3KHIA

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
223
Chain Sequence
AEMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFGLVHNQRVVQQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRNGDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 74
structure length 223
sequence length 238
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3khiA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3khiA02
1XFYA 4G0DA 3ELMA 1K7IA 4JA1A 4FVLA 3WV3A 2WO8A 2MLRA 4IJOA 3HDBA 1RMZA 3V96B 4H49A 3G5CA 1MMQA 2Y6CA 3LE9A 4HMAA 3L0TA 1GE5A 3E8RA 1MNCA 1DMTA 1A86A 2DW2A 3LKAA 1XFXA 1ZTQA 1I76A 2L0RA 4AIGA 4JP4A 1IACA 3DSLA 3UVCA 3EWJA 1BUVM 1Y93A 1FBLA 2W0DA 4A3WA 3ZXHA 4PKVA 3CKIA 3WV1A 4IUWA 1Y0VA 1XUCA 5L79A 1QIBA 1R55A 1ZXCA 1BIWA 2X7MA 1HOVA 2OW0A 2OZRA 1D7XA 1K7QA 1HFCA 1OO9A 3DPFA 4XBHA 2W15A 1Q3AA 3LQBA 4H76A 3RTSA 1BM6A 3B92A 3GBOA 3G42A 2OXWA 2J0TA 2JNPA 4EFSA 1KUIA 3OHOA 3Q2GA 3LUMA 5D3CA 5I3MA 2SRTA 1SATA 1CAQA 3F1AA 4H3XA 1HTDA 3AYUA 3I7IA 5CZMA 3KECA 4A7BA 1BQOA 3KMEA 1YCMA 3NX7A 1UTZA 1Z3JA 1JJ9A 4GR8A 4I35A 1QJJA 1GO8P 1IAGA 1UMSA 1PWUA 1G05A 2D1NA 3LIRA 1CQRA 1C7KA 3HBUP 2X3AA 3DWBA 1J7NA 1JH1A 4IN9A 3ZUKA 2OVXA 2TCLA 1ROSA 1CK7A 3F15A 1GE6A 2DW0A 2OW9A 3EDIA 1ND1A 2YIGA 1IAAA 3F17A 5H8XA 1YOUA 1CGEA 3N2VA 1YQYA 4FXYP 1GKDA 3HY9A 1JIZA 4ON1A 1GE7A 3TS4A 4AXQA 1YP1A 4GF1A 1AF0A 1QIAA 1UTTA 3LUNA 1BUDA 1FM1A 2FV5A 4GUYA 3LGPA 4AUOA 2JSDA 3KRYA 2D1OA 2W14A 2JT5A 2MLSA 2Y6DA 1AYKA 1PWQA 4WF6A 4XM6A 1SRPA 1O0TA 2OW1A 4ILWD 2XS4A 2O36A 1L6JA 1EB6A 4XM8A 1QJIA 1HV5A 2OY4A 1O0QA 4JPAA 3LK8A 1JAQA 2CKIA 3VTGA 1R1IA 1G49A 3HYGA 1OMJA 2K9CA 3O2XA 3KEJA 1HFSA 3TT4A 4WKEA 1C3IA 966CA 4PKWA 1ATLA 456CA 1SMPA 1XUDA 1R54A 1OM7A 2AYKA 2QPJA 5I12A 2EROA 3KMCA 3DL1A 4CTHA 1SLNA 2N8RA 3WV2A 2JIHA 2K2GA 2I47A 3EDZA 3KEKA 1SLMA 1CGLA 3B8ZA 1CIZA 3I7GA 1ZS0A 3OHLA 5D2BA 5D1SA 3O64A 3EDGA 1MMRA 3N2UA 2E2DA 2RJPA 2V4BA 4GQLA 4H1QA 3P24A 1HY7A 5BOYA 3LIKA 1K7GA 2USNA 1PWPA 3F19A 3LJGA 1XFWA 1D8MA 3Q2HA 2POJA 3K7NA 3AIGA 1JAOA 1OS9A 4DF9A 1RM8A 1WNIA 2Z2DA 3EHYA 4J4MA 5D1UA 1OS2A 2MZIA 4H82A 1BSWA 3F16A 1D8FA 4L63A 5B5OA 2AIGP 5L7FA 1BKCI 1R1HA 4XCTA 2ERQA 3TSKA 5BOTA 2KRJA 3HB2P 5I43A 4DD8A 5B5PA 5BPAA 1JIWP 1IAEA 4G9LA 1FLSA 2A8HA 1OM8A 2OY2A 4PKTA 1XFZA 3LJTA 2W12A 1BZSA 4GR0A 1UMTA 2DDFA 3U1RA 5CUHA 1XFVA 3EDHA 4PKUA 4Q1LA 1MMBA 3ZVSA 3LQ0A 1I1IP 1JANA 3SHIA 2X3BA 4L19A 1USNA 1IABA 1C8TA 1Y8JA 1KUFA 4WK7A 1BQQM 1G9KA 2PJTA 1G12A 3KHIA 4FXQA 2MZEA 3F18A 4GWNA 1G4KA 4H30A 1I73A 1DTHA 4FU4A 2OVZA 5I4OA 1KBCA 2E3XA 2OW2A 4WZVA 4PKSA 3P1VA 4DPEA 1ZXVA 2X3CA 5I2ZA 3HY7A 1BKCE 3KWVC 3LEAA 1CGFA 1XURA 2JT6A 2ERPA 1S4BP 2WO9A 1GXDA 4I03A 1BKCA 4XM7A 4QKZA 3LJZA 4L6TA 1GKCA 2MZHA 3DNGA 1KUKA 4GR3A 5I0LA 5JMYA 2YB9A 4AYKA 1KUHA 4HX3A 4ZR5A 4JQGA 3USNA 1SU3A 2WOAA 3RTTA 1PWWA 2J83A 3LMCA 1D5JA 1JK3A 3TVCA 3VI1A 1CXVA 3HDAP 4JIJA 1OM6A 1JAPA 2OXUA 1XFUA 2DDYA 2CLTA 2OI0A 2HU6A 3L0VA 2W13A 1ZVXA 5CXAA 4PKQA 1B8YA 3AYKA 3HBVP 5D1TA 5D7WA 2RJQA 4DV8A 1JKYA 3BA0A 1KAPP 3K7LA 3MA2A 1QICA 4PKRA 2OXZA 3EHXA 1GO7P 2FV9A 1AKLA 1H71P 1UEAA 3LILA 1QUAA 4H84A 1KUGA 1EAKA 3DPEA 1A85A 4GWMA 1B3DA 2XS3A 5LABA 1IADA 2DW1A 1PWVA 1ZP5A 4H2EA 1ASTA 1MMPA 3B2ZA 1R1JA 2O3EA 830CA 4WKIA 1EUBA 4R3VA
chains in the Genus database with same CATH superfamily
2QDJA 3H4CA 1XFYA 4G0DA 3ELMA 1K7IA 4JA1A 2QQ8A 2CCHB 4FVLA 3WV3A 1UNGD 2PMIB 2WO8A 2MLRA 4IJOA 3HDBA 4MIMA 1RMZA 3V96B 4H49A 3G5CA 2I53A 1MMQA 4CXAB 3BLHB 5HBEB 2Y6CA 3LE9A 4HMAA 3L0TA 1GE5A 1BU2A 4OB0B 3E8RA 1MNCA 1VYWB 2F2CA 2IW8B 5IHYA 2DXCB 2UZLB 1DMTA 3NDQA 1A86A 2QGSA 3BLQB 2DW2A 3LKAA 1KXUA 4KRCB 4BBRM 4EOLB 4EC9B 5LQFB 1XFXA 1ZTQA 2ZPFB 2BS2A 1I76A 2L0RA 4AIGA 4JP4A 4F7SB 1IACA 2WHBB 4FX3B 3DSLA 2ZZDB 3UVCA 3EWJA 2YUFA 1XAXA 4EORB 4CFXB 1BUVM 1Y93A 1FBLA 2W0DA 4A3WA 1UGPB 3ZXHA 2WJ9A 2CYZB 4PKVA 1TFBA 4BY1X 3CKIA 3WV1A 4IUWA 4Z6YA 5DQVA 1N4MA 5CEIB 4F7JB 1Y0VA 1XUCA 5L79A 1QIBA 1R55A 1JSUB 1ZXCA 1BIWA 5EFQB 2X7MA 2UZBB 5IF1B 1HOVA 2OW0A 2OZRA 1D7XA 1K7QA 1HFCA 4OR5B 4EONB 1OO9A 3DPFA 4XBHA 2W15A 1Q3AA 3LQBA 1UNHD 4H76A 3RTSA 1BM6A 3BG5A 3B92A 3GBOA 1VOLA 3G42A 2OXWA 4BCMD 4YC3B 2UUEB 2J0TA 2JNPA 4EFSA 1KUIA 3OHOA 3Q2GA 3LUMA 5D3CA 5I3MA 2SRTA 1SATA 1CAQA 2CJMB 3VKHA 3F1AA 4H3XA 1HTDA 3AYUA 1C9BA 2DPPB 3I7IA 5CZMA 3KECA 4A7BA 4CRLB 1BQOA 3KMEA 4F6UB 1YCMA 3NX7A 1UTZA 1Z3JA 2ZPEB 1JJ9A 4GR8A 1D3UB 4I35A 1QJJA 1H24B 4G6LB 1GO8P 1IAGA 5HVYB 1UMSA 1PWUA 4AI6A 1G05A 1AISB 2D1NA 4CFMB 3LIRA 1CQRA 1C7KA 3HBUP 5CYIB 2X3AA 2CZ0B 1J7NA 1JH1A 3DWBA 3WVEB 2W99A 4IN9A 3ZUKA 1QMZB 5HQ0B 2OVXA 1OL1B 2TCLA 4BCQD 1UGRB 4LOCA 3QHWB 1ROSA 1CK7A 3TW7A 3F15A 2DMEA 1O9KA 1GE6A 2WMAB 2W9ZA 2DW0A 2OW9A 3A8MB 1ENWA 3EDIA 2C6TB 1ND1A 2YIGA 1FVVB 1IAAA 4YOOA 2UZEB 1UGSB 4ZGJB 2BPMB 3F17A 4BBSM 1YOUA 5H8XA 1AHJB 1CGEA 2ZPGB 4CFVB 3N2VA 1YQYA 2C4GB 4FXYP 3DTIA 1GKDA 3WVDB 1OI9B 4EOMB 3HY9A 3MY5B 1JIZA 4ON1A 1GE7A 3TS4A 2CZ6B 4AXQA 1YP1A 4GF1A 1AF0A 1QIAA 1UTTA 3LUNA 1UNLD 1BUDA 3LQ5B 4JX5A 4HNUA 5IDPB 4BCIB 3DJBA 1FM1A 3HHTB 2FV5A 4MFDA 4GUYA 4YOZA 4BCKB 3LGPA 4AUOA 4II5B 2JSDA 3KRYA 4L7AA 2D1OA 2G9XB 2W14A 2JT5A 4OGRB 2MLSA 2JGZB 2Y6DA 1AYKA 1O9KB 1PWQA 4WF6A 3QYBA 4Y72B 4EOQB 1H1SB 4XM6A 1SRPA 1O0TA 2OW1A 2W9FA 2XS4A 2O36A 1L6JA 1EB6A 4ILWD 2PHGA 4XM8A 1QJIA 1HV5A 2OY4A 1JOWA 3O0GD 1O0QA 3QXEB 4JPAA 3TNHB 3LK8A 1JAQA 2CKIA 3VTGA 1R1IA 1G49A 3HYGA 1OMJA 2K9CA 3O2XA 3KEJA 1H25B 1HFSA 2R7GA 4BCFB 3TT4A 4WKEA 3X24B 1C3IA 5L2WB 2W96A 966CA 4PKWA 1ATLA 4HNTA 3VKGA 456CA 1SMPA 1XUDA 4NSTB 1R54A 1OM7A 4CFNB 1V29B 2AYKA 2QPJA 5I12A 3K7AM 2EROA 4CFUD 5I5ZB 3KMCA 3DL1A 4CTHA 4OB2B 1SLNA 2N8RA 3WV2A 2IVXA 4AKGA 2JIHA 2K2GA 2I47A 3EDZA 1UGQB 1QLBA 3QYHB 5EJCA 1SLMA 1CGLA 3KEKA 2D0QB 2CZ1B 4F6WB 3B8ZA 1CIZA 3I7GA 2DD4B 4BCJB 1FKMA 1ZS0A 4M6VA 1OIYB 2CZ7B 3OHLA 5HBJB 5ACBA 4MFEA 3QZ5B 3MI9B 5D2BA 2PK2A 4OB1B 1H26B 3O64A 2I40B 5D1SA 4RODA 3EDGA 3MY1B 1MMRA 3N2UA 5LMKB 2E2DA 2RJPA 2V4BA 3GTMS 4IMYB 4GQLA 4H1QA 3POMA 3BHUB 1VINA 4FM4B 3P24A 1HY7A 5BOYA 3LIKA 3G33B 1K7GA 2USNA 1PWPA 3BG9A 2WEVB 3HBLA 4BCNB 3F19A 3LJGA 1XFWA 3TNWB 1D8MA 3BLRB 1OKWB 3Q2HA 3X28B 2POJA 3K7NA 3AIGA 3BHVB 1XO2A 2WIHB 1JAOA 2DD5B 1OS9A 4DF9A 1OL2B 1E9HB 1RM8A 1WNIA 2Z2DA 2WXVB 3EHYA 4J4MA 1E7PA 5D1UA 1OS2A 3PO3S 2MZIA 4H82A 1BSWA 3F16A 1D8FA 1IREB 1URCB 4BCHB 4L63A 5B5OA 2AIGP 5L7FA 1BKCI 1R1HA 2IN3A 2ERQA 4XCTA 3TSKA 5BOTA 1H1QB 4EOKB 1TVIA 2KRJA 4EOSB 3HB2P 5I43A 4DD8A 1H4LD 5B5PA 5BPAA 1AD6A 1JIWP 1IAEA 3A8HB 3QWLA 4F70B 4G9LA 2DXBB 4ELJA 5HNBB 4HLQA 1FLSA 2A8HA 4HL4A 2BS4A 1OM8A 2OY2A 4PKTA 2B9RA 1XFZA 1JSTB 3LJTA 2V22B 4BY7X 2W12A 3X25B 3TNIB 4EC8B 4BCQB 1BZSA 4GR0A 4HNVA 3HZJA 1UMTA 2ZCFB 2DDFA 3U1RA 5CUHA 1XFVA 4KRDB 4ZGDB 2C5OB 3EDHA 4PKUA 4Q1LA 3A8LB 3BG3A 1MMBA 3ZVSA 3LQ0A 1I1IP 1JANA 2ZPBB 3HO8A 3A8OB 1ZP2A 4BCGB 3SHIA 2X3BA 4EOJB 2EUFA 4L19A 4ROEA 3QYGB 2C5XB 1USNA 1IABA 3DTKA 1C8TA 1Y8JA 1KUFA 4WK7A 1BQQM 1G9KA 2PJTA 3M03A 4EOPB 1G12A 4F7LB 3KHIA 3DTEA 3VYGB 4I3ZB 4FXQA 2MZEA 3F18A 1H28B 4GWNA 2ZPHB 1G4KA 4H30A 4TTHA 1I73A 4EOOB 1W98B 2PK9B 1DTHA 2IW6B 3TW6A 4FU4A 2OVZA 5I4OA 3QYEA 1KBCA 2E3XA 4QSHA 1OZ9A 2OW2A 4WZVA 5IDNB 1H1RB 4PKSA 2X1NB 3P1VA 1JKWA 2QDYB 4DPEA 1ZXVA 2X3CA 3TN8B 3EOCB 5I2ZA 2C5VB 4EOIB 3HY7A 1BKCE 3X26B 4BXXX 2WFYB 3HB9A 3KWVC 3EIDB 3LEAA 1FINB 3VYHB 1CGFA 4YOSA 1XURA 2LW4A 2WIPB 4ZGEB 4JX4A 2ERPA 2JT6A 1S4BP 4BCND 1GXDA 2WO9A 1BKCA 4I03A 2WMBB 4QKZA 4XM7A 3LJZA 4L6TA 1GKCA 2MZHA 3DNGA 1KUKA 4GR3A 5I0LA 5JMYA 4CFUB 2YB9A 4AYKA 3A8GB 1KUHA 4OB3B 2PJQA 1PKDB 2W2HA 4HX3A 4ZR5A 4JQGA 3USNA 1SU3A 4F6SB 2WOAA 3RTTA 1PWWA 2J83A 3LMCA 2ZPIB 4BCOB 4AKHA 1D5JA 1JK3A 3TVCA 3VI1A 1CXVA 3HDAP 4BCMB 1F5QB 4AKIA 1OM6A 4JIJA 1JAPA 2OXUA 1XFUA 2DDYA 1GUXA 3MIAB 2CLTA 1XM5A 2OI0A 2BKZB 4BCPB 2IW9B 2HU6A 4JX6A 1OGUB 3L0VA 3RGFB 2W13A 1ZVXA 2C5NB 3X20B 5DQWA 2KMGA 5CXAA 4F7NB 5ICPB 1B8YA 4PKQA 1H27B 4NC6A 5HBHB 3AYKA 2BS3A 3HBVP 5D1TA 5D7WA 2RJQA 4DV8A 1H1PB 1JKYA 3BA0A 4CFWB 3F5XB 1KAPP 3K7LA 2UZDB 3DDPB 3B57A 2WPAB 3MA2A 1QICA 3QZ9B 2QF7A 4PKRA 2OXZA 3EHXA 1TD6A 1GO7P 2FV9A 2KR6A 1AKLA 1OIUB 1H71P 4ELLA 1UEAA 1G3NC 3LILA 1QUAA 4H84A 3DDQB 1KUGA 1EAKA 2AHJB 3QHRB 4ROCA 1A85A 3DPEA 4GWMA 2QFZA 1B3DA 2XS3A 5LABA 1IADA 1GY3B 3EJ1B 3DOGB 2DW1A 3BHTB 4UN0A 1GUXB 2G77A 1P5EB 1PWVA 1ZP5A 4H2EA 1ASTA 5BNJB 5FGKB 1GH6B 2CCIB 1MMPA 3B2ZA 1R1JA 2O3EA 830CA 3DTOA 4WKIA 1OKVB 1EUBA 4R3VA
chains in the Genus database with same CATH topology
2QDJA 3H4CA 1XFYA 4G0DA 3ELMA 1K7IA 4JA1A 2QQ8A 4FVLA 3WV3A 2WO8A 2MLRA 4IJOA 3HDBA 4MIMA 1RMZA 3V96B 4H49A 3G5CA 1MMQA 2Y6CA 3LE9A 4HMAA 3L0TA 1GE5A 4OB0B 3E8RA 1MNCA 2DXCB 1DMTA 1A86A 2DW2A 3LKAA 4BBRM 1XFXA 1ZTQA 2ZPFB 2BS2A 1I76A 2L0RA 4AIGA 4JP4A 1IACA 3DSLA 2ZZDB 3UVCA 3EWJA 2YUFA 1BUVM 1Y93A 1FBLA 2W0DA 4A3WA 1UGPB 3ZXHA 2WJ9A 2CYZB 4PKVA 3CKIA 3WV1A 4IUWA 4Z6YA 1Y0VA 1XUCA 5L79A 1QIBA 1R55A 1ZXCA 1BIWA 2X7MA 1HOVA 2OW0A 2OZRA 1D7XA 1K7QA 1HFCA 1OO9A 3DPFA 4XBHA 2W15A 1Q3AA 3LQBA 4H76A 3RTSA 1BM6A 3BG5A 3B92A 3GBOA 3G42A 2OXWA 2J0TA 2JNPA 4EFSA 1KUIA 3OHOA 3Q2GA 3LUMA 5D3CA 5I3MA 2SRTA 1SATA 1CAQA 3VKHA 3F1AA 4H3XA 1HTDA 3AYUA 2DPPB 3I7IA 5CZMA 3KECA 4A7BA 1BQOA 3KMEA 1YCMA 3NX7A 1UTZA 1Z3JA 2ZPEB 1JJ9A 4GR8A 4I35A 1QJJA 1GO8P 1IAGA 1UMSA 1PWUA 4AI6A 1G05A 2D1NA 3LIRA 1CQRA 1C7KA 3HBUP 2X3AA 2CZ0B 1J7NA 1JH1A 3DWBA 3WVEB 4IN9A 3ZUKA 2OVXA 2TCLA 1UGRB 4LOCA 1ROSA 1CK7A 3TW7A 3F15A 1GE6A 2DW0A 2OW9A 3A8MB 3EDIA 1ND1A 2YIGA 1IAAA 4ZGJB 1UGSB 3F17A 4BBSM 1YOUA 5H8XA 1AHJB 1CGEA 2ZPGB 3N2VA 1YQYA 4FXYP 3DTIA 1GKDA 3WVDB 3HY9A 1JIZA 4ON1A 1GE7A 3TS4A 2CZ6B 4AXQA 1YP1A 4GF1A 1AF0A 1QIAA 1UTTA 3LUNA 1BUDA 4JX5A 4HNUA 1FM1A 3HHTB 2FV5A 4MFDA 4GUYA 3LGPA 4AUOA 2JSDA 3KRYA 4L7AA 2D1OA 2W14A 2JT5A 2MLSA 2Y6DA 1AYKA 1PWQA 4WF6A 3QYBA 4XM6A 1SRPA 1O0TA 2OW1A 4ILWD 2XS4A 2O36A 1L6JA 1EB6A 4XM8A 1QJIA 1HV5A 2OY4A 1O0QA 4JPAA 3QXEB 3LK8A 1JAQA 2CKIA 3VTGA 1R1IA 1G49A 3HYGA 1OMJA 2K9CA 3O2XA 3KEJA 1HFSA 3TT4A 4WKEA 3X24B 1C3IA 966CA 4PKWA 1ATLA 4HNTA 3VKGA 456CA 1SMPA 1XUDA 1R54A 1OM7A 1V29B 2AYKA 2QPJA 5I12A 2EROA 3KMCA 3DL1A 4CTHA 4OB2B 1SLNA 2N8RA 3WV2A 2JIHA 4AKGA 2K2GA 2I47A 3EDZA 1UGQB 1QLBA 3QYHB 5EJCA 1SLMA 1CGLA 3KEKA 2D0QB 2CZ1B 3B8ZA 1CIZA 3I7GA 2DD4B 1FKMA 1ZS0A 4M6VA 2CZ7B 3OHLA 4MFEA 3QZ5B 5D2BA 5D1SA 4OB1B 3O64A 3EDGA 1MMRA 3N2UA 2E2DA 2RJPA 2V4BA 4GQLA 4H1QA 4FM4B 3P24A 1HY7A 5BOYA 3LIKA 1K7GA 2USNA 1PWPA 3BG9A 3HBLA 3F19A 3LJGA 1XFWA 1D8MA 3Q2HA 3X28B 2POJA 3K7NA 3AIGA 1JAOA 2DD5B 1OS9A 4DF9A 1RM8A 1WNIA 2Z2DA 3EHYA 4J4MA 1E7PA 5D1UA 1OS2A 2MZIA 4H82A 1BSWA 3F16A 1D8FA 1IREB 4L63A 5B5OA 2AIGP 5L7FA 1BKCI 1R1HA 4XCTA 2ERQA 3TSKA 5BOTA 2KRJA 3HB2P 5I43A 4DD8A 5B5PA 5BPAA 1JIWP 1IAEA 3A8HB 3QWLA 4G9LA 2DXBB 4ELJA 4HLQA 1FLSA 2A8HA 4HL4A 2BS4A 1OM8A 2OY2A 4PKTA 1XFZA 3LJTA 2W12A 3X25B 1BZSA 4GR0A 4HNVA 3HZJA 1UMTA 2ZCFB 2DDFA 3U1RA 5CUHA 1XFVA 4ZGDB 3EDHA 4PKUA 4Q1LA 3A8LB 3BG3A 1MMBA 3ZVSA 3LQ0A 1I1IP 1JANA 2ZPBB 3HO8A 3A8OB 3SHIA 2X3BA 4L19A 3QYGB 3DTKA 1USNA 1IABA 1C8TA 1Y8JA 1KUFA 4WK7A 1BQQM 1G9KA 2PJTA 1G12A 3KHIA 3DTEA 3VYGB 4FXQA 2MZEA 3F18A 4GWNA 2ZPHB 1G4KA 4H30A 1I73A 1DTHA 3TW6A 4FU4A 2OVZA 5I4OA 3QYEA 1KBCA 2E3XA 4QSHA 2OW2A 4WZVA 4PKSA 3P1VA 2QDYB 4DPEA 1ZXVA 2X3CA 5I2ZA 3HY7A 1BKCE 3X26B 3HB9A 3KWVC 3LEAA 3VYHB 1CGFA 1XURA 4ZGEB 2JT6A 4JX4A 2ERPA 1S4BP 2WO9A 1GXDA 4I03A 1BKCA 4XM7A 4QKZA 3LJZA 4L6TA 1GKCA 2MZHA 3DNGA 1KUKA 4GR3A 5I0LA 5JMYA 2YB9A 4AYKA 3A8GB 1KUHA 4OB3B 4HX3A 4ZR5A 4JQGA 3USNA 1SU3A 2WOAA 3RTTA 1PWWA 2J83A 3LMCA 2ZPIB 4AKHA 1D5JA 1JK3A 3TVCA 3VI1A 1CXVA 3HDAP 4JIJA 4AKIA 1OM6A 1JAPA 2OXUA 1XFUA 2DDYA 2CLTA 2OI0A 2HU6A 4JX6A 3L0VA 2W13A 1ZVXA 3X20B 2KMGA 5CXAA 4PKQA 1B8YA 4NC6A 3AYKA 2BS3A 3HBVP 5D1TA 5D7WA 2RJQA 4DV8A 1JKYA 3BA0A 1KAPP 3K7LA 3MA2A 1QICA 3QZ9B 2QF7A 4PKRA 2OXZA 3EHXA 1GO7P 2FV9A 2KR6A 1AKLA 1H71P 1UEAA 3LILA 1QUAA 4H84A 1KUGA 1EAKA 2AHJB 3DPEA 1A85A 4GWMA 2QFZA 1B3DA 2XS3A 5LABA 1IADA 2DW1A 2G77A 1PWVA 1ZP5A 4H2EA 1ASTA 1MMPA 3B2ZA 1R1JA 2O3EA 830CA 4WKIA 1EUBA 4R3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFY A;  4G0D A;  3ELM A;  1K7I A;  4JA1 A;  4FVL A;  3WV3 A;  2WO8 A;  2MLR A;  4IJO A;  3HDB A;  1RMZ A;  3V96 B;  4H49 A;  3G5C A;  1MMQ A;  2Y6C A;  3LE9 A;  4HMA A;  3L0T A;  1GE5 A;  3E8R A;  1MNC A;  1DMT A;  1A86 A;  2DW2 A;  3LKA A;  1XFX A;  1ZTQ A;  1I76 A;  2L0R A;  4AIG A;  4JP4 A;  1IAC A;  3DSL A;  3UVC A;  3EWJ A;  1BUV M;  1Y93 A;  1FBL A;  2W0D A;  4A3W A;  3ZXH A;  4PKV A;  3CKI A;  3WV1 A;  4IUW A;  1Y0V A;  1XUC A;  5L79 A;  1QIB A;  1R55 A;  1ZXC A;  1BIW A;  2X7M A;  1HOV A;  2OW0 A;  2OZR A;  1D7X A;  1K7Q A;  1HFC A;  1OO9 A;  3DPF A;  4XBH A;  2W15 A;  1Q3A A;  3LQB A;  4H76 A;  3RTS A;  1BM6 A;  3B92 A;  3GBO A;  3G42 A;  2OXW A;  2J0T A;  2JNP A;  4EFS A;  1KUI A;  3OHO A;  3Q2G A;  3LUM A;  5D3C A;  5I3M A;  2SRT A;  1SAT A;  1CAQ A;  3F1A A;  4H3X A;  1HTD A;  3AYU A;  3I7I A;  5CZM A;  3KEC A;  4A7B A;  1BQO A;  3KME A;  1YCM A;  3NX7 A;  1UTZ A;  1Z3J A;  1JJ9 A;  4GR8 A;  4I35 A;  1QJJ A;  1GO8 P;  1IAG A;  1UMS A;  1PWU A;  1G05 A;  2D1N A;  3LIR A;  1CQR A;  1C7K A;  3HBU P;  2X3A A;  3DWB A;  1J7N A;  1JH1 A;  4IN9 A;  3ZUK A;  2OVX A;  2TCL A;  1ROS A;  1CK7 A;  3F15 A;  1GE6 A;  2DW0 A;  2OW9 A;  3EDI A;  1ND1 A;  2YIG A;  1IAA A;  3F17 A;  5H8X A;  1YOU A;  1CGE A;  3N2V A;  1YQY A;  4FXY P;  1GKD A;  3HY9 A;  1JIZ A;  4ON1 A;  1GE7 A;  3TS4 A;  4AXQ A;  1YP1 A;  4GF1 A;  1AF0 A;  1QIA A;  1UTT A;  3LUN A;  1BUD A;  1FM1 A;  2FV5 A;  4GUY A;  3LGP A;  4AUO A;  2JSD A;  3KRY A;  2D1O A;  2W14 A;  2JT5 A;  2MLS A;  2Y6D A;  1AYK A;  1PWQ A;  4WF6 A;  4XM6 A;  1SRP A;  1O0T A;  2OW1 A;  4ILW D;  2XS4 A;  2O36 A;  1L6J A;  1EB6 A;  4XM8 A;  1QJI A;  1HV5 A;  2OY4 A;  1O0Q A;  4JPA A;  3LK8 A;  1JAQ A;  2CKI A;  3VTG A;  1R1I A;  1G49 A;  3HYG A;  1OMJ A;  2K9C A;  3O2X A;  3KEJ A;  1HFS A;  3TT4 A;  4WKE A;  1C3I A;  966C A;  4PKW A;  1ATL A;  456C A;  1SMP A;  1XUD A;  1R54 A;  1OM7 A;  2AYK A;  2QPJ A;  5I12 A;  2ERO A;  3KMC A;  3DL1 A;  4CTH A;  1SLN A;  2N8R A;  3WV2 A;  2JIH A;  2K2G A;  2I47 A;  3EDZ A;  3KEK A;  1SLM A;  1CGL A;  3B8Z A;  1CIZ A;  3I7G A;  1ZS0 A;  3OHL A;  5D2B A;  5D1S A;  3O64 A;  3EDG A;  1MMR A;  3N2U A;  2E2D A;  2RJP A;  2V4B A;  4GQL A;  4H1Q A;  3P24 A;  1HY7 A;  5BOY A;  3LIK A;  1K7G A;  2USN A;  1PWP A;  3F19 A;  3LJG A;  1XFW A;  1D8M A;  3Q2H A;  2POJ A;  3K7N A;  3AIG A;  1JAO A;  1OS9 A;  4DF9 A;  1RM8 A;  1WNI A;  2Z2D A;  3EHY A;  4J4M A;  5D1U A;  1OS2 A;  2MZI A;  4H82 A;  1BSW A;  3F16 A;  1D8F A;  4L63 A;  5B5O A;  2AIG P;  5L7F A;  1BKC I;  1R1H A;  4XCT A;  2ERQ A;  3TSK A;  5BOT A;  2KRJ A;  3HB2 P;  5I43 A;  4DD8 A;  5B5P A;  5BPA A;  1JIW P;  1IAE A;  4G9L A;  1FLS A;  2A8H A;  1OM8 A;  2OY2 A;  4PKT A;  1XFZ A;  3LJT A;  2W12 A;  1BZS A;  4GR0 A;  1UMT A;  2DDF A;  3U1R A;  5CUH A;  1XFV A;  3EDH A;  4PKU A;  4Q1L A;  1MMB A;  3ZVS A;  3LQ0 A;  1I1I P;  1JAN A;  3SHI A;  2X3B A;  4L19 A;  1USN A;  1IAB A;  1C8T A;  1Y8J A;  1KUF A;  4WK7 A;  1BQQ M;  1G9K A;  2PJT A;  1G12 A;  3KHI A;  4FXQ A;  2MZE A;  3F18 A;  4GWN A;  1G4K A;  4H30 A;  1I73 A;  1DTH A;  4FU4 A;  2OVZ A;  5I4O A;  1KBC A;  2E3X A;  2OW2 A;  4WZV A;  4PKS A;  3P1V A;  4DPE A;  1ZXV A;  2X3C A;  5I2Z A;  3HY7 A;  1BKC E;  3KWV C;  3LEA A;  1CGF A;  1XUR A;  2JT6 A;  2ERP A;  1S4B P;  2WO9 A;  1GXD A;  4I03 A;  1BKC A;  4XM7 A;  4QKZ A;  3LJZ A;  4L6T A;  1GKC A;  2MZH A;  3DNG A;  1KUK A;  4GR3 A;  5I0L A;  5JMY A;  2YB9 A;  4AYK A;  1KUH A;  4HX3 A;  4ZR5 A;  4JQG A;  3USN A;  1SU3 A;  2WOA A;  3RTT A;  1PWW A;  2J83 A;  3LMC A;  1D5J A;  1JK3 A;  3TVC A;  3VI1 A;  1CXV A;  3HDA P;  4JIJ A;  1OM6 A;  1JAP A;  2OXU A;  1XFU A;  2DDY A;  2CLT A;  2OI0 A;  2HU6 A;  3L0V A;  2W13 A;  1ZVX A;  5CXA A;  4PKQ A;  1B8Y A;  3AYK A;  3HBV P;  5D1T A;  5D7W A;  2RJQ A;  4DV8 A;  1JKY A;  3BA0 A;  1KAP P;  3K7L A;  3MA2 A;  1QIC A;  4PKR A;  2OXZ A;  3EHX A;  1GO7 P;  2FV9 A;  1AKL A;  1H71 P;  1UEA A;  3LIL A;  1QUA A;  4H84 A;  1KUG A;  1EAK A;  3DPE A;  1A85 A;  4GWM A;  1B3D A;  2XS3 A;  5LAB A;  1IAD A;  2DW1 A;  1PWV A;  1ZP5 A;  4H2E A;  1AST A;  1MMP A;  3B2Z A;  1R1J A;  2O3E A;  830C A;  4WKI A;  1EUB A;  4R3V A; 
#chains in the Genus database with same CATH topology
 2QDJ A;  3H4C A;  1XFY A;  4G0D A;  3ELM A;  1K7I A;  4JA1 A;  2QQ8 A;  2CCH B;  4FVL A;  3WV3 A;  1UNG D;  2PMI B;  2WO8 A;  2MLR A;  4IJO A;  3HDB A;  4MIM A;  1RMZ A;  3V96 B;  4H49 A;  3G5C A;  2I53 A;  1MMQ A;  4CXA B;  3BLH B;  5HBE B;  2Y6C A;  3LE9 A;  4HMA A;  3L0T A;  1GE5 A;  1BU2 A;  4OB0 B;  3E8R A;  1MNC A;  1VYW B;  2F2C A;  2IW8 B;  5IHY A;  2DXC B;  2UZL B;  1DMT A;  3NDQ A;  1A86 A;  2QGS A;  3BLQ B;  2DW2 A;  3LKA A;  1KXU A;  4KRC B;  4BBR M;  4EOL B;  4EC9 B;  5LQF B;  1XFX A;  1ZTQ A;  2ZPF B;  2BS2 A;  1I76 A;  2L0R A;  4AIG A;  4JP4 A;  4F7S B;  1IAC A;  2WHB B;  4FX3 B;  3DSL A;  2ZZD B;  3UVC A;  3EWJ A;  2YUF A;  1XAX A;  4EOR B;  4CFX B;  1BUV M;  1Y93 A;  1FBL A;  2W0D A;  4A3W A;  1UGP B;  3ZXH A;  2WJ9 A;  2CYZ B;  4PKV A;  1TFB A;  4BY1 X;  3CKI A;  3WV1 A;  4IUW A;  4Z6Y A;  5DQV A;  1N4M A;  5CEI B;  4F7J B;  1Y0V A;  1XUC A;  5L79 A;  1QIB A;  1R55 A;  1JSU B;  1ZXC A;  1BIW A;  5EFQ B;  2X7M A;  2UZB B;  5IF1 B;  1HOV A;  2OW0 A;  2OZR A;  1D7X A;  1K7Q A;  1HFC A;  4OR5 B;  4EON B;  1OO9 A;  3DPF A;  4XBH A;  2W15 A;  1Q3A A;  3LQB A;  1UNH D;  4H76 A;  3RTS A;  1BM6 A;  3BG5 A;  3B92 A;  3GBO A;  1VOL A;  3G42 A;  2OXW A;  4BCM D;  4YC3 B;  2UUE B;  2J0T A;  2JNP A;  4EFS A;  1KUI A;  3OHO A;  3Q2G A;  3LUM A;  5D3C A;  5I3M A;  2SRT A;  1SAT A;  1CAQ A;  2CJM B;  3VKH A;  3F1A A;  4H3X A;  1HTD A;  3AYU A;  1C9B A;  2DPP B;  3I7I A;  5CZM A;  3KEC A;  4A7B A;  4CRL B;  1BQO A;  3KME A;  4F6U B;  1YCM A;  3NX7 A;  1UTZ A;  1Z3J A;  2ZPE B;  1JJ9 A;  4GR8 A;  1D3U B;  4I35 A;  1QJJ A;  1H24 B;  4G6L B;  1GO8 P;  1IAG A;  5HVY B;  1UMS A;  1PWU A;  4AI6 A;  1G05 A;  1AIS B;  2D1N A;  4CFM B;  3LIR A;  1CQR A;  1C7K A;  3HBU P;  5CYI B;  2X3A A;  2CZ0 B;  1J7N A;  1JH1 A;  3DWB A;  3WVE B;  2W99 A;  4IN9 A;  3ZUK A;  1QMZ B;  5HQ0 B;  2OVX A;  1OL1 B;  2TCL A;  4BCQ D;  1UGR B;  4LOC A;  3QHW B;  1ROS A;  1CK7 A;  3TW7 A;  3F15 A;  2DME A;  1O9K A;  1GE6 A;  2WMA B;  2W9Z A;  2DW0 A;  2OW9 A;  3A8M B;  1ENW A;  3EDI A;  2C6T B;  1ND1 A;  2YIG A;  1FVV B;  1IAA A;  4YOO A;  2UZE B;  1UGS B;  4ZGJ B;  2BPM B;  3F17 A;  4BBS M;  1YOU A;  5H8X A;  1AHJ B;  1CGE A;  2ZPG B;  4CFV B;  3N2V A;  1YQY A;  2C4G B;  4FXY P;  3DTI A;  1GKD A;  3WVD B;  1OI9 B;  4EOM B;  3HY9 A;  3MY5 B;  1JIZ A;  4ON1 A;  1GE7 A;  3TS4 A;  2CZ6 B;  4AXQ A;  1YP1 A;  4GF1 A;  1AF0 A;  1QIA A;  1UTT A;  3LUN A;  1UNL D;  1BUD A;  3LQ5 B;  4JX5 A;  4HNU A;  5IDP B;  4BCI B;  3DJB A;  1FM1 A;  3HHT B;  2FV5 A;  4MFD A;  4GUY A;  4YOZ A;  4BCK B;  3LGP A;  4AUO A;  4II5 B;  2JSD A;  3KRY A;  4L7A A;  2D1O A;  2G9X B;  2W14 A;  2JT5 A;  4OGR B;  2MLS A;  2JGZ B;  2Y6D A;  1AYK A;  1O9K B;  1PWQ A;  4WF6 A;  3QYB A;  4Y72 B;  4EOQ B;  1H1S B;  4XM6 A;  1SRP A;  1O0T A;  2OW1 A;  2W9F A;  2XS4 A;  2O36 A;  1L6J A;  1EB6 A;  4ILW D;  2PHG A;  4XM8 A;  1QJI A;  1HV5 A;  2OY4 A;  1JOW A;  3O0G D;  1O0Q A;  3QXE B;  4JPA A;  3TNH B;  3LK8 A;  1JAQ A;  2CKI A;  3VTG A;  1R1I A;  1G49 A;  3HYG A;  1OMJ A;  2K9C A;  3O2X A;  3KEJ A;  1H25 B;  1HFS A;  2R7G A;  4BCF B;  3TT4 A;  4WKE A;  3X24 B;  1C3I A;  5L2W B;  2W96 A;  966C A;  4PKW A;  1ATL A;  4HNT A;  3VKG A;  456C A;  1SMP A;  1XUD A;  4NST B;  1R54 A;  1OM7 A;  4CFN B;  1V29 B;  2AYK A;  2QPJ A;  5I12 A;  3K7A M;  2ERO A;  4CFU D;  5I5Z B;  3KMC A;  3DL1 A;  4CTH A;  4OB2 B;  1SLN A;  2N8R A;  3WV2 A;  2IVX A;  4AKG A;  2JIH A;  2K2G A;  2I47 A;  3EDZ A;  1UGQ B;  1QLB A;  3QYH B;  5EJC A;  1SLM A;  1CGL A;  3KEK A;  2D0Q B;  2CZ1 B;  4F6W B;  3B8Z A;  1CIZ A;  3I7G A;  2DD4 B;  4BCJ B;  1FKM A;  1ZS0 A;  4M6V A;  1OIY B;  2CZ7 B;  3OHL A;  5HBJ B;  5ACB A;  4MFE A;  3QZ5 B;  3MI9 B;  5D2B A;  2PK2 A;  4OB1 B;  1H26 B;  3O64 A;  2I40 B;  5D1S A;  4ROD A;  3EDG A;  3MY1 B;  1MMR A;  3N2U A;  5LMK B;  2E2D A;  2RJP A;  2V4B A;  3GTM S;  4IMY B;  4GQL A;  4H1Q A;  3POM A;  3BHU B;  1VIN A;  4FM4 B;  3P24 A;  1HY7 A;  5BOY A;  3LIK A;  3G33 B;  1K7G A;  2USN A;  1PWP A;  3BG9 A;  2WEV B;  3HBL A;  4BCN B;  3F19 A;  3LJG A;  1XFW A;  3TNW B;  1D8M A;  3BLR B;  1OKW B;  3Q2H A;  3X28 B;  2POJ A;  3K7N A;  3AIG A;  3BHV B;  1XO2 A;  2WIH B;  1JAO A;  2DD5 B;  1OS9 A;  4DF9 A;  1OL2 B;  1E9H B;  1RM8 A;  1WNI A;  2Z2D A;  2WXV B;  3EHY A;  4J4M A;  1E7P A;  5D1U A;  1OS2 A;  3PO3 S;  2MZI A;  4H82 A;  1BSW A;  3F16 A;  1D8F A;  1IRE B;  1URC B;  4BCH B;  4L63 A;  5B5O A;  2AIG P;  5L7F A;  1BKC I;  1R1H A;  2IN3 A;  2ERQ A;  4XCT A;  3TSK A;  5BOT A;  1H1Q B;  4EOK B;  1TVI A;  2KRJ A;  4EOS B;  3HB2 P;  5I43 A;  4DD8 A;  1H4L D;  5B5P A;  5BPA A;  1AD6 A;  1JIW P;  1IAE A;  3A8H B;  3QWL A;  4F70 B;  4G9L A;  2DXB B;  4ELJ A;  5HNB B;  4HLQ A;  1FLS A;  2A8H A;  4HL4 A;  2BS4 A;  1OM8 A;  2OY2 A;  4PKT A;  2B9R A;  1XFZ A;  1JST B;  3LJT A;  2V22 B;  4BY7 X;  2W12 A;  3X25 B;  3TNI B;  4EC8 B;  4BCQ B;  1BZS A;  4GR0 A;  4HNV A;  3HZJ A;  1UMT A;  2ZCF B;  2DDF A;  3U1R A;  5CUH A;  1XFV A;  4KRD B;  4ZGD B;  2C5O B;  3EDH A;  4PKU A;  4Q1L A;  3A8L B;  3BG3 A;  1MMB A;  3ZVS A;  3LQ0 A;  1I1I P;  1JAN A;  2ZPB B;  3HO8 A;  3A8O B;  1ZP2 A;  4BCG B;  3SHI A;  2X3B A;  4EOJ B;  2EUF A;  4L19 A;  4ROE A;  3QYG B;  2C5X B;  1USN A;  1IAB A;  3DTK A;  1C8T A;  1Y8J A;  1KUF A;  4WK7 A;  1BQQ M;  1G9K A;  2PJT A;  3M03 A;  4EOP B;  1G12 A;  4F7L B;  3KHI A;  3DTE A;  3VYG B;  4I3Z B;  4FXQ A;  2MZE A;  3F18 A;  1H28 B;  4GWN A;  2ZPH B;  1G4K A;  4H30 A;  4TTH A;  1I73 A;  4EOO B;  1W98 B;  2PK9 B;  1DTH A;  2IW6 B;  3TW6 A;  4FU4 A;  2OVZ A;  5I4O A;  3QYE A;  1KBC A;  2E3X A;  4QSH A;  1OZ9 A;  2OW2 A;  4WZV A;  5IDN B;  1H1R B;  4PKS A;  2X1N B;  3P1V A;  1JKW A;  2QDY B;  4DPE A;  1ZXV A;  2X3C A;  3TN8 B;  3EOC B;  5I2Z A;  2C5V B;  4EOI B;  3HY7 A;  1BKC E;  3X26 B;  4BXX X;  2WFY B;  3HB9 A;  3KWV C;  3EID B;  3LEA A;  1FIN B;  3VYH B;  1CGF A;  4YOS A;  1XUR A;  2LW4 A;  2WIP B;  4ZGE B;  4JX4 A;  2ERP A;  2JT6 A;  1S4B P;  4BCN D;  1GXD A;  2WO9 A;  1BKC A;  4I03 A;  2WMB B;  4QKZ A;  4XM7 A;  3LJZ A;  4L6T A;  1GKC A;  2MZH A;  3DNG A;  1KUK A;  4GR3 A;  5I0L A;  5JMY A;  4CFU B;  2YB9 A;  4AYK A;  3A8G B;  1KUH A;  4OB3 B;  2PJQ A;  1PKD B;  2W2H A;  4HX3 A;  4ZR5 A;  4JQG A;  3USN A;  1SU3 A;  4F6S B;  2WOA A;  3RTT A;  1PWW A;  2J83 A;  3LMC A;  2ZPI B;  4BCO B;  4AKH A;  1D5J A;  1JK3 A;  3TVC A;  3VI1 A;  1CXV A;  3HDA P;  4BCM B;  1F5Q B;  4AKI A;  1OM6 A;  4JIJ A;  1JAP A;  2OXU A;  1XFU A;  2DDY A;  1GUX A;  3MIA B;  2CLT A;  1XM5 A;  2OI0 A;  2BKZ B;  4BCP B;  2IW9 B;  2HU6 A;  4JX6 A;  1OGU B;  3L0V A;  3RGF B;  2W13 A;  1ZVX A;  2C5N B;  3X20 B;  5DQW A;  2KMG A;  5CXA A;  4F7N B;  5ICP B;  1B8Y A;  4PKQ A;  1H27 B;  4NC6 A;  5HBH B;  3AYK A;  2BS3 A;  3HBV P;  5D1T A;  5D7W A;  2RJQ A;  4DV8 A;  1H1P B;  1JKY A;  3BA0 A;  4CFW B;  3F5X B;  1KAP P;  3K7L A;  2UZD B;  3DDP B;  3B57 A;  2WPA B;  3MA2 A;  1QIC A;  3QZ9 B;  2QF7 A;  4PKR A;  2OXZ A;  3EHX A;  1TD6 A;  1GO7 P;  2FV9 A;  2KR6 A;  1AKL A;  1OIU B;  1H71 P;  4ELL A;  1UEA A;  1G3N C;  3LIL A;  1QUA A;  4H84 A;  3DDQ B;  1KUG A;  1EAK A;  2AHJ B;  3QHR B;  4ROC A;  1A85 A;  3DPE A;  4GWM A;  2QFZ A;  1B3D A;  2XS3 A;  5LAB A;  1IAD A;  1GY3 B;  3EJ1 B;  3DOG B;  2DW1 A;  3BHT B;  4UN0 A;  1GUX B;  2G77 A;  1P5E B;  1PWV A;  1ZP5 A;  4H2E A;  1AST A;  5BNJ B;  5FGK B;  1GH6 B;  2CCI B;  1MMP A;  3B2Z A;  1R1J A;  2O3E A;  830C A;  3DTO A;  4WKI A;  1OKV B;  1EUB A;  4R3V A; 
#chains in the Genus database with same CATH homology
 2QDJ A;  3H4C A;  1XFY A;  4G0D A;  3ELM A;  1K7I A;  4JA1 A;  2QQ8 A;  4FVL A;  3WV3 A;  2WO8 A;  2MLR A;  4IJO A;  3HDB A;  4MIM A;  1RMZ A;  3V96 B;  4H49 A;  3G5C A;  1MMQ A;  2Y6C A;  3LE9 A;  4HMA A;  3L0T A;  1GE5 A;  4OB0 B;  3E8R A;  1MNC A;  2DXC B;  1DMT A;  1A86 A;  2DW2 A;  3LKA A;  4BBR M;  1XFX A;  1ZTQ A;  2ZPF B;  2BS2 A;  1I76 A;  2L0R A;  4AIG A;  4JP4 A;  1IAC A;  3DSL A;  2ZZD B;  3UVC A;  3EWJ A;  2YUF A;  1BUV M;  1Y93 A;  1FBL A;  2W0D A;  4A3W A;  1UGP B;  3ZXH A;  2WJ9 A;  2CYZ B;  4PKV A;  3CKI A;  3WV1 A;  4IUW A;  4Z6Y A;  1Y0V A;  1XUC A;  5L79 A;  1QIB A;  1R55 A;  1ZXC A;  1BIW A;  2X7M A;  1HOV A;  2OW0 A;  2OZR A;  1D7X A;  1K7Q A;  1HFC A;  1OO9 A;  3DPF A;  4XBH A;  2W15 A;  1Q3A A;  3LQB A;  4H76 A;  3RTS A;  1BM6 A;  3BG5 A;  3B92 A;  3GBO A;  3G42 A;  2OXW A;  2J0T A;  2JNP A;  4EFS A;  1KUI A;  3OHO A;  3Q2G A;  3LUM A;  5D3C A;  5I3M A;  2SRT A;  1SAT A;  1CAQ A;  3VKH A;  3F1A A;  4H3X A;  1HTD A;  3AYU A;  2DPP B;  3I7I A;  5CZM A;  3KEC A;  4A7B A;  1BQO A;  3KME A;  1YCM A;  3NX7 A;  1UTZ A;  1Z3J A;  2ZPE B;  1JJ9 A;  4GR8 A;  4I35 A;  1QJJ A;  1GO8 P;  1IAG A;  1UMS A;  1PWU A;  4AI6 A;  1G05 A;  2D1N A;  3LIR A;  1CQR A;  1C7K A;  3HBU P;  2X3A A;  2CZ0 B;  1J7N A;  1JH1 A;  3DWB A;  3WVE B;  4IN9 A;  3ZUK A;  2OVX A;  2TCL A;  1UGR B;  4LOC A;  1ROS A;  1CK7 A;  3TW7 A;  3F15 A;  1GE6 A;  2DW0 A;  2OW9 A;  3A8M B;  3EDI A;  1ND1 A;  2YIG A;  1IAA A;  4ZGJ B;  1UGS B;  3F17 A;  4BBS M;  1YOU A;  5H8X A;  1AHJ B;  1CGE A;  2ZPG B;  3N2V A;  1YQY A;  4FXY P;  3DTI A;  1GKD A;  3WVD B;  3HY9 A;  1JIZ A;  4ON1 A;  1GE7 A;  3TS4 A;  2CZ6 B;  4AXQ A;  1YP1 A;  4GF1 A;  1AF0 A;  1QIA A;  1UTT A;  3LUN A;  1BUD A;  4JX5 A;  4HNU A;  1FM1 A;  3HHT B;  2FV5 A;  4MFD A;  4GUY A;  3LGP A;  4AUO A;  2JSD A;  3KRY A;  4L7A A;  2D1O A;  2W14 A;  2JT5 A;  2MLS A;  2Y6D A;  1AYK A;  1PWQ A;  4WF6 A;  3QYB A;  4XM6 A;  1SRP A;  1O0T A;  2OW1 A;  4ILW D;  2XS4 A;  2O36 A;  1L6J A;  1EB6 A;  4XM8 A;  1QJI A;  1HV5 A;  2OY4 A;  1O0Q A;  4JPA A;  3QXE B;  3LK8 A;  1JAQ A;  2CKI A;  3VTG A;  1R1I A;  1G49 A;  3HYG A;  1OMJ A;  2K9C A;  3O2X A;  3KEJ A;  1HFS A;  3TT4 A;  4WKE A;  3X24 B;  1C3I A;  966C A;  4PKW A;  1ATL A;  4HNT A;  3VKG A;  456C A;  1SMP A;  1XUD A;  1R54 A;  1OM7 A;  1V29 B;  2AYK A;  2QPJ A;  5I12 A;  2ERO A;  3KMC A;  3DL1 A;  4CTH A;  4OB2 B;  1SLN A;  2N8R A;  3WV2 A;  2JIH A;  4AKG A;  2K2G A;  2I47 A;  3EDZ A;  1UGQ B;  1QLB A;  3QYH B;  5EJC A;  1SLM A;  1CGL A;  3KEK A;  2D0Q B;  2CZ1 B;  3B8Z A;  1CIZ A;  3I7G A;  2DD4 B;  1FKM A;  1ZS0 A;  4M6V A;  2CZ7 B;  3OHL A;  4MFE A;  3QZ5 B;  5D2B A;  5D1S A;  4OB1 B;  3O64 A;  3EDG A;  1MMR A;  3N2U A;  2E2D A;  2RJP A;  2V4B A;  4GQL A;  4H1Q A;  4FM4 B;  3P24 A;  1HY7 A;  5BOY A;  3LIK A;  1K7G A;  2USN A;  1PWP A;  3BG9 A;  3HBL A;  3F19 A;  3LJG A;  1XFW A;  1D8M A;  3Q2H A;  3X28 B;  2POJ A;  3K7N A;  3AIG A;  1JAO A;  2DD5 B;  1OS9 A;  4DF9 A;  1RM8 A;  1WNI A;  2Z2D A;  3EHY A;  4J4M A;  1E7P A;  5D1U A;  1OS2 A;  2MZI A;  4H82 A;  1BSW A;  3F16 A;  1D8F A;  1IRE B;  4L63 A;  5B5O A;  2AIG P;  5L7F A;  1BKC I;  1R1H A;  4XCT A;  2ERQ A;  3TSK A;  5BOT A;  2KRJ A;  3HB2 P;  5I43 A;  4DD8 A;  5B5P A;  5BPA A;  1JIW P;  1IAE A;  3A8H B;  3QWL A;  4G9L A;  2DXB B;  4ELJ A;  4HLQ A;  1FLS A;  2A8H A;  4HL4 A;  2BS4 A;  1OM8 A;  2OY2 A;  4PKT A;  1XFZ A;  3LJT A;  2W12 A;  3X25 B;  1BZS A;  4GR0 A;  4HNV A;  3HZJ A;  1UMT A;  2ZCF B;  2DDF A;  3U1R A;  5CUH A;  1XFV A;  4ZGD B;  3EDH A;  4PKU A;  4Q1L A;  3A8L B;  3BG3 A;  1MMB A;  3ZVS A;  3LQ0 A;  1I1I P;  1JAN A;  2ZPB B;  3HO8 A;  3A8O B;  3SHI A;  2X3B A;  4L19 A;  3QYG B;  3DTK A;  1USN A;  1IAB A;  1C8T A;  1Y8J A;  1KUF A;  4WK7 A;  1BQQ M;  1G9K A;  2PJT A;  1G12 A;  3KHI A;  3DTE A;  3VYG B;  4FXQ A;  2MZE A;  3F18 A;  4GWN A;  2ZPH B;  1G4K A;  4H30 A;  1I73 A;  1DTH A;  3TW6 A;  4FU4 A;  2OVZ A;  5I4O A;  3QYE A;  1KBC A;  2E3X A;  4QSH A;  2OW2 A;  4WZV A;  4PKS A;  3P1V A;  2QDY B;  4DPE A;  1ZXV A;  2X3C A;  5I2Z A;  3HY7 A;  1BKC E;  3X26 B;  3HB9 A;  3KWV C;  3LEA A;  3VYH B;  1CGF A;  1XUR A;  4ZGE B;  2JT6 A;  4JX4 A;  2ERP A;  1S4B P;  2WO9 A;  1GXD A;  4I03 A;  1BKC A;  4XM7 A;  4QKZ A;  3LJZ A;  4L6T A;  1GKC A;  2MZH A;  3DNG A;  1KUK A;  4GR3 A;  5I0L A;  5JMY A;  2YB9 A;  4AYK A;  3A8G B;  1KUH A;  4OB3 B;  4HX3 A;  4ZR5 A;  4JQG A;  3USN A;  1SU3 A;  2WOA A;  3RTT A;  1PWW A;  2J83 A;  3LMC A;  2ZPI B;  4AKH A;  1D5J A;  1JK3 A;  3TVC A;  3VI1 A;  1CXV A;  3HDA P;  4JIJ A;  4AKI A;  1OM6 A;  1JAP A;  2OXU A;  1XFU A;  2DDY A;  2CLT A;  2OI0 A;  2HU6 A;  4JX6 A;  3L0V A;  2W13 A;  1ZVX A;  3X20 B;  2KMG A;  5CXA A;  4PKQ A;  1B8Y A;  4NC6 A;  3AYK A;  2BS3 A;  3HBV P;  5D1T A;  5D7W A;  2RJQ A;  4DV8 A;  1JKY A;  3BA0 A;  1KAP P;  3K7L A;  3MA2 A;  1QIC A;  3QZ9 B;  2QF7 A;  4PKR A;  2OXZ A;  3EHX A;  1GO7 P;  2FV9 A;  2KR6 A;  1AKL A;  1H71 P;  1UEA A;  3LIL A;  1QUA A;  4H84 A;  1KUG A;  1EAK A;  2AHJ B;  3DPE A;  1A85 A;  4GWM A;  2QFZ A;  1B3D A;  2XS3 A;  5LAB A;  1IAD A;  2DW1 A;  2G77 A;  1PWV A;  1ZP5 A;  4H2E A;  1AST A;  1MMP A;  3B2Z A;  1R1J A;  2O3E A;  830C A;  4WKI A;  1EUB A;  4R3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...