3KHIA

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
223
Chain Sequence
AEMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFGLVHNQRVVQQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRNGDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
molecule tags Hydrolase
total genus 74
structure length 223
sequence length 238
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3khiA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3khiA02
3DL1A 3EDGA 1KUGA 2W12A 4R3VA 1JAOA 1DTHA 4PKRA 2WO8A 2HU6A 4IN9A 2JNPA 4H82A 3EHYA 1BUVM 4XM8A 2CLTA 1PWWA 1PWVA 4FVLA 4H3XA 2JT6A 3HYGA 2D1OA 3EHXA 4L6TA 3VTGA 4QKZA 4DV8A 3ZUKA 1GO8P 2X3CA 3KRYA 4IJOA 1BM6A 5I2ZA 3F18A 4FXYP 3LK8A 1QIBA 1OO9A 4PKUA 3HDBA 3ZXHA 3B8ZA 3LUMA 4H1QA 1XFXA 1R1JA 1SMPA 5I43A 4JPAA 4H2EA 2DDYA 1CQRA 2OZRA 1JANA 1K7IA 1UTZA 3LJZA 2OW0A 1XFUA 2TCLA 2OVXA 2X3AA 3I7GA 4DD8A 3EDIA 3HY7A 3NX7A 966CA 3L0VA 1A86A 2OVZA 2ERQA 3ZVSA 3B2ZA 3AYKA 4G9LA 1Z3JA 4L19A 2FV9A 3EWJA 5I3MA 1K7GA 1HTDA 2W15A 1CIZA 1YOUA 3EDHA 1ZXVA 2W14A 4DPEA 4XM6A 4GR8A 3AIGA 3LMCA 4GUYA 5BOTA 2AYKA 1WNIA 5LABA 3HB2P 5D1SA 1BKCI 1XUDA 4AIGA 4HX3A 1JH1A 2OXUA 5CUHA 4WKEA 3HBUP 3LUNA 1IABA 1GKCA 3KECA 4GWMA 5D3CA 1MMBA 4WZVA 1XFZA 1ND1A 3Q2HA 5CXAA 1G12A 1MNCA 4I35A 1Y0VA 1OS9A 4ON1A 1S4BP 1QIAA 5D1UA 5JMYA 1FM1A 1IAAA 3USNA 2JSDA 3UVCA 4H76A 1JJ9A 1ZS0A 3AYUA 3OHOA 2DW1A 2PJTA 1CGEA 3CKIA 3OHLA 2FV5A 4JQGA 1ZVXA 2QPJA 3KEJA 1PWQA 3P24A 3RTSA 4IUWA 2O3EA 1AYKA 3LIKA 1D8FA 3F16A 2OY4A 2MZIA 3LQ0A 2X3BA 4AXQA 3HBVP 1HFCA 2V4BA 1EB6A 1UTTA 3TSKA 2DDFA 3MA2A 2K9CA 4XBHA 2Y6CA 2I47A 1B8YA 1UMTA 3F15A 1YCMA 1ROSA 1G05A 1D8MA 2X7MA 2AIGP 1GE5A 2OXZA 3TVCA 2CKIA 4GR3A 3KEKA 2USNA 1YP1A 2D1NA 2MLSA 1XFYA 1B3DA 3N2UA 3TT4A 5I0LA 3HY9A 3HDAP 1C8TA 2WOAA 2Z2DA 3SHIA 4L63A 2L0RA 1MMRA 3F1AA 1I1IP 1BQOA 3U1RA 2WO9A 2POJA 1AKLA 4H49A 4JP4A 3O2XA 4GQLA 3KWVC 1GO7P 2W0DA 2W13A 4PKQA 4JA1A 1R54A 5D1TA 1XFWA 1MMPA 4GR0A 1R1HA 1KUFA 1MMQA 3P1VA 2YIGA 2ERPA 1JAQA 3DPEA 4PKSA 3DSLA 1YQYA 1C7KA 1KBCA 1H71P 1OM6A 1G4KA 1CK7A 3ELMA 2E2DA 2MZEA 3KMEA 1BUDA 4ZR5A 1IACA 1GXDA 3LGPA 2E3XA 3LKAA 2JIHA 4WKIA 4FXQA 1BKCA 1D5JA 1J7NA 1SATA 2JT5A 1CGFA 4H30A 2OY2A 1ZXCA 5L79A 1XFVA 2J83A 3Q2GA 1HY7A 1GKDA 4DF9A 2DW0A 2OW9A 3VI1A 1Y8JA 4A3WA 1C3IA 4Q1LA 4HMAA 1JAPA 4JIJA 1IAEA 3TS4A 1EUBA 3LQBA 1EAKA 1R1IA 5CZMA 1ZP5A 3LILA 4J4MA 3B92A 2A8HA 1IAGA 2XS4A 1ZTQA 1O0TA 4AYKA 1QICA 1HFSA 4WF6A 1GE6A 3N2VA 4WK7A 456CA 1BZSA 3G5CA 1QJIA 1ASTA 5BOYA 3L0TA 5B5PA 4PKTA 1BQQM 4G0DA 2KRJA 3LE9A 2OI0A 4CTHA 1PWUA 1SLMA 1CXVA 1BIWA 2RJPA 3EDZA 4FU4A 1RMZA 3LEAA 1ATLA 1QJJA 1SRPA 3K7NA 3DWBA 1I73A 1RM8A 3RTTA 1USNA 3KMCA 5D2BA 2J0TA 2RJQA 2O36A 3LJGA 4I03A 3V96B 1JK3A 2OW1A 1OM7A 3DNGA 3K7LA 2SRTA 3GBOA 4PKVA 3KHIA 4GF1A 3F17A 1QUAA 1PWPA 1DMTA 1L6JA 3LJTA 4ILWD 1D7XA 1G49A 4XCTA 1Y93A 2YB9A 1BSWA 1OMJA 1CAQA 2N8RA 2K2GA 5D7WA 1G9KA 3BA0A 1K7QA 1KUHA 1Q3AA 1JIZA 1KUKA 1I76A 3O64A 4PKWA 4A7BA 1CGLA 2DW2A 4EFSA 1XUCA 3DPFA 1A85A 4H84A 1OS2A 1FLSA 1KUIA 1JKYA 1KAPP 5B5OA 2OXWA 3F19A 1HOVA 830CA 3I7IA 1UMSA 5L7FA 1O0QA 2XS3A 1R55A 1SU3A 3E8RA 5I4OA 1IADA 3G42A 4XM7A 2OW2A 1GE7A 5I12A 3LIRA 4AUOA 5H8XA 1HV5A 2Y6DA 3WV3A 1AF0A 1OM8A 5BPAA 2EROA 3WV2A 1FBLA 1XURA 1JIWP 2MLRA 3WV1A 2MZHA 1UEAA 1BKCE 4GWNA 1SLNA
chains in the Genus database with same CATH superfamily
1OIUB 3DL1A 3EDGA 1KUGA 2W12A 2X1NB 4R3VA 1JAOA 1DTHA 4PKRA 4BCND 5DQVA 4Z6YA 5HBEB 2CYZB 2CZ1B 2HU6A 2WO8A 4IN9A 2JNPA 2W2HA 4H82A 4G6LB 3EHYA 4M6VA 1AD6A 1BUVM 4ZGEB 3BG9A 4XM8A 2CLTA 4BBRM 1PWWA 2YUFA 2CZ7B 1PWVA 1N4MA 4FVLA 4H3XA 4II5B 2IW6B 2JT6A 3BLRB 3HYGA 2W9ZA 4BY1X 2D1OA 2IVXA 3EHXA 4L6TA 3VTGA 4QKZA 1OKWB 4DV8A 3ZUKA 1GO8P 3BHTB 2X3CA 2ZPHB 3KRYA 4CFWB 4IJOA 1BM6A 5I2ZA 4MIMA 3F18A 4YOOA 3QHRB 2IW8B 1PKDB 3TNIB 3LK8A 1G3NC 4EOKB 4FXYP 1QIBA 1OO9A 4PKUA 3HDBA 3ZXHA 3B8ZA 5IDPB 2DD4B 3LUMA 4H1QA 1XFXA 2QDYB 1R1JA 2IN3A 1SMPA 5I43A 4BY7X 4AKIA 4JPAA 2AHJB 4H2EA 2DDYA 1CQRA 2OZRA 2ZZDB 1JANA 1K7IA 1UTZA 5LQFB 4JX4A 2OW0A 3LJZA 4TTHA 1GUXA 1XFUA 2TCLA 2UUEB 1OIYB 4EORB 3DDPB 2OVXA 2X3AA 3I7GA 2F2CA 3M03A 4DD8A 3EDIA 3HY7A 1URCB 3NX7A 4F7SB 1AHJB 966CA 3L0VA 4OGRB 1A86A 2OVZA 5CEIB 1C9BA 3QWLA 2ERQA 4EOQB 3ZVSA 3B2ZA 1OL2B 2C5NB 4FM4B 2DD5B 3AYKA 4G9LA 1Z3JA 4L19A 3BLHB 3MI9B 3QYEA 2WMBB 4NC6A 2FV9A 3EWJA 5I3MA 1P5EB 1K7GA 1HTDA 1BU2A 2W15A 4CFMB 1CIZA 2KMGA 2DXBB 1YOUA 5HBHB 1ZXVA 3EDHA 2W14A 4DPEA 3X25B 2WFYB 4XM6A 1H1RB 4EOIB 4ZGJB 4EOOB 4GR8A 3AIGA 3LMCA 2WXVB 4GUYA 2G9XB 5BOTA 4BCIB 2AYKA 2CZ6B 1WNIA 3A8GB 5LABA 3HB2P 5D1SA 1BKCI 4L7AA 1JOWA 1XUDA 4AI6A 4AIGA 4F6UB 4HX3A 1JH1A 3QZ9B 4BCJB 2OXUA 5CUHA 4WKEA 3HBUP 3LUNA 1IABA 3BG3A 5IF1B 1GKCA 3KECA 4GWMA 1OKVB 2I40B 4CXAB 5D3CA 1MMBA 4WZVA 1XFZA 1ND1A 3Q2HA 5CXAA 1H1SB 1G12A 1MNCA 4I35A 1OGUB 1OS9A 3F5XB 1Y0VA 4OB0B 4ON1A 1S4BP 1QIAA 5D1UA 5JMYA 1FM1A 1E7PA 1IAAA 3USNA 2JSDA 4BXXX 3UVCA 4YC3B 4H76A 1JJ9A 2WIHB 1VYWB 4F6SB 4UN0A 1ZS0A 3AYUA 3OHOA 2DW1A 1QMZB 2PJTA 2QDJA 4EOSB 1CGEA 3CKIA 4KRCB 3OHLA 4OB1B 4AKGA 5HQ0B 3POMA 2FV5A 4JQGA 1ZVXA 2QPJA 4BCNB 1FKMA 3KEJA 1PWQA 3P24A 1GUXB 3RTSA 4IUWA 5EJCA 1OL1B 2O3EA 1AYKA 1UGPB 3LIKA 1D8FA 3F16A 2OY4A 1H28B 3HO8A 2UZBB 2MZIA 2IW9B 3LQ0A 2C4GB 2X3BA 3BG5A 2D0QB 4AXQA 3HBVP 1IREB 3HBLA 2WIPB 1HFCA 2BS3A 2EUFA 2PJQA 1EB6A 3RGFB 2W99A 1UTTA 2V4BA 3TSKA 2DDFA 4BCGB 3DTKA 3MA2A 2K9CA 4XBHA 2Y6CA 5HBJB 2I47A 3LQ5B 3MY1B 2ZPIB 3HZJA 1B8YA 4CFXB 1UMTA 3F15A 1YCMA 2BS4A 1ROSA 1G05A 5HVYB 5EFQB 2ZPGB 1W98B 1D8MA 2X7MA 2BS2A 2AIGP 1GE5A 4ROCA 2OXZA 1KXUA 3TVCA 2CKIA 4GR3A 2W9FA 3KEKA 3A8LB 4BCQD 2USNA 1YP1A 2D1NA 2MLSA 1XFYA 1B3DA 3N2UA 3A8MB 3TT4A 2CJMB 3EJ1B 3HY9A 5I0LA 3HDAP 1C8TA 2C6TB 2WOAA 5ICPB 2Z2DA 3SHIA 4EOJB 4L63A 2L0RA 4MFDA 1JSUB 1MMRA 1QLBA 3F1AA 1I1IP 1UGSB 1BQOA 3QZ5B 3U1RA 4MFEA 4NSTB 2WO9A 2POJA 1JSTB 1AKLA 4H49A 4JP4A 1D3UB 3O2XA 4GQLA 3KWVC 4F7JB 1GO7P 1H27B 4IMYB 2W0DA 2W13A 3VYGB 4PKQA 4JA1A 5IDNB 1R54A 2QQ8A 5D1TA 1XFWA 4CFUD 1GH6B 1MMPA 1UNGD 3X24B 1OZ9A 4GR0A 2PHGA 3NDQA 1KUFA 1R1HA 1MMQA 3P1VA 4BCMB 2YIGA 4KRDB 2ERPA 5FGKB 1JAQA 1ENWA 3DPEA 4PKSA 1OI9B 4YOZA 2PK9B 2ZCFB 3DSLA 1YQYA 1C7KA 3DDQB 1KBCA 4EONB 1H71P 1H26B 4F6WB 3X26B 1OM6A 4EOLB 1G4KA 1CK7A 3PO3S 2E2DA 3ELMA 2MZEA 2R7GA 3BHVB 4I3ZB 3QXEB 4BCPB 1BUDA 3KMEA 4ZR5A 1IACA 1GXDA 3LGPA 1TVIA 4FX3B 2BKZB 2E3XA 4RODA 5BNJB 2JIHA 3LKAA 4FXQA 4WKIA 1BKCA 1D5JA 2WPAB 4BCOB 4BBSM 1J7NA 1SATA 1ZP2A 3EOCB 1VINA 3DTEA 1H24B 4ELJA 2JGZB 2JT5A 1CGFA 4H30A 2OY2A 1ZXCA 5L79A 2B9RA 4OB2B 3TW6A 3MIAB 1XFVA 2J83A 3Q2GA 1HY7A 2DMEA 1GKDA 4DF9A 3GTMS 1H1QB 2DW0A 2WMAB 3H4CA 2OW9A 1Y8JA 3VI1A 4F70B 3MY5B 4A3WA 2I53A 3G33B 1C3IA 4Q1LA 4HMAA 1JAPA 4JIJA 1V29B 1IAEA 3TS4A 1EUBA 3LQBA 3DTIA 1EAKA 1R1IA 5CYIB 5CZMA 1ZP5A 5HNBB 3LILA 4J4MA 3B92A 3QYHB 4F7LB 2A8HA 1IAGA 2XS4A 2BPMB 1ZTQA 5DQWA 1F5QB 1O0TA 4AYKA 3O0GD 1QICA 4HLQA 1HFSA 4WF6A 1GE6A 3N2VA 4WK7A 456CA 1O9KA 3K7AM 1BZSA 3G5CA 1QJIA 1FINB 1ASTA 5BOYA 2CZ0B 3L0TA 4BCFB 5B5PA 3TW7A 4PKTA 4JX6A 1BQQM 4Y72B 4G0DA 3DOGB 1H25B 2UZLB 3VKGA 2KRJA 3LE9A 2OI0A 2G77A 2V22B 1UGRB 4CTHA 5L2WB 1UNHD 1FVVB 1PWUA 1SLMA 4BCKB 4ROEA 1CXVA 1VOLA 4OR5B 4HNUA 4ZGDB 2C5OB 1BIWA 2RJPA 1TFBA 3EDZA 4CFVB 4FU4A 1RMZA 3TNHB 2WHBB 1TD6A 1UNLD 3LEAA 1ATLA 2UZDB 4BCQB 1QJJA 1SRPA 3K7NA 2DPPB 3WVEB 3DWBA 3A8OB 1I73A 1RM8A 3RTTA 1USNA 2ZPFB 3KMCA 5D2BA 4F7NB 2J0TA 2RJQA 5LMKB 2O36A 3QYGB 3LJGA 3B57A 3QYBA 4I03A 3V96B 4JX5A 1JK3A 2OW1A 1JKWA 3WVDB 1OM7A 1GY3B 3DNGA 2WEVB 2SRTA 3K7LA 2PMIB 2C5VB 3GBOA 4PKVA 2CCIB 3KHIA 4GF1A 4HL4A 3F17A 1QUAA 4CRLB 3BLQB 2CCHB 1AISB 4EOPB 3VYHB 1PWPA 2QF7A 3HB9A 3EIDB 4CFNB 1DMTA 1E9HB 1L6JA 4OB3B 2QFZA 3LJTA 4ILWD 1D7XA 1G49A 4XCTA 1Y93A 2YB9A 4CFUB 1BSWA 1OMJA 3QHWB 1CAQA 2N8RA 2K2GA 5D7WA 1G9KA 3DJBA 3BA0A 1K7QA 1KUHA 3HHTB 4HNTA 1Q3AA 1XM5A 4QSHA 1JIZA 5I5ZB 1KUKA 1I76A 3O64A 4BCMD 4PKWA 4A7BA 1CGLA 4ELLA 2DW2A 4EFSA 1XUCA 3DPFA 1A85A 4H84A 2WJ9A 1OS2A 3A8HB 1FLSA 3X28B 2QGSA 4BCHB 4YOSA 1JKYA 1KAPP 1KUIA 5B5OA 4EOMB 2OXWA 2LW4A 3F19A 1H1PB 1HOVA 2W96A 830CA 3VKHA 3DTOA 4AKHA 3I7IA 1O9KB 3BHUB 4EC8B 1UMSA 5L7FA 1O0QA 2XS3A 1UGQB 1XO2A 1R55A 1SU3A 2KR6A 4EC9B 3E8RA 5I4OA 1IADA 3G42A 4XM7A 2OW2A 3TN8B 1GE7A 5I12A 3LIRA 4AUOA 5H8XA 1HV5A 2DXCB 3TNWB 2Y6DA 1AF0A 3WV3A 1H4LD 2C5XB 1OM8A 4LOCA 4HNVA 3X20B 2UZEB 2EROA 3WV2A 5BPAA 1FBLA 1XURA 1JIWP 2MLRA 2ZPEB 2ZPBB 5IHYA 3WV1A 2PK2A 2MZHA 1UEAA 5ACBA 1BKCE 1XAXA 4GWNA 1SLNA
chains in the Genus database with same CATH topology
3DL1A 3EDGA 1KUGA 2W12A 4R3VA 1JAOA 1DTHA 4PKRA 4Z6YA 2WO8A 2CZ1B 2CYZB 2HU6A 4IN9A 2JNPA 4H82A 3EHYA 4M6VA 1BUVM 4ZGEB 3BG9A 4XM8A 2CLTA 4BBRM 1PWWA 2YUFA 2CZ7B 1PWVA 4FVLA 4H3XA 2JT6A 3HYGA 2D1OA 3EHXA 4L6TA 3VTGA 4QKZA 4DV8A 3ZUKA 1GO8P 2X3CA 2ZPHB 3KRYA 4IJOA 1BM6A 5I2ZA 4MIMA 3F18A 4FXYP 3LK8A 1QIBA 1OO9A 4PKUA 3HDBA 3ZXHA 3B8ZA 3LUMA 2DD4B 4H1QA 1XFXA 2QDYB 1R1JA 1SMPA 5I43A 4AKIA 4JPAA 2AHJB 4H2EA 2DDYA 1CQRA 2OZRA 2ZZDB 1JANA 1K7IA 1UTZA 3LJZA 4JX4A 2OW0A 1XFUA 2TCLA 2OVXA 2X3AA 3I7GA 4DD8A 3EDIA 3HY7A 3NX7A 1AHJB 966CA 3L0VA 1A86A 2OVZA 3QWLA 2ERQA 3ZVSA 3B2ZA 4FM4B 2DD5B 3AYKA 4G9LA 1Z3JA 4L19A 3QYEA 4NC6A 2FV9A 3EWJA 5I3MA 1K7GA 1HTDA 2W15A 1CIZA 2KMGA 2DXBB 1YOUA 3EDHA 1ZXVA 2W14A 4DPEA 3X25B 4XM6A 4ZGJB 4GR8A 3AIGA 3LMCA 4GUYA 5BOTA 2AYKA 2CZ6B 1WNIA 3A8GB 5LABA 3HB2P 5D1SA 1BKCI 4L7AA 1XUDA 4AI6A 4AIGA 4HX3A 1JH1A 3QZ9B 2OXUA 5CUHA 4WKEA 3HBUP 3LUNA 1IABA 3BG3A 1GKCA 3KECA 4GWMA 5D3CA 1MMBA 4WZVA 1XFZA 1ND1A 3Q2HA 5CXAA 1G12A 1MNCA 4I35A 1Y0VA 1OS9A 4ON1A 4OB0B 1S4BP 1QIAA 5D1UA 5JMYA 1FM1A 1E7PA 1IAAA 3USNA 2JSDA 3UVCA 4H76A 1JJ9A 1ZS0A 3AYUA 3OHOA 2DW1A 2PJTA 2QDJA 1CGEA 3CKIA 3OHLA 4OB1B 4AKGA 2FV5A 4JQGA 1ZVXA 2QPJA 1FKMA 3KEJA 1PWQA 3P24A 3RTSA 4IUWA 5EJCA 2O3EA 1AYKA 1UGPB 3LIKA 1D8FA 3F16A 2OY4A 3HO8A 2MZIA 3LQ0A 2X3BA 3BG5A 2D0QB 4AXQA 3HBVP 1IREB 3HBLA 1HFCA 2BS3A 2V4BA 1EB6A 1UTTA 3TSKA 2DDFA 3DTKA 3MA2A 2K9CA 4XBHA 2Y6CA 2I47A 2ZPIB 3HZJA 1B8YA 1UMTA 3F15A 1YCMA 2BS4A 1ROSA 1G05A 1D8MA 2ZPGB 2X7MA 2BS2A 2AIGP 1GE5A 2OXZA 3TVCA 2CKIA 4GR3A 3KEKA 3A8LB 2USNA 1YP1A 2D1NA 2MLSA 1XFYA 1B3DA 3N2UA 3A8MB 3TT4A 5I0LA 3HY9A 3HDAP 1C8TA 2WOAA 2Z2DA 3SHIA 4L63A 2L0RA 4MFDA 1MMRA 1QLBA 3F1AA 1I1IP 1UGSB 1BQOA 3QZ5B 3U1RA 4MFEA 2WO9A 2POJA 1AKLA 4H49A 4JP4A 3O2XA 4GQLA 3KWVC 1GO7P 2W0DA 2W13A 3VYGB 4PKQA 4JA1A 1R54A 2QQ8A 5D1TA 1XFWA 1MMPA 3X24B 4GR0A 1R1HA 1KUFA 1MMQA 3P1VA 2YIGA 2ERPA 1JAQA 3DPEA 4PKSA 2ZCFB 3DSLA 1YQYA 1C7KA 1KBCA 1H71P 3X26B 1OM6A 1G4KA 1CK7A 3ELMA 2E2DA 2MZEA 3QXEB 1BUDA 3KMEA 4ZR5A 1IACA 1GXDA 3LGPA 2E3XA 3LKAA 2JIHA 4WKIA 4FXQA 1BKCA 1D5JA 4BBSM 1J7NA 1SATA 3DTEA 4ELJA 2JT5A 1CGFA 4H30A 2OY2A 1ZXCA 5L79A 4OB2B 3TW6A 1XFVA 2J83A 3Q2GA 1HY7A 1GKDA 4DF9A 2DW0A 3H4CA 2OW9A 1Y8JA 3VI1A 4A3WA 1C3IA 4Q1LA 4HMAA 1JAPA 4JIJA 1V29B 1IAEA 3TS4A 1EUBA 3LQBA 3DTIA 1EAKA 1R1IA 5CZMA 1ZP5A 3LILA 4J4MA 3B92A 3QYHB 2A8HA 1IAGA 2XS4A 1ZTQA 1O0TA 4AYKA 1QICA 4HLQA 1HFSA 4WF6A 1GE6A 3N2VA 4WK7A 456CA 1BZSA 3G5CA 1QJIA 1ASTA 5BOYA 2CZ0B 3L0TA 5B5PA 3TW7A 4PKTA 4JX6A 1BQQM 4G0DA 3VKGA 2KRJA 3LE9A 2OI0A 2G77A 1UGRB 4CTHA 1PWUA 1SLMA 1CXVA 4HNUA 4ZGDB 1BIWA 2RJPA 3EDZA 4FU4A 1RMZA 3LEAA 1ATLA 1QJJA 1SRPA 3K7NA 2DPPB 3WVEB 3DWBA 3A8OB 1I73A 1RM8A 3RTTA 1USNA 2ZPFB 3KMCA 5D2BA 2J0TA 2RJQA 2O36A 3QYGB 3LJGA 3QYBA 4I03A 3V96B 4JX5A 1JK3A 2OW1A 3WVDB 1OM7A 3DNGA 3K7LA 2SRTA 3GBOA 4PKVA 3KHIA 4GF1A 4HL4A 3F17A 1QUAA 3VYHB 1PWPA 2QF7A 3HB9A 1DMTA 1L6JA 4OB3B 2QFZA 3LJTA 4ILWD 1D7XA 1G49A 4XCTA 1Y93A 2YB9A 1BSWA 1OMJA 1CAQA 2N8RA 2K2GA 5D7WA 1G9KA 3BA0A 1K7QA 1KUHA 3HHTB 4HNTA 1Q3AA 4QSHA 1JIZA 1KUKA 1I76A 3O64A 4PKWA 4A7BA 1CGLA 2DW2A 4EFSA 1XUCA 3DPFA 1A85A 4H84A 2WJ9A 1OS2A 3A8HB 1FLSA 3X28B 1KUIA 1JKYA 1KAPP 5B5OA 2OXWA 3F19A 1HOVA 830CA 3VKHA 4AKHA 3I7IA 1UMSA 5L7FA 1O0QA 2XS3A 1UGQB 1R55A 1SU3A 2KR6A 3E8RA 5I4OA 1IADA 3G42A 4XM7A 2OW2A 1GE7A 5I12A 3LIRA 4AUOA 5H8XA 1HV5A 2DXCB 2Y6DA 3WV3A 1AF0A 1OM8A 4LOCA 4HNVA 3X20B 5BPAA 2EROA 3WV2A 1FBLA 1XURA 1JIWP 2MLRA 2ZPEB 2ZPBB 3WV1A 2MZHA 1UEAA 1BKCE 4GWNA 1SLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DL1 A;  3EDG A;  1KUG A;  2W12 A;  4R3V A;  1JAO A;  1DTH A;  4PKR A;  2WO8 A;  2HU6 A;  4IN9 A;  2JNP A;  4H82 A;  3EHY A;  1BUV M;  4XM8 A;  2CLT A;  1PWW A;  1PWV A;  4FVL A;  4H3X A;  2JT6 A;  3HYG A;  2D1O A;  3EHX A;  4L6T A;  3VTG A;  4QKZ A;  4DV8 A;  3ZUK A;  1GO8 P;  2X3C A;  3KRY A;  4IJO A;  1BM6 A;  5I2Z A;  3F18 A;  4FXY P;  3LK8 A;  1QIB A;  1OO9 A;  4PKU A;  3HDB A;  3ZXH A;  3B8Z A;  3LUM A;  4H1Q A;  1XFX A;  1R1J A;  1SMP A;  5I43 A;  4JPA A;  4H2E A;  2DDY A;  1CQR A;  2OZR A;  1JAN A;  1K7I A;  1UTZ A;  3LJZ A;  2OW0 A;  1XFU A;  2TCL A;  2OVX A;  2X3A A;  3I7G A;  4DD8 A;  3EDI A;  3HY7 A;  3NX7 A;  966C A;  3L0V A;  1A86 A;  2OVZ A;  2ERQ A;  3ZVS A;  3B2Z A;  3AYK A;  4G9L A;  1Z3J A;  4L19 A;  2FV9 A;  3EWJ A;  5I3M A;  1K7G A;  1HTD A;  2W15 A;  1CIZ A;  1YOU A;  3EDH A;  1ZXV A;  2W14 A;  4DPE A;  4XM6 A;  4GR8 A;  3AIG A;  3LMC A;  4GUY A;  5BOT A;  2AYK A;  1WNI A;  5LAB A;  3HB2 P;  5D1S A;  1BKC I;  1XUD A;  4AIG A;  4HX3 A;  1JH1 A;  2OXU A;  5CUH A;  4WKE A;  3HBU P;  3LUN A;  1IAB A;  1GKC A;  3KEC A;  4GWM A;  5D3C A;  1MMB A;  4WZV A;  1XFZ A;  1ND1 A;  3Q2H A;  5CXA A;  1G12 A;  1MNC A;  4I35 A;  1Y0V A;  1OS9 A;  4ON1 A;  1S4B P;  1QIA A;  5D1U A;  5JMY A;  1FM1 A;  1IAA A;  3USN A;  2JSD A;  3UVC A;  4H76 A;  1JJ9 A;  1ZS0 A;  3AYU A;  3OHO A;  2DW1 A;  2PJT A;  1CGE A;  3CKI A;  3OHL A;  2FV5 A;  4JQG A;  1ZVX A;  2QPJ A;  3KEJ A;  1PWQ A;  3P24 A;  3RTS A;  4IUW A;  2O3E A;  1AYK A;  3LIK A;  1D8F A;  3F16 A;  2OY4 A;  2MZI A;  3LQ0 A;  2X3B A;  4AXQ A;  3HBV P;  1HFC A;  2V4B A;  1EB6 A;  1UTT A;  3TSK A;  2DDF A;  3MA2 A;  2K9C A;  4XBH A;  2Y6C A;  2I47 A;  1B8Y A;  1UMT A;  3F15 A;  1YCM A;  1ROS A;  1G05 A;  1D8M A;  2X7M A;  2AIG P;  1GE5 A;  2OXZ A;  3TVC A;  2CKI A;  4GR3 A;  3KEK A;  2USN A;  1YP1 A;  2D1N A;  2MLS A;  1XFY A;  1B3D A;  3N2U A;  3TT4 A;  5I0L A;  3HY9 A;  3HDA P;  1C8T A;  2WOA A;  2Z2D A;  3SHI A;  4L63 A;  2L0R A;  1MMR A;  3F1A A;  1I1I P;  1BQO A;  3U1R A;  2WO9 A;  2POJ A;  1AKL A;  4H49 A;  4JP4 A;  3O2X A;  4GQL A;  3KWV C;  1GO7 P;  2W0D A;  2W13 A;  4PKQ A;  4JA1 A;  1R54 A;  5D1T A;  1XFW A;  1MMP A;  4GR0 A;  1R1H A;  1KUF A;  1MMQ A;  3P1V A;  2YIG A;  2ERP A;  1JAQ A;  3DPE A;  4PKS A;  3DSL A;  1YQY A;  1C7K A;  1KBC A;  1H71 P;  1OM6 A;  1G4K A;  1CK7 A;  3ELM A;  2E2D A;  2MZE A;  3KME A;  1BUD A;  4ZR5 A;  1IAC A;  1GXD A;  3LGP A;  2E3X A;  3LKA A;  2JIH A;  4WKI A;  4FXQ A;  1BKC A;  1D5J A;  1J7N A;  1SAT A;  2JT5 A;  1CGF A;  4H30 A;  2OY2 A;  1ZXC A;  5L79 A;  1XFV A;  2J83 A;  3Q2G A;  1HY7 A;  1GKD A;  4DF9 A;  2DW0 A;  2OW9 A;  3VI1 A;  1Y8J A;  4A3W A;  1C3I A;  4Q1L A;  4HMA A;  1JAP A;  4JIJ A;  1IAE A;  3TS4 A;  1EUB A;  3LQB A;  1EAK A;  1R1I A;  5CZM A;  1ZP5 A;  3LIL A;  4J4M A;  3B92 A;  2A8H A;  1IAG A;  2XS4 A;  1ZTQ A;  1O0T A;  4AYK A;  1QIC A;  1HFS A;  4WF6 A;  1GE6 A;  3N2V A;  4WK7 A;  456C A;  1BZS A;  3G5C A;  1QJI A;  1AST A;  5BOY A;  3L0T A;  5B5P A;  4PKT A;  1BQQ M;  4G0D A;  2KRJ A;  3LE9 A;  2OI0 A;  4CTH A;  1PWU A;  1SLM A;  1CXV A;  1BIW A;  2RJP A;  3EDZ A;  4FU4 A;  1RMZ A;  3LEA A;  1ATL A;  1QJJ A;  1SRP A;  3K7N A;  3DWB A;  1I73 A;  1RM8 A;  3RTT A;  1USN A;  3KMC A;  5D2B A;  2J0T A;  2RJQ A;  2O36 A;  3LJG A;  4I03 A;  3V96 B;  1JK3 A;  2OW1 A;  1OM7 A;  3DNG A;  3K7L A;  2SRT A;  3GBO A;  4PKV A;  3KHI A;  4GF1 A;  3F17 A;  1QUA A;  1PWP A;  1DMT A;  1L6J A;  3LJT A;  4ILW D;  1D7X A;  1G49 A;  4XCT A;  1Y93 A;  2YB9 A;  1BSW A;  1OMJ A;  1CAQ A;  2N8R A;  2K2G A;  5D7W A;  1G9K A;  3BA0 A;  1K7Q A;  1KUH A;  1Q3A A;  1JIZ A;  1KUK A;  1I76 A;  3O64 A;  4PKW A;  4A7B A;  1CGL A;  2DW2 A;  4EFS A;  1XUC A;  3DPF A;  1A85 A;  4H84 A;  1OS2 A;  1FLS A;  1KUI A;  1JKY A;  1KAP P;  5B5O A;  2OXW A;  3F19 A;  1HOV A;  830C A;  3I7I A;  1UMS A;  5L7F A;  1O0Q A;  2XS3 A;  1R55 A;  1SU3 A;  3E8R A;  5I4O A;  1IAD A;  3G42 A;  4XM7 A;  2OW2 A;  1GE7 A;  5I12 A;  3LIR A;  4AUO A;  5H8X A;  1HV5 A;  2Y6D A;  3WV3 A;  1AF0 A;  1OM8 A;  5BPA A;  2ERO A;  3WV2 A;  1FBL A;  1XUR A;  1JIW P;  2MLR A;  3WV1 A;  2MZH A;  1UEA A;  1BKC E;  4GWN A;  1SLN A; 
#chains in the Genus database with same CATH topology
 1OIU B;  3DL1 A;  3EDG A;  1KUG A;  2W12 A;  2X1N B;  4R3V A;  1JAO A;  1DTH A;  4PKR A;  4BCN D;  5DQV A;  4Z6Y A;  5HBE B;  2CYZ B;  2CZ1 B;  2HU6 A;  2WO8 A;  4IN9 A;  2JNP A;  2W2H A;  4H82 A;  4G6L B;  3EHY A;  4M6V A;  1AD6 A;  1BUV M;  4ZGE B;  3BG9 A;  4XM8 A;  2CLT A;  4BBR M;  1PWW A;  2YUF A;  2CZ7 B;  1PWV A;  1N4M A;  4FVL A;  4H3X A;  4II5 B;  2IW6 B;  2JT6 A;  3BLR B;  3HYG A;  2W9Z A;  4BY1 X;  2D1O A;  2IVX A;  3EHX A;  4L6T A;  3VTG A;  4QKZ A;  1OKW B;  4DV8 A;  3ZUK A;  1GO8 P;  3BHT B;  2X3C A;  2ZPH B;  3KRY A;  4CFW B;  4IJO A;  1BM6 A;  5I2Z A;  4MIM A;  3F18 A;  4YOO A;  3QHR B;  2IW8 B;  1PKD B;  3TNI B;  3LK8 A;  1G3N C;  4EOK B;  4FXY P;  1QIB A;  1OO9 A;  4PKU A;  3HDB A;  3ZXH A;  3B8Z A;  5IDP B;  2DD4 B;  3LUM A;  4H1Q A;  1XFX A;  2QDY B;  1R1J A;  2IN3 A;  1SMP A;  5I43 A;  4BY7 X;  4AKI A;  4JPA A;  2AHJ B;  4H2E A;  2DDY A;  1CQR A;  2OZR A;  2ZZD B;  1JAN A;  1K7I A;  1UTZ A;  5LQF B;  4JX4 A;  2OW0 A;  3LJZ A;  4TTH A;  1GUX A;  1XFU A;  2TCL A;  2UUE B;  1OIY B;  4EOR B;  3DDP B;  2OVX A;  2X3A A;  3I7G A;  2F2C A;  3M03 A;  4DD8 A;  3EDI A;  3HY7 A;  1URC B;  3NX7 A;  4F7S B;  1AHJ B;  966C A;  3L0V A;  4OGR B;  1A86 A;  2OVZ A;  5CEI B;  1C9B A;  3QWL A;  2ERQ A;  4EOQ B;  3ZVS A;  3B2Z A;  1OL2 B;  2C5N B;  4FM4 B;  2DD5 B;  3AYK A;  4G9L A;  1Z3J A;  4L19 A;  3BLH B;  3MI9 B;  3QYE A;  2WMB B;  4NC6 A;  2FV9 A;  3EWJ A;  5I3M A;  1P5E B;  1K7G A;  1HTD A;  1BU2 A;  2W15 A;  4CFM B;  1CIZ A;  2KMG A;  2DXB B;  1YOU A;  5HBH B;  1ZXV A;  3EDH A;  2W14 A;  4DPE A;  3X25 B;  2WFY B;  4XM6 A;  1H1R B;  4EOI B;  4ZGJ B;  4EOO B;  4GR8 A;  3AIG A;  3LMC A;  2WXV B;  4GUY A;  2G9X B;  5BOT A;  4BCI B;  2AYK A;  2CZ6 B;  1WNI A;  3A8G B;  5LAB A;  3HB2 P;  5D1S A;  1BKC I;  4L7A A;  1JOW A;  1XUD A;  4AI6 A;  4AIG A;  4F6U B;  4HX3 A;  1JH1 A;  3QZ9 B;  4BCJ B;  2OXU A;  5CUH A;  4WKE A;  3HBU P;  3LUN A;  1IAB A;  3BG3 A;  5IF1 B;  1GKC A;  3KEC A;  4GWM A;  1OKV B;  2I40 B;  4CXA B;  5D3C A;  1MMB A;  4WZV A;  1XFZ A;  1ND1 A;  3Q2H A;  5CXA A;  1H1S B;  1G12 A;  1MNC A;  4I35 A;  1OGU B;  1OS9 A;  3F5X B;  1Y0V A;  4OB0 B;  4ON1 A;  1S4B P;  1QIA A;  5D1U A;  5JMY A;  1FM1 A;  1E7P A;  1IAA A;  3USN A;  2JSD A;  4BXX X;  3UVC A;  4YC3 B;  4H76 A;  1JJ9 A;  2WIH B;  1VYW B;  4F6S B;  4UN0 A;  1ZS0 A;  3AYU A;  3OHO A;  2DW1 A;  1QMZ B;  2PJT A;  2QDJ A;  4EOS B;  1CGE A;  3CKI A;  4KRC B;  3OHL A;  4OB1 B;  4AKG A;  5HQ0 B;  3POM A;  2FV5 A;  4JQG A;  1ZVX A;  2QPJ A;  4BCN B;  1FKM A;  3KEJ A;  1PWQ A;  3P24 A;  1GUX B;  3RTS A;  4IUW A;  5EJC A;  1OL1 B;  2O3E A;  1AYK A;  1UGP B;  3LIK A;  1D8F A;  3F16 A;  2OY4 A;  1H28 B;  3HO8 A;  2UZB B;  2MZI A;  2IW9 B;  3LQ0 A;  2C4G B;  2X3B A;  3BG5 A;  2D0Q B;  4AXQ A;  3HBV P;  1IRE B;  3HBL A;  2WIP B;  1HFC A;  2BS3 A;  2EUF A;  2PJQ A;  1EB6 A;  3RGF B;  2W99 A;  1UTT A;  2V4B A;  3TSK A;  2DDF A;  4BCG B;  3DTK A;  3MA2 A;  2K9C A;  4XBH A;  2Y6C A;  5HBJ B;  2I47 A;  3LQ5 B;  3MY1 B;  2ZPI B;  3HZJ A;  1B8Y A;  4CFX B;  1UMT A;  3F15 A;  1YCM A;  2BS4 A;  1ROS A;  1G05 A;  5HVY B;  5EFQ B;  2ZPG B;  1W98 B;  1D8M A;  2X7M A;  2BS2 A;  2AIG P;  1GE5 A;  4ROC A;  2OXZ A;  1KXU A;  3TVC A;  2CKI A;  4GR3 A;  2W9F A;  3KEK A;  3A8L B;  4BCQ D;  2USN A;  1YP1 A;  2D1N A;  2MLS A;  1XFY A;  1B3D A;  3N2U A;  3A8M B;  3TT4 A;  2CJM B;  3EJ1 B;  3HY9 A;  5I0L A;  3HDA P;  1C8T A;  2C6T B;  2WOA A;  5ICP B;  2Z2D A;  3SHI A;  4EOJ B;  4L63 A;  2L0R A;  4MFD A;  1JSU B;  1MMR A;  1QLB A;  3F1A A;  1I1I P;  1UGS B;  1BQO A;  3QZ5 B;  3U1R A;  4MFE A;  4NST B;  2WO9 A;  2POJ A;  1JST B;  1AKL A;  4H49 A;  4JP4 A;  1D3U B;  3O2X A;  4GQL A;  3KWV C;  4F7J B;  1GO7 P;  1H27 B;  4IMY B;  2W0D A;  2W13 A;  3VYG B;  4PKQ A;  4JA1 A;  5IDN B;  1R54 A;  2QQ8 A;  5D1T A;  1XFW A;  4CFU D;  1GH6 B;  1MMP A;  1UNG D;  3X24 B;  1OZ9 A;  4GR0 A;  2PHG A;  3NDQ A;  1KUF A;  1R1H A;  1MMQ A;  3P1V A;  4BCM B;  2YIG A;  4KRD B;  2ERP A;  5FGK B;  1JAQ A;  1ENW A;  3DPE A;  4PKS A;  1OI9 B;  4YOZ A;  2PK9 B;  2ZCF B;  3DSL A;  1YQY A;  1C7K A;  3DDQ B;  1KBC A;  4EON B;  1H71 P;  1H26 B;  4F6W B;  3X26 B;  1OM6 A;  4EOL B;  1G4K A;  1CK7 A;  3PO3 S;  2E2D A;  3ELM A;  2MZE A;  2R7G A;  3BHV B;  4I3Z B;  3QXE B;  4BCP B;  1BUD A;  3KME A;  4ZR5 A;  1IAC A;  1GXD A;  3LGP A;  1TVI A;  4FX3 B;  2BKZ B;  2E3X A;  4ROD A;  5BNJ B;  2JIH A;  3LKA A;  4FXQ A;  4WKI A;  1BKC A;  1D5J A;  2WPA B;  4BCO B;  4BBS M;  1J7N A;  1SAT A;  1ZP2 A;  3EOC B;  1VIN A;  3DTE A;  1H24 B;  4ELJ A;  2JGZ B;  2JT5 A;  1CGF A;  4H30 A;  2OY2 A;  1ZXC A;  5L79 A;  2B9R A;  4OB2 B;  3TW6 A;  3MIA B;  1XFV A;  2J83 A;  3Q2G A;  1HY7 A;  2DME A;  1GKD A;  4DF9 A;  3GTM S;  1H1Q B;  2DW0 A;  2WMA B;  3H4C A;  2OW9 A;  1Y8J A;  3VI1 A;  4F70 B;  3MY5 B;  4A3W A;  2I53 A;  3G33 B;  1C3I A;  4Q1L A;  4HMA A;  1JAP A;  4JIJ A;  1V29 B;  1IAE A;  3TS4 A;  1EUB A;  3LQB A;  3DTI A;  1EAK A;  1R1I A;  5CYI B;  5CZM A;  1ZP5 A;  5HNB B;  3LIL A;  4J4M A;  3B92 A;  3QYH B;  4F7L B;  2A8H A;  1IAG A;  2XS4 A;  2BPM B;  1ZTQ A;  5DQW A;  1F5Q B;  1O0T A;  4AYK A;  3O0G D;  1QIC A;  4HLQ A;  1HFS A;  4WF6 A;  1GE6 A;  3N2V A;  4WK7 A;  456C A;  1O9K A;  3K7A M;  1BZS A;  3G5C A;  1QJI A;  1FIN B;  1AST A;  5BOY A;  2CZ0 B;  3L0T A;  4BCF B;  5B5P A;  3TW7 A;  4PKT A;  4JX6 A;  1BQQ M;  4Y72 B;  4G0D A;  3DOG B;  1H25 B;  2UZL B;  3VKG A;  2KRJ A;  3LE9 A;  2OI0 A;  2G77 A;  2V22 B;  1UGR B;  4CTH A;  5L2W B;  1UNH D;  1FVV B;  1PWU A;  1SLM A;  4BCK B;  4ROE A;  1CXV A;  1VOL A;  4OR5 B;  4HNU A;  4ZGD B;  2C5O B;  1BIW A;  2RJP A;  1TFB A;  3EDZ A;  4CFV B;  4FU4 A;  1RMZ A;  3TNH B;  2WHB B;  1TD6 A;  1UNL D;  3LEA A;  1ATL A;  2UZD B;  4BCQ B;  1QJJ A;  1SRP A;  3K7N A;  2DPP B;  3WVE B;  3DWB A;  3A8O B;  1I73 A;  1RM8 A;  3RTT A;  1USN A;  2ZPF B;  3KMC A;  5D2B A;  4F7N B;  2J0T A;  2RJQ A;  5LMK B;  2O36 A;  3QYG B;  3LJG A;  3B57 A;  3QYB A;  4I03 A;  3V96 B;  4JX5 A;  1JK3 A;  2OW1 A;  1JKW A;  3WVD B;  1OM7 A;  1GY3 B;  3DNG A;  2WEV B;  2SRT A;  3K7L A;  2PMI B;  2C5V B;  3GBO A;  4PKV A;  2CCI B;  3KHI A;  4GF1 A;  4HL4 A;  3F17 A;  1QUA A;  4CRL B;  3BLQ B;  2CCH B;  1AIS B;  4EOP B;  3VYH B;  1PWP A;  2QF7 A;  3HB9 A;  3EID B;  4CFN B;  1DMT A;  1E9H B;  1L6J A;  4OB3 B;  2QFZ A;  3LJT A;  4ILW D;  1D7X A;  1G49 A;  4XCT A;  1Y93 A;  2YB9 A;  4CFU B;  1BSW A;  1OMJ A;  3QHW B;  1CAQ A;  2N8R A;  2K2G A;  5D7W A;  1G9K A;  3DJB A;  3BA0 A;  1K7Q A;  1KUH A;  3HHT B;  4HNT A;  1Q3A A;  1XM5 A;  4QSH A;  1JIZ A;  5I5Z B;  1KUK A;  1I76 A;  3O64 A;  4BCM D;  4PKW A;  4A7B A;  1CGL A;  4ELL A;  2DW2 A;  4EFS A;  1XUC A;  3DPF A;  1A85 A;  4H84 A;  2WJ9 A;  1OS2 A;  3A8H B;  1FLS A;  3X28 B;  2QGS A;  4BCH B;  4YOS A;  1JKY A;  1KAP P;  1KUI A;  5B5O A;  4EOM B;  2OXW A;  2LW4 A;  3F19 A;  1H1P B;  1HOV A;  2W96 A;  830C A;  3VKH A;  3DTO A;  4AKH A;  3I7I A;  1O9K B;  3BHU B;  4EC8 B;  1UMS A;  5L7F A;  1O0Q A;  2XS3 A;  1UGQ B;  1XO2 A;  1R55 A;  1SU3 A;  2KR6 A;  4EC9 B;  3E8R A;  5I4O A;  1IAD A;  3G42 A;  4XM7 A;  2OW2 A;  3TN8 B;  1GE7 A;  5I12 A;  3LIR A;  4AUO A;  5H8X A;  1HV5 A;  2DXC B;  3TNW B;  2Y6D A;  1AF0 A;  3WV3 A;  1H4L D;  2C5X B;  1OM8 A;  4LOC A;  4HNV A;  3X20 B;  2UZE B;  2ERO A;  3WV2 A;  5BPA A;  1FBL A;  1XUR A;  1JIW P;  2MLR A;  2ZPE B;  2ZPB B;  5IHY A;  3WV1 A;  2PK2 A;  2MZH A;  1UEA A;  5ACB A;  1BKC E;  1XAX A;  4GWN A;  1SLN A; 
#chains in the Genus database with same CATH homology
 3DL1 A;  3EDG A;  1KUG A;  2W12 A;  4R3V A;  1JAO A;  1DTH A;  4PKR A;  4Z6Y A;  2WO8 A;  2CZ1 B;  2CYZ B;  2HU6 A;  4IN9 A;  2JNP A;  4H82 A;  3EHY A;  4M6V A;  1BUV M;  4ZGE B;  3BG9 A;  4XM8 A;  2CLT A;  4BBR M;  1PWW A;  2YUF A;  2CZ7 B;  1PWV A;  4FVL A;  4H3X A;  2JT6 A;  3HYG A;  2D1O A;  3EHX A;  4L6T A;  3VTG A;  4QKZ A;  4DV8 A;  3ZUK A;  1GO8 P;  2X3C A;  2ZPH B;  3KRY A;  4IJO A;  1BM6 A;  5I2Z A;  4MIM A;  3F18 A;  4FXY P;  3LK8 A;  1QIB A;  1OO9 A;  4PKU A;  3HDB A;  3ZXH A;  3B8Z A;  3LUM A;  2DD4 B;  4H1Q A;  1XFX A;  2QDY B;  1R1J A;  1SMP A;  5I43 A;  4AKI A;  4JPA A;  2AHJ B;  4H2E A;  2DDY A;  1CQR A;  2OZR A;  2ZZD B;  1JAN A;  1K7I A;  1UTZ A;  3LJZ A;  4JX4 A;  2OW0 A;  1XFU A;  2TCL A;  2OVX A;  2X3A A;  3I7G A;  4DD8 A;  3EDI A;  3HY7 A;  3NX7 A;  1AHJ B;  966C A;  3L0V A;  1A86 A;  2OVZ A;  3QWL A;  2ERQ A;  3ZVS A;  3B2Z A;  4FM4 B;  2DD5 B;  3AYK A;  4G9L A;  1Z3J A;  4L19 A;  3QYE A;  4NC6 A;  2FV9 A;  3EWJ A;  5I3M A;  1K7G A;  1HTD A;  2W15 A;  1CIZ A;  2KMG A;  2DXB B;  1YOU A;  3EDH A;  1ZXV A;  2W14 A;  4DPE A;  3X25 B;  4XM6 A;  4ZGJ B;  4GR8 A;  3AIG A;  3LMC A;  4GUY A;  5BOT A;  2AYK A;  2CZ6 B;  1WNI A;  3A8G B;  5LAB A;  3HB2 P;  5D1S A;  1BKC I;  4L7A A;  1XUD A;  4AI6 A;  4AIG A;  4HX3 A;  1JH1 A;  3QZ9 B;  2OXU A;  5CUH A;  4WKE A;  3HBU P;  3LUN A;  1IAB A;  3BG3 A;  1GKC A;  3KEC A;  4GWM A;  5D3C A;  1MMB A;  4WZV A;  1XFZ A;  1ND1 A;  3Q2H A;  5CXA A;  1G12 A;  1MNC A;  4I35 A;  1Y0V A;  1OS9 A;  4ON1 A;  4OB0 B;  1S4B P;  1QIA A;  5D1U A;  5JMY A;  1FM1 A;  1E7P A;  1IAA A;  3USN A;  2JSD A;  3UVC A;  4H76 A;  1JJ9 A;  1ZS0 A;  3AYU A;  3OHO A;  2DW1 A;  2PJT A;  2QDJ A;  1CGE A;  3CKI A;  3OHL A;  4OB1 B;  4AKG A;  2FV5 A;  4JQG A;  1ZVX A;  2QPJ A;  1FKM A;  3KEJ A;  1PWQ A;  3P24 A;  3RTS A;  4IUW A;  5EJC A;  2O3E A;  1AYK A;  1UGP B;  3LIK A;  1D8F A;  3F16 A;  2OY4 A;  3HO8 A;  2MZI A;  3LQ0 A;  2X3B A;  3BG5 A;  2D0Q B;  4AXQ A;  3HBV P;  1IRE B;  3HBL A;  1HFC A;  2BS3 A;  2V4B A;  1EB6 A;  1UTT A;  3TSK A;  2DDF A;  3DTK A;  3MA2 A;  2K9C A;  4XBH A;  2Y6C A;  2I47 A;  2ZPI B;  3HZJ A;  1B8Y A;  1UMT A;  3F15 A;  1YCM A;  2BS4 A;  1ROS A;  1G05 A;  1D8M A;  2ZPG B;  2X7M A;  2BS2 A;  2AIG P;  1GE5 A;  2OXZ A;  3TVC A;  2CKI A;  4GR3 A;  3KEK A;  3A8L B;  2USN A;  1YP1 A;  2D1N A;  2MLS A;  1XFY A;  1B3D A;  3N2U A;  3A8M B;  3TT4 A;  5I0L A;  3HY9 A;  3HDA P;  1C8T A;  2WOA A;  2Z2D A;  3SHI A;  4L63 A;  2L0R A;  4MFD A;  1MMR A;  1QLB A;  3F1A A;  1I1I P;  1UGS B;  1BQO A;  3QZ5 B;  3U1R A;  4MFE A;  2WO9 A;  2POJ A;  1AKL A;  4H49 A;  4JP4 A;  3O2X A;  4GQL A;  3KWV C;  1GO7 P;  2W0D A;  2W13 A;  3VYG B;  4PKQ A;  4JA1 A;  1R54 A;  2QQ8 A;  5D1T A;  1XFW A;  1MMP A;  3X24 B;  4GR0 A;  1R1H A;  1KUF A;  1MMQ A;  3P1V A;  2YIG A;  2ERP A;  1JAQ A;  3DPE A;  4PKS A;  2ZCF B;  3DSL A;  1YQY A;  1C7K A;  1KBC A;  1H71 P;  3X26 B;  1OM6 A;  1G4K A;  1CK7 A;  3ELM A;  2E2D A;  2MZE A;  3QXE B;  1BUD A;  3KME A;  4ZR5 A;  1IAC A;  1GXD A;  3LGP A;  2E3X A;  3LKA A;  2JIH A;  4WKI A;  4FXQ A;  1BKC A;  1D5J A;  4BBS M;  1J7N A;  1SAT A;  3DTE A;  4ELJ A;  2JT5 A;  1CGF A;  4H30 A;  2OY2 A;  1ZXC A;  5L79 A;  4OB2 B;  3TW6 A;  1XFV A;  2J83 A;  3Q2G A;  1HY7 A;  1GKD A;  4DF9 A;  2DW0 A;  3H4C A;  2OW9 A;  1Y8J A;  3VI1 A;  4A3W A;  1C3I A;  4Q1L A;  4HMA A;  1JAP A;  4JIJ A;  1V29 B;  1IAE A;  3TS4 A;  1EUB A;  3LQB A;  3DTI A;  1EAK A;  1R1I A;  5CZM A;  1ZP5 A;  3LIL A;  4J4M A;  3B92 A;  3QYH B;  2A8H A;  1IAG A;  2XS4 A;  1ZTQ A;  1O0T A;  4AYK A;  1QIC A;  4HLQ A;  1HFS A;  4WF6 A;  1GE6 A;  3N2V A;  4WK7 A;  456C A;  1BZS A;  3G5C A;  1QJI A;  1AST A;  5BOY A;  2CZ0 B;  3L0T A;  5B5P A;  3TW7 A;  4PKT A;  4JX6 A;  1BQQ M;  4G0D A;  3VKG A;  2KRJ A;  3LE9 A;  2OI0 A;  2G77 A;  1UGR B;  4CTH A;  1PWU A;  1SLM A;  1CXV A;  4HNU A;  4ZGD B;  1BIW A;  2RJP A;  3EDZ A;  4FU4 A;  1RMZ A;  3LEA A;  1ATL A;  1QJJ A;  1SRP A;  3K7N A;  2DPP B;  3WVE B;  3DWB A;  3A8O B;  1I73 A;  1RM8 A;  3RTT A;  1USN A;  2ZPF B;  3KMC A;  5D2B A;  2J0T A;  2RJQ A;  2O36 A;  3QYG B;  3LJG A;  3QYB A;  4I03 A;  3V96 B;  4JX5 A;  1JK3 A;  2OW1 A;  3WVD B;  1OM7 A;  3DNG A;  3K7L A;  2SRT A;  3GBO A;  4PKV A;  3KHI A;  4GF1 A;  4HL4 A;  3F17 A;  1QUA A;  3VYH B;  1PWP A;  2QF7 A;  3HB9 A;  1DMT A;  1L6J A;  4OB3 B;  2QFZ A;  3LJT A;  4ILW D;  1D7X A;  1G49 A;  4XCT A;  1Y93 A;  2YB9 A;  1BSW A;  1OMJ A;  1CAQ A;  2N8R A;  2K2G A;  5D7W A;  1G9K A;  3BA0 A;  1K7Q A;  1KUH A;  3HHT B;  4HNT A;  1Q3A A;  4QSH A;  1JIZ A;  1KUK A;  1I76 A;  3O64 A;  4PKW A;  4A7B A;  1CGL A;  2DW2 A;  4EFS A;  1XUC A;  3DPF A;  1A85 A;  4H84 A;  2WJ9 A;  1OS2 A;  3A8H B;  1FLS A;  3X28 B;  1KUI A;  1JKY A;  1KAP P;  5B5O A;  2OXW A;  3F19 A;  1HOV A;  830C A;  3VKH A;  4AKH A;  3I7I A;  1UMS A;  5L7F A;  1O0Q A;  2XS3 A;  1UGQ B;  1R55 A;  1SU3 A;  2KR6 A;  3E8R A;  5I4O A;  1IAD A;  3G42 A;  4XM7 A;  2OW2 A;  1GE7 A;  5I12 A;  3LIR A;  4AUO A;  5H8X A;  1HV5 A;  2DXC B;  2Y6D A;  3WV3 A;  1AF0 A;  1OM8 A;  4LOC A;  4HNV A;  3X20 B;  5BPA A;  2ERO A;  3WV2 A;  1FBL A;  1XUR A;  1JIW P;  2MLR A;  2ZPE B;  2ZPB B;  3WV1 A;  2MZH A;  1UEA A;  1BKC E;  4GWN A;  1SLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...