1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
2PVDB 2ZPBB 1UGRB 2CZ7B 4ZGJB 4RKUE 2D0QB 2CZ0B 1QP3A 4OB2B 2PVOB 4OB3B 3VYHB 4ZGEB 3WVEB 3LW5E 2O01E 2PUKB 2PVGB 1UGPB 2DPPB 4ZGDB 2DD5A 4XK8E 2ZPGB 4OB0B 5L8RE 2DD5B 2ZPEB 3VYGB 3QZ9B 2PUOB 2ZPIB 2WSCE 4KT0E 3X28B 2CYZB 3A8HB 2DXCA 1AHJB 2WSEE 2ZPHB 3HHTB 3VYGA 1DJ7B 1JB0E 2DXBB 3A8GB 3QYHB 3A8LB 2ZZDB 4Y28E 4L6V5 2DXCB 2ZPFB 1IREB 1GXIE 1PSEA 3X20B 3QXEB 2DXBA 3A8MB 4FM4B 3A8OB 2WSFE 3WVDB 3QZ5B 2ZCFB 2ZZDA 2CZ1B 2PU9B 2QDYB 3X25B 1UGQB 1UGSB 2CZ6B 1PSFA 4OB1B 3QYGB 3X24B 2AHJB 2DD4A 1V29B 2DD4B 1QP2A 3X26B
chains in the Genus database with same CATH superfamily
4CC2A 3TW6A 2LZ6B 1QVFP 5GAOl 3S6WA 2K4YA 1KD1U 4HL4A 1C9BA 1VQOQ 3LX7A 1IB8A 1BI0A 2JTMA 1S1NA 1JU5C 1U06A 5CKHA 4C92G 2QA4T 2COZA 5DLOA 3HP9A 4AFSC 3VU3C 1Q7YU 3F5XB 3QHWB 1OOTA 5HNBB 3FC3A 1IHVA 3JCMP 3CPWA 1JSTB 2RA2A 2QXFA 1YI2T 3J80E 1NZ9A 1Q82R 1HD3A 3AT1B 3MHXA 2HSPA 1XQHA 1GUXA 3JCMc 1IRXA 2LT4A 1O9KB 4A54A 3PVLA 1RAHB 4M7AF 1R0BG 2IW6B 1I81A 3OYFA 2K5FA 2RHXA 4EOLB 2A28A 3OW2A 3QHSA 5LJ3d 1BKBA 4ELLA 5I22A 4Z02A 2P4TA 3EH1A 4DBRA 2K79A 4J9GA 2DL4A 5D6YA 2HAXA 2XI9A 5KYWB 3A8HB 3MI9B 2ZPHB 4MMKA 1Q82C 2D0NA 4R0KA 1YHQA 2KROA 2LX9A 1XOVA 1Z9ZA 2DXTA 5GAOp 4M6VA 2QEXT 1OX8A 2V26A 3OSSC 2YLBA 3CCQA 3BHUB 3MPUB 2NLUA 1GL5A 2FZGB 2RN8A 1K73R 1WLPB 4JRQA 3CCVA 2D1XA 4RTVA 1P5EB 4M7DA 1QQJA 4ATOA 3GLXA 1M9SA 1OI9B 2DFUA 2DL5A 4TVRA 1Q95G 2HBWA 2CH4W 4EIKA 3L2VA 4FU6A 4QSHA 4F7JB 3RERA 3TSZA 5DY9A 3JCMd 3I56T 3QKJA 4C92A 2HBPA 4XTUA 2E4HA 2SRCA 5GMKm 3CCET 2JS2A 5GANe 2YRDA 4X9DA 3BLRB 1FINB 3MKDA 2COYA 1VYVA 2VKNA 1ZSZC 4EOPB 3OB9A 2F1LA 4FSXA 1QW1A 3CMEQ 1YI2A 1G2BA 5IXBA 4FYWB 2WXVB 3N5BB 3PNWC 4EOJB 2A0FB 3Q1JA 1BYMA 5FU7B 4XQ3A 4RTWA 2EYZA 5GAMd 1WQ7A 2F5TX 2OTJT 3OYCA 3WVEB 1PC0A 5IDPB 2H3EB 1MV0B 2PUKB 4VUBA 4E7LA 2DZ9A 3CPWS 1H24B 1EZZB 2DYBA 4IKFA 1MUZA 2A36A 4HA8A 3FRNA 4JRKA 3JCMh 3M55A 3BY7A 3QWXX 3CPWP 3TN8B 2E12A 4J83A 1FXXA 4ROCA 2QTXA 1YWOA 2CP6A 1B07A 1WI7A 4EOOB 5KCOA 1W2BP 1KC8R 4CFMB 4Z89A 3EGXA 1F1BB 1WJSA 2WMAB 3RMQA 4CFUB 4BCPB 2O4XA 2QQ9A 4II5B 4Z6YA 2RI5A 3VS3A 2XDBA 1N5ZA 1WHJA 1WYXA 1ZBXA 4AKIA 4M77C 4JLGA 5LJ5h 3QXEB 1M5Q1 2CSQA 3PGGA 3BG3A 1RLPC 2EKHA 4FYYB 4LD9K 3UATA 1M8MA 3A98A 1M90C 2QAZA 3OYJA 1AVZC 3TSWA 1UGVA 3M5AA 5C6SA 3CCQQ 4HNUA 1YNZA 1LCKA 1UGQB 2CT3A 5KYXA 3BDUA 5KYXB 5D7UA 1OZ2A 4A4KA 4LUEA 2XD0A 5I11A 3PO3S 4KGZB 1OU9A 3OY9A 1GFDA 4EMKC 4BCFB 1RI0A 2QQBA 4PJOG 1HXDA 3GF5A 3EG1A 2H3JA 3A5ZB 2RQTA 3FDRA 3CC4A 2G9XB 3G71A 2I53A 1Y0MA 3QHRB 2VASA 3H6ZA 4MFDA 1QLBA 4C8QF 2PJQA 5IHIA 4ME7A 1U3OA 2IW8B 4OMFB 4PJOC 2HKNA 3UF4A 2RJCA 1H1PB 1FMKA 1KHCA 2EWNA 2YRVA 2FRYA 1M3BA 1M2VB 4Y72B 4M7DG 3KFVA 2QI2A 4JJCA 3VS1A 1SSFA 2D9TA 3H0FA 2OTJA 1XNIA 5L23A 4DEXA 1R0CB 2OAUA 1D0ZA 1K1ZA 5FRNA 3GNGA 2CP5A 4IIOA 1SF9A 2ZPIB 3I55Q 4KT0E 2ESWA 1X6BA 2EYXA 1VQKQ 2DBKA 4B9XA 2DL3A 1JJ2A 3V8KA 1UNHD 2GGRA 2QASA 3GNFB 1D3BA 4ELJA 3HHTB 4E7HA 3L2ZA 3QUIA 1M1KC 2LTOA 5FU6B 2DNUA 1OX9A 3SWNC 4Y28E 5A2QE 2CSIA 3VS4A 3H8ZA 3CD6A 1JKWA 2O4XB 1H28B 2RNAA 3L2RA 3H4CA 2K7AA 1K4US 2UZBB 1KJWA 5GJWB 1M3CA 1VQ4Q 4M77D 4BBRM 4RTZA 4F04B 3CC2A 1VQOT 1X69A 1VINA 3CCEA 2DX1A 2JZ2A 2DJQA 1K73C 2VGMA 3KXTA 4ZN1A 3CC2Q 1IHWA 1V29B 4FX3B 1G3YA 4EC9B 3JCMb 1GBQA 4HT8A 2PVDB 3FJPA 2RQWA 4QT7A 1VQMA 1WQWA 2IVWA 3EFOB 3NGPA 3M56A 4HCZA 5LQFB 1KIKA 2ECZA 1JBMA 4M7AE 2VXEA 4M77G 1E7PA 4DBQA 3V7SA 2P4RA 1TD6A 4M75E 2E1HA 1H92A 4OMMA 4C92E 3CD6Q 2D0QB 3PT9A 3VS0A 5LMKB 2GCXA 3A1PA 1ZSGA 2O9VA 4EMKA 2BZYA 2E5KA 4OB3B 1X27A 1YJNA 5GAN5 4EOQB 2MIOA 4C8QD 1ABOA 5IH2A 1WFWA 3CXCS 5LJ5e 1QCFA 4KUIA 1WJRA 1OPLA 3CMET 5IHNA 4KUDK 2VVKA 1YIJT 4ZTJA 4KRTA 1EX4A 3OW2S 1B3QA 1RACB 2KQWA 2KYMA 2X51A 4PJOA 4OMOA 3HZJA 3RR6A 1VQKT 4O5VA 3BLHB 2MWPA 3SEMA 2D6FA 1Q82U 2L3PA 1URCB 1KK7A 2BS3A 3MJXA 2HNIA 4BCQB 1NG2A 3LGLA 3CCVT 2MMPA 2LDMA 4KRDB 2W2HA 3VYGA 4KRCB 1K8AC 3K7AM 1M2OA 5HK0A 1J3TA 1GCQC 2A7YA 1VQ8Q 4CFUD 4QW2A 4M7DD 1VQ8A 1Y07A 3MY1B 2W9FA 4RG2A 2XG8D 1AWWA 2GFUA 4MZTA 1M1KR 3A8MB 4FM4B 3RGFB 3REAB 5FRMA 5GAMj 2JMAA 3VS6A 4KBMB 3CCST 4QKUA 4EOKB 1D3UB 2LRQA 1ACMB 1XTDA 4D8DA 4EPCA 2AK5A 2L8DA 3HPWA 4GLKA 4IIMA 3MIAB 2DTIA 2M0OA 2MWOA 3CC2T 1Y71A 1KG1A 3G7ZA 1CSKA 1JSUB 1I5OB 5J3BA 3PTAA 2DL7A 4ELYC 3G71T 2FB7A 2IVXA 3DJBA 1YJNT 1D09B 4X1VA 4C0FA 4A53A 3JB9G 2GQVA 2Y4YA 2J6FA 4PFPA 4V2SA 2RD1A 4RTXA 2LCLA 5GMKj 3EOCB 1UDLA 2YUPA 4BB7A 4BE2A 3I56A 1NEBA 4C8QG 1RAFB 3RKXA 2K5LA 3T9NA 2K57A 2QG9B 1M4ZA 4NL2A 1H1RB 2HCKA 2KBTA 4Q5WA 4M7AA 2V8KA 5CVIA 1K9MR 1VQNT 5ACBA 2WIPB 5DQWA 4J9BA 1WXTA 2DIQA 4C8QC 1T3LA 1GY3B 2UZDB 2DD5A 2ZPGB 1B34A 2DD5B 4AMCA 4F6UB 1QKXA 3I55A 3LYIA 3M57A 1LPLA 1E6GA 2VWFA 4E47A 2C0IA 1VQ9A 5GANd 2CP3A 3G1JA 4RMOA 3QG1A 1Y96A 1Q86R 1N4MA 2DMOA 4M7AC 2GFAA 1M27C 2QGGA 2HL3A 2IG0A 4RUGA 2PHGA 2K3YA 1N8RR 3A8LB 2ENMA 1HSQA 3OQ5A 4EORB 2A37A 3M0PA 5GAN4 4M75C 1E9HB 2ED0A 3OSVA 2HEQA 4EMHA 5CKDA 1K9MU 5FGKB 4A4HA 1WZOA 2YDLA 3BDLA 3PE0A 4EOSB 1FWZA 2M0YA 5CO7A 4LDXA 2K9GA 5HK3A 5DQVA 1ZX6A 2J6KA 3MP8A 1G5VA 1UJYA 2QGSA 4EONB 5HCKA 1YJ9Q 1NE8A 4MIMA 2EPDA 4CXAB 3JSCA 3BHVB 5KYUA 2O31A 4X9CA 1NJIU 2QGFB 1AZEA 1N9SA 3M9QA 2AHJB 1R8OB 1TWBA 1W1FA 3VJPA 2X3WD 2FO0A 3OA6A 1TUCA 2HMAA 4C5HA 1K0SA 3NMZC 2X1NB 2DTOA 1TS9A 3LWHA 4M78C 4BY6B 3PIPA 1ZP2A 4XTWA 2L3QA 3BW1A 4PLLA 2DF6A 6AT1B 1E6HA 4UC4A 1FMVA 4C5GA 3G4SA 4ZGEB 4M78G 2R57A 3CCMA 4C92C 2O2OA 1C1AA 3I5RA 4F7SB 3JCMV 1CKBA 1MMGA 3J81E 4JLIA 4JDSA 2DPPB 1I07A 1NJIR 4O6JA 2RPNA 1NLOC 4PK4A 3CCJT 4PJOD 1HYOA 1UHCA 1AWXA 2F2VA 4F17A 4BBSM 1ZUYA 4XTYA 2O88A 1VIEA 3SWNA 1KD1C 1YN8A 2DEQA 2NUPB 2FYKA 3E9GA 1VQLT 3EG3A 4DA4A 5D6WA 1G8XA 5EG2A 4M7AB 2F2XA 1OEBA 3J7AF 3BG5A 4F7UE 2L89A 4C5IA 2EJGA 2D8HA 3CBOA 4OGEA 3EH2A 3OYBA 4J6XA 2F2CA 3I9QA 1BCOA 1V1CA 4L6V5 5GMKe 2ZAEA 3CCLA 3KBGA 4LDVA 2ZPFB 4ZTFA 1PSEA 1SHFA 3M4YA 3P8HA 1AWOA 2QF7A 1FX7A 1K9AA 1NLPC 2VV5A 2YUQA 1N8RC 3JB9I 2FRWA 2P84A 2J06A 1H641 2QQRA 3WXMB 3URGA 1WGSA 3QZ5B 2R5AA 5CKFA 5LJ5d 2DJZA 2V1RA 1UTIA 3SD4A 1G3NC 3M59A 1Z9QA 1X6GA 4ZNXA 2WFYB 2KNBB 5ICPB 3M4GA 1Q81R 2WPAB 2QEXQ 4C8QE 3CD6T 2DYIA 1SRMA 3OYGA 4MZPA 1VQPQ 2EJFA 3JV3A 4HXJA 4M77A 4FYXB 1VQ5Q 2EQKA 1UFFA 2ED1A 4RCBA 4CC7A 4AG1C 1UECA 1I5LA 2JN0A 1Q81C 2LJ0A 1M2VA 1VYTA 2LC4A 2AT1B 1YIJQ 5EFQB 2WMBB 5GAOq 4FCYA 5DLQE 4C8QA 4BCOB 3OYDA 3JB9F 3EJ1B 4UN0A 3CCJA 3RUXA 3OBWA 3JAME 2V8JA 1QCNA 3PFSA 1I4K1 1OL2B 4PKCC 4E7JA 4OGRB 2RI2A 3OS0A 4OF1A 4E7SA 4M75G 2VYTA 5HKCA 1VQMT 3OYKA 1WIEA 1JJ2S 1O75A 2IN3A 2CUBA 3CCUQ 1OQKA 2AKLA 3RIRA 2DE0X 4WCIA 1YJ9A 2OTLT 1VQLQ 3EGXB 3HKSA 1GUXB 2PZ1A 4YTLA 3CBMA 4J9CA 1BK2A 2K2MA 1SEMA 3ME9A 3QO3A 1YJWQ 1TXQA 3CCMT 1UG1A 5CR2A 1GBRA 4BY6C 1EFNA 2DMEA 2DRMA 1OIYB 1NBEB 2B8AA 5LJ3h 2C5VB 5KYYA 2GNCA 1D1BA 4XAXB 3KHIA 3OYYA 1M1FA 2EFIA 4F6SB 3RMSA 5AT1B 3QYBA 1GXIE 1YFNA 5C0MA 1NYFA 2BS2A 1PKSA 2NUTB 4M7DE 4Y92A 1Q86C 1YWPA 2A3LA 4KGVB 4AKHA 4BE1A 3O8VA 2X4JA 3CCRA 2LNHB 3CC7A 4A63B 3VS5A 4OB1B 2P0QA 1RI9A 2QTVA 1SSHA 3CPFA 2BKZB 3LH5A 3QYEA 5A0GA 4EMKB 5IHKA 3MEVA 4LE9A 3L42A 1MMDA 4FSSA 2K6DA 1KQSS 4M78A 2XK0A 4FW1A 1GRIA 4CRIA 3CCLT 2FEIA 1G83A 5AYFA 1KC8U 4MZMA 4NOYA 4C5EA 2JM8A 2AKKA 1KXUA 3OW2P 1PKDB 2JM9A 1OKWB 3HTRA 2XIDA 2PK9B 3EG0A 3OS1A 1VOMA 2DETA 3QJYA 1GH6B 1BU1A 3CMAA 1H1SB 5KE3A 1WX6A 1ZBJA 1Y7XA 1WPYA 3V8JA 5GAOr 2BZXA 1H1QB 2M51A 3BFMA 4EOIB 1D3BB 4HVVA 2W96A 1KQSP 5GAOm 2O9SA 1CKAA 3QBYA 3CMAT 4F7UG 2L5QA 2C0OA 1W2BA 1AISB 1RUWA 1AOJA 2DBMA 2BTTA 3CCVQ 2QK0A 4M77E 3VRYA 2HL5C 1M8VA 3QYHB 4NL3A 3CXCP 1JRIA 4JX4A 4LDYA 4JRPA 3DDQB 2DTHA 8ATCB 1QVGA 2DXCB 3EFSA 4CC3A 3UPUA 4HVUA 4L59A 3ZFJA 5KCHA 4HCCA 4JZ3A 2OI3A 5CEIB 2DZCA 4J9IA 2RHIA 5GAN6 2NUTA 4PJLA 1LNXA 3E9FA 4J7FA 1OGUB 4DOVA 4AFUC 3HFNA 3SDZA 1SG5A 1U1TA 1QMZB 5HBJB 3VKGA 2FPDA 3QYGB 4MMLA 4HCKA 3OYLA 4DEYA 2JNGA 2VC8A 3X26B 4BDYA 4Z88A 1H26B 4NC6A 1VQ6T 3RKWA 2E3HA 1OYXA 1VQ4T 4CFWB 1UGRB 1QVFA 4I3ZB 2AIRB 3META 2CZ7B 5GANj 1VQ7T 1BIBA 2Z0WA 5GAN7 4B6MA 1QMCA 4M78B 4BCGB 3TCJA 1K76A 2FHDA 1FYNA 3HRUA 2XDDA 3GP8A 4MFEA 2PVOB 2RJDA 4CC4B 1XJWB 3I55T 1VQ6A 1NEGA 1ARKA 4G6LB 4HVWA 2B9RA 1D0YA 2PNIA 2LP5A 4XTVA 5KH6A 1FVVB 1YITA 4K11A 2QYZA 2KYBA 4OB0B 5CKBA 2ZPEB 2X9HA 4M77F 1YBYA 4J5YA 2LJ1A 4F7UA 3X28B 3M0TA 3P8DA 2QA4A 1KHIA 4M78E 3ZL7C 4JRIA 2COWA 4Z8AA 2Y4XA 3OMGA 2KR3A 4KULA 5FU6C 5GMKh 1WNLA 2WACA 1S72Q 2EGCA 1BB9A 5GANh 2C5OB 4XTZA 5I21A 4OVAA 2K3BA 4PJOE 3NPFA 4M78D 2DL8A 4QQGA 1XO2A 3OYAA 3QJ6A 3X20B 3R6OA 2E70A 4IUTA 1AEYA 2F5KA 3WVDB 2RK1A 1VYUA 1RABB 4JX6A 4OMNA 3CCMQ 3MEWA 2CZ1B 4AFQC 2BPMB 2PU9B 4JPBW 1X6OA 4EOMB 1SHGA 4PJOF 4BXXX 2DK3A 1AZGB 3NHNA 3VS7A 1ZSZB 1BCMA 1MGQA 2YUNA 4AI6A 5CQYA 3HFOA 1BI1A 3OYHA 2JGZB 4PJNA 2AZSA 2JMCA 4M75D 4ANJA 2HKQB 1HK9A 2QQ8A 2CZ0B 2WJ9A 2A08A 3OBYA 2JJ9A 2PQWA 3CCUT 4D8KA 3G71Q 1M90R 3DB3A 2OTLQ 4OR5B 5GAMe 2EJ9A 4R55A 1T3SA 1RL2A 2G77A 2KE9A 2NUPA 4PFZA 3JCMX 3G4SQ 4QQDA 1Q7YC 1W70A 1VOLA 1ZUUA 5CCAA 2P0KA 1VIFA 3E1SA 1M1GA 2YHTA 3CCJQ 2H8HA 2YUOA 4E7IA 1RLQC 4C92F 3EGDB 4AT1B 2CYZB 3O0GD 1YHQQ 2RI3A 1YIJA 3CC4T 2EBPA 2MF2A 2CREA 4F7UB 2LCSA 2ZGWA 2XMFA 3QDFA 1PD0A 2KXDA 4ESRA 1R77A 2CS7A 4AG2C 4BE0A 1JB0E 3C4SA 1JXOA 1JEGA 5IN1A 4IUVA 3I5SA 4RG8A 2L3SA 1WDXA 1LOJA 4C92B 5LJ3g 4M75B 4M7AG 2XICA 3LH0A 3H0HA 2EQJA 1N27A 4BI8B 3A8OB 4F70B 2KDSA 2WSFE 3IQLA 3DOGB 3VKIA 2ZZDA 1ZA1B 2DAQA 5D6XA 4Y91A 2EUFA 3JB9D 1YJNQ 2QDLA 3VRZA 3X25B 3I56Q 3CCLQ 1IGUA 2JVVA 2Y90A 2YRCA 1W2BS 1PSFA 4YOZA 2PTKA 3ASKA 3JB9H 3S3NA 2BE9B 4C8QB 4BI3A 3QDRB 5GMKi 1QP2A 1FKMA 4M4ZA 4LNPA 1OV3A 2MOXA 4R56A 1M30A 3EHRA 1OKVB 4XTXA 5CK9A 4PJMA 4RKUE 2DEUA 5L2WB 1OZ3A 1VQ9Q 3TEEA 5GANf 2CGHA 5CKEA 1N8RU 1QP3A 3REBB 1ZHIA 3PMTA 1EIFA 1PD1A 2XKOC 1PNJA 2NUZA 4BCQD 5GAN2 5GAN8 1NM7A 3EFOA 1NJIC 2O01E 4OGCA 1UB4A 2RHUA 4NS5A 5IAYA 4JZ4A 4XK8E 2QA4Q 4J6YA 2BIVA 3EG2A 4KH1B 3VKHA 2DXUA 2JT4A 2PUOB 2RQUA 2HD0A 3MCAB 4CI0C 1K8AU 1ENWA 5HVYB 1YI2Q 2MCNA 3ULRB 2RB6A 2V1QA 5IHYA 1YITQ 3PMIA 3BHTB 2ROLA 3CQTA 1AHJB 2M1HA 2WIHB 3PVQA 4JJDA 1W6XA 2JTEA 4EDUA 3GPLA 1VA7A 3DDPB 4GLMA 1HJDA 3M03A 4LDWA 4PFOA 2RK2A 3L2UA 4KGXB 5LJ3j 4CFNB 3EGDA 4M75A 1TFBA 2KMTA 2EAYA 2DXBA 1QLYA 1YP5A 1BBZA 2QFZA 2CCIB 4NSTB 2HQHA 1IGQA 5IT9E 3H0IA 2ZCFB 3TNHB 4F14A 4BCJB 3CCSQ 1MNEA 1YCSB 2C6TB 1D1CA 3THKA 1UGSB 3TNWB 2HQEA 2C5XB 2V22B 2CZ6B 1SRLA 4RTUA 3LLRA 4CFVB 3BG9A 3CCRT 1PRMC 2DD4A 2JS0A 5HY6A 2DKGA 2DD4B 3JB9J 1H8KA 2KGTA 2LT1A 4LXCA 1IXDA 5J39A 3D7SB 2W10A 4DBHA 3MEAA 2DVJA 2P0PA 1X2QA 4MDWA 4JS5A 3OMCA 2IIMA 1D1AA 3L1AA 4ROEA 1VQPT 1KSWA 4XU3A 4JS4A 3CCEQ 4MDXA 5FWCA 3DKMA 3G33B 5HBHB 2X35A 3CEYA 2EYWA 2LQKA 3M0UA 4F6WB 1TG0A 1KQ1A 2OX7A 4BACA 2LJ3A 1G3WA 4N0AA 2KR6A 4C0DB 1PRLC 4HNVA 4E7ZA 2M16A 1VQNQ 1VYWB 2W9ZA 1OU8A 2BUDA 3FIFA 4BY1X 1U8RA 1UUEA 5A0LA 1I1JA 3HBLA 2MI6A 2B86A 3G6ET 4ELZC 2VGNA 3ER0A 1Q81U 1H25B 4LUDA 2HQXA 5GMKl 4HCBA 4YOSA 4GBQA 2DXCA 2RJEA 2KY9A 2NYSA 3CMAQ 2R58A 3RESA 1VQMQ 3BE3A 2ABLA 2D8JA 1RAIB 4M7DF 2AZVA 4FT4A 3DL1A 5KYWA 4HKEA 5J26A 3DLMA 3INZA 4M75F 3CXCA 2EKOA 1PWTA 2L3RA 2J05A 4HNTA 1GFCA 4JJBA 1QVFS 4XU1A 3HO8A 2I40B 2C0TA 3JCMf 5EJCA 1LVKA 1RAAB 3QWYA 1Y96B 1VQ5T 3M0SA 1ZUKA 2ROTA 3F70A 1YJWT 2RMOA 2CKKA 2DILA 2RO0A 2RJFA 2BS4A 1QWEA 2YSQA 3QSUA 1AT1B 2KXCA 3MY5B 4QQ6A 2UZLB 3CCRQ 2EQUA 1VQ7A 2M9UA 3OS2A 2W0ZA 2X4XA 2OJ2A 4A4FA 4JJNK 4DBFA 3CMEA 1GCQA 3HRSA 2CH4A 1VQNA 2LQNA 2L0AA 3KUFA 3HSBA 5LJ5f 3C95A 1MV3A 2CP0A 2K5IA 4QVZA 2CJMB 5EC7A 1P92A 3M58A 2ATCB 3G4ST 1H27B 1VQKA 4PJOB 3OYNA 1QWFA 4J8OA 5GAN3 1OPKA 4P5NA 3EAEA 1H3HA 2KSSA 4D6WA 2C06A 2UUEB 2PMIB 2RHZA 1TSFA 2MPXC 1KFZA 3POMA 2CP2A 1WHLA 2RF0A 3S3OA 4M7AD 4FYVB 1QKWA 2GF7A 3FB9A 3ZEHA 4BCMD 2SEMA 1TU0B 3SB2A 1VQLA 1JOWA 1G3SA 2KK4A 4RTTA 5CAIA 5L8RE 2V8IA 1UNLD 4TTHA 1QCOA 4IURA 4LD6A 3L2WA 2E64A 2EVRA 5FW9A 1SPKA 1M90U 2WSCE 4ORZA 3EIDB 1X75C 2YT6A 1T0HA 2UZEB 2DRKA 4F16A 3CCSA 1KC8C 3R6NA 1WJQA 4AFZC 3C94A 3NTHA 2RQRA 1W4SA 2BKDN 3V7CA 1MHNA 4F7LB 5KYNA 1DJ7B 2XDPA 2NWMA 3E2UA 2QQSA 3HB9A 2VUBA 2E10A 2FZKB 2MAMA 3CCQT 3GTMS 3UWNA 3ZBDA 2DLPA 4OMPA 4HT9A 3VV0A 3VUBA 1KQSA 2J6OA 3SWNB 1VUBA 2KMGA 1TUGB 1VQ4A 5HQ0B 4BCND 2LW4A 3RNJA 1RADB 3PIOA 2HSEB 4CFXB 3V8LA 2RM4A 5KYYB 2E41A 1ZSZA 4QVDA 1VQ5A 3P8BB 5GJVB 4DQ2A 2LQ8A 1U1SA 4A4GA 3SFMA 5FLXE 1KD1R 2RQVA 2PK2A 4BI4A 2CDTA 2KRMA 3LWIA 1X43A 3X24B 1RAEB 1BI2A 1PCXA 2K3XA 3GIBA 1N6AA 1AWJA 3EHQA 2G3RA 1Q7YR 1WHMA 3FLGA 2FZCB 2DA9A 4FW2A 1OULA 2ZPBB 3RKYA 2JW4A 4ZN3A 1LJOA 2X4WA 3OYIA 4PLIA 3TU4K 9ATCB 5I5ZB 2WEVB 4E2FB 5GAMf 3CC7T 2OAWA 2KVQG 4M7DC 1ZLMA 1WHGA 2M02A 3MP6A 4RODA 1NPPA 1IZ6A 4BCIB 1UJ0A 3VS2A 2OTJQ 1WXUA 1ABQA 3TREA 4JUVA 3LGFA 1OI1A 3G6EA 4PJJA 4WF2A 1AD6A 2KEAA 2VXFA 3VYGB 1C6VX 1K0XA 1GCPA 2YXYA 2C5NB 2I0NA 1H4LD 3AHUA 1OIUB 3H41A 5CQXA 4BUGA 3CC4Q 1N9RA 4BD3A 2QDJA 5LJ5g 5DM7R 1K73U 4J9HA 5CIUA 4BCHB 3OYMA 2JOYA 4EC8B 3A8GB 3DLLA 3JRZA 4E7KA 4LOCA 3OS5A 4HLQA 1JXMA 2EGEA 2LNVA 3NFCA 5FWBA 4JX5A 2ZZDB 4J9FA 3QPHA 1QVGP 1Q86U 1SKUB 4YC3B 1RAGB 2XHCA 1YJWA 4IUQA 2HZYA 2QQAA 1TUDA 1QVPA 5KE2A 2JXBA 1KQ2A 3JCMW 2LCCA 1MMNA 3TW7A 1VQ7Q 2KAFA 5GAMh 3UDCA 2GBQA 2CP7A 3M54A 4XU2A 1TTHB 4LN2A 3JCMJ 2DERA 4WTOB 3NDQA 2I2LA 3HL8A 2MK5A 1X2KA 1OL1B 2JTFA 4ZGJB 5HBEB 4CRLB 4IUUA 2IPOB 1UEBA 1Y57A 1VQ9T 5I2MA 5LJ3f 2VB6A 1M1KU 2EGAA 5LL6S 1B34B 4OB2B 1TOVA 3VUZA 3TQ7P 4J7IA 5FROA 3G6EQ 4F7UF 2EQMA 4E6RA 7AT1B 5I2SA 1S72A 3M0QA 3TVTA 2GTJA 2EIFA 4FT2A 3LW5E 3RBBB 1I8FA 2PVGB 3RDVA 1C0MA 4YOOA 3V7RA 1MMAA 1WHHA 1UGPB 2LQWA 3UA7A 2FVUA 2KT8A 1VQPA 4II1A 5LJ3e 2X3XD 3QZ9B 4RCCA 2G6FX 2CUDA 1U5SA 1VQ8T 2CT4A 2JUFA 2J7IA 1VQOA 2BE7D 3O5ZA 5IDNB 4C0ZA 2WSEE 1BIAA 3M0RA 5IXFA 2LX7A 2DXBB 5LJ5j 3QWLA 1PG5B 4LDUA 2DVEA 2DIGA 3MEUA 3FJ5A 4C0GA 2F69A 5FU7C 2LMJA 4J9EA 2E5QA 4BY7X 1PHTA 1ZQ1A 3SHWA 1YHQT 4OMQA 5M9OA 4QVCA 4M77B 1IREB 1TH7A 1D0XA 2HDAA 2C4GB 2YLCA 4GY5A 2IW9B 1JO8A 4PNOA 2DM1A 3DTOA 2QDYB 1UHFA 3GBQA 4IMYB 4F7NB 1WHKA 2R7GA 5KYUB 1NYGA 4KH0B 2RHYA 1IO6A 3E19A 3JCMe 2FG0A 1F5QB 4L5GA 4X34A 1I0CA 4OP0A 2E65A 1FMWA 2K2VA 3NTKA 1G3TA 1E7OA 1VQ6Q 1YJ9T 4FIBA 2OTLA 2XU8A 4XU0A 1O9KA 1BI3A 4B9WA 3EFRA 1BU2A 3GOXA 1A0NB 1NPRA 1T0JA 3VYHB 2LVMA 3C12A 1JJ2P 3EG9B 5GANg 3BLQB 2EQIA 3MO8A 3L2QA 2EYYA 3EG9A 3TNIB 3MP1A 4C92D 2YWWA 4PL6A 1ZA2B 1UNGD 1PKTA 4RTYA 3NTIA 4ZGDB 3EGUA 3DB4A 1K9MC 2E6ZA 3H9NA 3U23A 4EMGA 4BCMB 3CCUA 3FEOA 3UA6A 2KRNA 1YCYA 4N4IA 4N4HA 2F2WA 2FPFA 4OMLA 2L2PA 3I35A 5A0DA 5BNJB 4DOWA 1MNDA 4M7DB 3LQ5B 1V76A 4BCKB 2KT1A 1PM3A 1S72T 3S3MA 2W99A 3JCMQ 4IUPA 4J9DA 1UE9A 3B57A 4N0AC 1O9SA 1W98B 2BZ8A 2R5MA 3JCMg 5GAOn 4BDZA 3HRTA 2KI7A 1YITT 1WXBA 2FL7A 1B7TA 1H3ZA 1AD5A 2KRSA 2EW3A 2WHBB 2E3IA 3M53A 4AKGA 2FPEA 2CCHB 4BCNB 1M3AA 3QIIA 4A4EA 4J6WA 1JQQA 4C0DC 3OYEA 4N4GA 5CYIB 2GQIA 2RH2A 1X01A 5ECAA 5IF1B 3CC7Q 2GTOA 2QEXA 2X4YA 2DO3A 1QVGS 2EYQA 3CBPA 1WA7A 8AT1B 4FL6A 4M78F 2E6NA 2MYSA 5GAMg 3UT1A 3C0CA 1K8AR
chains in the Genus database with same CATH topology
4BDYA 4ELYC 3HSBA 5LJ5f 3G71T 2FB7A 4NC6A 3C95A 1VQ6T 3RKWA 3TW6A 1OYXA 1VQ4T 2K5IA 4QVZA 5GAOl 1YJNT 4C0FA 1UGRB 2K4YA 3S6WA 4A53A 4HL4A 1KD1U 1QVFA 3META 2CZ7B 1P92A 3LX7A 3M58A 1BIBA 5GANj 3JB9G 1VQ7T 2GQVA 1BI0A 2Y4YA 3G4ST 1VQKA 2JTMA 3OYNA 4J8OA 5GAN3 4PJOB 4P5NA 2RD1A 5CKHA 5GAN7 4V2SA 3EAEA 4C92G 4M78B 2QA4T 2KSSA 2LCLA 5GMKj 5DLOA 3HP9A 4D6WA 4BB7A 3TCJA 3VU3C 4BE2A 2C06A 2FHDA 3HRUA 2XDDA 3GP8A 3I56A 4MFEA 2PVOB 4C8QG 2RHZA 3RKXA 2RJDA 1Q7YU 3I55T 3FC3A 3JCMP 2K5LA 3T9NA 3CPWA 2K57A 2RA2A 2QXFA 1M4ZA 1YI2T 1VQ6A 4NL2A 1NZ9A 3J80E 3S3OA 4Q5WA 4M7AD 4M7AA 2V8KA 5CVIA 2GF7A 3MHXA 1VQNT 3FB9A 3ZEHA 4XTVA 5KH6A 1YITA 1XQHA 3JCMc 2DIQA 3SB2A 4C8QC 1VQLA 1G3SA 2KK4A 2DD5A 2LT4A 5CAIA 2ZPGB 4OB0B 1B34A 4A54A 5CKBA 2DD5B 2ZPEB 2V8IA 5L8RE 4M7AF 3I55A 4IURA 4LD6A 4M77F 1I81A 3OYFA 1YBYA 3LYIA 2E64A 2K5FA 2RHXA 3L2WA 4J5YA 3M57A 1M90U 3OW2A 3QHSA 4F7UA 4E47A 2WSCE 1BKBA 5LJ3d 3X28B 5GANd 1VQ9A 1X75C 4Z02A 2P4TA 3P8DA 2QA4A 1KHIA 4M78E 3CCSA 5D6YA 4JRIA 4RMOA 2XI9A 1KC8C 2HAXA 3QG1A 3A8HB 1WJQA 1Y96A 2Y4XA 3C94A 3OMGA 3NTHA 4KULA 2ZPHB 1W4SA 4MMKA 2BKDN 5FU6C 1Q82C 2GFAA 3V7CA 5GMKh 4M7AC 1MHNA 1WNLA 2WACA 2OTJA 1DJ7B 2XDPA 2IG0A 2K3YA 1YHQA 5GANh 2QQSA 3HB9A 2VUBA 4XTZA 3A8LB 2E10A 2LX9A 1XOVA 3OQ5A 2MAMA 4OVAA 5I21A 3CCQT 2DXTA 5GAOp 3UWNA 3ZBDA 4M6VA 5GAN4 4HT9A 4PJOE 4M75C 4M78D 3VV0A 4QQGA 3VUBA 2QEXT 3OSSC 1KQSA 2YLBA 3OYAA 3CCQA 3SWNB 1VUBA 3X20B 2KMGA 2NLUA 3OSVA 3QJ6A 3R6OA 4EMHA 5CKDA 1VQ4A 2E70A 1K9MU 4JRQA 4IUTA 4A4HA 3CCVA 3BDLA 3PIOA 2F5KA 3WVDB 2RK1A 4M7DA 1FWZA 4ATOA 4JX6A 3GLXA 1M9SA 4TVRA 5CO7A 3MEWA 3V8LA 2RM4A 5HK3A 4LDXA 2CZ1B 2E41A 4QVDA 2PU9B 3P8BB 4FU6A 3L2VA 3MP8A 1VQ5A 1X6OA 4QSHA 1G5VA 4DQ2A 2LQ8A 1U1SA 1NE8A 3RERA 4MIMA 3JSCA 4A4GA 3SFMA 5FLXE 5DY9A 3JCMd 3I56T 4BI4A 3QKJA 4PJOF 4C92A 3LWIA 4X9CA 1NJIU 2HBPA 4XTUA 3X24B 1BI2A 2DK3A 2K3XA 1N9SA 5GMKm 3M9QA 2AHJB 1R8OB 3CCET 3GIBA 3VJPA 3OA6A 1N6AA 5GANe 2G3RA 4C5HA 3FLGA 4X9DA 1MGQA 2ZPBB 4AI6A 5CQYA 3HFOA 3RKYA 4ZN3A 3OYIA 1LJOA 2DTOA 2X4WA 4PLIA 3TU4K 3OB9A 4FSXA 1BI1A 1QW1A 1YI2A 3OYHA 3LWHA 5GAMf 3CC7T 3N5BB 3PNWC 4M78C 2KVQG 4M75D 4BY6B 4M7DC 3PIPA 1HK9A 3Q1JA 2QQ8A 2CZ0B 4XTWA 2WJ9A 1BYMA 5FU7B 4XQ3A 3OBYA 2PQWA 3BW1A 3CCUT 4PLLA 5GAMd 3MP6A 1WQ7A 1NPPA 4UC4A 1IZ6A 2F5TX 2OTJT 3DB3A 4C5GA 3G4SA 5GAMe 2EJ9A 4ZGEB 4R55A 4M78G 2R57A 3CCMA 4C92C 3OYCA 3WVEB 1RL2A 2G77A 2PUKB 3JCMV 3JCMX 3TREA 4JUVA 3LGFA 4QQDA 3J81E 1Q7YC 4JLIA 4JDSA 1OI1A 2DPPB 5CCAA 4VUBA 4E7LA 2DZ9A 3G6EA 2P0KA 4WF2A 4O6JA 3CPWS 1VIFA 4IKFA 2VXFA 3VYGB 3CCJT 4PJOD 3E1SA 1M1GA 2YHTA 4HA8A 4BBSM 4E7IA 3FRNA 4XTYA 4JRKA 3JCMh 4C92F 1VIEA 3SWNA 2CYZB 1KD1C 3M55A 3BY7A 2RI3A 1YIJA 2DEQA 3CC4T 3AHUA 2E12A 5CQXA 2FYKA 3E9GA 4BUGA 1VQLT 1N9RA 1FXXA 2MF2A 4J83A 2QTXA 4BD3A 4F7UB 2ZGWA 4DA4A 2QDJA 5D6WA 5LJ5g 5DM7R 1K73U 5KCOA 5EG2A 4M7AB 2CS7A 4BE0A 5CIUA 1JB0E 3OYMA 2JOYA 1WJSA 3C4SA 3J7AF 3A8GB 3BG5A 3JRZA 3RMQA 3DLLA 4E7KA 4F7UE 4LOCA 2L89A 3OS5A 5IN1A 4HLQA 4IUVA 4RG8A 4C5IA 2LNVA 2EJGA 2O4XA 3NFCA 4JX5A 2QQ9A 2ZZDB 3CBOA 4OGEA 1LOJA 4C92B 3OYBA 4Z6YA 5LJ3g 2RI5A 4J6XA 4M75B 2XDBA 4M7AG 3QPHA 4L6V5 5GMKe 3CCLA 3KBGA 2XICA 3LH0A 2ZPFB 4LDVA 1Q86U 2EQJA 1ZBXA 4ZTFA 1PSEA 4AKIA 3M4YA 3P8HA 4M77C 2QF7A 1FX7A 2VV5A 2XHCA 4JLGA 1YJWA 4IUQA 5LJ5h 1N8RC 3QXEB 3CC2T 1N27A 1M5Q1 2QQAA 3PGGA 4BI8B 3BG3A 3A8OB 1QVPA 1H641 3JB9I 2KDSA 2WSFE 5KE2A 4LD9K 2QQRA 3WXMB 3URGA 1WGSA 3QZ5B 2R5AA 2ZZDA 5CKFA 2DAQA 2DJZA 3VKIA 5LJ5d 3OYJA 3SD4A 5D6XA 1KQ2A 4Y91A 3JCMW 3M59A 3M5AA 3JB9D 5C6SA 2LCCA 3X25B 4HNUA 3TW7A 1UGQB 2JVVA 3M4GA 2KAFA 2Y90A 3BDUA 1W2BS 3JB9F 5GAMh 4C8QE 1PSFA 3UDCA 3CD6T 3ASKA 3OYGA 1OZ2A 4A4KA 4MZPA 3M54A 3S3NA 3JB9H 2EJFA 4XU2A 2XD0A 3JCMJ 4C8QB 4BI3A 4M77A 3QDRB 5GMKi 3OY9A 1QP2A 1FKMA 2EQKA 4EMKC 4RCBA 2I2LA 1RI0A 4R56A 3HL8A 2QQBA 4PJOG 1HXDA 3GF5A 1I5LA 2JN0A 2H3JA 1Q81C 3A5ZB 3FDRA 3CC4A 3G71A 2LC4A 4XTXA 2JTFA 4ZGJB 4IUUA 5CK9A 4RKUE 5GAOq 1OZ3A 3H6ZA 5DLQE 1UEBA 3TEEA 4C8QA 4MFDA 5GANf 1QLBA 5I2MA 5LJ3f 4C8QF 3OYDA 1VQ9T 2CGHA 3CCJA 5CKEA 4ME7A 3RUXA 1N8RU 1QP3A 1M1KU 5LL6S 3OBWA 4OMFB 1B34B 3JAME 4OB2B 4PJOC 2RJCA 3VUZA 1ZHIA 1KHCA 2V8JA 2EWNA 4J7IA 3PMTA 1EIFA 2YRVA 2EQMA 5FROA 2XKOC 4F7UF 3PFSA 5I2SA 5GAN2 1S72A 1I4K1 4M7DG 2QI2A 2EIFA 5GAN8 4PKCC 1SSFA 3LW5E 2D9TA 4FT2A 1I8FA 4E7JA 1NJIC 2RI2A 2O01E 4OF1A 2PVGB 1XNIA 2VYTA 4M75G 4OGCA 5HKCA 3OS0A 3V7RA 1VQMT 1UB4A 2RHUA 1UGPB 4NS5A 5IAYA 3OYKA 2OAUA 2FVUA 4XK8E 4J6YA 2BIVA 1JJ2S 1VQPA 3VKHA 4II1A 2DXUA 5LJ3e 5FRNA 1O75A 3QZ9B 3GNGA 2PUOB 4RCCA 2HD0A 3MCAB 2ZPIB 3RIRA 1VQ8T 4KT0E 4CI0C 1K8AU 1YJ9A 2OTLT 2JUFA 2RB6A 1VQOA 4B9XA 3HKSA 1JJ2A 3PMIA 4YTLA 3CBMA 3V8KA 4C0ZA 1AHJB 2WSEE 2M1HA 3GNFB 1D3BA 4ELJA 1BIAA 3HHTB 4E7HA 4EDUA 3ME9A 3QO3A 3L2ZA 2DXBB 5LJ5j 3GPLA 3CCMT 3QWLA 5CR2A 4LDUA 2DVEA 2DIGA 3QUIA 4BY6C 2LTOA 1M1KC 2B8AA 3MEUA 5FU6B 5LJ3h 4C0GA 2F69A 5FU7C 3SWNC 4XAXB 3KHIA 4Y28E 3OYYA 2E5QA 1M1FA 1ZQ1A 2EFIA 4LDWA 5A2QE 1YHQT 3RMSA 3H8ZA 2RK2A 4BACA 5M9OA 4QVCA 3L2UA 3CD6A 3QYBA 4M77B 2O4XB 1IREB 5LJ3j 5C0MA 1TH7A 2BS2A 3H4CA 3L2RA 1GXIE 4M75A 2KMTA 2EAYA 2DXBA 4M7DE 2YLCA 4GY5A 2QFZA 4PNOA 5IT9E 2ZCFB 1Q86C 2QDYB 2A3LA 4M77D 4BBRM 4AKHA 4BE1A 3CC2A 3O8VA 2X4JA 1VQOT 3CCRA 1UGSB 2HQEA 3CCEA 3CC7A 2CZ6B 4OB1B 2JZ2A 1K73C 2P0QA 2VGMA 3LLRA 2RHYA 3BG9A 4ZN1A 3KXTA 3CCRT 3E19A 3JCMe 3CPFA 2DD4A 1V29B 1G3YA 3JCMb 4L5GA 2DKGA 2DD4B 4X34A 5HY6A 4HT8A 4OP0A 2E65A 3QYEA 3JB9J 2LT1A 2PVDB 3FJPA 5A0GA 4EMKB 2K2VA 5J39A 3MEVA 1WQWA 2IVWA 3NTKA 3MEAA 3M56A 3L42A 4HCZA 1G3TA 1VQMA 1JBMA 1KQSS 4M78A 4FIBA 2XK0A 1YJ9T 2OTLA 4M7AE 2P0PA 2VXEA 2XU8A 4M77G 4XU0A 4CRIA 3CCLT 1E7PA 5AYFA 3V7SA 4MDWA 4JS5A 1BI3A 4M75E 4B9WA 2E1HA 3EFRA 4MZMA 1KC8U 4C92E 3OMCA 4NOYA 4C5EA 2D0QB 3PT9A 3L1AA 2GCXA 1VQPT 4XU3A 3GOXA 4JS4A 4MDXA 3DKMA 4EMKA 4OB3B 2X35A 3CEYA 1NPRA 1YJNA 5GAN5 3VYHB 2LQKA 2LVMA 2XIDA 4C8QD 3CXCS 5LJ5e 3C12A 1KQ1A 3OS1A 5GANg 1G3WA 3MO8A 3QJYA 1WJRA 2KR6A 4KUIA 4N0AA 3L2QA 3CMAA 3CMET 3MP1A 4C92D 5KE3A 4PL6A 4C0DB 1YIJT 4KUDK 4HNVA 1Y7XA 2M16A 4ZTJA 1WPYA 3NTIA 4ZGDB 2BUDA 3FIFA 3OW2S 3V8JA 3DB4A 5GAOr 1K9MC 2KQWA 1U8RA 4PJOA 5A0LA 2E6ZA 4EMGA 3HBLA 2MI6A 3HZJA 3CCUA 3G6ET 4ELZC 2VGNA 3BFMA 3ER0A 3FEOA 1VQKT 4O5VA 1Q81U 1D3BB 1YCYA 2MWPA 4N4IA 4N4HA 3UT1A 2D6FA 1Q82U 2HQXA 5A0DA 5GAOm 4DOWA 3QBYA 5GMKl 4HCBA 2BS3A 3CMAT 4M7DB 2HNIA 2DXCA 2RJEA 2KY9A 2L5QA 4F7UG 2R58A 3RESA 1W2BA 3CCVT 3LGLA 2MMPA 2LDMA 3VYGA 1K8AC 1M90C 4M77E 1S72T 4M7DF 1M8VA 3QYHB 4FT4A 3DL1A 5HK0A 4NL3A 3S3MA 4HKEA 5J26A 3JCMQ 3DLMA 3INZA 4IUPA 1JRIA 4M75F 4JX4A 4LDYA 3CXCA 4JRPA 2DTHA 2EKOA 4N0AC 2A7YA 1O9SA 4QW2A 4M7DD 1VQ8A 2L3RA 2R5MA 3JCMg 1Y07A 5GAOn 4BDZA 1QVGA 2DXCB 4HNTA 3HRTA 3EFSA 1QVFS 4XU1A 1YITT 4RG2A 3HO8A 2XG8D 3JCMf 5EJCA 2GFUA 2FL7A 4MZTA 3UPUA 1H3ZA 4L59A 3A8MB 4FM4B 3ZFJA 5KCHA 1VQ5T 1Y96B 5FRMA 5GAMj 4HCCA 3F70A 1YJWT 4KBMB 2CKKA 2DZCA 3M53A 4AKGA 2RHIA 2RO0A 5GAN6 3CCST 2RJFA 2BS4A 3QSUA 2LRQA 3QIIA 4A4EA 4J6WA 1LNXA 1XTDA 3E9FA 4C0DC 4EPCA 2L8DA 3HPWA 3OYEA 4GLKA 4N4GA 4J7FA 4DOVA 4QQ6A 3HFNA 2RH2A 3SDZA 2DTIA 2M0OA 1U1TA 1X01A 3VKGA 2MWOA 2QEXA 2X4YA 2DO3A 1QVGS 3QYGB 1Y71A 2EQUA 2M9UA 2EYQA 3CBPA 3OS2A 1VQ7A 3G7ZA 4FL6A 1KG1A 2X4XA 4MMLA 5J3BA 4M78F 4A4FA 2E6NA 3OYLA 4JJNK 3CMEA 2JNGA 3HRSA 5GAMg 2VC8A 3PTAA 1VQNA 3X26B 3KUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVD B;  2ZPB B;  1UGR B;  2CZ7 B;  4ZGJ B;  4RKU E;  2D0Q B;  2CZ0 B;  1QP3 A;  4OB2 B;  2PVO B;  4OB3 B;  3VYH B;  4ZGE B;  3WVE B;  3LW5 E;  2O01 E;  2PUK B;  2PVG B;  1UGP B;  2DPP B;  4ZGD B;  2DD5 A;  4XK8 E;  2ZPG B;  4OB0 B;  5L8R E;  2DD5 B;  2ZPE B;  3VYG B;  3QZ9 B;  2PUO B;  2ZPI B;  2WSC E;  4KT0 E;  3X28 B;  2CYZ B;  3A8H B;  2DXC A;  1AHJ B;  2WSE E;  2ZPH B;  3HHT B;  3VYG A;  1DJ7 B;  1JB0 E;  2DXB B;  3A8G B;  3QYH B;  3A8L B;  2ZZD B;  4Y28 E;  4L6V 5;  2DXC B;  2ZPF B;  1IRE B;  1GXI E;  1PSE A;  3X20 B;  3QXE B;  2DXB A;  3A8M B;  4FM4 B;  3A8O B;  2WSF E;  3WVD B;  3QZ5 B;  2ZCF B;  2ZZD A;  2CZ1 B;  2PU9 B;  2QDY B;  3X25 B;  1UGQ B;  1UGS B;  2CZ6 B;  1PSF A;  4OB1 B;  3QYG B;  3X24 B;  2AHJ B;  2DD4 A;  1V29 B;  2DD4 B;  1QP2 A;  3X26 B; 
#chains in the Genus database with same CATH topology
 4CC2 A;  3TW6 A;  2LZ6 B;  1QVF P;  5GAO l;  3S6W A;  2K4Y A;  1KD1 U;  4HL4 A;  1C9B A;  1VQO Q;  3LX7 A;  1IB8 A;  1BI0 A;  2JTM A;  1S1N A;  1JU5 C;  1U06 A;  5CKH A;  4C92 G;  2QA4 T;  2COZ A;  5DLO A;  3HP9 A;  4AFS C;  3VU3 C;  1Q7Y U;  3F5X B;  3QHW B;  1OOT A;  5HNB B;  3FC3 A;  1IHV A;  3JCM P;  3CPW A;  1JST B;  2RA2 A;  2QXF A;  1YI2 T;  3J80 E;  1NZ9 A;  1Q82 R;  1HD3 A;  3AT1 B;  3MHX A;  2HSP A;  1XQH A;  1GUX A;  3JCM c;  1IRX A;  2LT4 A;  1O9K B;  4A54 A;  3PVL A;  1RAH B;  4M7A F;  1R0B G;  2IW6 B;  1I81 A;  3OYF A;  2K5F A;  2RHX A;  4EOL B;  2A28 A;  3OW2 A;  3QHS A;  5LJ3 d;  1BKB A;  4ELL A;  5I22 A;  4Z02 A;  2P4T A;  3EH1 A;  4DBR A;  2K79 A;  4J9G A;  2DL4 A;  5D6Y A;  2HAX A;  2XI9 A;  5KYW B;  3A8H B;  3MI9 B;  2ZPH B;  4MMK A;  1Q82 C;  2D0N A;  4R0K A;  1YHQ A;  2KRO A;  2LX9 A;  1XOV A;  1Z9Z A;  2DXT A;  5GAO p;  4M6V A;  2QEX T;  1OX8 A;  2V26 A;  3OSS C;  2YLB A;  3CCQ A;  3BHU B;  3MPU B;  2NLU A;  1GL5 A;  2FZG B;  2RN8 A;  1K73 R;  1WLP B;  4JRQ A;  3CCV A;  2D1X A;  4RTV A;  1P5E B;  4M7D A;  1QQJ A;  4ATO A;  3GLX A;  1M9S A;  1OI9 B;  2DFU A;  2DL5 A;  4TVR A;  1Q95 G;  2HBW A;  2CH4 W;  4EIK A;  3L2V A;  4FU6 A;  4QSH A;  4F7J B;  3RER A;  3TSZ A;  5DY9 A;  3JCM d;  3I56 T;  3QKJ A;  4C92 A;  2HBP A;  4XTU A;  2E4H A;  2SRC A;  5GMK m;  3CCE T;  2JS2 A;  5GAN e;  2YRD A;  4X9D A;  3BLR B;  1FIN B;  3MKD A;  2COY A;  1VYV A;  2VKN A;  1ZSZ C;  4EOP B;  3OB9 A;  2F1L A;  4FSX A;  1QW1 A;  3CME Q;  1YI2 A;  1G2B A;  5IXB A;  4FYW B;  2WXV B;  3N5B B;  3PNW C;  4EOJ B;  2A0F B;  3Q1J A;  1BYM A;  5FU7 B;  4XQ3 A;  4RTW A;  2EYZ A;  5GAM d;  1WQ7 A;  2F5T X;  2OTJ T;  3OYC A;  3WVE B;  1PC0 A;  5IDP B;  2H3E B;  1MV0 B;  2PUK B;  4VUB A;  4E7L A;  2DZ9 A;  3CPW S;  1H24 B;  1EZZ B;  2DYB A;  4IKF A;  1MUZ A;  2A36 A;  4HA8 A;  3FRN A;  4JRK A;  3JCM h;  3M55 A;  3BY7 A;  3QWX X;  3CPW P;  3TN8 B;  2E12 A;  4J83 A;  1FXX A;  4ROC A;  2QTX A;  1YWO A;  2CP6 A;  1B07 A;  1WI7 A;  4EOO B;  5KCO A;  1W2B P;  1KC8 R;  4CFM B;  4Z89 A;  3EGX A;  1F1B B;  1WJS A;  2WMA B;  3RMQ A;  4CFU B;  4BCP B;  2O4X A;  2QQ9 A;  4II5 B;  4Z6Y A;  2RI5 A;  3VS3 A;  2XDB A;  1N5Z A;  1WHJ A;  1WYX A;  1ZBX A;  4AKI A;  4M77 C;  4JLG A;  5LJ5 h;  3QXE B;  1M5Q 1;  2CSQ A;  3PGG A;  3BG3 A;  1RLP C;  2EKH A;  4FYY B;  4LD9 K;  3UAT A;  1M8M A;  3A98 A;  1M90 C;  2QAZ A;  3OYJ A;  1AVZ C;  3TSW A;  1UGV A;  3M5A A;  5C6S A;  3CCQ Q;  4HNU A;  1YNZ A;  1LCK A;  1UGQ B;  2CT3 A;  5KYX A;  3BDU A;  5KYX B;  5D7U A;  1OZ2 A;  4A4K A;  4LUE A;  2XD0 A;  5I11 A;  3PO3 S;  4KGZ B;  1OU9 A;  3OY9 A;  1GFD A;  4EMK C;  4BCF B;  1RI0 A;  2QQB A;  4PJO G;  1HXD A;  3GF5 A;  3EG1 A;  2H3J A;  3A5Z B;  2RQT A;  3FDR A;  3CC4 A;  2G9X B;  3G71 A;  2I53 A;  1Y0M A;  3QHR B;  2VAS A;  3H6Z A;  4MFD A;  1QLB A;  4C8Q F;  2PJQ A;  5IHI A;  4ME7 A;  1U3O A;  2IW8 B;  4OMF B;  4PJO C;  2HKN A;  3UF4 A;  2RJC A;  1H1P B;  1FMK A;  1KHC A;  2EWN A;  2YRV A;  2FRY A;  1M3B A;  1M2V B;  4Y72 B;  4M7D G;  3KFV A;  2QI2 A;  4JJC A;  3VS1 A;  1SSF A;  2D9T A;  3H0F A;  2OTJ A;  1XNI A;  5L23 A;  4DEX A;  1R0C B;  2OAU A;  1D0Z A;  1K1Z A;  5FRN A;  3GNG A;  2CP5 A;  4IIO A;  1SF9 A;  2ZPI B;  3I55 Q;  4KT0 E;  2ESW A;  1X6B A;  2EYX A;  1VQK Q;  2DBK A;  4B9X A;  2DL3 A;  1JJ2 A;  3V8K A;  1UNH D;  2GGR A;  2QAS A;  3GNF B;  1D3B A;  4ELJ A;  3HHT B;  4E7H A;  3L2Z A;  3QUI A;  1M1K C;  2LTO A;  5FU6 B;  2DNU A;  1OX9 A;  3SWN C;  4Y28 E;  5A2Q E;  2CSI A;  3VS4 A;  3H8Z A;  3CD6 A;  1JKW A;  2O4X B;  1H28 B;  2RNA A;  3L2R A;  3H4C A;  2K7A A;  1K4U S;  2UZB B;  1KJW A;  5GJW B;  1M3C A;  1VQ4 Q;  4M77 D;  4BBR M;  4RTZ A;  4F04 B;  3CC2 A;  1VQO T;  1X69 A;  1VIN A;  3CCE A;  2DX1 A;  2JZ2 A;  2DJQ A;  1K73 C;  2VGM A;  3KXT A;  4ZN1 A;  3CC2 Q;  1IHW A;  1V29 B;  4FX3 B;  1G3Y A;  4EC9 B;  3JCM b;  1GBQ A;  4HT8 A;  2PVD B;  3FJP A;  2RQW A;  4QT7 A;  1VQM A;  1WQW A;  2IVW A;  3EFO B;  3NGP A;  3M56 A;  4HCZ A;  5LQF B;  1KIK A;  2ECZ A;  1JBM A;  4M7A E;  2VXE A;  4M77 G;  1E7P A;  4DBQ A;  3V7S A;  2P4R A;  1TD6 A;  4M75 E;  2E1H A;  1H92 A;  4OMM A;  4C92 E;  3CD6 Q;  2D0Q B;  3PT9 A;  3VS0 A;  5LMK B;  2GCX A;  3A1P A;  1ZSG A;  2O9V A;  4EMK A;  2BZY A;  2E5K A;  4OB3 B;  1X27 A;  1YJN A;  5GAN 5;  4EOQ B;  2MIO A;  4C8Q D;  1ABO A;  5IH2 A;  1WFW A;  3CXC S;  5LJ5 e;  1QCF A;  4KUI A;  1WJR A;  1OPL A;  3CME T;  5IHN A;  4KUD K;  2VVK A;  1YIJ T;  4ZTJ A;  4KRT A;  1EX4 A;  3OW2 S;  1B3Q A;  1RAC B;  2KQW A;  2KYM A;  2X51 A;  4PJO A;  4OMO A;  3HZJ A;  3RR6 A;  1VQK T;  4O5V A;  3BLH B;  2MWP A;  3SEM A;  2D6F A;  1Q82 U;  2L3P A;  1URC B;  1KK7 A;  2BS3 A;  3MJX A;  2HNI A;  4BCQ B;  1NG2 A;  3LGL A;  3CCV T;  2MMP A;  2LDM A;  4KRD B;  2W2H A;  3VYG A;  4KRC B;  1K8A C;  3K7A M;  1M2O A;  5HK0 A;  1J3T A;  1GCQ C;  2A7Y A;  1VQ8 Q;  4CFU D;  4QW2 A;  4M7D D;  1VQ8 A;  1Y07 A;  3MY1 B;  2W9F A;  4RG2 A;  2XG8 D;  1AWW A;  2GFU A;  4MZT A;  1M1K R;  3A8M B;  4FM4 B;  3RGF B;  3REA B;  5FRM A;  5GAM j;  2JMA A;  3VS6 A;  4KBM B;  3CCS T;  4QKU A;  4EOK B;  1D3U B;  2LRQ A;  1ACM B;  1XTD A;  4D8D A;  4EPC A;  2AK5 A;  2L8D A;  3HPW A;  4GLK A;  4IIM A;  3MIA B;  2DTI A;  2M0O A;  2MWO A;  3CC2 T;  1Y71 A;  1KG1 A;  3G7Z A;  1CSK A;  1JSU B;  1I5O B;  5J3B A;  3PTA A;  2DL7 A;  4ELY C;  3G71 T;  2FB7 A;  2IVX A;  3DJB A;  1YJN T;  1D09 B;  4X1V A;  4C0F A;  4A53 A;  3JB9 G;  2GQV A;  2Y4Y A;  2J6F A;  4PFP A;  4V2S A;  2RD1 A;  4RTX A;  2LCL A;  5GMK j;  3EOC B;  1UDL A;  2YUP A;  4BB7 A;  4BE2 A;  3I56 A;  1NEB A;  4C8Q G;  1RAF B;  3RKX A;  2K5L A;  3T9N A;  2K57 A;  2QG9 B;  1M4Z A;  4NL2 A;  1H1R B;  2HCK A;  2KBT A;  4Q5W A;  4M7A A;  2V8K A;  5CVI A;  1K9M R;  1VQN T;  5ACB A;  2WIP B;  5DQW A;  4J9B A;  1WXT A;  2DIQ A;  4C8Q C;  1T3L A;  1GY3 B;  2UZD B;  2DD5 A;  2ZPG B;  1B34 A;  2DD5 B;  4AMC A;  4F6U B;  1QKX A;  3I55 A;  3LYI A;  3M57 A;  1LPL A;  1E6G A;  2VWF A;  4E47 A;  2C0I A;  1VQ9 A;  5GAN d;  2CP3 A;  3G1J A;  4RMO A;  3QG1 A;  1Y96 A;  1Q86 R;  1N4M A;  2DMO A;  4M7A C;  2GFA A;  1M27 C;  2QGG A;  2HL3 A;  2IG0 A;  4RUG A;  2PHG A;  2K3Y A;  1N8R R;  3A8L B;  2ENM A;  1HSQ A;  3OQ5 A;  4EOR B;  2A37 A;  3M0P A;  5GAN 4;  4M75 C;  1E9H B;  2ED0 A;  3OSV A;  2HEQ A;  4EMH A;  5CKD A;  1K9M U;  5FGK B;  4A4H A;  1WZO A;  2YDL A;  3BDL A;  3PE0 A;  4EOS B;  1FWZ A;  2M0Y A;  5CO7 A;  4LDX A;  2K9G A;  5HK3 A;  5DQV A;  1ZX6 A;  2J6K A;  3MP8 A;  1G5V A;  1UJY A;  2QGS A;  4EON B;  5HCK A;  1YJ9 Q;  1NE8 A;  4MIM A;  2EPD A;  4CXA B;  3JSC A;  3BHV B;  5KYU A;  2O31 A;  4X9C A;  1NJI U;  2QGF B;  1AZE A;  1N9S A;  3M9Q A;  2AHJ B;  1R8O B;  1TWB A;  1W1F A;  3VJP A;  2X3W D;  2FO0 A;  3OA6 A;  1TUC A;  2HMA A;  4C5H A;  1K0S A;  3NMZ C;  2X1N B;  2DTO A;  1TS9 A;  3LWH A;  4M78 C;  4BY6 B;  3PIP A;  1ZP2 A;  4XTW A;  2L3Q A;  3BW1 A;  4PLL A;  2DF6 A;  6AT1 B;  1E6H A;  4UC4 A;  1FMV A;  4C5G A;  3G4S A;  4ZGE B;  4M78 G;  2R57 A;  3CCM A;  4C92 C;  2O2O A;  1C1A A;  3I5R A;  4F7S B;  3JCM V;  1CKB A;  1MMG A;  3J81 E;  4JLI A;  4JDS A;  2DPP B;  1I07 A;  1NJI R;  4O6J A;  2RPN A;  1NLO C;  4PK4 A;  3CCJ T;  4PJO D;  1HYO A;  1UHC A;  1AWX A;  2F2V A;  4F17 A;  4BBS M;  1ZUY A;  4XTY A;  2O88 A;  1VIE A;  3SWN A;  1KD1 C;  1YN8 A;  2DEQ A;  2NUP B;  2FYK A;  3E9G A;  1VQL T;  3EG3 A;  4DA4 A;  5D6W A;  1G8X A;  5EG2 A;  4M7A B;  2F2X A;  1OEB A;  3J7A F;  3BG5 A;  4F7U E;  2L89 A;  4C5I A;  2EJG A;  2D8H A;  3CBO A;  4OGE A;  3EH2 A;  3OYB A;  4J6X A;  2F2C A;  3I9Q A;  1BCO A;  1V1C A;  4L6V 5;  5GMK e;  2ZAE A;  3CCL A;  3KBG A;  4LDV A;  2ZPF B;  4ZTF A;  1PSE A;  1SHF A;  3M4Y A;  3P8H A;  1AWO A;  2QF7 A;  1FX7 A;  1K9A A;  1NLP C;  2VV5 A;  2YUQ A;  1N8R C;  3JB9 I;  2FRW A;  2P84 A;  2J06 A;  1H64 1;  2QQR A;  3WXM B;  3URG A;  1WGS A;  3QZ5 B;  2R5A A;  5CKF A;  5LJ5 d;  2DJZ A;  2V1R A;  1UTI A;  3SD4 A;  1G3N C;  3M59 A;  1Z9Q A;  1X6G A;  4ZNX A;  2WFY B;  2KNB B;  5ICP B;  3M4G A;  1Q81 R;  2WPA B;  2QEX Q;  4C8Q E;  3CD6 T;  2DYI A;  1SRM A;  3OYG A;  4MZP A;  1VQP Q;  2EJF A;  3JV3 A;  4HXJ A;  4M77 A;  4FYX B;  1VQ5 Q;  2EQK A;  1UFF A;  2ED1 A;  4RCB A;  4CC7 A;  4AG1 C;  1UEC A;  1I5L A;  2JN0 A;  1Q81 C;  2LJ0 A;  1M2V A;  1VYT A;  2LC4 A;  2AT1 B;  1YIJ Q;  5EFQ B;  2WMB B;  5GAO q;  4FCY A;  5DLQ E;  4C8Q A;  4BCO B;  3OYD A;  3JB9 F;  3EJ1 B;  4UN0 A;  3CCJ A;  3RUX A;  3OBW A;  3JAM E;  2V8J A;  1QCN A;  3PFS A;  1I4K 1;  1OL2 B;  4PKC C;  4E7J A;  4OGR B;  2RI2 A;  3OS0 A;  4OF1 A;  4E7S A;  4M75 G;  2VYT A;  5HKC A;  1VQM T;  3OYK A;  1WIE A;  1JJ2 S;  1O75 A;  2IN3 A;  2CUB A;  3CCU Q;  1OQK A;  2AKL A;  3RIR A;  2DE0 X;  4WCI A;  1YJ9 A;  2OTL T;  1VQL Q;  3EGX B;  3HKS A;  1GUX B;  2PZ1 A;  4YTL A;  3CBM A;  4J9C A;  1BK2 A;  2K2M A;  1SEM A;  3ME9 A;  3QO3 A;  1YJW Q;  1TXQ A;  3CCM T;  1UG1 A;  5CR2 A;  1GBR A;  4BY6 C;  1EFN A;  2DME A;  2DRM A;  1OIY B;  1NBE B;  2B8A A;  5LJ3 h;  2C5V B;  5KYY A;  2GNC A;  1D1B A;  4XAX B;  3KHI A;  3OYY A;  1M1F A;  2EFI A;  4F6S B;  3RMS A;  5AT1 B;  3QYB A;  1GXI E;  1YFN A;  5C0M A;  1NYF A;  2BS2 A;  1PKS A;  2NUT B;  4M7D E;  4Y92 A;  1Q86 C;  1YWP A;  2A3L A;  4KGV B;  4AKH A;  4BE1 A;  3O8V A;  2X4J A;  3CCR A;  2LNH B;  3CC7 A;  4A63 B;  3VS5 A;  4OB1 B;  2P0Q A;  1RI9 A;  2QTV A;  1SSH A;  3CPF A;  2BKZ B;  3LH5 A;  3QYE A;  5A0G A;  4EMK B;  5IHK A;  3MEV A;  4LE9 A;  3L42 A;  1MMD A;  4FSS A;  2K6D A;  1KQS S;  4M78 A;  2XK0 A;  4FW1 A;  1GRI A;  4CRI A;  3CCL T;  2FEI A;  1G83 A;  5AYF A;  1KC8 U;  4MZM A;  4NOY A;  4C5E A;  2JM8 A;  2AKK A;  1KXU A;  3OW2 P;  1PKD B;  2JM9 A;  1OKW B;  3HTR A;  2XID A;  2PK9 B;  3EG0 A;  3OS1 A;  1VOM A;  2DET A;  3QJY A;  1GH6 B;  1BU1 A;  3CMA A;  1H1S B;  5KE3 A;  1WX6 A;  1ZBJ A;  1Y7X A;  1WPY A;  3V8J A;  5GAO r;  2BZX A;  1H1Q B;  2M51 A;  3BFM A;  4EOI B;  1D3B B;  4HVV A;  2W96 A;  1KQS P;  5GAO m;  2O9S A;  1CKA A;  3QBY A;  3CMA T;  4F7U G;  2L5Q A;  2C0O A;  1W2B A;  1AIS B;  1RUW A;  1AOJ A;  2DBM A;  2BTT A;  3CCV Q;  2QK0 A;  4M77 E;  3VRY A;  2HL5 C;  1M8V A;  3QYH B;  4NL3 A;  3CXC P;  1JRI A;  4JX4 A;  4LDY A;  4JRP A;  3DDQ B;  2DTH A;  8ATC B;  1QVG A;  2DXC B;  3EFS A;  4CC3 A;  3UPU A;  4HVU A;  4L59 A;  3ZFJ A;  5KCH A;  4HCC A;  4JZ3 A;  2OI3 A;  5CEI B;  2DZC A;  4J9I A;  2RHI A;  5GAN 6;  2NUT A;  4PJL A;  1LNX A;  3E9F A;  4J7F A;  1OGU B;  4DOV A;  4AFU C;  3HFN A;  3SDZ A;  1SG5 A;  1U1T A;  1QMZ B;  5HBJ B;  3VKG A;  2FPD A;  3QYG B;  4MML A;  4HCK A;  3OYL A;  4DEY A;  2JNG A;  2VC8 A;  3X26 B;  4BDY A;  4Z88 A;  1H26 B;  4NC6 A;  1VQ6 T;  3RKW A;  2E3H A;  1OYX A;  1VQ4 T;  4CFW B;  1UGR B;  1QVF A;  4I3Z B;  2AIR B;  3MET A;  2CZ7 B;  5GAN j;  1VQ7 T;  1BIB A;  2Z0W A;  5GAN 7;  4B6M A;  1QMC A;  4M78 B;  4BCG B;  3TCJ A;  1K76 A;  2FHD A;  1FYN A;  3HRU A;  2XDD A;  3GP8 A;  4MFE A;  2PVO B;  2RJD A;  4CC4 B;  1XJW B;  3I55 T;  1VQ6 A;  1NEG A;  1ARK A;  4G6L B;  4HVW A;  2B9R A;  1D0Y A;  2PNI A;  2LP5 A;  4XTV A;  5KH6 A;  1FVV B;  1YIT A;  4K11 A;  2QYZ A;  2KYB A;  4OB0 B;  5CKB A;  2ZPE B;  2X9H A;  4M77 F;  1YBY A;  4J5Y A;  2LJ1 A;  4F7U A;  3X28 B;  3M0T A;  3P8D A;  2QA4 A;  1KHI A;  4M78 E;  3ZL7 C;  4JRI A;  2COW A;  4Z8A A;  2Y4X A;  3OMG A;  2KR3 A;  4KUL A;  5FU6 C;  5GMK h;  1WNL A;  2WAC A;  1S72 Q;  2EGC A;  1BB9 A;  5GAN h;  2C5O B;  4XTZ A;  5I21 A;  4OVA A;  2K3B A;  4PJO E;  3NPF A;  4M78 D;  2DL8 A;  4QQG A;  1XO2 A;  3OYA A;  3QJ6 A;  3X20 B;  3R6O A;  2E70 A;  4IUT A;  1AEY A;  2F5K A;  3WVD B;  2RK1 A;  1VYU A;  1RAB B;  4JX6 A;  4OMN A;  3CCM Q;  3MEW A;  2CZ1 B;  4AFQ C;  2BPM B;  2PU9 B;  4JPB W;  1X6O A;  4EOM B;  1SHG A;  4PJO F;  4BXX X;  2DK3 A;  1AZG B;  3NHN A;  3VS7 A;  1ZSZ B;  1BCM A;  1MGQ A;  2YUN A;  4AI6 A;  5CQY A;  3HFO A;  1BI1 A;  3OYH A;  2JGZ B;  4PJN A;  2AZS A;  2JMC A;  4M75 D;  4ANJ A;  2HKQ B;  1HK9 A;  2QQ8 A;  2CZ0 B;  2WJ9 A;  2A08 A;  3OBY A;  2JJ9 A;  2PQW A;  3CCU T;  4D8K A;  3G71 Q;  1M90 R;  3DB3 A;  2OTL Q;  4OR5 B;  5GAM e;  2EJ9 A;  4R55 A;  1T3S A;  1RL2 A;  2G77 A;  2KE9 A;  2NUP A;  4PFZ A;  3JCM X;  3G4S Q;  4QQD A;  1Q7Y C;  1W70 A;  1VOL A;  1ZUU A;  5CCA A;  2P0K A;  1VIF A;  3E1S A;  1M1G A;  2YHT A;  3CCJ Q;  2H8H A;  2YUO A;  4E7I A;  1RLQ C;  4C92 F;  3EGD B;  4AT1 B;  2CYZ B;  3O0G D;  1YHQ Q;  2RI3 A;  1YIJ A;  3CC4 T;  2EBP A;  2MF2 A;  2CRE A;  4F7U B;  2LCS A;  2ZGW A;  2XMF A;  3QDF A;  1PD0 A;  2KXD A;  4ESR A;  1R77 A;  2CS7 A;  4AG2 C;  4BE0 A;  1JB0 E;  3C4S A;  1JXO A;  1JEG A;  5IN1 A;  4IUV A;  3I5S A;  4RG8 A;  2L3S A;  1WDX A;  1LOJ A;  4C92 B;  5LJ3 g;  4M75 B;  4M7A G;  2XIC A;  3LH0 A;  3H0H A;  2EQJ A;  1N27 A;  4BI8 B;  3A8O B;  4F70 B;  2KDS A;  2WSF E;  3IQL A;  3DOG B;  3VKI A;  2ZZD A;  1ZA1 B;  2DAQ A;  5D6X A;  4Y91 A;  2EUF A;  3JB9 D;  1YJN Q;  2QDL A;  3VRZ A;  3X25 B;  3I56 Q;  3CCL Q;  1IGU A;  2JVV A;  2Y90 A;  2YRC A;  1W2B S;  1PSF A;  4YOZ A;  2PTK A;  3ASK A;  3JB9 H;  3S3N A;  2BE9 B;  4C8Q B;  4BI3 A;  3QDR B;  5GMK i;  1QP2 A;  1FKM A;  4M4Z A;  4LNP A;  1OV3 A;  2MOX A;  4R56 A;  1M30 A;  3EHR A;  1OKV B;  4XTX A;  5CK9 A;  4PJM A;  4RKU E;  2DEU A;  5L2W B;  1OZ3 A;  1VQ9 Q;  3TEE A;  5GAN f;  2CGH A;  5CKE A;  1N8R U;  1QP3 A;  3REB B;  1ZHI A;  3PMT A;  1EIF A;  1PD1 A;  2XKO C;  1PNJ A;  2NUZ A;  4BCQ D;  5GAN 2;  5GAN 8;  1NM7 A;  3EFO A;  1NJI C;  2O01 E;  4OGC A;  1UB4 A;  2RHU A;  4NS5 A;  5IAY A;  4JZ4 A;  4XK8 E;  2QA4 Q;  4J6Y A;  2BIV A;  3EG2 A;  4KH1 B;  3VKH A;  2DXU A;  2JT4 A;  2PUO B;  2RQU A;  2HD0 A;  3MCA B;  4CI0 C;  1K8A U;  1ENW A;  5HVY B;  1YI2 Q;  2MCN A;  3ULR B;  2RB6 A;  2V1Q A;  5IHY A;  1YIT Q;  3PMI A;  3BHT B;  2ROL A;  3CQT A;  1AHJ B;  2M1H A;  2WIH B;  3PVQ A;  4JJD A;  1W6X A;  2JTE A;  4EDU A;  3GPL A;  1VA7 A;  3DDP B;  4GLM A;  1HJD A;  3M03 A;  4LDW A;  4PFO A;  2RK2 A;  3L2U A;  4KGX B;  5LJ3 j;  4CFN B;  3EGD A;  4M75 A;  1TFB A;  2KMT A;  2EAY A;  2DXB A;  1QLY A;  1YP5 A;  1BBZ A;  2QFZ A;  2CCI B;  4NST B;  2HQH A;  1IGQ A;  5IT9 E;  3H0I A;  2ZCF B;  3TNH B;  4F14 A;  4BCJ B;  3CCS Q;  1MNE A;  1YCS B;  2C6T B;  1D1C A;  3THK A;  1UGS B;  3TNW B;  2HQE A;  2C5X B;  2V22 B;  2CZ6 B;  1SRL A;  4RTU A;  3LLR A;  4CFV B;  3BG9 A;  3CCR T;  1PRM C;  2DD4 A;  2JS0 A;  5HY6 A;  2DKG A;  2DD4 B;  3JB9 J;  1H8K A;  2KGT A;  2LT1 A;  4LXC A;  1IXD A;  5J39 A;  3D7S B;  2W10 A;  4DBH A;  3MEA A;  2DVJ A;  2P0P A;  1X2Q A;  4MDW A;  4JS5 A;  3OMC A;  2IIM A;  1D1A A;  3L1A A;  4ROE A;  1VQP T;  1KSW A;  4XU3 A;  4JS4 A;  3CCE Q;  4MDX A;  5FWC A;  3DKM A;  3G33 B;  5HBH B;  2X35 A;  3CEY A;  2EYW A;  2LQK A;  3M0U A;  4F6W B;  1TG0 A;  1KQ1 A;  2OX7 A;  4BAC A;  2LJ3 A;  1G3W A;  4N0A A;  2KR6 A;  4C0D B;  1PRL C;  4HNV A;  4E7Z A;  2M16 A;  1VQN Q;  1VYW B;  2W9Z A;  1OU8 A;  2BUD A;  3FIF A;  4BY1 X;  1U8R A;  1UUE A;  5A0L A;  1I1J A;  3HBL A;  2MI6 A;  2B86 A;  3G6E T;  4ELZ C;  2VGN A;  3ER0 A;  1Q81 U;  1H25 B;  4LUD A;  2HQX A;  5GMK l;  4HCB A;  4YOS A;  4GBQ A;  2DXC A;  2RJE A;  2KY9 A;  2NYS A;  3CMA Q;  2R58 A;  3RES A;  1VQM Q;  3BE3 A;  2ABL A;  2D8J A;  1RAI B;  4M7D F;  2AZV A;  4FT4 A;  3DL1 A;  5KYW A;  4HKE A;  5J26 A;  3DLM A;  3INZ A;  4M75 F;  3CXC A;  2EKO A;  1PWT A;  2L3R A;  2J05 A;  4HNT A;  1GFC A;  4JJB A;  1QVF S;  4XU1 A;  3HO8 A;  2I40 B;  2C0T A;  3JCM f;  5EJC A;  1LVK A;  1RAA B;  3QWY A;  1Y96 B;  1VQ5 T;  3M0S A;  1ZUK A;  2ROT A;  3F70 A;  1YJW T;  2RMO A;  2CKK A;  2DIL A;  2RO0 A;  2RJF A;  2BS4 A;  1QWE A;  2YSQ A;  3QSU A;  1AT1 B;  2KXC A;  3MY5 B;  4QQ6 A;  2UZL B;  3CCR Q;  2EQU A;  1VQ7 A;  2M9U A;  3OS2 A;  2W0Z A;  2X4X A;  2OJ2 A;  4A4F A;  4JJN K;  4DBF A;  3CME A;  1GCQ A;  3HRS A;  2CH4 A;  1VQN A;  2LQN A;  2L0A A;  3KUF A;  3HSB A;  5LJ5 f;  3C95 A;  1MV3 A;  2CP0 A;  2K5I A;  4QVZ A;  2CJM B;  5EC7 A;  1P92 A;  3M58 A;  2ATC B;  3G4S T;  1H27 B;  1VQK A;  4PJO B;  3OYN A;  1QWF A;  4J8O A;  5GAN 3;  1OPK A;  4P5N A;  3EAE A;  1H3H A;  2KSS A;  4D6W A;  2C06 A;  2UUE B;  2PMI B;  2RHZ A;  1TSF A;  2MPX C;  1KFZ A;  3POM A;  2CP2 A;  1WHL A;  2RF0 A;  3S3O A;  4M7A D;  4FYV B;  1QKW A;  2GF7 A;  3FB9 A;  3ZEH A;  4BCM D;  2SEM A;  1TU0 B;  3SB2 A;  1VQL A;  1JOW A;  1G3S A;  2KK4 A;  4RTT A;  5CAI A;  5L8R E;  2V8I A;  1UNL D;  4TTH A;  1QCO A;  4IUR A;  4LD6 A;  3L2W A;  2E64 A;  2EVR A;  5FW9 A;  1SPK A;  1M90 U;  2WSC E;  4ORZ A;  3EID B;  1X75 C;  2YT6 A;  1T0H A;  2UZE B;  2DRK A;  4F16 A;  3CCS A;  1KC8 C;  3R6N A;  1WJQ A;  4AFZ C;  3C94 A;  3NTH A;  2RQR A;  1W4S A;  2BKD N;  3V7C A;  1MHN A;  4F7L B;  5KYN A;  1DJ7 B;  2XDP A;  2NWM A;  3E2U A;  2QQS A;  3HB9 A;  2VUB A;  2E10 A;  2FZK B;  2MAM A;  3CCQ T;  3GTM S;  3UWN A;  3ZBD A;  2DLP A;  4OMP A;  4HT9 A;  3VV0 A;  3VUB A;  1KQS A;  2J6O A;  3SWN B;  1VUB A;  2KMG A;  1TUG B;  1VQ4 A;  5HQ0 B;  4BCN D;  2LW4 A;  3RNJ A;  1RAD B;  3PIO A;  2HSE B;  4CFX B;  3V8L A;  2RM4 A;  5KYY B;  2E41 A;  1ZSZ A;  4QVD A;  1VQ5 A;  3P8B B;  5GJV B;  4DQ2 A;  2LQ8 A;  1U1S A;  4A4G A;  3SFM A;  5FLX E;  1KD1 R;  2RQV A;  2PK2 A;  4BI4 A;  2CDT A;  2KRM A;  3LWI A;  1X43 A;  3X24 B;  1RAE B;  1BI2 A;  1PCX A;  2K3X A;  3GIB A;  1N6A A;  1AWJ A;  3EHQ A;  2G3R A;  1Q7Y R;  1WHM A;  3FLG A;  2FZC B;  2DA9 A;  4FW2 A;  1OUL A;  2ZPB B;  3RKY A;  2JW4 A;  4ZN3 A;  1LJO A;  2X4W A;  3OYI A;  4PLI A;  3TU4 K;  9ATC B;  5I5Z B;  2WEV B;  4E2F B;  5GAM f;  3CC7 T;  2OAW A;  2KVQ G;  4M7D C;  1ZLM A;  1WHG A;  2M02 A;  3MP6 A;  4ROD A;  1NPP A;  1IZ6 A;  4BCI B;  1UJ0 A;  3VS2 A;  2OTJ Q;  1WXU A;  1ABQ A;  3TRE A;  4JUV A;  3LGF A;  1OI1 A;  3G6E A;  4PJJ A;  4WF2 A;  1AD6 A;  2KEA A;  2VXF A;  3VYG B;  1C6V X;  1K0X A;  1GCP A;  2YXY A;  2C5N B;  2I0N A;  1H4L D;  3AHU A;  1OIU B;  3H41 A;  5CQX A;  4BUG A;  3CC4 Q;  1N9R A;  4BD3 A;  2QDJ A;  5LJ5 g;  5DM7 R;  1K73 U;  4J9H A;  5CIU A;  4BCH B;  3OYM A;  2JOY A;  4EC8 B;  3A8G B;  3DLL A;  3JRZ A;  4E7K A;  4LOC A;  3OS5 A;  4HLQ A;  1JXM A;  2EGE A;  2LNV A;  3NFC A;  5FWB A;  4JX5 A;  2ZZD B;  4J9F A;  3QPH A;  1QVG P;  1Q86 U;  1SKU B;  4YC3 B;  1RAG B;  2XHC A;  1YJW A;  4IUQ A;  2HZY A;  2QQA A;  1TUD A;  1QVP A;  5KE2 A;  2JXB A;  1KQ2 A;  3JCM W;  2LCC A;  1MMN A;  3TW7 A;  1VQ7 Q;  2KAF A;  5GAM h;  3UDC A;  2GBQ A;  2CP7 A;  3M54 A;  4XU2 A;  1TTH B;  4LN2 A;  3JCM J;  2DER A;  4WTO B;  3NDQ A;  2I2L A;  3HL8 A;  2MK5 A;  1X2K A;  1OL1 B;  2JTF A;  4ZGJ B;  5HBE B;  4CRL B;  4IUU A;  2IPO B;  1UEB A;  1Y57 A;  1VQ9 T;  5I2M A;  5LJ3 f;  2VB6 A;  1M1K U;  2EGA A;  5LL6 S;  1B34 B;  4OB2 B;  1TOV A;  3VUZ A;  3TQ7 P;  4J7I A;  5FRO A;  3G6E Q;  4F7U F;  2EQM A;  4E6R A;  7AT1 B;  5I2S A;  1S72 A;  3M0Q A;  3TVT A;  2GTJ A;  2EIF A;  4FT2 A;  3LW5 E;  3RBB B;  1I8F A;  2PVG B;  3RDV A;  1C0M A;  4YOO A;  3V7R A;  1MMA A;  1WHH A;  1UGP B;  2LQW A;  3UA7 A;  2FVU A;  2KT8 A;  1VQP A;  4II1 A;  5LJ3 e;  2X3X D;  3QZ9 B;  4RCC A;  2G6F X;  2CUD A;  1U5S A;  1VQ8 T;  2CT4 A;  2JUF A;  2J7I A;  1VQO A;  2BE7 D;  3O5Z A;  5IDN B;  4C0Z A;  2WSE E;  1BIA A;  3M0R A;  5IXF A;  2LX7 A;  2DXB B;  5LJ5 j;  3QWL A;  1PG5 B;  4LDU A;  2DVE A;  2DIG A;  3MEU A;  3FJ5 A;  4C0G A;  2F69 A;  5FU7 C;  2LMJ A;  4J9E A;  2E5Q A;  4BY7 X;  1PHT A;  1ZQ1 A;  3SHW A;  1YHQ T;  4OMQ A;  5M9O A;  4QVC A;  4M77 B;  1IRE B;  1TH7 A;  1D0X A;  2HDA A;  2C4G B;  2YLC A;  4GY5 A;  2IW9 B;  1JO8 A;  4PNO A;  2DM1 A;  3DTO A;  2QDY B;  1UHF A;  3GBQ A;  4IMY B;  4F7N B;  1WHK A;  2R7G A;  5KYU B;  1NYG A;  4KH0 B;  2RHY A;  1IO6 A;  3E19 A;  3JCM e;  2FG0 A;  1F5Q B;  4L5G A;  4X34 A;  1I0C A;  4OP0 A;  2E65 A;  1FMW A;  2K2V A;  3NTK A;  1G3T A;  1E7O A;  1VQ6 Q;  1YJ9 T;  4FIB A;  2OTL A;  2XU8 A;  4XU0 A;  1O9K A;  1BI3 A;  4B9W A;  3EFR A;  1BU2 A;  3GOX A;  1A0N B;  1NPR A;  1T0J A;  3VYH B;  2LVM A;  3C12 A;  1JJ2 P;  3EG9 B;  5GAN g;  3BLQ B;  2EQI A;  3MO8 A;  3L2Q A;  2EYY A;  3EG9 A;  3TNI B;  3MP1 A;  4C92 D;  2YWW A;  4PL6 A;  1ZA2 B;  1UNG D;  1PKT A;  4RTY A;  3NTI A;  4ZGD B;  3EGU A;  3DB4 A;  1K9M C;  2E6Z A;  3H9N A;  3U23 A;  4EMG A;  4BCM B;  3CCU A;  3FEO A;  3UA6 A;  2KRN A;  1YCY A;  4N4I A;  4N4H A;  2F2W A;  2FPF A;  4OML A;  2L2P A;  3I35 A;  5A0D A;  5BNJ B;  4DOW A;  1MND A;  4M7D B;  3LQ5 B;  1V76 A;  4BCK B;  2KT1 A;  1PM3 A;  1S72 T;  3S3M A;  2W99 A;  3JCM Q;  4IUP A;  4J9D A;  1UE9 A;  3B57 A;  4N0A C;  1O9S A;  1W98 B;  2BZ8 A;  2R5M A;  3JCM g;  5GAO n;  4BDZ A;  3HRT A;  2KI7 A;  1YIT T;  1WXB A;  2FL7 A;  1B7T A;  1H3Z A;  1AD5 A;  2KRS A;  2EW3 A;  2WHB B;  2E3I A;  3M53 A;  4AKG A;  2FPE A;  2CCH B;  4BCN B;  1M3A A;  3QII A;  4A4E A;  4J6W A;  1JQQ A;  4C0D C;  3OYE A;  4N4G A;  5CYI B;  2GQI A;  2RH2 A;  1X01 A;  5ECA A;  5IF1 B;  3CC7 Q;  2GTO A;  2QEX A;  2X4Y A;  2DO3 A;  1QVG S;  2EYQ A;  3CBP A;  1WA7 A;  8AT1 B;  4FL6 A;  4M78 F;  2E6N A;  2MYS A;  5GAM g;  3UT1 A;  3C0C A;  1K8A R; 
#chains in the Genus database with same CATH homology
 4BDY A;  4ELY C;  3HSB A;  5LJ5 f;  3G71 T;  2FB7 A;  4NC6 A;  3C95 A;  1VQ6 T;  3RKW A;  3TW6 A;  1OYX A;  1VQ4 T;  2K5I A;  4QVZ A;  5GAO l;  1YJN T;  4C0F A;  1UGR B;  2K4Y A;  3S6W A;  4A53 A;  4HL4 A;  1KD1 U;  1QVF A;  3MET A;  2CZ7 B;  1P92 A;  3LX7 A;  3M58 A;  1BIB A;  5GAN j;  3JB9 G;  1VQ7 T;  2GQV A;  1BI0 A;  2Y4Y A;  3G4S T;  1VQK A;  2JTM A;  3OYN A;  4J8O A;  5GAN 3;  4PJO B;  4P5N A;  2RD1 A;  5CKH A;  5GAN 7;  4V2S A;  3EAE A;  4C92 G;  4M78 B;  2QA4 T;  2KSS A;  2LCL A;  5GMK j;  5DLO A;  3HP9 A;  4D6W A;  4BB7 A;  3TCJ A;  3VU3 C;  4BE2 A;  2C06 A;  2FHD A;  3HRU A;  2XDD A;  3GP8 A;  3I56 A;  4MFE A;  2PVO B;  4C8Q G;  2RHZ A;  3RKX A;  2RJD A;  1Q7Y U;  3I55 T;  3FC3 A;  3JCM P;  2K5L A;  3T9N A;  3CPW A;  2K57 A;  2RA2 A;  2QXF A;  1M4Z A;  1YI2 T;  1VQ6 A;  4NL2 A;  1NZ9 A;  3J80 E;  3S3O A;  4Q5W A;  4M7A D;  4M7A A;  2V8K A;  5CVI A;  2GF7 A;  3MHX A;  1VQN T;  3FB9 A;  3ZEH A;  4XTV A;  5KH6 A;  1YIT A;  1XQH A;  3JCM c;  2DIQ A;  3SB2 A;  4C8Q C;  1VQL A;  1G3S A;  2KK4 A;  2DD5 A;  2LT4 A;  5CAI A;  2ZPG B;  4OB0 B;  1B34 A;  4A54 A;  5CKB A;  2DD5 B;  2ZPE B;  2V8I A;  5L8R E;  4M7A F;  3I55 A;  4IUR A;  4LD6 A;  4M77 F;  1I81 A;  3OYF A;  1YBY A;  3LYI A;  2E64 A;  2K5F A;  2RHX A;  3L2W A;  4J5Y A;  3M57 A;  1M90 U;  3OW2 A;  3QHS A;  4F7U A;  4E47 A;  2WSC E;  1BKB A;  5LJ3 d;  3X28 B;  5GAN d;  1VQ9 A;  1X75 C;  4Z02 A;  2P4T A;  3P8D A;  2QA4 A;  1KHI A;  4M78 E;  3CCS A;  5D6Y A;  4JRI A;  4RMO A;  2XI9 A;  1KC8 C;  2HAX A;  3QG1 A;  3A8H B;  1WJQ A;  1Y96 A;  2Y4X A;  3C94 A;  3OMG A;  3NTH A;  4KUL A;  2ZPH B;  1W4S A;  4MMK A;  2BKD N;  5FU6 C;  1Q82 C;  2GFA A;  3V7C A;  5GMK h;  4M7A C;  1MHN A;  1WNL A;  2WAC A;  2OTJ A;  1DJ7 B;  2XDP A;  2IG0 A;  2K3Y A;  1YHQ A;  5GAN h;  2QQS A;  3HB9 A;  2VUB A;  4XTZ A;  3A8L B;  2E10 A;  2LX9 A;  1XOV A;  3OQ5 A;  2MAM A;  4OVA A;  5I21 A;  3CCQ T;  2DXT A;  5GAO p;  3UWN A;  3ZBD A;  4M6V A;  5GAN 4;  4HT9 A;  4PJO E;  4M75 C;  4M78 D;  3VV0 A;  4QQG A;  3VUB A;  2QEX T;  3OSS C;  1KQS A;  2YLB A;  3OYA A;  3CCQ A;  3SWN B;  1VUB A;  3X20 B;  2KMG A;  2NLU A;  3OSV A;  3QJ6 A;  3R6O A;  4EMH A;  5CKD A;  1VQ4 A;  2E70 A;  1K9M U;  4JRQ A;  4IUT A;  4A4H A;  3CCV A;  3BDL A;  3PIO A;  2F5K A;  3WVD B;  2RK1 A;  4M7D A;  1FWZ A;  4ATO A;  4JX6 A;  3GLX A;  1M9S A;  4TVR A;  5CO7 A;  3MEW A;  3V8L A;  2RM4 A;  5HK3 A;  4LDX A;  2CZ1 B;  2E41 A;  4QVD A;  2PU9 B;  3P8B B;  4FU6 A;  3L2V A;  3MP8 A;  1VQ5 A;  1X6O A;  4QSH A;  1G5V A;  4DQ2 A;  2LQ8 A;  1U1S A;  1NE8 A;  3RER A;  4MIM A;  3JSC A;  4A4G A;  3SFM A;  5FLX E;  5DY9 A;  3JCM d;  3I56 T;  4BI4 A;  3QKJ A;  4PJO F;  4C92 A;  3LWI A;  4X9C A;  1NJI U;  2HBP A;  4XTU A;  3X24 B;  1BI2 A;  2DK3 A;  2K3X A;  1N9S A;  5GMK m;  3M9Q A;  2AHJ B;  1R8O B;  3CCE T;  3GIB A;  3VJP A;  3OA6 A;  1N6A A;  5GAN e;  2G3R A;  4C5H A;  3FLG A;  4X9D A;  1MGQ A;  2ZPB B;  4AI6 A;  5CQY A;  3HFO A;  3RKY A;  4ZN3 A;  3OYI A;  1LJO A;  2DTO A;  2X4W A;  4PLI A;  3TU4 K;  3OB9 A;  4FSX A;  1BI1 A;  1QW1 A;  1YI2 A;  3OYH A;  3LWH A;  5GAM f;  3CC7 T;  3N5B B;  3PNW C;  4M78 C;  2KVQ G;  4M75 D;  4BY6 B;  4M7D C;  3PIP A;  1HK9 A;  3Q1J A;  2QQ8 A;  2CZ0 B;  4XTW A;  2WJ9 A;  1BYM A;  5FU7 B;  4XQ3 A;  3OBY A;  2PQW A;  3BW1 A;  3CCU T;  4PLL A;  5GAM d;  3MP6 A;  1WQ7 A;  1NPP A;  4UC4 A;  1IZ6 A;  2F5T X;  2OTJ T;  3DB3 A;  4C5G A;  3G4S A;  5GAM e;  2EJ9 A;  4ZGE B;  4R55 A;  4M78 G;  2R57 A;  3CCM A;  4C92 C;  3OYC A;  3WVE B;  1RL2 A;  2G77 A;  2PUK B;  3JCM V;  3JCM X;  3TRE A;  4JUV A;  3LGF A;  4QQD A;  3J81 E;  1Q7Y C;  4JLI A;  4JDS A;  1OI1 A;  2DPP B;  5CCA A;  4VUB A;  4E7L A;  2DZ9 A;  3G6E A;  2P0K A;  4WF2 A;  4O6J A;  3CPW S;  1VIF A;  4IKF A;  2VXF A;  3VYG B;  3CCJ T;  4PJO D;  3E1S A;  1M1G A;  2YHT A;  4HA8 A;  4BBS M;  4E7I A;  3FRN A;  4XTY A;  4JRK A;  3JCM h;  4C92 F;  1VIE A;  3SWN A;  2CYZ B;  1KD1 C;  3M55 A;  3BY7 A;  2RI3 A;  1YIJ A;  2DEQ A;  3CC4 T;  3AHU A;  2E12 A;  5CQX A;  2FYK A;  3E9G A;  4BUG A;  1VQL T;  1N9R A;  1FXX A;  2MF2 A;  4J83 A;  2QTX A;  4BD3 A;  4F7U B;  2ZGW A;  4DA4 A;  2QDJ A;  5D6W A;  5LJ5 g;  5DM7 R;  1K73 U;  5KCO A;  5EG2 A;  4M7A B;  2CS7 A;  4BE0 A;  5CIU A;  1JB0 E;  3OYM A;  2JOY A;  1WJS A;  3C4S A;  3J7A F;  3A8G B;  3BG5 A;  3JRZ A;  3RMQ A;  3DLL A;  4E7K A;  4F7U E;  4LOC A;  2L89 A;  3OS5 A;  5IN1 A;  4HLQ A;  4IUV A;  4RG8 A;  4C5I A;  2LNV A;  2EJG A;  2O4X A;  3NFC A;  4JX5 A;  2QQ9 A;  2ZZD B;  3CBO A;  4OGE A;  1LOJ A;  4C92 B;  3OYB A;  4Z6Y A;  5LJ3 g;  2RI5 A;  4J6X A;  4M75 B;  2XDB A;  4M7A G;  3QPH A;  4L6V 5;  5GMK e;  3CCL A;  3KBG A;  2XIC A;  3LH0 A;  2ZPF B;  4LDV A;  1Q86 U;  2EQJ A;  1ZBX A;  4ZTF A;  1PSE A;  4AKI A;  3M4Y A;  3P8H A;  4M77 C;  2QF7 A;  1FX7 A;  2VV5 A;  2XHC A;  4JLG A;  1YJW A;  4IUQ A;  5LJ5 h;  1N8R C;  3QXE B;  3CC2 T;  1N27 A;  1M5Q 1;  2QQA A;  3PGG A;  4BI8 B;  3BG3 A;  3A8O B;  1QVP A;  1H64 1;  3JB9 I;  2KDS A;  2WSF E;  5KE2 A;  4LD9 K;  2QQR A;  3WXM B;  3URG A;  1WGS A;  3QZ5 B;  2R5A A;  2ZZD A;  5CKF A;  2DAQ A;  2DJZ A;  3VKI A;  5LJ5 d;  3OYJ A;  3SD4 A;  5D6X A;  1KQ2 A;  4Y91 A;  3JCM W;  3M59 A;  3M5A A;  3JB9 D;  5C6S A;  2LCC A;  3X25 B;  4HNU A;  3TW7 A;  1UGQ B;  2JVV A;  3M4G A;  2KAF A;  2Y90 A;  3BDU A;  1W2B S;  3JB9 F;  5GAM h;  4C8Q E;  1PSF A;  3UDC A;  3CD6 T;  3ASK A;  3OYG A;  1OZ2 A;  4A4K A;  4MZP A;  3M54 A;  3S3N A;  3JB9 H;  2EJF A;  4XU2 A;  2XD0 A;  3JCM J;  4C8Q B;  4BI3 A;  4M77 A;  3QDR B;  5GMK i;  3OY9 A;  1QP2 A;  1FKM A;  2EQK A;  4EMK C;  4RCB A;  2I2L A;  1RI0 A;  4R56 A;  3HL8 A;  2QQB A;  4PJO G;  1HXD A;  3GF5 A;  1I5L A;  2JN0 A;  2H3J A;  1Q81 C;  3A5Z B;  3FDR A;  3CC4 A;  3G71 A;  2LC4 A;  4XTX A;  2JTF A;  4ZGJ B;  4IUU A;  5CK9 A;  4RKU E;  5GAO q;  1OZ3 A;  3H6Z A;  5DLQ E;  1UEB A;  3TEE A;  4C8Q A;  4MFD A;  5GAN f;  1QLB A;  5I2M A;  5LJ3 f;  4C8Q F;  3OYD A;  1VQ9 T;  2CGH A;  3CCJ A;  5CKE A;  4ME7 A;  3RUX A;  1N8R U;  1QP3 A;  1M1K U;  5LL6 S;  3OBW A;  4OMF B;  1B34 B;  3JAM E;  4OB2 B;  4PJO C;  2RJC A;  3VUZ A;  1ZHI A;  1KHC A;  2V8J A;  2EWN A;  4J7I A;  3PMT A;  1EIF A;  2YRV A;  2EQM A;  5FRO A;  2XKO C;  4F7U F;  3PFS A;  5I2S A;  5GAN 2;  1S72 A;  1I4K 1;  4M7D G;  2QI2 A;  2EIF A;  5GAN 8;  4PKC C;  1SSF A;  3LW5 E;  2D9T A;  4FT2 A;  1I8F A;  4E7J A;  1NJI C;  2RI2 A;  2O01 E;  4OF1 A;  2PVG B;  1XNI A;  2VYT A;  4M75 G;  4OGC A;  5HKC A;  3OS0 A;  3V7R A;  1VQM T;  1UB4 A;  2RHU A;  1UGP B;  4NS5 A;  5IAY A;  3OYK A;  2OAU A;  2FVU A;  4XK8 E;  4J6Y A;  2BIV A;  1JJ2 S;  1VQP A;  3VKH A;  4II1 A;  2DXU A;  5LJ3 e;  5FRN A;  1O75 A;  3QZ9 B;  3GNG A;  2PUO B;  4RCC A;  2HD0 A;  3MCA B;  2ZPI B;  3RIR A;  1VQ8 T;  4KT0 E;  4CI0 C;  1K8A U;  1YJ9 A;  2OTL T;  2JUF A;  2RB6 A;  1VQO A;  4B9X A;  3HKS A;  1JJ2 A;  3PMI A;  4YTL A;  3CBM A;  3V8K A;  4C0Z A;  1AHJ B;  2WSE E;  2M1H A;  3GNF B;  1D3B A;  4ELJ A;  1BIA A;  3HHT B;  4E7H A;  4EDU A;  3ME9 A;  3QO3 A;  3L2Z A;  2DXB B;  5LJ5 j;  3GPL A;  3CCM T;  3QWL A;  5CR2 A;  4LDU A;  2DVE A;  2DIG A;  3QUI A;  4BY6 C;  2LTO A;  1M1K C;  2B8A A;  3MEU A;  5FU6 B;  5LJ3 h;  4C0G A;  2F69 A;  5FU7 C;  3SWN C;  4XAX B;  3KHI A;  4Y28 E;  3OYY A;  2E5Q A;  1M1F A;  1ZQ1 A;  2EFI A;  4LDW A;  5A2Q E;  1YHQ T;  3RMS A;  3H8Z A;  2RK2 A;  4BAC A;  5M9O A;  4QVC A;  3L2U A;  3CD6 A;  3QYB A;  4M77 B;  2O4X B;  1IRE B;  5LJ3 j;  5C0M A;  1TH7 A;  2BS2 A;  3H4C A;  3L2R A;  1GXI E;  4M75 A;  2KMT A;  2EAY A;  2DXB A;  4M7D E;  2YLC A;  4GY5 A;  2QFZ A;  4PNO A;  5IT9 E;  2ZCF B;  1Q86 C;  2QDY B;  2A3L A;  4M77 D;  4BBR M;  4AKH A;  4BE1 A;  3CC2 A;  3O8V A;  2X4J A;  1VQO T;  3CCR A;  1UGS B;  2HQE A;  3CCE A;  3CC7 A;  2CZ6 B;  4OB1 B;  2JZ2 A;  1K73 C;  2P0Q A;  2VGM A;  3LLR A;  2RHY A;  3BG9 A;  4ZN1 A;  3KXT A;  3CCR T;  3E19 A;  3JCM e;  3CPF A;  2DD4 A;  1V29 B;  1G3Y A;  3JCM b;  4L5G A;  2DKG A;  2DD4 B;  4X34 A;  5HY6 A;  4HT8 A;  4OP0 A;  2E65 A;  3QYE A;  3JB9 J;  2LT1 A;  2PVD B;  3FJP A;  5A0G A;  4EMK B;  2K2V A;  5J39 A;  3MEV A;  1WQW A;  2IVW A;  3NTK A;  3MEA A;  3M56 A;  3L42 A;  4HCZ A;  1G3T A;  1VQM A;  1JBM A;  1KQS S;  4M78 A;  4FIB A;  2XK0 A;  1YJ9 T;  2OTL A;  4M7A E;  2P0P A;  2VXE A;  2XU8 A;  4M77 G;  4XU0 A;  4CRI A;  3CCL T;  1E7P A;  5AYF A;  3V7S A;  4MDW A;  4JS5 A;  1BI3 A;  4M75 E;  4B9W A;  2E1H A;  3EFR A;  4MZM A;  1KC8 U;  4C92 E;  3OMC A;  4NOY A;  4C5E A;  2D0Q B;  3PT9 A;  3L1A A;  2GCX A;  1VQP T;  4XU3 A;  3GOX A;  4JS4 A;  4MDX A;  3DKM A;  4EMK A;  4OB3 B;  2X35 A;  3CEY A;  1NPR A;  1YJN A;  5GAN 5;  3VYH B;  2LQK A;  2LVM A;  2XID A;  4C8Q D;  3CXC S;  5LJ5 e;  3C12 A;  1KQ1 A;  3OS1 A;  5GAN g;  1G3W A;  3MO8 A;  3QJY A;  1WJR A;  2KR6 A;  4KUI A;  4N0A A;  3L2Q A;  3CMA A;  3CME T;  3MP1 A;  4C92 D;  5KE3 A;  4PL6 A;  4C0D B;  1YIJ T;  4KUD K;  4HNV A;  1Y7X A;  2M16 A;  4ZTJ A;  1WPY A;  3NTI A;  4ZGD B;  2BUD A;  3FIF A;  3OW2 S;  3V8J A;  3DB4 A;  5GAO r;  1K9M C;  2KQW A;  1U8R A;  4PJO A;  5A0L A;  2E6Z A;  4EMG A;  3HBL A;  2MI6 A;  3HZJ A;  3CCU A;  3G6E T;  4ELZ C;  2VGN A;  3BFM A;  3ER0 A;  3FEO A;  1VQK T;  4O5V A;  1Q81 U;  1D3B B;  1YCY A;  2MWP A;  4N4I A;  4N4H A;  3UT1 A;  2D6F A;  1Q82 U;  2HQX A;  5A0D A;  5GAO m;  4DOW A;  3QBY A;  5GMK l;  4HCB A;  2BS3 A;  3CMA T;  4M7D B;  2HNI A;  2DXC A;  2RJE A;  2KY9 A;  2L5Q A;  4F7U G;  2R58 A;  3RES A;  1W2B A;  3CCV T;  3LGL A;  2MMP A;  2LDM A;  3VYG A;  1K8A C;  1M90 C;  4M77 E;  1S72 T;  4M7D F;  1M8V A;  3QYH B;  4FT4 A;  3DL1 A;  5HK0 A;  4NL3 A;  3S3M A;  4HKE A;  5J26 A;  3JCM Q;  3DLM A;  3INZ A;  4IUP A;  1JRI A;  4M75 F;  4JX4 A;  4LDY A;  3CXC A;  4JRP A;  2DTH A;  2EKO A;  4N0A C;  2A7Y A;  1O9S A;  4QW2 A;  4M7D D;  1VQ8 A;  2L3R A;  2R5M A;  3JCM g;  1Y07 A;  5GAO n;  4BDZ A;  1QVG A;  2DXC B;  4HNT A;  3HRT A;  3EFS A;  1QVF S;  4XU1 A;  1YIT T;  4RG2 A;  3HO8 A;  2XG8 D;  3JCM f;  5EJC A;  2GFU A;  2FL7 A;  4MZT A;  3UPU A;  1H3Z A;  4L59 A;  3A8M B;  4FM4 B;  3ZFJ A;  5KCH A;  1VQ5 T;  1Y96 B;  5FRM A;  5GAM j;  4HCC A;  3F70 A;  1YJW T;  4KBM B;  2CKK A;  2DZC A;  3M53 A;  4AKG A;  2RHI A;  2RO0 A;  5GAN 6;  3CCS T;  2RJF A;  2BS4 A;  3QSU A;  2LRQ A;  3QII A;  4A4E A;  4J6W A;  1LNX A;  1XTD A;  3E9F A;  4C0D C;  4EPC A;  2L8D A;  3HPW A;  3OYE A;  4GLK A;  4N4G A;  4J7F A;  4DOV A;  4QQ6 A;  3HFN A;  2RH2 A;  3SDZ A;  2DTI A;  2M0O A;  1U1T A;  1X01 A;  3VKG A;  2MWO A;  2QEX A;  2X4Y A;  2DO3 A;  1QVG S;  3QYG B;  1Y71 A;  2EQU A;  2M9U A;  2EYQ A;  3CBP A;  3OS2 A;  1VQ7 A;  3G7Z A;  4FL6 A;  1KG1 A;  2X4X A;  4MML A;  5J3B A;  4M78 F;  4A4F A;  2E6N A;  3OYL A;  4JJN K;  3CME A;  2JNG A;  3HRS A;  5GAM g;  2VC8 A;  3PTA A;  1VQN A;  3X26 B;  3KUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...