1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile Hydratase
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
2PVGB 2ZPIB 2ZZDA 4ZGEB 2DD4A 1V29B 3QZ9B 2CZ6B 3VYHB 2CZ1B 4OB1B 1JB0E 2DXBB 3X24B 2ZPBB 2PVDB 1IREB 2DD5B 2ZPFB 4OB3B 1AHJB 3WVDB 2ZPHB 1UGSB 3A8LB 2DXCB 1DJ7B 4RKUE 4Y28E 3WVEB 2CYZB 2AHJB 1UGPB 1GXIE 3LW5E 1QP3A 2CZ7B 2ZPEB 2CZ0B 4ZGJB 2ZZDB 3A8OB 2DD4B 2WSCE 4L6V5 1PSEA 3QYGB 4OB0B 1QP2A 2WSFE 2WSEE 2ZPGB 2PVOB 4ZGDB 3VYGA 4FM4B 3QZ5B 2QDYB 2DPPB 3A8GB 3X25B 3A8MB 3QYHB 4XK8E 5L8RE 4OB2B 1PSFA 2PUKB 3A8HB 3X28B 2PU9B 2DXBA 2D0QB 1UGQB 2PUOB 3X26B 2O01E 2DD5A 2ZCFB 2DXCA 4KT0E 3HHTB 1UGRB 3VYGB 3X20B 3QXEB
chains in the Genus database with same CATH superfamily
5I2SA 4F7SB 4BBRM 2G3RA 1X27A 4A4KA 3VKHA 2E3HA 3HO8A 3MPUB 2L0AA 4M7DF 9ATCB 1KC8R 4DBHA 4Y72B 3RGFB 3M4GA 1M1GA 1VUBA 2E3IA 3OA6A 1Q81C 5LJ3g 1KHIA 3EFRA 2KYMA 1IREB 3UA6A 2PQWA 1VQ8T 4OB3B 1RUWA 5A0GA 2DXCB 2CCIB 4J9EA 3U23A 5GMKj 2R57A 2VGMA 4C92A 2C06A 2D6FA 1BI3A 2JUFA 6AT1B 1X6GA 2ESWA 3HZJA 5GANf 4PFZA 3BY7A 4E7IA 3CD6Q 4F04B 2RK2A 2DILA 4EOKB 2ZZDB 4RODA 1W98B 3LQ5B 2WSCE 4JJDA 3SD4A 2K6DA 2KR3A 4EMKC 1GBQA 4MDXA 4N4IA 4M6VA 3BHTB 1WHHA 2K3BA 1H641 4KULA 2K5FA 3HB9A 1WQWA 2BPMB 4KUDK 1A0NB 2K5LA 4FM4B 2RD1A 3VJPA 1VQ5A 5AT1B 3C12A 3RR6A 3VU3C 2BZXA 3QG1A 4JS5A 3QYHB 1E7PA 1OKWB 1H27B 1OI9B 2CKKA 2C5VB 3GIBA 4C92G 3A8HB 2B8AA 2F5KA 1RABB 2QQ9A 2DL3A 1XOVA 2MWPA 3RNJA 1S1NA 1V76A 5CVIA 3CC7A 3PO3S 4E47A 3HBLA 1M8VA 4KRDB 5GMKi 2YHTA 4C92C 4J9BA 3CMAT 2C5NB 4CC3A 1TH7A 3RKWA 5GAOn 1HYOA 4WF2A 2HKQB 3JCMc 4HVUA 5FGKB 1E9HB 3X20B 4HKEA 4QQGA 3META 2KROA 1VQPQ 3C0CA 4NS5A 2BS4A 1YI2T 1VOMA 1CKAA 1TTHB 4KBMB 4ELYC 4OP0A 4BACA 1YITA 4J9IA 2OAWA 1NJIR 2RPNA 2CZ1B 2DXUA 5GAN4 3JSCA 2DAQA 2QYZA 1OV3A 2CGHA 1EZZB 2BKDN 5GANj 4BCNB 4XU3A 5DLQE 3C95A 2PTKA 4BUGA 2QEXA 1N5ZA 1FMWA 2FVUA 1KHCA 2K4YA 4XTXA 1MMDA 3RERA 4HNVA 1OL2B 3CMEQ 1AD5A 4QKUA 3CCQA 1RAIB 2B86A 5CKBA 2LC4A 2OTJT 3CC2Q 3BG9A 2DF6A 1VQKQ 2CJMB 1IO6A 1JU5C 2M1HA 3QIIA 4IUQA 3M0SA 4HCCA 1GFCA 1XQHA 3J7AF 2X9HA 4OMOA 2JMCA 2DYBA 2D0NA 1QKXA 3JAME 2RI3A 2QA4T 4C92F 2MAMA 3E19A 3DOGB 3MEUA 1QMCA 3VS4A 2DA9A 2LP5A 3MHXA 4HVVA 3OYGA 2E70A 1U06A 4B9WA 2O4XB 2H3JA 3ER0A 4GBQA 1PRMC 2GCXA 2I0NA 2JT4A 2DLPA 2DVEA 3OSVA 2EQKA 3CBMA 1D0XA 3ZL7C 2HEQA 4HLQA 3CQTA 5L2WB 3OMGA 2E5QA 4F6UB 4C0DC 2LCLA 4J9FA 4M7DD 1K9MU 1MGQA 1Y96B 3GP8A 1BCMA 3NHNA 4EOOB 2L8DA 4LDVA 1OYXA 4NL2A 2K2VA 5GAN2 5GJWB 2COYA 2NUTA 4X9DA 3CCRT 1JSUB 1YIJT 2OI3A 1YJNQ 3CCJQ 2YXYA 3SWNA 3L42A 1M8MA 3OYCA 3RUXA 4J6WA 1FX7A 1NLOC 5HBEB 1I5OB 4KGZB 1D3BB 3NPFA 4RUGA 3TNWB 3JB9I 2C0TA 1VQMA 1O75A 4Z02A 1BI0A 1MV3A 1N27A 2OTLA 4LNPA 1G3NC 1G3YA 1N9SA 4AI6A 2ZPBB 5LJ3f 1JXOA 5FU6B 3TN8B 2DD5B 4ZN1A 1G3TA 2QDJA 1X6OA 4IUUA 2DETA 2JOYA 3GNGA 4NL3A 4IUTA 1QVFP 1KQSP 1RAEB 1FWZA 3F5XB 2QTXA 4A63B 4M7AG 1AEYA 5KYYA 1T0HA 1RADB 1JOWA 4K11A 1H1QB 4ZGJB 2AT1B 3CC4T 3G6EQ 4C8QB 1X2QA 1WYXA 1QWEA 2A0FB 1WJQA 4JX4A 4M7AC 2NWMA 2K3YA 4M75A 2IW6B 2RQVA 4RTXA 1VQ5Q 2ZAEA 4D8DA 2D8JA 4L5GA 3OYEA 3GLXA 1BU1A 1I8FA 3M59A 1SHGA 2XU8A 1VQLT 3R6NA 1WZOA 4OB2B 4J9GA 3OW2S 4OGCA 5CO7A 3TW6A 1M1KR 1PNJA 3HRSA 4ELLA 2ED1A 4B9XA 3FIFA 5FWBA 2DBKA 3EFOA 3OBYA 3MEWA 1YJWQ 2DTOA 3VS2A 2BKZB 4AFZC 2RH2A 1UB4A 4LN2A 4MMKA 1WGSA 1PKSA 4XTUA 1UFFA 4M75G 2XK0A 2EQMA 4PLLA 1QCFA 5GMKl 1YITQ 4M78A 5LJ3j 3OYYA 2NYSA 4R56A 3EG9A 4M75C 2GQIA 4RTWA 4ANJA 1PKTA 4C92D 4GLMA 1K73R 2DXBB 4J9CA 3I56Q 4I3ZB 1I07A 1SSHA 2RQRA 3BDUA 3CCQQ 2YUPA 3EGDA 3JCMW 3CCJT 3WVDB 3A8LB 4MIMA 3OYLA 1C6VX 4Y28E 1N9RA 1G2BA 1YCYA 1SF9A 2D1XA 1OX8A 5LQFB 3M58A 3HTRA 1T3LA 2R5AA 3G4SA 3PE0A 2MK5A 4LXCA 1RI0A 1EX4A 3V8JA 3OS0A 2AKKA 2EYZA 1WXTA 2J06A 4MDWA 1QVGP 1MUZA 1AD6A 3KHIA 1Y71A 4M78G 3RKYA 5ICPB 1D09B 4MZPA 3CCET 1N8RR 4F7UG 4JJBA 3JCMX 1YWPA 4C5GA 1B34A 3HFNA 4M4ZA 4J83A 2EBPA 1X6BA 3I55A 2IW8B 4M78C 5GANg 1M30A 3NTKA 2YSQA 4N4GA 2W10A 3HRTA 2CP7A 4EOJB 3EG2A 5EG2A 3PMIA 1D1AA 4M75F 4II5B 1XNIA 1M2VA 4VUBA 2CUBA 1ZX6A 3L2QA 2VV5A 5HK0A 2JTMA 3UPUA 2Y90A 2O01E 4EC9B 4EIKA 3VS3A 3SEMA 2DL5A 3G71Q 2JNGA 4Z8AA 2CP0A 3E9FA 3OYIA 1WIEA 1BU2A 4J9DA 2KXDA 3CPWS 1VQ6A 3OYFA 2RQUA 4IUPA 3BDLA 4BCQD 5FROA 2EKOA 4CC7A 4CRIA 1QWFA 4LDXA 3O5ZA 3LH0A 2DIQA 3EJ1B 3CPWA 5GAMh 2COWA 5HKCA 3CC7T 4KRCB 2RJFA 4Q5WA 5A0DA 1HXDA 1TUDA 2FRWA 4AKGA 2PNIA 3BW1A 3CCMQ 5FU7B 4C8QE 2FZKB 3ZFJA 2VXFA 3L1AA 1RACB 2JJ9A 4BE0A 1M3CA 4R55A 2JGZB 4M78F 3QDRB 2HNIA 1PD1A 4CI0C 1Q86U 2NUZA 3M54A 5ECAA 2LQ8A 1OIUB 2DJQA 2LJ0A 3UF4A 1YITT 1VQPA 4F6WB 4C0GA 4BCMB 4HT9A 1UECA 1NG2A 1GUXA 2P4TA 3A8OB 2V8IA 3FJPA 2DD4B 3VKGA 2DIGA 2EKHA 4L6V5 2LT4A 5D7UA 5LJ3d 1KJWA 2FL7A 1IGUA 2A08A 2QEXT 4XQ3A 3HP9A 2WSEE 1U1SA 1PG5B 1C0MA 3TREA 2XHCA 1AISB 2L2PA 3CMEA 2QI2A 3FDRA 4BB7A 2FG0A 8AT1B 3ASKA 3MEAA 2C6TB 1VYWB 2FEIA 3EFSA 3CC2A 2QQAA 4F16A 1VQKA 5GJVB 3RMQA 2IVXA 1ZLMA 3JCMV 3M0RA 1NEGA 4PJOB 1T0JA 1YCSB 5CR2A 5CKFA 4F70B 1X43A 2ED0A 2DXCA 2MF2A 2X4YA 2KBTA 5LL6S 3S6WA 2HDAA 1P5EB 1Y07A 3CBPA 1VQNQ 1YJ9T 2DRKA 3MP1A 2YLBA 4BDZA 4LD9K 4DBFA 3QWYA 2ZPIB 5HK3A 1SRLA 4FU6A 2E1HA 2ZZDA 2Z0WA 1K9MC 5C0MA 2ATCB 2BZYA 4M77B 1OPKA 3REBB 2VKNA 3EH2A 4F6SB 2HQEA 2J6KA 2WHBB 2J7IA 1PHTA 3THKA 1I1JA 2I2LA 3QYEA 4FW1A 4GY5A 5HCKA 2JTFA 2QGFB 2Y4YA 5LJ3e 3QHRB 1M90U 3G4SQ 5LJ5j 1VQMT 5DQVA 1MHNA 1YP5A 2GGRA 4M75D 4RTVA 3PIPA 4C0FA 2QASA 1IXDA 2OTLT 3JCMQ 4BBSM 2LVMA 2H3EB 3L2RA 2ROTA 3DDQB 1M2OA 3FLGA 2GF7A 3TQ7P 2QK0A 3JCMg 4OB0B 4RTYA 4EORB 2BZ8A 2FB7A 2KQWA 2RNAA 3I55Q 3ME9A 1G5VA 3KBGA 3SB2A 4JRPA 4V2SA 4N0AC 5DY9A 3J80E 3CXCP 4QT7A 4QSHA 2EYYA 2VWFA 1VQOT 1YHQA 2DVJA 1VQ9Q 2AK5A 3OSSC 2WXVB 4HL4A 4CFUD 3J81E 4MZTA 1QLBA 2J6OA 1IZ6A 3G6EA 1SPKA 3MO8A 2RQWA 2O88A 1VQ6Q 1BK2A 4M78D 4RTTA 4A4HA 2KSSA 3P8HA 5I22A 2X1NB 1X69A 2EQJA 2GQVA 2J05A 4PL6A 3DLMA 1UNLD 3EG3A 4EMKB 2QQ8A 3P8DA 1K8AU 4CFWB 2YUOA 1NM7A 1Q81R 5GAOl 1UUEA 1OULA 1FINB 3JRZA 4BY6C 4JRIA 3V7RA 1WLPB 4JJCA 1EIFA 4OB1B 2LRQA 1YJWA 1H8KA 4Z88A 1KD1C 1ZA2B 5AYFA 3VRZA 2A7YA 2O4XA 4C5EA 1S72Q 2X4WA 5EFQB 1DJ7B 1UHCA 2QQRA 2LNHB 1OZ3A 1Y96A 2AZVA 2DKGA 2CZ7B 2GFAA 2K3XA 2E10A 4A4GA 2YRDA 1ZQ1A 5HVYB 2DE0X 1Q7YU 2EGEA 3M57A 4PLIA 3MI9B 4AFQC 4FX3B 1VOLA 4AKIA 1SEMA 1F1BB 2RHUA 2WIPB 2P84A 3I56A 1JSTB 2FHDA 4DBQA 1VQ7Q 2DL4A 2SEMA 4PJOE 2W2HA 2CCHB 2EJGA 1ZBJA 1D3BA 2HSEB 2VUBA 4BCPB 5DQWA 3G4ST 4XTZA 2CH4W 4WTOB 2WMAB 2LQKA 5IHIA 1Q82U 1Y7XA 3VV0A 1NZ9A 2V8JA 1JJ2S 2DD5A 3OYJA 2ZCFB 3EH1A 1ZSZB 2LCCA 1K0XA 2DM1A 1UGVA 4M77E 1HSQA 4NOYA 4FW2A 1VINA 2D8HA 5DM7R 3UT1A 2KE9A 2F69A 3LWHA 4EOMB 3QPHA 5KE3A 1KC8U 2RJDA 4JDSA 3CD6T 4YOZA 2DNUA 4O6JA 1Y57A 3QBYA 3R6OA 4C8QA 2DFUA 1OU9A 4UN0A 4ZGEB 3LGLA 3VS7A 1YNZA 5GAOr 5HBHB 1WXUA 5IAYA 3ULRB 1I0CA 2VVKA 3H9NA 1BYMA 4II1A 5LMKB 2VXEA 3MIAB 1I4K1 4PFPA 5M9OA 1AOJA 3BG3A 3QWXX 4PJJA 4J5YA 3H4CA 2LJ1A 3G71A 1OL1B 1QW1A 5CKDA 1PM3A 4JZ3A 4E7LA 2LTOA 2KGTA 2PJQA 2UZDB 2YUQA 1RAAB 4G6LB 3A5ZB 3LWIA 1W2BS 3OYKA 1PCXA 1QCOA 1YWOA 1G83A 2QGGA 2L3PA 7AT1B 2MYSA 3CCLQ 3JCMf 2DZ9A 2RM4A 3L2UA 4C8QG 1W2BA 1VIFA 3BLQB 2ZPGB 3CCMA 2JM8A 2YUNA 2MMPA 3E2UA 1OGUB 1UDLA 5CAIA 2JZ2A 1TS9A 2O31A 1YHQQ 3NTIA 1Q86C 2X4JA 4RTUA 3GF5A 4C8QC 1VQPT 2LW4A 2YWWA 2FPEA 3DTOA 1M9SA 5L8RE 1VQ8A 2FZGB 3VKIA 1U5SA 2FO0A 5LJ5g 2DXBA 3SWNC 4JPBW 4FYWB 5GMKe 2F2VA 3TSWA 4L59A 1JKWA 1KSWA 1G3SA 3OS1A 2I40B 4X9CA 1R0CB 2CP3A 2KXCA 1Q95G 4OGRB 5GANd 1TU0B 4BD3A 4BE1A 2DX1A 3CMET 3PVQA 3TNIB 1NJIU 1CKBA 1H26B 4PK4A 3CCVQ 2HCKA 3CC2T 3CCUQ 3VYGB 3QXEB 1UNGD 1VQKT 5IXBA 2XDDA 4PJMA 4PJLA 4M7AB 2VC8A 5EC7A 1RAFB 1VYTA 4AG1C 1RL2A 3D7SB 5I5ZB 3OW2A 1KIKA 1VYVA 4PKCC 3GPLA 2P0QA 2AKLA 2EYWA 4LUEA 1CSKA 4E2FB 3RIRA 1KD1U 2KT8A 4BI8B 4IURA 1OX9A 3M53A 2EJFA 4MZMA 4C92E 2KNBB 4A54A 2FPDA 4UC4A 2M0OA 1M4ZA 1Z9QA 3VRYA 4C8QF 2QF7A 1OEBA 2COZA 2EAYA 1UTIA 1VQNA 3VS1A 1IHWA 1E7OA 1P92A 2XICA 4AFSC 2IPOB 3LW5E 4ELZC 3CMAA 2EW3A 4QVZA 1AT1B 3URGA 4XU0A 4FCYA 2PHGA 2E6ZA 3QJYA 2DBMA 1R77A 1K1ZA 1PSEA 3N5BB 1YI2A 4HA8A 5FW9A 1YJNT 1AWXA 2C5XB 1QKWA 3OYDA 4J9HA 2X3XD 3GOXA 3DLLA 1KQ2A 1AVZC 1RAHB 5GAMg 1M90C 3JB9F 4BCND 1VA7A 5CKHA 2MPXC 4KH0B 3A98A 2RF0A 5GANe 3EOCB 2PUKB 2QGSA 4AKHA 2AIRB 2E64A 4YOOA 4AFUC 4ROEA 3RBBB 1IB8A 2KAFA 5GAOq 2LNVA 4D6WA 1NLPC 3NDQA 1B3QA 4E7ZA 3FEOA 5CQXA 2HMAA 4N4HA 3EGXB 4BCKB 1ZUKA 5GMKh 3UWNA 1SHFA 1ENWA 1AZEA 1YHQT 3O0GD 2QA4A 2EGCA 5A2QE 2F2WA 1VQ9A 2DD4A 2MWOA 3G6ET 2ENMA 2X3WD 3DB3A 3IQLA 2SRCA 2ECZA 3L2ZA 3OMCA 1H4LD 2LCSA 1WNLA 4R0KA 1VQ5T 2EQIA 1SRMA 2XDPA 1U3OA 5J26A 4FYXB 5I2MA 3JCMb 2K2MA 4F7UB 3PIOA 4EONB 2O9VA 5KE2A 1M3BA 4FIBA 4E7SA 2IW9B 3QHWB 2IN3A 1GH6B 1I5LA 2V8KA 2XDBA 3MEVA 1LCKA 3CCRA 1YIJA 3NTHA 4JX6A 1K8AC 3EIDB 2JS0A 5KYUB 2ZPEB 4PJOA 2WMBB 3FRNA 3ZEHA 2HZYA 4EPCA 3QHSA 8ATCB 3HSBA 1YJWT 1XO2A 2GTOA 2QQBA 2L89A 2V1QA 4KRTA 3I9QA 2OAUA 1YFNA 3JV3A 1M1KU 1GFDA 5CYIB 2XD0A 3KXTA 3EAEA 2L5QA 2DTIA 2HL3A 3HRUA 1S72A 1ZUUA 1KK7A 1VQ8Q 3RMSA 3CCSA 2C0OA 2LDMA 5J3BA 1FMVA 2CP6A 4LDUA 2KRNA 1SSFA 4F14A 4M77A 4E7JA 3Q1JA 4D8KA 4MMLA 2QDLA 3JCMd 2EPDA 5LJ5f 1Q7YC 4M7AE 3H6ZA 1UGQB 4BY7X 5GANh 1WHJA 2KK4A 3I56T 2K79A 3CCQT 4PJOG 3PTAA 1BCOA 2XIDA 3BHUB 4C8QD 1K76A 3HHTB 1VQ7A 3LGFA 2F1LA 1BI2A 2BE7D 2C0IA 4JS4A 1K73U 4PJOC 3PGGA 2PVGB 3CPFA 1MMAA 1VYUA 1HK9A 2XKOC 1Q82C 1JEGA 3RKXA 3VS0A 3M0TA 3QDFA 4XU2A 1JBMA 5KYXB 4OMMA 2CZ6B 3VYHB 4JLIA 4BE2A 3P8BB 2A37A 2CUDA 2MIOA 4LE9A 1QMZB 4M77G 2DYIA 2F5TX 3CBOA 2DEUA 3JB9D 5I11A 3M55A 4C5HA 2ZPHB 4BCOB 2KI7A 3O8VA 4JUVA 4EMHA 3CMAQ 4JJNK 1WX6A 4RKUE 1KC8C 4BY1X 4OR5B 3I5SA 4M7DB 3PVLA 4M77C 1WHGA 1GXIE 4RG2A 2W9FA 5HQ0B 2R7GA 3TNHB 1KFZA 1YI2Q 1QCNA 2KMTA 2P0KA 2LQWA 1WQ7A 4QVDA 2PK2A 1I81A 3PT9A 5FRNA 3M0PA 2Y4XA 2RA2A 3EG1A 3OW2P 5IDNB 3MCAB 2E5KA 4J7IA 4CFVB 2C5OB 3V8KA 3G71T 3CEYA 5IF1B 2PZ1A 2A3LA 2W96A 1JQQA 4OF1A 3JCMe 1QVFS 1KQSS 4FYVB 1M5Q1 3OY9A 4ZGDB 2AZSA 3INZA 4ZTFA 1Y0MA 4Y92A 1H1RB 4HNTA 4O5VA 1ZBXA 5GAMf 4EMKA 1ZSGA 3X25B 2G6FX 4PJOF 3I35A 5FLXE 2K7AA 2EQUA 4HNUA 1QVFA 1KQSA 1NPPA 3OS2A 4PFOA 4XK8E 4ELJA 4OVAA 4EOPB 4BCGB 3UDCA 1PSFA 2OTJQ 1FKMA 2DZCA 1NBEB 1B7TA 3UATA 1TD6A 2LMJA 5CIUA 4DEYA 4X1VA 3CCMT 3CCLA 3T9NA 4OMLA 5IHNA 5KYWB 2QA4Q 2R5MA 3G7ZA 3MY1B 4M78E 3EHRA 5IXFA 3DL1A 1W1FA 1K9MR 1JO8A 3NMZC 4M77F 1UNHD 4KGVB 4F7UE 1NE8A 3CCEA 1UGPB 2IIMA 4NSTB 2MOXA 2NUPB 1D0ZA 4OMFB 2FRYA 3E9GA 2E41A 4JX5A 5GAN7 4F7JB 3OBWA 1OQKA 2KDSA 3JCMP 1O9KB 2L3QA 1K0SA 1PC0A 2OX7A 4CC2A 3L2WA 4QQDA 3M0QA 1VQ4A 3X24B 4J6XA 4LUDA 1EFNA 1OIYB 2ZPFB 3CCRQ 2D9TA 2B9RA 1YIJQ 1NJIC 1IGQA 1AHJB 3LLRA 5ACBA 1FXXA 2CREA 2DMEA 2EUFA 4BCFB 1NYGA 5I21A 3CCVA 2VB6A 3CCUA 3WVEB 1MMNA 4F7NB 2A36A 1WFWA 3LYIA 1W6XA 1G3WA 2EYQA 2RJEA 1ARKA 2WEVB 4OMNA 1AWJA 5GAMj 1BIAA 2LZ6B 1ZSZA 4MFEA 2KMGA 2LX7A 2DRMA 3M0UA 4JRKA 3CCSQ 4BCJB 1XJWB 2C4GB 4ATOA 2WPAB 1VQNT 5J39A 1UEBA 2K9GA 2RHZA 4IIMA 1TOVA 1UHFA 3LX7A 3VS5A 4EOSB 5IHYA 5LJ3h 1H1SB 3JCMh 1AWWA 3MY5B 1BIBA 4BY6B 2E6NA 1D1CA 4X34A 3CPWP 2KRMA 1GBRA 4C92B 4EOIB 4HT8A 4FT2A 4ROCA 1QVGS 1WHLA 2FYKA 2DK3A 3X28B 2PU9B 3QUIA 2QXFA 2W99A 3X26B 3OYAA 3CC4Q 2LQNA 2PK9B 2EYXA 1QVGA 5C6SA 3G33B 4BCMD 3DJBA 2ROLA 1KXUA 4LDWA 1ABQA 2QAZA 3JB9H 2EFIA 4RG8A 5KCOA 1OOTA 3GNFB 1H3HA 2QQSA 4KH1B 4EMGA 1J3TA 4EOLB 4TTHA 4BCHB 2JS2A 4RTZA 5LJ5d 1ZSZC 1VQLQ 3V8LA 1KD1R 4M7DE 1V29B 1H28B 1NEBA 4XTVA 2DMOA 2CT3A 1TXQA 5IDPB 1SKUB 3I55T 5IH2A 2G9XB 1R8OB 1JB0E 1LPLA 2DL8A 3HFOA 1OI1A 4PJNA 1JJ2A 2CH4A 1H1PB 5FWCA 4QVCA 1BB9A 2DTHA 4CFMB 4PJOD 1WI7A 2X4XA 1VIEA 4J7FA 1D3UB 4PNOA 1AZGB 1U8RA 1VQ9T 3JB9J 1R0BG 2YDLA 3V7SA 2XG8D 3BE3A 2GBQA 1FVVB 1YJ9A 2W0ZA 1U1TA 2JMAA 2KYBA 3C94A 1VQ6T 1GY3B 4DOVA 1M27C 5L23A 1RI9A 3HKSA 4BCQB 5CKEA 4AG2C 4A4FA 4C0DB 4AMCA 3G1JA 5DLOA 4LD6A 2YRCA 1V1CA 2FPFA 1WA7A 2RHIA 4M77D 1PKDB 3VYGA 2KT1A 2RJCA 4YTLA 4M7AA 3H41A 4FYYB 2QDYB 2DPPB 1E6HA 1HJDA 2DEQA 2PMIB 1WHMA 2IVWA 5FU6C 3PFSA 1M1FA 3VS6A 1H24B 2EJ9A 2UUEB 2BS3A 2F2CA 4EOQB 1H92A 2D0QB 2V1RA 2CS7A 1UJ0A 2R58A 3KUFA 5LJ5e 3BFMA 2I53A 3TU4K 3VUBA 1M1KC 1Q81U 2CT4A 3OS5A 1H25B 2QTVA 1S72T 5GAMd 1K4US 3CCEQ 3MP6A 3CCST 2HQXA 4B6MA 1UGRB 3MP8A 4LOCA 2UZEB 2W9ZA 2CSQA 2LJ3A 2EGAA 3QKJA 5GAOm 2YRVA 4Z6YA 5KCHA 3C4SA 1VQ4Q 1BKBA 2RO0A 2XMFA 1VQOA 3JB9G 4ESRA 4RCBA 3S3MA 3QSUA 2G77A 2H8HA 4Z89A 2YLCA 1VQ7T 4KGXB 2L3SA 4BI4A 1PWTA 5GAN8 1W4SA 3M03A 2NUTB 1H3ZA 5HBJB 1K73C 5HNBB 1GRIA 3SFMA 3SWNB 3MKDA 1ACMB 2RB6A 2M02A 3M9QA 4ZN3A 2ZGWA 1IHVA 4KUIA 2V26A 1FYNA 3TSZA 4J6YA 1BI1A 4HXJA 1G8XA 4CFXB 4ZNXA 1F5QB 2KR6A 2CDTA 4OMQA 1Q86R 4XTWA 3CC7Q 1N6AA 3EG0A 5D6YA 3EGXA 4F17A 1X2KA 1ZA1B 1QP2A 1ZUYA 1KQ1A 1YN8A 2JVVA 2CSIA 2RQTA 1WJSA 4ORZA 2DXTA 4E7HA 3F70A 1RAGB 2A28A 2X51A 4FL6A 2O9SA 5D6XA 3RDVA 2RI2A 2KRSA 5CQYA 3OYNA 4CRLB 3A8MB 3BG5A 1N8RC 3JCMJ 3KFVA 1GCQA 5GAMe 1MMGA 1TG0A 2XI9A 3LH5A 1LJOA 1YBYA 5GAN3 2JTEA 2M51A 2KY9A 5KYYB 1OU8A 2P0PA 4AT1B 1WPYA 3H0IA 5GAN5 4F7UA 4BXXX 1C9BA 1TFBA 4A53A 3QWLA 4M7AF 4IMYB 3A1PA 4FSSA 3CXCS 1C1AA 4HCKA 4M75B 2QEXQ 4KT0E 3TEEA 2WFYB 1TUCA 1TWBA 2DJZA 4QW2A 3OYBA 3HPWA 4C5IA 4CC4B 5LJ5h 4XU1A 2OJ2A 5KYUA 5GAN6 3CXCA 3VUZA 4RCCA 4TVRA 1URCB 2YT6A 2HQHA 4QQ6A 1TSFA 1XTDA 4OMPA 3WXMB 3E1SA 2OTJA 2J6FA 3QZ9B 3CCLT 2LX9A 2QG9B 1MNDA 2X35A 1GL5A 3OB9A 3FB9A 3ZBDA 1LVKA 1Z9ZA 4BCIB 5IT9E 3EFOB 2L3RA 2MCNA 3DDPB 2M9UA 1WHKA 5D6WA 4BDYA 2MI6A 3QJ6A 4FT4A 1MNEA 1K9AA 3H0FA 1UJYA 1PRLC 1GCQC 2RK1A 4CFUB 4C0ZA 1X01A 3EGUA 1YJ9Q 2M16A 4DOWA 1AWOA 2LT1A 4WCIA 5CK9A 5HY6A 4NC6A 4IKFA 3S3OA 2RHYA 2EIFA 2DL7A 4M78B 3QYBA 5FRMA 2K5IA 3PMTA 2HBWA 1VQ4T 1OZ2A 1WXBA 4XAXB 5IHKA 3CD6A 4P5NA 3QO3A 1HD3A 3EG9B 3I5RA 4ZTJA 1M90R 3UA7A 3BLRB 2WSFE 4CXAB 3NFCA 1JRIA 2KVQG 3DB4A 1ABOA 4OGEA 1JJ2P 4YOSA 3CCVT 3OYHA 2KEAA 3CCUT 1E6GA 4EDUA 3EGDB 3BHVB 3S3NA 2CP5A 2QFZA 1GCPA 5FU7C 2P4RA 3AT1B 3TVTA 5GAOp 5KYXA 1W70A 1VQMQ 4DA4A 2F2XA 3TW7A 4LDYA 4JZ4A 3PNWC 2OTLQ 3M5AA 3HL8A 2RN8A 2V22B 2WIHB 3M56A 5CEIB 2CP2A 2O2OA 2VASA 1M3AA 3OYMA 2VGNA 1B07A 1QVPA 3GTMS 4M7DA 4J8OA 1D0YA 2RI5A 4F7LB 2HSPA 3RESA 3DKMA 3AHUA 4YC3B 2GFUA 1B34B 2ABLA 2M0YA 4BI3A 4FSXA 1NPRA 1RLQC 4ME7A 1VQOQ 4HCZA 1MV0B 1WDXA 4GLKA 4F7UF 1LOJA 2BTTA 3V7CA 2VYTA 5A0LA 1QLYA 3H8ZA 2UZLB 1W2BP 1LNXA 1M2VB 1RLPC 5CCAA 2BS2A 3CC4A 2E4HA 2JXBA 4DBRA 4JLGA 1KG1A 3SHWA 2FZCB 2BE9B 5GMKm 2PVDB 5EJCA 1K8AR 1JXMA 3GBQA 1UGSB 2DERA 2UZBB 2IG0A 4A4EA 4HCBA 2GTJA 2E65A 2CYZB 4CFNB 2AHJB 2E12A 2NLUA 2HL5C 1BBZA 4JRQA 2EVRA 1QP3A 4M7DG 4DQ2A 1VQLA 2DO3A 4DEXA 2CZ0B 2JW4A 4M7AD 5KYWA 2K57A 3QYGB 1T3SA 1D1BA 2BUDA 4Y91A 4E6RA 4M7DC 1FMKA 1SG5A 2GNCA 4E7KA 2PVOB 3FC3A 5KH6A 1UG1A 1IRXA 1N8RU 2NUPA 3K7AM 3QZ5B 4HVWA 3A8GB 3L2VA 1Q7YR 1UE9A 4MFDA 4M75E 3POMA 4XTYA 1O9SA 3NGPA 3REAB 1TUGB 1N4MA 1PD0A 1X75C 3TCJA 1WJRA 3OQ5A 1OPLA 1O9KA 4N0AA 2RHXA 3FJ5A 3M4YA 2JM9A 4IIOA 1QQJA 5BNJB 3H0HA 2PUOB 3MJXA 2EWNA 5IN1A 3B57A 3EHQA 3BLHB 1GUXB 2RMOA 2BIVA 1ZP2A 2JN0A 1OKVB 2WACA 1Q82R 1NYFA 2HBPA 4IUVA 2HD0A 2HAXA 2WJ9A 5KYNA 1YJNA 3CCJA 4EC8B 3SDZA 2HKNA 1ZHIA 4RMOA
chains in the Genus database with same CATH topology
1VQKT 2XDDA 5I2SA 4LDXA 4BBRM 2G3RA 4M7AB 2VC8A 4A4KA 3VKHA 3LH0A 2DIQA 3HO8A 5LJ5d 3CPWA 5GAMh 1RL2A 3V8LA 4M7DE 1V29B 5HKCA 3OW2A 3CC7T 5FRMA 4XTVA 4PKCC 3GPLA 2RJFA 2P0QA 4Q5WA 4M7DF 1KD1U 3RIRA 3I55T 5A0DA 1HXDA 4BI8B 4IURA 1R8OB 1JB0E 3HFOA 4AKGA 1OI1A 1M1GA 3M4GA 1VUBA 3M53A 2EJFA 3BW1A 4MZMA 4C92E 3OA6A 1Q81C 5LJ3g 1JJ2A 1KHIA 5FU7B 4C8QE 3EFRA 4A54A 3ZFJA 2VXFA 3L1AA 1IREB 4QVCA 4UC4A 4BE0A 2DTHA 2M0OA 1M4ZA 2PQWA 4M78F 4OB3B 3QDRB 4R55A 1VQ8T 2HNIA 2X4XA 5A0GA 4CI0C 4PJOD 2DXCB 1VIEA 4C8QF 2QF7A 1Q86U 4J7FA 2R57A 2EAYA 2VGMA 4C92A 4PNOA 3M54A 5GMKj 1VQNA 1U8RA 2C06A 2D6FA 1P92A 1BI3A 2LQ8A 2XICA 1VQ9T 3JB9J 2JUFA 3LW5E 4ELZC 3CMAA 3V7SA 2XG8D 3HZJA 1YITT 5GANf 1VQPA 4E7IA 3BY7A 4QVZA 2RK2A 3URGA 4C0GA 4HT9A 4XU0A 1YJ9A 1U1TA 2E6ZA 2P4TA 3C94A 2ZZDB 3QJYA 3A8OB 2V8IA 3FJPA 2DD4B 3VKGA 2DIGA 2WSCE 4L6V5 2LT4A 5LJ3d 1VQ6T 4DOVA 1PSEA 3N5BB 3SD4A 1YI2A 4HA8A 4EMKC 4MDXA 4N4IA 2FL7A 1YJNT 4M6VA 3HKSA 2QEXT 4XQ3A 5CKEA 3HP9A 2WSEE 1U1SA 4QVDA 1H641 4A4FA 4C0DB 5DLOA 4LD6A 4KULA 4M77D 3OYDA 2RHIA 2K5FA 3HB9A 1WQWA 4CRIA 3VYGA 3GOXA 2RJCA 3TREA 3DLLA 1KQ2A 4KUDK 2K5LA 2XHCA 4YTLA 4FM4B 5GAMg 2RD1A 3VJPA 4M7AA 1M90C 2QDYB 2DPPB 1VQ5A 3JB9F 3C12A 3VU3C 3CMEA 2QI2A 3QG1A 3FDRA 4BB7A 4JS5A 3QYHB 2DEQA 3ASKA 3MEAA 5CKHA 3EFSA 2IVWA 2QQAA 5FU6C 3CC2A 1E7PA 3PFSA 5GANe 1M1FA 2PUKB 1VQKA 2CKKA 3GIBA 3RMQA 4C92G 3A8HB 4AKHA 2EJ9A 2BS3A 2B8AA 2E64A 2F5KA 2QQ9A 2D0QB 3JCMV 1XOVA 2CS7A 2MWPA 2R58A 4PJOB 5CVIA 2KAFA 5GAOq 3CC7A 2LNVA 3KUFA 4D6WA 5CR2A 4E47A 5CKFA 5LJ5e 3BFMA 3HBLA 3FEOA 1M8VA 3TU4K 3VUBA 5CQXA 1M1KC 2DXCA 1Q81U 2MF2A 2X4YA 3OS5A 2YHTA 4N4HA 4C92C 5GMKi 1S72T 5GAMd 3CMAT 3MP6A 5LL6S 5GMKh 3UWNA 3CCST 3S6WA 1Y07A 2HQXA 1TH7A 3CBPA 1UGRB 1YHQT 3RKWA 3MP8A 5GAOn 1YJ9T 4LOCA 4WF2A 2QA4A 3JCMc 3MP1A 3X20B 2YLBA 4HKEA 4QQGA 4BDZA 4LD9K 2ZPIB 3META 5A2QE 4NS5A 2BS4A 1YI2T 5HK3A 4FU6A 2E1HA 2ZZDA 4KBMB 4ELYC 3QKJA 1VQ9A 5GAOm 2DD4A 2MWOA 2YRVA 4OP0A 3G6ET 3DB3A 4BACA 1K9MC 5C0MA 4Z6YA 5KCHA 3C4SA 1YITA 1BKBA 2RO0A 4M77B 1VQOA 3L2ZA 3JB9G 3OMCA 4RCBA 2CZ1B 3S3MA 2DXUA 3QSUA 2G77A 5GAN4 3JSCA 2DAQA 1WNLA 2CGHA 2HQEA 1VQ5T 2YLCA 2BKDN 2XDPA 5GANj 1VQ7T 4XU3A 5J26A 5DLQE 5I2MA 4BI4A 3JCMb 4F7UB 3C95A 3PIOA 2I2LA 3QYEA 5KE2A 4BUGA 1W4SA 4FIBA 5GAN8 2QEXA 4GY5A 1H3ZA 2FVUA 1KHCA 2JTFA 2K4YA 4XTXA 2Y4YA 5LJ3e 4HNVA 3RERA 1I5LA 1K73C 1M90U 3CCQA 3SWNB 2V8KA 3SFMA 5LJ5j 2XDBA 3MEVA 5CKBA 3CCRA 1VQMT 1YIJA 1MHNA 2LC4A 4M75D 2OTJT 3NTHA 4JX6A 3BG9A 2RB6A 3PIPA 4ZN3A 3M9QA 4C0FA 2ZGWA 1K8AC 4KUIA 2OTLT 2ZPEB 4J6YA 3JCMQ 2M1HA 4BBSM 3QIIA 1BI1A 4PJOA 4IUQA 2LVMA 3FRNA 3ZEHA 1XQHA 3L2RA 4HCCA 4EPCA 3J7AF 3QHSA 3FLGA 3HSBA 2GF7A 2KR6A 1YJWT 4XTWA 1N6AA 3JCMg 4OB0B 5D6YA 2QQBA 1QP2A 2L89A 3JAME 2RI3A 2QA4T 1KQ1A 2FB7A 2JVVA 4C92F 2KQWA 2MAMA 3E19A 1WJSA 3MEUA 2OAUA 1M1KU 3ME9A 2DXTA 4E7HA 1G5VA 2XD0A 3KBGA 3KXTA 3F70A 3MHXA 3EAEA 3SB2A 4JRPA 4V2SA 2L5QA 2DTIA 4N0AC 3OYGA 5DY9A 2E70A 3HRUA 4FL6A 5D6XA 1S72A 3J80E 2RI2A 4B9WA 3RMSA 3CCSA 2O4XB 4QSHA 2H3JA 3ER0A 5CQYA 3OYNA 1VQOT 2LDMA 3A8MB 3BG5A 1N8RC 5J3BA 2GCXA 2DVEA 3JCMJ 4LDUA 1YHQA 3OSVA 1SSFA 2EQKA 3CBMA 5GAMe 4M77A 4HLQA 2XI9A 3OSSC 4E7JA 3Q1JA 1LJOA 3OMGA 2E5QA 4MMLA 3JCMd 4C0DC 1YBYA 4HL4A 2LCLA 5GAN3 3J81E 1MGQA 1Y96B 4MZTA 3GP8A 1K9MU 4M7DD 1QLBA 2KY9A 5LJ5f 1Q7YC 1IZ6A 4M7AE 2L8DA 3H6ZA 1UGQB 2P0PA 4LDVA 3MO8A 3G6EA 1WPYA 1OYXA 5GANh 5GAN5 4F7UA 4NL2A 2KK4A 3I56T 2K2VA 5GAN2 4A53A 3CCQT 3QWLA 4M7AF 4X9DA 4M78D 4PJOG 3PTAA 3CCRT 3CXCS 2XIDA 1YIJT 4A4HA 4M75B 4C8QD 2KSSA 4KT0E 3P8HA 3TEEA 3HHTB 1VQ7A 3LGFA 3L42A 3SWNA 2DJZA 4QW2A 3OYBA 3HPWA 4C5IA 1BI2A 3OYCA 5LJ5h 4JS4A 4XU1A 3RUXA 4J6WA 1FX7A 2EQJA 2GQVA 5GAN6 1K73U 3CXCA 3VUZA 4PL6A 4RCCA 3S3OA 4PJOC 3PGGA 2PVGB 3CPFA 3DLMA 4TVRA 1D3BB 4EMKB 2QQ8A 1HK9A 3P8DA 4QQ6A 2XKOC 1K8AU 3JB9I 1Q82C 1VQMA 1O75A 1XTDA 3RKXA 4Z02A 3WXMB 5GAOl 3E1SA 4XU2A 2OTJA 1JBMA 3QZ9B 1BI0A 3CCLT 2LX9A 1N27A 2CZ6B 2X35A 2OTLA 3JRZA 3VYHB 4JLIA 4BY6C 4JRIA 3V7RA 1EIFA 4OB1B 1G3YA 3OB9A 3P8BB 4BE2A 2LRQA 1N9SA 4M77G 3FB9A 3ZBDA 1YJWA 4AI6A 2ZPBB 5IT9E 2L3RA 5LJ3f 1KD1C 2M9UA 2F5TX 5AYFA 5D6WA 4BDYA 2A7YA 2MI6A 2DD5B 2O4XA 3CBOA 1G3TA 2QDJA 1X6OA 3QJ6A 4FT4A 4IUUA 4C5EA 4ZN1A 3JB9D 3M55A 4C5HA 2ZPHB 4JUVA 3O8VA 2X4WA 4EMHA 1DJ7B 2JOYA 4JJNK 3GNGA 4RKUE 4NL3A 1KC8C 4IUTA 2RK1A 4M7DB 4M77C 2QQRA 4C0ZA 1FWZA 1X01A 2M16A 2QTXA 4M7AG 1GXIE 1OZ3A 4RG2A 4DOWA 1Y96A 2LT1A 5CK9A 5HY6A 4NC6A 2DKGA 4IKFA 2CZ7B 2GFAA 2K3XA 2KMTA 2E10A 2EIFA 2P0KA 2RHYA 3QYBA 1WQ7A 4M78B 4ZGJB 1ZQ1A 2K5IA 1I81A 3PMTA 3PT9A 4A4GA 4C8QB 3CC4T 5FRNA 2Y4XA 1WJQA 1OZ2A 2RA2A 1VQ4T 4JX4A 4XAXB 1Q7YU 3M57A 3CD6A 3MCAB 4P5NA 3QO3A 4PLIA 4M7AC 4ZTJA 4J7IA 2K3YA 4M75A 2WSFE 4AKIA 3V8KA 3G71T 3NFCA 1JRIA 3CEYA 2RHUA 2KVQG 2A3LA 3I56A 3DB4A 4OGEA 2FHDA 4OF1A 3JCMe 1QVFS 1KQSS 1M5Q1 4PJOE 3CCVT 3OY9A 3OYHA 4L5GA 4ZGDB 3OYEA 3GLXA 3INZA 3CCUT 4ZTFA 2EJGA 1D3BA 4HNTA 4O5VA 1ZBXA 5GAMf 4EMKA 4EDUA 3X25B 4PJOF 2VUBA 1I8FA 5FLXE 3S3NA 3M59A 2QFZA 4HNUA 2EQUA 5FU7C 1QVFA 2XU8A 3G4ST 1KQSA 1VQLT 1NPPA 5GAOp 4XK8E 3OS2A 4XTZA 4OB2B 4ELJA 2LQKA 4OVAA 3OW2S 4OGCA 3UDCA 1PSFA 5FU6B 1FKMA 3TW6A 5CO7A 4DA4A 1Q82U 3HRSA 1Y7XA 3VV0A 3TW7A 2DZCA 4B9XA 4LDYA 1NZ9A 3PNWC 2V8JA 3M5AA 3HL8A 3FIFA 5CIUA 3OBYA 3M56A 1JJ2S 3CCMT 3CCLA 3MEWA 2DTOA 2DD5A 3OYJA 2ZCFB 3T9NA 3OYMA 2VGNA 2LCCA 2RH2A 1UB4A 1QVPA 4M77E 4NOYA 2R5MA 3G7ZA 4J8OA 4M7DA 4MMKA 4M78E 2RI5A 1WGSA 3DL1A 5DM7R 4XTUA 3UT1A 3RESA 3DKMA 4M75G 4M77F 2F69A 2GFUA 2XK0A 3LWHA 3AHUA 3QPHA 1B34B 2EQMA 4PLLA 5KE3A 5GMKl 1KC8U 4F7UE 1NE8A 4BI3A 2RJDA 3CCEA 4FSXA 1UGPB 1NPRA 4JDSA 3CD6T 4M78A 5LJ3j 3OYYA 4OMFB 4ME7A 4HCZA 4O6JA 3E9GA 3QBYA 3R6OA 4C8QA 4F7UF 2E41A 4GLKA 4JX5A 1LOJA 4ZGEB 3LGLA 4R56A 5GAOr 5GAN7 3V7CA 4M75C 3OBWA 2VYTA 5A0LA 2KDSA 5IAYA 3JCMP 3H8ZA 4C92D 1LNXA 5CCAA 2BS2A 1BYMA 3L2WA 3CC4A 4II1A 2DXBB 2VXEA 4QQDA 4JLGA 1VQ4A 1KG1A 3X24B 1I4K1 4J6XA 5M9OA 3BG3A 3BDUA 5GMKm 2PVDB 4J5YA 5EJCA 3H4CA 2ZPFB 3JCMW 3CCJT 3G71A 2D9TA 1NJIC 1AHJB 3WVDB 3A8LB 1UGSB 4MIMA 1QW1A 1FXXA 3LLRA 5CKDA 3OYLA 4Y28E 5I21A 1N9RA 2IG0A 3CCVA 4A4EA 1YCYA 4HCBA 2E65A 3WVEB 2CYZB 2LTOA 3CCUA 2AHJB 4E7LA 2E12A 2NLUA 3LYIA 4JRQA 1G3WA 1QP3A 3M58A 4M7DG 3A5ZB 2R5AA 3LWIA 2EYQA 1W2BS 2RJEA 4DQ2A 3OYKA 3G4SA 2DO3A 1VQLA 1RI0A 2CZ0B 3V8JA 3OS0A 5GAMj 1BIAA 4MDWA 4M7AD 3KHIA 1Y71A 2K57A 4M78G 4MFEA 2DZ9A 3QYGB 2RM4A 2KMGA 3JCMf 3RKYA 2BUDA 3L2UA 4C8QG 4Y91A 4MZPA 1W2BA 4M7DC 3CCET 1VIFA 4F7UG 4JRKA 2ZPGB 3CCMA 3JCMX 2MMPA 4ATOA 4C5GA 1B34A 1VQNT 4E7KA 2PVOB 3FC3A 5CAIA 5KH6A 2JZ2A 3HFNA 1UEBA 4J83A 5J39A 1Q86C 3NTIA 2RHZA 1N8RU 2X4JA 3I55A 3LX7A 4M78C 3QZ5B 5GANg 3A8GB 3GF5A 5LJ3h 4C8QC 3NTKA 4MFDA 3JCMh 3L2VA 4M75E 1VQPT 1BIBA 4XTYA 4BY6B 1O9SA 2E6NA 4X34A 3TCJA 1X75C 4N4GA 1WJRA 3HRTA 1M9SA 5L8RE 4C92B 3OQ5A 5EG2A 3PMIA 1VQ8A 4HT8A 4FT2A 1QVGS 4M75F 4N0AA 2FYKA 1XNIA 2DK3A 2RHXA 3VKIA 4VUBA 3M4YA 3L2QA 3X28B 2PU9B 2VV5A 2DXBA 3QUIA 5LJ5g 3SWNC 2QXFA 2PUOB 3X26B 5HK0A 3OYAA 5GMKe 2EWNA 5IN1A 2JTMA 3UPUA 4L59A 2Y90A 2O01E 1QVGA 2BIVA 1G3SA 3OS1A 5C6SA 4X9CA 2JN0A 2JNGA 5GANd 4LDWA 2WACA 4BD3A 4BE1A 3E9FA 3OYIA 3CMET 1VQ6A 3CPWS 1NJIU 3JB9H 3OYFA 2HBPA 4IUVA 2EFIA 2HD0A 2HAXA 4RG8A 5KCOA 2WJ9A 3GNFB 4IUPA 2QQSA 3BDLA 3CC2T 5FROA 4EMGA 3CCJA 1YJNA 3SDZA 2EKOA 3VYGB 1ZHIA 4RMOA 3QXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVG B;  2ZPI B;  2ZZD A;  4ZGE B;  2DD4 A;  1V29 B;  3QZ9 B;  2CZ6 B;  3VYH B;  2CZ1 B;  4OB1 B;  1JB0 E;  2DXB B;  3X24 B;  2ZPB B;  2PVD B;  1IRE B;  2DD5 B;  2ZPF B;  4OB3 B;  1AHJ B;  3WVD B;  2ZPH B;  1UGS B;  3A8L B;  2DXC B;  1DJ7 B;  4RKU E;  4Y28 E;  3WVE B;  2CYZ B;  2AHJ B;  1UGP B;  1GXI E;  3LW5 E;  1QP3 A;  2CZ7 B;  2ZPE B;  2CZ0 B;  4ZGJ B;  2ZZD B;  3A8O B;  2DD4 B;  2WSC E;  4L6V 5;  1PSE A;  3QYG B;  4OB0 B;  1QP2 A;  2WSF E;  2WSE E;  2ZPG B;  2PVO B;  4ZGD B;  3VYG A;  4FM4 B;  3QZ5 B;  2QDY B;  2DPP B;  3A8G B;  3X25 B;  3A8M B;  3QYH B;  4XK8 E;  5L8R E;  4OB2 B;  1PSF A;  2PUK B;  3A8H B;  3X28 B;  2PU9 B;  2DXB A;  2D0Q B;  1UGQ B;  2PUO B;  3X26 B;  2O01 E;  2DD5 A;  2ZCF B;  2DXC A;  4KT0 E;  3HHT B;  1UGR B;  3VYG B;  3X20 B;  3QXE B; 
#chains in the Genus database with same CATH topology
 5I2S A;  4F7S B;  4BBR M;  2G3R A;  1X27 A;  4A4K A;  3VKH A;  2E3H A;  3HO8 A;  3MPU B;  2L0A A;  4M7D F;  9ATC B;  1KC8 R;  4DBH A;  4Y72 B;  3RGF B;  3M4G A;  1M1G A;  1VUB A;  2E3I A;  3OA6 A;  1Q81 C;  5LJ3 g;  1KHI A;  3EFR A;  2KYM A;  1IRE B;  3UA6 A;  2PQW A;  1VQ8 T;  4OB3 B;  1RUW A;  5A0G A;  2DXC B;  2CCI B;  4J9E A;  3U23 A;  5GMK j;  2R57 A;  2VGM A;  4C92 A;  2C06 A;  2D6F A;  1BI3 A;  2JUF A;  6AT1 B;  1X6G A;  2ESW A;  3HZJ A;  5GAN f;  4PFZ A;  3BY7 A;  4E7I A;  3CD6 Q;  4F04 B;  2RK2 A;  2DIL A;  4EOK B;  2ZZD B;  4ROD A;  1W98 B;  3LQ5 B;  2WSC E;  4JJD A;  3SD4 A;  2K6D A;  2KR3 A;  4EMK C;  1GBQ A;  4MDX A;  4N4I A;  4M6V A;  3BHT B;  1WHH A;  2K3B A;  1H64 1;  4KUL A;  2K5F A;  3HB9 A;  1WQW A;  2BPM B;  4KUD K;  1A0N B;  2K5L A;  4FM4 B;  2RD1 A;  3VJP A;  1VQ5 A;  5AT1 B;  3C12 A;  3RR6 A;  3VU3 C;  2BZX A;  3QG1 A;  4JS5 A;  3QYH B;  1E7P A;  1OKW B;  1H27 B;  1OI9 B;  2CKK A;  2C5V B;  3GIB A;  4C92 G;  3A8H B;  2B8A A;  2F5K A;  1RAB B;  2QQ9 A;  2DL3 A;  1XOV A;  2MWP A;  3RNJ A;  1S1N A;  1V76 A;  5CVI A;  3CC7 A;  3PO3 S;  4E47 A;  3HBL A;  1M8V A;  4KRD B;  5GMK i;  2YHT A;  4C92 C;  4J9B A;  3CMA T;  2C5N B;  4CC3 A;  1TH7 A;  3RKW A;  5GAO n;  1HYO A;  4WF2 A;  2HKQ B;  3JCM c;  4HVU A;  5FGK B;  1E9H B;  3X20 B;  4HKE A;  4QQG A;  3MET A;  2KRO A;  1VQP Q;  3C0C A;  4NS5 A;  2BS4 A;  1YI2 T;  1VOM A;  1CKA A;  1TTH B;  4KBM B;  4ELY C;  4OP0 A;  4BAC A;  1YIT A;  4J9I A;  2OAW A;  1NJI R;  2RPN A;  2CZ1 B;  2DXU A;  5GAN 4;  3JSC A;  2DAQ A;  2QYZ A;  1OV3 A;  2CGH A;  1EZZ B;  2BKD N;  5GAN j;  4BCN B;  4XU3 A;  5DLQ E;  3C95 A;  2PTK A;  4BUG A;  2QEX A;  1N5Z A;  1FMW A;  2FVU A;  1KHC A;  2K4Y A;  4XTX A;  1MMD A;  3RER A;  4HNV A;  1OL2 B;  3CME Q;  1AD5 A;  4QKU A;  3CCQ A;  1RAI B;  2B86 A;  5CKB A;  2LC4 A;  2OTJ T;  3CC2 Q;  3BG9 A;  2DF6 A;  1VQK Q;  2CJM B;  1IO6 A;  1JU5 C;  2M1H A;  3QII A;  4IUQ A;  3M0S A;  4HCC A;  1GFC A;  1XQH A;  3J7A F;  2X9H A;  4OMO A;  2JMC A;  2DYB A;  2D0N A;  1QKX A;  3JAM E;  2RI3 A;  2QA4 T;  4C92 F;  2MAM A;  3E19 A;  3DOG B;  3MEU A;  1QMC A;  3VS4 A;  2DA9 A;  2LP5 A;  3MHX A;  4HVV A;  3OYG A;  2E70 A;  1U06 A;  4B9W A;  2O4X B;  2H3J A;  3ER0 A;  4GBQ A;  1PRM C;  2GCX A;  2I0N A;  2JT4 A;  2DLP A;  2DVE A;  3OSV A;  2EQK A;  3CBM A;  1D0X A;  3ZL7 C;  2HEQ A;  4HLQ A;  3CQT A;  5L2W B;  3OMG A;  2E5Q A;  4F6U B;  4C0D C;  2LCL A;  4J9F A;  4M7D D;  1K9M U;  1MGQ A;  1Y96 B;  3GP8 A;  1BCM A;  3NHN A;  4EOO B;  2L8D A;  4LDV A;  1OYX A;  4NL2 A;  2K2V A;  5GAN 2;  5GJW B;  2COY A;  2NUT A;  4X9D A;  3CCR T;  1JSU B;  1YIJ T;  2OI3 A;  1YJN Q;  3CCJ Q;  2YXY A;  3SWN A;  3L42 A;  1M8M A;  3OYC A;  3RUX A;  4J6W A;  1FX7 A;  1NLO C;  5HBE B;  1I5O B;  4KGZ B;  1D3B B;  3NPF A;  4RUG A;  3TNW B;  3JB9 I;  2C0T A;  1VQM A;  1O75 A;  4Z02 A;  1BI0 A;  1MV3 A;  1N27 A;  2OTL A;  4LNP A;  1G3N C;  1G3Y A;  1N9S A;  4AI6 A;  2ZPB B;  5LJ3 f;  1JXO A;  5FU6 B;  3TN8 B;  2DD5 B;  4ZN1 A;  1G3T A;  2QDJ A;  1X6O A;  4IUU A;  2DET A;  2JOY A;  3GNG A;  4NL3 A;  4IUT A;  1QVF P;  1KQS P;  1RAE B;  1FWZ A;  3F5X B;  2QTX A;  4A63 B;  4M7A G;  1AEY A;  5KYY A;  1T0H A;  1RAD B;  1JOW A;  4K11 A;  1H1Q B;  4ZGJ B;  2AT1 B;  3CC4 T;  3G6E Q;  4C8Q B;  1X2Q A;  1WYX A;  1QWE A;  2A0F B;  1WJQ A;  4JX4 A;  4M7A C;  2NWM A;  2K3Y A;  4M75 A;  2IW6 B;  2RQV A;  4RTX A;  1VQ5 Q;  2ZAE A;  4D8D A;  2D8J A;  4L5G A;  3OYE A;  3GLX A;  1BU1 A;  1I8F A;  3M59 A;  1SHG A;  2XU8 A;  1VQL T;  3R6N A;  1WZO A;  4OB2 B;  4J9G A;  3OW2 S;  4OGC A;  5CO7 A;  3TW6 A;  1M1K R;  1PNJ A;  3HRS A;  4ELL A;  2ED1 A;  4B9X A;  3FIF A;  5FWB A;  2DBK A;  3EFO A;  3OBY A;  3MEW A;  1YJW Q;  2DTO A;  3VS2 A;  2BKZ B;  4AFZ C;  2RH2 A;  1UB4 A;  4LN2 A;  4MMK A;  1WGS A;  1PKS A;  4XTU A;  1UFF A;  4M75 G;  2XK0 A;  2EQM A;  4PLL A;  1QCF A;  5GMK l;  1YIT Q;  4M78 A;  5LJ3 j;  3OYY A;  2NYS A;  4R56 A;  3EG9 A;  4M75 C;  2GQI A;  4RTW A;  4ANJ A;  1PKT A;  4C92 D;  4GLM A;  1K73 R;  2DXB B;  4J9C A;  3I56 Q;  4I3Z B;  1I07 A;  1SSH A;  2RQR A;  3BDU A;  3CCQ Q;  2YUP A;  3EGD A;  3JCM W;  3CCJ T;  3WVD B;  3A8L B;  4MIM A;  3OYL A;  1C6V X;  4Y28 E;  1N9R A;  1G2B A;  1YCY A;  1SF9 A;  2D1X A;  1OX8 A;  5LQF B;  3M58 A;  3HTR A;  1T3L A;  2R5A A;  3G4S A;  3PE0 A;  2MK5 A;  4LXC A;  1RI0 A;  1EX4 A;  3V8J A;  3OS0 A;  2AKK A;  2EYZ A;  1WXT A;  2J06 A;  4MDW A;  1QVG P;  1MUZ A;  1AD6 A;  3KHI A;  1Y71 A;  4M78 G;  3RKY A;  5ICP B;  1D09 B;  4MZP A;  3CCE T;  1N8R R;  4F7U G;  4JJB A;  3JCM X;  1YWP A;  4C5G A;  1B34 A;  3HFN A;  4M4Z A;  4J83 A;  2EBP A;  1X6B A;  3I55 A;  2IW8 B;  4M78 C;  5GAN g;  1M30 A;  3NTK A;  2YSQ A;  4N4G A;  2W10 A;  3HRT A;  2CP7 A;  4EOJ B;  3EG2 A;  5EG2 A;  3PMI A;  1D1A A;  4M75 F;  4II5 B;  1XNI A;  1M2V A;  4VUB A;  2CUB A;  1ZX6 A;  3L2Q A;  2VV5 A;  5HK0 A;  2JTM A;  3UPU A;  2Y90 A;  2O01 E;  4EC9 B;  4EIK A;  3VS3 A;  3SEM A;  2DL5 A;  3G71 Q;  2JNG A;  4Z8A A;  2CP0 A;  3E9F A;  3OYI A;  1WIE A;  1BU2 A;  4J9D A;  2KXD A;  3CPW S;  1VQ6 A;  3OYF A;  2RQU A;  4IUP A;  3BDL A;  4BCQ D;  5FRO A;  2EKO A;  4CC7 A;  4CRI A;  1QWF A;  4LDX A;  3O5Z A;  3LH0 A;  2DIQ A;  3EJ1 B;  3CPW A;  5GAM h;  2COW A;  5HKC A;  3CC7 T;  4KRC B;  2RJF A;  4Q5W A;  5A0D A;  1HXD A;  1TUD A;  2FRW A;  4AKG A;  2PNI A;  3BW1 A;  3CCM Q;  5FU7 B;  4C8Q E;  2FZK B;  3ZFJ A;  2VXF A;  3L1A A;  1RAC B;  2JJ9 A;  4BE0 A;  1M3C A;  4R55 A;  2JGZ B;  4M78 F;  3QDR B;  2HNI A;  1PD1 A;  4CI0 C;  1Q86 U;  2NUZ A;  3M54 A;  5ECA A;  2LQ8 A;  1OIU B;  2DJQ A;  2LJ0 A;  3UF4 A;  1YIT T;  1VQP A;  4F6W B;  4C0G A;  4BCM B;  4HT9 A;  1UEC A;  1NG2 A;  1GUX A;  2P4T A;  3A8O B;  2V8I A;  3FJP A;  2DD4 B;  3VKG A;  2DIG A;  2EKH A;  4L6V 5;  2LT4 A;  5D7U A;  5LJ3 d;  1KJW A;  2FL7 A;  1IGU A;  2A08 A;  2QEX T;  4XQ3 A;  3HP9 A;  2WSE E;  1U1S A;  1PG5 B;  1C0M A;  3TRE A;  2XHC A;  1AIS B;  2L2P A;  3CME A;  2QI2 A;  3FDR A;  4BB7 A;  2FG0 A;  8AT1 B;  3ASK A;  3MEA A;  2C6T B;  1VYW B;  2FEI A;  3EFS A;  3CC2 A;  2QQA A;  4F16 A;  1VQK A;  5GJV B;  3RMQ A;  2IVX A;  1ZLM A;  3JCM V;  3M0R A;  1NEG A;  4PJO B;  1T0J A;  1YCS B;  5CR2 A;  5CKF A;  4F70 B;  1X43 A;  2ED0 A;  2DXC A;  2MF2 A;  2X4Y A;  2KBT A;  5LL6 S;  3S6W A;  2HDA A;  1P5E B;  1Y07 A;  3CBP A;  1VQN Q;  1YJ9 T;  2DRK A;  3MP1 A;  2YLB A;  4BDZ A;  4LD9 K;  4DBF A;  3QWY A;  2ZPI B;  5HK3 A;  1SRL A;  4FU6 A;  2E1H A;  2ZZD A;  2Z0W A;  1K9M C;  5C0M A;  2ATC B;  2BZY A;  4M77 B;  1OPK A;  3REB B;  2VKN A;  3EH2 A;  4F6S B;  2HQE A;  2J6K A;  2WHB B;  2J7I A;  1PHT A;  3THK A;  1I1J A;  2I2L A;  3QYE A;  4FW1 A;  4GY5 A;  5HCK A;  2JTF A;  2QGF B;  2Y4Y A;  5LJ3 e;  3QHR B;  1M90 U;  3G4S Q;  5LJ5 j;  1VQM T;  5DQV A;  1MHN A;  1YP5 A;  2GGR A;  4M75 D;  4RTV A;  3PIP A;  4C0F A;  2QAS A;  1IXD A;  2OTL T;  3JCM Q;  4BBS M;  2LVM A;  2H3E B;  3L2R A;  2ROT A;  3DDQ B;  1M2O A;  3FLG A;  2GF7 A;  3TQ7 P;  2QK0 A;  3JCM g;  4OB0 B;  4RTY A;  4EOR B;  2BZ8 A;  2FB7 A;  2KQW A;  2RNA A;  3I55 Q;  3ME9 A;  1G5V A;  3KBG A;  3SB2 A;  4JRP A;  4V2S A;  4N0A C;  5DY9 A;  3J80 E;  3CXC P;  4QT7 A;  4QSH A;  2EYY A;  2VWF A;  1VQO T;  1YHQ A;  2DVJ A;  1VQ9 Q;  2AK5 A;  3OSS C;  2WXV B;  4HL4 A;  4CFU D;  3J81 E;  4MZT A;  1QLB A;  2J6O A;  1IZ6 A;  3G6E A;  1SPK A;  3MO8 A;  2RQW A;  2O88 A;  1VQ6 Q;  1BK2 A;  4M78 D;  4RTT A;  4A4H A;  2KSS A;  3P8H A;  5I22 A;  2X1N B;  1X69 A;  2EQJ A;  2GQV A;  2J05 A;  4PL6 A;  3DLM A;  1UNL D;  3EG3 A;  4EMK B;  2QQ8 A;  3P8D A;  1K8A U;  4CFW B;  2YUO A;  1NM7 A;  1Q81 R;  5GAO l;  1UUE A;  1OUL A;  1FIN B;  3JRZ A;  4BY6 C;  4JRI A;  3V7R A;  1WLP B;  4JJC A;  1EIF A;  4OB1 B;  2LRQ A;  1YJW A;  1H8K A;  4Z88 A;  1KD1 C;  1ZA2 B;  5AYF A;  3VRZ A;  2A7Y A;  2O4X A;  4C5E A;  1S72 Q;  2X4W A;  5EFQ B;  1DJ7 B;  1UHC A;  2QQR A;  2LNH B;  1OZ3 A;  1Y96 A;  2AZV A;  2DKG A;  2CZ7 B;  2GFA A;  2K3X A;  2E10 A;  4A4G A;  2YRD A;  1ZQ1 A;  5HVY B;  2DE0 X;  1Q7Y U;  2EGE A;  3M57 A;  4PLI A;  3MI9 B;  4AFQ C;  4FX3 B;  1VOL A;  4AKI A;  1SEM A;  1F1B B;  2RHU A;  2WIP B;  2P84 A;  3I56 A;  1JST B;  2FHD A;  4DBQ A;  1VQ7 Q;  2DL4 A;  2SEM A;  4PJO E;  2W2H A;  2CCH B;  2EJG A;  1ZBJ A;  1D3B A;  2HSE B;  2VUB A;  4BCP B;  5DQW A;  3G4S T;  4XTZ A;  2CH4 W;  4WTO B;  2WMA B;  2LQK A;  5IHI A;  1Q82 U;  1Y7X A;  3VV0 A;  1NZ9 A;  2V8J A;  1JJ2 S;  2DD5 A;  3OYJ A;  2ZCF B;  3EH1 A;  1ZSZ B;  2LCC A;  1K0X A;  2DM1 A;  1UGV A;  4M77 E;  1HSQ A;  4NOY A;  4FW2 A;  1VIN A;  2D8H A;  5DM7 R;  3UT1 A;  2KE9 A;  2F69 A;  3LWH A;  4EOM B;  3QPH A;  5KE3 A;  1KC8 U;  2RJD A;  4JDS A;  3CD6 T;  4YOZ A;  2DNU A;  4O6J A;  1Y57 A;  3QBY A;  3R6O A;  4C8Q A;  2DFU A;  1OU9 A;  4UN0 A;  4ZGE B;  3LGL A;  3VS7 A;  1YNZ A;  5GAO r;  5HBH B;  1WXU A;  5IAY A;  3ULR B;  1I0C A;  2VVK A;  3H9N A;  1BYM A;  4II1 A;  5LMK B;  2VXE A;  3MIA B;  1I4K 1;  4PFP A;  5M9O A;  1AOJ A;  3BG3 A;  3QWX X;  4PJJ A;  4J5Y A;  3H4C A;  2LJ1 A;  3G71 A;  1OL1 B;  1QW1 A;  5CKD A;  1PM3 A;  4JZ3 A;  4E7L A;  2LTO A;  2KGT A;  2PJQ A;  2UZD B;  2YUQ A;  1RAA B;  4G6L B;  3A5Z B;  3LWI A;  1W2B S;  3OYK A;  1PCX A;  1QCO A;  1YWO A;  1G83 A;  2QGG A;  2L3P A;  7AT1 B;  2MYS A;  3CCL Q;  3JCM f;  2DZ9 A;  2RM4 A;  3L2U A;  4C8Q G;  1W2B A;  1VIF A;  3BLQ B;  2ZPG B;  3CCM A;  2JM8 A;  2YUN A;  2MMP A;  3E2U A;  1OGU B;  1UDL A;  5CAI A;  2JZ2 A;  1TS9 A;  2O31 A;  1YHQ Q;  3NTI A;  1Q86 C;  2X4J A;  4RTU A;  3GF5 A;  4C8Q C;  1VQP T;  2LW4 A;  2YWW A;  2FPE A;  3DTO A;  1M9S A;  5L8R E;  1VQ8 A;  2FZG B;  3VKI A;  1U5S A;  2FO0 A;  5LJ5 g;  2DXB A;  3SWN C;  4JPB W;  4FYW B;  5GMK e;  2F2V A;  3TSW A;  4L59 A;  1JKW A;  1KSW A;  1G3S A;  3OS1 A;  2I40 B;  4X9C A;  1R0C B;  2CP3 A;  2KXC A;  1Q95 G;  4OGR B;  5GAN d;  1TU0 B;  4BD3 A;  4BE1 A;  2DX1 A;  3CME T;  3PVQ A;  3TNI B;  1NJI U;  1CKB A;  1H26 B;  4PK4 A;  3CCV Q;  2HCK A;  3CC2 T;  3CCU Q;  3VYG B;  3QXE B;  1UNG D;  1VQK T;  5IXB A;  2XDD A;  4PJM A;  4PJL A;  4M7A B;  2VC8 A;  5EC7 A;  1RAF B;  1VYT A;  4AG1 C;  1RL2 A;  3D7S B;  5I5Z B;  3OW2 A;  1KIK A;  1VYV A;  4PKC C;  3GPL A;  2P0Q A;  2AKL A;  2EYW A;  4LUE A;  1CSK A;  4E2F B;  3RIR A;  1KD1 U;  2KT8 A;  4BI8 B;  4IUR A;  1OX9 A;  3M53 A;  2EJF A;  4MZM A;  4C92 E;  2KNB B;  4A54 A;  2FPD A;  4UC4 A;  2M0O A;  1M4Z A;  1Z9Q A;  3VRY A;  4C8Q F;  2QF7 A;  1OEB A;  2COZ A;  2EAY A;  1UTI A;  1VQN A;  3VS1 A;  1IHW A;  1E7O A;  1P92 A;  2XIC A;  4AFS C;  2IPO B;  3LW5 E;  4ELZ C;  3CMA A;  2EW3 A;  4QVZ A;  1AT1 B;  3URG A;  4XU0 A;  4FCY A;  2PHG A;  2E6Z A;  3QJY A;  2DBM A;  1R77 A;  1K1Z A;  1PSE A;  3N5B B;  1YI2 A;  4HA8 A;  5FW9 A;  1YJN T;  1AWX A;  2C5X B;  1QKW A;  3OYD A;  4J9H A;  2X3X D;  3GOX A;  3DLL A;  1KQ2 A;  1AVZ C;  1RAH B;  5GAM g;  1M90 C;  3JB9 F;  4BCN D;  1VA7 A;  5CKH A;  2MPX C;  4KH0 B;  3A98 A;  2RF0 A;  5GAN e;  3EOC B;  2PUK B;  2QGS A;  4AKH A;  2AIR B;  2E64 A;  4YOO A;  4AFU C;  4ROE A;  3RBB B;  1IB8 A;  2KAF A;  5GAO q;  2LNV A;  4D6W A;  1NLP C;  3NDQ A;  1B3Q A;  4E7Z A;  3FEO A;  5CQX A;  2HMA A;  4N4H A;  3EGX B;  4BCK B;  1ZUK A;  5GMK h;  3UWN A;  1SHF A;  1ENW A;  1AZE A;  1YHQ T;  3O0G D;  2QA4 A;  2EGC A;  5A2Q E;  2F2W A;  1VQ9 A;  2DD4 A;  2MWO A;  3G6E T;  2ENM A;  2X3W D;  3DB3 A;  3IQL A;  2SRC A;  2ECZ A;  3L2Z A;  3OMC A;  1H4L D;  2LCS A;  1WNL A;  4R0K A;  1VQ5 T;  2EQI A;  1SRM A;  2XDP A;  1U3O A;  5J26 A;  4FYX B;  5I2M A;  3JCM b;  2K2M A;  4F7U B;  3PIO A;  4EON B;  2O9V A;  5KE2 A;  1M3B A;  4FIB A;  4E7S A;  2IW9 B;  3QHW B;  2IN3 A;  1GH6 B;  1I5L A;  2V8K A;  2XDB A;  3MEV A;  1LCK A;  3CCR A;  1YIJ A;  3NTH A;  4JX6 A;  1K8A C;  3EID B;  2JS0 A;  5KYU B;  2ZPE B;  4PJO A;  2WMB B;  3FRN A;  3ZEH A;  2HZY A;  4EPC A;  3QHS A;  8ATC B;  3HSB A;  1YJW T;  1XO2 A;  2GTO A;  2QQB A;  2L89 A;  2V1Q A;  4KRT A;  3I9Q A;  2OAU A;  1YFN A;  3JV3 A;  1M1K U;  1GFD A;  5CYI B;  2XD0 A;  3KXT A;  3EAE A;  2L5Q A;  2DTI A;  2HL3 A;  3HRU A;  1S72 A;  1ZUU A;  1KK7 A;  1VQ8 Q;  3RMS A;  3CCS A;  2C0O A;  2LDM A;  5J3B A;  1FMV A;  2CP6 A;  4LDU A;  2KRN A;  1SSF A;  4F14 A;  4M77 A;  4E7J A;  3Q1J A;  4D8K A;  4MML A;  2QDL A;  3JCM d;  2EPD A;  5LJ5 f;  1Q7Y C;  4M7A E;  3H6Z A;  1UGQ B;  4BY7 X;  5GAN h;  1WHJ A;  2KK4 A;  3I56 T;  2K79 A;  3CCQ T;  4PJO G;  3PTA A;  1BCO A;  2XID A;  3BHU B;  4C8Q D;  1K76 A;  3HHT B;  1VQ7 A;  3LGF A;  2F1L A;  1BI2 A;  2BE7 D;  2C0I A;  4JS4 A;  1K73 U;  4PJO C;  3PGG A;  2PVG B;  3CPF A;  1MMA A;  1VYU A;  1HK9 A;  2XKO C;  1Q82 C;  1JEG A;  3RKX A;  3VS0 A;  3M0T A;  3QDF A;  4XU2 A;  1JBM A;  5KYX B;  4OMM A;  2CZ6 B;  3VYH B;  4JLI A;  4BE2 A;  3P8B B;  2A37 A;  2CUD A;  2MIO A;  4LE9 A;  1QMZ B;  4M77 G;  2DYI A;  2F5T X;  3CBO A;  2DEU A;  3JB9 D;  5I11 A;  3M55 A;  4C5H A;  2ZPH B;  4BCO B;  2KI7 A;  3O8V A;  4JUV A;  4EMH A;  3CMA Q;  4JJN K;  1WX6 A;  4RKU E;  1KC8 C;  4BY1 X;  4OR5 B;  3I5S A;  4M7D B;  3PVL A;  4M77 C;  1WHG A;  1GXI E;  4RG2 A;  2W9F A;  5HQ0 B;  2R7G A;  3TNH B;  1KFZ A;  1YI2 Q;  1QCN A;  2KMT A;  2P0K A;  2LQW A;  1WQ7 A;  4QVD A;  2PK2 A;  1I81 A;  3PT9 A;  5FRN A;  3M0P A;  2Y4X A;  2RA2 A;  3EG1 A;  3OW2 P;  5IDN B;  3MCA B;  2E5K A;  4J7I A;  4CFV B;  2C5O B;  3V8K A;  3G71 T;  3CEY A;  5IF1 B;  2PZ1 A;  2A3L A;  2W96 A;  1JQQ A;  4OF1 A;  3JCM e;  1QVF S;  1KQS S;  4FYV B;  1M5Q 1;  3OY9 A;  4ZGD B;  2AZS A;  3INZ A;  4ZTF A;  1Y0M A;  4Y92 A;  1H1R B;  4HNT A;  4O5V A;  1ZBX A;  5GAM f;  4EMK A;  1ZSG A;  3X25 B;  2G6F X;  4PJO F;  3I35 A;  5FLX E;  2K7A A;  2EQU A;  4HNU A;  1QVF A;  1KQS A;  1NPP A;  3OS2 A;  4PFO A;  4XK8 E;  4ELJ A;  4OVA A;  4EOP B;  4BCG B;  3UDC A;  1PSF A;  2OTJ Q;  1FKM A;  2DZC A;  1NBE B;  1B7T A;  3UAT A;  1TD6 A;  2LMJ A;  5CIU A;  4DEY A;  4X1V A;  3CCM T;  3CCL A;  3T9N A;  4OML A;  5IHN A;  5KYW B;  2QA4 Q;  2R5M A;  3G7Z A;  3MY1 B;  4M78 E;  3EHR A;  5IXF A;  3DL1 A;  1W1F A;  1K9M R;  1JO8 A;  3NMZ C;  4M77 F;  1UNH D;  4KGV B;  4F7U E;  1NE8 A;  3CCE A;  1UGP B;  2IIM A;  4NST B;  2MOX A;  2NUP B;  1D0Z A;  4OMF B;  2FRY A;  3E9G A;  2E41 A;  4JX5 A;  5GAN 7;  4F7J B;  3OBW A;  1OQK A;  2KDS A;  3JCM P;  1O9K B;  2L3Q A;  1K0S A;  1PC0 A;  2OX7 A;  4CC2 A;  3L2W A;  4QQD A;  3M0Q A;  1VQ4 A;  3X24 B;  4J6X A;  4LUD A;  1EFN A;  1OIY B;  2ZPF B;  3CCR Q;  2D9T A;  2B9R A;  1YIJ Q;  1NJI C;  1IGQ A;  1AHJ B;  3LLR A;  5ACB A;  1FXX A;  2CRE A;  2DME A;  2EUF A;  4BCF B;  1NYG A;  5I21 A;  3CCV A;  2VB6 A;  3CCU A;  3WVE B;  1MMN A;  4F7N B;  2A36 A;  1WFW A;  3LYI A;  1W6X A;  1G3W A;  2EYQ A;  2RJE A;  1ARK A;  2WEV B;  4OMN A;  1AWJ A;  5GAM j;  1BIA A;  2LZ6 B;  1ZSZ A;  4MFE A;  2KMG A;  2LX7 A;  2DRM A;  3M0U A;  4JRK A;  3CCS Q;  4BCJ B;  1XJW B;  2C4G B;  4ATO A;  2WPA B;  1VQN T;  5J39 A;  1UEB A;  2K9G A;  2RHZ A;  4IIM A;  1TOV A;  1UHF A;  3LX7 A;  3VS5 A;  4EOS B;  5IHY A;  5LJ3 h;  1H1S B;  3JCM h;  1AWW A;  3MY5 B;  1BIB A;  4BY6 B;  2E6N A;  1D1C A;  4X34 A;  3CPW P;  2KRM A;  1GBR A;  4C92 B;  4EOI B;  4HT8 A;  4FT2 A;  4ROC A;  1QVG S;  1WHL A;  2FYK A;  2DK3 A;  3X28 B;  2PU9 B;  3QUI A;  2QXF A;  2W99 A;  3X26 B;  3OYA A;  3CC4 Q;  2LQN A;  2PK9 B;  2EYX A;  1QVG A;  5C6S A;  3G33 B;  4BCM D;  3DJB A;  2ROL A;  1KXU A;  4LDW A;  1ABQ A;  2QAZ A;  3JB9 H;  2EFI A;  4RG8 A;  5KCO A;  1OOT A;  3GNF B;  1H3H A;  2QQS A;  4KH1 B;  4EMG A;  1J3T A;  4EOL B;  4TTH A;  4BCH B;  2JS2 A;  4RTZ A;  5LJ5 d;  1ZSZ C;  1VQL Q;  3V8L A;  1KD1 R;  4M7D E;  1V29 B;  1H28 B;  1NEB A;  4XTV A;  2DMO A;  2CT3 A;  1TXQ A;  5IDP B;  1SKU B;  3I55 T;  5IH2 A;  2G9X B;  1R8O B;  1JB0 E;  1LPL A;  2DL8 A;  3HFO A;  1OI1 A;  4PJN A;  1JJ2 A;  2CH4 A;  1H1P B;  5FWC A;  4QVC A;  1BB9 A;  2DTH A;  4CFM B;  4PJO D;  1WI7 A;  2X4X A;  1VIE A;  4J7F A;  1D3U B;  4PNO A;  1AZG B;  1U8R A;  1VQ9 T;  3JB9 J;  1R0B G;  2YDL A;  3V7S A;  2XG8 D;  3BE3 A;  2GBQ A;  1FVV B;  1YJ9 A;  2W0Z A;  1U1T A;  2JMA A;  2KYB A;  3C94 A;  1VQ6 T;  1GY3 B;  4DOV A;  1M27 C;  5L23 A;  1RI9 A;  3HKS A;  4BCQ B;  5CKE A;  4AG2 C;  4A4F A;  4C0D B;  4AMC A;  3G1J A;  5DLO A;  4LD6 A;  2YRC A;  1V1C A;  2FPF A;  1WA7 A;  2RHI A;  4M77 D;  1PKD B;  3VYG A;  2KT1 A;  2RJC A;  4YTL A;  4M7A A;  3H41 A;  4FYY B;  2QDY B;  2DPP B;  1E6H A;  1HJD A;  2DEQ A;  2PMI B;  1WHM A;  2IVW A;  5FU6 C;  3PFS A;  1M1F A;  3VS6 A;  1H24 B;  2EJ9 A;  2UUE B;  2BS3 A;  2F2C A;  4EOQ B;  1H92 A;  2D0Q B;  2V1R A;  2CS7 A;  1UJ0 A;  2R58 A;  3KUF A;  5LJ5 e;  3BFM A;  2I53 A;  3TU4 K;  3VUB A;  1M1K C;  1Q81 U;  2CT4 A;  3OS5 A;  1H25 B;  2QTV A;  1S72 T;  5GAM d;  1K4U S;  3CCE Q;  3MP6 A;  3CCS T;  2HQX A;  4B6M A;  1UGR B;  3MP8 A;  4LOC A;  2UZE B;  2W9Z A;  2CSQ A;  2LJ3 A;  2EGA A;  3QKJ A;  5GAO m;  2YRV A;  4Z6Y A;  5KCH A;  3C4S A;  1VQ4 Q;  1BKB A;  2RO0 A;  2XMF A;  1VQO A;  3JB9 G;  4ESR A;  4RCB A;  3S3M A;  3QSU A;  2G77 A;  2H8H A;  4Z89 A;  2YLC A;  1VQ7 T;  4KGX B;  2L3S A;  4BI4 A;  1PWT A;  5GAN 8;  1W4S A;  3M03 A;  2NUT B;  1H3Z A;  5HBJ B;  1K73 C;  5HNB B;  1GRI A;  3SFM A;  3SWN B;  3MKD A;  1ACM B;  2RB6 A;  2M02 A;  3M9Q A;  4ZN3 A;  2ZGW A;  1IHV A;  4KUI A;  2V26 A;  1FYN A;  3TSZ A;  4J6Y A;  1BI1 A;  4HXJ A;  1G8X A;  4CFX B;  4ZNX A;  1F5Q B;  2KR6 A;  2CDT A;  4OMQ A;  1Q86 R;  4XTW A;  3CC7 Q;  1N6A A;  3EG0 A;  5D6Y A;  3EGX A;  4F17 A;  1X2K A;  1ZA1 B;  1QP2 A;  1ZUY A;  1KQ1 A;  1YN8 A;  2JVV A;  2CSI A;  2RQT A;  1WJS A;  4ORZ A;  2DXT A;  4E7H A;  3F70 A;  1RAG B;  2A28 A;  2X51 A;  4FL6 A;  2O9S A;  5D6X A;  3RDV A;  2RI2 A;  2KRS A;  5CQY A;  3OYN A;  4CRL B;  3A8M B;  3BG5 A;  1N8R C;  3JCM J;  3KFV A;  1GCQ A;  5GAM e;  1MMG A;  1TG0 A;  2XI9 A;  3LH5 A;  1LJO A;  1YBY A;  5GAN 3;  2JTE A;  2M51 A;  2KY9 A;  5KYY B;  1OU8 A;  2P0P A;  4AT1 B;  1WPY A;  3H0I A;  5GAN 5;  4F7U A;  4BXX X;  1C9B A;  1TFB A;  4A53 A;  3QWL A;  4M7A F;  4IMY B;  3A1P A;  4FSS A;  3CXC S;  1C1A A;  4HCK A;  4M75 B;  2QEX Q;  4KT0 E;  3TEE A;  2WFY B;  1TUC A;  1TWB A;  2DJZ A;  4QW2 A;  3OYB A;  3HPW A;  4C5I A;  4CC4 B;  5LJ5 h;  4XU1 A;  2OJ2 A;  5KYU A;  5GAN 6;  3CXC A;  3VUZ A;  4RCC A;  4TVR A;  1URC B;  2YT6 A;  2HQH A;  4QQ6 A;  1TSF A;  1XTD A;  4OMP A;  3WXM B;  3E1S A;  2OTJ A;  2J6F A;  3QZ9 B;  3CCL T;  2LX9 A;  2QG9 B;  1MND A;  2X35 A;  1GL5 A;  3OB9 A;  3FB9 A;  3ZBD A;  1LVK A;  1Z9Z A;  4BCI B;  5IT9 E;  3EFO B;  2L3R A;  2MCN A;  3DDP B;  2M9U A;  1WHK A;  5D6W A;  4BDY A;  2MI6 A;  3QJ6 A;  4FT4 A;  1MNE A;  1K9A A;  3H0F A;  1UJY A;  1PRL C;  1GCQ C;  2RK1 A;  4CFU B;  4C0Z A;  1X01 A;  3EGU A;  1YJ9 Q;  2M16 A;  4DOW A;  1AWO A;  2LT1 A;  4WCI A;  5CK9 A;  5HY6 A;  4NC6 A;  4IKF A;  3S3O A;  2RHY A;  2EIF A;  2DL7 A;  4M78 B;  3QYB A;  5FRM A;  2K5I A;  3PMT A;  2HBW A;  1VQ4 T;  1OZ2 A;  1WXB A;  4XAX B;  5IHK A;  3CD6 A;  4P5N A;  3QO3 A;  1HD3 A;  3EG9 B;  3I5R A;  4ZTJ A;  1M90 R;  3UA7 A;  3BLR B;  2WSF E;  4CXA B;  3NFC A;  1JRI A;  2KVQ G;  3DB4 A;  1ABO A;  4OGE A;  1JJ2 P;  4YOS A;  3CCV T;  3OYH A;  2KEA A;  3CCU T;  1E6G A;  4EDU A;  3EGD B;  3BHV B;  3S3N A;  2CP5 A;  2QFZ A;  1GCP A;  5FU7 C;  2P4R A;  3AT1 B;  3TVT A;  5GAO p;  5KYX A;  1W70 A;  1VQM Q;  4DA4 A;  2F2X A;  3TW7 A;  4LDY A;  4JZ4 A;  3PNW C;  2OTL Q;  3M5A A;  3HL8 A;  2RN8 A;  2V22 B;  2WIH B;  3M56 A;  5CEI B;  2CP2 A;  2O2O A;  2VAS A;  1M3A A;  3OYM A;  2VGN A;  1B07 A;  1QVP A;  3GTM S;  4M7D A;  4J8O A;  1D0Y A;  2RI5 A;  4F7L B;  2HSP A;  3RES A;  3DKM A;  3AHU A;  4YC3 B;  2GFU A;  1B34 B;  2ABL A;  2M0Y A;  4BI3 A;  4FSX A;  1NPR A;  1RLQ C;  4ME7 A;  1VQO Q;  4HCZ A;  1MV0 B;  1WDX A;  4GLK A;  4F7U F;  1LOJ A;  2BTT A;  3V7C A;  2VYT A;  5A0L A;  1QLY A;  3H8Z A;  2UZL B;  1W2B P;  1LNX A;  1M2V B;  1RLP C;  5CCA A;  2BS2 A;  3CC4 A;  2E4H A;  2JXB A;  4DBR A;  4JLG A;  1KG1 A;  3SHW A;  2FZC B;  2BE9 B;  5GMK m;  2PVD B;  5EJC A;  1K8A R;  1JXM A;  3GBQ A;  1UGS B;  2DER A;  2UZB B;  2IG0 A;  4A4E A;  4HCB A;  2GTJ A;  2E65 A;  2CYZ B;  4CFN B;  2AHJ B;  2E12 A;  2NLU A;  2HL5 C;  1BBZ A;  4JRQ A;  2EVR A;  1QP3 A;  4M7D G;  4DQ2 A;  1VQL A;  2DO3 A;  4DEX A;  2CZ0 B;  2JW4 A;  4M7A D;  5KYW A;  2K57 A;  3QYG B;  1T3S A;  1D1B A;  2BUD A;  4Y91 A;  4E6R A;  4M7D C;  1FMK A;  1SG5 A;  2GNC A;  4E7K A;  2PVO B;  3FC3 A;  5KH6 A;  1UG1 A;  1IRX A;  1N8R U;  2NUP A;  3K7A M;  3QZ5 B;  4HVW A;  3A8G B;  3L2V A;  1Q7Y R;  1UE9 A;  4MFD A;  4M75 E;  3POM A;  4XTY A;  1O9S A;  3NGP A;  3REA B;  1TUG B;  1N4M A;  1PD0 A;  1X75 C;  3TCJ A;  1WJR A;  3OQ5 A;  1OPL A;  1O9K A;  4N0A A;  2RHX A;  3FJ5 A;  3M4Y A;  2JM9 A;  4IIO A;  1QQJ A;  5BNJ B;  3H0H A;  2PUO B;  3MJX A;  2EWN A;  5IN1 A;  3B57 A;  3EHQ A;  3BLH B;  1GUX B;  2RMO A;  2BIV A;  1ZP2 A;  2JN0 A;  1OKV B;  2WAC A;  1Q82 R;  1NYF A;  2HBP A;  4IUV A;  2HD0 A;  2HAX A;  2WJ9 A;  5KYN A;  1YJN A;  3CCJ A;  4EC8 B;  3SDZ A;  2HKN A;  1ZHI A;  4RMO A; 
#chains in the Genus database with same CATH homology
 1VQK T;  2XDD A;  5I2S A;  4LDX A;  4BBR M;  2G3R A;  4M7A B;  2VC8 A;  4A4K A;  3VKH A;  3LH0 A;  2DIQ A;  3HO8 A;  5LJ5 d;  3CPW A;  5GAM h;  1RL2 A;  3V8L A;  4M7D E;  1V29 B;  5HKC A;  3OW2 A;  3CC7 T;  5FRM A;  4XTV A;  4PKC C;  3GPL A;  2RJF A;  2P0Q A;  4Q5W A;  4M7D F;  1KD1 U;  3RIR A;  3I55 T;  5A0D A;  1HXD A;  4BI8 B;  4IUR A;  1R8O B;  1JB0 E;  3HFO A;  4AKG A;  1OI1 A;  1M1G A;  3M4G A;  1VUB A;  3M53 A;  2EJF A;  3BW1 A;  4MZM A;  4C92 E;  3OA6 A;  1Q81 C;  5LJ3 g;  1JJ2 A;  1KHI A;  5FU7 B;  4C8Q E;  3EFR A;  4A54 A;  3ZFJ A;  2VXF A;  3L1A A;  1IRE B;  4QVC A;  4UC4 A;  4BE0 A;  2DTH A;  2M0O A;  1M4Z A;  2PQW A;  4M78 F;  4OB3 B;  3QDR B;  4R55 A;  1VQ8 T;  2HNI A;  2X4X A;  5A0G A;  4CI0 C;  4PJO D;  2DXC B;  1VIE A;  4C8Q F;  2QF7 A;  1Q86 U;  4J7F A;  2R57 A;  2EAY A;  2VGM A;  4C92 A;  4PNO A;  3M54 A;  5GMK j;  1VQN A;  1U8R A;  2C06 A;  2D6F A;  1P92 A;  1BI3 A;  2LQ8 A;  2XIC A;  1VQ9 T;  3JB9 J;  2JUF A;  3LW5 E;  4ELZ C;  3CMA A;  3V7S A;  2XG8 D;  3HZJ A;  1YIT T;  5GAN f;  1VQP A;  4E7I A;  3BY7 A;  4QVZ A;  2RK2 A;  3URG A;  4C0G A;  4HT9 A;  4XU0 A;  1YJ9 A;  1U1T A;  2E6Z A;  2P4T A;  3C94 A;  2ZZD B;  3QJY A;  3A8O B;  2V8I A;  3FJP A;  2DD4 B;  3VKG A;  2DIG A;  2WSC E;  4L6V 5;  2LT4 A;  5LJ3 d;  1VQ6 T;  4DOV A;  1PSE A;  3N5B B;  3SD4 A;  1YI2 A;  4HA8 A;  4EMK C;  4MDX A;  4N4I A;  2FL7 A;  1YJN T;  4M6V A;  3HKS A;  2QEX T;  4XQ3 A;  5CKE A;  3HP9 A;  2WSE E;  1U1S A;  4QVD A;  1H64 1;  4A4F A;  4C0D B;  5DLO A;  4LD6 A;  4KUL A;  4M77 D;  3OYD A;  2RHI A;  2K5F A;  3HB9 A;  1WQW A;  4CRI A;  3VYG A;  3GOX A;  2RJC A;  3TRE A;  3DLL A;  1KQ2 A;  4KUD K;  2K5L A;  2XHC A;  4YTL A;  4FM4 B;  5GAM g;  2RD1 A;  3VJP A;  4M7A A;  1M90 C;  2QDY B;  2DPP B;  1VQ5 A;  3JB9 F;  3C12 A;  3VU3 C;  3CME A;  2QI2 A;  3QG1 A;  3FDR A;  4BB7 A;  4JS5 A;  3QYH B;  2DEQ A;  3ASK A;  3MEA A;  5CKH A;  3EFS A;  2IVW A;  2QQA A;  5FU6 C;  3CC2 A;  1E7P A;  3PFS A;  5GAN e;  1M1F A;  2PUK B;  1VQK A;  2CKK A;  3GIB A;  3RMQ A;  4C92 G;  3A8H B;  4AKH A;  2EJ9 A;  2BS3 A;  2B8A A;  2E64 A;  2F5K A;  2QQ9 A;  2D0Q B;  3JCM V;  1XOV A;  2CS7 A;  2MWP A;  2R58 A;  4PJO B;  5CVI A;  2KAF A;  5GAO q;  3CC7 A;  2LNV A;  3KUF A;  4D6W A;  5CR2 A;  4E47 A;  5CKF A;  5LJ5 e;  3BFM A;  3HBL A;  3FEO A;  1M8V A;  3TU4 K;  3VUB A;  5CQX A;  1M1K C;  2DXC A;  1Q81 U;  2MF2 A;  2X4Y A;  3OS5 A;  2YHT A;  4N4H A;  4C92 C;  5GMK i;  1S72 T;  5GAM d;  3CMA T;  3MP6 A;  5LL6 S;  5GMK h;  3UWN A;  3CCS T;  3S6W A;  1Y07 A;  2HQX A;  1TH7 A;  3CBP A;  1UGR B;  1YHQ T;  3RKW A;  3MP8 A;  5GAO n;  1YJ9 T;  4LOC A;  4WF2 A;  2QA4 A;  3JCM c;  3MP1 A;  3X20 B;  2YLB A;  4HKE A;  4QQG A;  4BDZ A;  4LD9 K;  2ZPI B;  3MET A;  5A2Q E;  4NS5 A;  2BS4 A;  1YI2 T;  5HK3 A;  4FU6 A;  2E1H A;  2ZZD A;  4KBM B;  4ELY C;  3QKJ A;  1VQ9 A;  5GAO m;  2DD4 A;  2MWO A;  2YRV A;  4OP0 A;  3G6E T;  3DB3 A;  4BAC A;  1K9M C;  5C0M A;  4Z6Y A;  5KCH A;  3C4S A;  1YIT A;  1BKB A;  2RO0 A;  4M77 B;  1VQO A;  3L2Z A;  3JB9 G;  3OMC A;  4RCB A;  2CZ1 B;  3S3M A;  2DXU A;  3QSU A;  2G77 A;  5GAN 4;  3JSC A;  2DAQ A;  1WNL A;  2CGH A;  2HQE A;  1VQ5 T;  2YLC A;  2BKD N;  2XDP A;  5GAN j;  1VQ7 T;  4XU3 A;  5J26 A;  5DLQ E;  5I2M A;  4BI4 A;  3JCM b;  4F7U B;  3C95 A;  3PIO A;  2I2L A;  3QYE A;  5KE2 A;  4BUG A;  1W4S A;  4FIB A;  5GAN 8;  2QEX A;  4GY5 A;  1H3Z A;  2FVU A;  1KHC A;  2JTF A;  2K4Y A;  4XTX A;  2Y4Y A;  5LJ3 e;  4HNV A;  3RER A;  1I5L A;  1K73 C;  1M90 U;  3CCQ A;  3SWN B;  2V8K A;  3SFM A;  5LJ5 j;  2XDB A;  3MEV A;  5CKB A;  3CCR A;  1VQM T;  1YIJ A;  1MHN A;  2LC4 A;  4M75 D;  2OTJ T;  3NTH A;  4JX6 A;  3BG9 A;  2RB6 A;  3PIP A;  4ZN3 A;  3M9Q A;  4C0F A;  2ZGW A;  1K8A C;  4KUI A;  2OTL T;  2ZPE B;  4J6Y A;  3JCM Q;  2M1H A;  4BBS M;  3QII A;  1BI1 A;  4PJO A;  4IUQ A;  2LVM A;  3FRN A;  3ZEH A;  1XQH A;  3L2R A;  4HCC A;  4EPC A;  3J7A F;  3QHS A;  3FLG A;  3HSB A;  2GF7 A;  2KR6 A;  1YJW T;  4XTW A;  1N6A A;  3JCM g;  4OB0 B;  5D6Y A;  2QQB A;  1QP2 A;  2L89 A;  3JAM E;  2RI3 A;  2QA4 T;  1KQ1 A;  2FB7 A;  2JVV A;  4C92 F;  2KQW A;  2MAM A;  3E19 A;  1WJS A;  3MEU A;  2OAU A;  1M1K U;  3ME9 A;  2DXT A;  4E7H A;  1G5V A;  2XD0 A;  3KBG A;  3KXT A;  3F70 A;  3MHX A;  3EAE A;  3SB2 A;  4JRP A;  4V2S A;  2L5Q A;  2DTI A;  4N0A C;  3OYG A;  5DY9 A;  2E70 A;  3HRU A;  4FL6 A;  5D6X A;  1S72 A;  3J80 E;  2RI2 A;  4B9W A;  3RMS A;  3CCS A;  2O4X B;  4QSH A;  2H3J A;  3ER0 A;  5CQY A;  3OYN A;  1VQO T;  2LDM A;  3A8M B;  3BG5 A;  1N8R C;  5J3B A;  2GCX A;  2DVE A;  3JCM J;  4LDU A;  1YHQ A;  3OSV A;  1SSF A;  2EQK A;  3CBM A;  5GAM e;  4M77 A;  4HLQ A;  2XI9 A;  3OSS C;  4E7J A;  3Q1J A;  1LJO A;  3OMG A;  2E5Q A;  4MML A;  3JCM d;  4C0D C;  1YBY A;  4HL4 A;  2LCL A;  5GAN 3;  3J81 E;  1MGQ A;  1Y96 B;  4MZT A;  3GP8 A;  1K9M U;  4M7D D;  1QLB A;  2KY9 A;  5LJ5 f;  1Q7Y C;  1IZ6 A;  4M7A E;  2L8D A;  3H6Z A;  1UGQ B;  2P0P A;  4LDV A;  3MO8 A;  3G6E A;  1WPY A;  1OYX A;  5GAN h;  5GAN 5;  4F7U A;  4NL2 A;  2KK4 A;  3I56 T;  2K2V A;  5GAN 2;  4A53 A;  3CCQ T;  3QWL A;  4M7A F;  4X9D A;  4M78 D;  4PJO G;  3PTA A;  3CCR T;  3CXC S;  2XID A;  1YIJ T;  4A4H A;  4M75 B;  4C8Q D;  2KSS A;  4KT0 E;  3P8H A;  3TEE A;  3HHT B;  1VQ7 A;  3LGF A;  3L42 A;  3SWN A;  2DJZ A;  4QW2 A;  3OYB A;  3HPW A;  4C5I A;  1BI2 A;  3OYC A;  5LJ5 h;  4JS4 A;  4XU1 A;  3RUX A;  4J6W A;  1FX7 A;  2EQJ A;  2GQV A;  5GAN 6;  1K73 U;  3CXC A;  3VUZ A;  4PL6 A;  4RCC A;  3S3O A;  4PJO C;  3PGG A;  2PVG B;  3CPF A;  3DLM A;  4TVR A;  1D3B B;  4EMK B;  2QQ8 A;  1HK9 A;  3P8D A;  4QQ6 A;  2XKO C;  1K8A U;  3JB9 I;  1Q82 C;  1VQM A;  1O75 A;  1XTD A;  3RKX A;  4Z02 A;  3WXM B;  5GAO l;  3E1S A;  4XU2 A;  2OTJ A;  1JBM A;  3QZ9 B;  1BI0 A;  3CCL T;  2LX9 A;  1N27 A;  2CZ6 B;  2X35 A;  2OTL A;  3JRZ A;  3VYH B;  4JLI A;  4BY6 C;  4JRI A;  3V7R A;  1EIF A;  4OB1 B;  1G3Y A;  3OB9 A;  3P8B B;  4BE2 A;  2LRQ A;  1N9S A;  4M77 G;  3FB9 A;  3ZBD A;  1YJW A;  4AI6 A;  2ZPB B;  5IT9 E;  2L3R A;  5LJ3 f;  1KD1 C;  2M9U A;  2F5T X;  5AYF A;  5D6W A;  4BDY A;  2A7Y A;  2MI6 A;  2DD5 B;  2O4X A;  3CBO A;  1G3T A;  2QDJ A;  1X6O A;  3QJ6 A;  4FT4 A;  4IUU A;  4C5E A;  4ZN1 A;  3JB9 D;  3M55 A;  4C5H A;  2ZPH B;  4JUV A;  3O8V A;  2X4W A;  4EMH A;  1DJ7 B;  2JOY A;  4JJN K;  3GNG A;  4RKU E;  4NL3 A;  1KC8 C;  4IUT A;  2RK1 A;  4M7D B;  4M77 C;  2QQR A;  4C0Z A;  1FWZ A;  1X01 A;  2M16 A;  2QTX A;  4M7A G;  1GXI E;  1OZ3 A;  4RG2 A;  4DOW A;  1Y96 A;  2LT1 A;  5CK9 A;  5HY6 A;  4NC6 A;  2DKG A;  4IKF A;  2CZ7 B;  2GFA A;  2K3X A;  2KMT A;  2E10 A;  2EIF A;  2P0K A;  2RHY A;  3QYB A;  1WQ7 A;  4M78 B;  4ZGJ B;  1ZQ1 A;  2K5I A;  1I81 A;  3PMT A;  3PT9 A;  4A4G A;  4C8Q B;  3CC4 T;  5FRN A;  2Y4X A;  1WJQ A;  1OZ2 A;  2RA2 A;  1VQ4 T;  4JX4 A;  4XAX B;  1Q7Y U;  3M57 A;  3CD6 A;  3MCA B;  4P5N A;  3QO3 A;  4PLI A;  4M7A C;  4ZTJ A;  4J7I A;  2K3Y A;  4M75 A;  2WSF E;  4AKI A;  3V8K A;  3G71 T;  3NFC A;  1JRI A;  3CEY A;  2RHU A;  2KVQ G;  2A3L A;  3I56 A;  3DB4 A;  4OGE A;  2FHD A;  4OF1 A;  3JCM e;  1QVF S;  1KQS S;  1M5Q 1;  4PJO E;  3CCV T;  3OY9 A;  3OYH A;  4L5G A;  4ZGD B;  3OYE A;  3GLX A;  3INZ A;  3CCU T;  4ZTF A;  2EJG A;  1D3B A;  4HNT A;  4O5V A;  1ZBX A;  5GAM f;  4EMK A;  4EDU A;  3X25 B;  4PJO F;  2VUB A;  1I8F A;  5FLX E;  3S3N A;  3M59 A;  2QFZ A;  4HNU A;  2EQU A;  5FU7 C;  1QVF A;  2XU8 A;  3G4S T;  1KQS A;  1VQL T;  1NPP A;  5GAO p;  4XK8 E;  3OS2 A;  4XTZ A;  4OB2 B;  4ELJ A;  2LQK A;  4OVA A;  3OW2 S;  4OGC A;  3UDC A;  1PSF A;  5FU6 B;  1FKM A;  3TW6 A;  5CO7 A;  4DA4 A;  1Q82 U;  3HRS A;  1Y7X A;  3VV0 A;  3TW7 A;  2DZC A;  4B9X A;  4LDY A;  1NZ9 A;  3PNW C;  2V8J A;  3M5A A;  3HL8 A;  3FIF A;  5CIU A;  3OBY A;  3M56 A;  1JJ2 S;  3CCM T;  3CCL A;  3MEW A;  2DTO A;  2DD5 A;  3OYJ A;  2ZCF B;  3T9N A;  3OYM A;  2VGN A;  2LCC A;  2RH2 A;  1UB4 A;  1QVP A;  4M77 E;  4NOY A;  2R5M A;  3G7Z A;  4J8O A;  4M7D A;  4MMK A;  4M78 E;  2RI5 A;  1WGS A;  3DL1 A;  5DM7 R;  4XTU A;  3UT1 A;  3RES A;  3DKM A;  4M75 G;  4M77 F;  2F69 A;  2GFU A;  2XK0 A;  3LWH A;  3AHU A;  3QPH A;  1B34 B;  2EQM A;  4PLL A;  5KE3 A;  5GMK l;  1KC8 U;  4F7U E;  1NE8 A;  4BI3 A;  2RJD A;  3CCE A;  4FSX A;  1UGP B;  1NPR A;  4JDS A;  3CD6 T;  4M78 A;  5LJ3 j;  3OYY A;  4OMF B;  4ME7 A;  4HCZ A;  4O6J A;  3E9G A;  3QBY A;  3R6O A;  4C8Q A;  4F7U F;  2E41 A;  4GLK A;  4JX5 A;  1LOJ A;  4ZGE B;  3LGL A;  4R56 A;  5GAO r;  5GAN 7;  3V7C A;  4M75 C;  3OBW A;  2VYT A;  5A0L A;  2KDS A;  5IAY A;  3JCM P;  3H8Z A;  4C92 D;  1LNX A;  5CCA A;  2BS2 A;  1BYM A;  3L2W A;  3CC4 A;  4II1 A;  2DXB B;  2VXE A;  4QQD A;  4JLG A;  1VQ4 A;  1KG1 A;  3X24 B;  1I4K 1;  4J6X A;  5M9O A;  3BG3 A;  3BDU A;  5GMK m;  2PVD B;  4J5Y A;  5EJC A;  3H4C A;  2ZPF B;  3JCM W;  3CCJ T;  3G71 A;  2D9T A;  1NJI C;  1AHJ B;  3WVD B;  3A8L B;  1UGS B;  4MIM A;  1QW1 A;  1FXX A;  3LLR A;  5CKD A;  3OYL A;  4Y28 E;  5I21 A;  1N9R A;  2IG0 A;  3CCV A;  4A4E A;  1YCY A;  4HCB A;  2E65 A;  3WVE B;  2CYZ B;  2LTO A;  3CCU A;  2AHJ B;  4E7L A;  2E12 A;  2NLU A;  3LYI A;  4JRQ A;  1G3W A;  1QP3 A;  3M58 A;  4M7D G;  3A5Z B;  2R5A A;  3LWI A;  2EYQ A;  1W2B S;  2RJE A;  4DQ2 A;  3OYK A;  3G4S A;  2DO3 A;  1VQL A;  1RI0 A;  2CZ0 B;  3V8J A;  3OS0 A;  5GAM j;  1BIA A;  4MDW A;  4M7A D;  3KHI A;  1Y71 A;  2K57 A;  4M78 G;  4MFE A;  2DZ9 A;  3QYG B;  2RM4 A;  2KMG A;  3JCM f;  3RKY A;  2BUD A;  3L2U A;  4C8Q G;  4Y91 A;  4MZP A;  1W2B A;  4M7D C;  3CCE T;  1VIF A;  4F7U G;  4JRK A;  2ZPG B;  3CCM A;  3JCM X;  2MMP A;  4ATO A;  4C5G A;  1B34 A;  1VQN T;  4E7K A;  2PVO B;  3FC3 A;  5CAI A;  5KH6 A;  2JZ2 A;  3HFN A;  1UEB A;  4J83 A;  5J39 A;  1Q86 C;  3NTI A;  2RHZ A;  1N8R U;  2X4J A;  3I55 A;  3LX7 A;  4M78 C;  3QZ5 B;  5GAN g;  3A8G B;  3GF5 A;  5LJ3 h;  4C8Q C;  3NTK A;  4MFD A;  3JCM h;  3L2V A;  4M75 E;  1VQP T;  1BIB A;  4XTY A;  4BY6 B;  1O9S A;  2E6N A;  4X34 A;  3TCJ A;  1X75 C;  4N4G A;  1WJR A;  3HRT A;  1M9S A;  5L8R E;  4C92 B;  3OQ5 A;  5EG2 A;  3PMI A;  1VQ8 A;  4HT8 A;  4FT2 A;  1QVG S;  4M75 F;  4N0A A;  2FYK A;  1XNI A;  2DK3 A;  2RHX A;  3VKI A;  4VUB A;  3M4Y A;  3L2Q A;  3X28 B;  2PU9 B;  2VV5 A;  2DXB A;  3QUI A;  5LJ5 g;  3SWN C;  2QXF A;  2PUO B;  3X26 B;  5HK0 A;  3OYA A;  5GMK e;  2EWN A;  5IN1 A;  2JTM A;  3UPU A;  4L59 A;  2Y90 A;  2O01 E;  1QVG A;  2BIV A;  1G3S A;  3OS1 A;  5C6S A;  4X9C A;  2JN0 A;  2JNG A;  5GAN d;  4LDW A;  2WAC A;  4BD3 A;  4BE1 A;  3E9F A;  3OYI A;  3CME T;  1VQ6 A;  3CPW S;  1NJI U;  3JB9 H;  3OYF A;  2HBP A;  4IUV A;  2EFI A;  2HD0 A;  2HAX A;  4RG8 A;  5KCO A;  2WJ9 A;  3GNF B;  4IUP A;  2QQS A;  3BDL A;  3CC2 T;  5FRO A;  4EMG A;  3CCJ A;  1YJN A;  3SDZ A;  2EKO A;  3VYG B;  1ZHI A;  4RMO A;  3QXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...