1KXU A;  3FIF A;  4Z02 A;  4J9I A;  1X01 A;  2FG0 A;  3OW2 P;  1E7O A;  5LJ3 h;  2XDD A;  4ANJ A;  1H92 A;  1WQW A;  2JXB A;  2DFU A;  2LX9 A;  1XTD A;  5HBH B;  4OMN A;  2JS0 A;  2P0K A;  2C6T B;  4KRT A;  3QYB A;  4FSS A;  1QWE A;  2F5K A;  4FL6 A;  3TNH B;  4XK8 E;  1EIF A;  2E5K A;  3P8D A;  3CCU Q;  2I53 A;  4BY6 C;  2RPN A;  4BAC A;  4J7I A;  4E7I A;  2PJQ A;  1H64 1;  2DO3 A;  2OAU A;  4AMC A;  2GFA A;  3BY7 A;  4BY1 X;  1VQ7 T;  1YHQ A;  2DYB A;  2CP0 A;  1GFC A;  5HK3 A;  4BCO B;  2OTJ Q;  2K6D A;  4KGV B;  3DLL A;  2JOY A;  1AD6 A;  4KUL A;  4HT8 A;  1TD6 A;  1H26 B;  2X4J A;  2ZPE B;  3FJ5 A;  2YUP A;  3ME9 A;  4M78 F;  1UDL A;  2ABL A;  3LYI A;  3ASK A;  4F04 B;  3CPW P;  3QZ5 B;  3CMA Q;  2CP3 A;  3DL1 A;  1R8O B;  5GAM h;  1M90 R;  3TU4 K;  2JS2 A;  1V76 A;  3VUB A;  2MK5 A;  2P4T A;  3EH1 A;  4C8Q A;  3VV0 A;  2CS7 A;  1NLP C;  3HB9 A;  1ZA1 B;  1PM3 A;  2DTO A;  4C92 G;  4M77 C;  3CD6 T;  1H1R B;  5IF1 B;  2KRO A;  4ROD A;  2MIO A;  2O2O A;  3QWL A;  4EOS B;  1PRL C;  4BDZ A;  1S72 T;  4M78 B;  1I4K 1;  1IZ6 A;  1MGQ A;  3NGP A;  3VS3 A;  2SRC A;  3CCE A;  5KYU A;  5GAN 6;  1NBE B;  3MHX A;  4XTX A;  3DLM A;  1QVF P;  3O8V A;  1GBQ A;  2CKK A;  3B57 A;  5GMK j;  2DBK A;  2DXB B;  2UZB B;  2EPD A;  4N4G A;  3SB2 A;  1NYF A;  4HL4 A;  1MV3 A;  4FYW B;  1YI2 T;  2FL7 A;  1VQL A;  4LUE A;  1VQO T;  4FSX A;  2HQX A;  3OYE A;  1AZE A;  4EOL B;  1D09 B;  2EW3 A;  5GMK m;  2PHG A;  4PFZ A;  4JUV A;  4ROE A;  2GFU A;  3PE0 A;  3RKW A;  4BY6 B;  2OTL A;  4M75 D;  1W2B S;  1CSK A;  2A3L A;  5LL6 S;  2DD4 B;  2R57 A;  4C0D B;  1WJR A;  1FIN B;  3F5X B;  2RH2 A;  5GAM g;  2RHY A;  4X9C A;  2HAX A;  2E3I A;  3JB9 F;  1WI7 A;  4OMM A;  1WHL A;  4PJO A;  2CUD A;  2VB6 A;  2Y90 A;  4M77 F;  4JS5 A;  3DKM A;  4JPB W;  1U06 A;  1ZBJ A;  1D3B A;  4BE0 A;  4ZTJ A;  1U1S A;  3E1S A;  3LH0 A;  3CC7 Q;  3UF4 A;  2KI7 A;  1JQQ A;  2EGE A;  3CCL T;  4EOO B;  1K73 R;  2O9V A;  1MND A;  3M59 A;  1QMC A;  2L8D A;  2M51 A;  3A8M B;  3QYH B;  1TUD A;  3OYN A;  4MFD A;  2LQK A;  2QAZ A;  1FMV A;  4M77 B;  3M0U A;  4CFV B;  2EYX A;  1OIY B;  5I2M A;  4BB7 A;  1WIE A;  3ZEH A;  4TVR A;  1JRI A;  1WA7 A;  3EAE A;  2KY9 A;  2QGS A;  1ZUY A;  3H8Z A;  5J26 A;  2M1H A;  2KBT A;  2L89 A;  4LD6 A;  2L3R A;  2C06 A;  2EGA A;  1RL2 A;  1C0M A;  3CPW A;  4OMP A;  1VQ6 Q;  1ZUU A;  1VQM Q;  3V7R A;  2VWF A;  4HA8 A;  2DM1 A;  2UZD B;  3UT1 A;  1H27 B;  2J6O A;  3JAM E;  1X2Q A;  2B9R A;  2LC4 A;  4FU6 A;  2A08 A;  4F14 A;  4ZGD B;  4II1 A;  4WF2 A;  2FRW A;  4OMO A;  2CYZ B;  1ABO A;  5HCK A;  2QDY B;  1IRX A;  3BHU B;  1Q7Y U;  3OYD A;  1MMD A;  4J9G A;  4JX6 A;  3M0Q A;  3CME Q;  1K73 C;  2F5T X;  3EFO A;  1FX7 A;  2YUN A;  2BS2 A;  4C92 E;  1D0X A;  3QHS A;  1QVF A;  3RER A;  1QP3 A;  1UEC A;  1VYW B;  5I21 A;  2K5I A;  1VQN A;  4F7U F;  1TU0 B;  2L2P A;  2VAS A;  3X24 B;  5I11 A;  3M55 A;  4OR5 B;  2XK0 A;  4XTU A;  3PT9 A;  1UB4 A;  4J6W A;  4PJO C;  2L3P A;  1DJ7 B;  4NL2 A;  1BCO A;  3BW1 A;  4E7J A;  4IIO A;  1OX8 A;  1M1F A;  1B07 A;  4B9X A;  3HHT B;  3I56 T;  2EJF A;  3VYH B;  5C0M A;  2XI9 A;  1URC B;  1VQ5 A;  2GF7 A;  3RES A;  3TVT A;  1TSF A;  1OI1 A;  5BNJ B;  4F7U B;  2K9G A;  1D0Z A;  1MUZ A;  3JCM e;  2H8H A;  2K3B A;  1RAF B;  3BE3 A;  4BCQ B;  2CDT A;  3OYH A;  1XOV A;  3CXC S;  4EOJ B;  4M7D D;  3A8G B;  3E2U A;  3A8L B;  2R7G A;  5CYI B;  5EG2 A;  3OS5 A;  4BBR M;  3RKX A;  3G6E T;  5C6S A;  2HD0 A;  1TWB A;  1XO2 A;  4ROC A;  2H3E B;  1BI1 A;  3NTK A;  4D8D A;  3RMQ A;  2CT3 A;  1PG5 B;  3OYG A;  2LRQ A;  4O5V A;  2E70 A;  4BD3 A;  3JCM h;  3G4S T; 
#chains in the Genus database with same CATH homology
 1N6A A;  2JTM A;  2KMT A;  4JLG A;  5CKD A;  4IUV A;  4JJN K;  1K8A U;  3G4S A;  3AHU A;  3SWN C;  5GAN 3;  2QTX A;  4FT2 A;  1N9R A;  2PU9 B;  4M75 G;  1XQH A;  4MZT A;  3FC3 A;  4RCB A;  4OVA A;  3M54 A;  1G3Y A;  2EYQ A;  1KQS S;  1Q81 C;  2M16 A;  2ZZD B;  2E65 A;  3H6Z A;  3S6W A;  4J5Y A;  1M1K U;  4OF1 A;  4OB0 B;  1VQK T;  3M56 A;  3KUF A;  1VQK A;  2YLC A;  4JDS A;  3HZJ A;  3EFR A;  4A4F A;  4C8Q C;  3JCM c;  3HKS A;  1U1T A;  1JBM A;  5LJ5 g;  3CBM A;  4M78 G;  3BG3 A;  4IUT A;  5CIU A;  3RIR A;  4BI3 A;  2RI3 A;  4JS4 A;  5A0L A;  3G71 T;  2CZ0 B;  2WSF E;  4PLI A;  2LCC A;  3G71 A;  2K2V A;  2K5L A;  4C8Q E;  3BG9 A;  3E9G A;  3QPH A;  4XQ3 A;  5FU7 B;  5GAN f;  3GOX A;  1Q82 U;  4EMH A;  2KAF A;  3GP8 A;  4PJO B;  4CI0 C;  3GIB A;  4M7D F;  3RKY A;  2HNI A;  4RG2 A;  3JCM Q;  5EJC A;  3L42 A;  3L2R A;  5KE2 A;  3A8H B;  2EJ9 A;  2MF2 A;  2VUB A;  5GAN 2;  1D3B B;  2KQW A;  5FU6 B;  3A8O B;  5A0G A;  4KUI A;  4MFE A;  2JNG A;  3OY9 A;  2WAC A;  2EQK A;  2XU8 A;  4JX5 A;  1KG1 A;  4C5I A;  3UDC A;  4JX4 A;  2E41 A;  4B9W A;  4HLQ A;  3OYM A;  3L1A A;  4EPC A;  3J80 E;  2VGM A;  5IAY A;  4ATO A;  2XIC A;  4FM4 B;  1YBY A;  2Y4Y A;  3VU3 C;  4C0D C;  2XKO C;  4C92 D;  3FRN A;  2PQW A;  2K3Y A;  3LWH A;  2QA4 T;  4X34 A;  3VKI A;  5KE3 A;  5LJ5 e;  3P8H A;  3OBY A;  2EIF A;  4XTZ A;  1BI3 A;  2QA4 A;  4HCC A;  1WNL A;  3M57 A;  2MWO A;  3LGL A;  5GMK i;  1Y96 B;  3M4Y A;  2E64 A;  2O4X A;  3OYB A;  4ELZ C;  3VKG A;  1N27 A;  3LX7 A;  3JCM f;  1YIJ T;  4LDV A;  1JJ2 S;  5GAO p;  4A4E A;  4NL3 A;  4M7A B;  3ZBD A;  4HNT A;  1YIJ A;  1KQ2 A;  4M7D E;  2H3J A;  3LGF A;  2E10 A;  2QI2 A;  4AI6 A;  2EQJ A;  3MP6 A;  4DOW A;  5HY6 A;  2V8K A;  2VYT A;  1WJS A;  3MP8 A;  3RUX A;  2EAY A;  3I55 T;  4MDX A;  3FEO A;  1QP2 A;  1G3S A;  3LW5 E;  2JTF A;  2VXF A;  3MCA B;  2CGH A;  3PFS A;  2B8A A;  3TW7 A;  3SDZ A;  4F7U A;  5GMK h;  3PIO A;  3I55 A;  3JRZ A;  3CXC A;  1NPP A;  1Y07 A;  5I2S A;  4C8Q F;  3PGG A;  2QQR A;  4EDU A;  3WVD B;  3C12 A;  3TCJ A;  3BDL A;  2BUD A;  2IG0 A;  4PLL A;  4PJO D;  4R56 A;  3S3N A;  3CC2 T;  2RHX A;  3QUI A;  3OQ5 A;  2CZ1 B;  1BIA A;  4ZGJ B;  2BS4 A;  2EWN A;  2LCL A;  1X6O A;  4N4H A;  5LJ3 g;  1Q7Y C;  1WPY A;  3CC2 A;  4D6W A;  4BUG A;  3URG A;  2QQA A;  2XID A;  1H3Z A;  2ZPG B;  1PSF A;  3JCM W;  1M90 U;  4HT9 A;  4J6Y A;  3SWN B;  4C5G A;  3HBL A;  3V8L A;  4XU2 A;  2QQS A;  3I56 A;  3OYA A;  2YLB A;  3TRE A;  4EMK A;  1VQP T;  1TH7 A;  5CVI A;  4QVC A;  3CC4 T;  4BDY A;  1VQP A;  5J39 A;  3UWN A;  2G77 A;  3CCQ T;  5GAM d;  3H4C A;  1QLB A;  4M77 G;  2DXU A;  3CCQ A;  4RCC A;  3CCS A;  4J7F A;  1E7P A;  2VGN A;  4MIM A;  4KBM B;  4ZTF A;  3DB4 A;  4C8Q B;  3HL8 A;  1VQ4 T;  4QQG A;  2ZPH B;  1VQ4 A;  3J81 E;  4C92 A;  4L5G A;  2RI2 A;  3FB9 A;  5HK0 A;  1JB0 E;  1YIT T;  4CRI A;  4OMF B;  4BI8 B;  4XTW A;  2DIQ A;  1IRE B;  1LNX A;  2LQ8 A;  1KQS A;  4DQ2 A;  4M7A D;  2CZ7 B;  4JLI A;  5IN1 A;  3ER0 A;  2QEX T;  3OYY A;  3X28 B;  4GLK A;  2QEX A;  3VJP A;  4C5E A;  5CQX A;  5LJ3 e;  5LJ5 j;  1K9M C;  4JRK A;  2I2L A;  4L59 A;  2ZZD A;  3VYG B;  2QFZ A;  2D9T A;  2VV5 A;  1YJW A;  1N8R U;  3M5A A;  5FRM A;  3G6E A;  3GNG A;  3V8K A;  2E12 A;  2DVE A;  2D6F A;  4M75 C;  4N0A A;  4HNV A;  3QYG B;  1YJ9 T;  1M1G A;  3HPW A;  1VQ8 T;  3CCV T;  2X4W A;  1YJ9 A;  1VQ8 A;  1BYM A;  2LVM A;  3OSS C;  3CCV A;  1Q81 U;  4JRQ A;  2KVQ G;  2HBP A;  1G3T A;  4LDW A;  4M75 E;  4PJO F;  3LWI A;  1FWZ A;  3S3O A;  3CEY A;  3M58 A;  1OYX A;  4M78 C;  5CKB A;  3L2V A;  4E7H A;  4PNO A;  1NJI U;  4BI4 A;  3FIF A;  4Z02 A;  5DLQ E;  3QZ9 B;  2FYK A;  5LJ5 f;  3UPU A;  3J7A F;  5CQY A;  1X01 A;  5HKC A;  2LDM A;  1M8V A;  3MO8 A;  2R58 A;  4M78 E;  4BBS M;  3GNF B;  5A0D A;  3BFM A;  3M4G A;  5LJ3 h;  4C8Q D;  4LDY A;  2XDD A;  1WQW A;  5GAN d;  2LX9 A;  2LNV A;  1XTD A;  1JJ2 A;  2M9U A;  5KCH A;  4A4K A;  3CCJ T;  3QO3 A;  2P0K A;  1Q86 C;  4C0F A;  3CCJ A;  3TEE A;  3QYB A;  2K3X A;  3CBP A;  3JCM V;  1FKM A;  4HNU A;  4J83 A;  3V7S A;  2F5K A;  4FL6 A;  4XK8 E;  4M7A F;  1EIF A;  2MI6 A;  4M7D A;  1X75 C;  3KBG A;  2DD5 A;  2WSC E;  5CKE A;  5GMK e;  3L2Z A;  3P8D A;  4Q5W A;  4A4G A;  1K8A C;  3QDR B;  1SSF A;  4XTV A;  4BY6 C;  4BAC A;  2PVO B;  4J7I A;  4E7I A;  1H64 1;  1K73 U;  3GPL A;  4XU0 A;  2DO3 A;  2GQV A;  2OAU A;  3N5B B;  4FIB A;  3CCM T;  3E9F A;  1PSE A;  1NE8 A;  4HCB A;  2GFA A;  3PNW C;  3BY7 A;  3QBY A;  1YHQ T;  1M1K C;  5D6X A;  2EFI A;  1VQ7 T;  3MET A;  1YHQ A;  5LJ3 j;  4F7U G;  5CK9 A;  1VQ7 A;  5CR2 A;  4M75 F;  4PKC C;  2LTO A;  5HK3 A;  3JCM d;  4M6V A;  5GAO q;  1WJQ A;  3G7Z A;  3M53 A;  3DLL A;  3OMC A;  3JCM J;  2JOY A;  3CCU T;  2Y4X A;  3V8J A;  5A2Q E;  4KUL A;  4HT8 A;  2X35 A;  2YHT A;  3CCU A;  4JRP A;  2VXE A;  4OGE A;  2PVD B;  2RJF A;  4E47 A;  2LT4 A;  4A53 A;  1QW1 A;  2X4J A;  2ZPE B;  3WXM B;  1QVG A;  3ME9 A;  4M78 F;  3S3M A;  1Q82 C;  3OYL A;  1OZ3 A;  3OS2 A;  3OA6 A;  3LYI A;  2P0P A;  1KC8 U;  3ASK A;  2DIG A;  3QZ5 B;  4XU3 A;  2OTJ T;  1V29 B;  2PUO B;  3DL1 A;  1R8O B;  2DTI A;  5GAM h;  2OTJ A;  2JUF A;  3MEV A;  3TU4 K;  2EQU A;  4NC6 A;  4ZN1 A;  5DLO A;  4A4H A;  3HSB A;  3RMS A;  3VUB A;  3E19 A;  2P4T A;  5LJ3 f;  2DZ9 A;  2JN0 A;  2RHZ A;  3QKJ A;  4C8Q A;  4M75 B;  3VV0 A;  5IT9 E;  2CS7 A;  3ZFJ A;  3HB9 A;  3JB9 D;  2R5A A;  2CZ6 B;  1BIB A;  2DTO A;  1KD1 U;  2DZC A;  4M77 C;  4C92 G;  3CD6 T;  1O9S A;  3JCM X;  3CMA T;  1MHN A;  3C94 A;  3CD6 A;  2JVV A;  3SFM A;  3CMA A;  4AKI A;  3CPW S;  3QWL A;  2QQ9 A;  4BDZ A;  1NPR A;  4XTY A;  4Y28 E;  1B34 B;  4N0A C;  1S72 T;  4M78 B;  1I4K 1;  2XDB A;  1IZ6 A;  1MGQ A;  4M77 E;  2ZPI B;  4L6V 5;  3CCE T;  4XAX B;  3VYG A;  3CCE A;  5GAN 6;  1QVG S;  3CC4 A;  5GAO r;  3INZ A;  3MHX A;  3DLM A;  4XTX A;  3O8V A;  3OSV A;  2CKK A;  4Y91 A;  1G3W A;  5GMK j;  2DXB B;  2QQ8 A;  1FXX A;  3TW6 A;  4N4G A;  3SB2 A;  1K9M U;  5GAN 7;  4HL4 A;  3MEU A;  1VQL T;  2YRV A;  1YI2 T;  2FL7 A;  1VQL A;  2O01 E;  1YIT A;  1YI2 A;  5D6W A;  2ZGW A;  4C0G A;  4RG8 A;  1VQO T;  2QDJ A;  4FSX A;  4RMO A;  2HQX A;  2DAQ A;  1HK9 A;  3OYE A;  1VQO A;  5DM7 R;  2KMG A;  2ZCF B;  2EQM A;  4QVD A;  5GMK m;  1YCY A;  4LDX A;  2DPP B;  2RA2 A;  2XD0 A;  4IKF A;  4JUV A;  2GFU A;  5KCO A;  2RHU A;  2LT1 A;  3RKW A;  2AHJ B;  1HXD A;  2QF7 A;  4BY6 B;  2OTL T;  5J3B A;  1UGR B;  3JCM b;  2DXC B;  2DK3 A;  4RKU E;  1VIE A;  4M75 D;  3C4S A;  3L2Q A;  1W2B S;  2OTL A;  2F69 A;  1VUB A;  2A3L A;  5LL6 S;  2DD4 B;  2RB6 A;  2R57 A;  1RI0 A;  4M7D C;  4C0D B;  1ZHI A;  5CAI A;  1M5Q 1;  1WJR A;  5GAM g;  2RH2 A;  2RHY A;  3KHI A;  4X9C A;  5CCA A;  2HAX A;  5LJ5 d;  3JB9 F;  4QVZ A;  2E1H A;  4PJO A;  1KQ1 A;  4MZM A;  2Y90 A;  1WQ7 A;  4M77 F;  4M78 D;  2MMP A;  3V7C A;  3OB9 A;  3DKM A;  2ZPF B;  4JS5 A;  4A54 A;  3OYF A;  2EJG A;  3X25 B;  2DXT A;  3HRS A;  1D3B A;  4IUQ A;  3OYK A;  1U1S A;  3E1S A;  4BE0 A;  4ZTJ A;  4M7D G;  4QQ6 A;  5GAO m;  3LH0 A;  5GAO n;  2QQB A;  3JB9 H;  2EKO A;  3OMG A;  5CO7 A;  2MAM A;  3R6O A;  2RM4 A;  4IUU A;  3QJY A;  3LLR A;  1I8F A;  2DJZ A;  3CCL T;  2RJC A;  2RK1 A;  4HCZ A;  3CCL A;  3PIP A;  3M59 A;  2BKD N;  2L8D A;  3Q1J A;  3HFN A;  1Y7X A;  2X4X A;  3A8M B;  3QYH B;  4LDU A;  1NZ9 A;  3HP9 A;  4AKH A;  1Y96 A;  3OYN A;  4MFD A;  3GLX A;  2LQK A;  4OB1 B;  3CC7 T;  5GAM e;  3MP1 A;  4M77 B;  4MZP A;  4X9D A;  3OW2 S;  4M7A A;  3CC7 A;  5FLX E;  5I2M A;  4BB7 A;  3BG5 A;  1BKB A;  4XU1 A;  4TVR A;  1LOJ A;  3NFC A;  1JRI A;  3FJP A;  3ZEH A;  4DOV A;  3EAE A;  4E7L A;  1NJI C;  3QSU A;  3GF5 A;  4E7K A;  1XNI A;  2KY9 A;  4F7U E;  1VQ9 T;  2FVU A;  3CCM A;  4OB2 B;  2E6Z A;  3H8Z A;  4AKG A;  2FB7 A;  2M0O A;  2MWP A;  5J26 A;  3QG1 A;  1VQ9 A;  2V8J A;  1G5V A;  2M1H A;  1GXI E;  1UGQ B;  4ME7 A;  2L89 A;  4QQD A;  3EFS A;  5DY9 A;  3L2U A;  4LD6 A;  2L3R A;  2C06 A;  5GMK l;  4V2S A;  2GCX A;  4M75 A;  3QXE B;  1RL2 A;  1ZBX A;  3CPW A;  4C8Q G;  4EMK C;  3V7R A;  4BE1 A;  4HA8 A;  5GAN g;  3P8B B;  2PVG B;  3UT1 A;  4YTL A;  4ELY C;  3PTA A;  3JAM E;  1U8R A;  4LD9 K;  2LC4 A;  4FU6 A;  3SWN A;  1W4S A;  1B34 A;  2G3R A;  4M78 A;  2E6N A;  4ZGD B;  3HO8 A;  2WJ9 A;  4II1 A;  5LJ3 d;  3NTH A;  4WF2 A;  2CYZ B;  4C92 C;  2XG8 D;  2QDY B;  4VUB A;  3CPF A;  1VQ6 T;  4P5N A;  1Q7Y U;  2K57 A;  2NLU A;  3OYD A;  1VQM T;  3M9Q A;  1VQ6 A;  1VQM A;  4JX6 A;  1K73 C;  2F5T X;  4NS5 A;  1FX7 A;  2DXB A;  2RK2 A;  4OB3 B;  4OP0 A;  2BS2 A;  4C92 E;  3QHS A;  5D6Y A;  1KHC A;  3T9N A;  5FRO A;  5GAO l;  5L8R E;  1Y71 A;  4M7D B;  2DD5 B;  1QVF A;  2L5Q A;  4JRI A;  4M77 D;  3RER A;  1QP3 A;  3HRT A;  2XDP A;  4ZN3 A;  3JCM g;  5I21 A;  1VQN T;  1UEB A;  5CKF A;  3PMI A;  3JCM P;  2K5I A;  1P92 A;  5GAN e;  2P0Q A;  1VQN A;  4F7U F;  3CME T;  4OGC A;  1S72 A;  3X26 B;  1AHJ B;  1W2B A;  3CME A;  4J6X A;  3QJ6 A;  3X24 B;  1LJO A;  3HFO A;  4KUD K;  1UGP B;  2RJE A;  3M55 A;  3JCM h;  2XK0 A;  4XTU A;  5FU7 C;  5KH6 A;  5GAN 4;  4Z6Y A;  4QSH A;  3C95 A;  3PMT A;  5GAM j;  3PT9 A;  4GY5 A;  2DXC A;  1UB4 A;  2DTH A;  4J6W A;  5M9O A;  1KC8 C;  4PJO C;  3BDU A;  3QII A;  1QVP A;  2DKG A;  1DJ7 B;  2RI5 A;  4NL2 A;  3BW1 A;  2DD4 A;  3F70 A;  2O4X B;  2DEQ A;  4ELJ A;  4C0Z A;  4EMG A;  4E7J A;  1YJN T;  1M1F A;  1YJN A;  3FDR A;  5FU6 C;  2E5Q A;  3HHT B;  4B9X A;  5LJ5 h;  1I5L A;  3CBO A;  2A7Y A;  3I56 T;  2EJF A;  4PJO E;  1VQ5 T;  3VYH B;  5C0M A;  2XI9 A;  5CKH A;  3JSC A;  4O6J A;  3KXT A;  1VQ5 A;  2GF7 A;  3RES A;  1OZ2 A;  2V8I A;  4PJO G;  2KK4 A;  1OI1 A;  2KSS A;  5GAN 5;  1ZQ1 A;  3JB9 G;  1KD1 C;  1QVF S;  4KT0 E;  3CCS T;  4MML A;  4F7U B;  1O75 A;  4DA4 A;  2PUK B;  3SD4 A;  3JCM e;  1WGS A;  4C5H A;  1M90 C;  5GAN 8;  4R55 A;  4LOC A;  2K4Y A;  2KDS A;  3OBW A;  2FHD A;  4C92 F;  5GAN h;  1BI2 A;  5GAM f;  3OYH A;  5AYF A;  4MMK A;  4QW2 A;  3X20 B;  1XOV A;  4IUR A;  3OS1 A;  3L2W A;  3CXC S;  3MEA A;  3A5Z B;  2VC8 A;  4M7A C;  2BIV A;  4M7D D;  3A8G B;  3OYJ A;  3CCR T;  3A8L B;  2XHC A;  1M4Z A;  2D0Q B;  3CCR A;  3DB3 A;  3OW2 A;  2RHI A;  2K5F A;  2KR6 A;  5GAN j;  2RJD A;  5EG2 A;  3VKH A;  3OS5 A;  3FLG A;  5FRN A;  3WVE B;  4BBR M;  3MEW A;  3OYI A;  3NTI A;  3RKX A;  4EMK B;  3JB9 J;  1YJW T;  4M7A E;  3VUZ A;  4HKE A;  3G6E T;  1I81 A;  4M77 A;  3QYE A;  5C6S A;  2HD0 A;  4MDW A;  1M9S A;  1BI1 A;  1KHI A;  2JZ2 A;  2QXF A;  4UC4 A;  4M7A G;  3NTK A;  2HQE A;  2BS3 A;  2ZPB B;  4IUP A;  1UGS B;  3OYC A;  4BE2 A;  2IVW A;  3RMQ A;  4ZGE B;  1Q86 U;  2WSE E;  1VIF A;  3OS0 A;  2RO0 A;  1BI0 A;  3HRU A;  3JB9 I;  3OYG A;  2R5M A;  4NOY A;  4PL6 A;  1N9S A;  2LRQ A;  4J8O A;  4N4I A;  4C92 B;  1N8R C;  4O5V A;  2E70 A;  4BD3 A;  4FT4 A;  2RD1 A;  3G4S T;  2X4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...