1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
2PUOB 4OB0B 2WSFE 2O01E 2ZPHB 2ZPGB 1AHJB 3QYGB 2ZZDA 3QZ9B 2DPPB 2CZ1B 2DXBB 3A8MB 2PU9B 2DD5B 3QZ5B 3VYHB 4OB1B 3A8OB 1DJ7B 3HHTB 2ZCFB 4KT0E 2DXCB 2AHJB 3X25B 1GXIE 3X24B 2PVDB 2ZPFB 3X28B 2DXBA 2DD5A 1IREB 3QXEB 2DXCA 3A8HB 4FM4B 1UGRB 2ZPIB 3VYGA 4ZGDB 2ZPBB 2QDYB 2WSEE 1V29B 4OB3B 1UGQB 3VYGB 3A8GB 4ZGJB 2D0QB 2PVOB 2CZ7B 4L6V5 2CZ6B 2ZPEB 2PVGB 1QP3A 3QYHB 3A8LB 3LW5E 1UGSB 1UGPB 3X26B 3X20B 1JB0E 1QP2A 2CZ0B 3WVDB 3WVEB 4ZGEB 4RKUE 5L8RE 2PUKB 1PSEA 2DD4A 2WSCE 4Y28E 4OB2B 1PSFA 2CYZB 2ZZDB 4XK8E 2DD4B
chains in the Genus database with same CATH superfamily
2F5KA 3CC4Q 2VXFA 3A1PA 3PE0A 2IN3A 3VS4A 3OYFA 4OGEA 4X34A 3PTAA 4EMHA 1JRIA 5DM7R 1PCXA 4RG2A 1R0BG 4J9EA 2DPPB 2CGHA 3JB9G 4FW1A 2QGSA 4OB1B 3S3MA 2YHTA 2MF2A 1CKAA 4PFOA 4E7SA 1RUWA 2E6NA 1Y96B 1X69A 5FRNA 4A4KA 1SSFA 1VQ4Q 1I5LA 1M3BA 1KC8C 4OMFB 1AVZC 3Q1JA 4M77C 3UWNA 2WMBB 3JAME 4AFSC 2LC4A 5FGKB 3SB2A 1VQPQ 4KUIA 2NLUA 3A8HB 2RD1A 2WXVB 2DVEA 3BY7A 4AKIA 2GQIA 2X3WD 3QO3A 1K4US 1KXUA 1WX6A 1V29B 4M7DA 4J8OA 1H1RB 4QW2A 4AFQC 4J83A 4N0AA 3OYHA 1UUEA 4ZGJB 4BE1A 2WJ9A 1TSFA 5EFQB 4KH0B 5LJ3d 4M77G 5C0MA 4BE0A 3MP8A 4DEXA 3UPUA 1QVPA 3I5SA 3H8ZA 1I07A 1B7TA 1KQ2A 4M75D 2JS0A 3G6EQ 5CEIB 4F6SB 3X20B 1YIJA 2X51A 1QVFA 4CFUB 2EYQA 2KY9A 1OL1B 2ED1A 1VIFA 1X6GA 3WVEB 4IURA 2K57A 1CKBA 5EC7A 4F7JB 5HQ0B 1KQSS 1QLYA 3H0IA 4LXCA 4QQGA 5C6SA 4M77B 3RR6A 1YJNA 1G3SA 1OX8A 2D9TA 4EMGA 4Z89A 3VU3C 2F1LA 3CCRA 3M5AA 2HQEA 1NEGA 4XK8E 3BLHB 4OB0B 2J06A 3OMCA 4HT8A 3CQTA 3CCLT 4M75C 3RNJA 1HSQA 3IQLA 1I1JA 4AI6A 1VQ6A 4OMNA 5IHIA 4II1A 1GRIA 1ZSGA 2JTMA 5GAMg 3THKA 1Q86C 2HBPA 3MP6A 1FWZA 1NZ9A 3QJ6A 4IIMA 4EOQB 2KYBA 2I40B 1Y57A 2KR6A 3T9NA 2ESWA 1M90C 2V1RA 2DL3A 5KYUB 5KE2A 2KT1A 2CP6A 5CKFA 4FT2A 3OW2S 2E70A 3CPWA 2HL3A 1FXXA 1VQ5A 3JB9F 2DXBA 2ENMA 5FWCA 3HFOA 2KNBB 1W98B 2JTFA 1SPKA 1IREB 4HCZA 1RAFB 1WQWA 2OX7A 4HNVA 4MMLA 5CVIA 2R5MA 2OTJQ 3CCUA 3H0HA 1OU9A 2X4XA 3TNWB 4M7DD 1FX7A 2VGNA 3BHUB 1WHGA 1IRXA 1AOJA 1UG1A 5HNBB 3NHNA 3QG1A 4F70B 1QCFA 2PVOB 2K2MA 5D6YA 1JKWA 2CZ7B 4M75B 2X3XD 3RKXA 4J9IA 3OYEA 3CMEQ 1QP3A 3CCSQ 3I56T 3QYHB 1LJOA 2DMEA 2M0OA 4E7IA 1GY3B 1WA7A 2RI5A 1UGPB 5J26A 1YI2T 2W10A 4YOSA 4JJCA 1XO2A 5A0DA 3MY5B 1Q81U 1H4LD 3H41A 2E5QA 2A08A 1P5EB 3BHVB 3S6WA 2UZBB 2DETA 3EIDB 4M77F 3GTMS 1KK7A 4JUVA 2LJ1A 4MIMA 3SHWA 3KUFA 3VKHA 2C0TA 2KROA 1K8AC 1ACMB 2KE9A 1SEMA 2RHYA 1YJWQ 1VQ9T 1KD1C 4Z02A 3UT1A 1NEBA 1Q82C 1VQ8T 1GCQA 4JRQA 2K3XA 4F7SB 1QLBA 1SF9A 3DLMA 3ZL7C 1RI9A 2L0AA 4DOVA 4LUEA 1K1ZA 4PLLA 2CUBA 3RDVA 1BK2A 4XU1A 3CCVA 1K73C 4B6MA 1T0HA 4KT0E 1HYOA 2WFYB 3ZEHA 5GAOp 3X25B 5GAN5 4EC9B 4EOLB 4J6WA 2YUOA 2EKHA 2RJEA 4RCBA 3HL8A 2W96A 4PNOA 5GMKm 1KQSP 1YITA 1K0SA 1TUDA 1BCMA 3FJ5A 3CCET 2LQKA 3BG5A 1O9KB 2EQIA 2P4TA 1EFNA 1OZ3A 1YJNQ 2AZSA 3OBWA 1M1FA 1U1TA 1ARKA 3MEUA 3OA6A 1VQPT 4BCPB 1WYXA 2LQ8A 4BCND 3LGLA 1VQLT 1ZUYA 2L3PA 2ATCB 5BNJB 4M75F 1MV3A 3ZBDA 1ENWA 2DK3A 3MJXA 4C8QC 1ZSZC 1KC8U 2DLPA 1U8RA 4OVAA 3ASKA 1VIEA 4KUDK 1C1AA 3DB4A 4HCBA 4XTZA 2E5KA 2A7YA 2QQRA 3JV3A 3NTHA 4EC8B 2EYZA 5GAN7 2YRVA 2X9HA 1TD6A 5LJ5j 3OB9A 4PJLA 4JX5A 2YLCA 4VUBA 2DZCA 4LN2A 1BIAA 1T0JA 2A37A 1M1GA 3GNFB 3LWIA 4MFEA 2ROTA 2EFIA 1X2QA 4C8QG 5GAOl 4X9DA 4C92A 2JW4A 3TSZA 1YFNA 2CCHB 3B57A 3OBYA 3F70A 3M0QA 2BS4A 4M7AE 5HK0A 4IUPA 4N4GA 3M03A 4BXXX 3RIRA 1WNLA 1GUXA 1PD0A 1T3SA 1FYNA 1M1KR 4FX3B 4ZN3A 3JCMW 4JX6A 4CC3A 2DXBB 4HNUA 1UNGD 1ZUKA 2QQSA 3QWXX 4MZTA 1KSWA 5DQVA 4IUTA 2X4WA 2DYIA 2BTTA 5CIUA 3OYBA 3CC7A 5GAOn 1KQ1A 2FPFA 2LNVA 2QYZA 1H92A 4M7AG 2CT3A 4HXJA 1R0CB 4BBRM 2DKGA 1GCQC 4O6JA 3M58A 3NTIA 1WHLA 2YT6A 4IIOA 2UZDB 3RGFB 2P4RA 1Q86U 3PVQA 5CQXA 3S3NA 4BCOB 4WF2A 1BI3A 2YRDA 3ULRB 1AEYA 5LQFB 4BB7A 2ZAEA 2XK0A 4CC4B 1UGQB 2VASA 5EG2A 2QXFA 2DAQA 3GF5A 4YOZA 2QAZA 1WPYA 1H25B 3OMGA 4EDUA 4D6WA 1NPPA 3I55A 2PVGB 1JJ2S 2RJCA 2J6FA 1GBRA 5IDPB 4F16A 3CCST 3LW5E 3CBPA 2QFZA 4BCMB 5LJ5d 3OS5A 2BE7D 3PGGA 1M4ZA 2RA2A 3MHXA 3ZFJA 1VOLA 2HL5C 3REAB 2RJFA 4JRPA 2I2LA 4C92D 1UNHD 1YWOA 8AT1B 1WJQA 3G71A 1AWWA 3EG9B 3UA6A 2LRQA 4C5GA 1S72A 2K5LA 2FO0A 3VKIA 3JCMe 2BE9B 1M30A 1MGQA 2VC8A 3JSCA 2PJQA 5GANf 1YJWT 3TNIB 2WSFE 3SD4A 1GBQA 4OGRB 5KCOA 2EJGA 2M51A 4C8QF 3CCMA 1UECA 2RN8A 2EQUA 2DYBA 3HKSA 3EFOA 3CXCS 2SRCA 4XTYA 1ZX6A 3H4CA 2DRMA 2DL7A 2CJMB 3FDRA 1YHQA 3EGXB 1W1FA 2J6OA 1S1NA 1JSTB 2DE0X 2K6DA 1YIJT 3CCLQ 5GAMj 5GMKj 1Q82U 2VWFA 1ZBXA 3FEOA 2LT1A 1VYUA 4BCFB 3UF4A 2H3JA 4XTWA 4OP0A 2JS2A 2H8HA 4E7LA 1WFWA 1EIFA 4X1VA 3QDFA 1YJNT 3PIOA 4FM4B 1KIKA 5DQWA 2E4HA 4J9BA 1K73U 4HKEA 4JS5A 4NL3A 2DXTA 3CCRT 5DLOA 2LVMA 1RAHB 1VQKA 2XDPA 3VS3A 1KJWA 1TTHB 4LDYA 2CZ6B 2BZXA 4ELJA 2ZPEB 3MEVA 1VQ6T 2PK2A 3MI9B 1FINB 2MWOA 1AISB 4FCYA 2FL7A 3CEYA 4EOSB 4HVUA 1YWPA 2DXUA 4L59A 2LP5A 4C92B 1H27B 1AD5A 1M2VA 1R8OB 3JCMV 1JO8A 2DL8A 3MPUB 3R6OA 1O75A 3M4YA 2XDBA 5FWBA 3QKJA 2X4JA 2GNCA 3CMAA 1PC0A 3BE3A 1VQ5T 1VQOA 1V76A 2FZCB 3A5ZB 1JOWA 1YI2Q 2XKOC 1GUXB 1VOMA 4F7LB 3CCUT 1VQ7A 4EOPB 2E12A 2WEVB 3H0FA 5D6XA 4N4HA 2MWPA 2M1HA 2BS3A 3CC2A 1QW1A 4F6WB 2HKNA 4LNPA 3C12A 2HAXA 3UDCA 4EMKC 4EOMB 4DBHA 3C4SA 4BY1X 4OMMA 4F17A 3VS7A 5FU6C 1IHVA 4BY7X 2A0FB 2PQWA 4GY5A 1JJ2P 3FIFA 3HO8A 2YUNA 2W9ZA 4M78C 1SHGA 2PU9B 4OMLA 2FRYA 1G3WA 3NMZC 2AIRB 1VQ9Q 3RBBB 1D0YA 1VQ8Q 2RB6A 5GAMd 1M8MA 1OV3A 3P8HA 3PT9A 1Q7YC 4K11A 4HL4A 4JZ4A 1AT1B 2KEAA 1Y7XA 2COYA 3QIIA 1WJRA 2HZYA 5GAN2 4QKUA 2JJ9A 1N9SA 2L3RA 1AWJA 2KXDA 3FLGA 1HD3A 3ME9A 3DTOA 2E64A 1X43A 2OTLA 2C5NB 5IHNA 3E9FA 1XTDA 4M78G 3AT1B 1D09B 4NL2A 4CC7A 5I21A 3AHUA 2DILA 5CR2A 4EMKB 1YBYA 2F2VA 2KT8A 2QASA 1UDLA 3CCEQ 4PJOD 3CXCP 2LQNA 5FU6B 3EJ1B 1GL5A 3DDPB 4M77E 1I4K1 3TREA 4M78B 3CCVT 1RAIB 4X9CA 1W6XA 2HBWA 1JSUB 2DX1A 3M0TA 4E47A 2B86A 1VQLQ 2FZGB 2UZLB 1WHHA 4RG8A 4OGCA 4ZGEB 3BDUA 3OYKA 3OSVA 2E3HA 2EWNA 2PTKA 4F7UA 1UNLD 3HFNA 2PK9B 4RKUE 1YJ9A 4BDZA 2PHGA 2HCKA 2RMOA 2LDMA 3OYCA 3F5XB 1U06A 2ECZA 2WSCE 1YITT 3HB9A 4OB2B 1ZA2B 1PSFA 2HEQA 2KI7A 3EFOB 4PJOC 1H1PB 2SEMA 2UZEB 2GFAA 2C5OB 2XMFA 5KCHA 1K9MU 3DJBA 3JCMg 2X4YA 2O2OA 4UC4A 1TUCA 4E6RA 1ZQ1A 5HKCA 3DB3A 2EYXA 2WIPB 1JXOA 4WCIA 2L2PA 1PNJA 4YOOA 2CZ1B 1OQKA 4HT9A 4R55A 1Y0MA 2D8HA 1QVGS 1D3BA 2K7AA 3EHQA 2G9XB 1OI1A 3CCJA 1K9MR 1Q95G 2Z0WA 4ELZC 4BD3A 3O5ZA 4CRLB 3DKMA 1U3OA 1UTIA 4KGVB 4M75E 3S3OA 3VS2A 2KMGA 2O4XB 3RUXA 4A54A 1UGRB 2ZPIB 5CKBA 3VYGA 4BCIB 5LL6S 2A28A 5GANe 2DMOA 2AZVA 4PJOB 1W2BS 4ELYC 3CC2Q 1VQMQ 5ICPB 2RH2A 1C9BA 4B9WA 2D0QB 2DFUA 1E7PA 2P84A 2CKKA 4ME7A 4R0KA 3VS1A 1BI2A 4M75G 4M78F 5GAN8 3QJYA 1Z9ZA 2O9VA 1OKVB 2L89A 1KG1A 3VS6A 3OS0A 1C0MA 2WACA 1ABQA 3BDLA 5IDNB 5M9OA 2BKDN 1H28B 5GAN3 4Y91A 4CXAB 1B34A 3CC7T 2L3SA 3J80E 2AT1B 1IHWA 2FG0A 4A63B 4Y92A 4JJDA 2OI3A 2DA9A 1WI7A 1GH6B 4F14A 2HKQB 2QQAA 4BI8B 3QHRB 3JCMJ 2EGEA 2KR3A 2QEXA 1CSKA 2RQTA 8ATCB 2M0YA 3I35A 2NUTA 2YRCA 2YLBA 5LJ5h 4PLIA 1OPKA 4XTUA 3SDZA 2A36A 4MZMA 2EQJA 4M7DC 2LT4A 4N0AC 1JJ2A 1EZZB 2OAUA 5FRMA 2ZZDA 5I22A 3QBYA 2D1XA 1E9HB 3SFMA 2JXBA 4HA8A 3EH1A 3G4SA 3I55T 2K79A 2VYTA 4KGXB 3E9GA 1OKWB 2EW3A 3MCAB 2HSPA 3QHWB 2D0NA 2JT4A 4QT7A 3KFVA 4XU3A 1N8RU 4JLGA 1Q81R 3KXTA 4M7DG 1NJIC 1N4MA 4ANJA 3H9NA 4IUQA 1ZLMA 1WXBA 4DBRA 3JRZA 4PJOF 5I11A 5L23A 3G71T 3FJPA 2DTOA 1S72T 1YIJQ 2E3IA 2QQ8A 4AT1B 2E65A 1MMDA 4BUGA 2QDJA 3CXCA 3OS2A 3JCMQ 1RABB 4B9XA 4NSTB 4CFNB 1OU8A 3CCMT 4M7DB 4PFZA 1N8RR 4F7UB 3NDQA 4CI0C 3VRZA 3V8LA 2DNUA 1E7OA 3X26B 3CCRQ 3L42A 1WJSA 4OMPA 2VB6A 4BCQD 3VKGA 5CQYA 2QTVA 2K4YA 1QVGP 2RJDA 2VXEA 3D7SB 5HY6A 2MI6A 2C6TB 1VQ6Q 4CFMB 2BKZB 2LX9A 2QGGA 1MUZA 1QMZB 4L5GA 4C8QE 1BCOA 4RCCA 2Y4XA 5LJ3f 1JQQA 1P92A 5IH2A 2NUZA 1MNEA 2EIFA 3M0PA 4XTXA 3CBMA 4E7HA 1W2BP 1QVFS 3PFSA 3GLXA 5GMKl 2ZPHB 2RK2A 2RI3A 3M0UA 2QA4A 1BBZA 3OW2P 3OYJA 4QVZA 4LDUA 1VQ5Q 1AHJB 2MIOA 1TH7A 1G83A 2KK4A 3JCMh 1XQHA 1KC8R 3J81E 2VKNA 1VYWB 3CCUQ 2VGMA 1AD6A 4P5NA 3QDRB 1GXIE 3EGDA 3N5BB 4E7ZA 3EOCB 2RHUA 4LDXA 2DZ9A 3C95A 2HQXA 2EGCA 2YUQA 4YC3B 2OAWA 4J7FA 2W99A 4JRKA 3CMAT 2DXCA 4Z88A 2ED0A 1VQOT 1QCNA 2DF6A 2MYSA 4MZPA 4PK4A 3CCQA 1ZP2A 2C0OA 1FKMA 5GAMh 2QDYB 2WSEE 5CK9A 1VQ7T 5GMKh 2XDDA 1MV0B 2XHCA 1NM7A 5GANg 3CC2T 2P0QA 2W0ZA 2B9RA 4M7DF 7AT1B 1N5ZA 1VQMT 4F7UF 3L2VA 3CPWS 1F5QB 1VQNA 4CFVB 4J9HA 4CFXB 4BCNB 1FMVA 4BCQB 2O9SA 3BLQB 4FSSA 2YDLA 2C5VB 3E19A 2XG8D 2LCLA 1MMNA 1BKBA 1GCPA 1UB4A 3U23A 1H8KA 3EFRA 1M90U 3LH5A 2CZ0B 3GOXA 2NUTB 4OF1A 1FMKA 1X6BA 2CSQA 4AFZC 1D1CA 1IGQA 4D8DA 4ZTFA 5EJCA 1TWBA 2WHBB 2PUKB 3EH2A 2DD4A 4A53A 2JZ2A 4J6XA 4RUGA 3CCVQ 4V2SA 3GNGA 4EOIB 2LJ0A 4RTVA 1KFZA 2ZZDB 1YP5A 3FB9A 1K9AA 2OTLT 3TNHB 1Q86R 3M55A 5CAIA 2I0NA 3K7AM 2AKKA 2G77A 3EG1A 4C0GA 4KRTA 1SKUB 3BG3A 3GBQA 1RADB 2KAFA 1M90R 4MMKA 4HLQA 2ZPGB 2IIMA 4RTUA 1YITQ 4M4ZA 2JM8A 4TVRA 1N9RA 4ROCA 3URGA 2HSEB 1D1AA 5CO7A 3BG9A 2L3QA 4XTVA 3CC4A 2ZCFB 4RTXA 1PM3A 3GP8A 3E2UA 3PMIA 1OIUB 3RMSA 2EUFA 3X24B 2MK5A 1W4SA 2C4GB 2FYKA 3LQ5B 4GLKA 5KYXA 4AG2C 5CCAA 3TW6A 4R56A 1YJ9T 2H3EB 1J3TA 1PKTA 5GJWB 3OYIA 4DBFA 1K8AU 4C92C 1VQ4A 3VJPA 2JMCA 1FVVB 1KD1U 1TS9A 4JS4A 2LMJA 2EGAA 1KQSA 2GGRA 3L2ZA 2QA4Q 3FC3A 1Y07A 2DBKA 4IUUA 1D1BA 1M27C 2AK5A 4MDWA 5J39A 1OZ2A 4JDSA 2RNAA 2FRWA 2DRKA 2JMAA 3NFCA 3C94A 4YTLA 2ROLA 5J3BA 5HCKA 4M77A 3WVDB 3OYLA 2QDLA 2Y90A 2J7IA 1K8AR 2DBMA 4C92G 3LYIA 3P8DA 1KD1R 4KGZB 4HNTA 1QCOA 4PJMA 3MP1A 1Q82R 3CCJT 2WPAB 1D0ZA 2R5AA 3G6EA 1U5SA 2VVKA 1I5OB 2LCSA 4FIBA 1AWOA 3EGUA 3OYAA 3CC7Q 5A0GA 1UEBA 2B8AA 3OW2A 2JOYA 5DLQE 3LGFA 4WTOB 1K73R 4HVVA 2NWMA 2CSIA 3DLLA 1F1BB 1MMGA 4OMQA 4ZNXA 4C0DC 4Z8AA 4KULA 3QZ9B 1X01A 4J9GA 2RHZA 3A8MB 3JCMd 3M4GA 2KXCA 1SSHA 3WXMB 3JB9D 4QQ6A 2DXCB 4QSHA 3GPLA 1LPLA 1N6AA 1PRMC 3HRSA 1RLQC 5KE3A 4CC2A 2QQ9A 1PRLC 2MMPA 4M6VA 2KSSA 2RQUA 1A0NB 3OYYA 2CCIB 1TXQA 1QKWA 2DD5A 1VYVA 2MPXC 4GLMA 3V8KA 1JBMA 3I55Q 3UA7A 2D8JA 3V8JA 3EFSA 3HP9A 5LJ3e 2QGFB 1AZEA 4LD9K 2R57A 2EQKA 3J7AF 2DTIA 2ZGWA 2FPEA 2DO3A 4M78E 5KYNA 1LCKA 1G8XA 1YN8A 4FYVB 5IXFA 1X6OA 3SWNA 1LVKA 1OYXA 1C6VX 2KDSA 5I2SA 2OTJA 3KBGA 1WHJA 4C0DB 4LDWA 1AZGB 3A8LB 4AKGA 2RK1A 3G71Q 1O9SA 3QSUA 4F04B 2LW4A 4M77D 2V22B 3G4ST 4BDYA 1S72Q 4BCGB 4IKFA 3POMA 2RQWA 2DL5A 2F69A 4BE2A 5HBEB 3UATA 3LLRA 4I3ZB 2KGTA 3V7SA 2AKLA 1LNXA 2D6FA 1RAGB 5GMKi 4FYWB 3CPFA 3TQ7P 1SG5A 3PNWC 3CCMQ 2DJQA 3CMEA 1RACB 2O88A 2EYWA 3CCSA 4FL6A 3VS5A 3CBOA 1HXDA 3OSSC 2CYZB 1WIEA 2HD0A 1IGUA 4BI4A 3HRTA 3M9QA 4C92F 1YHQQ 1NYGA 4BCKB 2LCCA 4PL6A 2GF7A 4FU6A 5LJ5f 4MDXA 4XU2A 1TG0A 1G3YA 1ZUUA 3OYGA 2LX7A 5KYXB 3LH0A 2JM9A 1UE9A 3BW1A 1YJWA 2CP5A 4BCJB 1D0XA 1OX9A 2AHJB 1M1KC 1O9KA 2DM1A 3EG0A 1I0CA 1IO6A 3RMQA 1VQKQ 1UHCA 4PJOE 2F5TX 2EPDA 5IT9E 3QWYA 2GQVA 1X75C 1Z9QA 3M54A 3M57A 2YXYA 4FW2A 1OI9B 3V7CA 1E6HA 1Y71A 2JGZB 2JN0A 3L1AA 2QG9B 5KYYA 4FSXA 2NYSA 1QWFA 3OYDA 1H641 3ER0A 2MOXA 4PJOG 1JEGA 4NS5A 1H3HA 3PVLA 2YWWA 3E1SA 4FYXB 2QA4T 4L6V5 1YNZA 1PKSA 2KRNA 4JPBW 1NE8A 3I9QA 3CMAQ 2RI2A 4A4EA 1BB9A 1BI0A 3JCMc 1VQOQ 2KYMA 2IW6B 4RTYA 5GANj 1UGSB 2DEQA 2BUDA 3LX7A 3JCMb 2Y4YA 1VQ7Q 1H24B 4MFDA 2FEIA 1M3AA 1OULA 1UFFA 1HK9A 5ECAA 5KYWA 2GTOA 2DTHA 1JXMA 5L8RE 2RF0A 3SWNC 5IF1B 2IG0A 4C0FA 1M2VB 5IXBA 1OIYB 9ATCB 5AT1B 2KQWA 4CFWB 4PFPA 2FPDA 4Z6YA 2PUOB 1WDXA 4C8QA 1ZSZA 4J7IA 3I5RA 3VUZA 3OS1A 2NUPA 3NPFA 3CCQT 3QPHA 4J5YA 1WHMA 4RTZA 3L2RA 4O5VA 1W70A 1BI1A 3BLRB 3QYGB 4AFUC 2CP7A 2K2VA 2PZ1A 3RESA 2CP3A 4D8KA 4J9CA 1VQNT 2DD5B 1OOTA 2COZA 3JB9I 2RHIA 3JCMf 2OTLQ 6AT1B 2X35A 2GCXA 2YSQA 2V8IA 5D7UA 1RL2A 2K3BA 4XU0A 3CD6A 3X28B 2HQHA 5DY9A 1M2OA 1G5VA 2PMIB 2CREA 2CUDA 1WXUA 4EPCA 2J05A 1VUBA 3SWNB 4M7AA 4JJNK 4M7DE 2KRMA 2XU8A 4F7UE 3M53A 3BFMA 4C5IA 4HCKA 2LNHB 1XJWB 1OL2B 3MY1B 1T3LA 5LJ3g 3L2QA 4PJNA 3A8GB 1NPRA 3G33B 2LQWA 4J6YA 5GAMf 4RMOA 3P8BB 3EG2A 1YJ9Q 1KHCA 4J9DA 2EAYA 2A3LA 4J9FA 2DEUA 1G2BA 2RO0A 4HVWA 5GANd 4F7UG 3MO8A 2E41A 2G6FX 3PMTA 4PJJA 2GBQA 2XD0A 2XI9A 4Q5WA 4LD6A 2CH4W 2VV5A 2BIVA 3CC4T 3GIBA 2KVQG 2V1QA 2CP0A 1Q7YU 1I81A 2DL4A 3EG9A 2BPMB 4N4IA 1QMCA 4EOJB 1QWEA 2QTXA 5GAOq 1PKDB 3M59A 3HTRA 4EOOB 3REBB 4C8QD 1X2KA 4E7KA 2L5QA 2EJFA 1YHQT 2O01E 2P0PA 4C0ZA 1BYMA 3OYNA 5CKEA 3TW7A 5I5ZB 2BZYA 1VQ4T 3M56A 1NG2A 4JRIA 4ORZA 2ABLA 4KBMB 1X27A 5AYFA 3CCJQ 1QKXA 5IHKA 1M3CA 2WMAB 1Q7YR 3EGXA 3QYBA 3JCMX 5IN1A 1UJYA 2F2CA 4ELLA 1TFBA 3QZ5B 5HK3A 2EBPA 5GAOm 4KRCB 5FW9A 2XICA 3NTKA 2P0KA 5KYYB 3MKDA 1WLPB 1RAEB 2O31A 2IVWA 1JU5C 4RODA 1VQKT 5HBHB 4M7AD 2L8DA 3HSBA 5GJVB 4GBQA 4LOCA 1D3BB 3TEEA 2E10A 2DVJA 4LE9A 1EX4A 2CP2A 2UUEB 4A4FA 4NC6A 4BY6C 3G6ET 2G3RA 4FYYB 4DA4A 3CCLA 1OGUB 1N27A 3M0SA 3VS0A 2KRSA 3C0CA 5FROA 4BCMD 5LJ5e 3LWHA 3VYGB 1IB8A 4AMCA 1M1KU 2EVRA 2M02A 3DOGB 3HPWA 5HBJB 4TTHA 4JLIA 2R7GA 2CDTA 1B07A 5FLXE 4EORB 1BIBA 4AG1C 2KMTA 4FT4A 3VRYA 2QQBA 5KYWB 2EJ9A 3G1JA 5HVYB 1E6GA 3L2WA 4M7AC 3DDQB 1SRLA 2QEXQ 1KHIA 2MCNA 1JB0E 2C0IA 4ROEA 4F7NB 2RPNA 3OY9A 2RQVA 1V1CA 1NBEB 5GAN4 2FVUA 4CRIA 3BHTB 3TVTA 3CD6Q 3HZJA 2K5FA 1B34B 2FZKB 2HNIA 4C8QB 1ZSZB 2NUPB 1PSEA 5CKDA 4Y28E 3G7ZA 1RI0A 2K5IA 4ESRA 1UJ0A 1HJDA 1XOVA 4AKHA 2RM4A 5CKHA 3G4SQ 2RQRA 3M0RA 5LMKB 3HRUA 2FB7A 5I2MA 4BY6B 5L2WB 1M8VA 1ZBJA 1ZHIA 1TUGB 2GFUA 1PWTA 2J6KA 4XAXB 4DBQA 4LUDA 1GFCA 3TSWA 4E7JA 1K0XA 1H26B 3I56A 1WHKA 2C5XB 4C5HA 3QUIA 1BU2A 1MHNA 2CT4A 2MAMA 3TN8B 3QWLA 1YI2A 2YUPA 2OTJT 4F6UB 1VA7A 3A98A 5D6WA 1DJ7B 3HHTB 1UHFA 4M7AB 1NLOC 2HMAA 4NOYA 4IMYB 5GAOr 2IVXA 3VV0A 4HCCA 2IPOB 2ZPFB 2DIGA 1IZ6A 4QQDA 3TU4K 1MNDA 3VUBA 1XNIA 2QI2A 5IAYA 4ZTJA 2VUBA 2COWA 1YCSB 3CMET 2DERA 1Y96A 1M9SA 5FU7C 2EKOA 1VQ9A 2RHXA 4ZGDB 5CYIB 2JTEA 1VQ8A 2F2WA 4EMKA 1K9MC 3MEWA 1QQJA 3RKYA 4C5EA 1BU1A 3INZA 1WGSA 4JZ3A 1PD1A 2DIQA 1PHTA 2PNIA 1H1QB 1MMAA 4M78A 5IHYA 5LJ3h 2EQMA 1WQ7A 3PO3S 2XIDA 4EONB 4IUVA 4KRDB 1QP2A 2WIHB 1QVFP 4PKCC 5A2QE 3V7RA 4EOKB 2GTJA 3CCEA 3SEMA 3RERA 3DL1A 4DOWA 4C92E 2I53A 3JCMP 1VQPA 3H6ZA 3O0GD 2K3YA 1NYFA 4BCHB 4JJBA 1NJIU 1D3UB 5FU7B 1ZA1B 5KH6A 1VQLA 1H1SB 1SRMA 1WZOA 4QVDA 1PG5B 3NGPA 3JB9H 1QVGA 2M16A 3TCJA 4XQ3A 5GAMe 4KH1B 5GMKe 2E1HA 1B3QA 1VYTA 2JNGA 3MEAA 1WXTA 1I8FA 1SHFA 2BS2A 3R6NA 3EG3A 2LJ3A 4M7AF 3VYHB 1URCB 1OEBA 4DQ2A 3A8OB 2LTOA 1W2BA 3CCQQ 1NJIR 1FMWA 2PVDB 4BI3A 3MIAB 1RLPC 1AWXA 4RTTA 2E6ZA 2IW8B 2QF7A 4DEYA 1H3ZA 5GAN6 4A4GA 2IW9B 2O4XA 3CPWP 3QYEA 4EIKA 1M5Q1 3EGDB 1VQNQ 4A4HA 3QXEB 1GFDA 5KYUA 3JB9J 4PJOA 2X1NB 3META 3L2UA 2F2XA 1TU0B 2JVVA 1U1SA 4JX4A 4Y72B 3HBLA 1LOJA 1G3NC 1OPLA 2ZPBB 1Q81C 3KHIA 1TOVA 4UN0A 2DJZA 4RTWA 4OB3B 3PIPA 1VINA 4M78D 5ACBA 3FRNA 1G3TA 3QHSA 5A0LA 4LDVA 4BACA 2W9FA 2HDAA 1K76A 5LJ5g 3I56Q 1IXDA 2V8KA 2QK0A 5LJ3j 2KBTA 2JUFA 2M9UA 2CH4A 2K9GA 4E2FB 2LZ6B 2BZ8A 1UGVA 2EYYA 2QEXT 1R77A 4BBSM 4M75A 3RKWA 1VQMA 1N8RC 2V8JA 1RAAB 4ATOA 2R58A 2OJ2A 1ABOA 4OMOA 3OYMA 4CFUD 3EHRA 3O8VA 3CD6T 3EAEA 2C06A 3OQ5A 4G6LB 4ZN1A 1NLPC 2W2HA 4II5B 4OR5B 1YCYA 2CS7A 5GANh 4QVCA 2DD4B 2FHDA 2V26A
chains in the Genus database with same CATH topology
2F5KA 2PUOB 3CBMA 4E7HA 1YJWT 1QVFS 2VXFA 3PFSA 2WSFE 3GLXA 3SD4A 4J7IA 3VUZA 4C8QA 2ZPHB 5GMKl 2RK2A 3OS1A 2RI3A 5KCOA 2EJGA 3OYFA 3QPHA 4J5YA 4OGEA 4X34A 4C8QF 2QA4A 3CCMA 3OYJA 3L2RA 2EQUA 4O5VA 4QVZA 3PTAA 3HKSA 1BI1A 4LDUA 4EMHA 1JRIA 5DM7R 1AHJB 3QYGB 3CXCS 4RG2A 2K2VA 3RESA 1TH7A 2DPPB 4XTYA 2KK4A 2CGHA 3JCMh 1VQNT 1XQHA 3J81E 3H4CA 3JB9G 2DD5B 2VGMA 3JB9I 4OB1B 3FDRA 2YHTA 3S3MA 2MF2A 2RHIA 1YHQA 3JCMf 2X35A 2GCXA 2E6NA 1Y96B 4P5NA 5FRNA 2V8IA 3QDRB 4A4KA 1YIJT 1GXIE 5GAMj 1RL2A 1SSFA 1I5LA 5GMKj 1Q82U 3N5BB 1ZBXA 1KC8C 3FEOA 4XU0A 3CD6A 3X28B 2LT1A 4OMFB 2RHUA 4LDXA 4M77C 3Q1JA 5DY9A 2H3JA 4XTWA 2DZ9A 4OP0A 3C95A 1G5VA 3UWNA 2HQXA 4E7LA 3JAME 1EIFA 4JRKA 4J7FA 4EPCA 2LC4A 3CMAT 2DXCA 3SB2A 1VUBA 3SWNB 4KUIA 2NLUA 4M7AA 1YJNT 3PIOA 4JJNK 3A8HB 1VQOT 4M7DE 4FM4B 2RD1A 2XU8A 2DVEA 3BY7A 4MZPA 4AKIA 4HKEA 4F7UE 3M53A 3BFMA 3QO3A 4JS5A 1K73U 4C5IA 4NL3A 3CCQA 2DXTA 3CCRT 1FKMA 5GAMh 5LJ3g 2QDYB 2WSEE 5CK9A 5DLOA 1V29B 1VQ7T 5GMKh 2XDDA 3L2QA 2LVMA 4M7DA 4J8OA 4QW2A 2XHCA 1VQKA 4J83A 4N0AA 3A8GB 5GANg 1NPRA 2P0QA 3OYHA 4ZGJB 3CC2T 4M7DF 4J6YA 4BE1A 5GAMf 2XDPA 4RMOA 1VQMT 3P8BB 4F7UF 3L2VA 2WJ9A 3CPWS 4LDYA 2CZ6B 1KHCA 1VQNA 4ELJA 2ZPEB 2EAYA 2A3LA 3MEVA 1VQ6T 5LJ3d 4M77G 5C0MA 4BE0A 2MWOA 2RO0A 3MP8A 5GANd 1QVPA 4F7UG 3UPUA 3H8ZA 3MO8A 4XTXA 4M75D 2E41A 1KQ2A 3PMTA 3E19A 3X20B 2FL7A 2XG8D 3CEYA 1YIJA 2XD0A 2LCLA 1QVFA 2EYQA 2XI9A 2KY9A 4Q5WA 2DXUA 1BKBA 4LD6A 1UB4A 4L59A 3EFRA 1VIFA 2VV5A 2BIVA 3CC4T 1M90U 4C92B 3GIBA 2CZ0B 3WVEB 2KVQG 4IURA 2K57A 1R8OB 3JCMV 3GOXA 4OF1A 3R6OA 1O75A 3M4YA 1I81A 1Q7YU 2XDBA 1KQSS 4ZTFA 3QKJA 2X4JA 5EJCA 3CMAA 2PUKB 4N4IA 4QQGA 4M77B 5C6SA 2QTXA 5GAOq 2DD4A 1YJNA 1N8RC 1G3SA 1VQ5T 4A53A 1VQOA 3M59A 2JZ2A 2D9TA 4J6XA 3A5ZB 4EMGA 3VU3C 2XKOC 3GNGA 4V2SA 4C8QD 3M5AA 2HQEA 3CCRA 3CCUT 2ZZDB 4XK8E 1VQ7A 2E12A 3FB9A 5D6XA 4N4HA 2MWPA 4E7KA 2OTLT 2L5QA 4OB0B 3M55A 2M1HA 2BS3A 3OMCA 1QW1A 2EJFA 5CAIA 3CC2A 1YHQT 4HT8A 2G77A 2O01E 2P0PA 3C12A 4C0ZA 3UDCA 4C0GA 3OYNA 5CKEA 4EMKC 3TW7A 3CCLT 1BYMA 1VQ4T 4M75C 3BG3A 3M56A 4AI6A 1VQ6A 2KAFA 3C4SA 4JRIA 4MMKA 4KBMB 4HLQA 2ZPGB 5AYFA 4II1A 5FU6C 2JTMA 2PQWA 4GY5A 5GAMg 1Q86C 3FIFA 2HBPA 3HO8A 3MP6A 4TVRA 3QYBA 1FWZA 1N9RA 1NZ9A 3QJ6A 5IN1A 3JCMX 4M78C 2PU9B 3URGA 3QZ5B 5HK3A 5CO7A 1G3WA 3BG9A 2KR6A 3T9NA 4XTVA 5GAOm 2ZCFB 3GP8A 1M90C 3CC4A 3PMIA 5KE2A 3RMSA 3OYLA 2RB6A 5GAMd 2XICA 3X24B 3NTKA 3P8HA 2P0KA 3PT9A 5CKFA 1Q7YC 4FT2A 4HL4A 1W4SA 3OW2S 2E70A 1Y7XA 2FYKA 3CPWA 4GLKA 1VQ5A 1FXXA 2IVWA 1WJRA 3QIIA 3JB9F 2DXBA 3HFOA 5CCAA 3TW6A 4R56A 2L8DA 5GAN2 1VQKT 4M7AD 1YJ9T 2JTFA 3HSBA 1IREB 1N9SA 4HCZA 1WQWA 2L3RA 4HNVA 4LOCA 4MMLA 5CVIA 2R5MA 1D3BB 3FLGA 3CCUA 3TEEA 2E10A 3ME9A 2E64A 2X4XA 4A4FA 2OTLA 4M7DD 4NC6A 4BY6C 3G6ET 3E9FA 1FX7A 1XTDA 2G3RA 4M78G 2VGNA 3OYIA 1K8AU 4C92C 4DA4A 3CCLA 1VQ4A 1N27A 3VJPA 4NL2A 1KD1U 5FROA 3QG1A 5I21A 5LJ5e 3VYGB 3LWHA 4JS4A 1M1KU 3HPWA 1KQSA 3L2ZA 3AHUA 3FC3A 1Y07A 4JLIA 5CR2A 2PVOB 4EMKB 1YBYA 5D6YA 5FLXE 4M75B 2CZ7B 4IUUA 4PJOD 3RKXA 1BIBA 2KMTA 4FT4A 2QQBA 3OYEA 1QP3A 3I56T 2EJ9A 3QYHB 1LJOA 2M0OA 5FU6B 4MDWA 4M77E 5J39A 1OZ2A 4JDSA 3L2WA 4E7IA 1I4K1 3TREA 2RI5A 4M78B 1UGPB 5J26A 3CCVT 1YI2T 4M7AC 4X9CA 1KHIA 3NFCA 3C94A 1JB0E 4YTLA 4E47A 5A0DA 5J3BA 3OY9A 1Q81U 2E5QA 4M77A 4OGCA 3WVDB 4ZGEB 3BDUA 4RG8A 3OYKA 2Y90A 3OSVA 2EWNA 3S6WA 5GAN4 2FVUA 4CRIA 4F7UA 3HFNA 4C92G 4M77F 4RKUE 4BDZA 1YJ9A 3HZJA 2K5FA 1B34B 2HNIA 3LYIA 3P8DA 4C8QB 4JUVA 2LDMA 4MIMA 3OYCA 4HNTA 1PSEA 3MP1A 5CKDA 3CCJT 2WSCE 1YITT 4Y28E 3HB9A 3G7ZA 1RI0A 2K5IA 2R5AA 4OB2B 3KUFA 3VKHA 1PSFA 1XOVA 4AKHA 3G6EA 2RM4A 5CKHA 1K8AC 4PJOC 2RHYA 1VQ9T 4FIBA 3HRUA 2FB7A 1KD1C 3OYAA 4Z02A 5I2MA 3UT1A 4BY6B 2GFAA 5A0GA 1M8VA 1UEBA 1Q82C 2B8AA 5KCHA 2JOYA 1ZHIA 5DLQE 3OW2A 1VQ8T 3LGFA 2K3XA 4JRQA 1K9MU 3JCMg 2GFUA 2X4YA 1QLBA 4UC4A 4XAXB 3DLLA 3DLMA 1ZQ1A 5HKCA 3DB3A 4E7JA 3I56A 4C0DC 4C5HA 4DOVA 4KULA 3QUIA 3QZ9B 1MHNA 4PLLA 1X01A 2MAMA 4XU1A 3QWLA 2RHZA 2CZ1B 3CCVA 1YI2A 3A8MB 4HT9A 3JCMd 2OTJT 1K73C 3M4GA 5D6WA 1DJ7B 3WXMB 3HHTB 4KT0E 3JB9D 4QQ6A 2DXCB 4QSHA 3ZEHA 5GAOp 4R55A 3GPLA 4M7AB 1N6AA 3X25B 5GAN5 4NOYA 3HRSA 5GAOr 4J6WA 5KE3A 3VV0A 2QQ9A 1QVGS 4HCCA 2MMPA 2RJEA 4M6VA 2KSSA 2ZPFB 1D3BA 1IZ6A 2DIGA 3HL8A 3OYYA 4PNOA 4QQDA 4RCBA 5GMKm 3TU4K 1OI1A 3CCJA 2HAXA 1YITA 3VUBA 2DD5A 1XNIA 4ELZC 3CCET 2LQKA 3BG5A 2QI2A 2P4TA 5IAYA 1OZ3A 2VUBA 3V8KA 4BD3A 4ZTJA 3OBWA 3CMET 1JBMA 1M1FA 3DKMA 4M75E 1Y96A 1M9SA 3V8JA 1U1TA 5FU7C 2EKOA 3S3OA 3EFSA 3HP9A 5LJ3e 2KMGA 2O4XB 3RUXA 3OA6A 4A54A 1VQPT 1UGRB 2ZPIB 2RHXA 5CKBA 4ZGDB 3VYGA 5LL6S 4LD9K 2LQ8A 2R57A 2EQKA 5GANe 1VQ8A 3J7AF 2DTIA 2ZGWA 4EMKA 3LGLA 1K9MC 4PJOB 1W2BS 3MEWA 3RKYA 4C5EA 3CCQT 4ELYC 2DO3A 1VQLT 4M78E 3INZA 1WGSA 4M75F 3ZBDA 2RH2A 1X6OA 4B9WA 2D0QB 2DIQA 2DK3A 4C8QC 1E7PA 3SWNA 1KC8U 2CKKA 5GANf 1U8RA 4ME7A 1OYXA 4OVAA 3ASKA 4M78A 1VIEA 5LJ3h 2KDSA 2EQMA 1BI2A 5I2SA 1VQ9A 4M75G 4KUDK 2OTJA 4HCBA 3DB4A 3KBGA 4M78F 4C0DB 5GAN8 3QJYA 4LDWA 4XTZA 2A7YA 3A8LB 4AKGA 2L89A 2QQRA 1O9SA 2RK1A 3NTHA 3QSUA 1KG1A 3OS0A 1WQ7A 2WACA 4M77D 3BDLA 5GAN7 3G4ST 2XIDA 5M9OA 4BDYA 2BKDN 5GAN3 2YRVA 4IUVA 4Y91A 4IKFA 1B34A 1QP2A 2F69A 5LJ5j 3OB9A 4BE2A 3CC7T 3LLRA 4PKCC 5A2QE 4JX5A 2YLCA 3J80E 3V7SA 4VUBA 1LNXA 2DZCA 3V7RA 2D6FA 5GMKi 1BIAA 3CCEA 3RERA 3CPFA 3DL1A 3PNWC 4DOWA 1M1GA 4C92E 3GNFB 3CMEA 3LWIA 3JCMP 4MFEA 3CCSA 2EFIA 4FL6A 2QQAA 3CBOA 1HXDA 4C8QG 1VQPA 3H6ZA 4BI8B 5GAOl 3OSSC 4X9DA 2CYZB 3JCMJ 2K3YA 2QEXA 2HD0A 1NJIU 4C92A 4BI4A 3HRTA 5FU7B 5KH6A 1VQLA 3M9QA 4C92F 2YLBA 5LJ5h 4PLIA 4QVDA 4XTUA 3OBYA 3JB9H 3SDZA 1QVGA 4MZMA 2LCCA 3F70A 4PL6A 2EQJA 2M16A 2GF7A 4FU6A 3TCJA 4XQ3A 5GAMe 5LJ5f 2BS4A 4M7AE 4MDXA 5GMKe 4M7DC 5HK0A 4XU2A 2E1HA 2LT4A 4IUPA 4N0AC 4N4GA 3JSCA 1JJ2A 2JNGA 3MEAA 1G3YA 2OAUA 3RIRA 1WNLA 3OYGA 1I8FA 2ZZDA 5FRMA 4ZN3A 3QBYA 3JCMW 4JX6A 2BS2A 3SFMA 2DXBB 4HNUA 3LH0A 4HA8A 3G4SA 3I55T 2QQSA 4MZTA 3BW1A 1YJWA 4M7AF 3VYHB 2VYTA 4DQ2A 3E9GA 2X4WA 4IUTA 3A8OB 5CIUA 2LTOA 3OYBA 3CC7A 1W2BA 2AHJB 3MCAB 5GAOn 1KQ1A 2LNVA 1M1KC 2PVDB 4BI3A 4M7AG 3RMQA 4XU3A 1N8RU 4BBRM 2DKGA 4PJOE 2F5TX 4JLGA 2E6ZA 2QF7A 1H3ZA 5IT9E 4O6JA 4A4GA 5GAN6 2O4XA 2GQVA 3M58A 3NTIA 1X75C 3KXTA 3M54A 3M57A 3QYEA 1M5Q1 3V7CA 4A4HA 4M7DG 3QXEB 1NJIC 3JB9J 4PJOA 1Y71A 1Q86U 3META 4IUQA 3L2UA 5CQXA 2JVVA 1U1SA 2JN0A 3JRZA 4PJOF 3G71T 4JX4A 3L1AA 3S3NA 3FJPA 4FSXA 2DTOA 3HBLA 1LOJA 4WF2A 1Q81C 2ZPBB 1BI3A 3KHIA 1S72T 2DJZA 3OYDA 4BB7A 4OB3B 2QQ8A 1H641 2XK0A 1UGQB 3ER0A 4M78D 4PJOG 3PIPA 4NS5A 2E65A 3FRNA 5EG2A 1G3TA 3QHSA 2QXFA 5A0LA 2DAQA 4BUGA 3GF5A 2QDJA 3E1SA 4LDVA 3CXCA 4BACA 3OS2A 2QA4T 4L6V5 3JCMQ 1WPYA 4B9XA 3CCMT 5LJ5g 4M7DB 3OMGA 4EDUA 1NE8A 1NPPA 4D6WA 2PVGB 2RI2A 2RJCA 4F7UB 3I55A 1JJ2S 2V8KA 4A4EA 5LJ3j 4CI0C 1BI0A 3JCMc 3CCST 3LW5E 3CBPA 2JUFA 2QFZA 2M9UA 3V8LA 1UGSB 2DEQA 5GANj 3X26B 2BUDA 3LX7A 3JCMb 2Y4YA 3L42A 5LJ5d 2QEXT 1WJSA 4MFDA 3VKGA 3OS5A 4BBSM 3PGGA 4M75A 3RKWA 1M4ZA 5CQYA 1VQMA 2V8JA 2RA2A 3MHXA 2K4YA 2R58A 3ZFJA 4ATOA 3OYMA 1HK9A 2RJDA 2DTHA 2VXEA 5HY6A 2RJFA 4JRPA 2MI6A 3O8VA 5L8RE 3CD6T 3EAEA 2I2LA 2IG0A 3SWNC 4C92D 2C06A 3OQ5A 4C0FA 2LX9A 1WJQA 4ZN1A 3G71A 5GANh 2CS7A 4L5GA 1YCYA 4C8QE 4RCCA 2LRQA 2KQWA 2Y4XA 4QVCA 4C5GA 5LJ3f 1S72A 2K5LA 1P92A 2DD4B 2FHDA 3VKIA 3JCMe 3MEUA 2EIFA 4Z6YA 1MGQA 2VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUO B;  4OB0 B;  2WSF E;  2O01 E;  2ZPH B;  2ZPG B;  1AHJ B;  3QYG B;  2ZZD A;  3QZ9 B;  2DPP B;  2CZ1 B;  2DXB B;  3A8M B;  2PU9 B;  2DD5 B;  3QZ5 B;  3VYH B;  4OB1 B;  3A8O B;  1DJ7 B;  3HHT B;  2ZCF B;  4KT0 E;  2DXC B;  2AHJ B;  3X25 B;  1GXI E;  3X24 B;  2PVD B;  2ZPF B;  3X28 B;  2DXB A;  2DD5 A;  1IRE B;  3QXE B;  2DXC A;  3A8H B;  4FM4 B;  1UGR B;  2ZPI B;  3VYG A;  4ZGD B;  2ZPB B;  2QDY B;  2WSE E;  1V29 B;  4OB3 B;  1UGQ B;  3VYG B;  3A8G B;  4ZGJ B;  2D0Q B;  2PVO B;  2CZ7 B;  4L6V 5;  2CZ6 B;  2ZPE B;  2PVG B;  1QP3 A;  3QYH B;  3A8L B;  3LW5 E;  1UGS B;  1UGP B;  3X26 B;  3X20 B;  1JB0 E;  1QP2 A;  2CZ0 B;  3WVD B;  3WVE B;  4ZGE B;  4RKU E;  5L8R E;  2PUK B;  1PSE A;  2DD4 A;  2WSC E;  4Y28 E;  4OB2 B;  1PSF A;  2CYZ B;  2ZZD B;  4XK8 E;  2DD4 B; 
#chains in the Genus database with same CATH topology
 2F5K A;  3CC4 Q;  2VXF A;  3A1P A;  3PE0 A;  2IN3 A;  3VS4 A;  3OYF A;  4OGE A;  4X34 A;  3PTA A;  4EMH A;  1JRI A;  5DM7 R;  1PCX A;  4RG2 A;  1R0B G;  4J9E A;  2DPP B;  2CGH A;  3JB9 G;  4FW1 A;  2QGS A;  4OB1 B;  3S3M A;  2YHT A;  2MF2 A;  1CKA A;  4PFO A;  4E7S A;  1RUW A;  2E6N A;  1Y96 B;  1X69 A;  5FRN A;  4A4K A;  1SSF A;  1VQ4 Q;  1I5L A;  1M3B A;  1KC8 C;  4OMF B;  1AVZ C;  3Q1J A;  4M77 C;  3UWN A;  2WMB B;  3JAM E;  4AFS C;  2LC4 A;  5FGK B;  3SB2 A;  1VQP Q;  4KUI A;  2NLU A;  3A8H B;  2RD1 A;  2WXV B;  2DVE A;  3BY7 A;  4AKI A;  2GQI A;  2X3W D;  3QO3 A;  1K4U S;  1KXU A;  1WX6 A;  1V29 B;  4M7D A;  4J8O A;  1H1R B;  4QW2 A;  4AFQ C;  4J83 A;  4N0A A;  3OYH A;  1UUE A;  4ZGJ B;  4BE1 A;  2WJ9 A;  1TSF A;  5EFQ B;  4KH0 B;  5LJ3 d;  4M77 G;  5C0M A;  4BE0 A;  3MP8 A;  4DEX A;  3UPU A;  1QVP A;  3I5S A;  3H8Z A;  1I07 A;  1B7T A;  1KQ2 A;  4M75 D;  2JS0 A;  3G6E Q;  5CEI B;  4F6S B;  3X20 B;  1YIJ A;  2X51 A;  1QVF A;  4CFU B;  2EYQ A;  2KY9 A;  1OL1 B;  2ED1 A;  1VIF A;  1X6G A;  3WVE B;  4IUR A;  2K57 A;  1CKB A;  5EC7 A;  4F7J B;  5HQ0 B;  1KQS S;  1QLY A;  3H0I A;  4LXC A;  4QQG A;  5C6S A;  4M77 B;  3RR6 A;  1YJN A;  1G3S A;  1OX8 A;  2D9T A;  4EMG A;  4Z89 A;  3VU3 C;  2F1L A;  3CCR A;  3M5A A;  2HQE A;  1NEG A;  4XK8 E;  3BLH B;  4OB0 B;  2J06 A;  3OMC A;  4HT8 A;  3CQT A;  3CCL T;  4M75 C;  3RNJ A;  1HSQ A;  3IQL A;  1I1J A;  4AI6 A;  1VQ6 A;  4OMN A;  5IHI A;  4II1 A;  1GRI A;  1ZSG A;  2JTM A;  5GAM g;  3THK A;  1Q86 C;  2HBP A;  3MP6 A;  1FWZ A;  1NZ9 A;  3QJ6 A;  4IIM A;  4EOQ B;  2KYB A;  2I40 B;  1Y57 A;  2KR6 A;  3T9N A;  2ESW A;  1M90 C;  2V1R A;  2DL3 A;  5KYU B;  5KE2 A;  2KT1 A;  2CP6 A;  5CKF A;  4FT2 A;  3OW2 S;  2E70 A;  3CPW A;  2HL3 A;  1FXX A;  1VQ5 A;  3JB9 F;  2DXB A;  2ENM A;  5FWC A;  3HFO A;  2KNB B;  1W98 B;  2JTF A;  1SPK A;  1IRE B;  4HCZ A;  1RAF B;  1WQW A;  2OX7 A;  4HNV A;  4MML A;  5CVI A;  2R5M A;  2OTJ Q;  3CCU A;  3H0H A;  1OU9 A;  2X4X A;  3TNW B;  4M7D D;  1FX7 A;  2VGN A;  3BHU B;  1WHG A;  1IRX A;  1AOJ A;  1UG1 A;  5HNB B;  3NHN A;  3QG1 A;  4F70 B;  1QCF A;  2PVO B;  2K2M A;  5D6Y A;  1JKW A;  2CZ7 B;  4M75 B;  2X3X D;  3RKX A;  4J9I A;  3OYE A;  3CME Q;  1QP3 A;  3CCS Q;  3I56 T;  3QYH B;  1LJO A;  2DME A;  2M0O A;  4E7I A;  1GY3 B;  1WA7 A;  2RI5 A;  1UGP B;  5J26 A;  1YI2 T;  2W10 A;  4YOS A;  4JJC A;  1XO2 A;  5A0D A;  3MY5 B;  1Q81 U;  1H4L D;  3H41 A;  2E5Q A;  2A08 A;  1P5E B;  3BHV B;  3S6W A;  2UZB B;  2DET A;  3EID B;  4M77 F;  3GTM S;  1KK7 A;  4JUV A;  2LJ1 A;  4MIM A;  3SHW A;  3KUF A;  3VKH A;  2C0T A;  2KRO A;  1K8A C;  1ACM B;  2KE9 A;  1SEM A;  2RHY A;  1YJW Q;  1VQ9 T;  1KD1 C;  4Z02 A;  3UT1 A;  1NEB A;  1Q82 C;  1VQ8 T;  1GCQ A;  4JRQ A;  2K3X A;  4F7S B;  1QLB A;  1SF9 A;  3DLM A;  3ZL7 C;  1RI9 A;  2L0A A;  4DOV A;  4LUE A;  1K1Z A;  4PLL A;  2CUB A;  3RDV A;  1BK2 A;  4XU1 A;  3CCV A;  1K73 C;  4B6M A;  1T0H A;  4KT0 E;  1HYO A;  2WFY B;  3ZEH A;  5GAO p;  3X25 B;  5GAN 5;  4EC9 B;  4EOL B;  4J6W A;  2YUO A;  2EKH A;  2RJE A;  4RCB A;  3HL8 A;  2W96 A;  4PNO A;  5GMK m;  1KQS P;  1YIT A;  1K0S A;  1TUD A;  1BCM A;  3FJ5 A;  3CCE T;  2LQK A;  3BG5 A;  1O9K B;  2EQI A;  2P4T A;  1EFN A;  1OZ3 A;  1YJN Q;  2AZS A;  3OBW A;  1M1F A;  1U1T A;  1ARK A;  3MEU A;  3OA6 A;  1VQP T;  4BCP B;  1WYX A;  2LQ8 A;  4BCN D;  3LGL A;  1VQL T;  1ZUY A;  2L3P A;  2ATC B;  5BNJ B;  4M75 F;  1MV3 A;  3ZBD A;  1ENW A;  2DK3 A;  3MJX A;  4C8Q C;  1ZSZ C;  1KC8 U;  2DLP A;  1U8R A;  4OVA A;  3ASK A;  1VIE A;  4KUD K;  1C1A A;  3DB4 A;  4HCB A;  4XTZ A;  2E5K A;  2A7Y A;  2QQR A;  3JV3 A;  3NTH A;  4EC8 B;  2EYZ A;  5GAN 7;  2YRV A;  2X9H A;  1TD6 A;  5LJ5 j;  3OB9 A;  4PJL A;  4JX5 A;  2YLC A;  4VUB A;  2DZC A;  4LN2 A;  1BIA A;  1T0J A;  2A37 A;  1M1G A;  3GNF B;  3LWI A;  4MFE A;  2ROT A;  2EFI A;  1X2Q A;  4C8Q G;  5GAO l;  4X9D A;  4C92 A;  2JW4 A;  3TSZ A;  1YFN A;  2CCH B;  3B57 A;  3OBY A;  3F70 A;  3M0Q A;  2BS4 A;  4M7A E;  5HK0 A;  4IUP A;  4N4G A;  3M03 A;  4BXX X;  3RIR A;  1WNL A;  1GUX A;  1PD0 A;  1T3S A;  1FYN A;  1M1K R;  4FX3 B;  4ZN3 A;  3JCM W;  4JX6 A;  4CC3 A;  2DXB B;  4HNU A;  1UNG D;  1ZUK A;  2QQS A;  3QWX X;  4MZT A;  1KSW A;  5DQV A;  4IUT A;  2X4W A;  2DYI A;  2BTT A;  5CIU A;  3OYB A;  3CC7 A;  5GAO n;  1KQ1 A;  2FPF A;  2LNV A;  2QYZ A;  1H92 A;  4M7A G;  2CT3 A;  4HXJ A;  1R0C B;  4BBR M;  2DKG A;  1GCQ C;  4O6J A;  3M58 A;  3NTI A;  1WHL A;  2YT6 A;  4IIO A;  2UZD B;  3RGF B;  2P4R A;  1Q86 U;  3PVQ A;  5CQX A;  3S3N A;  4BCO B;  4WF2 A;  1BI3 A;  2YRD A;  3ULR B;  1AEY A;  5LQF B;  4BB7 A;  2ZAE A;  2XK0 A;  4CC4 B;  1UGQ B;  2VAS A;  5EG2 A;  2QXF A;  2DAQ A;  3GF5 A;  4YOZ A;  2QAZ A;  1WPY A;  1H25 B;  3OMG A;  4EDU A;  4D6W A;  1NPP A;  3I55 A;  2PVG B;  1JJ2 S;  2RJC A;  2J6F A;  1GBR A;  5IDP B;  4F16 A;  3CCS T;  3LW5 E;  3CBP A;  2QFZ A;  4BCM B;  5LJ5 d;  3OS5 A;  2BE7 D;  3PGG A;  1M4Z A;  2RA2 A;  3MHX A;  3ZFJ A;  1VOL A;  2HL5 C;  3REA B;  2RJF A;  4JRP A;  2I2L A;  4C92 D;  1UNH D;  1YWO A;  8AT1 B;  1WJQ A;  3G71 A;  1AWW A;  3EG9 B;  3UA6 A;  2LRQ A;  4C5G A;  1S72 A;  2K5L A;  2FO0 A;  3VKI A;  3JCM e;  2BE9 B;  1M30 A;  1MGQ A;  2VC8 A;  3JSC A;  2PJQ A;  5GAN f;  1YJW T;  3TNI B;  2WSF E;  3SD4 A;  1GBQ A;  4OGR B;  5KCO A;  2EJG A;  2M51 A;  4C8Q F;  3CCM A;  1UEC A;  2RN8 A;  2EQU A;  2DYB A;  3HKS A;  3EFO A;  3CXC S;  2SRC A;  4XTY A;  1ZX6 A;  3H4C A;  2DRM A;  2DL7 A;  2CJM B;  3FDR A;  1YHQ A;  3EGX B;  1W1F A;  2J6O A;  1S1N A;  1JST B;  2DE0 X;  2K6D A;  1YIJ T;  3CCL Q;  5GAM j;  5GMK j;  1Q82 U;  2VWF A;  1ZBX A;  3FEO A;  2LT1 A;  1VYU A;  4BCF B;  3UF4 A;  2H3J A;  4XTW A;  4OP0 A;  2JS2 A;  2H8H A;  4E7L A;  1WFW A;  1EIF A;  4X1V A;  3QDF A;  1YJN T;  3PIO A;  4FM4 B;  1KIK A;  5DQW A;  2E4H A;  4J9B A;  1K73 U;  4HKE A;  4JS5 A;  4NL3 A;  2DXT A;  3CCR T;  5DLO A;  2LVM A;  1RAH B;  1VQK A;  2XDP A;  3VS3 A;  1KJW A;  1TTH B;  4LDY A;  2CZ6 B;  2BZX A;  4ELJ A;  2ZPE B;  3MEV A;  1VQ6 T;  2PK2 A;  3MI9 B;  1FIN B;  2MWO A;  1AIS B;  4FCY A;  2FL7 A;  3CEY A;  4EOS B;  4HVU A;  1YWP A;  2DXU A;  4L59 A;  2LP5 A;  4C92 B;  1H27 B;  1AD5 A;  1M2V A;  1R8O B;  3JCM V;  1JO8 A;  2DL8 A;  3MPU B;  3R6O A;  1O75 A;  3M4Y A;  2XDB A;  5FWB A;  3QKJ A;  2X4J A;  2GNC A;  3CMA A;  1PC0 A;  3BE3 A;  1VQ5 T;  1VQO A;  1V76 A;  2FZC B;  3A5Z B;  1JOW A;  1YI2 Q;  2XKO C;  1GUX B;  1VOM A;  4F7L B;  3CCU T;  1VQ7 A;  4EOP B;  2E12 A;  2WEV B;  3H0F A;  5D6X A;  4N4H A;  2MWP A;  2M1H A;  2BS3 A;  3CC2 A;  1QW1 A;  4F6W B;  2HKN A;  4LNP A;  3C12 A;  2HAX A;  3UDC A;  4EMK C;  4EOM B;  4DBH A;  3C4S A;  4BY1 X;  4OMM A;  4F17 A;  3VS7 A;  5FU6 C;  1IHV A;  4BY7 X;  2A0F B;  2PQW A;  4GY5 A;  1JJ2 P;  3FIF A;  3HO8 A;  2YUN A;  2W9Z A;  4M78 C;  1SHG A;  2PU9 B;  4OML A;  2FRY A;  1G3W A;  3NMZ C;  2AIR B;  1VQ9 Q;  3RBB B;  1D0Y A;  1VQ8 Q;  2RB6 A;  5GAM d;  1M8M A;  1OV3 A;  3P8H A;  3PT9 A;  1Q7Y C;  4K11 A;  4HL4 A;  4JZ4 A;  1AT1 B;  2KEA A;  1Y7X A;  2COY A;  3QII A;  1WJR A;  2HZY A;  5GAN 2;  4QKU A;  2JJ9 A;  1N9S A;  2L3R A;  1AWJ A;  2KXD A;  3FLG A;  1HD3 A;  3ME9 A;  3DTO A;  2E64 A;  1X43 A;  2OTL A;  2C5N B;  5IHN A;  3E9F A;  1XTD A;  4M78 G;  3AT1 B;  1D09 B;  4NL2 A;  4CC7 A;  5I21 A;  3AHU A;  2DIL A;  5CR2 A;  4EMK B;  1YBY A;  2F2V A;  2KT8 A;  2QAS A;  1UDL A;  3CCE Q;  4PJO D;  3CXC P;  2LQN A;  5FU6 B;  3EJ1 B;  1GL5 A;  3DDP B;  4M77 E;  1I4K 1;  3TRE A;  4M78 B;  3CCV T;  1RAI B;  4X9C A;  1W6X A;  2HBW A;  1JSU B;  2DX1 A;  3M0T A;  4E47 A;  2B86 A;  1VQL Q;  2FZG B;  2UZL B;  1WHH A;  4RG8 A;  4OGC A;  4ZGE B;  3BDU A;  3OYK A;  3OSV A;  2E3H A;  2EWN A;  2PTK A;  4F7U A;  1UNL D;  3HFN A;  2PK9 B;  4RKU E;  1YJ9 A;  4BDZ A;  2PHG A;  2HCK A;  2RMO A;  2LDM A;  3OYC A;  3F5X B;  1U06 A;  2ECZ A;  2WSC E;  1YIT T;  3HB9 A;  4OB2 B;  1ZA2 B;  1PSF A;  2HEQ A;  2KI7 A;  3EFO B;  4PJO C;  1H1P B;  2SEM A;  2UZE B;  2GFA A;  2C5O B;  2XMF A;  5KCH A;  1K9M U;  3DJB A;  3JCM g;  2X4Y A;  2O2O A;  4UC4 A;  1TUC A;  4E6R A;  1ZQ1 A;  5HKC A;  3DB3 A;  2EYX A;  2WIP B;  1JXO A;  4WCI A;  2L2P A;  1PNJ A;  4YOO A;  2CZ1 B;  1OQK A;  4HT9 A;  4R55 A;  1Y0M A;  2D8H A;  1QVG S;  1D3B A;  2K7A A;  3EHQ A;  2G9X B;  1OI1 A;  3CCJ A;  1K9M R;  1Q95 G;  2Z0W A;  4ELZ C;  4BD3 A;  3O5Z A;  4CRL B;  3DKM A;  1U3O A;  1UTI A;  4KGV B;  4M75 E;  3S3O A;  3VS2 A;  2KMG A;  2O4X B;  3RUX A;  4A54 A;  1UGR B;  2ZPI B;  5CKB A;  3VYG A;  4BCI B;  5LL6 S;  2A28 A;  5GAN e;  2DMO A;  2AZV A;  4PJO B;  1W2B S;  4ELY C;  3CC2 Q;  1VQM Q;  5ICP B;  2RH2 A;  1C9B A;  4B9W A;  2D0Q B;  2DFU A;  1E7P A;  2P84 A;  2CKK A;  4ME7 A;  4R0K A;  3VS1 A;  1BI2 A;  4M75 G;  4M78 F;  5GAN 8;  3QJY A;  1Z9Z A;  2O9V A;  1OKV B;  2L89 A;  1KG1 A;  3VS6 A;  3OS0 A;  1C0M A;  2WAC A;  1ABQ A;  3BDL A;  5IDN B;  5M9O A;  2BKD N;  1H28 B;  5GAN 3;  4Y91 A;  4CXA B;  1B34 A;  3CC7 T;  2L3S A;  3J80 E;  2AT1 B;  1IHW A;  2FG0 A;  4A63 B;  4Y92 A;  4JJD A;  2OI3 A;  2DA9 A;  1WI7 A;  1GH6 B;  4F14 A;  2HKQ B;  2QQA A;  4BI8 B;  3QHR B;  3JCM J;  2EGE A;  2KR3 A;  2QEX A;  1CSK A;  2RQT A;  8ATC B;  2M0Y A;  3I35 A;  2NUT A;  2YRC A;  2YLB A;  5LJ5 h;  4PLI A;  1OPK A;  4XTU A;  3SDZ A;  2A36 A;  4MZM A;  2EQJ A;  4M7D C;  2LT4 A;  4N0A C;  1JJ2 A;  1EZZ B;  2OAU A;  5FRM A;  2ZZD A;  5I22 A;  3QBY A;  2D1X A;  1E9H B;  3SFM A;  2JXB A;  4HA8 A;  3EH1 A;  3G4S A;  3I55 T;  2K79 A;  2VYT A;  4KGX B;  3E9G A;  1OKW B;  2EW3 A;  3MCA B;  2HSP A;  3QHW B;  2D0N A;  2JT4 A;  4QT7 A;  3KFV A;  4XU3 A;  1N8R U;  4JLG A;  1Q81 R;  3KXT A;  4M7D G;  1NJI C;  1N4M A;  4ANJ A;  3H9N A;  4IUQ A;  1ZLM A;  1WXB A;  4DBR A;  3JRZ A;  4PJO F;  5I11 A;  5L23 A;  3G71 T;  3FJP A;  2DTO A;  1S72 T;  1YIJ Q;  2E3I A;  2QQ8 A;  4AT1 B;  2E65 A;  1MMD A;  4BUG A;  2QDJ A;  3CXC A;  3OS2 A;  3JCM Q;  1RAB B;  4B9X A;  4NST B;  4CFN B;  1OU8 A;  3CCM T;  4M7D B;  4PFZ A;  1N8R R;  4F7U B;  3NDQ A;  4CI0 C;  3VRZ A;  3V8L A;  2DNU A;  1E7O A;  3X26 B;  3CCR Q;  3L42 A;  1WJS A;  4OMP A;  2VB6 A;  4BCQ D;  3VKG A;  5CQY A;  2QTV A;  2K4Y A;  1QVG P;  2RJD A;  2VXE A;  3D7S B;  5HY6 A;  2MI6 A;  2C6T B;  1VQ6 Q;  4CFM B;  2BKZ B;  2LX9 A;  2QGG A;  1MUZ A;  1QMZ B;  4L5G A;  4C8Q E;  1BCO A;  4RCC A;  2Y4X A;  5LJ3 f;  1JQQ A;  1P92 A;  5IH2 A;  2NUZ A;  1MNE A;  2EIF A;  3M0P A;  4XTX A;  3CBM A;  4E7H A;  1W2B P;  1QVF S;  3PFS A;  3GLX A;  5GMK l;  2ZPH B;  2RK2 A;  2RI3 A;  3M0U A;  2QA4 A;  1BBZ A;  3OW2 P;  3OYJ A;  4QVZ A;  4LDU A;  1VQ5 Q;  1AHJ B;  2MIO A;  1TH7 A;  1G83 A;  2KK4 A;  3JCM h;  1XQH A;  1KC8 R;  3J81 E;  2VKN A;  1VYW B;  3CCU Q;  2VGM A;  1AD6 A;  4P5N A;  3QDR B;  1GXI E;  3EGD A;  3N5B B;  4E7Z A;  3EOC B;  2RHU A;  4LDX A;  2DZ9 A;  3C95 A;  2HQX A;  2EGC A;  2YUQ A;  4YC3 B;  2OAW A;  4J7F A;  2W99 A;  4JRK A;  3CMA T;  2DXC A;  4Z88 A;  2ED0 A;  1VQO T;  1QCN A;  2DF6 A;  2MYS A;  4MZP A;  4PK4 A;  3CCQ A;  1ZP2 A;  2C0O A;  1FKM A;  5GAM h;  2QDY B;  2WSE E;  5CK9 A;  1VQ7 T;  5GMK h;  2XDD A;  1MV0 B;  2XHC A;  1NM7 A;  5GAN g;  3CC2 T;  2P0Q A;  2W0Z A;  2B9R A;  4M7D F;  7AT1 B;  1N5Z A;  1VQM T;  4F7U F;  3L2V A;  3CPW S;  1F5Q B;  1VQN A;  4CFV B;  4J9H A;  4CFX B;  4BCN B;  1FMV A;  4BCQ B;  2O9S A;  3BLQ B;  4FSS A;  2YDL A;  2C5V B;  3E19 A;  2XG8 D;  2LCL A;  1MMN A;  1BKB A;  1GCP A;  1UB4 A;  3U23 A;  1H8K A;  3EFR A;  1M90 U;  3LH5 A;  2CZ0 B;  3GOX A;  2NUT B;  4OF1 A;  1FMK A;  1X6B A;  2CSQ A;  4AFZ C;  1D1C A;  1IGQ A;  4D8D A;  4ZTF A;  5EJC A;  1TWB A;  2WHB B;  2PUK B;  3EH2 A;  2DD4 A;  4A53 A;  2JZ2 A;  4J6X A;  4RUG A;  3CCV Q;  4V2S A;  3GNG A;  4EOI B;  2LJ0 A;  4RTV A;  1KFZ A;  2ZZD B;  1YP5 A;  3FB9 A;  1K9A A;  2OTL T;  3TNH B;  1Q86 R;  3M55 A;  5CAI A;  2I0N A;  3K7A M;  2AKK A;  2G77 A;  3EG1 A;  4C0G A;  4KRT A;  1SKU B;  3BG3 A;  3GBQ A;  1RAD B;  2KAF A;  1M90 R;  4MMK A;  4HLQ A;  2ZPG B;  2IIM A;  4RTU A;  1YIT Q;  4M4Z A;  2JM8 A;  4TVR A;  1N9R A;  4ROC A;  3URG A;  2HSE B;  1D1A A;  5CO7 A;  3BG9 A;  2L3Q A;  4XTV A;  3CC4 A;  2ZCF B;  4RTX A;  1PM3 A;  3GP8 A;  3E2U A;  3PMI A;  1OIU B;  3RMS A;  2EUF A;  3X24 B;  2MK5 A;  1W4S A;  2C4G B;  2FYK A;  3LQ5 B;  4GLK A;  5KYX A;  4AG2 C;  5CCA A;  3TW6 A;  4R56 A;  1YJ9 T;  2H3E B;  1J3T A;  1PKT A;  5GJW B;  3OYI A;  4DBF A;  1K8A U;  4C92 C;  1VQ4 A;  3VJP A;  2JMC A;  1FVV B;  1KD1 U;  1TS9 A;  4JS4 A;  2LMJ A;  2EGA A;  1KQS A;  2GGR A;  3L2Z A;  2QA4 Q;  3FC3 A;  1Y07 A;  2DBK A;  4IUU A;  1D1B A;  1M27 C;  2AK5 A;  4MDW A;  5J39 A;  1OZ2 A;  4JDS A;  2RNA A;  2FRW A;  2DRK A;  2JMA A;  3NFC A;  3C94 A;  4YTL A;  2ROL A;  5J3B A;  5HCK A;  4M77 A;  3WVD B;  3OYL A;  2QDL A;  2Y90 A;  2J7I A;  1K8A R;  2DBM A;  4C92 G;  3LYI A;  3P8D A;  1KD1 R;  4KGZ B;  4HNT A;  1QCO A;  4PJM A;  3MP1 A;  1Q82 R;  3CCJ T;  2WPA B;  1D0Z A;  2R5A A;  3G6E A;  1U5S A;  2VVK A;  1I5O B;  2LCS A;  4FIB A;  1AWO A;  3EGU A;  3OYA A;  3CC7 Q;  5A0G A;  1UEB A;  2B8A A;  3OW2 A;  2JOY A;  5DLQ E;  3LGF A;  4WTO B;  1K73 R;  4HVV A;  2NWM A;  2CSI A;  3DLL A;  1F1B B;  1MMG A;  4OMQ A;  4ZNX A;  4C0D C;  4Z8A A;  4KUL A;  3QZ9 B;  1X01 A;  4J9G A;  2RHZ A;  3A8M B;  3JCM d;  3M4G A;  2KXC A;  1SSH A;  3WXM B;  3JB9 D;  4QQ6 A;  2DXC B;  4QSH A;  3GPL A;  1LPL A;  1N6A A;  1PRM C;  3HRS A;  1RLQ C;  5KE3 A;  4CC2 A;  2QQ9 A;  1PRL C;  2MMP A;  4M6V A;  2KSS A;  2RQU A;  1A0N B;  3OYY A;  2CCI B;  1TXQ A;  1QKW A;  2DD5 A;  1VYV A;  2MPX C;  4GLM A;  3V8K A;  1JBM A;  3I55 Q;  3UA7 A;  2D8J A;  3V8J A;  3EFS A;  3HP9 A;  5LJ3 e;  2QGF B;  1AZE A;  4LD9 K;  2R57 A;  2EQK A;  3J7A F;  2DTI A;  2ZGW A;  2FPE A;  2DO3 A;  4M78 E;  5KYN A;  1LCK A;  1G8X A;  1YN8 A;  4FYV B;  5IXF A;  1X6O A;  3SWN A;  1LVK A;  1OYX A;  1C6V X;  2KDS A;  5I2S A;  2OTJ A;  3KBG A;  1WHJ A;  4C0D B;  4LDW A;  1AZG B;  3A8L B;  4AKG A;  2RK1 A;  3G71 Q;  1O9S A;  3QSU A;  4F04 B;  2LW4 A;  4M77 D;  2V22 B;  3G4S T;  4BDY A;  1S72 Q;  4BCG B;  4IKF A;  3POM A;  2RQW A;  2DL5 A;  2F69 A;  4BE2 A;  5HBE B;  3UAT A;  3LLR A;  4I3Z B;  2KGT A;  3V7S A;  2AKL A;  1LNX A;  2D6F A;  1RAG B;  5GMK i;  4FYW B;  3CPF A;  3TQ7 P;  1SG5 A;  3PNW C;  3CCM Q;  2DJQ A;  3CME A;  1RAC B;  2O88 A;  2EYW A;  3CCS A;  4FL6 A;  3VS5 A;  3CBO A;  1HXD A;  3OSS C;  2CYZ B;  1WIE A;  2HD0 A;  1IGU A;  4BI4 A;  3HRT A;  3M9Q A;  4C92 F;  1YHQ Q;  1NYG A;  4BCK B;  2LCC A;  4PL6 A;  2GF7 A;  4FU6 A;  5LJ5 f;  4MDX A;  4XU2 A;  1TG0 A;  1G3Y A;  1ZUU A;  3OYG A;  2LX7 A;  5KYX B;  3LH0 A;  2JM9 A;  1UE9 A;  3BW1 A;  1YJW A;  2CP5 A;  4BCJ B;  1D0X A;  1OX9 A;  2AHJ B;  1M1K C;  1O9K A;  2DM1 A;  3EG0 A;  1I0C A;  1IO6 A;  3RMQ A;  1VQK Q;  1UHC A;  4PJO E;  2F5T X;  2EPD A;  5IT9 E;  3QWY A;  2GQV A;  1X75 C;  1Z9Q A;  3M54 A;  3M57 A;  2YXY A;  4FW2 A;  1OI9 B;  3V7C A;  1E6H A;  1Y71 A;  2JGZ B;  2JN0 A;  3L1A A;  2QG9 B;  5KYY A;  4FSX A;  2NYS A;  1QWF A;  3OYD A;  1H64 1;  3ER0 A;  2MOX A;  4PJO G;  1JEG A;  4NS5 A;  1H3H A;  3PVL A;  2YWW A;  3E1S A;  4FYX B;  2QA4 T;  4L6V 5;  1YNZ A;  1PKS A;  2KRN A;  4JPB W;  1NE8 A;  3I9Q A;  3CMA Q;  2RI2 A;  4A4E A;  1BB9 A;  1BI0 A;  3JCM c;  1VQO Q;  2KYM A;  2IW6 B;  4RTY A;  5GAN j;  1UGS B;  2DEQ A;  2BUD A;  3LX7 A;  3JCM b;  2Y4Y A;  1VQ7 Q;  1H24 B;  4MFD A;  2FEI A;  1M3A A;  1OUL A;  1UFF A;  1HK9 A;  5ECA A;  5KYW A;  2GTO A;  2DTH A;  1JXM A;  5L8R E;  2RF0 A;  3SWN C;  5IF1 B;  2IG0 A;  4C0F A;  1M2V B;  5IXB A;  1OIY B;  9ATC B;  5AT1 B;  2KQW A;  4CFW B;  4PFP A;  2FPD A;  4Z6Y A;  2PUO B;  1WDX A;  4C8Q A;  1ZSZ A;  4J7I A;  3I5R A;  3VUZ A;  3OS1 A;  2NUP A;  3NPF A;  3CCQ T;  3QPH A;  4J5Y A;  1WHM A;  4RTZ A;  3L2R A;  4O5V A;  1W70 A;  1BI1 A;  3BLR B;  3QYG B;  4AFU C;  2CP7 A;  2K2V A;  2PZ1 A;  3RES A;  2CP3 A;  4D8K A;  4J9C A;  1VQN T;  2DD5 B;  1OOT A;  2COZ A;  3JB9 I;  2RHI A;  3JCM f;  2OTL Q;  6AT1 B;  2X35 A;  2GCX A;  2YSQ A;  2V8I A;  5D7U A;  1RL2 A;  2K3B A;  4XU0 A;  3CD6 A;  3X28 B;  2HQH A;  5DY9 A;  1M2O A;  1G5V A;  2PMI B;  2CRE A;  2CUD A;  1WXU A;  4EPC A;  2J05 A;  1VUB A;  3SWN B;  4M7A A;  4JJN K;  4M7D E;  2KRM A;  2XU8 A;  4F7U E;  3M53 A;  3BFM A;  4C5I A;  4HCK A;  2LNH B;  1XJW B;  1OL2 B;  3MY1 B;  1T3L A;  5LJ3 g;  3L2Q A;  4PJN A;  3A8G B;  1NPR A;  3G33 B;  2LQW A;  4J6Y A;  5GAM f;  4RMO A;  3P8B B;  3EG2 A;  1YJ9 Q;  1KHC A;  4J9D A;  2EAY A;  2A3L A;  4J9F A;  2DEU A;  1G2B A;  2RO0 A;  4HVW A;  5GAN d;  4F7U G;  3MO8 A;  2E41 A;  2G6F X;  3PMT A;  4PJJ A;  2GBQ A;  2XD0 A;  2XI9 A;  4Q5W A;  4LD6 A;  2CH4 W;  2VV5 A;  2BIV A;  3CC4 T;  3GIB A;  2KVQ G;  2V1Q A;  2CP0 A;  1Q7Y U;  1I81 A;  2DL4 A;  3EG9 A;  2BPM B;  4N4I A;  1QMC A;  4EOJ B;  1QWE A;  2QTX A;  5GAO q;  1PKD B;  3M59 A;  3HTR A;  4EOO B;  3REB B;  4C8Q D;  1X2K A;  4E7K A;  2L5Q A;  2EJF A;  1YHQ T;  2O01 E;  2P0P A;  4C0Z A;  1BYM A;  3OYN A;  5CKE A;  3TW7 A;  5I5Z B;  2BZY A;  1VQ4 T;  3M56 A;  1NG2 A;  4JRI A;  4ORZ A;  2ABL A;  4KBM B;  1X27 A;  5AYF A;  3CCJ Q;  1QKX A;  5IHK A;  1M3C A;  2WMA B;  1Q7Y R;  3EGX A;  3QYB A;  3JCM X;  5IN1 A;  1UJY A;  2F2C A;  4ELL A;  1TFB A;  3QZ5 B;  5HK3 A;  2EBP A;  5GAO m;  4KRC B;  5FW9 A;  2XIC A;  3NTK A;  2P0K A;  5KYY B;  3MKD A;  1WLP B;  1RAE B;  2O31 A;  2IVW A;  1JU5 C;  4ROD A;  1VQK T;  5HBH B;  4M7A D;  2L8D A;  3HSB A;  5GJV B;  4GBQ A;  4LOC A;  1D3B B;  3TEE A;  2E10 A;  2DVJ A;  4LE9 A;  1EX4 A;  2CP2 A;  2UUE B;  4A4F A;  4NC6 A;  4BY6 C;  3G6E T;  2G3R A;  4FYY B;  4DA4 A;  3CCL A;  1OGU B;  1N27 A;  3M0S A;  3VS0 A;  2KRS A;  3C0C A;  5FRO A;  4BCM D;  5LJ5 e;  3LWH A;  3VYG B;  1IB8 A;  4AMC A;  1M1K U;  2EVR A;  2M02 A;  3DOG B;  3HPW A;  5HBJ B;  4TTH A;  4JLI A;  2R7G A;  2CDT A;  1B07 A;  5FLX E;  4EOR B;  1BIB A;  4AG1 C;  2KMT A;  4FT4 A;  3VRY A;  2QQB A;  5KYW B;  2EJ9 A;  3G1J A;  5HVY B;  1E6G A;  3L2W A;  4M7A C;  3DDQ B;  1SRL A;  2QEX Q;  1KHI A;  2MCN A;  1JB0 E;  2C0I A;  4ROE A;  4F7N B;  2RPN A;  3OY9 A;  2RQV A;  1V1C A;  1NBE B;  5GAN 4;  2FVU A;  4CRI A;  3BHT B;  3TVT A;  3CD6 Q;  3HZJ A;  2K5F A;  1B34 B;  2FZK B;  2HNI A;  4C8Q B;  1ZSZ B;  2NUP B;  1PSE A;  5CKD A;  4Y28 E;  3G7Z A;  1RI0 A;  2K5I A;  4ESR A;  1UJ0 A;  1HJD A;  1XOV A;  4AKH A;  2RM4 A;  5CKH A;  3G4S Q;  2RQR A;  3M0R A;  5LMK B;  3HRU A;  2FB7 A;  5I2M A;  4BY6 B;  5L2W B;  1M8V A;  1ZBJ A;  1ZHI A;  1TUG B;  2GFU A;  1PWT A;  2J6K A;  4XAX B;  4DBQ A;  4LUD A;  1GFC A;  3TSW A;  4E7J A;  1K0X A;  1H26 B;  3I56 A;  1WHK A;  2C5X B;  4C5H A;  3QUI A;  1BU2 A;  1MHN A;  2CT4 A;  2MAM A;  3TN8 B;  3QWL A;  1YI2 A;  2YUP A;  2OTJ T;  4F6U B;  1VA7 A;  3A98 A;  5D6W A;  1DJ7 B;  3HHT B;  1UHF A;  4M7A B;  1NLO C;  2HMA A;  4NOY A;  4IMY B;  5GAO r;  2IVX A;  3VV0 A;  4HCC A;  2IPO B;  2ZPF B;  2DIG A;  1IZ6 A;  4QQD A;  3TU4 K;  1MND A;  3VUB A;  1XNI A;  2QI2 A;  5IAY A;  4ZTJ A;  2VUB A;  2COW A;  1YCS B;  3CME T;  2DER A;  1Y96 A;  1M9S A;  5FU7 C;  2EKO A;  1VQ9 A;  2RHX A;  4ZGD B;  5CYI B;  2JTE A;  1VQ8 A;  2F2W A;  4EMK A;  1K9M C;  3MEW A;  1QQJ A;  3RKY A;  4C5E A;  1BU1 A;  3INZ A;  1WGS A;  4JZ3 A;  1PD1 A;  2DIQ A;  1PHT A;  2PNI A;  1H1Q B;  1MMA A;  4M78 A;  5IHY A;  5LJ3 h;  2EQM A;  1WQ7 A;  3PO3 S;  2XID A;  4EON B;  4IUV A;  4KRD B;  1QP2 A;  2WIH B;  1QVF P;  4PKC C;  5A2Q E;  3V7R A;  4EOK B;  2GTJ A;  3CCE A;  3SEM A;  3RER A;  3DL1 A;  4DOW A;  4C92 E;  2I53 A;  3JCM P;  1VQP A;  3H6Z A;  3O0G D;  2K3Y A;  1NYF A;  4BCH B;  4JJB A;  1NJI U;  1D3U B;  5FU7 B;  1ZA1 B;  5KH6 A;  1VQL A;  1H1S B;  1SRM A;  1WZO A;  4QVD A;  1PG5 B;  3NGP A;  3JB9 H;  1QVG A;  2M16 A;  3TCJ A;  4XQ3 A;  5GAM e;  4KH1 B;  5GMK e;  2E1H A;  1B3Q A;  1VYT A;  2JNG A;  3MEA A;  1WXT A;  1I8F A;  1SHF A;  2BS2 A;  3R6N A;  3EG3 A;  2LJ3 A;  4M7A F;  3VYH B;  1URC B;  1OEB A;  4DQ2 A;  3A8O B;  2LTO A;  1W2B A;  3CCQ Q;  1NJI R;  1FMW A;  2PVD B;  4BI3 A;  3MIA B;  1RLP C;  1AWX A;  4RTT A;  2E6Z A;  2IW8 B;  2QF7 A;  4DEY A;  1H3Z A;  5GAN 6;  4A4G A;  2IW9 B;  2O4X A;  3CPW P;  3QYE A;  4EIK A;  1M5Q 1;  3EGD B;  1VQN Q;  4A4H A;  3QXE B;  1GFD A;  5KYU A;  3JB9 J;  4PJO A;  2X1N B;  3MET A;  3L2U A;  2F2X A;  1TU0 B;  2JVV A;  1U1S A;  4JX4 A;  4Y72 B;  3HBL A;  1LOJ A;  1G3N C;  1OPL A;  2ZPB B;  1Q81 C;  3KHI A;  1TOV A;  4UN0 A;  2DJZ A;  4RTW A;  4OB3 B;  3PIP A;  1VIN A;  4M78 D;  5ACB A;  3FRN A;  1G3T A;  3QHS A;  5A0L A;  4LDV A;  4BAC A;  2W9F A;  2HDA A;  1K76 A;  5LJ5 g;  3I56 Q;  1IXD A;  2V8K A;  2QK0 A;  5LJ3 j;  2KBT A;  2JUF A;  2M9U A;  2CH4 A;  2K9G A;  4E2F B;  2LZ6 B;  2BZ8 A;  1UGV A;  2EYY A;  2QEX T;  1R77 A;  4BBS M;  4M75 A;  3RKW A;  1VQM A;  1N8R C;  2V8J A;  1RAA B;  4ATO A;  2R58 A;  2OJ2 A;  1ABO A;  4OMO A;  3OYM A;  4CFU D;  3EHR A;  3O8V A;  3CD6 T;  3EAE A;  2C06 A;  3OQ5 A;  4G6L B;  4ZN1 A;  1NLP C;  2W2H A;  4II5 B;  4OR5 B;  1YCY A;  2CS7 A;  5GAN h;  4QVC A;  2DD4 B;  2FHD A;  2V26 A; 
#chains in the Genus database with same CATH homology
 2F5K A;  2PUO B;  3CBM A;  4E7H A;  1YJW T;  1QVF S;  2VXF A;  3PFS A;  2WSF E;  3GLX A;  3SD4 A;  4J7I A;  3VUZ A;  4C8Q A;  2ZPH B;  5GMK l;  2RK2 A;  3OS1 A;  2RI3 A;  5KCO A;  2EJG A;  3OYF A;  3QPH A;  4J5Y A;  4OGE A;  4X34 A;  4C8Q F;  2QA4 A;  3CCM A;  3OYJ A;  3L2R A;  2EQU A;  4O5V A;  4QVZ A;  3PTA A;  3HKS A;  1BI1 A;  4LDU A;  4EMH A;  1JRI A;  5DM7 R;  1AHJ B;  3QYG B;  3CXC S;  4RG2 A;  2K2V A;  3RES A;  1TH7 A;  2DPP B;  4XTY A;  2KK4 A;  2CGH A;  3JCM h;  1VQN T;  1XQH A;  3J81 E;  3H4C A;  3JB9 G;  2DD5 B;  2VGM A;  3JB9 I;  4OB1 B;  3FDR A;  2YHT A;  3S3M A;  2MF2 A;  2RHI A;  1YHQ A;  3JCM f;  2X35 A;  2GCX A;  2E6N A;  1Y96 B;  4P5N A;  5FRN A;  2V8I A;  3QDR B;  4A4K A;  1YIJ T;  1GXI E;  5GAM j;  1RL2 A;  1SSF A;  1I5L A;  5GMK j;  1Q82 U;  3N5B B;  1ZBX A;  1KC8 C;  3FEO A;  4XU0 A;  3CD6 A;  3X28 B;  2LT1 A;  4OMF B;  2RHU A;  4LDX A;  4M77 C;  3Q1J A;  5DY9 A;  2H3J A;  4XTW A;  2DZ9 A;  4OP0 A;  3C95 A;  1G5V A;  3UWN A;  2HQX A;  4E7L A;  3JAM E;  1EIF A;  4JRK A;  4J7F A;  4EPC A;  2LC4 A;  3CMA T;  2DXC A;  3SB2 A;  1VUB A;  3SWN B;  4KUI A;  2NLU A;  4M7A A;  1YJN T;  3PIO A;  4JJN K;  3A8H B;  1VQO T;  4M7D E;  4FM4 B;  2RD1 A;  2XU8 A;  2DVE A;  3BY7 A;  4MZP A;  4AKI A;  4HKE A;  4F7U E;  3M53 A;  3BFM A;  3QO3 A;  4JS5 A;  1K73 U;  4C5I A;  4NL3 A;  3CCQ A;  2DXT A;  3CCR T;  1FKM A;  5GAM h;  5LJ3 g;  2QDY B;  2WSE E;  5CK9 A;  5DLO A;  1V29 B;  1VQ7 T;  5GMK h;  2XDD A;  3L2Q A;  2LVM A;  4M7D A;  4J8O A;  4QW2 A;  2XHC A;  1VQK A;  4J83 A;  4N0A A;  3A8G B;  5GAN g;  1NPR A;  2P0Q A;  3OYH A;  4ZGJ B;  3CC2 T;  4M7D F;  4J6Y A;  4BE1 A;  5GAM f;  2XDP A;  4RMO A;  1VQM T;  3P8B B;  4F7U F;  3L2V A;  2WJ9 A;  3CPW S;  4LDY A;  2CZ6 B;  1KHC A;  1VQN A;  4ELJ A;  2ZPE B;  2EAY A;  2A3L A;  3MEV A;  1VQ6 T;  5LJ3 d;  4M77 G;  5C0M A;  4BE0 A;  2MWO A;  2RO0 A;  3MP8 A;  5GAN d;  1QVP A;  4F7U G;  3UPU A;  3H8Z A;  3MO8 A;  4XTX A;  4M75 D;  2E41 A;  1KQ2 A;  3PMT A;  3E19 A;  3X20 B;  2FL7 A;  2XG8 D;  3CEY A;  1YIJ A;  2XD0 A;  2LCL A;  1QVF A;  2EYQ A;  2XI9 A;  2KY9 A;  4Q5W A;  2DXU A;  1BKB A;  4LD6 A;  1UB4 A;  4L59 A;  3EFR A;  1VIF A;  2VV5 A;  2BIV A;  3CC4 T;  1M90 U;  4C92 B;  3GIB A;  2CZ0 B;  3WVE B;  2KVQ G;  4IUR A;  2K57 A;  1R8O B;  3JCM V;  3GOX A;  4OF1 A;  3R6O A;  1O75 A;  3M4Y A;  1I81 A;  1Q7Y U;  2XDB A;  1KQS S;  4ZTF A;  3QKJ A;  2X4J A;  5EJC A;  3CMA A;  2PUK B;  4N4I A;  4QQG A;  4M77 B;  5C6S A;  2QTX A;  5GAO q;  2DD4 A;  1YJN A;  1N8R C;  1G3S A;  1VQ5 T;  4A53 A;  1VQO A;  3M59 A;  2JZ2 A;  2D9T A;  4J6X A;  3A5Z B;  4EMG A;  3VU3 C;  2XKO C;  3GNG A;  4V2S A;  4C8Q D;  3M5A A;  2HQE A;  3CCR A;  3CCU T;  2ZZD B;  4XK8 E;  1VQ7 A;  2E12 A;  3FB9 A;  5D6X A;  4N4H A;  2MWP A;  4E7K A;  2OTL T;  2L5Q A;  4OB0 B;  3M55 A;  2M1H A;  2BS3 A;  3OMC A;  1QW1 A;  2EJF A;  5CAI A;  3CC2 A;  1YHQ T;  4HT8 A;  2G77 A;  2O01 E;  2P0P A;  3C12 A;  4C0Z A;  3UDC A;  4C0G A;  3OYN A;  5CKE A;  4EMK C;  3TW7 A;  3CCL T;  1BYM A;  1VQ4 T;  4M75 C;  3BG3 A;  3M56 A;  4AI6 A;  1VQ6 A;  2KAF A;  3C4S A;  4JRI A;  4MMK A;  4KBM B;  4HLQ A;  2ZPG B;  5AYF A;  4II1 A;  5FU6 C;  2JTM A;  2PQW A;  4GY5 A;  5GAM g;  1Q86 C;  3FIF A;  2HBP A;  3HO8 A;  3MP6 A;  4TVR A;  3QYB A;  1FWZ A;  1N9R A;  1NZ9 A;  3QJ6 A;  5IN1 A;  3JCM X;  4M78 C;  2PU9 B;  3URG A;  3QZ5 B;  5HK3 A;  5CO7 A;  1G3W A;  3BG9 A;  2KR6 A;  3T9N A;  4XTV A;  5GAO m;  2ZCF B;  3GP8 A;  1M90 C;  3CC4 A;  3PMI A;  5KE2 A;  3RMS A;  3OYL A;  2RB6 A;  5GAM d;  2XIC A;  3X24 B;  3NTK A;  3P8H A;  2P0K A;  3PT9 A;  5CKF A;  1Q7Y C;  4FT2 A;  4HL4 A;  1W4S A;  3OW2 S;  2E70 A;  1Y7X A;  2FYK A;  3CPW A;  4GLK A;  1VQ5 A;  1FXX A;  2IVW A;  1WJR A;  3QII A;  3JB9 F;  2DXB A;  3HFO A;  5CCA A;  3TW6 A;  4R56 A;  2L8D A;  5GAN 2;  1VQK T;  4M7A D;  1YJ9 T;  2JTF A;  3HSB A;  1IRE B;  1N9S A;  4HCZ A;  1WQW A;  2L3R A;  4HNV A;  4LOC A;  4MML A;  5CVI A;  2R5M A;  1D3B B;  3FLG A;  3CCU A;  3TEE A;  2E10 A;  3ME9 A;  2E64 A;  2X4X A;  4A4F A;  2OTL A;  4M7D D;  4NC6 A;  4BY6 C;  3G6E T;  3E9F A;  1FX7 A;  1XTD A;  2G3R A;  4M78 G;  2VGN A;  3OYI A;  1K8A U;  4C92 C;  4DA4 A;  3CCL A;  1VQ4 A;  1N27 A;  3VJP A;  4NL2 A;  1KD1 U;  5FRO A;  3QG1 A;  5I21 A;  5LJ5 e;  3VYG B;  3LWH A;  4JS4 A;  1M1K U;  3HPW A;  1KQS A;  3L2Z A;  3AHU A;  3FC3 A;  1Y07 A;  4JLI A;  5CR2 A;  2PVO B;  4EMK B;  1YBY A;  5D6Y A;  5FLX E;  4M75 B;  2CZ7 B;  4IUU A;  4PJO D;  3RKX A;  1BIB A;  2KMT A;  4FT4 A;  2QQB A;  3OYE A;  1QP3 A;  3I56 T;  2EJ9 A;  3QYH B;  1LJO A;  2M0O A;  5FU6 B;  4MDW A;  4M77 E;  5J39 A;  1OZ2 A;  4JDS A;  3L2W A;  4E7I A;  1I4K 1;  3TRE A;  2RI5 A;  4M78 B;  1UGP B;  5J26 A;  3CCV T;  1YI2 T;  4M7A C;  4X9C A;  1KHI A;  3NFC A;  3C94 A;  1JB0 E;  4YTL A;  4E47 A;  5A0D A;  5J3B A;  3OY9 A;  1Q81 U;  2E5Q A;  4M77 A;  4OGC A;  3WVD B;  4ZGE B;  3BDU A;  4RG8 A;  3OYK A;  2Y90 A;  3OSV A;  2EWN A;  3S6W A;  5GAN 4;  2FVU A;  4CRI A;  4F7U A;  3HFN A;  4C92 G;  4M77 F;  4RKU E;  4BDZ A;  1YJ9 A;  3HZJ A;  2K5F A;  1B34 B;  2HNI A;  3LYI A;  3P8D A;  4C8Q B;  4JUV A;  2LDM A;  4MIM A;  3OYC A;  4HNT A;  1PSE A;  3MP1 A;  5CKD A;  3CCJ T;  2WSC E;  1YIT T;  4Y28 E;  3HB9 A;  3G7Z A;  1RI0 A;  2K5I A;  2R5A A;  4OB2 B;  3KUF A;  3VKH A;  1PSF A;  1XOV A;  4AKH A;  3G6E A;  2RM4 A;  5CKH A;  1K8A C;  4PJO C;  2RHY A;  1VQ9 T;  4FIB A;  3HRU A;  2FB7 A;  1KD1 C;  3OYA A;  4Z02 A;  5I2M A;  3UT1 A;  4BY6 B;  2GFA A;  5A0G A;  1M8V A;  1UEB A;  1Q82 C;  2B8A A;  5KCH A;  2JOY A;  1ZHI A;  5DLQ E;  3OW2 A;  1VQ8 T;  3LGF A;  2K3X A;  4JRQ A;  1K9M U;  3JCM g;  2GFU A;  2X4Y A;  1QLB A;  4UC4 A;  4XAX B;  3DLL A;  3DLM A;  1ZQ1 A;  5HKC A;  3DB3 A;  4E7J A;  3I56 A;  4C0D C;  4C5H A;  4DOV A;  4KUL A;  3QUI A;  3QZ9 B;  1MHN A;  4PLL A;  1X01 A;  2MAM A;  4XU1 A;  3QWL A;  2RHZ A;  2CZ1 B;  3CCV A;  1YI2 A;  3A8M B;  4HT9 A;  3JCM d;  2OTJ T;  1K73 C;  3M4G A;  5D6W A;  1DJ7 B;  3WXM B;  3HHT B;  4KT0 E;  3JB9 D;  4QQ6 A;  2DXC B;  4QSH A;  3ZEH A;  5GAO p;  4R55 A;  3GPL A;  4M7A B;  1N6A A;  3X25 B;  5GAN 5;  4NOY A;  3HRS A;  5GAO r;  4J6W A;  5KE3 A;  3VV0 A;  2QQ9 A;  1QVG S;  4HCC A;  2MMP A;  2RJE A;  4M6V A;  2KSS A;  2ZPF B;  1D3B A;  1IZ6 A;  2DIG A;  3HL8 A;  3OYY A;  4PNO A;  4QQD A;  4RCB A;  5GMK m;  3TU4 K;  1OI1 A;  3CCJ A;  2HAX A;  1YIT A;  3VUB A;  2DD5 A;  1XNI A;  4ELZ C;  3CCE T;  2LQK A;  3BG5 A;  2QI2 A;  2P4T A;  5IAY A;  1OZ3 A;  2VUB A;  3V8K A;  4BD3 A;  4ZTJ A;  3OBW A;  3CME T;  1JBM A;  1M1F A;  3DKM A;  4M75 E;  1Y96 A;  1M9S A;  3V8J A;  1U1T A;  5FU7 C;  2EKO A;  3S3O A;  3EFS A;  3HP9 A;  5LJ3 e;  2KMG A;  2O4X B;  3RUX A;  3OA6 A;  4A54 A;  1VQP T;  1UGR B;  2ZPI B;  2RHX A;  5CKB A;  4ZGD B;  3VYG A;  5LL6 S;  4LD9 K;  2LQ8 A;  2R57 A;  2EQK A;  5GAN e;  1VQ8 A;  3J7A F;  2DTI A;  2ZGW A;  4EMK A;  3LGL A;  1K9M C;  4PJO B;  1W2B S;  3MEW A;  3RKY A;  4C5E A;  3CCQ T;  4ELY C;  2DO3 A;  1VQL T;  4M78 E;  3INZ A;  1WGS A;  4M75 F;  3ZBD A;  2RH2 A;  1X6O A;  4B9W A;  2D0Q B;  2DIQ A;  2DK3 A;  4C8Q C;  1E7P A;  3SWN A;  1KC8 U;  2CKK A;  5GAN f;  1U8R A;  4ME7 A;  1OYX A;  4OVA A;  3ASK A;  4M78 A;  1VIE A;  5LJ3 h;  2KDS A;  2EQM A;  1BI2 A;  5I2S A;  1VQ9 A;  4M75 G;  4KUD K;  2OTJ A;  4HCB A;  3DB4 A;  3KBG A;  4M78 F;  4C0D B;  5GAN 8;  3QJY A;  4LDW A;  4XTZ A;  2A7Y A;  3A8L B;  4AKG A;  2L89 A;  2QQR A;  1O9S A;  2RK1 A;  3NTH A;  3QSU A;  1KG1 A;  3OS0 A;  1WQ7 A;  2WAC A;  4M77 D;  3BDL A;  5GAN 7;  3G4S T;  2XID A;  5M9O A;  4BDY A;  2BKD N;  5GAN 3;  2YRV A;  4IUV A;  4Y91 A;  4IKF A;  1B34 A;  1QP2 A;  2F69 A;  5LJ5 j;  3OB9 A;  4BE2 A;  3CC7 T;  3LLR A;  4PKC C;  5A2Q E;  4JX5 A;  2YLC A;  3J80 E;  3V7S A;  4VUB A;  1LNX A;  2DZC A;  3V7R A;  2D6F A;  5GMK i;  1BIA A;  3CCE A;  3RER A;  3CPF A;  3DL1 A;  3PNW C;  4DOW A;  1M1G A;  4C92 E;  3GNF B;  3CME A;  3LWI A;  3JCM P;  4MFE A;  3CCS A;  2EFI A;  4FL6 A;  2QQA A;  3CBO A;  1HXD A;  4C8Q G;  1VQP A;  3H6Z A;  4BI8 B;  5GAO l;  3OSS C;  4X9D A;  2CYZ B;  3JCM J;  2K3Y A;  2QEX A;  2HD0 A;  1NJI U;  4C92 A;  4BI4 A;  3HRT A;  5FU7 B;  5KH6 A;  1VQL A;  3M9Q A;  4C92 F;  2YLB A;  5LJ5 h;  4PLI A;  4QVD A;  4XTU A;  3OBY A;  3JB9 H;  3SDZ A;  1QVG A;  4MZM A;  2LCC A;  3F70 A;  4PL6 A;  2EQJ A;  2M16 A;  2GF7 A;  4FU6 A;  3TCJ A;  4XQ3 A;  5GAM e;  5LJ5 f;  2BS4 A;  4M7A E;  4MDX A;  5GMK e;  4M7D C;  5HK0 A;  4XU2 A;  2E1H A;  2LT4 A;  4IUP A;  4N0A C;  4N4G A;  3JSC A;  1JJ2 A;  2JNG A;  3MEA A;  1G3Y A;  2OAU A;  3RIR A;  1WNL A;  3OYG A;  1I8F A;  2ZZD A;  5FRM A;  4ZN3 A;  3QBY A;  3JCM W;  4JX6 A;  2BS2 A;  3SFM A;  2DXB B;  4HNU A;  3LH0 A;  4HA8 A;  3G4S A;  3I55 T;  2QQS A;  4MZT A;  3BW1 A;  1YJW A;  4M7A F;  3VYH B;  2VYT A;  4DQ2 A;  3E9G A;  2X4W A;  4IUT A;  3A8O B;  5CIU A;  2LTO A;  3OYB A;  3CC7 A;  1W2B A;  2AHJ B;  3MCA B;  5GAO n;  1KQ1 A;  2LNV A;  1M1K C;  2PVD B;  4BI3 A;  4M7A G;  3RMQ A;  4XU3 A;  1N8R U;  4BBR M;  2DKG A;  4PJO E;  2F5T X;  4JLG A;  2E6Z A;  2QF7 A;  1H3Z A;  5IT9 E;  4O6J A;  4A4G A;  5GAN 6;  2O4X A;  2GQV A;  3M58 A;  3NTI A;  1X75 C;  3KXT A;  3M54 A;  3M57 A;  3QYE A;  1M5Q 1;  3V7C A;  4A4H A;  4M7D G;  3QXE B;  1NJI C;  3JB9 J;  4PJO A;  1Y71 A;  1Q86 U;  3MET A;  4IUQ A;  3L2U A;  5CQX A;  2JVV A;  1U1S A;  2JN0 A;  3JRZ A;  4PJO F;  3G71 T;  4JX4 A;  3L1A A;  3S3N A;  3FJP A;  4FSX A;  2DTO A;  3HBL A;  1LOJ A;  4WF2 A;  1Q81 C;  2ZPB B;  1BI3 A;  3KHI A;  1S72 T;  2DJZ A;  3OYD A;  4BB7 A;  4OB3 B;  2QQ8 A;  1H64 1;  2XK0 A;  1UGQ B;  3ER0 A;  4M78 D;  4PJO G;  3PIP A;  4NS5 A;  2E65 A;  3FRN A;  5EG2 A;  1G3T A;  3QHS A;  2QXF A;  5A0L A;  2DAQ A;  4BUG A;  3GF5 A;  2QDJ A;  3E1S A;  4LDV A;  3CXC A;  4BAC A;  3OS2 A;  2QA4 T;  4L6V 5;  3JCM Q;  1WPY A;  4B9X A;  3CCM T;  5LJ5 g;  4M7D B;  3OMG A;  4EDU A;  1NE8 A;  1NPP A;  4D6W A;  2PVG B;  2RI2 A;  2RJC A;  4F7U B;  3I55 A;  1JJ2 S;  2V8K A;  4A4E A;  5LJ3 j;  4CI0 C;  1BI0 A;  3JCM c;  3CCS T;  3LW5 E;  3CBP A;  2JUF A;  2QFZ A;  2M9U A;  3V8L A;  1UGS B;  2DEQ A;  5GAN j;  3X26 B;  2BUD A;  3LX7 A;  3JCM b;  2Y4Y A;  3L42 A;  5LJ5 d;  2QEX T;  1WJS A;  4MFD A;  3VKG A;  3OS5 A;  4BBS M;  3PGG A;  4M75 A;  3RKW A;  1M4Z A;  5CQY A;  1VQM A;  2V8J A;  2RA2 A;  3MHX A;  2K4Y A;  2R58 A;  3ZFJ A;  4ATO A;  3OYM A;  1HK9 A;  2RJD A;  2DTH A;  2VXE A;  5HY6 A;  2RJF A;  4JRP A;  2MI6 A;  3O8V A;  5L8R E;  3CD6 T;  3EAE A;  2I2L A;  2IG0 A;  3SWN C;  4C92 D;  2C06 A;  3OQ5 A;  4C0F A;  2LX9 A;  1WJQ A;  4ZN1 A;  3G71 A;  5GAN h;  2CS7 A;  4L5G A;  1YCY A;  4C8Q E;  4RCC A;  2LRQ A;  2KQW A;  2Y4X A;  4QVC A;  4C5G A;  5LJ3 f;  1S72 A;  2K5L A;  1P92 A;  2DD4 B;  2FHD A;  3VKI A;  3JCM e;  3MEU A;  2EIF A;  4Z6Y A;  1MGQ A;  2VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...