1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
1GXIE 3QZ5B 3QYHB 3QZ9B 1QP2A 3A8HB 2ZZDA 3X25B 2ZCFB 4L6V5 2PUKB 2D0QB 2ZPGB 3A8MB 3VYGB 2O01E 3WVDB 1PSEA 4FM4B 2WSFE 4OB3B 4ZGJB 2DPPB 2PVDB 1AHJB 4Y28E 1UGPB 2PU9B 2DXBA 2ZPIB 2DXBB 3LW5E 2ZPFB 1PSFA 2DD5A 4XK8E 2CZ6B 1QP3A 2PUOB 2PVOB 2CZ7B 1IREB 3A8LB 2PVGB 2WSEE 4KT0E 3VYGA 4RKUE 2WSCE 2CYZB 2ZZDB 5L8RE 1UGRB 4OB0B 3X20B 2ZPEB 2CZ1B 1JB0E 2DXCB 3QYGB 4OB1B 3WVEB 4ZGEB 3A8OB 3X24B 2ZPHB 2QDYB 4ZGDB 1UGSB 3X26B 3VYHB 2AHJB 1V29B 2DD4A 2ZPBB 3X28B 2CZ0B 2DD5B 1DJ7B 4OB2B 1UGQB 2DD4B 3HHTB 3QXEB 3A8GB 2DXCA
chains in the Genus database with same CATH superfamily
2WPAB 3CD6T 4D8DA 3QZ5B 3QYHB 2K9GA 3CMAA 4IUUA 3EFSA 1TTHB 1YJWQ 4BE2A 4QVCA 2K5FA 5GANd 1KFZA 3KFVA 2D0QB 1V1CA 2G77A 3CMAQ 2KVQG 3VYGB 3CCLA 2DFUA 3WVDB 3KBGA 5HK0A 2KR3A 1LOJA 3LGLA 1WDXA 1VQMQ 2YXYA 3CD6Q 2RF0A 1RI0A 2DVJA 1EZZB 1UTIA 2PVDB 4EOIB 1GY3B 2VXEA 2COYA 1FKMA 3N5BB 4RTTA 4M7AE 2PHGA 2D0NA 1NJIC 3TNIB 2EPDA 1WX6A 1E7PA 1RAGB 1WHHA 3H0HA 3VRYA 2J6OA 4CFMB 2VGMA 5EG2A 2ZPIB 5HCKA 4ZTJA 4BCKB 3NHNA 1H3HA 2XU8A 3EFOB 1OOTA 3VRZA 3MKDA 1GUXB 2F2WA 4JZ4A 1D3BB 3PFSA 3MCAB 3QWLA 1TU0B 2XIDA 2I0NA 3OYBA 5IT9E 1K0SA 1UNGD 5GJVB 2B8AA 3NTIA 2BE9B 3JCMW 1TUGB 5FRMA 3DL1A 1WQ7A 5FWCA 2KXDA 1YIJT 3FDRA 3RKWA 5IN1A 4BCFB 1OL1B 1K9MU 3SB2A 1BBZA 1N27A 2A0FB 1D09B 2W96A 5KE3A 2C5XB 4M75A 1NG2A 3VYHB 1IHWA 2K2MA 2EQUA 3G4SQ 1V29B 2DXUA 2ABLA 4LD9K 3BW1A 2F69A 2B86A 5J39A 2A28A 1NYFA 3BLRB 3POMA 4E7JA 2DF6A 1OU8A 4EOPB 2PJQA 2EYWA 1OGUB 3EGXA 1ZBJA 3BDUA 4PJOA 2O31A 1JOWA 4Z89A 3CC4Q 5KH6A 2LCLA 2QQ9A 3M0UA 3A8HB 5HK3A 1VQ5T 2KYMA 1CKAA 4R56A 5CCAA 1AT1B 4EOKB 3A8MB 3EG9A 2BKZB 3HZJA 2KRNA 4F17A 1KIKA 4X34A 4N4HA 2NUPA 2QK0A 1K8AR 4BCOB 4CRIA 1QMCA 1KQSA 4E7IA 2V26A 1G83A 2HD0A 3G6EQ 2F2VA 2LP5A 4KBMB 5D6YA 3RUXA 1AWWA 2CP3A 4J5YA 5IDNB 1IXDA 2HZYA 1Q82C 2HDAA 3JB9F 1I1JA 2D1XA 5L23A 3JCMQ 3JSCA 4ME7A 2HQHA 3VS4A 4UN0A 2E6NA 2ZPFB 5CIUA 4XK8E 1G3NC 1U06A 3I56Q 2L3SA 4ZN1A 4QQGA 2HBWA 1VYVA 5ECAA 3NTKA 2QAZA 2FG0A 4IIOA 4M4ZA 3G1JA 1YCSB 4J6XA 2KT8A 2ZZDB 1M2VA 3QKJA 3OYGA 1O9KB 2EWNA 2C0TA 4QVDA 3J81E 1ZQ1A 4FYXB 2LTOA 4HNTA 1YI2Q 1BI2A 1CSKA 1VQ7T 4Y72B 4M77B 2NWMA 4OMNA 5LJ3f 4OR5B 2W0ZA 1LJOA 1N9SA 5GANf 3HKSA 3MP1A 3JCMb 3VS1A 1TSFA 2X4JA 2JMCA 4M7DE 4EC8B 3EGDA 2DXTA 5IXBA 3M58A 4RG2A 2FZCB 2A08A 1X2KA 4IUQA 2XDDA 2E10A 3DB4A 1WIEA 4BI8B 2EJFA 2KMTA 2VWFA 4JLGA 4PK4A 3I55Q 2JOYA 3C0CA 1I81A 2JZ2A 4J6YA 4O5VA 5I21A 2DMOA 1ZA2B 2H8HA 3BLQB 4WF2A 2JN0A 3X25B 2QQRA 2WMBB 2A37A 1VIEA 2EQIA 5GMKl 3EG1A 4G6LB 5D6XA 3LWIA 1YBYA 2YLBA 4YOOA 4C0ZA 3M53A 4RUGA 2M1HA 3H4CA 4QT7A 2HQEA 1AOJA 2P84A 3TN8B 3S3MA 4ZGJB 2CJMB 2XK0A 3H0FA 3F70A 4LE9A 5KYXA 2LJ0A 2M16A 4JRPA 3OQ5A 2EQMA 3NTHA 4M7AB 3RNJA 4OGRB 1I8FA 4FIBA 2RD1A 4A4GA 1BYMA 2OTLQ 1IO6A 2E70A 4E7LA 1VQKT 3EIDB 3HRUA 3NGPA 3G4SA 4PJOD 3P8DA 2LX7A 2PVOB 1QQJA 3CBOA 1XOVA 5GAMd 3GBQA 2DL3A 4M7AG 1UGVA 1VQ9Q 4FCYA 1N8RU 4BY7X 4B9XA 1OPLA 4RTYA 5GMKi 1VQ6A 1H8KA 4RCBA 3GTMS 3VKIA 1HYOA 3O0GD 2QA4Q 4M78F 4HNVA 3BLHB 1Q81C 3EGXB 1WA7A 2LQNA 3DKMA 3QYGB 1FMVA 4EOOB 4Z6YA 5DQVA 5HKCA 4JX6A 1M90C 3HTRA 2YT6A 4RTXA 3QWXX 4GLKA 1DJ7B 2AZSA 1O75A 1WHLA 3MO8A 3REBB 1ARKA 1WI7A 2PZ1A 4FYYB 2DEQA 8AT1B 4OMPA 1H25B 2DKGA 1C0MA 3OYEA 3L42A 3G71T 5GAN5 2M51A 3CCQQ 4E7HA 4F7UE 1W4SA 3GNFB 3JAME 1N8RR 4L6V5 1YJNQ 1GH6B 4M77G 4MZPA 2YLCA 3DLMA 4E6RA 2P4TA 3MIAB 2RPNA 4BDYA 4LDYA 4LDXA 4EOMB 2YRVA 1XO2A 2EW3A 3EFOA 2DPPB 4J8OA 1UHCA 2E1HA 1YJNT 1M8MA 4Q5WA 5IHNA 2FYKA 1WHKA 2JM8A 2L3RA 3SWNC 2RHYA 3M55A 4E47A 1AZEA 4M7AC 2HBPA 4BCMB 1FX7A 1KC8U 3QDRB 2KSSA 2PUOB 1WHJA 4C8QG 3MJXA 4BI3A 1T3LA 3CEYA 1EIFA 1OX9A 3A8LB 4CC7A 2WSEE 1UUEA 2HSPA 4KT0E 3VYGA 1BU1A 2G3RA 2MIOA 2NUTB 3H6ZA 4B6MA 1VQOT 5CAIA 1SSHA 1TXQA 2OI3A 2WSCE 4BD3A 1UNLD 2GTJA 2W10A 4OMQA 5LJ5e 4BB7A 2VXFA 2C6TB 1M1KC 5EFQB 5LJ5g 4M77E 2DMEA 4OB1B 1O9SA 4JRQA 2KT1A 3HRTA 4IMYB 4II1A 2CKKA 1S72A 3OY9A 2DVEA 2A3LA 5LJ3d 2QDYB 2EBPA 3VS0A 3OW2A 3QHRB 1YITQ 3X26B 1I5LA 4J6WA 3CQTA 5GMKe 3JB9I 1NEBA 2FPDA 1K8AU 5CKEA 1QCFA 2AT1B 4CC2A 1MHNA 3DDPB 3QPHA 4N0AA 2QQBA 1PRLC 4AT1B 1KC8C 4MZTA 3PE0A 1ZLMA 3JCMg 2X35A 1UGQB 3UT1A 3ME9A 3QJYA 3HO8A 3RMQA 3ZEHA 3OS5A 3JCMP 2ZAEA 5KYUA 4KRCB 1VQNT 2BIVA 4M7DF 3QZ9B 1QP2A 3JRZA 3CCLT 4XTXA 4M6VA 2F5KA 3OYJA 5GANh 3MP8A 1Z9ZA 1WJRA 2X9HA 2WXVB 2E64A 2K3XA 3QG1A 4FT4A 2DETA 4JRKA 2YRDA 3HBLA 1NZ9A 3H0IA 5KYYA 4BCPB 1AISB 3EG2A 4DA4A 1VQOA 4QKUA 4CFUD 2ED0A 2DZ9A 3AHUA 2PU9B 4NS5A 1UG1A 3CXCS 1VQMT 2C4GB 1YHQQ 3M4YA 1W6XA 1SSFA 1KC8R 5BNJB 4ESRA 2FEIA 1TH7A 4HXJA 5LJ5d 1BI1A 4NOYA 2WIHB 1KD1R 2IW6B 1MGQA 2QQ8A 1ABOA 1SG5A 5AT1B 4C0GA 1RAHB 3NMZC 2DX1A 4RTUA 2RM4A 5GMKm 5IHYA 2DERA 5L8RE 3OYLA 4PJOG 3VUZA 3PO3S 1CKBA 1U3OA 1IRXA 4R0KA 4M7DC 1UEBA 2JM9A 4AI6A 2H3JA 1VQOQ 3S3OA 2QGFB 2HAXA 3MY5B 1NYGA 2HL3A 3FIFA 4M7AD 1UDLA 4DEXA 2WHBB 4IUVA 3OW2P 3CCQT 3A8OB 2XG8D 4DBRA 4F04B 2CP7A 5FW9A 3HRSA 3K7AM 3FB9A 2RK1A 4PJOB 5LJ3g 2JVVA 2LW4A 1MNDA 2DLPA 2RHIA 1X6GA 4M7DG 2EJGA 2QFZA 3QYEA 4J7FA 1ZP2A 4PFOA 2KEAA 4XU3A 3CBMA 5HVYB 5CKHA 5KE2A 3JB9D 2LT4A 2RB6A 2LQWA 2R5MA 1K9MC 2RHUA 2GTOA 2JS0A 2YWWA 2DJQA 2L5QA 1FYNA 2D9TA 1WXTA 1VQ9T 2PUKB 1YCYA 3PIOA 2DE0X 2O01E 2DILA 4EOQB 2RO0A 4JJNK 4C92A 3BG3A 3MEAA 1AWXA 2CS7A 4HNUA 2OTLT 2PQWA 3PTAA 1VQLQ 1GCQA 1E7OA 3PVQA 3DB3A 4EMKA 4OGEA 1QVFA 2I2LA 1AD6A 3UPUA 1H641 2C5VB 1X75C 3OS0A 3OYFA 4PJOF 3G6ET 1U8RA 3QUIA 2EYQA 4QSHA 1W2BP 2GBQA 1OU9A 1YIJQ 2E41A 1AWOA 4M78G 2ROTA 4HCZA 1N6AA 4PJNA 3VS2A 5KYYB 4KGXB 4BCIB 5C6SA 1OKWB 3PIPA 1VQ7A 4F7UG 3I5SA 3V7SA 2BS4A 1UGRB 4QQ6A 4M75E 4QW2A 1M2OA 2M9UA 4ANJA 4ELYC 5DLQE 2EYXA 4PFZA 3P8BB 1WYXA 4M78C 2L3PA 2W9ZA 3CCUA 1MV0B 2EFIA 3MEVA 3G6EA 1W2BS 2CSIA 3PGGA 2PK9B 4D6WA 1I5OB 3VS5A 1QWEA 1YJ9Q 1RADB 1OQKA 2FPFA 3G7ZA 5IAYA 2WEVB 4J7IA 2IG0A 2QA4A 2C0IA 3UA6A 4HA8A 1H4LD 3PVLA 1Q82R 2K57A 2OAWA 5GANe 1MMDA 3VS3A 2YRCA 5KCHA 2DA9A 2EAYA 3BG5A 4O6JA 1NLPC 1JEGA 2L89A 5M9OA 3FLGA 1KG1A 5LMKB 3E1SA 1U1TA 4EMKB 3M5AA 2O88A 3CXCP 2R7GA 4AKIA 3CPWA 4KRTA 4BBSM 1ZUUA 2V1QA 1OIUB 4HVWA 2ZZDA 4F6SB 5IHIA 2COZA 4EMKC 1ZHIA 2CGHA 1SEMA 4N0AC 1M9SA 1B34A 3THKA 1JJ2P 3QIIA 4EDUA 1ZUKA 3RDVA 3I55T 3CMAT 2MWOA 2P0KA 1M3BA 4C5HA 1VQ8Q 1GBRA 3JB9J 5CVIA 2E5QA 3S6WA 1PSEA 1N4MA 5CK9A 2E12A 1K0XA 4C92D 4Z8AA 4PKCC 1RI9A 1QLBA 2D8HA 1H28B 3QHWB 2VB6A 1HK9A 1VQ4Q 1ZSZB 3OW2S 2Z0WA 5CO7A 2K79A 4F6WB 2PMIB 2DXBB 3LW5E 1PSFA 1YI2T 5LJ3j 1GFCA 3H9NA 2CZ6B 3JCMc 3V7CA 2PK2A 3FRNA 2D8JA 2EYZA 1U5SA 4PLIA 2QA4T 4BACA 3ER0A 1W98B 2E6ZA 1TWBA 2CP6A 2CH4A 1OEBA 2BPMB 3CCMQ 4JX4A 2LJ1A 4J9BA 2IVXA 3VKHA 3GP8A 2NUTA 2DIQA 4XU1A 3QSUA 2EKOA 2CP0A 4XTYA 1GCQC 1LNXA 2DO3A 4XAXB 1Q86C 2EJ9A 2L2PA 2OJ2A 5CKDA 2ENMA 1C9BA 3CC2Q 4OF1A 2RK2A 3BG9A 4YOZA 2JTEA 2ZPHB 2DNUA 4FSSA 2WJ9A 3QYBA 1UB4A 4FYWB 1FMKA 4KUIA 3OS2A 3G4ST 4M75C 4J9GA 2QEXQ 4M75B 1VQ6Q 5GAN8 3I35A 2RJEA 3L1AA 4UC4A 3E9FA 1KQSS 1G3TA 2OX7A 3CXCA 2B9RA 3VV0A 3MPUB 1GL5A 3C95A 1G3WA 2R57A 1BI3A 4AKHA 1G3SA 3M0QA 4BCMD 2HSEB 2MI6A 4BUGA 4EORB 2DAQA 2CREA 1TS9A 3M57A 2F5TX 1AD5A 2OTLA 3TW6A 2YHTA 2O4XA 2ZCFB 4M78B 1K76A 2QQSA 1RL2A 2NLUA 3CMET 1NE8A 5GAOl 4C8QE 3EH2A 4YOSA 4Y91A 1M4ZA 1Q86R 4GBQA 1N8RC 2C5NB 3TCJA 4RODA 4AG2C 1QVGA 2JW4A 1LVKA 1SKUB 3UF4A 1JXMA 4CFWB 2VUBA 2VGNA 1VQPQ 2W9FA 1R0BG 3EG0A 1VYWB 2QTXA 2CH4W 4NL2A 1RAAB 1VQKA 1BCMA 2CZ7B 4EMGA 3MP6A 1ZSGA 1KXUA 2RI5A 4KH1B 4F70B 2YSQA 1VQPT 2BZXA 2GFAA 4XQ3A 4HCCA 5FU7B 2FL7A 4F7UA 1QVPA 2E65A 3BY7A 3ZBDA 4C92C 3OBWA 4V2SA 3MEWA 2NYSA 1VQ5A 3TNHB 2KI7A 1VQ8T 1T0JA 5L2WB 1D1BA 4PNOA 4A63B 4RMOA 2ED1A 1S72Q 4FYVB 4XTWA 4A4EA 2XDPA 1BIAA 3AT1B 3WVEB 4HKEA 4A54A 4NC6A 1M8VA 3OS1A 1M1KR 5LQFB 4R55A 2QEXA 4C8QD 1FINB 3RBBB 2JTMA 3V8KA 1ZSZA 2DD4A 3J7AF 3VUBA 4CFVB 5GAMh 2CZ0B 3TSWA 4KULA 1IHVA 2DL4A 5IXFA 3OYAA 1NM7A 1JJ2S 5GAN7 1QWFA 1F5QB 3OYIA 3HHTB 3CC4A 1H24B 3PT9A 1NEGA 1K9MR 4CFUB 4DOWA 3OSSC 1LPLA 3CCVA 4ATOA 3VU3C 4ROEA 3FEOA 3QJ6A 4LNPA 3NPFA 4A4FA 3G71A 1W70A 3L2ZA 1PG5B 2WIPB 2AZVA 4JRIA 2QGGA 4BCQB 1RACB 5A0LA 2O9VA 4CXAB 1VQ4A 1UFFA 1O9KA 1VUBA 1UJ0A 5GAN6 3HFOA 3IQLA 3GLXA 4A4HA 5CYIB 2LZ6B 2DEUA 1Q95G 1YWPA 1JU5C 2E3HA 5EJCA 2L8DA 1IGUA 2MYSA 2VC8A 2DL5A 4JUVA 4X9CA 1BI0A 1TG0A 4JLIA 1YJNA 4ELLA 4DBFA 4RTVA 3SHWA 5FWBA 3CPWS 1WLPB 4FSXA 3TQ7P 2O9SA 5KYWA 3M4GA 1QKWA 2J6FA 3UATA 1A0NB 3CPFA 2K5IA 1R0CB 1NJIR 2NUZA 5HBHB 5GAN3 3CC7T 2KMGA 4WTOB 3QBYA 1C6VX 1G8XA 2LNHB 2RI2A 2FZGB 1QVFS 5FLXE 4AFZC 2WACA 4GY5A 1VIFA 3CCET 4FW1A 4C92B 1XNIA 2EVRA 3RKYA 2YDLA 3RERA 3BHTB 4AMCA 2YUNA 1MUZA 2EQKA 4AG1C 4CC4B 1RAIB 2Y90A 1ABQA 2KRSA 1WNLA 2DK3A 3OYCA 4AFUC 3EHRA 3X24B 2JJ9A 2MK5A 3M0SA 1PD1A 1YN8A 1P5EB 4MMLA 1QCOA 2DL8A 2KGTA 2AHJB 4F7SB 3JCMX 4IUPA 1RUWA 1K9AA 2GCXA 5LJ3h 1YITT 5GAMe 3R6NA 3JB9H 3A98A 3LH5A 5CEIB 5GMKh 1FWZA 4M7AF 1OL2B 1VQ7Q 2LT1A 2XD0A 4Z88A 4BCGB 3A8GB 4DBHA 3CCRQ 2UZBB 1EX4A 2QGSA 1QW1A 2ZGWA 2PTKA 1GFDA 2M0YA 3CCUT 4OMOA 3MI9B 1K8AC 4C5EA 1JRIA 2VASA 3JCMd 1X69A 2OTJT 2FZKB 1W1FA 1KHCA 2J6KA 1GRIA 3TEEA 1QKXA 4WCIA 2BKDN 1VQMA 4LXCA 1AZGB 4OB3B 3CCSQ 1Q7YR 2Y4XA 3LLRA 4LDVA 2J06A 1Y7XA 4C0FA 1KD1U 1XTDA 3CC2A 2XICA 4ROCA 2GF7A 2V1RA 5DY9A 2F2XA 3REAB 4EMHA 2DRMA 3FC3A 3L2QA 3SWNB 1PCXA 4M78E 1YFNA 3CCJA 4J9HA 4C8QF 2JT4A 3HB9A 1VA7A 1XQHA 1OI9B 4M78D 1MMAA 3UWNA 3EGDB 1M30A 2PVGB 2GGRA 1WJSA 4X1VA 3HL8A 4NSTB 1B34B 4RG8A 4BY6B 4M77F 2CP2A 1G5VA 3BE3A 2VV5A 1JJ2A 3M03A 3L2WA 2RJCA 1VQNQ 3CCMA 1PKSA 2GQVA 2JTFA 4D8KA 1WJQA 3JCMh 3CCEA 1B7TA 3CPWP 2X4XA 5GAOq 1VINA 3KHIA 4BCHB 3LQ5B 3TU4K 1Y71A 5ICPB 3CCVT 5FU7C 5CR2A 3KXTA 2ATCB 3NFCA 3F5XB 4BXXX 2RNAA 1I07A 5GAMg 1V76A 4KGVB 2KYBA 4L59A 4J9IA 4M77A 4Z02A 1VQLA 5LJ5h 3CMEA 2XI9A 2BE7D 4FL6A 2QI2A 4JJDA 2QTVA 3S3NA 1XJWB 3I5RA 4MFEA 3OYYA 2ZPGB 3PMIA 2K5LA 2L3QA 1M90U 4AFSC 4DOVA 4E7SA 1LCKA 2QDJA 4C8QB 4EOSB 3OYMA 2LX9A 4BI4A 5LJ5j 1I0CA 1H27B 2DBMA 3V8JA 3JCMf 3EOCB 4BCNB 3O5ZA 4KGZB 1HD3A 2LNVA 5CQXA 3UDCA 1SHGA 1C1AA 2F1LA 3SWNA 4E7KA 3CCST 4E7ZA 2UZDB 1WZOA 2X4WA 3FJPA 1PC0A 2MAMA 2W99A 1BIBA 2M0OA 3M0PA 4B9WA 3LH0A 4J9EA 1TUCA 2K7AA 4FW2A 1Y96B 2OTJA 2KAFA 2X4YA 5LJ5f 1PKDB 1FMWA 2DTIA 3OSVA 2P0QA 2BS3A 2CYZB 2DIGA 3EJ1B 3RIRA 1PHTA 5A2QE 4N4GA 3RR6A 2F2CA 4OMLA 2GFUA 8ATCB 4BE0A 1X6BA 2RQRA 4MDWA 2OAUA 4EOLB 4EONB 4NL3A 2W2HA 3E19A 3TNWB 1D1CA 3OYKA 1SHFA 4IURA 1K4US 2C0OA 1GBQA 5I22A 9ATCB 1WQWA 1H1QB 1TD6A 3FJ5A 1D0XA 3G71Q 1ZUYA 4A53A 2QQAA 2LJ3A 4OB2B 1KHIA 1UECA 3M0RA 3I55A 1J3TA 2FPEA 5I2MA 4LUDA 1EFNA 2XDBA 4PJOC 3TVTA 1VQ6T 1MV3A 4QVZA 2VKNA 4DEYA 4BBRM 5A0DA 3EFRA 4M78A 3JCMV 2RN8A 2CT3A 4CRLB 2J05A 1WGSA 2KXCA 1RABB 3U23A 5HBJB 2GNCA 4J9DA 4LOCA 1D3BA 1X27A 5HQ0B 1G3YA 2QASA 2Y4YA 2RMOA 2WSFE 3I9QA 4EIKA 2FRYA 5GANj 3GIBA 2DM1A 4E2FB 3M56A 4RTWA 4ORZA 3EHQA 3RGFB 2DTHA 3JCMe 4M77C 1W2BA 3CCJT 4F7NB 3DDQB 3UA7A 1VYTA 2DXBA 3DJBA 2QYZA 1RAFB 1OI1A 2AK5A 3C4SA 4JPBW 4BE1A 1VQ4T 5I5ZB 1B07A 1IREB 1TUDA 3LGFA 3ULRB 2G6FX 1BKBA 3LWHA 5IH2A 3J80E 1VQKQ 1N5ZA 4OGCA 2LQ8A 1RLPC 2EIFA 3H8ZA 3D7SB 4MIMA 3X20B 2JUFA 4AFQC 1JBMA 5C0MA 2CZ1B 2FHDA 5GAOp 1SF9A 5KYUB 4QQDA 1Y96A 3OB9A 1Z9QA 1KQSP 3RMSA 2JMAA 4C0DB 2L0AA 1YJ9T 4I3ZB 1KQ1A 2XMFA 5CQYA 4FU6A 4C92G 1M90R 3L2RA 1MMGA 5KCOA 2V8KA 5DQWA 5GAMj 4BY6C 2JGZB 3L2UA 3MY1B 5KYXB 1YNZA 3B57A 2LC4A 3CCRT 1Y57A 4A4KA 3MEUA 2KR6A 4F7UF 2X3XD 1BCOA 3C94A 3V8LA 2HQXA 5GAMf 1ACMB 4EC9B 2UZLB 2IPOB 2ROLA 3LX7A 3META 2I40B 3TREA 2J7IA 2RQUA 4JX5A 5EC7A 4HLQA 2K3YA 4F7UB 4LDWA 2MMPA 2KQWA 1VQ9A 2DRKA 4N4IA 2LMJA 3ZFJA 1JO8A 1PKTA 1WXBA 3NDQA 1Q81U 1RAEB 7AT1B 2MOXA 5DLOA 1AHJB 2RJFA 5GANg 2RA2A 1E6GA 3CC7A 1OZ2A 2FRWA 5I2SA 1UGPB 3M54A 2KK4A 3CBPA 1YJWA 4MDXA 3BHUB 4PJLA 1VOLA 1X2QA 2PNIA 2CDTA 1WXUA 1H1RB 2G9XB 2LCCA 2VVKA 1NPRA 2K6DA 3RKXA 4OVAA 1QCNA 2DL7A 4RKUE 5FGKB 2IN3A 3SD4A 1X6OA 1WHMA 3HFNA 2ECZA 1NJIU 1VQ8A 2IW9B 4BCND 1PD0A 3LYIA 4PFPA 4C5GA 1JB0E 2DYBA 5J26A 1HSQA 1JXOA 1OIYB 2H3EB 4II5B 3QWYA 3MHXA 3HSBA 2CCIB 5CKFA 1D0YA 2HKQB 4OMFB 3CMEQ 3ZL7C 3EG3A 3CCJQ 1UE9A 3OYHA 2K3BA 3JCMJ 4LUEA 1KSWA 2KY9A 2QXFA 1M1GA 2E5KA 3C12A 3L2VA 4IIMA 4HCBA 4L5GA 5D7UA 1NPPA 2AKLA 5J3BA 2WMAB 1JSTB 2DXCA 4KRDB 1ZBXA 2C5OB 1T3SA 3R6OA 4XU2A 3EG9B 3RESA 4X9DA 1GXIE 5HNBB 4HT9A 4C0DC 4IUTA 3VKGA 4JJBA 1ZA1B 2AIRB 1IB8A 2MWPA 5GAN2 3CCMT 3CCQA 1IZ6A 4FX3B 2V8JA 1M3CA 2HMAA 4M7DD 1QLYA 3G33B 1YWOA 3INZA 1JSUB 1R8OB 2R58A 5GMKj 4BCJB 3CCUQ 2RQVA 1H26B 4EOJB 4FT2A 1M5Q1 4GLMA 4MZMA 1QVGS 1AEYA 4Y28E 4ZN3A 4M7AA 4HVVA 5GJWB 4EPCA 1Q7YC 2HKNA 2RJDA 2DD5A 3OBYA 2K2VA 1QP3A 1B3QA 3EGUA 2SEMA 2DZCA 1TOVA 3SDZA 4F16A 1YJ9A 1SRLA 1YHQT 1URCB 4F7LB 2AKKA 3TW7A 5FRNA 2EUFA 1OULA 5IHKA 2LVMA 4P5NA 3CCSA 1H1SB 1PRMC 2D6FA 3GPLA 4LDUA 3QO3A 4JDSA 3OYNA 2EQJA 4LN2A 2EGEA 4OB0B 1KK7A 1OZ3A 1OX8A 3E2UA 2BS2A 1GUXA 1IGQA 3VS7A 1YP5A 1M2VB 1X01A 4JS4A 4ZGEB 4RCCA 2YUQA 4VUBA 5HBEB 1ENWA 4HL4A 3I56A 3M59A 5IDPB 2QEXT 1UHFA 4ELZC 1UGSB 1VQ5Q 1X43A 2ZPBB 1ZSZC 3E9GA 1JQQA 3BFMA 4KUDK 2X3WD 1UNHD 2SRCA 1WFWA 2DD5B 1WPYA 1WHGA 5KYNA 1Q7YU 1AWJA 2E4HA 2EGAA 5GAN4 4CC3A 2DD4B 2K4YA 1OKVB 3QXEB 1PM3A 2FO0A 2IIMA 3CCVQ 2KE9A 5A0GA 2QF7A 4JS5A 3WXMB 4PJOE 4HT8A 1U1SA 2M02A 1VQPA 2NUPB 3GNGA 3BDLA 1AVZC 3QHSA 2JNGA 4J9FA 2I53A 4ZNXA 2XHCA 3KUFA 4PJJA 3OMCA 4M75F 4FM4B 4CFXB 1GCPA 2KBTA 3OA6A 2X1NB 2IW8B 1Y07A 4XTZA 2DTOA 3OMGA 3SFMA 5FROA 4AKGA 1BK2A 1S1NA 4DQ2A 2LRQA 3GF5A 1YI2A 3P8HA 4ELJA 2KDSA 4TTHA 3TSZA 5CKBA 2MF2A 5ACBA 3DLLA 1OPKA 1JKWA 1MMNA 2MPXC 5HY6A 1NLOC 1PNJA 2QG9B 1M1KU 2EKHA 5DM7R 3I56T 3JB9G 1H92A 1FXXA 2IVWA 2V22B 1SPKA 3DTOA 4C92F 2CUDA 4M7DA 4CI0C 1K73R 2YUPA 4PJMA 2DXCB 4JZ3A 2YUOA 3BHVB 1KJWA 3ASKA 2BZYA 4XTVA 3JV3A 2HCKA 3A1PA 2FB7A 2OTJQ 3PMTA 2UZEB 2CCHB 1E9HB 1P92A 2A36A 1R77A 2HNIA 2CP5A 5D6WA 4C92E 1UJYA 1YHQA 1QVFP 1NBEB 5GAOr 4OMMA 2P0PA 5GAOn 2HL5C 2QDLA 2EGCA 1QVGP 3CCEQ 4MFDA 2DJZA 1M3AA 3QDFA 1YITA 2RHXA 1Y0MA 1MNEA 1VYUA 1N9RA 1D0ZA 2BTTA 1I4K1 2HEQA 4M75G 2O4XB 1H3ZA 1T0HA 4YTLA 2RQWA 2C06A 1KQ2A 2R5AA 4BY1X 2LQKA 1K73C 2X51A 4M77D 2WFYB 3VS6A 1FVVB 2BUDA 3CD6A 1Q82U 4J9CA 5LL6S 4C8QC 3DOGB 1HXDA 4DBQA 1VQLT 2CUBA 2O2OA 3T9NA 5KYWB 3HPWA 1VOMA 4RTZA 1OYXA 5I11A 3A5ZB 1BB9A 2RQTA 2RH2A 1PWTA 1F1BB 4M75D 2UUEB 2CSQA 3Q1JA 5FU6B 2LCSA 2COWA 2JXBA 3URGA 1D1AA 6AT1B 4M7DB 1ZX6A 2FVUA 3O8VA 5GAOm 4BCQD 1SRMA 3SEMA 1VQNA 3OYDA 4XTUA 4TVRA 2RHZA 2ZPEB 2P4RA 4IKFA 1TFBA 5FU6C 4ZTFA 4YC3B 5IF1B 4C5IA 1G2BA 3CCRA 3H41A 2A7YA 3HP9A 1BU2A 4K11A 1QMZB 2VYTA 2KROA 4PLLA 1Q81R 2V8IA 1HJDA 2EYYA 3CC7Q 4J83A 1OV3A 3EH1A 3VJPA 1RLQC 2KRMA 4Y92A 3PNWC 3GOXA 4KH0B 1K73U 2MCNA 4F6UB 2DBKA 4HVUA 2DYIA 4ZGDB 5AYFA 5LJ3e 2ESWA 4CFNB 1M1FA 1S72T 4F14A 2E3IA 3M9QA 3CC2T 3CCLQ 3X28B 1Q86U 1M27C 4HCKA 2BZ8A 4XU0A 2RI3A 3M0TA 4LD6A 3EAEA 3CC4T 1D3UB 4OP0A 4MMKA 1YJWT 2XKOC 1K1ZA 2LDMA 4F7JB 2KNBB 4JJCA 4BDZA 2GQIA 2JS2A 1E6HA 4C8QA 1YIJA 1H1PB 1KD1C 4PL6A 2CT4A 3V7RA
chains in the Genus database with same CATH topology
3LX7A 3META 3CCVA 3CD6T 3TREA 3QZ5B 3QYHB 4ATOA 3QZ9B 4JX5A 1QP2A 3FEOA 3JRZA 3QJ6A 4IUUA 3EFSA 3VU3C 3CMAA 3CCLT 4XTXA 4HLQA 4M6VA 4A4FA 2F5KA 3OYJA 3L2ZA 3G71A 2K3YA 2K5FA 4JRIA 4F7UB 4QVCA 5GANd 4LDWA 2MMPA 2D0QB 2KQWA 5GANh 1VQ9A 5A0LA 3MP8A 2G77A 1WJRA 2KVQG 3VYGB 4N4IA 1VQ4A 3CCLA 3WVDB 3KBGA 2E64A 1VUBA 2K3XA 3QG1A 3ZFJA 5GAN6 4FT4A 3HFOA 5HK0A 1LOJA 3GLXA 3LGLA 4A4HA 4JRKA 1Q81U 5EJCA 2L8DA 2VC8A 1RI0A 4JUVA 5DLOA 3HBLA 2PVDB 1AHJB 1NZ9A 2RJFA 5GANg 2VXEA 2RA2A 4X9CA 1BI0A 1FKMA 3N5BB 3CC7A 4M7AE 1OZ2A 4JLIA 1YJNA 1NJIC 4DA4A 1VQOA 3CPWS 1E7PA 5I2SA 1UGPB 3M54A 2KK4A 2DZ9A 4FSXA 2VGMA 3CBPA 2PU9B 4NS5A 1YJWA 3AHUA 5EG2A 2ZPIB 3CXCS 4ZTJA 1VQMT 4MDXA 3M4GA 3M4YA 1SSFA 2XU8A 3CPFA 2K5IA 5GAN3 3CC7T 1TH7A 5LJ5d 2KMGA 3QBYA 1BI1A 4NOYA 4A4KA 1MGQA 1D3BB 2RI2A 2LCCA 2QQ8A 3MCAB 3PFSA 1NPRA 3QWLA 3RKXA 4C0GA 1QVFS 5FLXE 4OVAA 2WACA 2XIDA 2RM4A 4RKUE 3SD4A 4GY5A 5GMKm 1VIFA 1X6OA 5L8RE 3OYBA 3HFNA 3OYLA 5IT9E 4PJOG 3CCET 3VUZA 4C92B 1XNIA 3RKYA 1NJIU 1VQ8A 4IKFA 4M7DC 1UEBA 2B8AA 3NTIA 3LYIA 3RERA 4AI6A 2H3JA 4C5GA 3JCMW 3S3OA 3DL1A 1WQ7A 2HAXA 5FRMA 1JB0E 2EQKA 2Y90A 3FIFA 4M7AD 5J26A 1YIJT 3FDRA 1WNLA 3RKWA 3G71T 4IUVA 2DK3A 5IN1A 3OYCA 3CCQT 3A8OB 2XG8D 3MHXA 3HSBA 5CKFA 3X24B 3HRSA 1K9MU 3FB9A 3SB2A 2RK1A 1N27A 4PJOB 4OMFB 5LJ3g 2JVVA 4MMLA 5KE3A 2RHIA 4M75A 3VYHB 2AHJB 3JCMX 3OYHA 2EQUA 4IUPA 1V29B 4M7DG 2DXUA 3JCMJ 4LD9K 3BW1A 2EJGA 2F69A 5J39A 2KY9A 2GCXA 2QXFA 5LJ3h 5GAMe 1M1GA 2QFZA 1YITT 3C12A 3JB9H 3QYEA 5GMKh 3L2VA 4HCBA 4J7FA 4E7JA 1FWZA 4M7AF 4L5GA 2XD0A 2LT1A 1NPPA 4XU3A 5J3BA 3CBMA 3A8GB 5CKHA 5KE2A 2DXCA 3JB9D 3R6OA 1ZBXA 1QW1A 2LT4A 2RB6A 2ZGWA 3BDUA 4XU2A 3RESA 4PJOA 2R5MA 1K9MC 4X9DA 1GXIE 5KH6A 2RHUA 4HT9A 2LCLA 4C0DC 2QQ9A 4IUTA 3CCUT 3VKGA 3A8HB 5HK3A 1K8AC 1VQ5T 4C5EA 1JRIA 2L5QA 4R56A 2D9TA 1VQ9T 2PUKB 2MWPA 5CCAA 3JCMd 5GAN2 3CCMT 2OTJT 3CCQA 1YCYA 3PIOA 1KHCA 1IZ6A 3A8MB 2O01E 3TEEA 2RO0A 3HZJA 4JJNK 1W2BS 2V8JA 4X34A 4N4HA 4C92A 3BG3A 2BKDN 1VQMA 4M7DD 3MEAA 2CS7A 4HNUA 4CRIA 1KQSA 4E7IA 3INZA 4OB3B 2HD0A 1R8OB 2R58A 2Y4XA 3LLRA 2PQWA 5GMKj 4LDVA 2OTLT 3PTAA 1Y7XA 4C0FA 4FT2A 4KBMB 5D6YA 3RUXA 1M5Q1 1KD1U 1XTDA 3CC2A 4J5YA 2XICA 4MZMA 2GF7A 1QVGS 4EMHA 5DY9A 3DB3A 4Y28E 4EMKA 4ZN3A 3FC3A 4M7AA 1Q82C 3JB9F 4EPCA 4OGEA 3SWNB 3L2QA 1QVFA 2I2LA 3JCMQ 4M78E 3UPUA 3JSCA 1H641 4ME7A 1Q7YC 1X75C 3OS0A 3CCJA 2E6NA 2RJDA 4C8QF 3OYFA 2ZPFB 2DD5A 5CIUA 3OBYA 2K2VA 4PJOF 4XK8E 3G6ET 1QP3A 3QUIA 2EYQA 4QSHA 1U8RA 3HB9A 2DZCA 2E41A 4M78G 3SDZA 1XQHA 4M78D 3UWNA 1YJ9A 1YHQT 4HCZA 1N6AA 2PVGB 3TW7A 4ZN1A 4QQGA 5FRNA 1WJSA 3NTKA 3HL8A 5C6SA 3PIPA 1VQ7A 2LVMA 1B34B 4P5NA 4RG8A 4F7UG 4BY6B 3CCSA 4J6XA 4M77F 3V7SA 2BS4A 2ZZDB 3GPLA 2D6FA 1UGRB 3QKJA 3QO3A 4JDSA 4LDUA 4M75E 4QQ6A 2EQJA 4QW2A 3OYNA 3OYGA 1G5VA 2VV5A 2M9UA 4ELYC 2EWNA 4OB0B 5DLQE 1JJ2A 4QVDA 3J81E 1ZQ1A 3L2WA 1OZ3A 2RJCA 3CCMA 2LTOA 4HNTA 2GQVA 2JTFA 2BS2A 3P8BB 4M78C 1BI2A 1VQ7T 4M77B 5LJ3f 1WJQA 1X01A 2EFIA 3MEVA 4ZGEB 4RCCA 3JCMh 3G6EA 3CCEA 3CCUA 1LJOA 2X4XA 3PGGA 5GAOq 4VUBA 3KHIA 1N9SA 4D6WA 5GANf 3HKSA 3MP1A 4HL4A 3I56A 3M59A 3JCMb 1Y71A 3TU4K 2QEXT 3G7ZA 5IAYA 2X4JA 4M7DE 4ELZC 1UGSB 2DXTA 4J7IA 2IG0A 2QA4A 3CCVT 4HA8A 2ZPBB 3E9GA 4KUDK 3BFMA 3M58A 5FU7C 5CR2A 2K57A 3KXTA 5GANe 3NFCA 4RG2A 2DD5B 1WPYA 5KCHA 2EAYA 2XDDA 4IUQA 1Q7YU 5GAMg 3BG5A 4O6JA 2L89A 2E10A 3DB4A 5GAN4 5M9OA 3FLGA 4BI8B 3E1SA 2DD4B 1U1TA 2EJFA 2K4YA 4L59A 4EMKB 3QXEB 4M77A 2KMTA 4Z02A 1VQLA 5LJ5h 3M5AA 5A0GA 2QF7A 3CMEA 2XI9A 4JLGA 4JS5A 2JOYA 4AKIA 1I81A 3CPWA 2JZ2A 3WXMB 4FL6A 4PJOE 4HT8A 1U1SA 4J6YA 2QI2A 4O5VA 5I21A 4BBSM 1VQPA 3S3NA 2ZZDA 4MFEA 4WF2A 3OYYA 2JN0A 3X25B 2QQRA 4EMKC 1ZHIA 2CGHA 1VIEA 4N0AC 1M9SA 1B34A 2ZPGB 3GNGA 3PMIA 2K5LA 3BDLA 5GMKl 1M90U 5D6XA 3QIIA 4DOVA 1YBYA 2YLBA 2JNGA 3QHSA 2QDJA 4EDUA 3LWIA 4C8QB 3I55T 3CMAT 2MWOA 2P0KA 2XHCA 4C0ZA 4C5HA 3KUFA 3OYMA 3M53A 3JB9J 2LX9A 3OMCA 2M1HA 3H4CA 2E5QA 5CVIA 1PSEA 4M75F 3S6WA 2HQEA 4BI4A 4FM4B 2E12A 5CK9A 3OA6A 1VQ5A 3V8JA 4C92D 1Y07A 3JCMf 3S3MA 5LJ5j 4ZGJB 2XK0A 4XTZA 3F70A 4PKCC 5CQXA 2LNVA 2DTOA 3UDCA 1QLBA 3OMGA 3SFMA 2M16A 5FROA 4AKGA 4JRPA 3SWNA 3OQ5A 4E7KA 2EQMA 3CCST 3NTHA 4M7AB 1HK9A 3OW2S 1I8FA 4FIBA 4DQ2A 2LRQA 5CO7A 3GF5A 2RD1A 1YI2A 2X4WA 4A4GA 3P8HA 4ELJA 2KDSA 1BYMA 3FJPA 2E70A 4E7LA 2DXBB 2MAMA 1PSFA 3LW5E 5CKBA 5LJ3j 3HRUA 3G4SA 1YI2T 1BIBA 2CZ6B 2M0OA 2MF2A 3P8DA 3DLLA 4PJOD 3JCMc 2PVOB 4B9WA 3LH0A 3V7CA 3FRNA 3CBOA 1XOVA 1Y96B 5GAMd 5HY6A 2OTJA 2KAFA 4PLIA 2X4YA 2QA4T 4BACA 3ER0A 1M1KU 5LJ5f 4M7AG 2E6ZA 2DTIA 3OSVA 5DM7R 3I56T 2P0QA 3JB9G 1FXXA 1N8RU 2IVWA 2BS3A 4JX4A 4B9XA 1VQ6A 2CYZB 5GMKi 4C92F 2DIGA 3RIRA 4M7DA 4CI0C 4RCBA 5A2QE 4N4GA 3VKHA 3GP8A 3QSUA 2DIQA 4XU1A 3VKIA 4M78F 4HNVA 2EKOA 1Q81C 2DXCB 4XTYA 2GFUA 3DKMA 1LNXA 3QYGB 2DO3A 3ASKA 4XAXB 1Q86C 2EJ9A 4BE0A 4XTVA 5CKDA 4Z6YA 4OF1A 4MDWA 2OAUA 2RK2A 2FB7A 3BG9A 5HKCA 4NL3A 4JX6A 1M90C 3E19A 2ZPHB 3PMTA 3OYKA 2WJ9A 3QYBA 1UB4A 4KUIA 1P92A 4IURA 3OS2A 3G4ST 4M75C 2HNIA 5D6WA 4C92E 1YHQA 4M75B 5GAOr 1WQWA 2P0PA 5GAN8 3J7AF 2RJEA 5GAOn 4GLKA 4JS4A 1DJ7B 3L1AA 4A53A 4UC4A 1O75A 2QQAA 3E9FA 3CC4A 1KQSS 1M8VA 1G3TA 3MO8A 4OB2B 1KHIA 3CXCA 3VV0A 4MFDA 3C95A 3I55A 1G3WA 2DJZA 2R57A 5I2MA 1YITA 1BI3A 2DEQA 4AKHA 1G3SA 2RHXA 4BUGA 2XDBA 2MI6A 4PJOC 2DKGA 1N9RA 4QVZA 1VQ6T 2DAQA 1I4K1 4M75G 3M57A 3OYEA 3L42A 4BBRM 2F5TX 5A0DA 3EFRA 4M78A 3JCMV 3TW6A 5GAN5 2OTLA 2O4XB 1H3ZA 4E7HA 2YHTA 2O4XA 1W4SA 3GNFB 4YTLA 1WGSA 2ZCFB 4L6V5 4F7UE 4M78B 3JAME 2C06A 2R5AA 1KQ2A 2LQKA 2QQSA 1RL2A 1K73C 2NLUA 4M77G 4LOCA 1D3BA 3CMET 4MZPA 2YLCA 3DLMA 1G3YA 4M77D 1NE8A 2P4TA 5GAOl 2BUDA 4C8QE 3CD6A 4Y91A 1M4ZA 4BDYA 1Q82U 2Y4YA 4LDYA 4LDXA 1N8RC 5LL6S 4C8QC 2YRVA 3TCJA 2WSFE 1HXDA 1QVGA 1VQLT 2DPPB 4J8OA 2E1HA 3T9NA 4Q5WA 1YJNT 5GANj 3GIBA 3HPWA 3M56A 2FYKA 1KG1A 2L3RA 3SWNC 2RHYA 1OYXA 2DTHA 3M55A 4E47A 4M7AC 3A5ZB 2HBPA 3JCMe 2VUBA 1FX7A 2VGNA 4M77C 1W2BA 3CCJT 4BE2A 2RH2A 2QTXA 2DXBA 1KC8U 3QDRB 4M75D 2KSSA 1OI1A 3C4SA 2PUOB 4NL2A 4BE1A 1VQ4T 4C8QG 1VQKA 2CZ7B 4BI3A 1IREB 3CEYA 4EMGA 1EIFA 3LGFA 3MP6A 3A8LB 1BKBA 3LWHA 2WSEE 3Q1JA 2RI5A 4KT0E 5FU6B 3VYGA 2G3RA 1VQPT 3J80E 3H6ZA 2GFAA 4XQ3A 4OGCA 2LQ8A 3URGA 5CAIA 1VQOT 5FU7B 4HCCA 4M7DB 2FL7A 4F7UA 1QVPA 2FVUA 3O8VA 2E65A 2WSCE 3BY7A 3ZBDA 4C92C 5GAOm 3OBWA 4BD3A 2EIFA 3H8ZA 1VQNA 4V2SA 3MEWA 3OYDA 4XTUA 4TVRA 4MIMA 3X20B 2ZPEB 2RHZA 4BB7A 2JUFA 5LJ5e 1VQ8T 1JBMA 2VXFA 2CZ1B 4PNOA 2FHDA 5C0MA 5GAOp 4RMOA 5FU6C 1M1KC 4ZTFA 5LJ5g 4QQDA 4C5IA 4M77E 1Y96A 3CCRA 2A7YA 4OB1B 1O9SA 3HP9A 4PLLA 2VYTA 3OB9A 4XTWA 4A4EA 2V8IA 2XDPA 4JRQA 1BIAA 3HRTA 3RMSA 3WVEB 4J83A 4HKEA 3VJPA 4C0DB 4A54A 4NC6A 1YJ9T 4II1A 2CKKA 3PNWC 1S72A 1KQ1A 3OY9A 2DVEA 3GOXA 2A3LA 5LJ3d 1K73U 3OS1A 2QDYB 3OW2A 5CQYA 4FU6A 4C92G 3L2RA 4ZGDB 5AYFA 4C8QD 3X26B 5KCOA 4R55A 2QEXA 2V8KA 1I5LA 5LJ3e 2JTMA 4J6WA 3V8KA 1M1FA 2DD4A 5GAMj 1S72T 5GMKe 3CC2T 3M9QA 3VUBA 4BY6C 3JB9I 1K8AU 5CKEA 3X28B 3L2UA 1Q86U 1MHNA 2CZ0B 5GAMh 3OYIA 4XU0A 2RI3A 3QPHA 4N0AA 4LD6A 2QQBA 3EAEA 2LC4A 4KULA 3CC4T 3CCRT 4OP0A 1KC8C 3OYAA 4MZTA 4MMKA 1YJWT 1JJ2S 5GAN7 2XKOC 3JCMg 2X35A 1UGQB 2LDMA 3UT1A 3HHTB 3ME9A 3MEUA 3HO8A 2KR6A 3QJYA 3RMQA 3OS5A 3ZEHA 3PT9A 4F7UF 4BDZA 3JCMP 3C94A 3V8LA 2HQXA 4DOWA 4C8QA 5GAMf 1YIJA 1VQKT 2BIVA 3OSSC 1VQNT 1KD1C 4PL6A 4M7DF 3V7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXI E;  3QZ5 B;  3QYH B;  3QZ9 B;  1QP2 A;  3A8H B;  2ZZD A;  3X25 B;  2ZCF B;  4L6V 5;  2PUK B;  2D0Q B;  2ZPG B;  3A8M B;  3VYG B;  2O01 E;  3WVD B;  1PSE A;  4FM4 B;  2WSF E;  4OB3 B;  4ZGJ B;  2DPP B;  2PVD B;  1AHJ B;  4Y28 E;  1UGP B;  2PU9 B;  2DXB A;  2ZPI B;  2DXB B;  3LW5 E;  2ZPF B;  1PSF A;  2DD5 A;  4XK8 E;  2CZ6 B;  1QP3 A;  2PUO B;  2PVO B;  2CZ7 B;  1IRE B;  3A8L B;  2PVG B;  2WSE E;  4KT0 E;  3VYG A;  4RKU E;  2WSC E;  2CYZ B;  2ZZD B;  5L8R E;  1UGR B;  4OB0 B;  3X20 B;  2ZPE B;  2CZ1 B;  1JB0 E;  2DXC B;  3QYG B;  4OB1 B;  3WVE B;  4ZGE B;  3A8O B;  3X24 B;  2ZPH B;  2QDY B;  4ZGD B;  1UGS B;  3X26 B;  3VYH B;  2AHJ B;  1V29 B;  2DD4 A;  2ZPB B;  3X28 B;  2CZ0 B;  2DD5 B;  1DJ7 B;  4OB2 B;  1UGQ B;  2DD4 B;  3HHT B;  3QXE B;  3A8G B;  2DXC A; 
#chains in the Genus database with same CATH topology
 2WPA B;  3CD6 T;  4D8D A;  3QZ5 B;  3QYH B;  2K9G A;  3CMA A;  4IUU A;  3EFS A;  1TTH B;  1YJW Q;  4BE2 A;  4QVC A;  2K5F A;  5GAN d;  1KFZ A;  3KFV A;  2D0Q B;  1V1C A;  2G77 A;  3CMA Q;  2KVQ G;  3VYG B;  3CCL A;  2DFU A;  3WVD B;  3KBG A;  5HK0 A;  2KR3 A;  1LOJ A;  3LGL A;  1WDX A;  1VQM Q;  2YXY A;  3CD6 Q;  2RF0 A;  1RI0 A;  2DVJ A;  1EZZ B;  1UTI A;  2PVD B;  4EOI B;  1GY3 B;  2VXE A;  2COY A;  1FKM A;  3N5B B;  4RTT A;  4M7A E;  2PHG A;  2D0N A;  1NJI C;  3TNI B;  2EPD A;  1WX6 A;  1E7P A;  1RAG B;  1WHH A;  3H0H A;  3VRY A;  2J6O A;  4CFM B;  2VGM A;  5EG2 A;  2ZPI B;  5HCK A;  4ZTJ A;  4BCK B;  3NHN A;  1H3H A;  2XU8 A;  3EFO B;  1OOT A;  3VRZ A;  3MKD A;  1GUX B;  2F2W A;  4JZ4 A;  1D3B B;  3PFS A;  3MCA B;  3QWL A;  1TU0 B;  2XID A;  2I0N A;  3OYB A;  5IT9 E;  1K0S A;  1UNG D;  5GJV B;  2B8A A;  3NTI A;  2BE9 B;  3JCM W;  1TUG B;  5FRM A;  3DL1 A;  1WQ7 A;  5FWC A;  2KXD A;  1YIJ T;  3FDR A;  3RKW A;  5IN1 A;  4BCF B;  1OL1 B;  1K9M U;  3SB2 A;  1BBZ A;  1N27 A;  2A0F B;  1D09 B;  2W96 A;  5KE3 A;  2C5X B;  4M75 A;  1NG2 A;  3VYH B;  1IHW A;  2K2M A;  2EQU A;  3G4S Q;  1V29 B;  2DXU A;  2ABL A;  4LD9 K;  3BW1 A;  2F69 A;  2B86 A;  5J39 A;  2A28 A;  1NYF A;  3BLR B;  3POM A;  4E7J A;  2DF6 A;  1OU8 A;  4EOP B;  2PJQ A;  2EYW A;  1OGU B;  3EGX A;  1ZBJ A;  3BDU A;  4PJO A;  2O31 A;  1JOW A;  4Z89 A;  3CC4 Q;  5KH6 A;  2LCL A;  2QQ9 A;  3M0U A;  3A8H B;  5HK3 A;  1VQ5 T;  2KYM A;  1CKA A;  4R56 A;  5CCA A;  1AT1 B;  4EOK B;  3A8M B;  3EG9 A;  2BKZ B;  3HZJ A;  2KRN A;  4F17 A;  1KIK A;  4X34 A;  4N4H A;  2NUP A;  2QK0 A;  1K8A R;  4BCO B;  4CRI A;  1QMC A;  1KQS A;  4E7I A;  2V26 A;  1G83 A;  2HD0 A;  3G6E Q;  2F2V A;  2LP5 A;  4KBM B;  5D6Y A;  3RUX A;  1AWW A;  2CP3 A;  4J5Y A;  5IDN B;  1IXD A;  2HZY A;  1Q82 C;  2HDA A;  3JB9 F;  1I1J A;  2D1X A;  5L23 A;  3JCM Q;  3JSC A;  4ME7 A;  2HQH A;  3VS4 A;  4UN0 A;  2E6N A;  2ZPF B;  5CIU A;  4XK8 E;  1G3N C;  1U06 A;  3I56 Q;  2L3S A;  4ZN1 A;  4QQG A;  2HBW A;  1VYV A;  5ECA A;  3NTK A;  2QAZ A;  2FG0 A;  4IIO A;  4M4Z A;  3G1J A;  1YCS B;  4J6X A;  2KT8 A;  2ZZD B;  1M2V A;  3QKJ A;  3OYG A;  1O9K B;  2EWN A;  2C0T A;  4QVD A;  3J81 E;  1ZQ1 A;  4FYX B;  2LTO A;  4HNT A;  1YI2 Q;  1BI2 A;  1CSK A;  1VQ7 T;  4Y72 B;  4M77 B;  2NWM A;  4OMN A;  5LJ3 f;  4OR5 B;  2W0Z A;  1LJO A;  1N9S A;  5GAN f;  3HKS A;  3MP1 A;  3JCM b;  3VS1 A;  1TSF A;  2X4J A;  2JMC A;  4M7D E;  4EC8 B;  3EGD A;  2DXT A;  5IXB A;  3M58 A;  4RG2 A;  2FZC B;  2A08 A;  1X2K A;  4IUQ A;  2XDD A;  2E10 A;  3DB4 A;  1WIE A;  4BI8 B;  2EJF A;  2KMT A;  2VWF A;  4JLG A;  4PK4 A;  3I55 Q;  2JOY A;  3C0C A;  1I81 A;  2JZ2 A;  4J6Y A;  4O5V A;  5I21 A;  2DMO A;  1ZA2 B;  2H8H A;  3BLQ B;  4WF2 A;  2JN0 A;  3X25 B;  2QQR A;  2WMB B;  2A37 A;  1VIE A;  2EQI A;  5GMK l;  3EG1 A;  4G6L B;  5D6X A;  3LWI A;  1YBY A;  2YLB A;  4YOO A;  4C0Z A;  3M53 A;  4RUG A;  2M1H A;  3H4C A;  4QT7 A;  2HQE A;  1AOJ A;  2P84 A;  3TN8 B;  3S3M A;  4ZGJ B;  2CJM B;  2XK0 A;  3H0F A;  3F70 A;  4LE9 A;  5KYX A;  2LJ0 A;  2M16 A;  4JRP A;  3OQ5 A;  2EQM A;  3NTH A;  4M7A B;  3RNJ A;  4OGR B;  1I8F A;  4FIB A;  2RD1 A;  4A4G A;  1BYM A;  2OTL Q;  1IO6 A;  2E70 A;  4E7L A;  1VQK T;  3EID B;  3HRU A;  3NGP A;  3G4S A;  4PJO D;  3P8D A;  2LX7 A;  2PVO B;  1QQJ A;  3CBO A;  1XOV A;  5GAM d;  3GBQ A;  2DL3 A;  4M7A G;  1UGV A;  1VQ9 Q;  4FCY A;  1N8R U;  4BY7 X;  4B9X A;  1OPL A;  4RTY A;  5GMK i;  1VQ6 A;  1H8K A;  4RCB A;  3GTM S;  3VKI A;  1HYO A;  3O0G D;  2QA4 Q;  4M78 F;  4HNV A;  3BLH B;  1Q81 C;  3EGX B;  1WA7 A;  2LQN A;  3DKM A;  3QYG B;  1FMV A;  4EOO B;  4Z6Y A;  5DQV A;  5HKC A;  4JX6 A;  1M90 C;  3HTR A;  2YT6 A;  4RTX A;  3QWX X;  4GLK A;  1DJ7 B;  2AZS A;  1O75 A;  1WHL A;  3MO8 A;  3REB B;  1ARK A;  1WI7 A;  2PZ1 A;  4FYY B;  2DEQ A;  8AT1 B;  4OMP A;  1H25 B;  2DKG A;  1C0M A;  3OYE A;  3L42 A;  3G71 T;  5GAN 5;  2M51 A;  3CCQ Q;  4E7H A;  4F7U E;  1W4S A;  3GNF B;  3JAM E;  1N8R R;  4L6V 5;  1YJN Q;  1GH6 B;  4M77 G;  4MZP A;  2YLC A;  3DLM A;  4E6R A;  2P4T A;  3MIA B;  2RPN A;  4BDY A;  4LDY A;  4LDX A;  4EOM B;  2YRV A;  1XO2 A;  2EW3 A;  3EFO A;  2DPP B;  4J8O A;  1UHC A;  2E1H A;  1YJN T;  1M8M A;  4Q5W A;  5IHN A;  2FYK A;  1WHK A;  2JM8 A;  2L3R A;  3SWN C;  2RHY A;  3M55 A;  4E47 A;  1AZE A;  4M7A C;  2HBP A;  4BCM B;  1FX7 A;  1KC8 U;  3QDR B;  2KSS A;  2PUO B;  1WHJ A;  4C8Q G;  3MJX A;  4BI3 A;  1T3L A;  3CEY A;  1EIF A;  1OX9 A;  3A8L B;  4CC7 A;  2WSE E;  1UUE A;  2HSP A;  4KT0 E;  3VYG A;  1BU1 A;  2G3R A;  2MIO A;  2NUT B;  3H6Z A;  4B6M A;  1VQO T;  5CAI A;  1SSH A;  1TXQ A;  2OI3 A;  2WSC E;  4BD3 A;  1UNL D;  2GTJ A;  2W10 A;  4OMQ A;  5LJ5 e;  4BB7 A;  2VXF A;  2C6T B;  1M1K C;  5EFQ B;  5LJ5 g;  4M77 E;  2DME A;  4OB1 B;  1O9S A;  4JRQ A;  2KT1 A;  3HRT A;  4IMY B;  4II1 A;  2CKK A;  1S72 A;  3OY9 A;  2DVE A;  2A3L A;  5LJ3 d;  2QDY B;  2EBP A;  3VS0 A;  3OW2 A;  3QHR B;  1YIT Q;  3X26 B;  1I5L A;  4J6W A;  3CQT A;  5GMK e;  3JB9 I;  1NEB A;  2FPD A;  1K8A U;  5CKE A;  1QCF A;  2AT1 B;  4CC2 A;  1MHN A;  3DDP B;  3QPH A;  4N0A A;  2QQB A;  1PRL C;  4AT1 B;  1KC8 C;  4MZT A;  3PE0 A;  1ZLM A;  3JCM g;  2X35 A;  1UGQ B;  3UT1 A;  3ME9 A;  3QJY A;  3HO8 A;  3RMQ A;  3ZEH A;  3OS5 A;  3JCM P;  2ZAE A;  5KYU A;  4KRC B;  1VQN T;  2BIV A;  4M7D F;  3QZ9 B;  1QP2 A;  3JRZ A;  3CCL T;  4XTX A;  4M6V A;  2F5K A;  3OYJ A;  5GAN h;  3MP8 A;  1Z9Z A;  1WJR A;  2X9H A;  2WXV B;  2E64 A;  2K3X A;  3QG1 A;  4FT4 A;  2DET A;  4JRK A;  2YRD A;  3HBL A;  1NZ9 A;  3H0I A;  5KYY A;  4BCP B;  1AIS B;  3EG2 A;  4DA4 A;  1VQO A;  4QKU A;  4CFU D;  2ED0 A;  2DZ9 A;  3AHU A;  2PU9 B;  4NS5 A;  1UG1 A;  3CXC S;  1VQM T;  2C4G B;  1YHQ Q;  3M4Y A;  1W6X A;  1SSF A;  1KC8 R;  5BNJ B;  4ESR A;  2FEI A;  1TH7 A;  4HXJ A;  5LJ5 d;  1BI1 A;  4NOY A;  2WIH B;  1KD1 R;  2IW6 B;  1MGQ A;  2QQ8 A;  1ABO A;  1SG5 A;  5AT1 B;  4C0G A;  1RAH B;  3NMZ C;  2DX1 A;  4RTU A;  2RM4 A;  5GMK m;  5IHY A;  2DER A;  5L8R E;  3OYL A;  4PJO G;  3VUZ A;  3PO3 S;  1CKB A;  1U3O A;  1IRX A;  4R0K A;  4M7D C;  1UEB A;  2JM9 A;  4AI6 A;  2H3J A;  1VQO Q;  3S3O A;  2QGF B;  2HAX A;  3MY5 B;  1NYG A;  2HL3 A;  3FIF A;  4M7A D;  1UDL A;  4DEX A;  2WHB B;  4IUV A;  3OW2 P;  3CCQ T;  3A8O B;  2XG8 D;  4DBR A;  4F04 B;  2CP7 A;  5FW9 A;  3HRS A;  3K7A M;  3FB9 A;  2RK1 A;  4PJO B;  5LJ3 g;  2JVV A;  2LW4 A;  1MND A;  2DLP A;  2RHI A;  1X6G A;  4M7D G;  2EJG A;  2QFZ A;  3QYE A;  4J7F A;  1ZP2 A;  4PFO A;  2KEA A;  4XU3 A;  3CBM A;  5HVY B;  5CKH A;  5KE2 A;  3JB9 D;  2LT4 A;  2RB6 A;  2LQW A;  2R5M A;  1K9M C;  2RHU A;  2GTO A;  2JS0 A;  2YWW A;  2DJQ A;  2L5Q A;  1FYN A;  2D9T A;  1WXT A;  1VQ9 T;  2PUK B;  1YCY A;  3PIO A;  2DE0 X;  2O01 E;  2DIL A;  4EOQ B;  2RO0 A;  4JJN K;  4C92 A;  3BG3 A;  3MEA A;  1AWX A;  2CS7 A;  4HNU A;  2OTL T;  2PQW A;  3PTA A;  1VQL Q;  1GCQ A;  1E7O A;  3PVQ A;  3DB3 A;  4EMK A;  4OGE A;  1QVF A;  2I2L A;  1AD6 A;  3UPU A;  1H64 1;  2C5V B;  1X75 C;  3OS0 A;  3OYF A;  4PJO F;  3G6E T;  1U8R A;  3QUI A;  2EYQ A;  4QSH A;  1W2B P;  2GBQ A;  1OU9 A;  1YIJ Q;  2E41 A;  1AWO A;  4M78 G;  2ROT A;  4HCZ A;  1N6A A;  4PJN A;  3VS2 A;  5KYY B;  4KGX B;  4BCI B;  5C6S A;  1OKW B;  3PIP A;  1VQ7 A;  4F7U G;  3I5S A;  3V7S A;  2BS4 A;  1UGR B;  4QQ6 A;  4M75 E;  4QW2 A;  1M2O A;  2M9U A;  4ANJ A;  4ELY C;  5DLQ E;  2EYX A;  4PFZ A;  3P8B B;  1WYX A;  4M78 C;  2L3P A;  2W9Z A;  3CCU A;  1MV0 B;  2EFI A;  3MEV A;  3G6E A;  1W2B S;  2CSI A;  3PGG A;  2PK9 B;  4D6W A;  1I5O B;  3VS5 A;  1QWE A;  1YJ9 Q;  1RAD B;  1OQK A;  2FPF A;  3G7Z A;  5IAY A;  2WEV B;  4J7I A;  2IG0 A;  2QA4 A;  2C0I A;  3UA6 A;  4HA8 A;  1H4L D;  3PVL A;  1Q82 R;  2K57 A;  2OAW A;  5GAN e;  1MMD A;  3VS3 A;  2YRC A;  5KCH A;  2DA9 A;  2EAY A;  3BG5 A;  4O6J A;  1NLP C;  1JEG A;  2L89 A;  5M9O A;  3FLG A;  1KG1 A;  5LMK B;  3E1S A;  1U1T A;  4EMK B;  3M5A A;  2O88 A;  3CXC P;  2R7G A;  4AKI A;  3CPW A;  4KRT A;  4BBS M;  1ZUU A;  2V1Q A;  1OIU B;  4HVW A;  2ZZD A;  4F6S B;  5IHI A;  2COZ A;  4EMK C;  1ZHI A;  2CGH A;  1SEM A;  4N0A C;  1M9S A;  1B34 A;  3THK A;  1JJ2 P;  3QII A;  4EDU A;  1ZUK A;  3RDV A;  3I55 T;  3CMA T;  2MWO A;  2P0K A;  1M3B A;  4C5H A;  1VQ8 Q;  1GBR A;  3JB9 J;  5CVI A;  2E5Q A;  3S6W A;  1PSE A;  1N4M A;  5CK9 A;  2E12 A;  1K0X A;  4C92 D;  4Z8A A;  4PKC C;  1RI9 A;  1QLB A;  2D8H A;  1H28 B;  3QHW B;  2VB6 A;  1HK9 A;  1VQ4 Q;  1ZSZ B;  3OW2 S;  2Z0W A;  5CO7 A;  2K79 A;  4F6W B;  2PMI B;  2DXB B;  3LW5 E;  1PSF A;  1YI2 T;  5LJ3 j;  1GFC A;  3H9N A;  2CZ6 B;  3JCM c;  3V7C A;  2PK2 A;  3FRN A;  2D8J A;  2EYZ A;  1U5S A;  4PLI A;  2QA4 T;  4BAC A;  3ER0 A;  1W98 B;  2E6Z A;  1TWB A;  2CP6 A;  2CH4 A;  1OEB A;  2BPM B;  3CCM Q;  4JX4 A;  2LJ1 A;  4J9B A;  2IVX A;  3VKH A;  3GP8 A;  2NUT A;  2DIQ A;  4XU1 A;  3QSU A;  2EKO A;  2CP0 A;  4XTY A;  1GCQ C;  1LNX A;  2DO3 A;  4XAX B;  1Q86 C;  2EJ9 A;  2L2P A;  2OJ2 A;  5CKD A;  2ENM A;  1C9B A;  3CC2 Q;  4OF1 A;  2RK2 A;  3BG9 A;  4YOZ A;  2JTE A;  2ZPH B;  2DNU A;  4FSS A;  2WJ9 A;  3QYB A;  1UB4 A;  4FYW B;  1FMK A;  4KUI A;  3OS2 A;  3G4S T;  4M75 C;  4J9G A;  2QEX Q;  4M75 B;  1VQ6 Q;  5GAN 8;  3I35 A;  2RJE A;  3L1A A;  4UC4 A;  3E9F A;  1KQS S;  1G3T A;  2OX7 A;  3CXC A;  2B9R A;  3VV0 A;  3MPU B;  1GL5 A;  3C95 A;  1G3W A;  2R57 A;  1BI3 A;  4AKH A;  1G3S A;  3M0Q A;  4BCM D;  2HSE B;  2MI6 A;  4BUG A;  4EOR B;  2DAQ A;  2CRE A;  1TS9 A;  3M57 A;  2F5T X;  1AD5 A;  2OTL A;  3TW6 A;  2YHT A;  2O4X A;  2ZCF B;  4M78 B;  1K76 A;  2QQS A;  1RL2 A;  2NLU A;  3CME T;  1NE8 A;  5GAO l;  4C8Q E;  3EH2 A;  4YOS A;  4Y91 A;  1M4Z A;  1Q86 R;  4GBQ A;  1N8R C;  2C5N B;  3TCJ A;  4ROD A;  4AG2 C;  1QVG A;  2JW4 A;  1LVK A;  1SKU B;  3UF4 A;  1JXM A;  4CFW B;  2VUB A;  2VGN A;  1VQP Q;  2W9F A;  1R0B G;  3EG0 A;  1VYW B;  2QTX A;  2CH4 W;  4NL2 A;  1RAA B;  1VQK A;  1BCM A;  2CZ7 B;  4EMG A;  3MP6 A;  1ZSG A;  1KXU A;  2RI5 A;  4KH1 B;  4F70 B;  2YSQ A;  1VQP T;  2BZX A;  2GFA A;  4XQ3 A;  4HCC A;  5FU7 B;  2FL7 A;  4F7U A;  1QVP A;  2E65 A;  3BY7 A;  3ZBD A;  4C92 C;  3OBW A;  4V2S A;  3MEW A;  2NYS A;  1VQ5 A;  3TNH B;  2KI7 A;  1VQ8 T;  1T0J A;  5L2W B;  1D1B A;  4PNO A;  4A63 B;  4RMO A;  2ED1 A;  1S72 Q;  4FYV B;  4XTW A;  4A4E A;  2XDP A;  1BIA A;  3AT1 B;  3WVE B;  4HKE A;  4A54 A;  4NC6 A;  1M8V A;  3OS1 A;  1M1K R;  5LQF B;  4R55 A;  2QEX A;  4C8Q D;  1FIN B;  3RBB B;  2JTM A;  3V8K A;  1ZSZ A;  2DD4 A;  3J7A F;  3VUB A;  4CFV B;  5GAM h;  2CZ0 B;  3TSW A;  4KUL A;  1IHV A;  2DL4 A;  5IXF A;  3OYA A;  1NM7 A;  1JJ2 S;  5GAN 7;  1QWF A;  1F5Q B;  3OYI A;  3HHT B;  3CC4 A;  1H24 B;  3PT9 A;  1NEG A;  1K9M R;  4CFU B;  4DOW A;  3OSS C;  1LPL A;  3CCV A;  4ATO A;  3VU3 C;  4ROE A;  3FEO A;  3QJ6 A;  4LNP A;  3NPF A;  4A4F A;  3G71 A;  1W70 A;  3L2Z A;  1PG5 B;  2WIP B;  2AZV A;  4JRI A;  2QGG A;  4BCQ B;  1RAC B;  5A0L A;  2O9V A;  4CXA B;  1VQ4 A;  1UFF A;  1O9K A;  1VUB A;  1UJ0 A;  5GAN 6;  3HFO A;  3IQL A;  3GLX A;  4A4H A;  5CYI B;  2LZ6 B;  2DEU A;  1Q95 G;  1YWP A;  1JU5 C;  2E3H A;  5EJC A;  2L8D A;  1IGU A;  2MYS A;  2VC8 A;  2DL5 A;  4JUV A;  4X9C A;  1BI0 A;  1TG0 A;  4JLI A;  1YJN A;  4ELL A;  4DBF A;  4RTV A;  3SHW A;  5FWB A;  3CPW S;  1WLP B;  4FSX A;  3TQ7 P;  2O9S A;  5KYW A;  3M4G A;  1QKW A;  2J6F A;  3UAT A;  1A0N B;  3CPF A;  2K5I A;  1R0C B;  1NJI R;  2NUZ A;  5HBH B;  5GAN 3;  3CC7 T;  2KMG A;  4WTO B;  3QBY A;  1C6V X;  1G8X A;  2LNH B;  2RI2 A;  2FZG B;  1QVF S;  5FLX E;  4AFZ C;  2WAC A;  4GY5 A;  1VIF A;  3CCE T;  4FW1 A;  4C92 B;  1XNI A;  2EVR A;  3RKY A;  2YDL A;  3RER A;  3BHT B;  4AMC A;  2YUN A;  1MUZ A;  2EQK A;  4AG1 C;  4CC4 B;  1RAI B;  2Y90 A;  1ABQ A;  2KRS A;  1WNL A;  2DK3 A;  3OYC A;  4AFU C;  3EHR A;  3X24 B;  2JJ9 A;  2MK5 A;  3M0S A;  1PD1 A;  1YN8 A;  1P5E B;  4MML A;  1QCO A;  2DL8 A;  2KGT A;  2AHJ B;  4F7S B;  3JCM X;  4IUP A;  1RUW A;  1K9A A;  2GCX A;  5LJ3 h;  1YIT T;  5GAM e;  3R6N A;  3JB9 H;  3A98 A;  3LH5 A;  5CEI B;  5GMK h;  1FWZ A;  4M7A F;  1OL2 B;  1VQ7 Q;  2LT1 A;  2XD0 A;  4Z88 A;  4BCG B;  3A8G B;  4DBH A;  3CCR Q;  2UZB B;  1EX4 A;  2QGS A;  1QW1 A;  2ZGW A;  2PTK A;  1GFD A;  2M0Y A;  3CCU T;  4OMO A;  3MI9 B;  1K8A C;  4C5E A;  1JRI A;  2VAS A;  3JCM d;  1X69 A;  2OTJ T;  2FZK B;  1W1F A;  1KHC A;  2J6K A;  1GRI A;  3TEE A;  1QKX A;  4WCI A;  2BKD N;  1VQM A;  4LXC A;  1AZG B;  4OB3 B;  3CCS Q;  1Q7Y R;  2Y4X A;  3LLR A;  4LDV A;  2J06 A;  1Y7X A;  4C0F A;  1KD1 U;  1XTD A;  3CC2 A;  2XIC A;  4ROC A;  2GF7 A;  2V1R A;  5DY9 A;  2F2X A;  3REA B;  4EMH A;  2DRM A;  3FC3 A;  3L2Q A;  3SWN B;  1PCX A;  4M78 E;  1YFN A;  3CCJ A;  4J9H A;  4C8Q F;  2JT4 A;  3HB9 A;  1VA7 A;  1XQH A;  1OI9 B;  4M78 D;  1MMA A;  3UWN A;  3EGD B;  1M30 A;  2PVG B;  2GGR A;  1WJS A;  4X1V A;  3HL8 A;  4NST B;  1B34 B;  4RG8 A;  4BY6 B;  4M77 F;  2CP2 A;  1G5V A;  3BE3 A;  2VV5 A;  1JJ2 A;  3M03 A;  3L2W A;  2RJC A;  1VQN Q;  3CCM A;  1PKS A;  2GQV A;  2JTF A;  4D8K A;  1WJQ A;  3JCM h;  3CCE A;  1B7T A;  3CPW P;  2X4X A;  5GAO q;  1VIN A;  3KHI A;  4BCH B;  3LQ5 B;  3TU4 K;  1Y71 A;  5ICP B;  3CCV T;  5FU7 C;  5CR2 A;  3KXT A;  2ATC B;  3NFC A;  3F5X B;  4BXX X;  2RNA A;  1I07 A;  5GAM g;  1V76 A;  4KGV B;  2KYB A;  4L59 A;  4J9I A;  4M77 A;  4Z02 A;  1VQL A;  5LJ5 h;  3CME A;  2XI9 A;  2BE7 D;  4FL6 A;  2QI2 A;  4JJD A;  2QTV A;  3S3N A;  1XJW B;  3I5R A;  4MFE A;  3OYY A;  2ZPG B;  3PMI A;  2K5L A;  2L3Q A;  1M90 U;  4AFS C;  4DOV A;  4E7S A;  1LCK A;  2QDJ A;  4C8Q B;  4EOS B;  3OYM A;  2LX9 A;  4BI4 A;  5LJ5 j;  1I0C A;  1H27 B;  2DBM A;  3V8J A;  3JCM f;  3EOC B;  4BCN B;  3O5Z A;  4KGZ B;  1HD3 A;  2LNV A;  5CQX A;  3UDC A;  1SHG A;  1C1A A;  2F1L A;  3SWN A;  4E7K A;  3CCS T;  4E7Z A;  2UZD B;  1WZO A;  2X4W A;  3FJP A;  1PC0 A;  2MAM A;  2W99 A;  1BIB A;  2M0O A;  3M0P A;  4B9W A;  3LH0 A;  4J9E A;  1TUC A;  2K7A A;  4FW2 A;  1Y96 B;  2OTJ A;  2KAF A;  2X4Y A;  5LJ5 f;  1PKD B;  1FMW A;  2DTI A;  3OSV A;  2P0Q A;  2BS3 A;  2CYZ B;  2DIG A;  3EJ1 B;  3RIR A;  1PHT A;  5A2Q E;  4N4G A;  3RR6 A;  2F2C A;  4OML A;  2GFU A;  8ATC B;  4BE0 A;  1X6B A;  2RQR A;  4MDW A;  2OAU A;  4EOL B;  4EON B;  4NL3 A;  2W2H A;  3E19 A;  3TNW B;  1D1C A;  3OYK A;  1SHF A;  4IUR A;  1K4U S;  2C0O A;  1GBQ A;  5I22 A;  9ATC B;  1WQW A;  1H1Q B;  1TD6 A;  3FJ5 A;  1D0X A;  3G71 Q;  1ZUY A;  4A53 A;  2QQA A;  2LJ3 A;  4OB2 B;  1KHI A;  1UEC A;  3M0R A;  3I55 A;  1J3T A;  2FPE A;  5I2M A;  4LUD A;  1EFN A;  2XDB A;  4PJO C;  3TVT A;  1VQ6 T;  1MV3 A;  4QVZ A;  2VKN A;  4DEY A;  4BBR M;  5A0D A;  3EFR A;  4M78 A;  3JCM V;  2RN8 A;  2CT3 A;  4CRL B;  2J05 A;  1WGS A;  2KXC A;  1RAB B;  3U23 A;  5HBJ B;  2GNC A;  4J9D A;  4LOC A;  1D3B A;  1X27 A;  5HQ0 B;  1G3Y A;  2QAS A;  2Y4Y A;  2RMO A;  2WSF E;  3I9Q A;  4EIK A;  2FRY A;  5GAN j;  3GIB A;  2DM1 A;  4E2F B;  3M56 A;  4RTW A;  4ORZ A;  3EHQ A;  3RGF B;  2DTH A;  3JCM e;  4M77 C;  1W2B A;  3CCJ T;  4F7N B;  3DDQ B;  3UA7 A;  1VYT A;  2DXB A;  3DJB A;  2QYZ A;  1RAF B;  1OI1 A;  2AK5 A;  3C4S A;  4JPB W;  4BE1 A;  1VQ4 T;  5I5Z B;  1B07 A;  1IRE B;  1TUD A;  3LGF A;  3ULR B;  2G6F X;  1BKB A;  3LWH A;  5IH2 A;  3J80 E;  1VQK Q;  1N5Z A;  4OGC A;  2LQ8 A;  1RLP C;  2EIF A;  3H8Z A;  3D7S B;  4MIM A;  3X20 B;  2JUF A;  4AFQ C;  1JBM A;  5C0M A;  2CZ1 B;  2FHD A;  5GAO p;  1SF9 A;  5KYU B;  4QQD A;  1Y96 A;  3OB9 A;  1Z9Q A;  1KQS P;  3RMS A;  2JMA A;  4C0D B;  2L0A A;  1YJ9 T;  4I3Z B;  1KQ1 A;  2XMF A;  5CQY A;  4FU6 A;  4C92 G;  1M90 R;  3L2R A;  1MMG A;  5KCO A;  2V8K A;  5DQW A;  5GAM j;  4BY6 C;  2JGZ B;  3L2U A;  3MY1 B;  5KYX B;  1YNZ A;  3B57 A;  2LC4 A;  3CCR T;  1Y57 A;  4A4K A;  3MEU A;  2KR6 A;  4F7U F;  2X3X D;  1BCO A;  3C94 A;  3V8L A;  2HQX A;  5GAM f;  1ACM B;  4EC9 B;  2UZL B;  2IPO B;  2ROL A;  3LX7 A;  3MET A;  2I40 B;  3TRE A;  2J7I A;  2RQU A;  4JX5 A;  5EC7 A;  4HLQ A;  2K3Y A;  4F7U B;  4LDW A;  2MMP A;  2KQW A;  1VQ9 A;  2DRK A;  4N4I A;  2LMJ A;  3ZFJ A;  1JO8 A;  1PKT A;  1WXB A;  3NDQ A;  1Q81 U;  1RAE B;  7AT1 B;  2MOX A;  5DLO A;  1AHJ B;  2RJF A;  5GAN g;  2RA2 A;  1E6G A;  3CC7 A;  1OZ2 A;  2FRW A;  5I2S A;  1UGP B;  3M54 A;  2KK4 A;  3CBP A;  1YJW A;  4MDX A;  3BHU B;  4PJL A;  1VOL A;  1X2Q A;  2PNI A;  2CDT A;  1WXU A;  1H1R B;  2G9X B;  2LCC A;  2VVK A;  1NPR A;  2K6D A;  3RKX A;  4OVA A;  1QCN A;  2DL7 A;  4RKU E;  5FGK B;  2IN3 A;  3SD4 A;  1X6O A;  1WHM A;  3HFN A;  2ECZ A;  1NJI U;  1VQ8 A;  2IW9 B;  4BCN D;  1PD0 A;  3LYI A;  4PFP A;  4C5G A;  1JB0 E;  2DYB A;  5J26 A;  1HSQ A;  1JXO A;  1OIY B;  2H3E B;  4II5 B;  3QWY A;  3MHX A;  3HSB A;  2CCI B;  5CKF A;  1D0Y A;  2HKQ B;  4OMF B;  3CME Q;  3ZL7 C;  3EG3 A;  3CCJ Q;  1UE9 A;  3OYH A;  2K3B A;  3JCM J;  4LUE A;  1KSW A;  2KY9 A;  2QXF A;  1M1G A;  2E5K A;  3C12 A;  3L2V A;  4IIM A;  4HCB A;  4L5G A;  5D7U A;  1NPP A;  2AKL A;  5J3B A;  2WMA B;  1JST B;  2DXC A;  4KRD B;  1ZBX A;  2C5O B;  1T3S A;  3R6O A;  4XU2 A;  3EG9 B;  3RES A;  4X9D A;  1GXI E;  5HNB B;  4HT9 A;  4C0D C;  4IUT A;  3VKG A;  4JJB A;  1ZA1 B;  2AIR B;  1IB8 A;  2MWP A;  5GAN 2;  3CCM T;  3CCQ A;  1IZ6 A;  4FX3 B;  2V8J A;  1M3C A;  2HMA A;  4M7D D;  1QLY A;  3G33 B;  1YWO A;  3INZ A;  1JSU B;  1R8O B;  2R58 A;  5GMK j;  4BCJ B;  3CCU Q;  2RQV A;  1H26 B;  4EOJ B;  4FT2 A;  1M5Q 1;  4GLM A;  4MZM A;  1QVG S;  1AEY A;  4Y28 E;  4ZN3 A;  4M7A A;  4HVV A;  5GJW B;  4EPC A;  1Q7Y C;  2HKN A;  2RJD A;  2DD5 A;  3OBY A;  2K2V A;  1QP3 A;  1B3Q A;  3EGU A;  2SEM A;  2DZC A;  1TOV A;  3SDZ A;  4F16 A;  1YJ9 A;  1SRL A;  1YHQ T;  1URC B;  4F7L B;  2AKK A;  3TW7 A;  5FRN A;  2EUF A;  1OUL A;  5IHK A;  2LVM A;  4P5N A;  3CCS A;  1H1S B;  1PRM C;  2D6F A;  3GPL A;  4LDU A;  3QO3 A;  4JDS A;  3OYN A;  2EQJ A;  4LN2 A;  2EGE A;  4OB0 B;  1KK7 A;  1OZ3 A;  1OX8 A;  3E2U A;  2BS2 A;  1GUX A;  1IGQ A;  3VS7 A;  1YP5 A;  1M2V B;  1X01 A;  4JS4 A;  4ZGE B;  4RCC A;  2YUQ A;  4VUB A;  5HBE B;  1ENW A;  4HL4 A;  3I56 A;  3M59 A;  5IDP B;  2QEX T;  1UHF A;  4ELZ C;  1UGS B;  1VQ5 Q;  1X43 A;  2ZPB B;  1ZSZ C;  3E9G A;  1JQQ A;  3BFM A;  4KUD K;  2X3W D;  1UNH D;  2SRC A;  1WFW A;  2DD5 B;  1WPY A;  1WHG A;  5KYN A;  1Q7Y U;  1AWJ A;  2E4H A;  2EGA A;  5GAN 4;  4CC3 A;  2DD4 B;  2K4Y A;  1OKV B;  3QXE B;  1PM3 A;  2FO0 A;  2IIM A;  3CCV Q;  2KE9 A;  5A0G A;  2QF7 A;  4JS5 A;  3WXM B;  4PJO E;  4HT8 A;  1U1S A;  2M02 A;  1VQP A;  2NUP B;  3GNG A;  3BDL A;  1AVZ C;  3QHS A;  2JNG A;  4J9F A;  2I53 A;  4ZNX A;  2XHC A;  3KUF A;  4PJJ A;  3OMC A;  4M75 F;  4FM4 B;  4CFX B;  1GCP A;  2KBT A;  3OA6 A;  2X1N B;  2IW8 B;  1Y07 A;  4XTZ A;  2DTO A;  3OMG A;  3SFM A;  5FRO A;  4AKG A;  1BK2 A;  1S1N A;  4DQ2 A;  2LRQ A;  3GF5 A;  1YI2 A;  3P8H A;  4ELJ A;  2KDS A;  4TTH A;  3TSZ A;  5CKB A;  2MF2 A;  5ACB A;  3DLL A;  1OPK A;  1JKW A;  1MMN A;  2MPX C;  5HY6 A;  1NLO C;  1PNJ A;  2QG9 B;  1M1K U;  2EKH A;  5DM7 R;  3I56 T;  3JB9 G;  1H92 A;  1FXX A;  2IVW A;  2V22 B;  1SPK A;  3DTO A;  4C92 F;  2CUD A;  4M7D A;  4CI0 C;  1K73 R;  2YUP A;  4PJM A;  2DXC B;  4JZ3 A;  2YUO A;  3BHV B;  1KJW A;  3ASK A;  2BZY A;  4XTV A;  3JV3 A;  2HCK A;  3A1P A;  2FB7 A;  2OTJ Q;  3PMT A;  2UZE B;  2CCH B;  1E9H B;  1P92 A;  2A36 A;  1R77 A;  2HNI A;  2CP5 A;  5D6W A;  4C92 E;  1UJY A;  1YHQ A;  1QVF P;  1NBE B;  5GAO r;  4OMM A;  2P0P A;  5GAO n;  2HL5 C;  2QDL A;  2EGC A;  1QVG P;  3CCE Q;  4MFD A;  2DJZ A;  1M3A A;  3QDF A;  1YIT A;  2RHX A;  1Y0M A;  1MNE A;  1VYU A;  1N9R A;  1D0Z A;  2BTT A;  1I4K 1;  2HEQ A;  4M75 G;  2O4X B;  1H3Z A;  1T0H A;  4YTL A;  2RQW A;  2C06 A;  1KQ2 A;  2R5A A;  4BY1 X;  2LQK A;  1K73 C;  2X51 A;  4M77 D;  2WFY B;  3VS6 A;  1FVV B;  2BUD A;  3CD6 A;  1Q82 U;  4J9C A;  5LL6 S;  4C8Q C;  3DOG B;  1HXD A;  4DBQ A;  1VQL T;  2CUB A;  2O2O A;  3T9N A;  5KYW B;  3HPW A;  1VOM A;  4RTZ A;  1OYX A;  5I11 A;  3A5Z B;  1BB9 A;  2RQT A;  2RH2 A;  1PWT A;  1F1B B;  4M75 D;  2UUE B;  2CSQ A;  3Q1J A;  5FU6 B;  2LCS A;  2COW A;  2JXB A;  3URG A;  1D1A A;  6AT1 B;  4M7D B;  1ZX6 A;  2FVU A;  3O8V A;  5GAO m;  4BCQ D;  1SRM A;  3SEM A;  1VQN A;  3OYD A;  4XTU A;  4TVR A;  2RHZ A;  2ZPE B;  2P4R A;  4IKF A;  1TFB A;  5FU6 C;  4ZTF A;  4YC3 B;  5IF1 B;  4C5I A;  1G2B A;  3CCR A;  3H41 A;  2A7Y A;  3HP9 A;  1BU2 A;  4K11 A;  1QMZ B;  2VYT A;  2KRO A;  4PLL A;  1Q81 R;  2V8I A;  1HJD A;  2EYY A;  3CC7 Q;  4J83 A;  1OV3 A;  3EH1 A;  3VJP A;  1RLQ C;  2KRM A;  4Y92 A;  3PNW C;  3GOX A;  4KH0 B;  1K73 U;  2MCN A;  4F6U B;  2DBK A;  4HVU A;  2DYI A;  4ZGD B;  5AYF A;  5LJ3 e;  2ESW A;  4CFN B;  1M1F A;  1S72 T;  4F14 A;  2E3I A;  3M9Q A;  3CC2 T;  3CCL Q;  3X28 B;  1Q86 U;  1M27 C;  4HCK A;  2BZ8 A;  4XU0 A;  2RI3 A;  3M0T A;  4LD6 A;  3EAE A;  3CC4 T;  1D3U B;  4OP0 A;  4MMK A;  1YJW T;  2XKO C;  1K1Z A;  2LDM A;  4F7J B;  2KNB B;  4JJC A;  4BDZ A;  2GQI A;  2JS2 A;  1E6H A;  4C8Q A;  1YIJ A;  1H1P B;  1KD1 C;  4PL6 A;  2CT4 A;  3V7R A; 
#chains in the Genus database with same CATH homology
 3LX7 A;  3MET A;  3CCV A;  3CD6 T;  3TRE A;  3QZ5 B;  3QYH B;  4ATO A;  3QZ9 B;  4JX5 A;  1QP2 A;  3FEO A;  3JRZ A;  3QJ6 A;  4IUU A;  3EFS A;  3VU3 C;  3CMA A;  3CCL T;  4XTX A;  4HLQ A;  4M6V A;  4A4F A;  2F5K A;  3OYJ A;  3L2Z A;  3G71 A;  2K3Y A;  2K5F A;  4JRI A;  4F7U B;  4QVC A;  5GAN d;  4LDW A;  2MMP A;  2D0Q B;  2KQW A;  5GAN h;  1VQ9 A;  5A0L A;  3MP8 A;  2G77 A;  1WJR A;  2KVQ G;  3VYG B;  4N4I A;  1VQ4 A;  3CCL A;  3WVD B;  3KBG A;  2E64 A;  1VUB A;  2K3X A;  3QG1 A;  3ZFJ A;  5GAN 6;  4FT4 A;  3HFO A;  5HK0 A;  1LOJ A;  3GLX A;  3LGL A;  4A4H A;  4JRK A;  1Q81 U;  5EJC A;  2L8D A;  2VC8 A;  1RI0 A;  4JUV A;  5DLO A;  3HBL A;  2PVD B;  1AHJ B;  1NZ9 A;  2RJF A;  5GAN g;  2VXE A;  2RA2 A;  4X9C A;  1BI0 A;  1FKM A;  3N5B B;  3CC7 A;  4M7A E;  1OZ2 A;  4JLI A;  1YJN A;  1NJI C;  4DA4 A;  1VQO A;  3CPW S;  1E7P A;  5I2S A;  1UGP B;  3M54 A;  2KK4 A;  2DZ9 A;  4FSX A;  2VGM A;  3CBP A;  2PU9 B;  4NS5 A;  1YJW A;  3AHU A;  5EG2 A;  2ZPI B;  3CXC S;  4ZTJ A;  1VQM T;  4MDX A;  3M4G A;  3M4Y A;  1SSF A;  2XU8 A;  3CPF A;  2K5I A;  5GAN 3;  3CC7 T;  1TH7 A;  5LJ5 d;  2KMG A;  3QBY A;  1BI1 A;  4NOY A;  4A4K A;  1MGQ A;  1D3B B;  2RI2 A;  2LCC A;  2QQ8 A;  3MCA B;  3PFS A;  1NPR A;  3QWL A;  3RKX A;  4C0G A;  1QVF S;  5FLX E;  4OVA A;  2WAC A;  2XID A;  2RM4 A;  4RKU E;  3SD4 A;  4GY5 A;  5GMK m;  1VIF A;  1X6O A;  5L8R E;  3OYB A;  3HFN A;  3OYL A;  5IT9 E;  4PJO G;  3CCE T;  3VUZ A;  4C92 B;  1XNI A;  3RKY A;  1NJI U;  1VQ8 A;  4IKF A;  4M7D C;  1UEB A;  2B8A A;  3NTI A;  3LYI A;  3RER A;  4AI6 A;  2H3J A;  4C5G A;  3JCM W;  3S3O A;  3DL1 A;  1WQ7 A;  2HAX A;  5FRM A;  1JB0 E;  2EQK A;  2Y90 A;  3FIF A;  4M7A D;  5J26 A;  1YIJ T;  3FDR A;  1WNL A;  3RKW A;  3G71 T;  4IUV A;  2DK3 A;  5IN1 A;  3OYC A;  3CCQ T;  3A8O B;  2XG8 D;  3MHX A;  3HSB A;  5CKF A;  3X24 B;  3HRS A;  1K9M U;  3FB9 A;  3SB2 A;  2RK1 A;  1N27 A;  4PJO B;  4OMF B;  5LJ3 g;  2JVV A;  4MML A;  5KE3 A;  2RHI A;  4M75 A;  3VYH B;  2AHJ B;  3JCM X;  3OYH A;  2EQU A;  4IUP A;  1V29 B;  4M7D G;  2DXU A;  3JCM J;  4LD9 K;  3BW1 A;  2EJG A;  2F69 A;  5J39 A;  2KY9 A;  2GCX A;  2QXF A;  5LJ3 h;  5GAM e;  1M1G A;  2QFZ A;  1YIT T;  3C12 A;  3JB9 H;  3QYE A;  5GMK h;  3L2V A;  4HCB A;  4J7F A;  4E7J A;  1FWZ A;  4M7A F;  4L5G A;  2XD0 A;  2LT1 A;  1NPP A;  4XU3 A;  5J3B A;  3CBM A;  3A8G B;  5CKH A;  5KE2 A;  2DXC A;  3JB9 D;  3R6O A;  1ZBX A;  1QW1 A;  2LT4 A;  2RB6 A;  2ZGW A;  3BDU A;  4XU2 A;  3RES A;  4PJO A;  2R5M A;  1K9M C;  4X9D A;  1GXI E;  5KH6 A;  2RHU A;  4HT9 A;  2LCL A;  4C0D C;  2QQ9 A;  4IUT A;  3CCU T;  3VKG A;  3A8H B;  5HK3 A;  1K8A C;  1VQ5 T;  4C5E A;  1JRI A;  2L5Q A;  4R56 A;  2D9T A;  1VQ9 T;  2PUK B;  2MWP A;  5CCA A;  3JCM d;  5GAN 2;  3CCM T;  2OTJ T;  3CCQ A;  1YCY A;  3PIO A;  1KHC A;  1IZ6 A;  3A8M B;  2O01 E;  3TEE A;  2RO0 A;  3HZJ A;  4JJN K;  1W2B S;  2V8J A;  4X34 A;  4N4H A;  4C92 A;  3BG3 A;  2BKD N;  1VQM A;  4M7D D;  3MEA A;  2CS7 A;  4HNU A;  4CRI A;  1KQS A;  4E7I A;  3INZ A;  4OB3 B;  2HD0 A;  1R8O B;  2R58 A;  2Y4X A;  3LLR A;  2PQW A;  5GMK j;  4LDV A;  2OTL T;  3PTA A;  1Y7X A;  4C0F A;  4FT2 A;  4KBM B;  5D6Y A;  3RUX A;  1M5Q 1;  1KD1 U;  1XTD A;  3CC2 A;  4J5Y A;  2XIC A;  4MZM A;  2GF7 A;  1QVG S;  4EMH A;  5DY9 A;  3DB3 A;  4Y28 E;  4EMK A;  4ZN3 A;  3FC3 A;  4M7A A;  1Q82 C;  3JB9 F;  4EPC A;  4OGE A;  3SWN B;  3L2Q A;  1QVF A;  2I2L A;  3JCM Q;  4M78 E;  3UPU A;  3JSC A;  1H64 1;  4ME7 A;  1Q7Y C;  1X75 C;  3OS0 A;  3CCJ A;  2E6N A;  2RJD A;  4C8Q F;  3OYF A;  2ZPF B;  2DD5 A;  5CIU A;  3OBY A;  2K2V A;  4PJO F;  4XK8 E;  3G6E T;  1QP3 A;  3QUI A;  2EYQ A;  4QSH A;  1U8R A;  3HB9 A;  2DZC A;  2E41 A;  4M78 G;  3SDZ A;  1XQH A;  4M78 D;  3UWN A;  1YJ9 A;  1YHQ T;  4HCZ A;  1N6A A;  2PVG B;  3TW7 A;  4ZN1 A;  4QQG A;  5FRN A;  1WJS A;  3NTK A;  3HL8 A;  5C6S A;  3PIP A;  1VQ7 A;  2LVM A;  1B34 B;  4P5N A;  4RG8 A;  4F7U G;  4BY6 B;  3CCS A;  4J6X A;  4M77 F;  3V7S A;  2BS4 A;  2ZZD B;  3GPL A;  2D6F A;  1UGR B;  3QKJ A;  3QO3 A;  4JDS A;  4LDU A;  4M75 E;  4QQ6 A;  2EQJ A;  4QW2 A;  3OYN A;  3OYG A;  1G5V A;  2VV5 A;  2M9U A;  4ELY C;  2EWN A;  4OB0 B;  5DLQ E;  1JJ2 A;  4QVD A;  3J81 E;  1ZQ1 A;  3L2W A;  1OZ3 A;  2RJC A;  3CCM A;  2LTO A;  4HNT A;  2GQV A;  2JTF A;  2BS2 A;  3P8B B;  4M78 C;  1BI2 A;  1VQ7 T;  4M77 B;  5LJ3 f;  1WJQ A;  1X01 A;  2EFI A;  3MEV A;  4ZGE B;  4RCC A;  3JCM h;  3G6E A;  3CCE A;  3CCU A;  1LJO A;  2X4X A;  3PGG A;  5GAO q;  4VUB A;  3KHI A;  1N9S A;  4D6W A;  5GAN f;  3HKS A;  3MP1 A;  4HL4 A;  3I56 A;  3M59 A;  3JCM b;  1Y71 A;  3TU4 K;  2QEX T;  3G7Z A;  5IAY A;  2X4J A;  4M7D E;  4ELZ C;  1UGS B;  2DXT A;  4J7I A;  2IG0 A;  2QA4 A;  3CCV T;  4HA8 A;  2ZPB B;  3E9G A;  4KUD K;  3BFM A;  3M58 A;  5FU7 C;  5CR2 A;  2K57 A;  3KXT A;  5GAN e;  3NFC A;  4RG2 A;  2DD5 B;  1WPY A;  5KCH A;  2EAY A;  2XDD A;  4IUQ A;  1Q7Y U;  5GAM g;  3BG5 A;  4O6J A;  2L89 A;  2E10 A;  3DB4 A;  5GAN 4;  5M9O A;  3FLG A;  4BI8 B;  3E1S A;  2DD4 B;  1U1T A;  2EJF A;  2K4Y A;  4L59 A;  4EMK B;  3QXE B;  4M77 A;  2KMT A;  4Z02 A;  1VQL A;  5LJ5 h;  3M5A A;  5A0G A;  2QF7 A;  3CME A;  2XI9 A;  4JLG A;  4JS5 A;  2JOY A;  4AKI A;  1I81 A;  3CPW A;  2JZ2 A;  3WXM B;  4FL6 A;  4PJO E;  4HT8 A;  1U1S A;  4J6Y A;  2QI2 A;  4O5V A;  5I21 A;  4BBS M;  1VQP A;  3S3N A;  2ZZD A;  4MFE A;  4WF2 A;  3OYY A;  2JN0 A;  3X25 B;  2QQR A;  4EMK C;  1ZHI A;  2CGH A;  1VIE A;  4N0A C;  1M9S A;  1B34 A;  2ZPG B;  3GNG A;  3PMI A;  2K5L A;  3BDL A;  5GMK l;  1M90 U;  5D6X A;  3QII A;  4DOV A;  1YBY A;  2YLB A;  2JNG A;  3QHS A;  2QDJ A;  4EDU A;  3LWI A;  4C8Q B;  3I55 T;  3CMA T;  2MWO A;  2P0K A;  2XHC A;  4C0Z A;  4C5H A;  3KUF A;  3OYM A;  3M53 A;  3JB9 J;  2LX9 A;  3OMC A;  2M1H A;  3H4C A;  2E5Q A;  5CVI A;  1PSE A;  4M75 F;  3S6W A;  2HQE A;  4BI4 A;  4FM4 B;  2E12 A;  5CK9 A;  3OA6 A;  1VQ5 A;  3V8J A;  4C92 D;  1Y07 A;  3JCM f;  3S3M A;  5LJ5 j;  4ZGJ B;  2XK0 A;  4XTZ A;  3F70 A;  4PKC C;  5CQX A;  2LNV A;  2DTO A;  3UDC A;  1QLB A;  3OMG A;  3SFM A;  2M16 A;  5FRO A;  4AKG A;  4JRP A;  3SWN A;  3OQ5 A;  4E7K A;  2EQM A;  3CCS T;  3NTH A;  4M7A B;  1HK9 A;  3OW2 S;  1I8F A;  4FIB A;  4DQ2 A;  2LRQ A;  5CO7 A;  3GF5 A;  2RD1 A;  1YI2 A;  2X4W A;  4A4G A;  3P8H A;  4ELJ A;  2KDS A;  1BYM A;  3FJP A;  2E70 A;  4E7L A;  2DXB B;  2MAM A;  1PSF A;  3LW5 E;  5CKB A;  5LJ3 j;  3HRU A;  3G4S A;  1YI2 T;  1BIB A;  2CZ6 B;  2M0O A;  2MF2 A;  3P8D A;  3DLL A;  4PJO D;  3JCM c;  2PVO B;  4B9W A;  3LH0 A;  3V7C A;  3FRN A;  3CBO A;  1XOV A;  1Y96 B;  5GAM d;  5HY6 A;  2OTJ A;  2KAF A;  4PLI A;  2X4Y A;  2QA4 T;  4BAC A;  3ER0 A;  1M1K U;  5LJ5 f;  4M7A G;  2E6Z A;  2DTI A;  3OSV A;  5DM7 R;  3I56 T;  2P0Q A;  3JB9 G;  1FXX A;  1N8R U;  2IVW A;  2BS3 A;  4JX4 A;  4B9X A;  1VQ6 A;  2CYZ B;  5GMK i;  4C92 F;  2DIG A;  3RIR A;  4M7D A;  4CI0 C;  4RCB A;  5A2Q E;  4N4G A;  3VKH A;  3GP8 A;  3QSU A;  2DIQ A;  4XU1 A;  3VKI A;  4M78 F;  4HNV A;  2EKO A;  1Q81 C;  2DXC B;  4XTY A;  2GFU A;  3DKM A;  1LNX A;  3QYG B;  2DO3 A;  3ASK A;  4XAX B;  1Q86 C;  2EJ9 A;  4BE0 A;  4XTV A;  5CKD A;  4Z6Y A;  4OF1 A;  4MDW A;  2OAU A;  2RK2 A;  2FB7 A;  3BG9 A;  5HKC A;  4NL3 A;  4JX6 A;  1M90 C;  3E19 A;  2ZPH B;  3PMT A;  3OYK A;  2WJ9 A;  3QYB A;  1UB4 A;  4KUI A;  1P92 A;  4IUR A;  3OS2 A;  3G4S T;  4M75 C;  2HNI A;  5D6W A;  4C92 E;  1YHQ A;  4M75 B;  5GAO r;  1WQW A;  2P0P A;  5GAN 8;  3J7A F;  2RJE A;  5GAO n;  4GLK A;  4JS4 A;  1DJ7 B;  3L1A A;  4A53 A;  4UC4 A;  1O75 A;  2QQA A;  3E9F A;  3CC4 A;  1KQS S;  1M8V A;  1G3T A;  3MO8 A;  4OB2 B;  1KHI A;  3CXC A;  3VV0 A;  4MFD A;  3C95 A;  3I55 A;  1G3W A;  2DJZ A;  2R57 A;  5I2M A;  1YIT A;  1BI3 A;  2DEQ A;  4AKH A;  1G3S A;  2RHX A;  4BUG A;  2XDB A;  2MI6 A;  4PJO C;  2DKG A;  1N9R A;  4QVZ A;  1VQ6 T;  2DAQ A;  1I4K 1;  4M75 G;  3M57 A;  3OYE A;  3L42 A;  4BBR M;  2F5T X;  5A0D A;  3EFR A;  4M78 A;  3JCM V;  3TW6 A;  5GAN 5;  2OTL A;  2O4X B;  1H3Z A;  4E7H A;  2YHT A;  2O4X A;  1W4S A;  3GNF B;  4YTL A;  1WGS A;  2ZCF B;  4L6V 5;  4F7U E;  4M78 B;  3JAM E;  2C06 A;  2R5A A;  1KQ2 A;  2LQK A;  2QQS A;  1RL2 A;  1K73 C;  2NLU A;  4M77 G;  4LOC A;  1D3B A;  3CME T;  4MZP A;  2YLC A;  3DLM A;  1G3Y A;  4M77 D;  1NE8 A;  2P4T A;  5GAO l;  2BUD A;  4C8Q E;  3CD6 A;  4Y91 A;  1M4Z A;  4BDY A;  1Q82 U;  2Y4Y A;  4LDY A;  4LDX A;  1N8R C;  5LL6 S;  4C8Q C;  2YRV A;  3TCJ A;  2WSF E;  1HXD A;  1QVG A;  1VQL T;  2DPP B;  4J8O A;  2E1H A;  3T9N A;  4Q5W A;  1YJN T;  5GAN j;  3GIB A;  3HPW A;  3M56 A;  2FYK A;  1KG1 A;  2L3R A;  3SWN C;  2RHY A;  1OYX A;  2DTH A;  3M55 A;  4E47 A;  4M7A C;  3A5Z B;  2HBP A;  3JCM e;  2VUB A;  1FX7 A;  2VGN A;  4M77 C;  1W2B A;  3CCJ T;  4BE2 A;  2RH2 A;  2QTX A;  2DXB A;  1KC8 U;  3QDR B;  4M75 D;  2KSS A;  1OI1 A;  3C4S A;  2PUO B;  4NL2 A;  4BE1 A;  1VQ4 T;  4C8Q G;  1VQK A;  2CZ7 B;  4BI3 A;  1IRE B;  3CEY A;  4EMG A;  1EIF A;  3LGF A;  3MP6 A;  3A8L B;  1BKB A;  3LWH A;  2WSE E;  3Q1J A;  2RI5 A;  4KT0 E;  5FU6 B;  3VYG A;  2G3R A;  1VQP T;  3J80 E;  3H6Z A;  2GFA A;  4XQ3 A;  4OGC A;  2LQ8 A;  3URG A;  5CAI A;  1VQO T;  5FU7 B;  4HCC A;  4M7D B;  2FL7 A;  4F7U A;  1QVP A;  2FVU A;  3O8V A;  2E65 A;  2WSC E;  3BY7 A;  3ZBD A;  4C92 C;  5GAO m;  3OBW A;  4BD3 A;  2EIF A;  3H8Z A;  1VQN A;  4V2S A;  3MEW A;  3OYD A;  4XTU A;  4TVR A;  4MIM A;  3X20 B;  2ZPE B;  2RHZ A;  4BB7 A;  2JUF A;  5LJ5 e;  1VQ8 T;  1JBM A;  2VXF A;  2CZ1 B;  4PNO A;  2FHD A;  5C0M A;  5GAO p;  4RMO A;  5FU6 C;  1M1K C;  4ZTF A;  5LJ5 g;  4QQD A;  4C5I A;  4M77 E;  1Y96 A;  3CCR A;  2A7Y A;  4OB1 B;  1O9S A;  3HP9 A;  4PLL A;  2VYT A;  3OB9 A;  4XTW A;  4A4E A;  2V8I A;  2XDP A;  4JRQ A;  1BIA A;  3HRT A;  3RMS A;  3WVE B;  4J83 A;  4HKE A;  3VJP A;  4C0D B;  4A54 A;  4NC6 A;  1YJ9 T;  4II1 A;  2CKK A;  3PNW C;  1S72 A;  1KQ1 A;  3OY9 A;  2DVE A;  3GOX A;  2A3L A;  5LJ3 d;  1K73 U;  3OS1 A;  2QDY B;  3OW2 A;  5CQY A;  4FU6 A;  4C92 G;  3L2R A;  4ZGD B;  5AYF A;  4C8Q D;  3X26 B;  5KCO A;  4R55 A;  2QEX A;  2V8K A;  1I5L A;  5LJ3 e;  2JTM A;  4J6W A;  3V8K A;  1M1F A;  2DD4 A;  5GAM j;  1S72 T;  5GMK e;  3CC2 T;  3M9Q A;  3VUB A;  4BY6 C;  3JB9 I;  1K8A U;  5CKE A;  3X28 B;  3L2U A;  1Q86 U;  1MHN A;  2CZ0 B;  5GAM h;  3OYI A;  4XU0 A;  2RI3 A;  3QPH A;  4N0A A;  4LD6 A;  2QQB A;  3EAE A;  2LC4 A;  4KUL A;  3CC4 T;  3CCR T;  4OP0 A;  1KC8 C;  3OYA A;  4MZT A;  4MMK A;  1YJW T;  1JJ2 S;  5GAN 7;  2XKO C;  3JCM g;  2X35 A;  1UGQ B;  2LDM A;  3UT1 A;  3HHT B;  3ME9 A;  3MEU A;  3HO8 A;  2KR6 A;  3QJY A;  3RMQ A;  3OS5 A;  3ZEH A;  3PT9 A;  4F7U F;  4BDZ A;  3JCM P;  3C94 A;  3V8L A;  2HQX A;  4DOW A;  4C8Q A;  5GAM f;  1YIJ A;  1VQK T;  2BIV A;  3OSS C;  1VQN T;  1KD1 C;  4PL6 A;  4M7D F;  3V7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...