4ELLA

Structure of the inactive retinoblastoma protein pocket domain
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
331
Chain Sequence
QQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESFAWLSDSPLFDLIKQSHTAADMYLEPVSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma-associated protein
publication title Structures of inactive retinoblastoma protein reveal multiple mechanisms for cell cycle control.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 128
structure length 331
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4ellA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4ellA01
2BKZB 1VYWB 5HNBB 4CFVB 1GUXA 4YOZA 3MY1B 4EONB 4ROCA 2UZEB 3BLHB 2W96A 5IF1B 4YOOA 2I40B 5L2WB 1AD6A 4BCHB 4CFUB 4BCJB 1GUXB 5FGKB 4BCMB 4EC8B 2F2CA 4Y72B 4BCQB 1OI9B 5LMKB 4II5B 1OL2B 1H25B 2C5VB 3M03A 4F7LB 2B9RA 5CYIB 2G9XB 2UZDB 3BHUB 3TN8B 5IDPB 3F5XB 1H1RB 4OR5B 2IW8B 3TNHB 4UN0A 5I5ZB 3EJ1B 2PMIB 5ICPB 4CXAB 1OIYB 4CRLB 1TFBA 4I3ZB 4F6UB 4RODA 2C5OB 2W2HA 1OL1B 1URCB 2C6TB 3TNWB 4BCGB 4CFUD 4F6SB 5ACBA 4BCMD 1H27B 4OGRB 2CJMB 5EFQB 3MI9B 4EOLB 2V22B 1ZP2A 4CFXB 4F7JB 4EOIB 1QMZB 4BCQD 1JSTB 3H4CA 1H4LD 4EOOB 3K7AM 1OIUB 2QDJA 3BHTB 3EIDB 1OGUB 1VOLA 3LQ5B 2WPAB 4TTHA 1H1PB 3DDQB 5IDNB 2JGZB 4CFNB 3BLRB 2BPMB 2WMBB 2EUFA 5LQFB 3RGFB 2PK2A 4F6WB 3POMA 2UZBB 2IW6B 4BCNB 4F7SB 1JKWA 1H26B 1OKVB 2WFYB 1FVVB 4EOSB 1GY3B 1AISB 4BCFB 3MY5B 2WMAB 4FX3B 1KXUA 1H28B 4EOPB 1VINA 2WXVB 1PKDB 4G6LB 1F5QB 3EOCB 4F70B 5BNJB 4CFMB 4IMYB 1GH6B 4BCIB 4BCPB 5HBEB 4BCOB 2UZLB 1FINB 2C5XB 5HBJB 2WEVB 3TNIB 4CFWB 2WIPB 2CCIB 4EC9B 5HQ0B 1BU2A 1UNLD 2C4GB 4BCND 3O0GD 2W9FA 1JOWA 1O9KA 4EOKB 4ELJA 3DOGB 1C9BA 1H1SB 1UNGD 4EOMB 2X1NB 4KRCB 4YC3B 5CEIB 1N4MA 2C5NB 5HVYB 1O9KB 1W98B 2R7GA 2PK9B 4F7NB 1D3UB 1OKWB 2CCHB 2WHBB 4EORB 1XO2A 3BLQB 4ELLA 3QHRB 1E9HB 1G3NC 1UNHD 3QHWB 2PHGA 2I53A 4YOSA 2W99A 2IVXA 2IW9B 3DDPB 3MIAB 4BCKB 4EOQB 4KRDB 1JSUB 2UUEB 4ROEA 3G33B 1H1QB 1P5EB 4NSTB 3BHVB 2WIHB 5HBHB 4EOJB 2W9ZA 1H24B
chains in the Genus database with same CATH superfamily
4BY7X 4YOZA 4FM4B 2W96A 5IF1B 4YOOA 5FGKB 4BCMB 4HNVA 3M03A 2C5VB 3A8GB 3NDQA 5CYIB 2B9RA 2UZDB 4MFEA 4AKGA 2PMIB 3VKGA 4RODA 5IHYA 1OL1B 1URCB 3TNWB 3A8HB 4CFXB 3K7AM 2BS4A 3EIDB 3DJBA 1UGRB 2ZCFB 5EJCA 4BXXX 2ZZDB 2WMBB 1ENWA 2PK2A 3POMA 2DD4B 2DXBB 2IW6B 4F7SB 1OKVB 1FVVB 4EOSB 4BCFB 4FX3B 3QWLA 4JX4A 4G6LB 1F5QB 2ZPEB 5HBEB 3VKHA 4BCOB 2UZLB 5HBJB 2WEVB 4CFWB 2CCIB 5DQWA 2C4GB 1JOWA 2ZPFB 5CEIB 1QLBA 3A8LB 3TW7A 2R7GA 2PK9B 2CCHB 4OB0B 2DD5B 2ZPIB 3DDPB 1JSUB 2KMGA 1V29B 1H24B 2BKZB 1VYWB 2CYZB 5HNBB 4CFVB 3HHTB 1GUXA 4HNTA 1UGSB 3QYBA 1AD6A 4EC8B 4Y72B 2DMEA 3TN8B 4HNUA 3F5XB 2IW8B 5I5ZB 3EJ1B 5ICPB 1OIYB 4CRLB 2W2HA 2C6TB 4F6SB 4BCMD 2CJMB 5EFQB 4EOLB 2V22B 4F7JB 4EOIB 4BY1X 1H4LD 3BG3A 3BHTB 3LQ5B 4TTHA 1H1PB 4AI6A 2EUFA 3RGFB 4ZGEB 4F6WB 4NC6A 4BCNB 1JKWA 2WFYB 3MY5B 1E7PA 1VINA 2WXVB 4F70B 3EOCB 3HO8A 4IMYB 1FINB 3PO3S 2WIPB 2CZ0B 1BU2A 4EOKB 3A8MB 4YC3B 1W98B 1D3UB 2WHBB 3X28B 3QZ9B 2ZPBB 1E9HB 4BBRM 3QHWB 2DXCB 4YOSA 2W99A 4AKIA 4BCKB 4KRDB 3HZJA 4ZGDB 4ROEA 1H1QB 3BHVB 2WIHB 5HBHB 4EOJB 3X20B 2BS2A 2QGSA 3MY1B 4ROCA 2ZPGB 3BLHB 5L2WB 4BCHB 4CFUB 4BCJB 1GUXB 1UGQB 2F2CA 2LW4A 2QQ8A 4BCQB 4II5B 4JX5A 4F7LB 2G9XB 4ZGJB 5IDPB 4OB3B 1H1RB 3HB9A 4OR5B 3TNHB 4UN0A 4CXAB 1TFBA 4I3ZB 4F6UB 4BCGB 3QXEB 4JX6A 1H27B 2CZ7B 3VYHB 3DTOA 1ZP2A 1QMZB 1JSTB 4EOOB 1OIUB 2QDJA 1VOLA 4BBSM 1OGUB 3A8OB 3DDQB 3HBLA 4CFNB 3BLRB 5LQFB 2UZBB 4HLQA 2IN3A 1GY3B 2QDYB 3DL1A 1H28B 4HL4A 1PKDB 4BCIB 4BCPB 1FKMA 3WVEB 3B57A 2PJQA 2C5XB 2D0QB 4BCND 4LOCA 2W9FA 2BS3A 1O9KA 3KHIA 1H1SB 1UNGD 4QSHA 2X1NB 4EOMB 4KRCB 2C5NB 5HVYB 4AKHA 4M6VA 1OKWB 1UGPB 1XO2A 3QHRB 4MFDA 3VYGB 2PHGA 2I53A 4EOQB 2QFZA 4Z6YA 2W9ZA 4OB2B 4EONB 2UZEB 3QYHB 2I40B 3BG9A 2KR6A 1OI9B 1TD6A 5LMKB 1OL2B 1H25B 3BHUB 3TW6A 2C5OB 2WJ9A 1AHJB 4CFUD 5ACBA 4OGRB 3MI9B 2ZPHB 2AHJB 4BCQD 3H4CA 2CZ1B 3X26B 2WPAB 2CZ6B 5IDNB 2JGZB 4OB1B 5DQVA 2BPMB 1IREB 3QYEA 1H26B 1AISB 2WMAB 1KXUA 2DPPB 4EOPB 5BNJB 4CFMB 1GH6B 3TNIB 4EC9B 5HQ0B 1UNLD 3QZ5B 3O0GD 3WVDB 4ELJA 3DOGB 1C9BA 1N4MA 1O9KB 4F7NB 3X24B 4EORB 3BLQB 4ELLA 1G3NC 1UNHD 3QYGB 3X25B 2IVXA 2IW9B 3MIAB 4MIMA 2G77A 2QF7A 2UUEB 3G33B 1P5EB 3BG5A 4NSTB 3GTMS
chains in the Genus database with same CATH topology
2BKZB 1VYWB 5HNBB 4CFVB 1GUXA 4YOZA 3MY1B 4EONB 4ROCA 2UZEB 3BLHB 2W96A 5IF1B 4YOOA 2I40B 5L2WB 1AD6A 4BCHB 4CFUB 4BCJB 1GUXB 5FGKB 4BCMB 4EC8B 2F2CA 4Y72B 4BCQB 1OI9B 5LMKB 4II5B 1OL2B 1H25B 2C5VB 3M03A 4F7LB 2B9RA 5CYIB 2G9XB 2UZDB 3BHUB 3TN8B 5IDPB 3F5XB 1H1RB 4OR5B 2IW8B 3TNHB 4UN0A 5I5ZB 3EJ1B 2PMIB 5ICPB 4CXAB 1OIYB 4CRLB 1TFBA 4I3ZB 4F6UB 4RODA 2C5OB 2W2HA 1OL1B 1URCB 2C6TB 3TNWB 4BCGB 4CFUD 4F6SB 5ACBA 4BCMD 1H27B 4OGRB 2CJMB 5EFQB 3MI9B 4EOLB 2V22B 1ZP2A 4CFXB 4F7JB 4EOIB 1QMZB 4BCQD 1JSTB 3H4CA 1H4LD 4EOOB 3K7AM 1OIUB 2QDJA 3BHTB 3EIDB 1OGUB 1VOLA 3LQ5B 2WPAB 4TTHA 1H1PB 3DDQB 5IDNB 2JGZB 4CFNB 3BLRB 2BPMB 2WMBB 2EUFA 5LQFB 3RGFB 2PK2A 4F6WB 3POMA 2UZBB 2IW6B 4BCNB 4F7SB 1JKWA 1H26B 1OKVB 2WFYB 1FVVB 4EOSB 1GY3B 1AISB 4BCFB 3MY5B 2WMAB 4FX3B 1KXUA 1H28B 4EOPB 1VINA 2WXVB 1PKDB 4G6LB 1F5QB 3EOCB 4F70B 5BNJB 4CFMB 4IMYB 1GH6B 4BCIB 4BCPB 5HBEB 4BCOB 2UZLB 1FINB 2C5XB 5HBJB 2WEVB 3TNIB 4CFWB 2WIPB 2CCIB 4EC9B 5HQ0B 1BU2A 1UNLD 2C4GB 4BCND 3O0GD 2W9FA 1JOWA 1O9KA 4EOKB 4ELJA 3DOGB 1C9BA 1H1SB 1UNGD 4EOMB 2X1NB 4KRCB 4YC3B 5CEIB 1N4MA 2C5NB 5HVYB 1O9KB 1W98B 2R7GA 2PK9B 4F7NB 1D3UB 1OKWB 2CCHB 2WHBB 4EORB 1XO2A 3BLQB 4ELLA 3QHRB 1E9HB 1G3NC 1UNHD 3QHWB 2PHGA 2I53A 4YOSA 2W99A 2IVXA 2IW9B 3DDPB 3MIAB 4BCKB 4EOQB 4KRDB 1JSUB 2UUEB 4ROEA 3G33B 1H1QB 1P5EB 4NSTB 3BHVB 2WIHB 5HBHB 4EOJB 2W9ZA 1H24B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKZ B;  1VYW B;  5HNB B;  4CFV B;  1GUX A;  4YOZ A;  3MY1 B;  4EON B;  4ROC A;  2UZE B;  3BLH B;  2W96 A;  5IF1 B;  4YOO A;  2I40 B;  5L2W B;  1AD6 A;  4BCH B;  4CFU B;  4BCJ B;  1GUX B;  5FGK B;  4BCM B;  4EC8 B;  2F2C A;  4Y72 B;  4BCQ B;  1OI9 B;  5LMK B;  4II5 B;  1OL2 B;  1H25 B;  2C5V B;  3M03 A;  4F7L B;  2B9R A;  5CYI B;  2G9X B;  2UZD B;  3BHU B;  3TN8 B;  5IDP B;  3F5X B;  1H1R B;  4OR5 B;  2IW8 B;  3TNH B;  4UN0 A;  5I5Z B;  3EJ1 B;  2PMI B;  5ICP B;  4CXA B;  1OIY B;  4CRL B;  1TFB A;  4I3Z B;  4F6U B;  4ROD A;  2C5O B;  2W2H A;  1OL1 B;  1URC B;  2C6T B;  3TNW B;  4BCG B;  4CFU D;  4F6S B;  5ACB A;  4BCM D;  1H27 B;  4OGR B;  2CJM B;  5EFQ B;  3MI9 B;  4EOL B;  2V22 B;  1ZP2 A;  4CFX B;  4F7J B;  4EOI B;  1QMZ B;  4BCQ D;  1JST B;  3H4C A;  1H4L D;  4EOO B;  3K7A M;  1OIU B;  2QDJ A;  3BHT B;  3EID B;  1OGU B;  1VOL A;  3LQ5 B;  2WPA B;  4TTH A;  1H1P B;  3DDQ B;  5IDN B;  2JGZ B;  4CFN B;  3BLR B;  2BPM B;  2WMB B;  2EUF A;  5LQF B;  3RGF B;  2PK2 A;  4F6W B;  3POM A;  2UZB B;  2IW6 B;  4BCN B;  4F7S B;  1JKW A;  1H26 B;  1OKV B;  2WFY B;  1FVV B;  4EOS B;  1GY3 B;  1AIS B;  4BCF B;  3MY5 B;  2WMA B;  4FX3 B;  1KXU A;  1H28 B;  4EOP B;  1VIN A;  2WXV B;  1PKD B;  4G6L B;  1F5Q B;  3EOC B;  4F70 B;  5BNJ B;  4CFM B;  4IMY B;  1GH6 B;  4BCI B;  4BCP B;  5HBE B;  4BCO B;  2UZL B;  1FIN B;  2C5X B;  5HBJ B;  2WEV B;  3TNI B;  4CFW B;  2WIP B;  2CCI B;  4EC9 B;  5HQ0 B;  1BU2 A;  1UNL D;  2C4G B;  4BCN D;  3O0G D;  2W9F A;  1JOW A;  1O9K A;  4EOK B;  4ELJ A;  3DOG B;  1C9B A;  1H1S B;  1UNG D;  4EOM B;  2X1N B;  4KRC B;  4YC3 B;  5CEI B;  1N4M A;  2C5N B;  5HVY B;  1O9K B;  1W98 B;  2R7G A;  2PK9 B;  4F7N B;  1D3U B;  1OKW B;  2CCH B;  2WHB B;  4EOR B;  1XO2 A;  3BLQ B;  4ELL A;  3QHR B;  1E9H B;  1G3N C;  1UNH D;  3QHW B;  2PHG A;  2I53 A;  4YOS A;  2W99 A;  2IVX A;  2IW9 B;  3DDP B;  3MIA B;  4BCK B;  4EOQ B;  4KRD B;  1JSU B;  2UUE B;  4ROE A;  3G33 B;  1H1Q B;  1P5E B;  4NST B;  3BHV B;  2WIH B;  5HBH B;  4EOJ B;  2W9Z A;  1H24 B; 
#chains in the Genus database with same CATH topology
 4BY7 X;  4YOZ A;  4FM4 B;  2W96 A;  5IF1 B;  4YOO A;  5FGK B;  4BCM B;  4HNV A;  3M03 A;  2C5V B;  3A8G B;  3NDQ A;  5CYI B;  2B9R A;  2UZD B;  4MFE A;  4AKG A;  2PMI B;  3VKG A;  4ROD A;  5IHY A;  1OL1 B;  1URC B;  3TNW B;  3A8H B;  4CFX B;  3K7A M;  2BS4 A;  3EID B;  3DJB A;  1UGR B;  2ZCF B;  5EJC A;  4BXX X;  2ZZD B;  2WMB B;  1ENW A;  2PK2 A;  3POM A;  2DD4 B;  2DXB B;  2IW6 B;  4F7S B;  1OKV B;  1FVV B;  4EOS B;  4BCF B;  4FX3 B;  3QWL A;  4JX4 A;  4G6L B;  1F5Q B;  2ZPE B;  5HBE B;  3VKH A;  4BCO B;  2UZL B;  5HBJ B;  2WEV B;  4CFW B;  2CCI B;  5DQW A;  2C4G B;  1JOW A;  2ZPF B;  5CEI B;  1QLB A;  3A8L B;  3TW7 A;  2R7G A;  2PK9 B;  2CCH B;  4OB0 B;  2DD5 B;  2ZPI B;  3DDP B;  1JSU B;  2KMG A;  1V29 B;  1H24 B;  2BKZ B;  1VYW B;  2CYZ B;  5HNB B;  4CFV B;  3HHT B;  1GUX A;  4HNT A;  1UGS B;  3QYB A;  1AD6 A;  4EC8 B;  4Y72 B;  2DME A;  3TN8 B;  4HNU A;  3F5X B;  2IW8 B;  5I5Z B;  3EJ1 B;  5ICP B;  1OIY B;  4CRL B;  2W2H A;  2C6T B;  4F6S B;  4BCM D;  2CJM B;  5EFQ B;  4EOL B;  2V22 B;  4F7J B;  4EOI B;  4BY1 X;  1H4L D;  3BG3 A;  3BHT B;  3LQ5 B;  4TTH A;  1H1P B;  4AI6 A;  2EUF A;  3RGF B;  4ZGE B;  4F6W B;  4NC6 A;  4BCN B;  1JKW A;  2WFY B;  3MY5 B;  1E7P A;  1VIN A;  2WXV B;  4F70 B;  3EOC B;  3HO8 A;  4IMY B;  1FIN B;  3PO3 S;  2WIP B;  2CZ0 B;  1BU2 A;  4EOK B;  3A8M B;  4YC3 B;  1W98 B;  1D3U B;  2WHB B;  3X28 B;  3QZ9 B;  2ZPB B;  1E9H B;  4BBR M;  3QHW B;  2DXC B;  4YOS A;  2W99 A;  4AKI A;  4BCK B;  4KRD B;  3HZJ A;  4ZGD B;  4ROE A;  1H1Q B;  3BHV B;  2WIH B;  5HBH B;  4EOJ B;  3X20 B;  2BS2 A;  2QGS A;  3MY1 B;  4ROC A;  2ZPG B;  3BLH B;  5L2W B;  4BCH B;  4CFU B;  4BCJ B;  1GUX B;  1UGQ B;  2F2C A;  2LW4 A;  2QQ8 A;  4BCQ B;  4II5 B;  4JX5 A;  4F7L B;  2G9X B;  4ZGJ B;  5IDP B;  4OB3 B;  1H1R B;  3HB9 A;  4OR5 B;  3TNH B;  4UN0 A;  4CXA B;  1TFB A;  4I3Z B;  4F6U B;  4BCG B;  3QXE B;  4JX6 A;  1H27 B;  2CZ7 B;  3VYH B;  3DTO A;  1ZP2 A;  1QMZ B;  1JST B;  4EOO B;  1OIU B;  2QDJ A;  1VOL A;  4BBS M;  1OGU B;  3A8O B;  3DDQ B;  3HBL A;  4CFN B;  3BLR B;  5LQF B;  2UZB B;  4HLQ A;  2IN3 A;  1GY3 B;  2QDY B;  3DL1 A;  1H28 B;  4HL4 A;  1PKD B;  4BCI B;  4BCP B;  1FKM A;  3WVE B;  3B57 A;  2PJQ A;  2C5X B;  2D0Q B;  4BCN D;  4LOC A;  2W9F A;  2BS3 A;  1O9K A;  3KHI A;  1H1S B;  1UNG D;  4QSH A;  2X1N B;  4EOM B;  4KRC B;  2C5N B;  5HVY B;  4AKH A;  4M6V A;  1OKW B;  1UGP B;  1XO2 A;  3QHR B;  4MFD A;  3VYG B;  2PHG A;  2I53 A;  4EOQ B;  2QFZ A;  4Z6Y A;  2W9Z A;  4OB2 B;  4EON B;  2UZE B;  3QYH B;  2I40 B;  3BG9 A;  2KR6 A;  1OI9 B;  1TD6 A;  5LMK B;  1OL2 B;  1H25 B;  3BHU B;  3TW6 A;  2C5O B;  2WJ9 A;  1AHJ B;  4CFU D;  5ACB A;  4OGR B;  3MI9 B;  2ZPH B;  2AHJ B;  4BCQ D;  3H4C A;  2CZ1 B;  3X26 B;  2WPA B;  2CZ6 B;  5IDN B;  2JGZ B;  4OB1 B;  5DQV A;  2BPM B;  1IRE B;  3QYE A;  1H26 B;  1AIS B;  2WMA B;  1KXU A;  2DPP B;  4EOP B;  5BNJ B;  4CFM B;  1GH6 B;  3TNI B;  4EC9 B;  5HQ0 B;  1UNL D;  3QZ5 B;  3O0G D;  3WVD B;  4ELJ A;  3DOG B;  1C9B A;  1N4M A;  1O9K B;  4F7N B;  3X24 B;  4EOR B;  3BLQ B;  4ELL A;  1G3N C;  1UNH D;  3QYG B;  3X25 B;  2IVX A;  2IW9 B;  3MIA B;  4MIM A;  2G77 A;  2QF7 A;  2UUE B;  3G33 B;  1P5E B;  3BG5 A;  4NST B;  3GTM S; 
#chains in the Genus database with same CATH homology
 2BKZ B;  1VYW B;  5HNB B;  4CFV B;  1GUX A;  4YOZ A;  3MY1 B;  4EON B;  4ROC A;  2UZE B;  3BLH B;  2W96 A;  5IF1 B;  4YOO A;  2I40 B;  5L2W B;  1AD6 A;  4BCH B;  4CFU B;  4BCJ B;  1GUX B;  5FGK B;  4BCM B;  4EC8 B;  2F2C A;  4Y72 B;  4BCQ B;  1OI9 B;  5LMK B;  4II5 B;  1OL2 B;  1H25 B;  2C5V B;  3M03 A;  4F7L B;  2B9R A;  5CYI B;  2G9X B;  2UZD B;  3BHU B;  3TN8 B;  5IDP B;  3F5X B;  1H1R B;  4OR5 B;  2IW8 B;  3TNH B;  4UN0 A;  5I5Z B;  3EJ1 B;  2PMI B;  5ICP B;  4CXA B;  1OIY B;  4CRL B;  1TFB A;  4I3Z B;  4F6U B;  4ROD A;  2C5O B;  2W2H A;  1OL1 B;  1URC B;  2C6T B;  3TNW B;  4BCG B;  4CFU D;  4F6S B;  5ACB A;  4BCM D;  1H27 B;  4OGR B;  2CJM B;  5EFQ B;  3MI9 B;  4EOL B;  2V22 B;  1ZP2 A;  4CFX B;  4F7J B;  4EOI B;  1QMZ B;  4BCQ D;  1JST B;  3H4C A;  1H4L D;  4EOO B;  3K7A M;  1OIU B;  2QDJ A;  3BHT B;  3EID B;  1OGU B;  1VOL A;  3LQ5 B;  2WPA B;  4TTH A;  1H1P B;  3DDQ B;  5IDN B;  2JGZ B;  4CFN B;  3BLR B;  2BPM B;  2WMB B;  2EUF A;  5LQF B;  3RGF B;  2PK2 A;  4F6W B;  3POM A;  2UZB B;  2IW6 B;  4BCN B;  4F7S B;  1JKW A;  1H26 B;  1OKV B;  2WFY B;  1FVV B;  4EOS B;  1GY3 B;  1AIS B;  4BCF B;  3MY5 B;  2WMA B;  4FX3 B;  1KXU A;  1H28 B;  4EOP B;  1VIN A;  2WXV B;  1PKD B;  4G6L B;  1F5Q B;  3EOC B;  4F70 B;  5BNJ B;  4CFM B;  4IMY B;  1GH6 B;  4BCI B;  4BCP B;  5HBE B;  4BCO B;  2UZL B;  1FIN B;  2C5X B;  5HBJ B;  2WEV B;  3TNI B;  4CFW B;  2WIP B;  2CCI B;  4EC9 B;  5HQ0 B;  1BU2 A;  1UNL D;  2C4G B;  4BCN D;  3O0G D;  2W9F A;  1JOW A;  1O9K A;  4EOK B;  4ELJ A;  3DOG B;  1C9B A;  1H1S B;  1UNG D;  4EOM B;  2X1N B;  4KRC B;  4YC3 B;  5CEI B;  1N4M A;  2C5N B;  5HVY B;  1O9K B;  1W98 B;  2R7G A;  2PK9 B;  4F7N B;  1D3U B;  1OKW B;  2CCH B;  2WHB B;  4EOR B;  1XO2 A;  3BLQ B;  4ELL A;  3QHR B;  1E9H B;  1G3N C;  1UNH D;  3QHW B;  2PHG A;  2I53 A;  4YOS A;  2W99 A;  2IVX A;  2IW9 B;  3DDP B;  3MIA B;  4BCK B;  4EOQ B;  4KRD B;  1JSU B;  2UUE B;  4ROE A;  3G33 B;  1H1Q B;  1P5E B;  4NST B;  3BHV B;  2WIH B;  5HBH B;  4EOJ B;  2W9Z A;  1H24 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...