4ELLA

Structure of the inactive retinoblastoma protein pocket domain
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
401
structure length
331
Chain Sequence
QQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESFAWLSDSPLFDLIKQSHTAADMYLEPVSTSLSLFYKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLAPIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Retinoblastoma-associated protein
publication title Structures of inactive retinoblastoma protein reveal multiple mechanisms for cell cycle control.
pubmed doi rcsb
source organism Homo sapiens
total genus 128
structure length 331
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4ellA02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4ellA01
1D3UB 1N4MA 2IW6B 3MY5B 1OI9B 4EOSB 5HVYB 4EOLB 1H28B 5HBHB 4F70B 1H1SB 2G9XB 4EOMB 1H27B 3BHVB 1H1RB 2WIHB 1GH6B 2PMIB 4BCMB 1H1PB 5EFQB 2C4GB 1JOWA 1O9KB 4OR5B 2CJMB 1OL1B 2I53A 1JSUB 2X1NB 4I3ZB 4ROEA 4BCNB 4CFMB 5IDPB 2WEVB 1E9HB 4BCQB 2R7GA 3BLQB 2PHGA 2EUFA 3M03A 4YC3B 4CFWB 4EORB 1F5QB 2BPMB 1AISB 1OKWB 4TTHA 4CFUD 1UNHD 1H4LD 2WMBB 3EOCB 3BLRB 3LQ5B 1OIUB 2F2CA 5LQFB 1FINB 4CRLB 3RGFB 3H4CA 4EOIB 2UZBB 1OGUB 3MIAB 2CCHB 5HBEB 1P5EB 3F5XB 4F6SB 4F7JB 2W2HA 5ACBA 4EC8B 5CYIB 2IW9B 1H25B 2W96A 4BCND 3EJ1B 4CXAB 2W9ZA 4YOSA 2WHBB 1GUXA 5CEIB 4BCGB 1BU2A 5IDNB 1JSTB 3O0GD 2C5NB 5BNJB 1TFBA 3BLHB 4FX3B 2PK9B 1UNLD 2I40B 3QHRB 4EOPB 4BCMD 3K7AM 1KXUA 4F6UB 4BCIB 1G3NC 1PKDB 2C5XB 2W9FA 5FGKB 3QHWB 1AD6A 2WXVB 4KRCB 1OIYB 1VINA 5HBJB 1XO2A 2IW8B 4BCQD 4F6WB 3TNIB 1UNGD 1H1QB 4BCPB 2UUEB 4F7LB 5ICPB 3DDQB 3TNHB 4CFUB 1GUXB 5HQ0B 5L2WB 4ROCA 4KRDB 4G6LB 4EONB 4BCHB 1FVVB 4EOJB 4BCOB 1VYWB 4CFXB 4BCFB 4ELJA 5LMKB 4IMYB 4BCKB 1H24B 1ZP2A 2IVXA 4RODA 4OGRB 4UN0A 4ELLA 2CCIB 1URCB 1H26B 4F7NB 4F7SB 2UZLB 3MY1B 1JKWA 3TNWB 1VOLA 2QDJA 4YOZA 1GY3B 2B9RA 2C5VB 2UZDB 4CFNB 1C9BA 2WPAB 5IF1B 2C5OB 3G33B 2UZEB 4EC9B 2WMAB 3EIDB 4EOKB 4YOOA 1OL2B 5HNBB 2V22B 2C6TB 2BKZB 2JGZB 3BHUB 2PK2A 4II5B 4CFVB 5I5ZB 1W98B 1QMZB 4EOOB 3DOGB 2W99A 2WFYB 1O9KA 3DDPB 4EOQB 4BCJB 3BHTB 3TN8B 4NSTB 4Y72B 3POMA 1OKVB 3MI9B 2WIPB
chains in the Genus database with same CATH superfamily
2D0QB 5DQWA 1OI9B 4BY1X 4EOSB 2BS2A 5HBHB 1H27B 4BY7X 2PMIB 2C4GB 1JOWA 2G77A 2X1NB 3TW7A 4AI6A 4BCQB 3PO3S 2EUFA 1ENWA 1F5QB 4BBSM 1OKWB 1UNHD 3BLRB 5LQFB 3RGFB 2CZ0B 2UZBB 3MIAB 2CCHB 2W2HA 4EC8B 5CYIB 2IW9B 3NDQA 4ZGEB 1GUXA 3O0GD 2I40B 3QHRB 4EOPB 3HB9A 3K7AM 4MFEA 4BCIB 1G3NC 1PKDB 4KRCB 4F6WB 4BCPB 3VKGA 5ICPB 3TNHB 4CFUB 5L2WB 4KRDB 2ZPGB 4G6LB 4BCHB 1VYWB 4BCFB 1AHJB 1H24B 2IVXA 4UN0A 2CCIB 1URCB 1H26B 2QF7A 4EC9B 2WMAB 3EIDB 4BBRM 2CZ1B 4HL4A 2KR6A 2PK2A 4OB3B 2ZPFB 2BS4A 3DOGB 1UGQB 4EOQB 4BCJB 3BG9A 2PJQA 3WVDB 3X24B 1QLBA 1H1SB 2G9XB 4EOMB 2ZPHB 1H1RB 4LOCA 4Z6YA 2CYZB 4ZGDB 5EFQB 1O9KB 4CFMB 2DPPB 2WEVB 1E9HB 3X20B 3BLQB 2PHGA 3M03A 4TTHA 4CFUD 3X26B 1H4LD 2WMBB 2F2CA 5HBEB 3F5XB 4F6SB 3EJ1B 3DJBA 3HBLA 4YOSA 5CEIB 2DD4B 1JSTB 2C5NB 2WJ9A 2CZ6B 3BLHB 5DQVA 3VYHB 2DXBB 2C5XB 2W9FA 5FGKB 1AD6A 1VINA 1XO2A 2IW8B 2UUEB 3A8GB 3QZ5B 3VKHA 1GUXB 4AKIA 2QQ8A 4RODA 3QXEB 3A8HB 4OGRB 1E7PA 3X25B 3MY1B 4ZGJB 3BG3A 2QDJA 1GY3B 2C5VB 2UZDB 1C9BA 3G33B 2UZEB 2V22B 2BKZB 4II5B 5I5ZB 1W98B 2W99A 4HNUA 3DDPB 1UGPB 2ZPEB 4Y72B 3POMA 3MI9B 4CFNB 1D3UB 2IW6B 2BS3A 5HVYB 1V29B 1H28B 3A8MB 4OB0B 1UGSB 4NC6A 1H1PB 4OR5B 1JSUB 2DXCB 5IDPB 2R7GA 4CFWB 2BPMB 3EOCB 4CRLB 4EOIB 3H4CA 4OB1B 1P5EB 4F7JB 5ACBA 4MIMA 3QYBA 1H25B 4FM4B 3QWLA 4CXAB 2W9ZA 2WHBB 5IDNB 1TFBA 3A8LB 3VYGB 4BCMD 3TW6A 2QGSA 3QYGB 2WXVB 1OIYB 2ZPIB 5HBJB 3A8OB 2ZPBB 4JX6A 3HHTB 4EONB 4EOJB 4BCOB 4CFXB 3QZ9B 4ELJA 5LMKB 4IMYB 1ZP2A 4ELLA 3QYHB 4F7NB 4F7SB 2UZLB 3X28B 2IN3A 1VOLA 4YOZA 3HZJA 2B9RA 4MFDA 5HNBB 4BXXX 4CFVB 1UGRB 5EJCA 2AHJB 5IHYA 4HNTA 3TN8B 4NSTB 3GTMS 1OKVB 2WIPB 1N4MA 3MY5B 4EOLB 4OB2B 4F70B 3BHVB 2WIHB 1GH6B 4JX4A 4BCMB 2CJMB 1OL1B 2I53A 4I3ZB 4ROEA 3QYEA 3DTOA 4EORB 4YC3B 3DL1A 3KHIA 1AISB 1FKMA 3LQ5B 1OIUB 3WVEB 1FINB 1OGUB 2W96A 2QDYB 4BCND 2CZ7B 4BCGB 1BU2A 5BNJB 2ZCFB 1TD6A 4FX3B 2PK9B 1UNLD 4HNVA 1KXUA 4F6UB 3QHWB 4BCQD 3TNIB 1UNGD 1H1QB 2DD5B 4M6VA 4F7LB 3DDQB 5HQ0B 4ROCA 2KMGA 2ZZDB 1FVVB 4BCKB 4AKHA 4AKGA 1IREB 1JKWA 3TNWB 4HLQA 2WPAB 5IF1B 2DMEA 4QSHA 2C5OB 3HO8A 2QFZA 4EOKB 4YOOA 1OL2B 2LW4A 2C6TB 3B57A 2JGZB 3BHUB 1QMZB 4EOOB 2WFYB 1O9KA 3BHTB 3BG5A 4BCNB 4JX5A
chains in the Genus database with same CATH topology
1D3UB 1N4MA 2IW6B 3MY5B 1OI9B 4EOSB 5HVYB 4EOLB 1H28B 5HBHB 4F70B 1H1SB 2G9XB 4EOMB 1H27B 3BHVB 1H1RB 2WIHB 1GH6B 2PMIB 4BCMB 1H1PB 5EFQB 2C4GB 1JOWA 1O9KB 4OR5B 2CJMB 1OL1B 2I53A 1JSUB 2X1NB 4I3ZB 4ROEA 4BCNB 4CFMB 5IDPB 2WEVB 1E9HB 4BCQB 2R7GA 3BLQB 2PHGA 2EUFA 3M03A 4YC3B 4CFWB 4EORB 1F5QB 2BPMB 1AISB 1OKWB 4TTHA 4CFUD 1UNHD 1H4LD 2WMBB 3EOCB 3BLRB 3LQ5B 1OIUB 2F2CA 5LQFB 1FINB 4CRLB 3RGFB 3H4CA 4EOIB 2UZBB 1OGUB 3MIAB 2CCHB 5HBEB 1P5EB 3F5XB 4F6SB 4F7JB 2W2HA 5ACBA 4EC8B 5CYIB 2IW9B 1H25B 2W96A 4BCND 3EJ1B 4CXAB 2W9ZA 4YOSA 2WHBB 1GUXA 5CEIB 4BCGB 1BU2A 5IDNB 1JSTB 3O0GD 2C5NB 5BNJB 1TFBA 3BLHB 4FX3B 2PK9B 1UNLD 2I40B 3QHRB 4EOPB 4BCMD 3K7AM 1KXUA 4F6UB 4BCIB 1G3NC 1PKDB 2C5XB 2W9FA 5FGKB 3QHWB 1AD6A 2WXVB 4KRCB 1OIYB 1VINA 5HBJB 1XO2A 2IW8B 4BCQD 4F6WB 3TNIB 1UNGD 1H1QB 4BCPB 2UUEB 4F7LB 5ICPB 3DDQB 3TNHB 4CFUB 1GUXB 5HQ0B 5L2WB 4ROCA 4KRDB 4G6LB 4EONB 4BCHB 1FVVB 4EOJB 4BCOB 1VYWB 4CFXB 4BCFB 4ELJA 5LMKB 4IMYB 4BCKB 1H24B 1ZP2A 2IVXA 4RODA 4OGRB 4UN0A 4ELLA 2CCIB 1URCB 1H26B 4F7NB 4F7SB 2UZLB 3MY1B 1JKWA 3TNWB 1VOLA 2QDJA 4YOZA 1GY3B 2B9RA 2C5VB 2UZDB 4CFNB 1C9BA 2WPAB 5IF1B 2C5OB 3G33B 2UZEB 4EC9B 2WMAB 3EIDB 4EOKB 4YOOA 1OL2B 5HNBB 2V22B 2C6TB 2BKZB 2JGZB 3BHUB 2PK2A 4II5B 4CFVB 5I5ZB 1W98B 1QMZB 4EOOB 3DOGB 2W99A 2WFYB 1O9KA 3DDPB 4EOQB 4BCJB 3BHTB 3TN8B 4NSTB 4Y72B 3POMA 1OKVB 3MI9B 2WIPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D3U B;  1N4M A;  2IW6 B;  3MY5 B;  1OI9 B;  4EOS B;  5HVY B;  4EOL B;  1H28 B;  5HBH B;  4F70 B;  1H1S B;  2G9X B;  4EOM B;  1H27 B;  3BHV B;  1H1R B;  2WIH B;  1GH6 B;  2PMI B;  4BCM B;  1H1P B;  5EFQ B;  2C4G B;  1JOW A;  1O9K B;  4OR5 B;  2CJM B;  1OL1 B;  2I53 A;  1JSU B;  2X1N B;  4I3Z B;  4ROE A;  4BCN B;  4CFM B;  5IDP B;  2WEV B;  1E9H B;  4BCQ B;  2R7G A;  3BLQ B;  2PHG A;  2EUF A;  3M03 A;  4YC3 B;  4CFW B;  4EOR B;  1F5Q B;  2BPM B;  1AIS B;  1OKW B;  4TTH A;  4CFU D;  1UNH D;  1H4L D;  2WMB B;  3EOC B;  3BLR B;  3LQ5 B;  1OIU B;  2F2C A;  5LQF B;  1FIN B;  4CRL B;  3RGF B;  3H4C A;  4EOI B;  2UZB B;  1OGU B;  3MIA B;  2CCH B;  5HBE B;  1P5E B;  3F5X B;  4F6S B;  4F7J B;  2W2H A;  5ACB A;  4EC8 B;  5CYI B;  2IW9 B;  1H25 B;  2W96 A;  4BCN D;  3EJ1 B;  4CXA B;  2W9Z A;  4YOS A;  2WHB B;  1GUX A;  5CEI B;  4BCG B;  1BU2 A;  5IDN B;  1JST B;  3O0G D;  2C5N B;  5BNJ B;  1TFB A;  3BLH B;  4FX3 B;  2PK9 B;  1UNL D;  2I40 B;  3QHR B;  4EOP B;  4BCM D;  3K7A M;  1KXU A;  4F6U B;  4BCI B;  1G3N C;  1PKD B;  2C5X B;  2W9F A;  5FGK B;  3QHW B;  1AD6 A;  2WXV B;  4KRC B;  1OIY B;  1VIN A;  5HBJ B;  1XO2 A;  2IW8 B;  4BCQ D;  4F6W B;  3TNI B;  1UNG D;  1H1Q B;  4BCP B;  2UUE B;  4F7L B;  5ICP B;  3DDQ B;  3TNH B;  4CFU B;  1GUX B;  5HQ0 B;  5L2W B;  4ROC A;  4KRD B;  4G6L B;  4EON B;  4BCH B;  1FVV B;  4EOJ B;  4BCO B;  1VYW B;  4CFX B;  4BCF B;  4ELJ A;  5LMK B;  4IMY B;  4BCK B;  1H24 B;  1ZP2 A;  2IVX A;  4ROD A;  4OGR B;  4UN0 A;  4ELL A;  2CCI B;  1URC B;  1H26 B;  4F7N B;  4F7S B;  2UZL B;  3MY1 B;  1JKW A;  3TNW B;  1VOL A;  2QDJ A;  4YOZ A;  1GY3 B;  2B9R A;  2C5V B;  2UZD B;  4CFN B;  1C9B A;  2WPA B;  5IF1 B;  2C5O B;  3G33 B;  2UZE B;  4EC9 B;  2WMA B;  3EID B;  4EOK B;  4YOO A;  1OL2 B;  5HNB B;  2V22 B;  2C6T B;  2BKZ B;  2JGZ B;  3BHU B;  2PK2 A;  4II5 B;  4CFV B;  5I5Z B;  1W98 B;  1QMZ B;  4EOO B;  3DOG B;  2W99 A;  2WFY B;  1O9K A;  3DDP B;  4EOQ B;  4BCJ B;  3BHT B;  3TN8 B;  4NST B;  4Y72 B;  3POM A;  1OKV B;  3MI9 B;  2WIP B; 
#chains in the Genus database with same CATH topology
 2D0Q B;  5DQW A;  1OI9 B;  4BY1 X;  4EOS B;  2BS2 A;  5HBH B;  1H27 B;  4BY7 X;  2PMI B;  2C4G B;  1JOW A;  2G77 A;  2X1N B;  3TW7 A;  4AI6 A;  4BCQ B;  3PO3 S;  2EUF A;  1ENW A;  1F5Q B;  4BBS M;  1OKW B;  1UNH D;  3BLR B;  5LQF B;  3RGF B;  2CZ0 B;  2UZB B;  3MIA B;  2CCH B;  2W2H A;  4EC8 B;  5CYI B;  2IW9 B;  3NDQ A;  4ZGE B;  1GUX A;  3O0G D;  2I40 B;  3QHR B;  4EOP B;  3HB9 A;  3K7A M;  4MFE A;  4BCI B;  1G3N C;  1PKD B;  4KRC B;  4F6W B;  4BCP B;  3VKG A;  5ICP B;  3TNH B;  4CFU B;  5L2W B;  4KRD B;  2ZPG B;  4G6L B;  4BCH B;  1VYW B;  4BCF B;  1AHJ B;  1H24 B;  2IVX A;  4UN0 A;  2CCI B;  1URC B;  1H26 B;  2QF7 A;  4EC9 B;  2WMA B;  3EID B;  4BBR M;  2CZ1 B;  4HL4 A;  2KR6 A;  2PK2 A;  4OB3 B;  2ZPF B;  2BS4 A;  3DOG B;  1UGQ B;  4EOQ B;  4BCJ B;  3BG9 A;  2PJQ A;  3WVD B;  3X24 B;  1QLB A;  1H1S B;  2G9X B;  4EOM B;  2ZPH B;  1H1R B;  4LOC A;  4Z6Y A;  2CYZ B;  4ZGD B;  5EFQ B;  1O9K B;  4CFM B;  2DPP B;  2WEV B;  1E9H B;  3X20 B;  3BLQ B;  2PHG A;  3M03 A;  4TTH A;  4CFU D;  3X26 B;  1H4L D;  2WMB B;  2F2C A;  5HBE B;  3F5X B;  4F6S B;  3EJ1 B;  3DJB A;  3HBL A;  4YOS A;  5CEI B;  2DD4 B;  1JST B;  2C5N B;  2WJ9 A;  2CZ6 B;  3BLH B;  5DQV A;  3VYH B;  2DXB B;  2C5X B;  2W9F A;  5FGK B;  1AD6 A;  1VIN A;  1XO2 A;  2IW8 B;  2UUE B;  3A8G B;  3QZ5 B;  3VKH A;  1GUX B;  4AKI A;  2QQ8 A;  4ROD A;  3QXE B;  3A8H B;  4OGR B;  1E7P A;  3X25 B;  3MY1 B;  4ZGJ B;  3BG3 A;  2QDJ A;  1GY3 B;  2C5V B;  2UZD B;  1C9B A;  3G33 B;  2UZE B;  2V22 B;  2BKZ B;  4II5 B;  5I5Z B;  1W98 B;  2W99 A;  4HNU A;  3DDP B;  1UGP B;  2ZPE B;  4Y72 B;  3POM A;  3MI9 B;  4CFN B;  1D3U B;  2IW6 B;  2BS3 A;  5HVY B;  1V29 B;  1H28 B;  3A8M B;  4OB0 B;  1UGS B;  4NC6 A;  1H1P B;  4OR5 B;  1JSU B;  2DXC B;  5IDP B;  2R7G A;  4CFW B;  2BPM B;  3EOC B;  4CRL B;  4EOI B;  3H4C A;  4OB1 B;  1P5E B;  4F7J B;  5ACB A;  4MIM A;  3QYB A;  1H25 B;  4FM4 B;  3QWL A;  4CXA B;  2W9Z A;  2WHB B;  5IDN B;  1TFB A;  3A8L B;  3VYG B;  4BCM D;  3TW6 A;  2QGS A;  3QYG B;  2WXV B;  1OIY B;  2ZPI B;  5HBJ B;  3A8O B;  2ZPB B;  4JX6 A;  3HHT B;  4EON B;  4EOJ B;  4BCO B;  4CFX B;  3QZ9 B;  4ELJ A;  5LMK B;  4IMY B;  1ZP2 A;  4ELL A;  3QYH B;  4F7N B;  4F7S B;  2UZL B;  3X28 B;  2IN3 A;  1VOL A;  4YOZ A;  3HZJ A;  2B9R A;  4MFD A;  5HNB B;  4BXX X;  4CFV B;  1UGR B;  5EJC A;  2AHJ B;  5IHY A;  4HNT A;  3TN8 B;  4NST B;  3GTM S;  1OKV B;  2WIP B;  1N4M A;  3MY5 B;  4EOL B;  4OB2 B;  4F70 B;  3BHV B;  2WIH B;  1GH6 B;  4JX4 A;  4BCM B;  2CJM B;  1OL1 B;  2I53 A;  4I3Z B;  4ROE A;  3QYE A;  3DTO A;  4EOR B;  4YC3 B;  3DL1 A;  3KHI A;  1AIS B;  1FKM A;  3LQ5 B;  1OIU B;  3WVE B;  1FIN B;  1OGU B;  2W96 A;  2QDY B;  4BCN D;  2CZ7 B;  4BCG B;  1BU2 A;  5BNJ B;  2ZCF B;  1TD6 A;  4FX3 B;  2PK9 B;  1UNL D;  4HNV A;  1KXU A;  4F6U B;  3QHW B;  4BCQ D;  3TNI B;  1UNG D;  1H1Q B;  2DD5 B;  4M6V A;  4F7L B;  3DDQ B;  5HQ0 B;  4ROC A;  2KMG A;  2ZZD B;  1FVV B;  4BCK B;  4AKH A;  4AKG A;  1IRE B;  1JKW A;  3TNW B;  4HLQ A;  2WPA B;  5IF1 B;  2DME A;  4QSH A;  2C5O B;  3HO8 A;  2QFZ A;  4EOK B;  4YOO A;  1OL2 B;  2LW4 A;  2C6T B;  3B57 A;  2JGZ B;  3BHU B;  1QMZ B;  4EOO B;  2WFY B;  1O9K A;  3BHT B;  3BG5 A;  4BCN B;  4JX5 A; 
#chains in the Genus database with same CATH homology
 1D3U B;  1N4M A;  2IW6 B;  3MY5 B;  1OI9 B;  4EOS B;  5HVY B;  4EOL B;  1H28 B;  5HBH B;  4F70 B;  1H1S B;  2G9X B;  4EOM B;  1H27 B;  3BHV B;  1H1R B;  2WIH B;  1GH6 B;  2PMI B;  4BCM B;  1H1P B;  5EFQ B;  2C4G B;  1JOW A;  1O9K B;  4OR5 B;  2CJM B;  1OL1 B;  2I53 A;  1JSU B;  2X1N B;  4I3Z B;  4ROE A;  4BCN B;  4CFM B;  5IDP B;  2WEV B;  1E9H B;  4BCQ B;  2R7G A;  3BLQ B;  2PHG A;  2EUF A;  3M03 A;  4YC3 B;  4CFW B;  4EOR B;  1F5Q B;  2BPM B;  1AIS B;  1OKW B;  4TTH A;  4CFU D;  1UNH D;  1H4L D;  2WMB B;  3EOC B;  3BLR B;  3LQ5 B;  1OIU B;  2F2C A;  5LQF B;  1FIN B;  4CRL B;  3RGF B;  3H4C A;  4EOI B;  2UZB B;  1OGU B;  3MIA B;  2CCH B;  5HBE B;  1P5E B;  3F5X B;  4F6S B;  4F7J B;  2W2H A;  5ACB A;  4EC8 B;  5CYI B;  2IW9 B;  1H25 B;  2W96 A;  4BCN D;  3EJ1 B;  4CXA B;  2W9Z A;  4YOS A;  2WHB B;  1GUX A;  5CEI B;  4BCG B;  1BU2 A;  5IDN B;  1JST B;  3O0G D;  2C5N B;  5BNJ B;  1TFB A;  3BLH B;  4FX3 B;  2PK9 B;  1UNL D;  2I40 B;  3QHR B;  4EOP B;  4BCM D;  3K7A M;  1KXU A;  4F6U B;  4BCI B;  1G3N C;  1PKD B;  2C5X B;  2W9F A;  5FGK B;  3QHW B;  1AD6 A;  2WXV B;  4KRC B;  1OIY B;  1VIN A;  5HBJ B;  1XO2 A;  2IW8 B;  4BCQ D;  4F6W B;  3TNI B;  1UNG D;  1H1Q B;  4BCP B;  2UUE B;  4F7L B;  5ICP B;  3DDQ B;  3TNH B;  4CFU B;  1GUX B;  5HQ0 B;  5L2W B;  4ROC A;  4KRD B;  4G6L B;  4EON B;  4BCH B;  1FVV B;  4EOJ B;  4BCO B;  1VYW B;  4CFX B;  4BCF B;  4ELJ A;  5LMK B;  4IMY B;  4BCK B;  1H24 B;  1ZP2 A;  2IVX A;  4ROD A;  4OGR B;  4UN0 A;  4ELL A;  2CCI B;  1URC B;  1H26 B;  4F7N B;  4F7S B;  2UZL B;  3MY1 B;  1JKW A;  3TNW B;  1VOL A;  2QDJ A;  4YOZ A;  1GY3 B;  2B9R A;  2C5V B;  2UZD B;  4CFN B;  1C9B A;  2WPA B;  5IF1 B;  2C5O B;  3G33 B;  2UZE B;  4EC9 B;  2WMA B;  3EID B;  4EOK B;  4YOO A;  1OL2 B;  5HNB B;  2V22 B;  2C6T B;  2BKZ B;  2JGZ B;  3BHU B;  2PK2 A;  4II5 B;  4CFV B;  5I5Z B;  1W98 B;  1QMZ B;  4EOO B;  3DOG B;  2W99 A;  2WFY B;  1O9K A;  3DDP B;  4EOQ B;  4BCJ B;  3BHT B;  3TN8 B;  4NST B;  4Y72 B;  3POM A;  1OKV B;  3MI9 B;  2WIP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...