3KHIA

Crystal structure of a putative metal-dependent hydrolase (yp_001336084.1) from klebsiella pneumoniae subsp. pneumoniae mgh 78578 at 1.95 a resolution
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
238
structure length
223
Chain Sequence
AEMPWEQALAIPVLAHLSSTEQHKLTQMAARFLQQKRLVALQGLELTPLHQARIAMLFCLPVLELGIEWLDGFHEVLIYPAPFGLVHNQRVVQQQGPVVLNWLDIQDSFDASGFNLVVHEVAHKLDTRNGDRASGVPLIPLREVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCHFYRQDPLARRRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Putative Metal-dependent Hydrolase
publication title The Structure of Mlc Titration Factor A (MtfA/YeeI) Reveals a Prototypical Zinc Metallopeptidase Related to Anthrax Lethal Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae subsp. pneumoniae mgh 78578
total genus 74
structure length 223
sequence length 238
ec nomenclature
pdb deposition date 2009-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06167 Peptidase_M90 Glucose-regulated metallo-peptidase M90
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.150 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3khiA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3khiA02
4QKZA 1JK3A 1R1IA 1HTDA 2FV9A 3TSKA 1HFSA 2MLSA 4DV8A 4ILWD 2K9CA 3LUNA 1Z3JA 1MNCA 3ELMA 1GO7P 4L6TA 2HU6A 4GR3A 4H49A 3HDAP 3I7IA 4GR8A 1XFWA 2O36A 4H84A 1JAOA 1Y0VA 3DL1A 3EHXA 1AF0A 2W15A 4PKSA 1G4KA 1R1JA 2DDFA 4JA1A 1OS9A 1QJIA 830CA 2JNPA 1MMPA 3DPFA 4AYKA 3LKAA 1IAEA 1A85A 2Y6DA 1BKCA 1UTTA 1CGFA 1XFVA 2N8RA 3F19A 3CKIA 2RJQA 3G5CA 1PWQA 3K7LA 1ZXCA 5I3MA 1QICA 1YQYA 5CZMA 1R54A 1KUGA 3OHOA 3DPEA 4XBHA 3DWBA 1HOVA 4WZVA 1OS2A 2PJTA 2X3CA 2A8HA 1CXVA 1FBLA 1GKCA 1JIWP 4PKRA 2USNA 1G05A 2I47A 1L6JA 2KRJA 2OZRA 1HY7A 5D2BA 4XM8A 1FM1A 3GBOA 2TCLA 3TT4A 2AYKA 3KHIA 1PWVA 3F17A 4ON1A 5I43A 2WO9A 1I1IP 4HMAA 4WK7A 3HY9A 4XM7A 2L0RA 3KEKA 1ZVXA 1KBCA 1JAPA 1GE6A 5CUHA 1BZSA 5BOTA 3DNGA 3HYGA 3F15A 2YIGA 1I76A 1ROSA 1I73A 3B92A 1GE5A 3LE9A 4AIGA 3LJTA 3TVCA 4H1QA 3HY7A 1FLSA 4HX3A 4DF9A 5I2ZA 1MMQA 1RMZA 3LUMA 3EWJA 3AYUA 1YCMA 1KAPP 2E2DA 1BQOA 4PKQA 2OW0A 3AIGA 2OI0A 1GO8P 2X7MA 1BUVM 1DTHA 2X3AA 1YOUA 1H71P 2YB9A 1BUDA 1HV5A 4J4MA 1BKCI 2XS3A 1C3IA 1G49A 4EFSA 1IACA 2FV5A 2OY4A 1WNIA 4FXYP 3B8ZA 4L63A 1ATLA 1SLNA 1B8YA 3EDGA 3I7GA 3F1AA 5JMYA 3HB2P 3HBUP 2V4BA 4WKEA 4H82A 1G9KA 4IUWA 1D5JA 1YP1A 2DW0A 2O3EA 3WV2A 3ZXHA 2OW2A 1XURA 4GQLA 3LIRA 2OVZA 2XS4A 5D1UA 4IJOA 3F18A 3KMEA 1JJ9A 3SHIA 2MZIA 3LIKA 1JKYA 5CXAA 1C7KA 1XFZA 2JIHA 4G0DA 1CK7A 4XCTA 1D8FA 2OXUA 4CTHA 3U1RA 1BKCE 5BOYA 1IABA 2DW2A 1HFCA 1UTZA 1QJJA 4JQGA 1CAQA 1PWPA 2MZHA 4I03A 3UVCA 2POJA 1XFXA 1AYKA 4JPAA 4A3WA 1ZP5A 4DD8A 1CGEA 1PWWA 1CGLA 2EROA 2DDYA 1Q3AA 1K7GA 4WF6A 1ZXVA 3L0TA 1JAQA 1IAGA 2OW9A 1KUFA 3VI1A 1ZS0A 3EHYA 3RTSA 2WO8A 3P1VA 4DPEA 3HDBA 3KECA 1JH1A 2K2GA 5D7WA 1SLMA 4FU4A 2JSDA 4GWMA 3RTTA 4GUYA 4PKWA 2AIGP 1O0TA 2Y6CA 2ERPA 4GF1A 5BPAA 3L0VA 3KMCA 2J83A 1CQRA 4H2EA 4PKUA 2WOAA 1PWUA 1GXDA 4ZR5A 966CA 3KEJA 1D8MA 1MMRA 4AXQA 1G12A 1Y93A 1EAKA 1OM7A 3EDIA 4PKTA 3USNA 1XUCA 1BSWA 1BM6A 5D1TA 2OXWA 3LILA 1SU3A 3DSLA 1AKLA 3EDHA 5I12A 3O64A 1BQQM 2W12A 5L7FA 1GKDA 3B2ZA 1ZTQA 3NX7A 1S4BP 3LJZA 1OM8A 1SMPA 2D1NA 1QIBA 2QPJA 5L79A 2CLTA 1EB6A 1RM8A 3LQBA 2MZEA 4FVLA 1QIAA 1Y8JA 4XM6A 1USNA 3LEAA 3P24A 1JANA 2W14A 2E3XA 4JP4A 2X3BA 2JT6A 1XFUA 1UMSA 2SRTA 3N2VA 1OM6A 5B5OA 1B3DA 456CA 3EDZA 2JT5A 1KUIA 3HBVP 1SATA 2Z2DA 1JIZA 2OY2A 1UMTA 3OHLA 4Q1LA 1OMJA 3Q2GA 1O0QA 3TS4A 2D1OA 3AYKA 4PKVA 4IN9A 1KUHA 3MA2A 4L19A 1DMTA 2MLRA 2W0DA 4AUOA 3Q2HA 5D1SA 2OVXA 1K7IA 3V96B 3BA0A 4GR0A 1UEAA 4G9LA 4H30A 1A86A 1OO9A 4FXQA 1XUDA 3KWVC 5I4OA 2ERQA 1K7QA 3LQ0A 4I35A 1MMBA 1J7NA 1R1HA 5LABA 4JIJA 3E8RA 1CIZA 3O2XA 3WV1A 5B5PA 1IAAA 4H76A 1ASTA 3N2UA 2OXZA 3LGPA 2DW1A 1ND1A 3LK8A 2W13A 1C8TA 1BIWA 3ZVSA 2CKIA 2RJPA 5I0LA 2J0TA 3KRYA 3LMCA 3K7NA 4H3XA 3ZUKA 1R55A 4R3VA 3VTGA 2OW1A 1GE7A 1QUAA 4GWNA 3F16A 5D3CA 1EUBA 4WKIA 3WV3A 3LJGA 5H8XA 4A7BA 1XFYA 1SRPA 1IADA 1KUKA 1D7XA 3G42A
chains in the Genus database with same CATH superfamily
4QKZA 5CYIB 2DD5B 5IF1B 1JK3A 1HTDA 1R1IA 2FV9A 3TSKA 4F7JB 1HFSA 4TTHA 2UZBB 2MLSA 2W2HA 4DV8A 4ILWD 1OIUB 3X24B 2K9CA 3LUNA 5FGKB 1MNCA 1Z3JA 3ELMA 1GO7P 1JSUB 4L6TA 2HU6A 2EUFA 4GR3A 2C4GB 1GY3B 4H49A 3HDAP 4Y72B 4IMYB 1XO2A 2F2CA 2C5VB 2QGSA 3I7IA 4GR8A 1XFWA 2O36A 2CJMB 4H84A 4EOPB 1JAOA 5BNJB 4OB0B 1Y0VA 3DL1A 3EHXA 4L7AA 1FKMA 4BCGB 3O0GD 2QDYB 3EIDB 1AF0A 2W15A 4PKSA 1G4KA 1R1JA 2DDFA 1QLBA 4ZGEB 4JA1A 1OS9A 1QJIA 830CA 2JNPA 1MMPA 3DPFA 4AYKA 3LKAA 1IAEA 1A85A 1KXUA 2Y6DA 1ENWA 4F7NB 1BKCA 1UTTA 1CGFA 1XFVA 2N8RA 3F19A 1N4MA 3QXEB 3CKIA 2RJQA 3G5CA 1PWQA 3K7LA 2DXBB 1ZXCA 2IW6B 5I3MA 1QICA 1YQYA 5CZMA 1R54A 1KUGA 4NSTB 5CEIB 3OHOA 1GH6B 3DPEA 4XBHA 4AI6A 3QYEA 3VYGB 3DWBA 2UZLB 1HOVA 2BKZB 2ZPEB 5L2WB 4WZVA 2IW9B 3DJBA 1OS2A 2PJTA 1AISB 2X3CA 4BCNB 2A8HA 3HBLA 1CXVA 4BCPB 1FBLA 1GKCA 2CCIB 1JIWP 4CXAB 4PKRA 1AHJB 2USNA 1FVVB 4ELJA 2UZEB 1G05A 2I47A 1L6JA 2KRJA 2OZRA 2W99A 1HY7A 4BCMD 1H28B 4EC9B 5D2BA 3GTMS 4XM8A 1FM1A 3GBOA 4BCJB 1H1QB 2TCLA 3MI9B 3WVEB 1E7PA 2WMAB 1VYWB 2AYKA 3TT4A 3KHIA 2QFZA 1JSTB 3POMA 4CFUD 4EOSB 1PWVA 3F17A 4ON1A 5I43A 2WO9A 1AD6A 4YOOA 2DPPB 1I1IP 1TFBA 4HMAA 5ICPB 4WK7A 3QYGB 4EOKB 3HY9A 4XM7A 1XM5A 4F6SB 2L0RA 3KEKA 4EONB 1KBCA 1ZVXA 1JAPA 2BPMB 2C6TB 1GE6A 5CUHA 5LMKB 3PO3S 1BZSA 1G3NC 5BOTA 3DNGA 3HYGA 3F15A 2YIGA 3QWLA 4ROCA 1I76A 1ROSA 5EFQB 1I73A 1E9HB 5ACBA 1TVIA 2LW4A 3B92A 2PK2A 1GE5A 3LE9A 4AIGA 3QZ9B 3LJTA 3TVCA 4H1QA 3HY7A 1FLSA 4HX3A 4HLQA 4DF9A 4BCHB 5I2ZA 2CZ6B 5EJCA 1MMQA 1F5QB 3A8GB 1RMZA 3LUMA 1OIYB 2DMEA 3EWJA 3AYUA 1YCMA 1KAPP 4MFDA 2E2DA 3MY5B 1BQOA 4PKQA 4CFMB 1QMZB 2OW0A 2CCHB 3VKGA 1P5EB 3HO8A 4BXXX 3AIGA 2OI0A 1GO8P 4KRDB 3MIAB 1C9BA 2X7MA 4ZGJB 2G77A 2W9FA 3HHTB 1BUVM 1DTHA 4BCQD 2X3AA 1YOUA 1H71P 3TW7A 2WPAB 2YB9A 1BUDA 2WEVB 4JX6A 4FM4B 1HV5A 4J4MA 2ZPGB 3VYHB 1BKCI 5I5ZB 2XS3A 3A8LB 1O9KB 1OL2B 2KR6A 1C3IA 2QQ8A 1G49A 4EFSA 1URCB 3QYBA 1IACA 2FV5A 2OY4A 1WNIA 4FXYP 3DTKA 4BCMB 2W96A 3B8ZA 4L63A 2DD4B 1ATLA 1SLNA 1B8YA 4HNVA 3EDGA 3I7GA 3F1AA 5JMYA 3HB2P 3HBUP 2V4BA 4CFUB 4WKEA 4H82A 1G9KA 4IUWA 2IVXA 4M6VA 1D5JA 1YP1A 2DW0A 2O3EA 2ZZDB 3WV2A 3ZXHA 2OW2A 4Z6YA 1XURA 4GQLA 3LIRA 2OVZA 4BY1X 4QSHA 2XS4A 5D1UA 4IJOA 3F18A 3KMEA 5IDNB 3G33B 1JJ9A 2CZ0B 3SHIA 4II5B 2MZIA 3F5XB 4CFWB 4BBSM 3LIKA 1JKYA 5CXAA 1C7KA 1XFZA 1GUXA 2AHJB 2JIHA 3DDPB 4G0DA 3WVDB 1CK7A 1BU2A 3QZ5B 4BBRM 4XCTA 4HNUA 4ZGDB 3QHWB 1D8FA 2OXUA 1PKDB 2BS3A 5HVYB 4CTHA 3U1RA 1BKCE 5BOYA 1IABA 2DW2A 2B9RA 1HFCA 1UTZA 1QJJA 1UGPB 4YOZA 4JQGA 3H4CA 1CAQA 1PWPA 2MZHA 2PMIB 4I03A 3UVCA 4EOJB 4BY7X 2POJA 1XFXA 3BLQB 1AYKA 4JPAA 4A3WA 1ZP5A 4JX4A 4DD8A 1CGEA 1PWWA 3X25B 1CGLA 5DQVA 2YUFA 4YC3B 2DDYA 2EROA 1Q3AA 1UGQB 1K7GA 1ZXVA 4WF6A 4BCQB 2D0QB 4NC6A 3L0TA 2KMGA 3EJ1B 3DTOA 3BG5A 1JAQA 1IAGA 2UUEB 2OW9A 4EOIB 3HZJA 1KUFA 3VI1A 4F70B 1ZS0A 3EHYA 3RTSA 2ZPFB 4ROEA 4F7SB 2WO8A 3P1VA 4DPEA 3HDBA 3KECA 1JH1A 2K2GA 5LQFB 5D7WA 2ZPHB 1SLMA 4FU4A 1UNLD 4AKGA 2JSDA 2R7GA 4GWMA 3RTTA 1FINB 4CFXB 4GUYA 4CFVB 2JGZB 4PKWA 2AIGP 1OI9B 1O0TA 4BCKB 2Y6CA 3QYHB 2ERPA 4GF1A 1H4LD 3L0VA 5BPAA 2WIHB 2ZPIB 3DTEA 3KMCA 2J83A 1CQRA 4H2EA 2C5NB 4PKUA 4KRCB 5DQWA 2WOAA 1PWUA 4AKHA 1GXDA 3TNIB 4ZR5A 5HQ0B 4EC8B 3K7AM 966CA 4F7LB 3KEJA 1D8MA 2CYZB 1MMRA 4AXQA 4BCIB 5HBHB 1G12A 2ZPBB 3BG9A 4OGRB 2CZ7B 2PHGA 3BHUB 1Y93A 1EAKA 1OM7A 3EDIA 2CZ1B 2UZDB 3TN8B 3NDQA 4PKTA 3USNA 4EOQB 2IW8B 4EOLB 1XUCA 1O9KA 2I40B 1BSWA 1BM6A 5D1TA 2QF7A 2OXWA 3LILA 4OB3B 1SU3A 1AKLA 3DSLA 2I53A 3EDHA 5I12A 3X28B 4MIMA 2WFYB 1H1RB 3O64A 1BQQM 2W12A 5L7FA 1GKDA 4AKIA 3DTIA 3B2ZA 1ZTQA 3NX7A 5HBEB 3VKHA 1S4BP 3LJZA 1H1PB 4JX5A 1OM8A 1SMPA 2WHBB 4OB1B 1QIBA 2D1NA 2QPJA 5L79A 1OZ9A 1XAXA 2CLTA 1EB6A 3B57A 3BLHB 4I3ZB 1RM8A 3LQBA 2MZEA 4FVLA 4G6LB 1QIAA 1Y8JA 1KUKA 1USNA 4XM6A 4CFNB 1H1SB 3LEAA 3P24A 1UGSB 3BLRB 4OR5B 1JANA 2W14A 4CRLB 2E3XA 4JP4A 2X3BA 2JT6A 4EOOB 1XFUA 3QHRB 1UMSA 2SRTA 3N2VA 1JOWA 1OM6A 5HNBB 1UNHD 1H25B 5B5OA 2G9XB 1B3DA 456CA 4EOMB 3EDZA 2JT5A 3BHVB 1TD6A 5IHYA 4BCFB 1KUIA 4LOCA 3HBVP 1SATA 2Z2DA 1JIZA 2OY2A 1VINA 1UMTA 3OHLA 1OMJA 4Q1LA 3Q2GA 1O0QA 3A8HB 3TS4A 2D1OA 3AYKA 4PKVA 4IN9A 2W9ZA 4RODA 1KUHA 3MA2A 2V22B 4L19A 4ELLA 1DMTA 2MLRA 2W0DA 1OKVB 1VOLA 4AUOA 3Q2HA 5D1SA 2OVXA 1K7IA 3HB9A 3V96B 3BA0A 2X1NB 1W98B 2WJ9A 3X20B 2WXVB 4GR0A 1UEAA 4G9LA 1IREB 4H30A 3X26B 1A86A 1OO9A 2QDJA 4FXQA 1XUDA 3KWVC 4FX3B 5I4OA 2ERQA 1K7QA 1ZP2A 3LQ0A 4I35A 1H27B 2DXCB 3MY1B 1GUXB 1MMBA 3LQ5B 1J7NA 4F6UB 1R1HA 5LABA 4UN0A 3TNWB 3E8RA 4JIJA 1CIZA 2PK9B 3O2XA 3WV1A 3BHTB 1H26B 4BCOB 5B5PA 1IAAA 4H76A 1H24B 1ASTA 2IN3A 3N2UA 2WIPB 4YOSA 3RGFB 3A8MB 3A8OB 4EORB 5IDPB 2OXZA 3LGPA 2DW1A 1ND1A 3LK8A 2W13A 1JKWA 5HBJB 4MFEA 2C5OB 1C8TA 1BIWA 4HL4A 3TW6A 3ZVSA 4F6WB 2CKIA 2RJPA 1D3UB 5I0LA 2J0TA 4OB2B 3KRYA 3LMCA 3M03A 3K7NA 4H3XA 3ZUKA 1R55A 4R3VA 3VTGA 2OW1A 1GE7A 1OL1B 1QUAA 1UNGD 2WMBB 4GWNA 2BS4A 1V29B 2C5XB 3F16A 2BS2A 5D3CA 1EUBA 4WKIA 2ZCFB 3WV3A 3BG3A 3DOGB 3LJGA 1OKWB 5H8XA 3TNHB 4A7BA 3EOCB 1XFYA 2PJQA 1UGRB 1SRPA 1IADA 4BCND 3DDQB 1D7XA 3G42A 1OGUB 4HNTA
chains in the Genus database with same CATH topology
4QKZA 1JK3A 2DD5B 1HTDA 1R1IA 2FV9A 3TSKA 1HFSA 2MLSA 4DV8A 4ILWD 3X24B 2K9CA 3LUNA 1Z3JA 1MNCA 3ELMA 1GO7P 4L6TA 2HU6A 4GR3A 4H49A 3HDAP 3I7IA 4GR8A 1XFWA 2O36A 4H84A 1JAOA 4OB0B 1Y0VA 3DL1A 3EHXA 4L7AA 1FKMA 2QDYB 1AF0A 2W15A 4PKSA 1G4KA 1R1JA 2DDFA 1QLBA 4ZGEB 4JA1A 1OS9A 1QJIA 830CA 2JNPA 1MMPA 3DPFA 4AYKA 3LKAA 1IAEA 1A85A 2Y6DA 1BKCA 1UTTA 1CGFA 1XFVA 2N8RA 3F19A 3QXEB 3CKIA 2RJQA 3G5CA 1PWQA 3K7LA 2DXBB 1ZXCA 5I3MA 1QICA 1YQYA 5CZMA 1R54A 1KUGA 3OHOA 3DPEA 4XBHA 4AI6A 3QYEA 3VYGB 3DWBA 1HOVA 2ZPEB 4WZVA 1OS2A 2PJTA 2X3CA 2A8HA 3HBLA 1CXVA 1FBLA 1GKCA 1JIWP 4PKRA 1AHJB 2USNA 4ELJA 1G05A 2I47A 1L6JA 2KRJA 2OZRA 1HY7A 5D2BA 4XM8A 1FM1A 3GBOA 2TCLA 3TT4A 1E7PA 3WVEB 2AYKA 3KHIA 2QFZA 1PWVA 3F17A 4ON1A 5I43A 2WO9A 2DPPB 1I1IP 4HMAA 4WK7A 3QYGB 3HY9A 4XM7A 2L0RA 3KEKA 1ZVXA 1KBCA 1JAPA 1GE6A 5CUHA 1BZSA 5BOTA 3DNGA 3HYGA 3F15A 2YIGA 3QWLA 1I76A 1ROSA 1I73A 3B92A 1GE5A 3LE9A 4AIGA 3QZ9B 3LJTA 3TVCA 4H1QA 3HY7A 1FLSA 4HX3A 4HLQA 4DF9A 5I2ZA 2CZ6B 5EJCA 1MMQA 3A8GB 1RMZA 3LUMA 3EWJA 3AYUA 1YCMA 1KAPP 4MFDA 2E2DA 1BQOA 4PKQA 2OW0A 3VKGA 3HO8A 3AIGA 2OI0A 1GO8P 2X7MA 4ZGJB 2G77A 1BUVM 3HHTB 1DTHA 2X3AA 1YOUA 1H71P 3TW7A 2YB9A 1BUDA 4JX6A 4FM4B 1HV5A 4J4MA 2ZPGB 3VYHB 1BKCI 2XS3A 3A8LB 2KR6A 1C3IA 2QQ8A 1G49A 4EFSA 3QYBA 1IACA 2FV5A 2OY4A 1WNIA 4FXYP 3DTKA 3B8ZA 4L63A 2DD4B 1ATLA 1SLNA 1B8YA 4HNVA 3EDGA 3I7GA 3F1AA 5JMYA 3HB2P 3HBUP 2V4BA 4WKEA 4H82A 1G9KA 4IUWA 1D5JA 4M6VA 1YP1A 2DW0A 2O3EA 2ZZDB 3WV2A 3ZXHA 2OW2A 4Z6YA 1XURA 4GQLA 3LIRA 2OVZA 4QSHA 2XS4A 5D1UA 4IJOA 3F18A 3KMEA 1JJ9A 2CZ0B 3SHIA 2MZIA 4BBSM 3LIKA 1JKYA 5CXAA 1C7KA 1XFZA 2AHJB 2JIHA 4G0DA 3WVDB 1CK7A 3QZ5B 4BBRM 4XCTA 4HNUA 4ZGDB 1D8FA 2OXUA 2BS3A 4CTHA 3U1RA 1BKCE 5BOYA 1IABA 2DW2A 1HFCA 1UTZA 1QJJA 1UGPB 4JQGA 3H4CA 1CAQA 1PWPA 2MZHA 4I03A 3UVCA 2POJA 1XFXA 1AYKA 4JPAA 4A3WA 1ZP5A 4JX4A 4DD8A 1CGEA 1PWWA 3X25B 1CGLA 2YUFA 2EROA 2DDYA 1Q3AA 1UGQB 1K7GA 1ZXVA 4WF6A 2D0QB 4NC6A 3L0TA 2KMGA 3BG5A 1JAQA 1IAGA 2OW9A 3HZJA 1KUFA 3VI1A 1ZS0A 3EHYA 3RTSA 2ZPFB 2WO8A 3P1VA 4DPEA 3HDBA 3KECA 1JH1A 2K2GA 5D7WA 2ZPHB 1SLMA 4FU4A 4AKGA 2JSDA 4GWMA 3RTTA 4GUYA 4PKWA 2AIGP 1O0TA 2Y6CA 3QYHB 2ERPA 4GF1A 5BPAA 3L0VA 2ZPIB 3DTEA 3KMCA 2J83A 1CQRA 4H2EA 4PKUA 2WOAA 1PWUA 4AKHA 1GXDA 4ZR5A 966CA 3KEJA 1D8MA 2CYZB 1MMRA 4AXQA 1G12A 2ZPBB 3BG9A 2CZ7B 1Y93A 1EAKA 1OM7A 3EDIA 2CZ1B 4PKTA 3USNA 1XUCA 1BSWA 1BM6A 5D1TA 2QF7A 2OXWA 3LILA 4OB3B 1SU3A 1AKLA 3DSLA 3EDHA 5I12A 3X28B 4MIMA 3O64A 1BQQM 2W12A 5L7FA 1GKDA 4AKIA 3DTIA 3B2ZA 1ZTQA 3NX7A 3VKHA 1S4BP 3LJZA 1OM8A 4JX5A 1SMPA 4OB1B 1QIBA 2D1NA 2QPJA 5L79A 2CLTA 1EB6A 1RM8A 3LQBA 2MZEA 4FVLA 1QIAA 1Y8JA 4XM6A 1USNA 3LEAA 3P24A 1UGSB 1JANA 2W14A 2E3XA 4JP4A 2X3BA 2JT6A 1XFUA 1UMSA 2SRTA 3N2VA 1OM6A 5B5OA 1B3DA 456CA 3EDZA 2JT5A 1KUIA 4LOCA 3HBVP 1SATA 2Z2DA 1JIZA 2OY2A 1UMTA 3OHLA 4Q1LA 1OMJA 3Q2GA 1O0QA 3A8HB 3TS4A 2D1OA 3AYKA 4PKVA 4IN9A 1KUHA 3MA2A 4L19A 1DMTA 2MLRA 2W0DA 4AUOA 3Q2HA 5D1SA 2OVXA 1K7IA 3HB9A 3V96B 3BA0A 2WJ9A 3X20B 4GR0A 1UEAA 4G9LA 1IREB 4H30A 3X26B 1A86A 1OO9A 2QDJA 4FXQA 1XUDA 3KWVC 5I4OA 2ERQA 1K7QA 3LQ0A 4I35A 2DXCB 1MMBA 1J7NA 1R1HA 5LABA 4JIJA 3E8RA 1CIZA 3O2XA 3WV1A 5B5PA 1IAAA 4H76A 1ASTA 3N2UA 3A8MB 3A8OB 2OXZA 3LGPA 2DW1A 1ND1A 3LK8A 2W13A 1C8TA 4MFEA 1BIWA 4HL4A 3TW6A 3ZVSA 2CKIA 2RJPA 5I0LA 2J0TA 4OB2B 3KRYA 3LMCA 3K7NA 4H3XA 3ZUKA 1R55A 4R3VA 3VTGA 2OW1A 1GE7A 1QUAA 4GWNA 2BS4A 1V29B 3F16A 2BS2A 5D3CA 1EUBA 4WKIA 2ZCFB 3WV3A 3BG3A 3LJGA 5H8XA 4A7BA 1XFYA 1SRPA 1UGRB 1IADA 1KUKA 1D7XA 3G42A 4HNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QKZ A;  1JK3 A;  1R1I A;  1HTD A;  2FV9 A;  3TSK A;  1HFS A;  2MLS A;  4DV8 A;  4ILW D;  2K9C A;  3LUN A;  1Z3J A;  1MNC A;  3ELM A;  1GO7 P;  4L6T A;  2HU6 A;  4GR3 A;  4H49 A;  3HDA P;  3I7I A;  4GR8 A;  1XFW A;  2O36 A;  4H84 A;  1JAO A;  1Y0V A;  3DL1 A;  3EHX A;  1AF0 A;  2W15 A;  4PKS A;  1G4K A;  1R1J A;  2DDF A;  4JA1 A;  1OS9 A;  1QJI A;  830C A;  2JNP A;  1MMP A;  3DPF A;  4AYK A;  3LKA A;  1IAE A;  1A85 A;  2Y6D A;  1BKC A;  1UTT A;  1CGF A;  1XFV A;  2N8R A;  3F19 A;  3CKI A;  2RJQ A;  3G5C A;  1PWQ A;  3K7L A;  1ZXC A;  5I3M A;  1QIC A;  1YQY A;  5CZM A;  1R54 A;  1KUG A;  3OHO A;  3DPE A;  4XBH A;  3DWB A;  1HOV A;  4WZV A;  1OS2 A;  2PJT A;  2X3C A;  2A8H A;  1CXV A;  1FBL A;  1GKC A;  1JIW P;  4PKR A;  2USN A;  1G05 A;  2I47 A;  1L6J A;  2KRJ A;  2OZR A;  1HY7 A;  5D2B A;  4XM8 A;  1FM1 A;  3GBO A;  2TCL A;  3TT4 A;  2AYK A;  3KHI A;  1PWV A;  3F17 A;  4ON1 A;  5I43 A;  2WO9 A;  1I1I P;  4HMA A;  4WK7 A;  3HY9 A;  4XM7 A;  2L0R A;  3KEK A;  1ZVX A;  1KBC A;  1JAP A;  1GE6 A;  5CUH A;  1BZS A;  5BOT A;  3DNG A;  3HYG A;  3F15 A;  2YIG A;  1I76 A;  1ROS A;  1I73 A;  3B92 A;  1GE5 A;  3LE9 A;  4AIG A;  3LJT A;  3TVC A;  4H1Q A;  3HY7 A;  1FLS A;  4HX3 A;  4DF9 A;  5I2Z A;  1MMQ A;  1RMZ A;  3LUM A;  3EWJ A;  3AYU A;  1YCM A;  1KAP P;  2E2D A;  1BQO A;  4PKQ A;  2OW0 A;  3AIG A;  2OI0 A;  1GO8 P;  2X7M A;  1BUV M;  1DTH A;  2X3A A;  1YOU A;  1H71 P;  2YB9 A;  1BUD A;  1HV5 A;  4J4M A;  1BKC I;  2XS3 A;  1C3I A;  1G49 A;  4EFS A;  1IAC A;  2FV5 A;  2OY4 A;  1WNI A;  4FXY P;  3B8Z A;  4L63 A;  1ATL A;  1SLN A;  1B8Y A;  3EDG A;  3I7G A;  3F1A A;  5JMY A;  3HB2 P;  3HBU P;  2V4B A;  4WKE A;  4H82 A;  1G9K A;  4IUW A;  1D5J A;  1YP1 A;  2DW0 A;  2O3E A;  3WV2 A;  3ZXH A;  2OW2 A;  1XUR A;  4GQL A;  3LIR A;  2OVZ A;  2XS4 A;  5D1U A;  4IJO A;  3F18 A;  3KME A;  1JJ9 A;  3SHI A;  2MZI A;  3LIK A;  1JKY A;  5CXA A;  1C7K A;  1XFZ A;  2JIH A;  4G0D A;  1CK7 A;  4XCT A;  1D8F A;  2OXU A;  4CTH A;  3U1R A;  1BKC E;  5BOY A;  1IAB A;  2DW2 A;  1HFC A;  1UTZ A;  1QJJ A;  4JQG A;  1CAQ A;  1PWP A;  2MZH A;  4I03 A;  3UVC A;  2POJ A;  1XFX A;  1AYK A;  4JPA A;  4A3W A;  1ZP5 A;  4DD8 A;  1CGE A;  1PWW A;  1CGL A;  2ERO A;  2DDY A;  1Q3A A;  1K7G A;  4WF6 A;  1ZXV A;  3L0T A;  1JAQ A;  1IAG A;  2OW9 A;  1KUF A;  3VI1 A;  1ZS0 A;  3EHY A;  3RTS A;  2WO8 A;  3P1V A;  4DPE A;  3HDB A;  3KEC A;  1JH1 A;  2K2G A;  5D7W A;  1SLM A;  4FU4 A;  2JSD A;  4GWM A;  3RTT A;  4GUY A;  4PKW A;  2AIG P;  1O0T A;  2Y6C A;  2ERP A;  4GF1 A;  5BPA A;  3L0V A;  3KMC A;  2J83 A;  1CQR A;  4H2E A;  4PKU A;  2WOA A;  1PWU A;  1GXD A;  4ZR5 A;  966C A;  3KEJ A;  1D8M A;  1MMR A;  4AXQ A;  1G12 A;  1Y93 A;  1EAK A;  1OM7 A;  3EDI A;  4PKT A;  3USN A;  1XUC A;  1BSW A;  1BM6 A;  5D1T A;  2OXW A;  3LIL A;  1SU3 A;  3DSL A;  1AKL A;  3EDH A;  5I12 A;  3O64 A;  1BQQ M;  2W12 A;  5L7F A;  1GKD A;  3B2Z A;  1ZTQ A;  3NX7 A;  1S4B P;  3LJZ A;  1OM8 A;  1SMP A;  2D1N A;  1QIB A;  2QPJ A;  5L79 A;  2CLT A;  1EB6 A;  1RM8 A;  3LQB A;  2MZE A;  4FVL A;  1QIA A;  1Y8J A;  4XM6 A;  1USN A;  3LEA A;  3P24 A;  1JAN A;  2W14 A;  2E3X A;  4JP4 A;  2X3B A;  2JT6 A;  1XFU A;  1UMS A;  2SRT A;  3N2V A;  1OM6 A;  5B5O A;  1B3D A;  456C A;  3EDZ A;  2JT5 A;  1KUI A;  3HBV P;  1SAT A;  2Z2D A;  1JIZ A;  2OY2 A;  1UMT A;  3OHL A;  4Q1L A;  1OMJ A;  3Q2G A;  1O0Q A;  3TS4 A;  2D1O A;  3AYK A;  4PKV A;  4IN9 A;  1KUH A;  3MA2 A;  4L19 A;  1DMT A;  2MLR A;  2W0D A;  4AUO A;  3Q2H A;  5D1S A;  2OVX A;  1K7I A;  3V96 B;  3BA0 A;  4GR0 A;  1UEA A;  4G9L A;  4H30 A;  1A86 A;  1OO9 A;  4FXQ A;  1XUD A;  3KWV C;  5I4O A;  2ERQ A;  1K7Q A;  3LQ0 A;  4I35 A;  1MMB A;  1J7N A;  1R1H A;  5LAB A;  4JIJ A;  3E8R A;  1CIZ A;  3O2X A;  3WV1 A;  5B5P A;  1IAA A;  4H76 A;  1AST A;  3N2U A;  2OXZ A;  3LGP A;  2DW1 A;  1ND1 A;  3LK8 A;  2W13 A;  1C8T A;  1BIW A;  3ZVS A;  2CKI A;  2RJP A;  5I0L A;  2J0T A;  3KRY A;  3LMC A;  3K7N A;  4H3X A;  3ZUK A;  1R55 A;  4R3V A;  3VTG A;  2OW1 A;  1GE7 A;  1QUA A;  4GWN A;  3F16 A;  5D3C A;  1EUB A;  4WKI A;  3WV3 A;  3LJG A;  5H8X A;  4A7B A;  1XFY A;  1SRP A;  1IAD A;  1KUK A;  1D7X A;  3G42 A; 
#chains in the Genus database with same CATH topology
 4QKZ A;  5CYI B;  2DD5 B;  5IF1 B;  1JK3 A;  1HTD A;  1R1I A;  2FV9 A;  3TSK A;  4F7J B;  1HFS A;  4TTH A;  2UZB B;  2MLS A;  2W2H A;  4DV8 A;  4ILW D;  1OIU B;  3X24 B;  2K9C A;  3LUN A;  5FGK B;  1MNC A;  1Z3J A;  3ELM A;  1GO7 P;  1JSU B;  4L6T A;  2HU6 A;  2EUF A;  4GR3 A;  2C4G B;  1GY3 B;  4H49 A;  3HDA P;  4Y72 B;  4IMY B;  1XO2 A;  2F2C A;  2C5V B;  2QGS A;  3I7I A;  4GR8 A;  1XFW A;  2O36 A;  2CJM B;  4H84 A;  4EOP B;  1JAO A;  5BNJ B;  4OB0 B;  1Y0V A;  3DL1 A;  3EHX A;  4L7A A;  1FKM A;  4BCG B;  3O0G D;  2QDY B;  3EID B;  1AF0 A;  2W15 A;  4PKS A;  1G4K A;  1R1J A;  2DDF A;  1QLB A;  4ZGE B;  4JA1 A;  1OS9 A;  1QJI A;  830C A;  2JNP A;  1MMP A;  3DPF A;  4AYK A;  3LKA A;  1IAE A;  1A85 A;  1KXU A;  2Y6D A;  1ENW A;  4F7N B;  1BKC A;  1UTT A;  1CGF A;  1XFV A;  2N8R A;  3F19 A;  1N4M A;  3QXE B;  3CKI A;  2RJQ A;  3G5C A;  1PWQ A;  3K7L A;  2DXB B;  1ZXC A;  2IW6 B;  5I3M A;  1QIC A;  1YQY A;  5CZM A;  1R54 A;  1KUG A;  4NST B;  5CEI B;  3OHO A;  1GH6 B;  3DPE A;  4XBH A;  4AI6 A;  3QYE A;  3VYG B;  3DWB A;  2UZL B;  1HOV A;  2BKZ B;  2ZPE B;  5L2W B;  4WZV A;  2IW9 B;  3DJB A;  1OS2 A;  2PJT A;  1AIS B;  2X3C A;  4BCN B;  2A8H A;  3HBL A;  1CXV A;  4BCP B;  1FBL A;  1GKC A;  2CCI B;  1JIW P;  4CXA B;  4PKR A;  1AHJ B;  2USN A;  1FVV B;  4ELJ A;  2UZE B;  1G05 A;  2I47 A;  1L6J A;  2KRJ A;  2OZR A;  2W99 A;  1HY7 A;  4BCM D;  1H28 B;  4EC9 B;  5D2B A;  3GTM S;  4XM8 A;  1FM1 A;  3GBO A;  4BCJ B;  1H1Q B;  2TCL A;  3MI9 B;  3WVE B;  1E7P A;  2WMA B;  1VYW B;  2AYK A;  3TT4 A;  3KHI A;  2QFZ A;  1JST B;  3POM A;  4CFU D;  4EOS B;  1PWV A;  3F17 A;  4ON1 A;  5I43 A;  2WO9 A;  1AD6 A;  4YOO A;  2DPP B;  1I1I P;  1TFB A;  4HMA A;  5ICP B;  4WK7 A;  3QYG B;  4EOK B;  3HY9 A;  4XM7 A;  1XM5 A;  4F6S B;  2L0R A;  3KEK A;  4EON B;  1KBC A;  1ZVX A;  1JAP A;  2BPM B;  2C6T B;  1GE6 A;  5CUH A;  5LMK B;  3PO3 S;  1BZS A;  1G3N C;  5BOT A;  3DNG A;  3HYG A;  3F15 A;  2YIG A;  3QWL A;  4ROC A;  1I76 A;  1ROS A;  5EFQ B;  1I73 A;  1E9H B;  5ACB A;  1TVI A;  2LW4 A;  3B92 A;  2PK2 A;  1GE5 A;  3LE9 A;  4AIG A;  3QZ9 B;  3LJT A;  3TVC A;  4H1Q A;  3HY7 A;  1FLS A;  4HX3 A;  4HLQ A;  4DF9 A;  4BCH B;  5I2Z A;  2CZ6 B;  5EJC A;  1MMQ A;  1F5Q B;  3A8G B;  1RMZ A;  3LUM A;  1OIY B;  2DME A;  3EWJ A;  3AYU A;  1YCM A;  1KAP P;  4MFD A;  2E2D A;  3MY5 B;  1BQO A;  4PKQ A;  4CFM B;  1QMZ B;  2OW0 A;  2CCH B;  3VKG A;  1P5E B;  3HO8 A;  4BXX X;  3AIG A;  2OI0 A;  1GO8 P;  4KRD B;  3MIA B;  1C9B A;  2X7M A;  4ZGJ B;  2G77 A;  2W9F A;  3HHT B;  1BUV M;  1DTH A;  4BCQ D;  2X3A A;  1YOU A;  1H71 P;  3TW7 A;  2WPA B;  2YB9 A;  1BUD A;  2WEV B;  4JX6 A;  4FM4 B;  1HV5 A;  4J4M A;  2ZPG B;  3VYH B;  1BKC I;  5I5Z B;  2XS3 A;  3A8L B;  1O9K B;  1OL2 B;  2KR6 A;  1C3I A;  2QQ8 A;  1G49 A;  4EFS A;  1URC B;  3QYB A;  1IAC A;  2FV5 A;  2OY4 A;  1WNI A;  4FXY P;  3DTK A;  4BCM B;  2W96 A;  3B8Z A;  4L63 A;  2DD4 B;  1ATL A;  1SLN A;  1B8Y A;  4HNV A;  3EDG A;  3I7G A;  3F1A A;  5JMY A;  3HB2 P;  3HBU P;  2V4B A;  4CFU B;  4WKE A;  4H82 A;  1G9K A;  4IUW A;  2IVX A;  4M6V A;  1D5J A;  1YP1 A;  2DW0 A;  2O3E A;  2ZZD B;  3WV2 A;  3ZXH A;  2OW2 A;  4Z6Y A;  1XUR A;  4GQL A;  3LIR A;  2OVZ A;  4BY1 X;  4QSH A;  2XS4 A;  5D1U A;  4IJO A;  3F18 A;  3KME A;  5IDN B;  3G33 B;  1JJ9 A;  2CZ0 B;  3SHI A;  4II5 B;  2MZI A;  3F5X B;  4CFW B;  4BBS M;  3LIK A;  1JKY A;  5CXA A;  1C7K A;  1XFZ A;  1GUX A;  2AHJ B;  2JIH A;  3DDP B;  4G0D A;  3WVD B;  1CK7 A;  1BU2 A;  3QZ5 B;  4BBR M;  4XCT A;  4HNU A;  4ZGD B;  3QHW B;  1D8F A;  2OXU A;  1PKD B;  2BS3 A;  5HVY B;  4CTH A;  3U1R A;  1BKC E;  5BOY A;  1IAB A;  2DW2 A;  2B9R A;  1HFC A;  1UTZ A;  1QJJ A;  1UGP B;  4YOZ A;  4JQG A;  3H4C A;  1CAQ A;  1PWP A;  2MZH A;  2PMI B;  4I03 A;  3UVC A;  4EOJ B;  4BY7 X;  2POJ A;  1XFX A;  3BLQ B;  1AYK A;  4JPA A;  4A3W A;  1ZP5 A;  4JX4 A;  4DD8 A;  1CGE A;  1PWW A;  3X25 B;  1CGL A;  5DQV A;  2YUF A;  4YC3 B;  2DDY A;  2ERO A;  1Q3A A;  1UGQ B;  1K7G A;  1ZXV A;  4WF6 A;  4BCQ B;  2D0Q B;  4NC6 A;  3L0T A;  2KMG A;  3EJ1 B;  3DTO A;  3BG5 A;  1JAQ A;  1IAG A;  2UUE B;  2OW9 A;  4EOI B;  3HZJ A;  1KUF A;  3VI1 A;  4F70 B;  1ZS0 A;  3EHY A;  3RTS A;  2ZPF B;  4ROE A;  4F7S B;  2WO8 A;  3P1V A;  4DPE A;  3HDB A;  3KEC A;  1JH1 A;  2K2G A;  5LQF B;  5D7W A;  2ZPH B;  1SLM A;  4FU4 A;  1UNL D;  4AKG A;  2JSD A;  2R7G A;  4GWM A;  3RTT A;  1FIN B;  4CFX B;  4GUY A;  4CFV B;  2JGZ B;  4PKW A;  2AIG P;  1OI9 B;  1O0T A;  4BCK B;  2Y6C A;  3QYH B;  2ERP A;  4GF1 A;  1H4L D;  3L0V A;  5BPA A;  2WIH B;  2ZPI B;  3DTE A;  3KMC A;  2J83 A;  1CQR A;  4H2E A;  2C5N B;  4PKU A;  4KRC B;  5DQW A;  2WOA A;  1PWU A;  4AKH A;  1GXD A;  3TNI B;  4ZR5 A;  5HQ0 B;  4EC8 B;  3K7A M;  966C A;  4F7L B;  3KEJ A;  1D8M A;  2CYZ B;  1MMR A;  4AXQ A;  4BCI B;  5HBH B;  1G12 A;  2ZPB B;  3BG9 A;  4OGR B;  2CZ7 B;  2PHG A;  3BHU B;  1Y93 A;  1EAK A;  1OM7 A;  3EDI A;  2CZ1 B;  2UZD B;  3TN8 B;  3NDQ A;  4PKT A;  3USN A;  4EOQ B;  2IW8 B;  4EOL B;  1XUC A;  1O9K A;  2I40 B;  1BSW A;  1BM6 A;  5D1T A;  2QF7 A;  2OXW A;  3LIL A;  4OB3 B;  1SU3 A;  1AKL A;  3DSL A;  2I53 A;  3EDH A;  5I12 A;  3X28 B;  4MIM A;  2WFY B;  1H1R B;  3O64 A;  1BQQ M;  2W12 A;  5L7F A;  1GKD A;  4AKI A;  3DTI A;  3B2Z A;  1ZTQ A;  3NX7 A;  5HBE B;  3VKH A;  1S4B P;  3LJZ A;  1H1P B;  4JX5 A;  1OM8 A;  1SMP A;  2WHB B;  4OB1 B;  1QIB A;  2D1N A;  2QPJ A;  5L79 A;  1OZ9 A;  1XAX A;  2CLT A;  1EB6 A;  3B57 A;  3BLH B;  4I3Z B;  1RM8 A;  3LQB A;  2MZE A;  4FVL A;  4G6L B;  1QIA A;  1Y8J A;  1KUK A;  1USN A;  4XM6 A;  4CFN B;  1H1S B;  3LEA A;  3P24 A;  1UGS B;  3BLR B;  4OR5 B;  1JAN A;  2W14 A;  4CRL B;  2E3X A;  4JP4 A;  2X3B A;  2JT6 A;  4EOO B;  1XFU A;  3QHR B;  1UMS A;  2SRT A;  3N2V A;  1JOW A;  1OM6 A;  5HNB B;  1UNH D;  1H25 B;  5B5O A;  2G9X B;  1B3D A;  456C A;  4EOM B;  3EDZ A;  2JT5 A;  3BHV B;  1TD6 A;  5IHY A;  4BCF B;  1KUI A;  4LOC A;  3HBV P;  1SAT A;  2Z2D A;  1JIZ A;  2OY2 A;  1VIN A;  1UMT A;  3OHL A;  1OMJ A;  4Q1L A;  3Q2G A;  1O0Q A;  3A8H B;  3TS4 A;  2D1O A;  3AYK A;  4PKV A;  4IN9 A;  2W9Z A;  4ROD A;  1KUH A;  3MA2 A;  2V22 B;  4L19 A;  4ELL A;  1DMT A;  2MLR A;  2W0D A;  1OKV B;  1VOL A;  4AUO A;  3Q2H A;  5D1S A;  2OVX A;  1K7I A;  3HB9 A;  3V96 B;  3BA0 A;  2X1N B;  1W98 B;  2WJ9 A;  3X20 B;  2WXV B;  4GR0 A;  1UEA A;  4G9L A;  1IRE B;  4H30 A;  3X26 B;  1A86 A;  1OO9 A;  2QDJ A;  4FXQ A;  1XUD A;  3KWV C;  4FX3 B;  5I4O A;  2ERQ A;  1K7Q A;  1ZP2 A;  3LQ0 A;  4I35 A;  1H27 B;  2DXC B;  3MY1 B;  1GUX B;  1MMB A;  3LQ5 B;  1J7N A;  4F6U B;  1R1H A;  5LAB A;  4UN0 A;  3TNW B;  3E8R A;  4JIJ A;  1CIZ A;  2PK9 B;  3O2X A;  3WV1 A;  3BHT B;  1H26 B;  4BCO B;  5B5P A;  1IAA A;  4H76 A;  1H24 B;  1AST A;  2IN3 A;  3N2U A;  2WIP B;  4YOS A;  3RGF B;  3A8M B;  3A8O B;  4EOR B;  5IDP B;  2OXZ A;  3LGP A;  2DW1 A;  1ND1 A;  3LK8 A;  2W13 A;  1JKW A;  5HBJ B;  4MFE A;  2C5O B;  1C8T A;  1BIW A;  4HL4 A;  3TW6 A;  3ZVS A;  4F6W B;  2CKI A;  2RJP A;  1D3U B;  5I0L A;  2J0T A;  4OB2 B;  3KRY A;  3LMC A;  3M03 A;  3K7N A;  4H3X A;  3ZUK A;  1R55 A;  4R3V A;  3VTG A;  2OW1 A;  1GE7 A;  1OL1 B;  1QUA A;  1UNG D;  2WMB B;  4GWN A;  2BS4 A;  1V29 B;  2C5X B;  3F16 A;  2BS2 A;  5D3C A;  1EUB A;  4WKI A;  2ZCF B;  3WV3 A;  3BG3 A;  3DOG B;  3LJG A;  1OKW B;  5H8X A;  3TNH B;  4A7B A;  3EOC B;  1XFY A;  2PJQ A;  1UGR B;  1SRP A;  1IAD A;  4BCN D;  3DDQ B;  1D7X A;  3G42 A;  1OGU B;  4HNT A; 
#chains in the Genus database with same CATH homology
 4QKZ A;  1JK3 A;  2DD5 B;  1HTD A;  1R1I A;  2FV9 A;  3TSK A;  1HFS A;  2MLS A;  4DV8 A;  4ILW D;  3X24 B;  2K9C A;  3LUN A;  1Z3J A;  1MNC A;  3ELM A;  1GO7 P;  4L6T A;  2HU6 A;  4GR3 A;  4H49 A;  3HDA P;  3I7I A;  4GR8 A;  1XFW A;  2O36 A;  4H84 A;  1JAO A;  4OB0 B;  1Y0V A;  3DL1 A;  3EHX A;  4L7A A;  1FKM A;  2QDY B;  1AF0 A;  2W15 A;  4PKS A;  1G4K A;  1R1J A;  2DDF A;  1QLB A;  4ZGE B;  4JA1 A;  1OS9 A;  1QJI A;  830C A;  2JNP A;  1MMP A;  3DPF A;  4AYK A;  3LKA A;  1IAE A;  1A85 A;  2Y6D A;  1BKC A;  1UTT A;  1CGF A;  1XFV A;  2N8R A;  3F19 A;  3QXE B;  3CKI A;  2RJQ A;  3G5C A;  1PWQ A;  3K7L A;  2DXB B;  1ZXC A;  5I3M A;  1QIC A;  1YQY A;  5CZM A;  1R54 A;  1KUG A;  3OHO A;  3DPE A;  4XBH A;  4AI6 A;  3QYE A;  3VYG B;  3DWB A;  1HOV A;  2ZPE B;  4WZV A;  1OS2 A;  2PJT A;  2X3C A;  2A8H A;  3HBL A;  1CXV A;  1FBL A;  1GKC A;  1JIW P;  4PKR A;  1AHJ B;  2USN A;  4ELJ A;  1G05 A;  2I47 A;  1L6J A;  2KRJ A;  2OZR A;  1HY7 A;  5D2B A;  4XM8 A;  1FM1 A;  3GBO A;  2TCL A;  3TT4 A;  1E7P A;  3WVE B;  2AYK A;  3KHI A;  2QFZ A;  1PWV A;  3F17 A;  4ON1 A;  5I43 A;  2WO9 A;  2DPP B;  1I1I P;  4HMA A;  4WK7 A;  3QYG B;  3HY9 A;  4XM7 A;  2L0R A;  3KEK A;  1ZVX A;  1KBC A;  1JAP A;  1GE6 A;  5CUH A;  1BZS A;  5BOT A;  3DNG A;  3HYG A;  3F15 A;  2YIG A;  3QWL A;  1I76 A;  1ROS A;  1I73 A;  3B92 A;  1GE5 A;  3LE9 A;  4AIG A;  3QZ9 B;  3LJT A;  3TVC A;  4H1Q A;  3HY7 A;  1FLS A;  4HX3 A;  4HLQ A;  4DF9 A;  5I2Z A;  2CZ6 B;  5EJC A;  1MMQ A;  3A8G B;  1RMZ A;  3LUM A;  3EWJ A;  3AYU A;  1YCM A;  1KAP P;  4MFD A;  2E2D A;  1BQO A;  4PKQ A;  2OW0 A;  3VKG A;  3HO8 A;  3AIG A;  2OI0 A;  1GO8 P;  2X7M A;  4ZGJ B;  2G77 A;  1BUV M;  3HHT B;  1DTH A;  2X3A A;  1YOU A;  1H71 P;  3TW7 A;  2YB9 A;  1BUD A;  4JX6 A;  4FM4 B;  1HV5 A;  4J4M A;  2ZPG B;  3VYH B;  1BKC I;  2XS3 A;  3A8L B;  2KR6 A;  1C3I A;  2QQ8 A;  1G49 A;  4EFS A;  3QYB A;  1IAC A;  2FV5 A;  2OY4 A;  1WNI A;  4FXY P;  3DTK A;  3B8Z A;  4L63 A;  2DD4 B;  1ATL A;  1SLN A;  1B8Y A;  4HNV A;  3EDG A;  3I7G A;  3F1A A;  5JMY A;  3HB2 P;  3HBU P;  2V4B A;  4WKE A;  4H82 A;  1G9K A;  4IUW A;  1D5J A;  4M6V A;  1YP1 A;  2DW0 A;  2O3E A;  2ZZD B;  3WV2 A;  3ZXH A;  2OW2 A;  4Z6Y A;  1XUR A;  4GQL A;  3LIR A;  2OVZ A;  4QSH A;  2XS4 A;  5D1U A;  4IJO A;  3F18 A;  3KME A;  1JJ9 A;  2CZ0 B;  3SHI A;  2MZI A;  4BBS M;  3LIK A;  1JKY A;  5CXA A;  1C7K A;  1XFZ A;  2AHJ B;  2JIH A;  4G0D A;  3WVD B;  1CK7 A;  3QZ5 B;  4BBR M;  4XCT A;  4HNU A;  4ZGD B;  1D8F A;  2OXU A;  2BS3 A;  4CTH A;  3U1R A;  1BKC E;  5BOY A;  1IAB A;  2DW2 A;  1HFC A;  1UTZ A;  1QJJ A;  1UGP B;  4JQG A;  3H4C A;  1CAQ A;  1PWP A;  2MZH A;  4I03 A;  3UVC A;  2POJ A;  1XFX A;  1AYK A;  4JPA A;  4A3W A;  1ZP5 A;  4JX4 A;  4DD8 A;  1CGE A;  1PWW A;  3X25 B;  1CGL A;  2YUF A;  2ERO A;  2DDY A;  1Q3A A;  1UGQ B;  1K7G A;  1ZXV A;  4WF6 A;  2D0Q B;  4NC6 A;  3L0T A;  2KMG A;  3BG5 A;  1JAQ A;  1IAG A;  2OW9 A;  3HZJ A;  1KUF A;  3VI1 A;  1ZS0 A;  3EHY A;  3RTS A;  2ZPF B;  2WO8 A;  3P1V A;  4DPE A;  3HDB A;  3KEC A;  1JH1 A;  2K2G A;  5D7W A;  2ZPH B;  1SLM A;  4FU4 A;  4AKG A;  2JSD A;  4GWM A;  3RTT A;  4GUY A;  4PKW A;  2AIG P;  1O0T A;  2Y6C A;  3QYH B;  2ERP A;  4GF1 A;  5BPA A;  3L0V A;  2ZPI B;  3DTE A;  3KMC A;  2J83 A;  1CQR A;  4H2E A;  4PKU A;  2WOA A;  1PWU A;  4AKH A;  1GXD A;  4ZR5 A;  966C A;  3KEJ A;  1D8M A;  2CYZ B;  1MMR A;  4AXQ A;  1G12 A;  2ZPB B;  3BG9 A;  2CZ7 B;  1Y93 A;  1EAK A;  1OM7 A;  3EDI A;  2CZ1 B;  4PKT A;  3USN A;  1XUC A;  1BSW A;  1BM6 A;  5D1T A;  2QF7 A;  2OXW A;  3LIL A;  4OB3 B;  1SU3 A;  1AKL A;  3DSL A;  3EDH A;  5I12 A;  3X28 B;  4MIM A;  3O64 A;  1BQQ M;  2W12 A;  5L7F A;  1GKD A;  4AKI A;  3DTI A;  3B2Z A;  1ZTQ A;  3NX7 A;  3VKH A;  1S4B P;  3LJZ A;  1OM8 A;  4JX5 A;  1SMP A;  4OB1 B;  1QIB A;  2D1N A;  2QPJ A;  5L79 A;  2CLT A;  1EB6 A;  1RM8 A;  3LQB A;  2MZE A;  4FVL A;  1QIA A;  1Y8J A;  4XM6 A;  1USN A;  3LEA A;  3P24 A;  1UGS B;  1JAN A;  2W14 A;  2E3X A;  4JP4 A;  2X3B A;  2JT6 A;  1XFU A;  1UMS A;  2SRT A;  3N2V A;  1OM6 A;  5B5O A;  1B3D A;  456C A;  3EDZ A;  2JT5 A;  1KUI A;  4LOC A;  3HBV P;  1SAT A;  2Z2D A;  1JIZ A;  2OY2 A;  1UMT A;  3OHL A;  4Q1L A;  1OMJ A;  3Q2G A;  1O0Q A;  3A8H B;  3TS4 A;  2D1O A;  3AYK A;  4PKV A;  4IN9 A;  1KUH A;  3MA2 A;  4L19 A;  1DMT A;  2MLR A;  2W0D A;  4AUO A;  3Q2H A;  5D1S A;  2OVX A;  1K7I A;  3HB9 A;  3V96 B;  3BA0 A;  2WJ9 A;  3X20 B;  4GR0 A;  1UEA A;  4G9L A;  1IRE B;  4H30 A;  3X26 B;  1A86 A;  1OO9 A;  2QDJ A;  4FXQ A;  1XUD A;  3KWV C;  5I4O A;  2ERQ A;  1K7Q A;  3LQ0 A;  4I35 A;  2DXC B;  1MMB A;  1J7N A;  1R1H A;  5LAB A;  4JIJ A;  3E8R A;  1CIZ A;  3O2X A;  3WV1 A;  5B5P A;  1IAA A;  4H76 A;  1AST A;  3N2U A;  3A8M B;  3A8O B;  2OXZ A;  3LGP A;  2DW1 A;  1ND1 A;  3LK8 A;  2W13 A;  1C8T A;  4MFE A;  1BIW A;  4HL4 A;  3TW6 A;  3ZVS A;  2CKI A;  2RJP A;  5I0L A;  2J0T A;  4OB2 B;  3KRY A;  3LMC A;  3K7N A;  4H3X A;  3ZUK A;  1R55 A;  4R3V A;  3VTG A;  2OW1 A;  1GE7 A;  1QUA A;  4GWN A;  2BS4 A;  1V29 B;  3F16 A;  2BS2 A;  5D3C A;  1EUB A;  4WKI A;  2ZCF B;  3WV3 A;  3BG3 A;  3LJG A;  5H8X A;  4A7B A;  1XFY A;  1SRP A;  1UGR B;  1IAD A;  1KUK A;  1D7X A;  3G42 A;  4HNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...