3KHIA

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
223
Chain Sequence
b'AEMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFGLVHNQRVVQQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRNGDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 74
structure length 223
sequence length 238
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3khiA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3khiA02
1PWPA 1PWVA 1FLSA 4JP4A 1A85A 1JAOA 1IAGA 2J0TA 4G0DA 3VI1A 2E2DA 1SLMA 5B5PA 4GR3A 3B92A 4FXYP 1BUDA 3LJGA 3O64A 1SMPA 5I43A 3U1RA 1BUVM 3ELMA 4AXQA 2K2GA 4CTHA 4GF1A 1JH1A 1KUFA 1D8FA 4GR0A 1KUIA 1Z3JA 1HV5A 4JPAA 1JKYA 2OVXA 4FU4A 1SLNA 1MMQA 1XFYA 3KMEA 4H2EA 2WO9A 1XURA 4G9LA 3TSKA 3LJZA 2A8HA 4IN9A 2JT5A 2DW2A 830CA 1EUBA 2SRTA 3OHOA 4H3XA 4WKEA 2USNA 1GO8P 3L0TA 4L63A 1BQQM 1D7XA 1HTDA 2JNPA 4H82A 3HDAP 3LUNA 2X3BA 5BPAA 5D2BA 4PKRA 2ERQA 5CXAA 1RM8A 3EDHA 1YOUA 4GUYA 3KEJA 1G05A 1I1IP 5D1SA 4PKSA 3F15A 2MLSA 4ZR5A 2TCLA 3EDGA 3EWJA 1BIWA 4GWNA 3TVCA 4DD8A 1IAEA 2O3EA 1UEAA 2W13A 1PWQA 3KMCA 3EDZA 1H71P 3CKIA 1YQYA 1KUGA 4L19A 1MNCA 1OMJA 1XFVA 1FBLA 1G4KA 2OW9A 2W15A 2Y6CA 1XFXA 2JIHA 3LIKA 1GE6A 1USNA 4AUOA 1ZP5A 2AIGP 5CZMA 4A3WA 1XUCA 3TT4A 1KUKA 1R55A 3LEAA 3P1VA 3HY7A 3UVCA 3SHIA 3LQBA 1CGLA 1L6JA 3KHIA 4XBHA 5I4OA 1HOVA 3AYUA 5H8XA 4HX3A 1DTHA 4PKVA 1ZS0A 3AIGA 2JT6A 3HY9A 3LE9A 1FM1A 3Q2GA 1DMTA 3LILA 1XFWA 1IACA 3F17A 1XFUA 2O36A 1OS9A 4AIGA 4WF6A 1QJJA 2OY4A 2YB9A 2JSDA 3K7NA 4XCTA 2W0DA 3WV3A 3BA0A 1R1JA 5I2ZA 3LIRA 1BQOA 3LJTA 1C8TA 3G5CA 1JIWP 3I7IA 1R54A 2ERPA 3KRYA 2W14A 1GKCA 1CGFA 1OM7A 3USNA 1OS2A 3Q2HA 2CLTA 5JMYA 4PKWA 1ND1A 1ZXCA 4JQGA 4GWMA 1S4BP 3RTTA 3TS4A 4JIJA 1J7NA 2OW2A 2MZEA 1C3IA 4I35A 3DL1A 4IJOA 2DW1A 1CQRA 1QICA 2DDYA 2EROA 4PKQA 2Z2DA 2K9CA 2RJQA 1CIZA 1G9KA 1BKCA 4XM7A 1MMRA 1SU3A 2W12A 4WZVA 3WV1A 2MZHA 2PJTA 2DDFA 2OI0A 3EHYA 5L7FA 3AYKA 1GE5A 1BM6A 1CAQA 4J4MA 1KBCA 3DSLA 1PWUA 1UMSA 1K7IA 1QIAA 1I73A 1WNIA 1CXVA 4HMAA 1AYKA 4H49A 1O0TA 1Y8JA 2OZRA 5I0LA 3VTGA 1IABA 1BZSA 3OHLA 2OY2A 1R1IA 4FXQA 2FV5A 1JAQA 2KRJA 4FVLA 1IAAA 3HYGA 1GE7A 2OXUA 1QIBA 4H76A 5LABA 5BOYA 1UTTA 3KEKA 1KUHA 2AYKA 2X7MA 3ZVSA 3O2XA 1I76A 2Y6DA 3ZUKA 3HBUP 3EHXA 1QJIA 3N2VA 3DPEA 4L6TA 1BKCI 2D1OA 3NX7A 4PKTA 2L0RA 1D8MA 4DF9A 2J83A 1MMBA 3B2ZA 1ZTQA 3B8ZA 2MZIA 3LMCA 5D1TA 1Q3AA 1G12A 1BSWA 4XM6A 1XUDA 2XS3A 3ZXHA 4JA1A 3V96B 1KAPP 1OM6A 3DWBA 2MLRA 2OW0A 4Q1LA 1EB6A 4IUWA 1JJ9A 1GO7P 1QUAA 1AKLA 1ZXVA 3F19A 1YP1A 4H1QA 1CGEA 4XM8A 1G49A 1BKCE 2OVZA 4WKIA 4GQLA 2YIGA 1A86A 2OW1A 4ON1A 5BOTA 3LKAA 4EFSA 4ILWD 4AYKA 4QKZA 456CA 1O0QA 4DV8A 2QPJA 2X3CA 4H30A 4A7BA 1JK3A 5D1UA 4WK7A 1OM8A 1YCMA 2WO8A 3HDBA 2N8RA 1K7GA 3F1AA 2XS4A 3DPFA 5B5OA 3LK8A 1PWWA 1B8YA 3K7LA 5D7WA 3E8RA 4PKUA 2WOAA 5CUHA 3F16A 3I7GA 5I3MA 1Y0VA 4R3VA 1R1HA 1Y93A 1ROSA 1OO9A 1ASTA 1RMZA 1ZVXA 2OXWA 3N2UA 1HFSA 2HU6A 1CK7A 3GBOA 1ATLA 2X3AA 1C7KA 3LGPA 2RJPA 1UTZA 5I12A 5D3CA 3DNGA 1HFCA 4I03A 2V4BA 1JIZA 3L0VA 3KWVC 1JAPA 1B3DA 3HBVP 3HB2P 1XFZA 3WV2A 2I47A 2OXZA 1JANA 3P24A 1IADA 1AF0A 4GR8A 2DW0A 3EDIA 3MA2A 1SRPA 4H84A 2E3XA 3KECA 5L79A 3G42A 1EAKA 1SATA 3RTSA 1UMTA 2FV9A 3F18A 966CA 2CKIA 1HY7A 2D1NA 1GXDA 2POJA 1MMPA 1GKDA 3LQ0A 1D5JA 4DPEA 1K7QA 3LUMA
chains in the Genus database with same CATH superfamily
4EORB 1PWPA 4ZGDB 4AKHA 1FLSA 1PWVA 4JP4A 1A85A 1JAOA 1IAGA 2J0TA 5ICPB 4G0DA 3VI1A 3MI9B 4YOSA 2E2DA 1SLMA 1H28B 5B5PA 4GR3A 3HBLA 3B92A 1PKDB 4FXYP 3BG9A 4HLQA 1BUDA 3LJGA 3O64A 1SMPA 2QDJA 1C9BA 5I43A 2I53A 3U1RA 1BUVM 3ELMA 2QQ8A 1N4MA 2KMGA 4AXQA 2K2GA 4UN0A 4GF1A 4CTHA 1GUXB 1JH1A 1KUFA 1D8FA 2BS4A 2C5OB 3DTKA 4GR0A 1KUIA 1Z3JA 4CFUB 1HV5A 4JPAA 2PMIB 2JGZB 1JKYA 3MIAB 4BXXX 2OVXA 4FU4A 1SLNA 2DPPB 4BCND 3DJBA 4EOMB 1OI9B 1MMQA 2CCHB 1XFYA 3KMEA 4H2EA 2WO9A 1XURA 2EUFA 4G9LA 4BCMD 3TSKA 2C5VB 3LJZA 2WIHB 2A8HA 4IN9A 2JT5A 2DW2A 830CA 1EUBA 1V29B 5CEIB 4KRDB 2SRTA 2CYZB 2F2CA 4HNUA 3DDQB 1KXUA 3OHOA 4ZGEB 4H3XA 4WKEA 2USNA 1GO8P 3L0TA 4L63A 1BQQM 1D7XA 2C4GB 1H27B 1HTDA 2JNPA 4OGRB 4H82A 2V22B 3HDAP 3LUNA 3X24B 4HL4A 2X3BA 3WVEB 5BPAA 4CFUD 5D2BA 2WJ9A 4PKRA 1UNHD 2ERQA 5CXAA 2BS3A 1RM8A 3EDHA 4TTHA 3VKHA 5L2WB 1H1QB 1YOUA 4GUYA 3KEJA 1G05A 1I1IP 5D1SA 5LMKB 3PO3S 4EOIB 4CFMB 3QXEB 4PKSA 1UGQB 3F15A 4BBRM 2CCIB 3M03A 4BBSM 2MLSA 4EOSB 2WHBB 4ZR5A 4OB1B 2TCLA 3EDGA 4OB2B 3EWJA 1E7PA 1H24B 1BIWA 5DQWA 3HZJA 4GWNA 3TVCA 4DD8A 2IW6B 1IAEA 2O3EA 1UEAA 2W13A 1PWQA 1ZP2A 3KMCA 3EDZA 1H71P 2WXVB 3HHTB 1YQYA 3POMA 3CKIA 1KUGA 4L19A 1JSTB 1OKWB 1MNCA 2BPMB 1OMJA 3TNWB 1UNLD 1FBLA 1XFVA 1G4KA 2OW9A 2W15A 1GH6B 4EOKB 2Y6CA 1XFXA 2JIHA 3LIKA 1GE6A 1USNA 4AUOA 3BHTB 1ZP5A 2AIGP 5CZMA 4G6LB 4A3WA 4EOLB 1XUCA 4ZGJB 4CFNB 3TT4A 2BKZB 4OR5B 1VINA 1KUKA 1R55A 1W98B 3LEAA 3P1VA 2ZPHB 4OB3B 3HY7A 3UVCA 3SHIA 2UZDB 3LQBA 1CGLA 1IREB 1OIUB 1L6JA 1JKWA 3KHIA 4XBHA 2CZ7B 5I4OA 3AYUA 1HOVA 5BNJB 5H8XA 4AKIA 4HX3A 1DTHA 4PKVA 3X26B 1ZS0A 3AIGA 2JT6A 3HY9A 3LE9A 1FM1A 4BCGB 3Q2GA 1DMTA 1UNGD 3LILA 1XFWA 5I5ZB 1IACA 3F17A 1UGRB 2WEVB 1XFUA 2O36A 4F7LB 1OS9A 4AIGA 4WF6A 4M6VA 1QJJA 2DD5B 3B57A 2OY4A 2YB9A 3F5XB 3BLQB 2JSDA 3DTIA 3K7NA 4XCTA 2UZBB 2W0DA 3WV3A 3WVDB 3BA0A 4F6UB 3QYGB 5IDPB 5IHYA 1R1JA 5I2ZA 2C6TB 3A8GB 3LIRA 3A8LB 3DDPB 1BQOA 3TNIB 3LJTA 1C8TA 3G5CA 1JIWP 3I7IA 3QZ9B 1R54A 2ERPA 5DQVA 2D0QB 2W14A 3KRYA 2WMAB 1GKCA 1CGFA 1OM7A 1FVVB 2C5NB 2W99A 4QSHA 3USNA 1OS2A 3Q2HA 2CLTA 5JMYA 2C5XB 3QZ5B 4PKWA 2W2HA 1OL1B 4NSTB 1ND1A 1ZXCA 4JQGA 1OKVB 4GWMA 3TN8B 1S4BP 3RTTA 3TS4A 2G9XB 3G33B 4JIJA 1J7NA 2CJMB 4KRCB 2OW2A 2MZEA 1OZ9A 2R7GA 2W9FA 1C3IA 4I35A 3DL1A 4IJOA 2DW1A 1CQRA 1QICA 2DDYA 4EC8B 4AKGA 2EROA 3MY5B 4PKQA 2Z2DA 2K9CA 2RJQA 1CIZA 4BCQB 1TVIA 1G9KA 1BKCA 2ZPBB 4BCJB 4XM7A 1MMRA 1SU3A 4AI6A 1ENWA 2CZ0B 2W12A 4WZVA 3WV1A 2MZHA 2ZZDB 2PJTA 2X1NB 2WMBB 2DDFA 2OI0A 2UZEB 3EHYA 4CFXB 5L7FA 2W9ZA 4MIMA 3AYKA 5FGKB 4RODA 1GE5A 4II5B 1BM6A 1CAQA 4J4MA 4YOZA 1KBCA 1JOWA 1VYWB 3DSLA 1PWUA 1XAXA 1UMSA 3EJ1B 5IDNB 1K7IA 1QIAA 1I73A 1WNIA 1CXVA 3EIDB 4FM4B 4HMAA 1AYKA 4H49A 3VKGA 1O0TA 1Y8JA 2OZRA 5I0LA 3VTGA 5HVYB 2CZ1B 1IABA 1BZSA 1P5EB 3BLRB 4BCPB 3OHLA 3GTMS 1E9HB 2OY2A 1R1IA 4FXQA 4EC9B 4BCQD 4HNTA 2FV5A 1JAQA 3DOGB 2KRJA 3O0GD 3VYHB 4ELJA 4JX4A 4CRLB 4ROEA 3QYBA 2IVXA 4FVLA 1IAAA 5CYIB 3HYGA 1GE7A 1TFBA 2OXUA 1VOLA 4EOQB 1H4LD 1AISB 1QIBA 4H76A 5HBHB 5LABA 1TD6A 1OIYB 5BOYA 3VYGB 1UTTA 4ROCA 3BG3A 4F7NB 3KEKA 1KUHA 2AYKA 2PJQA 2X7MA 3ZVSA 3O2XA 1I76A 1H1PB 4EONB 2Y6DA 2LW4A 3ZUKA 3HBUP 3EHXA 1QJIA 3N2VA 3DPEA 4L6TA 4F7SB 4BCKB 5HBJB 1BKCI 2IW8B 2D1OA 1OGUB 2DXCB 4FX3B 3NX7A 2CZ6B 4L7AA 3K7AM 4BY1X 4PKTA 1JSUB 2L0RA 4YOOA 1D8MA 4DF9A 3X20B 2J83A 1MMBA 2UZLB 2ZPEB 3B2ZA 1ZTQA 3B8ZA 2MZIA 3LMCA 5D1TA 1Q3AA 1G12A 3A8MB 3EOCB 1BSWA 4XM6A 1XUDA 2XS3A 1O9KA 3ZXHA 4JX6A 2AHJB 4BCHB 5IF1B 4JA1A 5EFQB 3LQ5B 2YUFA 4BCFB 2QFZA 1KAPP 3V96B 2IW9B 4CXAB 4Y72B 5HNBB 1OM6A 2MLRA 3DWBA 2OW0A 4Q1LA 3BG5A 1EB6A 4IUWA 2ZPFB 4HNVA 1JJ9A 1GO7P 2PK9B 4BY7X 1AKLA 1QUAA 1ZXVA 4F6SB 1AD6A 5LQFB 2KR6A 4I3ZB 3F19A 1YP1A 3A8OB 2DMEA 4H1QA 1CGEA 4XM8A 1G49A 3DTOA 1BKCE 2OVZA 1AHJB 4WKIA 4GQLA 3HB9A 2YIGA 4EOOB 1A86A 2B9RA 2OW1A 1QMZB 3TW7A 2QF7A 1XM5A 4ON1A 5BOTA 3LKAA 4EFSA 4ILWD 2BS2A 1H1SB 4AYKA 4JX5A 5ACBA 4LOCA 1H25B 4QKZA 456CA 1O0QA 4DV8A 3BLHB 2QPJA 2X3CA 4H30A 3BHVB 4A7BA 1JK3A 1F5QB 2QDYB 4F7JB 1UGSB 5D1UA 4WK7A 2UUEB 2ZPGB 3X28B 1OM8A 1YCMA 2ZCFB 2WO8A 3HDBA 2N8RA 1K7GA 4EOJB 3F1AA 2ZPIB 2I40B 3HO8A 3QHWB 2XS4A 3DPFA 5B5OA 3LK8A 4YC3B 1PWWA 1B8YA 3K7LA 5D7WA 3QHRB 3RGFB 3E8RA 4PKUA 2WFYB 1G3NC 4EOPB 4Z6YA 2WOAA 5CUHA 3F16A 1XO2A 3I7GA 5I3MA 1FINB 1UGPB 1Y0VA 4R3VA 1R1HA 1Y93A 1URCB 1ROSA 2WIPB 1GY3B 1OO9A 1ASTA 1O9KB 4BCIB 1RMZA 1GUXA 1ZVXA 1QLBA 2OXWA 3N2UA 2DD4B 5HQ0B 1HFSA 2HU6A 3QYHB 2G77A 1H1RB 4MFEA 1CK7A 3GBOA 1ATLA 2X3AA 1C7KA 3LGPA 2WPAB 2RJPA 1UTZA 5I12A 2QGSA 4OB0B 5D3CA 3DNGA 3X25B 1HFCA 4I03A 4NC6A 2V4BA 1JIZA 3L0VA 3KWVC 1JAPA 2IN3A 1B3DA 3HBVP 3HB2P 1XFZA 1H26B 1D3UB 3WV2A 2I47A 4CFVB 5HBEB 2OXZA 1JANA 2DXBB 4IMYB 3P24A 1IADA 4F70B 1AF0A 1BU2A 3BHUB 2DW0A 3EDIA 4GR8A 3MA2A 3NDQA 3QWLA 1SRPA 3A8HB 1OL2B 4H84A 2PHGA 2E3XA 3DTEA 3KECA 3H4CA 4F6WB 5L79A 4MFDA 3G42A 1EAKA 1SATA 3RTSA 1UMTA 2FV9A 3F18A 966CA 3QYEA 2W96A 4ELLA 2CKIA 4BCNB 1FKMA 4BCOB 1HY7A 2D1NA 1GXDA 5EJCA 3TNHB 2PK2A 2POJA 1MMPA 1GKDA 3LQ0A 1D5JA 3MY1B 4DPEA 1K7QA 4BCMB 4CFWB 3LUMA 3TW6A
chains in the Genus database with same CATH topology
1PWPA 4ZGDB 4AKHA 1FLSA 1PWVA 4JP4A 1A85A 1JAOA 1IAGA 2J0TA 4G0DA 3VI1A 2E2DA 1SLMA 5B5PA 4GR3A 3HBLA 3B92A 4FXYP 3BG9A 4HLQA 1BUDA 3LJGA 3O64A 1SMPA 2QDJA 5I43A 3U1RA 1BUVM 3ELMA 2QQ8A 2KMGA 4AXQA 2K2GA 4CTHA 4GF1A 1JH1A 1KUFA 1D8FA 2BS4A 3DTKA 4GR0A 1KUIA 1Z3JA 1HV5A 4JPAA 1JKYA 2OVXA 4FU4A 1SLNA 2DPPB 1MMQA 1XFYA 3KMEA 4H2EA 2WO9A 1XURA 4G9LA 3TSKA 3LJZA 2A8HA 4IN9A 2JT5A 2DW2A 830CA 1EUBA 1V29B 2SRTA 2CYZB 4HNUA 3OHOA 4ZGEB 4H3XA 4WKEA 2USNA 1GO8P 3L0TA 4L63A 1BQQM 1D7XA 1HTDA 2JNPA 4H82A 3HDAP 3LUNA 3X24B 4HL4A 2X3BA 3WVEB 5BPAA 5D2BA 2WJ9A 4PKRA 2ERQA 5CXAA 2BS3A 1RM8A 3EDHA 3VKHA 1YOUA 4GUYA 3KEJA 1G05A 1I1IP 5D1SA 3QXEB 4PKSA 1UGQB 3F15A 4BBRM 4BBSM 2MLSA 4ZR5A 4OB1B 2TCLA 3EDGA 4OB2B 3EWJA 1E7PA 1BIWA 3HZJA 4GWNA 3TVCA 4DD8A 1IAEA 2O3EA 1UEAA 2W13A 1PWQA 3KMCA 3EDZA 1H71P 3HHTB 3CKIA 1YQYA 1KUGA 4L19A 1MNCA 1OMJA 1XFVA 1FBLA 1G4KA 2OW9A 2W15A 2Y6CA 1XFXA 2JIHA 3LIKA 1GE6A 1USNA 4AUOA 1ZP5A 2AIGP 5CZMA 4A3WA 1XUCA 4ZGJB 3TT4A 1KUKA 1R55A 3LEAA 3P1VA 2ZPHB 4OB3B 3HY7A 3UVCA 3SHIA 3LQBA 1CGLA 1IREB 1L6JA 3KHIA 4XBHA 2CZ7B 5I4OA 3AYUA 1HOVA 5H8XA 4AKIA 4HX3A 1DTHA 4PKVA 3X26B 1ZS0A 3AIGA 2JT6A 3HY9A 3LE9A 1FM1A 3Q2GA 1DMTA 3LILA 1XFWA 1IACA 3F17A 1UGRB 1XFUA 2O36A 1OS9A 4AIGA 4WF6A 4M6VA 1QJJA 2DD5B 2OY4A 2YB9A 2JSDA 3DTIA 3K7NA 4XCTA 2W0DA 3WV3A 3WVDB 3BA0A 3QYGB 1R1JA 5I2ZA 3A8GB 3LIRA 3A8LB 1BQOA 3LJTA 1C8TA 3G5CA 1JIWP 3I7IA 3QZ9B 1R54A 2ERPA 2D0QB 2W14A 3KRYA 1GKCA 1CGFA 1OM7A 4QSHA 3USNA 1OS2A 3Q2HA 2CLTA 5JMYA 3QZ5B 4PKWA 1ND1A 1ZXCA 4JQGA 4GWMA 1S4BP 3RTTA 3TS4A 4JIJA 1J7NA 2OW2A 2MZEA 1C3IA 4I35A 3DL1A 4IJOA 2DW1A 1CQRA 1QICA 2DDYA 4AKGA 2EROA 4PKQA 2Z2DA 2K9CA 2RJQA 1CIZA 1G9KA 1BKCA 2ZPBB 4XM7A 1MMRA 1SU3A 4AI6A 2CZ0B 2W12A 4WZVA 3WV1A 2MZHA 2ZZDB 2PJTA 2DDFA 2OI0A 3EHYA 5L7FA 4MIMA 3AYKA 1GE5A 1BM6A 1CAQA 4J4MA 1KBCA 3DSLA 1PWUA 1UMSA 1K7IA 1QIAA 1I73A 1WNIA 1CXVA 4FM4B 4HMAA 1AYKA 4H49A 3VKGA 1O0TA 1Y8JA 2OZRA 5I0LA 3VTGA 2CZ1B 1IABA 1BZSA 3OHLA 2OY2A 1R1IA 4FXQA 4HNTA 2FV5A 1JAQA 2KRJA 3VYHB 4ELJA 4JX4A 3QYBA 4FVLA 1IAAA 3HYGA 1GE7A 2OXUA 1QIBA 4H76A 5LABA 5BOYA 3VYGB 1UTTA 3BG3A 3KEKA 1KUHA 2AYKA 2X7MA 3ZVSA 3O2XA 1I76A 2Y6DA 3ZUKA 3HBUP 3EHXA 1QJIA 3N2VA 3DPEA 4L6TA 1BKCI 2D1OA 2DXCB 3NX7A 2CZ6B 4L7AA 4PKTA 2L0RA 1D8MA 4DF9A 3X20B 2J83A 1MMBA 2ZPEB 3B2ZA 1ZTQA 3B8ZA 2MZIA 3LMCA 5D1TA 1Q3AA 1G12A 3A8MB 1BSWA 4XM6A 1XUDA 2XS3A 3ZXHA 4JX6A 2AHJB 4JA1A 2YUFA 3V96B 2QFZA 1KAPP 1OM6A 2MLRA 3DWBA 2OW0A 4Q1LA 3BG5A 1EB6A 4IUWA 2ZPFB 4HNVA 1JJ9A 1GO7P 1QUAA 1AKLA 1ZXVA 2KR6A 3F19A 1YP1A 3A8OB 4H1QA 1CGEA 4XM8A 1G49A 1BKCE 2OVZA 1AHJB 4WKIA 4GQLA 3HB9A 2YIGA 1A86A 2OW1A 3TW7A 2QF7A 4ON1A 5BOTA 3LKAA 4EFSA 4ILWD 2BS2A 4AYKA 4JX5A 4LOCA 4QKZA 456CA 1O0QA 4DV8A 2QPJA 2X3CA 4H30A 4A7BA 1JK3A 2QDYB 1UGSB 5D1UA 4WK7A 2ZPGB 3X28B 1OM8A 1YCMA 2WO8A 2ZCFB 3HDBA 2N8RA 1K7GA 3F1AA 2ZPIB 3HO8A 2XS4A 3DPFA 5B5OA 3LK8A 1PWWA 1B8YA 3K7LA 5D7WA 3E8RA 4PKUA 4Z6YA 2WOAA 5CUHA 3F16A 3I7GA 5I3MA 1UGPB 1Y0VA 4R3VA 1R1HA 1Y93A 1ROSA 1OO9A 1ASTA 1RMZA 1ZVXA 1QLBA 2OXWA 3N2UA 2DD4B 1HFSA 2HU6A 3QYHB 2G77A 4MFEA 1CK7A 3GBOA 1ATLA 2X3AA 1C7KA 3LGPA 2RJPA 1UTZA 5I12A 4OB0B 5D3CA 3DNGA 3X25B 1HFCA 4I03A 4NC6A 2V4BA 1JIZA 3L0VA 3KWVC 1JAPA 1B3DA 3HBVP 3HB2P 1XFZA 3WV2A 2I47A 2OXZA 1JANA 2DXBB 3P24A 1IADA 1AF0A 4GR8A 2DW0A 3EDIA 3MA2A 3QWLA 1SRPA 3A8HB 4H84A 2E3XA 3DTEA 3KECA 3H4CA 5L79A 4MFDA 3G42A 1EAKA 1SATA 3RTSA 1UMTA 2FV9A 3F18A 966CA 3QYEA 2CKIA 1FKMA 1HY7A 2D1NA 1GXDA 5EJCA 2POJA 1MMPA 1GKDA 3LQ0A 1D5JA 4DPEA 1K7QA 3LUMA 3TW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWP A;  1PWV A;  1FLS A;  4JP4 A;  1A85 A;  1JAO A;  1IAG A;  2J0T A;  4G0D A;  3VI1 A;  2E2D A;  1SLM A;  5B5P A;  4GR3 A;  3B92 A;  4FXY P;  1BUD A;  3LJG A;  3O64 A;  1SMP A;  5I43 A;  3U1R A;  1BUV M;  3ELM A;  4AXQ A;  2K2G A;  4CTH A;  4GF1 A;  1JH1 A;  1KUF A;  1D8F A;  4GR0 A;  1KUI A;  1Z3J A;  1HV5 A;  4JPA A;  1JKY A;  2OVX A;  4FU4 A;  1SLN A;  1MMQ A;  1XFY A;  3KME A;  4H2E A;  2WO9 A;  1XUR A;  4G9L A;  3TSK A;  3LJZ A;  2A8H A;  4IN9 A;  2JT5 A;  2DW2 A;  830C A;  1EUB A;  2SRT A;  3OHO A;  4H3X A;  4WKE A;  2USN A;  1GO8 P;  3L0T A;  4L63 A;  1BQQ M;  1D7X A;  1HTD A;  2JNP A;  4H82 A;  3HDA P;  3LUN A;  2X3B A;  5BPA A;  5D2B A;  4PKR A;  2ERQ A;  5CXA A;  1RM8 A;  3EDH A;  1YOU A;  4GUY A;  3KEJ A;  1G05 A;  1I1I P;  5D1S A;  4PKS A;  3F15 A;  2MLS A;  4ZR5 A;  2TCL A;  3EDG A;  3EWJ A;  1BIW A;  4GWN A;  3TVC A;  4DD8 A;  1IAE A;  2O3E A;  1UEA A;  2W13 A;  1PWQ A;  3KMC A;  3EDZ A;  1H71 P;  3CKI A;  1YQY A;  1KUG A;  4L19 A;  1MNC A;  1OMJ A;  1XFV A;  1FBL A;  1G4K A;  2OW9 A;  2W15 A;  2Y6C A;  1XFX A;  2JIH A;  3LIK A;  1GE6 A;  1USN A;  4AUO A;  1ZP5 A;  2AIG P;  5CZM A;  4A3W A;  1XUC A;  3TT4 A;  1KUK A;  1R55 A;  3LEA A;  3P1V A;  3HY7 A;  3UVC A;  3SHI A;  3LQB A;  1CGL A;  1L6J A;  3KHI A;  4XBH A;  5I4O A;  1HOV A;  3AYU A;  5H8X A;  4HX3 A;  1DTH A;  4PKV A;  1ZS0 A;  3AIG A;  2JT6 A;  3HY9 A;  3LE9 A;  1FM1 A;  3Q2G A;  1DMT A;  3LIL A;  1XFW A;  1IAC A;  3F17 A;  1XFU A;  2O36 A;  1OS9 A;  4AIG A;  4WF6 A;  1QJJ A;  2OY4 A;  2YB9 A;  2JSD A;  3K7N A;  4XCT A;  2W0D A;  3WV3 A;  3BA0 A;  1R1J A;  5I2Z A;  3LIR A;  1BQO A;  3LJT A;  1C8T A;  3G5C A;  1JIW P;  3I7I A;  1R54 A;  2ERP A;  3KRY A;  2W14 A;  1GKC A;  1CGF A;  1OM7 A;  3USN A;  1OS2 A;  3Q2H A;  2CLT A;  5JMY A;  4PKW A;  1ND1 A;  1ZXC A;  4JQG A;  4GWM A;  1S4B P;  3RTT A;  3TS4 A;  4JIJ A;  1J7N A;  2OW2 A;  2MZE A;  1C3I A;  4I35 A;  3DL1 A;  4IJO A;  2DW1 A;  1CQR A;  1QIC A;  2DDY A;  2ERO A;  4PKQ A;  2Z2D A;  2K9C A;  2RJQ A;  1CIZ A;  1G9K A;  1BKC A;  4XM7 A;  1MMR A;  1SU3 A;  2W12 A;  4WZV A;  3WV1 A;  2MZH A;  2PJT A;  2DDF A;  2OI0 A;  3EHY A;  5L7F A;  3AYK A;  1GE5 A;  1BM6 A;  1CAQ A;  4J4M A;  1KBC A;  3DSL A;  1PWU A;  1UMS A;  1K7I A;  1QIA A;  1I73 A;  1WNI A;  1CXV A;  4HMA A;  1AYK A;  4H49 A;  1O0T A;  1Y8J A;  2OZR A;  5I0L A;  3VTG A;  1IAB A;  1BZS A;  3OHL A;  2OY2 A;  1R1I A;  4FXQ A;  2FV5 A;  1JAQ A;  2KRJ A;  4FVL A;  1IAA A;  3HYG A;  1GE7 A;  2OXU A;  1QIB A;  4H76 A;  5LAB A;  5BOY A;  1UTT A;  3KEK A;  1KUH A;  2AYK A;  2X7M A;  3ZVS A;  3O2X A;  1I76 A;  2Y6D A;  3ZUK A;  3HBU P;  3EHX A;  1QJI A;  3N2V A;  3DPE A;  4L6T A;  1BKC I;  2D1O A;  3NX7 A;  4PKT A;  2L0R A;  1D8M A;  4DF9 A;  2J83 A;  1MMB A;  3B2Z A;  1ZTQ A;  3B8Z A;  2MZI A;  3LMC A;  5D1T A;  1Q3A A;  1G12 A;  1BSW A;  4XM6 A;  1XUD A;  2XS3 A;  3ZXH A;  4JA1 A;  3V96 B;  1KAP P;  1OM6 A;  3DWB A;  2MLR A;  2OW0 A;  4Q1L A;  1EB6 A;  4IUW A;  1JJ9 A;  1GO7 P;  1QUA A;  1AKL A;  1ZXV A;  3F19 A;  1YP1 A;  4H1Q A;  1CGE A;  4XM8 A;  1G49 A;  1BKC E;  2OVZ A;  4WKI A;  4GQL A;  2YIG A;  1A86 A;  2OW1 A;  4ON1 A;  5BOT A;  3LKA A;  4EFS A;  4ILW D;  4AYK A;  4QKZ A;  456C A;  1O0Q A;  4DV8 A;  2QPJ A;  2X3C A;  4H30 A;  4A7B A;  1JK3 A;  5D1U A;  4WK7 A;  1OM8 A;  1YCM A;  2WO8 A;  3HDB A;  2N8R A;  1K7G A;  3F1A A;  2XS4 A;  3DPF A;  5B5O A;  3LK8 A;  1PWW A;  1B8Y A;  3K7L A;  5D7W A;  3E8R A;  4PKU A;  2WOA A;  5CUH A;  3F16 A;  3I7G A;  5I3M A;  1Y0V A;  4R3V A;  1R1H A;  1Y93 A;  1ROS A;  1OO9 A;  1AST A;  1RMZ A;  1ZVX A;  2OXW A;  3N2U A;  1HFS A;  2HU6 A;  1CK7 A;  3GBO A;  1ATL A;  2X3A A;  1C7K A;  3LGP A;  2RJP A;  1UTZ A;  5I12 A;  5D3C A;  3DNG A;  1HFC A;  4I03 A;  2V4B A;  1JIZ A;  3L0V A;  3KWV C;  1JAP A;  1B3D A;  3HBV P;  3HB2 P;  1XFZ A;  3WV2 A;  2I47 A;  2OXZ A;  1JAN A;  3P24 A;  1IAD A;  1AF0 A;  4GR8 A;  2DW0 A;  3EDI A;  3MA2 A;  1SRP A;  4H84 A;  2E3X A;  3KEC A;  5L79 A;  3G42 A;  1EAK A;  1SAT A;  3RTS A;  1UMT A;  2FV9 A;  3F18 A;  966C A;  2CKI A;  1HY7 A;  2D1N A;  1GXD A;  2POJ A;  1MMP A;  1GKD A;  3LQ0 A;  1D5J A;  4DPE A;  1K7Q A;  3LUM A; 
#chains in the Genus database with same CATH topology
 4EOR B;  1PWP A;  4ZGD B;  4AKH A;  1FLS A;  1PWV A;  4JP4 A;  1A85 A;  1JAO A;  1IAG A;  2J0T A;  5ICP B;  4G0D A;  3VI1 A;  3MI9 B;  4YOS A;  2E2D A;  1SLM A;  1H28 B;  5B5P A;  4GR3 A;  3HBL A;  3B92 A;  1PKD B;  4FXY P;  3BG9 A;  4HLQ A;  1BUD A;  3LJG A;  3O64 A;  1SMP A;  2QDJ A;  1C9B A;  5I43 A;  2I53 A;  3U1R A;  1BUV M;  3ELM A;  2QQ8 A;  1N4M A;  2KMG A;  4AXQ A;  2K2G A;  4UN0 A;  4GF1 A;  4CTH A;  1GUX B;  1JH1 A;  1KUF A;  1D8F A;  2BS4 A;  2C5O B;  3DTK A;  4GR0 A;  1KUI A;  1Z3J A;  4CFU B;  1HV5 A;  4JPA A;  2PMI B;  2JGZ B;  1JKY A;  3MIA B;  4BXX X;  2OVX A;  4FU4 A;  1SLN A;  2DPP B;  4BCN D;  3DJB A;  4EOM B;  1OI9 B;  1MMQ A;  2CCH B;  1XFY A;  3KME A;  4H2E A;  2WO9 A;  1XUR A;  2EUF A;  4G9L A;  4BCM D;  3TSK A;  2C5V B;  3LJZ A;  2WIH B;  2A8H A;  4IN9 A;  2JT5 A;  2DW2 A;  830C A;  1EUB A;  1V29 B;  5CEI B;  4KRD B;  2SRT A;  2CYZ B;  2F2C A;  4HNU A;  3DDQ B;  1KXU A;  3OHO A;  4ZGE B;  4H3X A;  4WKE A;  2USN A;  1GO8 P;  3L0T A;  4L63 A;  1BQQ M;  1D7X A;  2C4G B;  1H27 B;  1HTD A;  2JNP A;  4OGR B;  4H82 A;  2V22 B;  3HDA P;  3LUN A;  3X24 B;  4HL4 A;  2X3B A;  3WVE B;  5BPA A;  4CFU D;  5D2B A;  2WJ9 A;  4PKR A;  1UNH D;  2ERQ A;  5CXA A;  2BS3 A;  1RM8 A;  3EDH A;  4TTH A;  3VKH A;  5L2W B;  1H1Q B;  1YOU A;  4GUY A;  3KEJ A;  1G05 A;  1I1I P;  5D1S A;  5LMK B;  3PO3 S;  4EOI B;  4CFM B;  3QXE B;  4PKS A;  1UGQ B;  3F15 A;  4BBR M;  2CCI B;  3M03 A;  4BBS M;  2MLS A;  4EOS B;  2WHB B;  4ZR5 A;  4OB1 B;  2TCL A;  3EDG A;  4OB2 B;  3EWJ A;  1E7P A;  1H24 B;  1BIW A;  5DQW A;  3HZJ A;  4GWN A;  3TVC A;  4DD8 A;  2IW6 B;  1IAE A;  2O3E A;  1UEA A;  2W13 A;  1PWQ A;  1ZP2 A;  3KMC A;  3EDZ A;  1H71 P;  2WXV B;  3HHT B;  1YQY A;  3POM A;  3CKI A;  1KUG A;  4L19 A;  1JST B;  1OKW B;  1MNC A;  2BPM B;  1OMJ A;  3TNW B;  1UNL D;  1FBL A;  1XFV A;  1G4K A;  2OW9 A;  2W15 A;  1GH6 B;  4EOK B;  2Y6C A;  1XFX A;  2JIH A;  3LIK A;  1GE6 A;  1USN A;  4AUO A;  3BHT B;  1ZP5 A;  2AIG P;  5CZM A;  4G6L B;  4A3W A;  4EOL B;  1XUC A;  4ZGJ B;  4CFN B;  3TT4 A;  2BKZ B;  4OR5 B;  1VIN A;  1KUK A;  1R55 A;  1W98 B;  3LEA A;  3P1V A;  2ZPH B;  4OB3 B;  3HY7 A;  3UVC A;  3SHI A;  2UZD B;  3LQB A;  1CGL A;  1IRE B;  1OIU B;  1L6J A;  1JKW A;  3KHI A;  4XBH A;  2CZ7 B;  5I4O A;  3AYU A;  1HOV A;  5BNJ B;  5H8X A;  4AKI A;  4HX3 A;  1DTH A;  4PKV A;  3X26 B;  1ZS0 A;  3AIG A;  2JT6 A;  3HY9 A;  3LE9 A;  1FM1 A;  4BCG B;  3Q2G A;  1DMT A;  1UNG D;  3LIL A;  1XFW A;  5I5Z B;  1IAC A;  3F17 A;  1UGR B;  2WEV B;  1XFU A;  2O36 A;  4F7L B;  1OS9 A;  4AIG A;  4WF6 A;  4M6V A;  1QJJ A;  2DD5 B;  3B57 A;  2OY4 A;  2YB9 A;  3F5X B;  3BLQ B;  2JSD A;  3DTI A;  3K7N A;  4XCT A;  2UZB B;  2W0D A;  3WV3 A;  3WVD B;  3BA0 A;  4F6U B;  3QYG B;  5IDP B;  5IHY A;  1R1J A;  5I2Z A;  2C6T B;  3A8G B;  3LIR A;  3A8L B;  3DDP B;  1BQO A;  3TNI B;  3LJT A;  1C8T A;  3G5C A;  1JIW P;  3I7I A;  3QZ9 B;  1R54 A;  2ERP A;  5DQV A;  2D0Q B;  2W14 A;  3KRY A;  2WMA B;  1GKC A;  1CGF A;  1OM7 A;  1FVV B;  2C5N B;  2W99 A;  4QSH A;  3USN A;  1OS2 A;  3Q2H A;  2CLT A;  5JMY A;  2C5X B;  3QZ5 B;  4PKW A;  2W2H A;  1OL1 B;  4NST B;  1ND1 A;  1ZXC A;  4JQG A;  1OKV B;  4GWM A;  3TN8 B;  1S4B P;  3RTT A;  3TS4 A;  2G9X B;  3G33 B;  4JIJ A;  1J7N A;  2CJM B;  4KRC B;  2OW2 A;  2MZE A;  1OZ9 A;  2R7G A;  2W9F A;  1C3I A;  4I35 A;  3DL1 A;  4IJO A;  2DW1 A;  1CQR A;  1QIC A;  2DDY A;  4EC8 B;  4AKG A;  2ERO A;  3MY5 B;  4PKQ A;  2Z2D A;  2K9C A;  2RJQ A;  1CIZ A;  4BCQ B;  1TVI A;  1G9K A;  1BKC A;  2ZPB B;  4BCJ B;  4XM7 A;  1MMR A;  1SU3 A;  4AI6 A;  1ENW A;  2CZ0 B;  2W12 A;  4WZV A;  3WV1 A;  2MZH A;  2ZZD B;  2PJT A;  2X1N B;  2WMB B;  2DDF A;  2OI0 A;  2UZE B;  3EHY A;  4CFX B;  5L7F A;  2W9Z A;  4MIM A;  3AYK A;  5FGK B;  4ROD A;  1GE5 A;  4II5 B;  1BM6 A;  1CAQ A;  4J4M A;  4YOZ A;  1KBC A;  1JOW A;  1VYW B;  3DSL A;  1PWU A;  1XAX A;  1UMS A;  3EJ1 B;  5IDN B;  1K7I A;  1QIA A;  1I73 A;  1WNI A;  1CXV A;  3EID B;  4FM4 B;  4HMA A;  1AYK A;  4H49 A;  3VKG A;  1O0T A;  1Y8J A;  2OZR A;  5I0L A;  3VTG A;  5HVY B;  2CZ1 B;  1IAB A;  1BZS A;  1P5E B;  3BLR B;  4BCP B;  3OHL A;  3GTM S;  1E9H B;  2OY2 A;  1R1I A;  4FXQ A;  4EC9 B;  4BCQ D;  4HNT A;  2FV5 A;  1JAQ A;  3DOG B;  2KRJ A;  3O0G D;  3VYH B;  4ELJ A;  4JX4 A;  4CRL B;  4ROE A;  3QYB A;  2IVX A;  4FVL A;  1IAA A;  5CYI B;  3HYG A;  1GE7 A;  1TFB A;  2OXU A;  1VOL A;  4EOQ B;  1H4L D;  1AIS B;  1QIB A;  4H76 A;  5HBH B;  5LAB A;  1TD6 A;  1OIY B;  5BOY A;  3VYG B;  1UTT A;  4ROC A;  3BG3 A;  4F7N B;  3KEK A;  1KUH A;  2AYK A;  2PJQ A;  2X7M A;  3ZVS A;  3O2X A;  1I76 A;  1H1P B;  4EON B;  2Y6D A;  2LW4 A;  3ZUK A;  3HBU P;  3EHX A;  1QJI A;  3N2V A;  3DPE A;  4L6T A;  4F7S B;  4BCK B;  5HBJ B;  1BKC I;  2IW8 B;  2D1O A;  1OGU B;  2DXC B;  4FX3 B;  3NX7 A;  2CZ6 B;  4L7A A;  3K7A M;  4BY1 X;  4PKT A;  1JSU B;  2L0R A;  4YOO A;  1D8M A;  4DF9 A;  3X20 B;  2J83 A;  1MMB A;  2UZL B;  2ZPE B;  3B2Z A;  1ZTQ A;  3B8Z A;  2MZI A;  3LMC A;  5D1T A;  1Q3A A;  1G12 A;  3A8M B;  3EOC B;  1BSW A;  4XM6 A;  1XUD A;  2XS3 A;  1O9K A;  3ZXH A;  4JX6 A;  2AHJ B;  4BCH B;  5IF1 B;  4JA1 A;  5EFQ B;  3LQ5 B;  2YUF A;  4BCF B;  2QFZ A;  1KAP P;  3V96 B;  2IW9 B;  4CXA B;  4Y72 B;  5HNB B;  1OM6 A;  2MLR A;  3DWB A;  2OW0 A;  4Q1L A;  3BG5 A;  1EB6 A;  4IUW A;  2ZPF B;  4HNV A;  1JJ9 A;  1GO7 P;  2PK9 B;  4BY7 X;  1AKL A;  1QUA A;  1ZXV A;  4F6S B;  1AD6 A;  5LQF B;  2KR6 A;  4I3Z B;  3F19 A;  1YP1 A;  3A8O B;  2DME A;  4H1Q A;  1CGE A;  4XM8 A;  1G49 A;  3DTO A;  1BKC E;  2OVZ A;  1AHJ B;  4WKI A;  4GQL A;  3HB9 A;  2YIG A;  4EOO B;  1A86 A;  2B9R A;  2OW1 A;  1QMZ B;  3TW7 A;  2QF7 A;  1XM5 A;  4ON1 A;  5BOT A;  3LKA A;  4EFS A;  4ILW D;  2BS2 A;  1H1S B;  4AYK A;  4JX5 A;  5ACB A;  4LOC A;  1H25 B;  4QKZ A;  456C A;  1O0Q A;  4DV8 A;  3BLH B;  2QPJ A;  2X3C A;  4H30 A;  3BHV B;  4A7B A;  1JK3 A;  1F5Q B;  2QDY B;  4F7J B;  1UGS B;  5D1U A;  4WK7 A;  2UUE B;  2ZPG B;  3X28 B;  1OM8 A;  1YCM A;  2ZCF B;  2WO8 A;  3HDB A;  2N8R A;  1K7G A;  4EOJ B;  3F1A A;  2ZPI B;  2I40 B;  3HO8 A;  3QHW B;  2XS4 A;  3DPF A;  5B5O A;  3LK8 A;  4YC3 B;  1PWW A;  1B8Y A;  3K7L A;  5D7W A;  3QHR B;  3RGF B;  3E8R A;  4PKU A;  2WFY B;  1G3N C;  4EOP B;  4Z6Y A;  2WOA A;  5CUH A;  3F16 A;  1XO2 A;  3I7G A;  5I3M A;  1FIN B;  1UGP B;  1Y0V A;  4R3V A;  1R1H A;  1Y93 A;  1URC B;  1ROS A;  2WIP B;  1GY3 B;  1OO9 A;  1AST A;  1O9K B;  4BCI B;  1RMZ A;  1GUX A;  1ZVX A;  1QLB A;  2OXW A;  3N2U A;  2DD4 B;  5HQ0 B;  1HFS A;  2HU6 A;  3QYH B;  2G77 A;  1H1R B;  4MFE A;  1CK7 A;  3GBO A;  1ATL A;  2X3A A;  1C7K A;  3LGP A;  2WPA B;  2RJP A;  1UTZ A;  5I12 A;  2QGS A;  4OB0 B;  5D3C A;  3DNG A;  3X25 B;  1HFC A;  4I03 A;  4NC6 A;  2V4B A;  1JIZ A;  3L0V A;  3KWV C;  1JAP A;  2IN3 A;  1B3D A;  3HBV P;  3HB2 P;  1XFZ A;  1H26 B;  1D3U B;  3WV2 A;  2I47 A;  4CFV B;  5HBE B;  2OXZ A;  1JAN A;  2DXB B;  4IMY B;  3P24 A;  1IAD A;  4F70 B;  1AF0 A;  1BU2 A;  3BHU B;  2DW0 A;  3EDI A;  4GR8 A;  3MA2 A;  3NDQ A;  3QWL A;  1SRP A;  3A8H B;  1OL2 B;  4H84 A;  2PHG A;  2E3X A;  3DTE A;  3KEC A;  3H4C A;  4F6W B;  5L79 A;  4MFD A;  3G42 A;  1EAK A;  1SAT A;  3RTS A;  1UMT A;  2FV9 A;  3F18 A;  966C A;  3QYE A;  2W96 A;  4ELL A;  2CKI A;  4BCN B;  1FKM A;  4BCO B;  1HY7 A;  2D1N A;  1GXD A;  5EJC A;  3TNH B;  2PK2 A;  2POJ A;  1MMP A;  1GKD A;  3LQ0 A;  1D5J A;  3MY1 B;  4DPE A;  1K7Q A;  4BCM B;  4CFW B;  3LUM A;  3TW6 A; 
#chains in the Genus database with same CATH homology
 1PWP A;  4ZGD B;  4AKH A;  1FLS A;  1PWV A;  4JP4 A;  1A85 A;  1JAO A;  1IAG A;  2J0T A;  4G0D A;  3VI1 A;  2E2D A;  1SLM A;  5B5P A;  4GR3 A;  3HBL A;  3B92 A;  4FXY P;  3BG9 A;  4HLQ A;  1BUD A;  3LJG A;  3O64 A;  1SMP A;  2QDJ A;  5I43 A;  3U1R A;  1BUV M;  3ELM A;  2QQ8 A;  2KMG A;  4AXQ A;  2K2G A;  4CTH A;  4GF1 A;  1JH1 A;  1KUF A;  1D8F A;  2BS4 A;  3DTK A;  4GR0 A;  1KUI A;  1Z3J A;  1HV5 A;  4JPA A;  1JKY A;  2OVX A;  4FU4 A;  1SLN A;  2DPP B;  1MMQ A;  1XFY A;  3KME A;  4H2E A;  2WO9 A;  1XUR A;  4G9L A;  3TSK A;  3LJZ A;  2A8H A;  4IN9 A;  2JT5 A;  2DW2 A;  830C A;  1EUB A;  1V29 B;  2SRT A;  2CYZ B;  4HNU A;  3OHO A;  4ZGE B;  4H3X A;  4WKE A;  2USN A;  1GO8 P;  3L0T A;  4L63 A;  1BQQ M;  1D7X A;  1HTD A;  2JNP A;  4H82 A;  3HDA P;  3LUN A;  3X24 B;  4HL4 A;  2X3B A;  3WVE B;  5BPA A;  5D2B A;  2WJ9 A;  4PKR A;  2ERQ A;  5CXA A;  2BS3 A;  1RM8 A;  3EDH A;  3VKH A;  1YOU A;  4GUY A;  3KEJ A;  1G05 A;  1I1I P;  5D1S A;  3QXE B;  4PKS A;  1UGQ B;  3F15 A;  4BBR M;  4BBS M;  2MLS A;  4ZR5 A;  4OB1 B;  2TCL A;  3EDG A;  4OB2 B;  3EWJ A;  1E7P A;  1BIW A;  3HZJ A;  4GWN A;  3TVC A;  4DD8 A;  1IAE A;  2O3E A;  1UEA A;  2W13 A;  1PWQ A;  3KMC A;  3EDZ A;  1H71 P;  3HHT B;  3CKI A;  1YQY A;  1KUG A;  4L19 A;  1MNC A;  1OMJ A;  1XFV A;  1FBL A;  1G4K A;  2OW9 A;  2W15 A;  2Y6C A;  1XFX A;  2JIH A;  3LIK A;  1GE6 A;  1USN A;  4AUO A;  1ZP5 A;  2AIG P;  5CZM A;  4A3W A;  1XUC A;  4ZGJ B;  3TT4 A;  1KUK A;  1R55 A;  3LEA A;  3P1V A;  2ZPH B;  4OB3 B;  3HY7 A;  3UVC A;  3SHI A;  3LQB A;  1CGL A;  1IRE B;  1L6J A;  3KHI A;  4XBH A;  2CZ7 B;  5I4O A;  3AYU A;  1HOV A;  5H8X A;  4AKI A;  4HX3 A;  1DTH A;  4PKV A;  3X26 B;  1ZS0 A;  3AIG A;  2JT6 A;  3HY9 A;  3LE9 A;  1FM1 A;  3Q2G A;  1DMT A;  3LIL A;  1XFW A;  1IAC A;  3F17 A;  1UGR B;  1XFU A;  2O36 A;  1OS9 A;  4AIG A;  4WF6 A;  4M6V A;  1QJJ A;  2DD5 B;  2OY4 A;  2YB9 A;  2JSD A;  3DTI A;  3K7N A;  4XCT A;  2W0D A;  3WV3 A;  3WVD B;  3BA0 A;  3QYG B;  1R1J A;  5I2Z A;  3A8G B;  3LIR A;  3A8L B;  1BQO A;  3LJT A;  1C8T A;  3G5C A;  1JIW P;  3I7I A;  3QZ9 B;  1R54 A;  2ERP A;  2D0Q B;  2W14 A;  3KRY A;  1GKC A;  1CGF A;  1OM7 A;  4QSH A;  3USN A;  1OS2 A;  3Q2H A;  2CLT A;  5JMY A;  3QZ5 B;  4PKW A;  1ND1 A;  1ZXC A;  4JQG A;  4GWM A;  1S4B P;  3RTT A;  3TS4 A;  4JIJ A;  1J7N A;  2OW2 A;  2MZE A;  1C3I A;  4I35 A;  3DL1 A;  4IJO A;  2DW1 A;  1CQR A;  1QIC A;  2DDY A;  4AKG A;  2ERO A;  4PKQ A;  2Z2D A;  2K9C A;  2RJQ A;  1CIZ A;  1G9K A;  1BKC A;  2ZPB B;  4XM7 A;  1MMR A;  1SU3 A;  4AI6 A;  2CZ0 B;  2W12 A;  4WZV A;  3WV1 A;  2MZH A;  2ZZD B;  2PJT A;  2DDF A;  2OI0 A;  3EHY A;  5L7F A;  4MIM A;  3AYK A;  1GE5 A;  1BM6 A;  1CAQ A;  4J4M A;  1KBC A;  3DSL A;  1PWU A;  1UMS A;  1K7I A;  1QIA A;  1I73 A;  1WNI A;  1CXV A;  4FM4 B;  4HMA A;  1AYK A;  4H49 A;  3VKG A;  1O0T A;  1Y8J A;  2OZR A;  5I0L A;  3VTG A;  2CZ1 B;  1IAB A;  1BZS A;  3OHL A;  2OY2 A;  1R1I A;  4FXQ A;  4HNT A;  2FV5 A;  1JAQ A;  2KRJ A;  3VYH B;  4ELJ A;  4JX4 A;  3QYB A;  4FVL A;  1IAA A;  3HYG A;  1GE7 A;  2OXU A;  1QIB A;  4H76 A;  5LAB A;  5BOY A;  3VYG B;  1UTT A;  3BG3 A;  3KEK A;  1KUH A;  2AYK A;  2X7M A;  3ZVS A;  3O2X A;  1I76 A;  2Y6D A;  3ZUK A;  3HBU P;  3EHX A;  1QJI A;  3N2V A;  3DPE A;  4L6T A;  1BKC I;  2D1O A;  2DXC B;  3NX7 A;  2CZ6 B;  4L7A A;  4PKT A;  2L0R A;  1D8M A;  4DF9 A;  3X20 B;  2J83 A;  1MMB A;  2ZPE B;  3B2Z A;  1ZTQ A;  3B8Z A;  2MZI A;  3LMC A;  5D1T A;  1Q3A A;  1G12 A;  3A8M B;  1BSW A;  4XM6 A;  1XUD A;  2XS3 A;  3ZXH A;  4JX6 A;  2AHJ B;  4JA1 A;  2YUF A;  3V96 B;  2QFZ A;  1KAP P;  1OM6 A;  2MLR A;  3DWB A;  2OW0 A;  4Q1L A;  3BG5 A;  1EB6 A;  4IUW A;  2ZPF B;  4HNV A;  1JJ9 A;  1GO7 P;  1QUA A;  1AKL A;  1ZXV A;  2KR6 A;  3F19 A;  1YP1 A;  3A8O B;  4H1Q A;  1CGE A;  4XM8 A;  1G49 A;  1BKC E;  2OVZ A;  1AHJ B;  4WKI A;  4GQL A;  3HB9 A;  2YIG A;  1A86 A;  2OW1 A;  3TW7 A;  2QF7 A;  4ON1 A;  5BOT A;  3LKA A;  4EFS A;  4ILW D;  2BS2 A;  4AYK A;  4JX5 A;  4LOC A;  4QKZ A;  456C A;  1O0Q A;  4DV8 A;  2QPJ A;  2X3C A;  4H30 A;  4A7B A;  1JK3 A;  2QDY B;  1UGS B;  5D1U A;  4WK7 A;  2ZPG B;  3X28 B;  1OM8 A;  1YCM A;  2WO8 A;  2ZCF B;  3HDB A;  2N8R A;  1K7G A;  3F1A A;  2ZPI B;  3HO8 A;  2XS4 A;  3DPF A;  5B5O A;  3LK8 A;  1PWW A;  1B8Y A;  3K7L A;  5D7W A;  3E8R A;  4PKU A;  4Z6Y A;  2WOA A;  5CUH A;  3F16 A;  3I7G A;  5I3M A;  1UGP B;  1Y0V A;  4R3V A;  1R1H A;  1Y93 A;  1ROS A;  1OO9 A;  1AST A;  1RMZ A;  1ZVX A;  1QLB A;  2OXW A;  3N2U A;  2DD4 B;  1HFS A;  2HU6 A;  3QYH B;  2G77 A;  4MFE A;  1CK7 A;  3GBO A;  1ATL A;  2X3A A;  1C7K A;  3LGP A;  2RJP A;  1UTZ A;  5I12 A;  4OB0 B;  5D3C A;  3DNG A;  3X25 B;  1HFC A;  4I03 A;  4NC6 A;  2V4B A;  1JIZ A;  3L0V A;  3KWV C;  1JAP A;  1B3D A;  3HBV P;  3HB2 P;  1XFZ A;  3WV2 A;  2I47 A;  2OXZ A;  1JAN A;  2DXB B;  3P24 A;  1IAD A;  1AF0 A;  4GR8 A;  2DW0 A;  3EDI A;  3MA2 A;  3QWL A;  1SRP A;  3A8H B;  4H84 A;  2E3X A;  3DTE A;  3KEC A;  3H4C A;  5L79 A;  4MFD A;  3G42 A;  1EAK A;  1SAT A;  3RTS A;  1UMT A;  2FV9 A;  3F18 A;  966C A;  3QYE A;  2CKI A;  1FKM A;  1HY7 A;  2D1N A;  1GXD A;  5EJC A;  2POJ A;  1MMP A;  1GKD A;  3LQ0 A;  1D5J A;  4DPE A;  1K7Q A;  3LUM A;  3TW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...