1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
2WSFE 2ZCFB 2PVDB 2CZ1B 2CZ6B 1V29B 3A8LB 3HHTB 3A8OB 2O01E 2CZ7B 2ZPIB 3QYHB 2PVOB 2DD4B 1QP2A 1PSEA 4OB2B 2DD5B 2WSCE 2ZPHB 1UGPB 2ZPBB 2DXBB 2PU9B 4ZGEB 4RKUE 5L8RE 1UGRB 1UGQB 2PUOB 4XK8E 2ZZDB 4L6V5 2ZPGB 4OB1B 4KT0E 2AHJB 3A8GB 2QDYB 3X20B 3QXEB 4ZGJB 2CZ0B 3X28B 2ZPFB 3A8MB 1JB0E 3WVDB 3VYHB 2DXCB 2D0QB 2DD4A 4OB0B 2PVGB 3VYGB 1QP3A 2DD5A 3X25B 2PUKB 4ZGDB 4OB3B 4FM4B 2DPPB 2DXBA 2ZPEB 3A8HB 2CYZB 2DXCA 3QZ5B 3LW5E 1UGSB 3QZ9B 3WVEB 3X26B 2ZZDA 3VYGA 1IREB 2WSEE 1AHJB 1DJ7B 4Y28E 3X24B 1PSFA 1GXIE 3QYGB
chains in the Genus database with same CATH superfamily
4RG2A 4XTXA 3KHIA 3S3NA 5CQYA 1WA7A 2JS0A 2FB7A 2RJDA 3LWIA 4AKHA 1ZHIA 3VS4A 3UDCA 4JX5A 3EGUA 2GNCA 1PNJA 4ELJA 1T3LA 3C4SA 1JJ2A 3E9FA 1GL5A 2KRNA 1UJ0A 1X2QA 2YRDA 3SWNC 5DQWA 3KFVA 2WSCE 1LNXA 1UB4A 1XOVA 2ZPHB 2KYBA 3P8BB 3H0FA 4JLIA 3VUZA 3RERA 6AT1B 1LOJA 2KEAA 3GNFB 2HQXA 1QMCA 3O5ZA 3CXCS 4BE0A 1AZEA 4Y72B 3VRYA 4OB1B 4KRTA 4J9GA 1QVFS 2JM9A 1FMVA 2LRQA 1B34A 3PVLA 2EFIA 3EAEA 5GAOp 3DOGB 2FRYA 1PRMC 2V26A 1VQ9Q 5FU7C 3NGPA 2ED1A 4JDSA 1IZ6A 1EIFA 1K9AA 2RHYA 4E7JA 4K11A 2FHDA 2PVGB 2AKLA 1R0CB 2PUKB 1VYUA 1VQMT 3CCSQ 1E6HA 1SHGA 3EG2A 1WHMA 1ZUUA 3CCSA 2J6FA 4BCIB 1YCYA 4OMMA 2E5QA 4O5VA 3LW5E 3OMCA 2C5NB 3ASKA 2BE7D 1QVGA 3H4CA 4BCQD 1ABOA 1I4K1 2M1HA 2ZZDA 3RKWA 4C8QB 3G4SQ 1VIFA 3CCJT 1J3TA 2VC8A 2ENMA 2BS3A 3G4SA 4J5YA 4RTWA 4N4IA 3ZFJA 3VKIA 4Y28E 2YT6A 4PJOE 1M3CA 3CCRT 4BCMB 4BUGA 1GCQC 3OYKA 4F6SB 1SPKA 2EJFA 2C5XB 4NS5A 2HAXA 2FRWA 1YHQQ 3O8VA 4IUTA 4UN0A 3QUIA 1OI9B 1XO2A 1O9SA 2QI2A 1VQLA 1G8XA 1M5Q1 3TVTA 1C9BA 1NYFA 3DL1A 2O01E 3CCVQ 2BE9B 1KHCA 1N8RR 2MF2A 3CCVA 4AFSC 4PJOG 4BCJB 1G3YA 4FW1A 3OSSC 3RDVA 4EPCA 4JJNK 4HVWA 3K7AM 4IIOA 4R0KA 2CCHB 1GCQA 5C6SA 3RKYA 5CKDA 3BLQB 4BI4A 4QVZA 1PD0A 3JCMW 3L1AA 2XDBA 2MPXC 1AEYA 5HCKA 1ENWA 1HK9A 4PJJA 3X28B 1OZ2A 1X75C 5A0LA 4M7DG 2BTTA 1X6GA 3OBYA 1VQ4Q 2F2CA 2E64A 5M9OA 1VQ4A 2RK2A 3PVQA 3MY5B 4LNPA 2X3XD 4RTTA 1Q82U 2K6DA 3F5XB 2DE0X 2K57A 2OTJT 4OR5B 4ZGDB 4OB3B 4FM4B 3A5ZB 2DPPB 5GJWB 4FYWB 4WF2A 1KK7A 1MUZA 2HBWA 3G6ET 2B9RA 3VS3A 4JS5A 4A4HA 4YOZA 4EOOB 2LCCA 1AZGB 4J6WA 1HJDA 4CRIA 2LW4A 3OYDA 2HL3A 1WNLA 4QQ6A 1S1NA 5IHKA 2HD0A 3M0QA 5HY6A 2IW8B 3QWLA 4CFWB 4NL3A 2IIMA 4HCBA 2CT4A 2PQWA 5GAMf 2R5MA 2QG9B 5DLQE 1B34B 5CKBA 3GF5A 1WI7A 4M75F 4A4EA 3VJPA 1KG1A 1UGVA 1CSKA 1PKSA 2DILA 5CKHA 1QVPA 2XG8D 4AG1C 4UC4A 1FMKA 2NLUA 2LCSA 3LLRA 1NZ9A 4A4FA 1AD6A 3BHUB 1M2VA 1OQKA 2CZ7B 4LN2A 4OMPA 3JCMP 2HSEB 2KT8A 1RADB 3SDZA 4FT2A 2DIGA 5EJCA 1PSEA 4F04B 1G3NC 3M55A 4YC3B 3CCLQ 4EMKC 4Z89A 2AT1B 3THKA 1PKDB 3Q1JA 1WYXA 5HNBB 1SG5A 2NUTB 1VQNT 4PJOD 1NJIR 2WIPB 1VQ7T 2XICA 1WHHA 2JNGA 2K3BA 2ZZDB 1UHFA 4KRDB 1OV3A 2J05A 2IN3A 2EYWA 4MMLA 5FU7B 3CCUA 2UZEB 2VVKA 3V7SA 1XJWB 2DBKA 2LNVA 1K76A 2MWOA 4IUVA 2X9HA 3M0PA 2KY9A 3UF4A 3OA6A 3UPUA 2Y4XA 2COYA 4M7DD 1RI0A 1UNGD 2C0OA 2IPOB 2K5LA 5LMKB 2LCLA 4M77B 1YJNQ 1GY3B 2A0FB 3HL8A 4X1VA 1BI1A 4AFQC 1QCOA 2Z0WA 4RCCA 2H3JA 4C0ZA 1RAIB 3M5AA 3URGA 4E7IA 3OQ5A 2G6FX 2ZPEB 2JOYA 3SEMA 5KE3A 4A54A 4OVAA 4PFOA 1OX9A 1JBMA 3NTHA 1FVVB 1Z9QA 4HA8A 2F2VA 3L42A 5GAN7 2F5TX 3TQ7P 3OSVA 1IHWA 2DXTA 2HDAA 1WQWA 4Q5WA 1KC8U 4C0DC 3TW6A 4AG2C 1QCFA 1PD1A 2K9GA 3LWHA 1NG2A 2DMOA 1I81A 2RM4A 2K7AA 2FVUA 5AYFA 1XTDA 1RAGB 1QWFA 5J39A 3QPHA 2JXBA 1V1CA 2FZGB 1UE9A 3CCQA 3A8OB 1OIYB 2GTOA 4HCZA 1TU0B 3J7AF 5GAMe 2E1HA 3BDLA 1LCKA 1WHLA 2XHCA 3FDRA 1D09B 1JOWA 2JUFA 1OGUB 2JTFA 4YOSA 3CC2A 2QAZA 2EVRA 4BCPB 1M9SA 1UGRB 5ECAA 3QWYA 3OYNA 4Z88A 1VQKA 3M59A 1VQ8Q 2ZGWA 1JU5C 1XNIA 2AHJB 1QKXA 3LGFA 3CCEQ 2BS4A 3CD6Q 5HVYB 2CP6A 4C92F 4EOQB 3S3OA 5GAN6 2EW3A 4CFXB 3CD6A 2BS2A 4RTVA 4CFUB 4M7AF 3NTKA 2XDDA 2JW4A 3CPWP 4FU6A 3CCST 3D7SB 3CPFA 4TVRA 1YWOA 2I40B 2QEXQ 5GANd 3H9NA 1MV0B 3VYHB 4M75C 4J6XA 1AWOA 1H26B 5D7UA 2QEXA 2HKQB 4DOVA 2HL5C 2J6OA 2JT4A 1K0SA 1QMZB 2OTLQ 3G4ST 1VIEA 3SHWA 1QWEA 1QLYA 4C8QG 2JM8A 2OTLA 1EX4A 1M2VB 3EGDB 3RBBB 3M56A 3RR6A 4MDWA 2CT3A 2KRSA 2ATCB 2ECZA 4OGEA 1ZA2B 2COZA 2QGGA 2DXCA 1SSHA 2DK3A 3BLHB 2FPDA 4HKEA 4B6MA 1ARKA 3QZ9B 3X26B 2YUNA 1Q81C 3TNIB 2GQVA 1YHQT 2X3WD 4CC7A 1UECA 4LUDA 4CFNB 1GCPA 1EZZB 1VQLT 4M75A 2AZSA 4LDYA 4OMLA 1Q95G 1KQ1A 2L0AA 3EG0A 4X34A 2A37A 2E12A 5D6XA 3CCVT 2RO0A 3CMAQ 2E3IA 2VGNA 1WDXA 3QYEA 3B57A 3G71Q 4F7UF 3CMAA 2WSFE 2EIFA 4EIKA 2ZCFB 1KQ2A 3QHRB 2EJ9A 1GH6B 4GLKA 2HCKA 1HSQA 3M53A 3NFCA 4JRIA 5GMKe 1H3ZA 5KH6A 2GTJA 4HCKA 3MEAA 3M0RA 3BW1A 4PLIA 5GAOl 3G6EA 2JN0A 1VQ4T 5GAOn 2M9UA 3MP6A 3CBPA 1X27A 4QQGA 1PKTA 5KCHA 1OKWB 2Y4YA 3J81E 2ZPGB 3BHTB 2AK5A 2QQ8A 1IRXA 4E7ZA 9ATCB 1IB8A 4BCOB 2JVVA 5CQXA 1G5VA 4FX3B 2CZ0B 2FZKB 3RESA 4DBRA 3A8MB 1JB0E 1MV3A 1IO6A 2DZCA 4MZMA 2COWA 4XQ3A 4M78B 1N27A 4CC2A 4R56A 2D0QB 1D1CA 3F70A 1N4MA 1JQQA 3TNHB 5LJ3f 5I22A 3P8DA 4BY6B 3JCMh 1H92A 3OYFA 2CUDA 1QQJA 4C8QD 4G6LB 1QW1A 4EMHA 3GNGA 5LJ5d 1GBQA 3A8HB 3OYMA 3LH5A 1FXXA 4E7SA 3PO3S 1D1BA 3META 2FPEA 2FO0A 4EONB 3FLGA 1O75A 3VYGA 2O9VA 1TFBA 1ZBXA 1Q86C 5ICPB 4PNOA 4EC9B 4XTYA 4C0DB 2KR3A 5HKCA 1TUGB 2YLCA 3JCMV 3I55Q 1RAHB 4RUGA 4J8OA 3HTRA 5D6WA 5DLOA 3S3MA 2KR6A 4BBRM 4JPBW 2YDLA 3M0TA 3JCMe 1BU1A 2IVXA 1H1PB 4AKGA 1KHIA 2E41A 3EFOB 4M7AC 5GANf 2CZ1B 4QQDA 4LDXA 1N8RU 4F6UB 5HQ0B 3M03A 4FIBA 4M77E 5J26A 5GMKl 4XU1A 2QA4Q 2RMOA 1OL2B 3CCUT 2M51A 2K2VA 4J9HA 1ZUYA 1Q81U 3LX7A 2E10A 2DVEA 2FL7A 2R7GA 3MPUB 2ZPBB 1Y0MA 4XU3A 4C5HA 4RTXA 2EYXA 2DBMA 1N9SA 4M4ZA 5CKFA 4C92A 1LPLA 1H28B 2RK1A 5LL6S 4FL6A 5CR2A 4M7AA 3A8GB 2BUDA 3MP8A 5GMKj 1F5QB 4HXJA 4M77G 2PJQA 4M75B 2OAUA 1H3HA 2ZPFB 3HBLA 1VQPQ 4WTOB 3TU4K 5HK0A 1VQPA 1R77A 3CPWS 1OPKA 3C0CA 1VA7A 2J6KA 4ZN3A 1PHTA 2DRMA 1CKAA 4MZTA 5GAN8 5DM7R 1H1SB 3CXCA 1K9MC 3A1PA 3MEWA 1QVFA 5KYWA 3OS1A 4PJOF 2WFYB 4LE9A 2O4XA 3MEUA 2O9SA 4BDZA 2DL5A 5FWCA 3H6ZA 3QZ5B 4BCNB 2VASA 1K73C 3SWNA 1VQ9A 2YUPA 8ATCB 2CGHA 1ZLMA 5L2WB 1YJ9Q 4ZTFA 2QDJA 1U5SA 4F7NB 3RKXA 3QDRB 1WFWA 3CCQT 5LJ3e 3HRSA 3EH1A 1UHCA 4F7UA 2QDLA 3CC4Q 4LD6A 1PC0A 2KGTA 2DJZA 2DNUA 1Y7XA 1WZOA 2XD0A 3CC4A 5FU6C 2KMGA 2YUOA 3M58A 2WMAB 3MO8A 3QBYA 4ELLA 3CC2T 2V22B 2MK5A 4P5NA 1V29B 3A8LB 1VQKT 2EYYA 3UWNA 1ZSZC 2CSIA 4BCFB 2RQRA 1WQ7A 3L2QA 3BHVB 1PM3A 1W4SA 2XMFA 5CCAA 3G1JA 4JJBA 2PZ1A 2P4TA 2DLPA 1ZX6A 1SRLA 2L5QA 1W70A 1W2BP 1NJIU 3CD6T 1ZBJA 2FG0A 4KUIA 5LJ5f 1TSFA 1OI1A 3M54A 3VS2A 2PU9B 4KGVB 1BYMA 1YHQA 2LT4A 1AWWA 1UGQB 2QEXT 1RL2A 1M90C 4BY7X 2UUEB 3EGXA 1Y07A 1VYVA 4M7DE 2DAQA 1JSTB 1YN8A 1MMAA 1Y96A 3X20B 2OTLT 2BZ8A 2RQVA 1RAEB 2DERA 1UDLA 3MKDA 2VUBA 1ZSZA 3ZL7C 1RLQC 1FINB 3BG3A 4M77D 1OEBA 3C94A 2W9ZA 4M6VA 1Q7YC 4JX6A 1Q81R 3KUFA 1MNEA 4Y92A 2EGEA 3X25B 2Y90A 1VQ6Q 2EBPA 2QQBA 2DZ9A 1VQ6A 2DYBA 2RHZA 3IQLA 4B9XA 3NHNA 2JJ9A 3CMAT 1JSUB 2RNAA 4FSSA 1N6AA 3CC7Q 2L3QA 4VUBA 3VKGA 4OP0A 2PTKA 1R8OB 3LYIA 2YWWA 2WSEE 3POMA 4C92B 2K79A 3V8JA 2MMPA 1GXIE 2EQUA 4EOKB 2XK0A 4M7AB 1D0XA 2E65A 1UG1A 4F70B 3EJ1B 2O88A 4HNTA 1JO8A 3OMGA 3RIRA 4ESRA 1YNZA 4DBFA 1RABB 3DLLA 4M78E 2WMBB 4EMGA 4MMKA 4JUVA 2HNIA 1M1FA 4XTUA 1MMDA 3QIIA 4JZ3A 2RHUA 5L23A 1GUXA 4AFUC 3M9QA 4PJMA 1TUDA 4IUQA 1AISB 4HL4A 1HYOA 4FSXA 4YOOA 2KK4A 2NUZA 5FGKB 1TG0A 4C5GA 3QHSA 2DKGA 4BDYA 3JCMX 5KYNA 5KYWB 5FWBA 2DTIA 4PJOC 2O4XB 3QWXX 3BE3A 2QK0A 2LX9A 2C5VB 3C95A 3DJBA 4M78G 3SWNB 1GRIA 2RJCA 3OW2P 1AOJA 2IW9B 2A28A 3CEYA 3R6NA 4KH1B 4BD3A 4F7UB 5FLXE 2KQWA 3OYEA 4DQ2A 1G3WA 3DDPB 4CRLB 3GIBA 2EAYA 4QT7A 3SB2A 3I35A 3CCLA 2KE9A 2DTHA 4JS4A 3VU3C 5KYYA 1E6GA 4II5B 4N0AC 1JXOA 2DVJA 4BB7A 4OB0B 1T0HA 3LGLA 1QP3A 1Q86R 2D6FA 1VUBA 4QKUA 2F2XA 4ZN1A 2K3XA 4IUPA 2RQWA 2YUQA 2DXBA 3TREA 3REAB 2DL3A 2BPMB 5CO7A 3HO8A 3OYYA 3JSCA 3PMIA 5D6YA 2KXDA 2P0KA 4BCGB 2AIRB 4LDWA 4EMKA 5FU6B 1BU2A 4Z8AA 2WACA 1KQSP 2HMAA 1YJNA 2CH4A 3EGXB 5IHNA 1Y96B 2WPAB 1FKMA 4HLQA 4L5GA 2DF6A 1ZSGA 3QSUA 3QDFA 3TN8B 3QKJA 1ZSZB 2LDMA 4E7KA 1M1KC 4C5EA 2JZ2A 4BE1A 2G9XB 3QO3A 5A0GA 2CZ6B 5GAMh 2RHXA 2AKKA 2WXVB 4OMFB 2PK9B 4A4GA 4J9IA 1E7PA 4IUUA 4B9WA 3HKSA 1OKVB 4M75G 2GGRA 1VQPT 2DXUA 1JKWA 1YJWQ 1X6BA 1M4ZA 4PK4A 2CP2A 1YJWA 4QVDA 2XDPA 2LZ6B 2K5FA 2RHIA 3HSBA 2FPFA 5I11A 3JB9G 3GOXA 5A0DA 2LNHB 3E19A 4M78D 1K9MR 3HRTA 3BG9A 2R57A 2BIVA 3BDUA 2L3RA 4TTHA 3RGFB 2YXYA 1I0CA 4XU2A 5GAOm 2R5AA 2ROLA 1B07A 2X51A 1WHKA 1K4US 3L2RA 5FROA 1NBEB 2E70A 1K73R 1VQ9T 4C8QE 2WEVB 2I53A 4MFEA 4KBMB 1A0NB 1VQMQ 1YI2Q 3VS5A 1GUXB 2M02A 3M4GA 1YJ9T 1VQ8A 1YI2A 1BI3A 2GQIA 2CREA 3CCEA 3PT9A 2FEIA 1VINA 2KI7A 2LC4A 2P0QA 3CC4T 1OOTA 3CCJQ 2D0NA 1H641 3EIDB 1JJ2P 1PCXA 2OX7A 2QQAA 3OY9A 4EORB 1IGUA 3OS5A 3VS0A 4LDUA 1OPLA 4ELYC 1HD3A 1QLBA 3QJ6A 2GFUA 4FYXB 3JCMJ 4MIMA 1MHNA 1KIKA 1FYNA 3V7CA 4EC8B 3MJXA 1BCOA 4KRCB 5HBHB 3EH2A 4C5IA 3TW7A 2M16A 4L59A 5KYUA 5GMKh 5HBJB 2E6NA 2VV5A 4A4KA 3HRUA 2ESWA 3ZBDA 2EQIA 4J83A 3PIOA 1MMNA 4RTYA 4BBSM 1K8AC 5KYYB 2G3RA 1M90R 2CS7A 3SD4A 2DTOA 3FB9A 4KGZB 4N4GA 2C5OB 3KBGA 4OMQA 3DLMA 5AT1B 2DXBB 4XTWA 4KH0B 1YBYA 3G71A 3L2UA 5ACBA 1G3TA 2RH2A 1Q7YR 2V8IA 1SEMA 4EDUA 4M75D 5GMKm 4ANJA 4EMKB 2QDYB 3E2UA 3OW2S 2E3HA 5CKEA 2DMEA 3JCMQ 3V8LA 1M1KU 3G7ZA 1QVGP 2X35A 4A63B 1VQ6T 3UT1A 1QCNA 2RI3A 5A2QE 3JB9D 2DEUA 1NPPA 2EYQA 3H8ZA 4E6RA 2DD4A 3NMZC 2DD5A 1VQ5Q 3MI9B 1V76A 3QHWB 1VQ5A 1VOMA 5GAMj 2DJQA 4BCND 4D8DA 2DYIA 4C92G 2NYSA 3I5SA 2GF7A 2QASA 4M7AG 2KBTA 1D0ZA 4F7JB 1C1AA 1BB9A 3QYBA 4EOMB 4X9CA 2C0IA 3VS1A 4M77F 4LD9K 1DJ7B 4ELZC 3PFSA 2A7YA 2KYMA 5C0MA 1TH7A 1UTIA 2HKNA 4F16A 3H41A 1U06A 1M3BA 2LTOA 3E9GA 4II1A 3PGGA 2HBPA 2W2HA 2LJ1A 1OU8A 4BCMD 3OYCA 3PE0A 4F7LB 1M27C 3AHUA 5IHYA 3DKMA 2ZPIB 2MYSA 5KYXA 2LQNA 1D3BA 4FCYA 2D8JA 3NPFA 4XTVA 1LJOA 3RUXA 3EFSA 1H8KA 1M2OA 1VYWB 4RTZA 3I55A 1PWTA 2H3EB 1KD1C 2K5IA 4LDVA 4C0GA 2YHTA 1PG5B 1SHFA 5GAMg 2W10A 3CCLT 2W96A 2PUOB 1H24B 2LQWA 2KRMA 1WGSA 2RI2A 2XIDA 2L8DA 3NTIA 2E4HA 3QXEB 4J7IA 4AKIA 1ABQA 2DIQA 2QA4A 1W98B 5CAIA 3WVDB 1BCMA 1MGQA 1VYTA 1D1AA 1K1ZA 3CBMA 2OI3A 2DXCB 1NEBA 1G3SA 4E7LA 2P0PA 5KYUB 3L2WA 1UJYA 1T3SA 3FC3A 5CK9A 1N9RA 3MEVA 1YJNT 5GAN4 4JRPA 5DY9A 3P8HA 1YCSB 3FJ5A 5CVIA 2A36A 3ULRB 4F7SB 1O9KA 2WHBB 3CBOA 5KCOA 3MP1A 3BLRB 3O0GD 4C92D 2QF7A 4GBQA 3CPWA 1JJ2S 2FYKA 1M1KR 2MOXA 5LJ3h 1IREB 4M7AD 3HZJA 3I56Q 2KMTA 2YSQA 3EFRA 3I56A 1VOLA 2VGMA 4AMCA 3X24B 1Q82C 5FRNA 1WHJA 1ACMB 2QGSA 4PKCC 1BI0A 1WX6A 2VWFA 4IIMA 1WXBA 2HQEA 2P84A 1OULA 5LQFB 2W9FA 2J06A 2ABLA 1WHGA 1E9HB 1YJWT 3HHTB 3NDQA 5GAMd 2EGCA 1I1JA 4M7DF 1YJ9A 3QYHB 2DD4B 2CSQA 4O6JA 3DB3A 3V7RA 1B7TA 3JRZA 2DD5B 1GBRA 3DDQB 2PK2A 4JLGA 3OYJA 5GANh 3JCMc 1WXTA 4PJLA 2PMIB 3J80E 1RACB 5IHIA 2KAFA 5IH2A 2LQ8A 4X9DA 1M8VA 4JX4A 3PMTA 3JB9I 4LOCA 3OBWA 2V1RA 4BCHB 1HXDA 5GAOr 2YLBA 3UA6A 5CYIB 1W1FA 3S6WA 1VQ8T 4F14A 4EOIB 1YI2T 2RPNA 4M77C 2O31A 3CCET 4ATOA 1H1QB 1QVGS 2ZAEA 2NUTA 1TTHB 5IDPB 1AVZC 5EFQB 3TCJA 2CP5A 4CFVB 4KGXB 1Q86U 1KXUA 2CUBA 5GANe 4NSTB 2MAMA 5BNJB 4NL2A 2ROTA 3GLXA 2RD1A 2MI6A 2DA9A 1MNDA 1SKUB 2XU8A 3M0SA 2EQKA 2CP7A 3VYGB 5I2MA 4YTLA 1KD1U 3EG3A 2KNBB 1IHVA 1U1TA 1AWJA 2BKZB 5KYXB 1D3BB 1G83A 5GAN2 1U1SA 4RTUA 4EOLB 3EOCB 4FW2A 4F17A 2X1NB 1UGSB 2EGAA 4M77A 4I3ZB 4M78F 4FYYB 1VQLQ 4XU0A 3RNJA 4LUEA 2GBQA 1SSFA 2VB6A 1OYXA 2DO3A 1YITQ 1K8AR 4OMOA 1YITA 1W6XA 3LQ5B 5KE2A 1RUWA 1WXUA 2L3SA 4ORZA 1NE8A 1I8FA 1NLPC 4QSHA 2RN8A 4AT1B 1AT1B 7AT1B 1VQOQ 1GFCA 2A3LA 1FWZA 2CKKA 1VQOA 3G71T 5FRMA 1X6OA 1ZUKA 2KSSA 2PNIA 2K4YA 3CC7A 3T9NA 2RF0A 1CKBA 2JS2A 1M30A 3JCMg 1UFFA 4BE2A 3OYBA 4EOPB 5GAN5 1YIJQ 1O9KB 4J9BA 4PL6A 3M0UA 8AT1B 1KC8C 1YIJA 3H0HA 3M57A 1UEBA 4OGCA 1K9MU 1OX8A 2RA2A 4A53A 1D3UB 2SEMA 3OYHA 1G2BA 2LQKA 3BG5A 4ZGJB 5LJ5h 3A98A 5LJ3j 2BZXA 1D0YA 1VQ5T 1K73U 4RCBA 4KULA 1H27B 3TNWB 3GTMS 2EJGA 1NPRA 1KSWA 3CMEQ 2LJ0A 2G77A 2MIOA 3CMEA 3ER0A 2KT1A 1JXMA 5IDNB 3DB4A 3PNWC 3QG1A 5GJVB 3HFNA 2HQHA 2X4YA 4CFUD 2M0YA 2X4XA 2LMJA 3ZEHA 2DM1A 4RODA 2NUPA 1LVKA 4D8KA 4BACA 4M7DC 2D9TA 3CCMQ 1AWXA 5GAOq 1YWPA 2I2LA 3FJPA 4CC3A 2GFAA 5LJ5e 3RMSA 3CCMA 2UZLB 2LJ3A 2RQUA 3DTOA 1RLPC 3OYGA 5EG2A 2RJFA 4MDXA 2BZYA 5GANj 2QQ9A 5GAN3 3JB9F 4PJOA 4BCQB 1F1BB 3EGDA 2DFUA 3ME9A 4KUDK 2E5KA 2B8AA 3QYGB 2A08A 3R6OA 4OF1A 4E47A 1TS9A 3OB9A 3WXMB 4CI0C 4R55A 3JCMd 4WCIA 3I55T 1QKWA 4JJCA 2O2OA 3L2VA 1KD1R 1M90U 1Z9ZA 2WIHB 4MFDA 2V8JA 5LJ3g 4M7DA 2E6ZA 1WLPB 2KVQG 3TSZA 2CDTA 3CQTA 3CCUQ 1S72Q 1RI9A 2P4RA 4Z02A 1P92A 4FYVB 2VXFA 1S72A 5J3BA 2EYZA 4AI6A 4N0AA 1ZA1B 4M75E 2QA4T 1I5OB 1Q7YU 1T0JA 3FIFA 4PJNA 1UUEA 1I07A 2DL7A 2JGZB 4C8QF 4XK8E 4L6V5 4F6WB 4M78C 4KT0E 2QQSA 2QTXA 4PFPA 3HFOA 4J9CA 4IKFA 3HB9A 5GANg 2IG0A 4XAXB 4ME7A 1ZP2A 1W2BS 4BY6C 3JCMb 1GFDA 2EKHA 1W2BA 2X4JA 3GPLA 2V8KA 4IMYB 4BI8B 2ED0A 4HT9A 4C0FA 4Y91A 2EUFA 2VYTA 1C0MA 2DETA 3I56T 1WJQA 4J9EA 4FT4A 4QW2A 4RG8A 4XTZA 1KFZA 1Q82R 1OIUB 4M78A 1WJSA 2YRVA 3MHXA 1BIAA 2RB6A 5FW9A 3GP8A 2CYZB 1BK2A 2B86A 1X69A 5CIUA 4PFZA 1C6VX 2YRCA 3VUBA 4E2FB 3CCQQ 3OS0A 1SF9A 2KXCA 5GMKi 5IXBA 3G33B 5LJ3d 1H1RB 1NYGA 1AHJB 3EG1A 1X43A 2UZBB 1PSFA 2QQRA 4DEXA 1VQMA 4CFMB 4DOWA 2JTEA 3PTAA 1YFNA 3OYLA 2PHGA 3BFMA 1H4LD 2EKOA 2OAWA 2LT1A 3CC2Q 2OJ2A 2L2PA 3VV0A 2DL4A 2XI9A 5LJ5j 1VQKQ 1UNHD 4ROEA 2PVDB 2F69A 3CCJA 3VKHA 2QFZA 4J9FA 2JMAA 2EWNA 1EFNA 2DX1A 1TD6A 3CCRQ 1H25B 3BY7A 2PVOB 3CCRA 2IW6B 1R0BG 3MY1B 3GBQA 1X2KA 3VS6A 4BI3A 1QP2A 1JEGA 3EG9A 3TEEA 3UA7A 3M4YA 4PLLA 5I2SA 2QXFA 3EFOA 4NOYA 3JB9J 3MCAB 2NUPB 1X01A 3OS2A 1UGPB 4BXXX 2QGFB 3E1SA 2XKOC 5DQVA 3CXCP 5I5ZB 2IVWA 2W99A 2C06A 2HEQA 1QVFP 1TUCA 3FEOA 3EHQA 3RMQA 3KXTA 4BY1X 1N8RC 4PJOB 4ZNXA 2M0OA 2I0NA 2HZYA 3I9QA 1BIBA 2D8HA 1URCB 3JCMf 2V1QA 2LX7A 2CP0A 1IGQA 5I21A 2C0TA 4OGRB 3VS7A 3FRNA 4EOSB 1RAFB 4V2SA 1K0XA 2L89A 4CC4B 4M7DB 1TWBA 2EPDA 4MZPA 1FX7A 4Z6YA 2AZVA 5LJ5g 2K3YA 1M8MA 4C92E 4DEYA 1WPYA 1OZ3A 1N5ZA 3QJYA 4EOJB 3OW2A 2UZDB 4M7AE 2CJMB 1YITT 2K2MA 4LXCA 1YP5A 4HCCA 4DBQA 3MIAB 1B3QA 4HT8A 1P5EB 1E7OA 2RQTA 2J7IA 3WVEB 1U3OA 1I5LA 4GLMA 3L2ZA 2EQJA 2MWPA 1UNLD 1VQOT 2OTJQ 2LP5A 1BBZA 1M3AA 3JB9H 2MCNA 3H0IA 3INZA 1WJRA 2OTJA 3EHRA 3I5RA 3CC7T 2D1XA 1Y57A 2JMCA 4JRKA 3OYAA 2RJEA 4C8QC 1BI2A 3G6EQ 3HP9A 4J7FA 2CCIB 4BCKB 1TOVA 4E7HA 1XQHA 4JRQA 2DL8A 1YIJT 1RAAB 1KC8R 1TXQA 4HVVA 1PRLC 2DEQA 2X4WA 2QYZA 2FZCB 4D6WA 4JZ4A 1FMWA 2DRKA 3OYIA 1JRIA 3UATA 5CEIB 5IAYA 1KQSS 4OB2B 2RI5A 1SRMA 1KQSA 4JJDA 1M1GA 4AFZC 4F7UE 2H8HA 4C8QA 3HPWA 1NLOC 1AD5A 4HNUA 4NC6A 3JV3A 5HK3A 3JAME 4ZGEB 1Y71A 2CP3A 4RKUE 2C6TB 5L8RE 3PIPA 5IXFA 5IN1A 2SRCA 3SFMA 4RMOA 4ZTJA 3CMET 2LVMA 1KJWA 2BKDN 3AT1B 5IT9E 5EC7A 4DA4A 4GY5A 4J6YA 2VKNA 2C4GB 5HBEB 4OMNA 1U8RA 3U23A 1VQNQ 1NM7A 3V8KA 3C12A 2L3PA 1VQ7Q 2KROA 3CCMT 1NJIC 1VQNA 4F7UG 1BKBA 4DBHA 1VQ7A 3VRZA 3REBB 4ROCA 2QTVA 1OU9A 1WIEA 1IXDA 4HNVA 4IURA 2HSPA 4HVUA 2WJ9A 4N4HA 2F5KA 2VXEA 1NEGA 2EQMA 5IF1B 4C92C 1MMGA 4QVCA 3EG9B 2F1LA 4J9DA 2W0ZA 3N5BB 2CH4W 1K8AU 2JTMA 2R58A 4CXAB 3TSWA 2KDSA 3LH0A 2F2WA 2GCXA 1ZQ1A 1OL1B 1S72T 2NWMA
chains in the Genus database with same CATH topology
1Y96B 5D6XA 5KE2A 3CCVT 2RO0A 4RG2A 1FKMA 4HLQA 4L5GA 4XTXA 1NE8A 2VGNA 3QYEA 3KHIA 1I8FA 5CQYA 3S3NA 3QSUA 4QSHA 2FB7A 3QKJA 2RJDA 4F7UF 3LWIA 4AKHA 2WSFE 2EIFA 3CMAA 1ZHIA 2LDMA 3UDCA 4E7KA 2ZCFB 4JX5A 1M1KC 2A3LA 4C5EA 2JZ2A 1KQ2A 1FWZA 4BE1A 2CKKA 1VQOA 3QO3A 5A0GA 3G71T 2CZ6B 4ELJA 5FRMA 1X6OA 5GAMh 2RHXA 2EJ9A 2KSSA 3C4SA 2K4YA 4GLKA 1JJ2A 3CC7A 3E9FA 3T9NA 4OMFB 3M53A 3NFCA 4JRIA 5GMKe 1H3ZA 3JCMg 5KH6A 4BE2A 4A4GA 3MEAA 3SWNC 2WSCE 1LNXA 1UB4A 1XOVA 2ZPHB 3BW1A 4PLIA 1E7PA 4IUUA 4B9WA 5GAN5 5GAOl 3OYBA 3HKSA 2JN0A 3G6EA 4M75G 3P8BB 1VQ4T 5GAOn 4JLIA 2M9UA 4PL6A 3MP6A 3CBPA 1VQPT 3VUZA 2DXUA 1KC8C 1YIJA 3RERA 4QQGA 1LOJA 1M4ZA 3GNFB 2HQXA 3M57A 1UEBA 4OGCA 5KCHA 1K9MU 3CXCS 4BE0A 4QVDA 2Y4YA 3J81E 1YJWA 2ZPGB 2XDPA 4OB1B 2QQ8A 2RA2A 4A53A 1QVFS 2K5FA 2LRQA 2RHIA 3HSBA 3OYHA 2JVVA 5CQXA 3GOXA 3JB9G 2LQKA 1G5VA 1B34A 3BG5A 4ZGJB 5A0DA 3E19A 2CZ0B 2EFIA 3EAEA 5LJ5h 4M78D 5LJ3j 3HRTA 3BG9A 3RESA 1VQ5T 2R57A 5GAOp 2BIVA 1K73U 3BDUA 3A8MB 1JB0E 2L3RA 4XU2A 4RCBA 4KULA 5GAOm 2R5AA 4MZMA 2DZCA 4XQ3A 4M78B 5FU7C 1N27A 2EJGA 1NPRA 3L2RA 4JDSA 2G77A 1IZ6A 1EIFA 2E70A 5FROA 4R56A 1VQ9T 4C8QE 2D0QB 4MFEA 3F70A 3CMEA 2RHYA 4E7JA 4KBMB 3ER0A 2FHDA 3DB4A 3PNWC 3QG1A 2PVGB 3HFNA 2X4YA 3M4GA 1YJ9T 5LJ3f 2X4XA 1VQ8A 2PUKB 1YI2A 1BI3A 3P8DA 3ZEHA 4BY6B 3JCMh 3OYFA 1VQMT 4BACA 3CCEA 4M7DC 2D9TA 3PT9A 4C8QD 4EMHA 1QW1A 5LJ5d 3GNGA 2LC4A 3CC4T 2P0QA 3A8HB 2I2LA 3FJPA 5GAOq 3OYMA 1FXXA 2GFAA 3CCSA 4MDXA 1YCYA 5LJ5e 3META 1H641 2E5QA 4O5VA 3RMSA 3LW5E 3OMCA 3CCMA 3ASKA 1QVGA 3H4CA 2M1HA 1I4K1 2ZZDA 3RKWA 4C8QB 2QQAA 3FLGA 1O75A 1VIFA 2RJFA 5EG2A 3OY9A 3VYGA 3OYGA 2VC8A 2QQ9A 3CCJT 3OS5A 5GAN3 5GANj 1ZBXA 2BS3A 3G4SA 3JB9F 4PJOA 1Q86C 4LDUA 4J5YA 4PNOA 4N4IA 4C0DB 4XTYA 3ZFJA 1QLBA 4ELYC 3VKIA 4Y28E 4KUDK 3ME9A 3QJ6A 5HKCA 2GFUA 2B8AA 3QYGB 4E47A 3R6OA 4OF1A 3CCRT 2YLCA 3JCMV 3OB9A 3WXMB 4BUGA 3JCMJ 1MHNA 4MIMA 3OYKA 4CI0C 3V7CA 4R55A 4J8OA 3JCMd 5D6WA 5DLOA 3S3MA 2EJFA 2KR6A 4BBRM 4NS5A 3I55T 2HAXA 3JCMe 4C5IA 3O8VA 4IUTA 4AKGA 1KHIA 2E41A 3QUIA 3L2VA 1M90U 4M7AC 4MFDA 3TW7A 2M16A 2V8JA 2E6ZA 2CZ1B 2KVQG 4L59A 4QQDA 5LJ3g 5GANf 1O9SA 1N8RU 2QI2A 5GMKh 4LDXA 2E6NA 2VV5A 4A4KA 3HRUA 3ZBDA 4J83A 3PIOA 4FIBA 4M77E 1VQLA 4BBSM 1M5Q1 1K8AC 4Z02A 5J26A 5GMKl 1P92A 4XU1A 3DL1A 2G3RA 2O01E 2VXFA 2CS7A 1S72A 5J3BA 3SD4A 2DTOA 1KHCA 2MF2A 3CCUT 3CCVA 4AI6A 3FB9A 4N0AA 2K2VA 4N4GA 4M75E 2QA4T 1Q81U 4PJOG 1G3YA 3LX7A 1Q7YU 2E10A 3OSSC 3KBGA 4EPCA 2DVEA 4JJNK 2FL7A 3DLMA 2ZPBB 2DXBB 4XTWA 5C6SA 3FIFA 4XU3A 3RKYA 1YBYA 5CKDA 3G71A 3L2UA 4C5HA 4PJOE 4BI4A 4QVZA 3JCMW 1G3TA 1N9SA 3L1AA 2RH2A 5CKFA 2RK1A 2V8IA 4XK8E 4C8QF 4L6V5 4C92A 4M75D 5LL6S 4EDUA 4FL6A 4KT0E 4M78C 5GMKm 5CR2A 4M7AA 3A8GB 2BUDA 3MP8A 1HK9A 2QQSA 2QTXA 2QDYB 4EMKB 5GMKj 3OW2S 3HFOA 3X28B 1OZ2A 1X75C 4M77G 5CKEA 5A0LA 4M75B 3JCMQ 3V8LA 4IKFA 3HB9A 2OAUA 5GANg 1M1KU 3G7ZA 2X35A 3OBYA 2IG0A 2ZPFB 3HBLA 1VQ6T 4XAXB 2E64A 3UT1A 5A2QE 2RI3A 5M9OA 3JB9D 3TU4K 4ME7A 1VQ4A 5HK0A 2RK2A 1VQPA 1W2BS 4BY6C 3JCMb 3CPWS 1W2BA 1NPPA 2X4JA 3GPLA 2V8KA 2EYQA 3H8ZA 4ZN3A 4BI8B 1Q82U 4HT9A 2DD4A 4MZTA 5GAN8 5DM7R 3CXCA 4C0FA 2DD5A 2K57A 4Y91A 2OTJT 2VYTA 1K9MC 3I56T 3MEWA 1QVFA 1WJQA 3OS1A 4FT4A 4QW2A 4PJOF 4RG8A 4XTZA 4ZGDB 1VQ5A 5GAMj 4OB3B 4FM4B 2O4XA 3A5ZB 3MEUA 4M78A 4C92G 2DPPB 1WJSA 2GF7A 2YRVA 4WF2A 3MHXA 1BIAA 2RB6A 4BDZA 3G6ET 3GP8A 4M7AG 2CYZB 3H6ZA 3QZ5B 1K73C 5CIUA 4JS5A 4A4HA 3SWNA 1VQ9A 2LCCA 4J6WA 3VUBA 4CRIA 2CGHA 3OS0A 3QYBA 3OYDA 4ZTFA 5GMKi 2QDJA 4X9CA 1WNLA 4QQ6A 5LJ3d 4M7DA 2HD0A 4M77F 3RKXA 1AHJB 5HY6A 3QDRB 3QWLA 1DJ7B 3CCQT 4LD9K 4NL3A 4HCBA 4ELZC 5LJ3e 3HRSA 1PSFA 2PQWA 2QQRA 2R5MA 4F7UA 5GAMf 3PFSA 2A7YA 1VQMA 4DOWA 5C0MA 4LD6A 1TH7A 3PTAA 2DJZA 5DLQE 3OYLA 1Y7XA 3BFMA 2XD0A 1B34B 5CKBA 3CC4A 3GF5A 5FU6C 2KMGA 2EKOA 4M75F 4A4EA 3M58A 2LT1A 3VJPA 3VV0A 1KG1A 2LTOA 2XI9A 5LJ5j 3E9GA 4II1A 1QVPA 3MO8A 5CKHA 2XG8D 2PVDB 3PGGA 2F69A 2HBPA 3QBYA 4UC4A 2NLUA 3VKHA 3CCJA 3CC2T 2QFZA 2EWNA 3LLRA 4P5NA 1NZ9A 1V29B 4A4FA 3A8LB 1VQKT 3OYCA 3UWNA 3AHUA 3DKMA 2CZ7B 1WQ7A 3BY7A 2ZPIB 2PVOB 3L2QA 1W4SA 3CCRA 5CCAA 3JCMP 4BI3A 3SDZA 1D3BA 4FT2A 1QP2A 2DIGA 5EJCA 1PSEA 2P4TA 3TEEA 3M55A 3M4YA 4PLLA 4XTVA 2QXFA 5I2SA 1NJIU 2L5QA 1LJOA 3RUXA 3EFSA 4NOYA 3MCAB 3JB9J 3CD6T 3I55A 1X01A 4KUIA 5LJ5f 3OS2A 1UGPB 1OI1A 2K5IA 4LDVA 4C0GA 4EMKC 1KD1C 3E1SA 2YHTA 3M54A 2XKOC 2PU9B 1BYMA 3Q1JA 5GAMg 1YHQA 2LT4A 1VQNT 3CCLT 4PJOD 2IVWA 1UGQB 1VQ7T 2XICA 2PUOB 2QEXT 2C06A 2JNGA 2ZZDB 1RL2A 1M90C 1WGSA 3FEOA 2RI2A 3RMQA 1Y07A 2L8DA 2XIDA 2DAQA 3KXTA 3NTIA 1N8RC 4M7DE 4MMLA 1Y96A 4PJOB 3X20B 3QXEB 4J7IA 5FU7B 4AKIA 2DIQA 3CCUA 2OTLT 3V7SA 2M0OA 2LNVA 2QA4A 2VUBA 2MWOA 4IUVA 2KY9A 5CAIA 3WVDB 3OA6A 1BIBA 3JCMf 1MGQA 3UPUA 2Y4XA 3BG3A 4M77D 4M7DD 5I21A 1RI0A 3C94A 3CBMA 4M6VA 1Q7YC 3FRNA 4V2SA 2K5LA 4JX6A 2L89A 2LCLA 2DXCB 3KUFA 1G3SA 4E7LA 4M77B 4M7DB 4MZPA 1FX7A 2P0PA 4Z6YA 3L2WA 3HL8A 5LJ5g 3X25B 2K3YA 2Y90A 4C92E 1BI1A 3FC3A 5CK9A 1N9RA 3MEVA 4RCCA 1YJNT 2H3JA 2QQBA 1WPYA 5GAN4 1OZ3A 4JRPA 2DZ9A 5DY9A 3P8HA 3QJYA 4C0ZA 3OW2A 1VQ6A 4M7AE 5CVIA 1YITT 2RHZA 3M5AA 3URGA 4E7IA 3OQ5A 4B9XA 2ZPEB 2JOYA 3CBOA 4HCCA 5KE3A 4A54A 3MP1A 4OVAA 5KCOA 4HT8A 3CMAT 1JBMA 3NTHA 3WVEB 1I5LA 4C92D 1N6AA 2QF7A 4HA8A 3L2ZA 3CPWA 1YITA 1JJ2S 2EQJA 2FYKA 2MWPA 4VUBA 3VKGA 1VQOT 3L42A 5LJ3h 1IREB 4OP0A 4M7AD 3HZJA 3JB9H 1R8OB 2KMTA 3LYIA 5GAN7 3INZA 1WJRA 2WSEE 2OTJA 3CC7T 4C92B 3EFRA 4JRKA 3OYAA 3I56A 2RJEA 2VGMA 2F5TX 3V8JA 3X24B 2MMPA 4C8QC 1Q82C 5FRNA 2EQUA 1BI2A 3OSVA 1GXIE 2DXTA 2XK0A 4M7AB 2E65A 1WQWA 3HP9A 4PKCC 4J7FA 4Q5WA 1KC8U 4HNTA 3OMGA 1BI0A 3RIRA 4E7HA 4C0DC 3TW6A 1XQHA 2HQEA 4JRQA 3DLLA 4M78E 3LWHA 4EMGA 1I81A 2RM4A 4MMKA 4JUVA 2FVUA 2HNIA 1M1FA 5AYFA 1XTDA 4XTUA 1YIJT 3QIIA 2RHUA 3M9QA 5J39A 3QPHA 2DEQA 2X4WA 1YJWT 3HHTB 4IUQA 4HL4A 3CCQA 3A8OB 4D6WA 5GAMd 4HCZA 3OYIA 4FSXA 1JRIA 1YJ9A 4M7DF 3QYHB 2KK4A 4C5GA 3J7AF 5GAMe 2DD4B 4O6JA 5IAYA 3DB3A 3QHSA 2E1HA 3V7RA 3JRZA 1KQSS 4OB2B 2DD5B 2DKGA 3BDLA 4BDYA 2RI5A 3JCMX 4JLGA 1KQSA 1M1GA 2XHCA 2DTIA 3JCMc 4F7UE 5GANh 3FDRA 3OYJA 4PJOC 4C8QA 2O4XB 3HPWA 2JUFA 4HNUA 3J80E 2JTFA 4NC6A 2KAFA 5HK3A 3JAME 2LQ8A 3CC2A 4ZGEB 1Y71A 1M9SA 4JX4A 3PMTA 4X9DA 4RKUE 3JB9I 2LX9A 1M8VA 5L8RE 3PIPA 1UGRB 3C95A 4LOCA 5IN1A 3OBWA 3OYNA 4M78G 1VQKA 3SFMA 3M59A 3SWNB 1HXDA 4RMOA 4ZTJA 2ZGWA 3CMET 2LVMA 2RJCA 5GAOr 1XNIA 2AHJB 2YLBA 2BKDN 4M7DG 3LGFA 3S6WA 5IT9E 2XDBA 2BS4A 4DA4A 3CEYA 1VQ8T 4C92F 4GY5A 3S3OA 4J6YA 1YI2T 4M77C 5GAN6 1U8RA 4BD3A 3CD6A 4F7UB 2BS2A 5FLXE 4M7AF 3CCET 2KQWA 3OYEA 4DQ2A 3NTKA 1G3WA 2XDDA 1QVGS 4ATOA 4FU6A 3CCST 4TVRA 3CPFA 3V8KA 3C12A 3TCJA 3GIBA 5GANd 1Q86U 2EAYA 3VYHB 3CCMT 1NJIC 4M75C 3SB2A 4J6XA 3CCLA 4F7UG 1VQNA 1BKBA 5GANe 2MAMA 2QEXA 1VQ7A 4NL2A 2DTHA 4JS4A 3VU3C 4DOVA 3GLXA 4N0AC 2MI6A 2RD1A 2XU8A 3G4ST 2EQKA 1VIEA 4BB7A 4OB0B 4HNVA 4IURA 4C8QG 3LGLA 3VYGB 1QP3A 2D6FA 5I2MA 2OTLA 4YTLA 1KD1U 2WJ9A 1VUBA 4N4HA 2F5KA 4ZN1A 1U1TA 2VXEA 2K3XA 4IUPA 2EQMA 2DXBA 3TREA 3M56A 1D3BB 4C92C 4QVCA 4MDWA 5GAN2 1U1SA 5CO7A 4OGEA 3HO8A 3OYYA 3N5BB 3JSCA 2DXCA 4HKEA 2DK3A 3PMIA 1UGSB 5D6YA 4M77A 2P0KA 3QZ9B 3X26B 4M78F 1Q81C 1K8AU 2JTMA 2GQVA 1YHQT 2R58A 4XU0A 4LDWA 4EMKA 5FU6B 2KDSA 2WACA 3LH0A 4M75A 1VQLT 1SSFA 2GCXA 1OYXA 1ZQ1A 4LDYA 2DO3A 1YJNA 1KQ1A 1S72T 4X34A 2E12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF E;  2ZCF B;  2PVD B;  2CZ1 B;  2CZ6 B;  1V29 B;  3A8L B;  3HHT B;  3A8O B;  2O01 E;  2CZ7 B;  2ZPI B;  3QYH B;  2PVO B;  2DD4 B;  1QP2 A;  1PSE A;  4OB2 B;  2DD5 B;  2WSC E;  2ZPH B;  1UGP B;  2ZPB B;  2DXB B;  2PU9 B;  4ZGE B;  4RKU E;  5L8R E;  1UGR B;  1UGQ B;  2PUO B;  4XK8 E;  2ZZD B;  4L6V 5;  2ZPG B;  4OB1 B;  4KT0 E;  2AHJ B;  3A8G B;  2QDY B;  3X20 B;  3QXE B;  4ZGJ B;  2CZ0 B;  3X28 B;  2ZPF B;  3A8M B;  1JB0 E;  3WVD B;  3VYH B;  2DXC B;  2D0Q B;  2DD4 A;  4OB0 B;  2PVG B;  3VYG B;  1QP3 A;  2DD5 A;  3X25 B;  2PUK B;  4ZGD B;  4OB3 B;  4FM4 B;  2DPP B;  2DXB A;  2ZPE B;  3A8H B;  2CYZ B;  2DXC A;  3QZ5 B;  3LW5 E;  1UGS B;  3QZ9 B;  3WVE B;  3X26 B;  2ZZD A;  3VYG A;  1IRE B;  2WSE E;  1AHJ B;  1DJ7 B;  4Y28 E;  3X24 B;  1PSF A;  1GXI E;  3QYG B; 
#chains in the Genus database with same CATH topology
 4RG2 A;  4XTX A;  3KHI A;  3S3N A;  5CQY A;  1WA7 A;  2JS0 A;  2FB7 A;  2RJD A;  3LWI A;  4AKH A;  1ZHI A;  3VS4 A;  3UDC A;  4JX5 A;  3EGU A;  2GNC A;  1PNJ A;  4ELJ A;  1T3L A;  3C4S A;  1JJ2 A;  3E9F A;  1GL5 A;  2KRN A;  1UJ0 A;  1X2Q A;  2YRD A;  3SWN C;  5DQW A;  3KFV A;  2WSC E;  1LNX A;  1UB4 A;  1XOV A;  2ZPH B;  2KYB A;  3P8B B;  3H0F A;  4JLI A;  3VUZ A;  3RER A;  6AT1 B;  1LOJ A;  2KEA A;  3GNF B;  2HQX A;  1QMC A;  3O5Z A;  3CXC S;  4BE0 A;  1AZE A;  4Y72 B;  3VRY A;  4OB1 B;  4KRT A;  4J9G A;  1QVF S;  2JM9 A;  1FMV A;  2LRQ A;  1B34 A;  3PVL A;  2EFI A;  3EAE A;  5GAO p;  3DOG B;  2FRY A;  1PRM C;  2V26 A;  1VQ9 Q;  5FU7 C;  3NGP A;  2ED1 A;  4JDS A;  1IZ6 A;  1EIF A;  1K9A A;  2RHY A;  4E7J A;  4K11 A;  2FHD A;  2PVG B;  2AKL A;  1R0C B;  2PUK B;  1VYU A;  1VQM T;  3CCS Q;  1E6H A;  1SHG A;  3EG2 A;  1WHM A;  1ZUU A;  3CCS A;  2J6F A;  4BCI B;  1YCY A;  4OMM A;  2E5Q A;  4O5V A;  3LW5 E;  3OMC A;  2C5N B;  3ASK A;  2BE7 D;  1QVG A;  3H4C A;  4BCQ D;  1ABO A;  1I4K 1;  2M1H A;  2ZZD A;  3RKW A;  4C8Q B;  3G4S Q;  1VIF A;  3CCJ T;  1J3T A;  2VC8 A;  2ENM A;  2BS3 A;  3G4S A;  4J5Y A;  4RTW A;  4N4I A;  3ZFJ A;  3VKI A;  4Y28 E;  2YT6 A;  4PJO E;  1M3C A;  3CCR T;  4BCM B;  4BUG A;  1GCQ C;  3OYK A;  4F6S B;  1SPK A;  2EJF A;  2C5X B;  4NS5 A;  2HAX A;  2FRW A;  1YHQ Q;  3O8V A;  4IUT A;  4UN0 A;  3QUI A;  1OI9 B;  1XO2 A;  1O9S A;  2QI2 A;  1VQL A;  1G8X A;  1M5Q 1;  3TVT A;  1C9B A;  1NYF A;  3DL1 A;  2O01 E;  3CCV Q;  2BE9 B;  1KHC A;  1N8R R;  2MF2 A;  3CCV A;  4AFS C;  4PJO G;  4BCJ B;  1G3Y A;  4FW1 A;  3OSS C;  3RDV A;  4EPC A;  4JJN K;  4HVW A;  3K7A M;  4IIO A;  4R0K A;  2CCH B;  1GCQ A;  5C6S A;  3RKY A;  5CKD A;  3BLQ B;  4BI4 A;  4QVZ A;  1PD0 A;  3JCM W;  3L1A A;  2XDB A;  2MPX C;  1AEY A;  5HCK A;  1ENW A;  1HK9 A;  4PJJ A;  3X28 B;  1OZ2 A;  1X75 C;  5A0L A;  4M7D G;  2BTT A;  1X6G A;  3OBY A;  1VQ4 Q;  2F2C A;  2E64 A;  5M9O A;  1VQ4 A;  2RK2 A;  3PVQ A;  3MY5 B;  4LNP A;  2X3X D;  4RTT A;  1Q82 U;  2K6D A;  3F5X B;  2DE0 X;  2K57 A;  2OTJ T;  4OR5 B;  4ZGD B;  4OB3 B;  4FM4 B;  3A5Z B;  2DPP B;  5GJW B;  4FYW B;  4WF2 A;  1KK7 A;  1MUZ A;  2HBW A;  3G6E T;  2B9R A;  3VS3 A;  4JS5 A;  4A4H A;  4YOZ A;  4EOO B;  2LCC A;  1AZG B;  4J6W A;  1HJD A;  4CRI A;  2LW4 A;  3OYD A;  2HL3 A;  1WNL A;  4QQ6 A;  1S1N A;  5IHK A;  2HD0 A;  3M0Q A;  5HY6 A;  2IW8 B;  3QWL A;  4CFW B;  4NL3 A;  2IIM A;  4HCB A;  2CT4 A;  2PQW A;  5GAM f;  2R5M A;  2QG9 B;  5DLQ E;  1B34 B;  5CKB A;  3GF5 A;  1WI7 A;  4M75 F;  4A4E A;  3VJP A;  1KG1 A;  1UGV A;  1CSK A;  1PKS A;  2DIL A;  5CKH A;  1QVP A;  2XG8 D;  4AG1 C;  4UC4 A;  1FMK A;  2NLU A;  2LCS A;  3LLR A;  1NZ9 A;  4A4F A;  1AD6 A;  3BHU B;  1M2V A;  1OQK A;  2CZ7 B;  4LN2 A;  4OMP A;  3JCM P;  2HSE B;  2KT8 A;  1RAD B;  3SDZ A;  4FT2 A;  2DIG A;  5EJC A;  1PSE A;  4F04 B;  1G3N C;  3M55 A;  4YC3 B;  3CCL Q;  4EMK C;  4Z89 A;  2AT1 B;  3THK A;  1PKD B;  3Q1J A;  1WYX A;  5HNB B;  1SG5 A;  2NUT B;  1VQN T;  4PJO D;  1NJI R;  2WIP B;  1VQ7 T;  2XIC A;  1WHH A;  2JNG A;  2K3B A;  2ZZD B;  1UHF A;  4KRD B;  1OV3 A;  2J05 A;  2IN3 A;  2EYW A;  4MML A;  5FU7 B;  3CCU A;  2UZE B;  2VVK A;  3V7S A;  1XJW B;  2DBK A;  2LNV A;  1K76 A;  2MWO A;  4IUV A;  2X9H A;  3M0P A;  2KY9 A;  3UF4 A;  3OA6 A;  3UPU A;  2Y4X A;  2COY A;  4M7D D;  1RI0 A;  1UNG D;  2C0O A;  2IPO B;  2K5L A;  5LMK B;  2LCL A;  4M77 B;  1YJN Q;  1GY3 B;  2A0F B;  3HL8 A;  4X1V A;  1BI1 A;  4AFQ C;  1QCO A;  2Z0W A;  4RCC A;  2H3J A;  4C0Z A;  1RAI B;  3M5A A;  3URG A;  4E7I A;  3OQ5 A;  2G6F X;  2ZPE B;  2JOY A;  3SEM A;  5KE3 A;  4A54 A;  4OVA A;  4PFO A;  1OX9 A;  1JBM A;  3NTH A;  1FVV B;  1Z9Q A;  4HA8 A;  2F2V A;  3L42 A;  5GAN 7;  2F5T X;  3TQ7 P;  3OSV A;  1IHW A;  2DXT A;  2HDA A;  1WQW A;  4Q5W A;  1KC8 U;  4C0D C;  3TW6 A;  4AG2 C;  1QCF A;  1PD1 A;  2K9G A;  3LWH A;  1NG2 A;  2DMO A;  1I81 A;  2RM4 A;  2K7A A;  2FVU A;  5AYF A;  1XTD A;  1RAG B;  1QWF A;  5J39 A;  3QPH A;  2JXB A;  1V1C A;  2FZG B;  1UE9 A;  3CCQ A;  3A8O B;  1OIY B;  2GTO A;  4HCZ A;  1TU0 B;  3J7A F;  5GAM e;  2E1H A;  3BDL A;  1LCK A;  1WHL A;  2XHC A;  3FDR A;  1D09 B;  1JOW A;  2JUF A;  1OGU B;  2JTF A;  4YOS A;  3CC2 A;  2QAZ A;  2EVR A;  4BCP B;  1M9S A;  1UGR B;  5ECA A;  3QWY A;  3OYN A;  4Z88 A;  1VQK A;  3M59 A;  1VQ8 Q;  2ZGW A;  1JU5 C;  1XNI A;  2AHJ B;  1QKX A;  3LGF A;  3CCE Q;  2BS4 A;  3CD6 Q;  5HVY B;  2CP6 A;  4C92 F;  4EOQ B;  3S3O A;  5GAN 6;  2EW3 A;  4CFX B;  3CD6 A;  2BS2 A;  4RTV A;  4CFU B;  4M7A F;  3NTK A;  2XDD A;  2JW4 A;  3CPW P;  4FU6 A;  3CCS T;  3D7S B;  3CPF A;  4TVR A;  1YWO A;  2I40 B;  2QEX Q;  5GAN d;  3H9N A;  1MV0 B;  3VYH B;  4M75 C;  4J6X A;  1AWO A;  1H26 B;  5D7U A;  2QEX A;  2HKQ B;  4DOV A;  2HL5 C;  2J6O A;  2JT4 A;  1K0S A;  1QMZ B;  2OTL Q;  3G4S T;  1VIE A;  3SHW A;  1QWE A;  1QLY A;  4C8Q G;  2JM8 A;  2OTL A;  1EX4 A;  1M2V B;  3EGD B;  3RBB B;  3M56 A;  3RR6 A;  4MDW A;  2CT3 A;  2KRS A;  2ATC B;  2ECZ A;  4OGE A;  1ZA2 B;  2COZ A;  2QGG A;  2DXC A;  1SSH A;  2DK3 A;  3BLH B;  2FPD A;  4HKE A;  4B6M A;  1ARK A;  3QZ9 B;  3X26 B;  2YUN A;  1Q81 C;  3TNI B;  2GQV A;  1YHQ T;  2X3W D;  4CC7 A;  1UEC A;  4LUD A;  4CFN B;  1GCP A;  1EZZ B;  1VQL T;  4M75 A;  2AZS A;  4LDY A;  4OML A;  1Q95 G;  1KQ1 A;  2L0A A;  3EG0 A;  4X34 A;  2A37 A;  2E12 A;  5D6X A;  3CCV T;  2RO0 A;  3CMA Q;  2E3I A;  2VGN A;  1WDX A;  3QYE A;  3B57 A;  3G71 Q;  4F7U F;  3CMA A;  2WSF E;  2EIF A;  4EIK A;  2ZCF B;  1KQ2 A;  3QHR B;  2EJ9 A;  1GH6 B;  4GLK A;  2HCK A;  1HSQ A;  3M53 A;  3NFC A;  4JRI A;  5GMK e;  1H3Z A;  5KH6 A;  2GTJ A;  4HCK A;  3MEA A;  3M0R A;  3BW1 A;  4PLI A;  5GAO l;  3G6E A;  2JN0 A;  1VQ4 T;  5GAO n;  2M9U A;  3MP6 A;  3CBP A;  1X27 A;  4QQG A;  1PKT A;  5KCH A;  1OKW B;  2Y4Y A;  3J81 E;  2ZPG B;  3BHT B;  2AK5 A;  2QQ8 A;  1IRX A;  4E7Z A;  9ATC B;  1IB8 A;  4BCO B;  2JVV A;  5CQX A;  1G5V A;  4FX3 B;  2CZ0 B;  2FZK B;  3RES A;  4DBR A;  3A8M B;  1JB0 E;  1MV3 A;  1IO6 A;  2DZC A;  4MZM A;  2COW A;  4XQ3 A;  4M78 B;  1N27 A;  4CC2 A;  4R56 A;  2D0Q B;  1D1C A;  3F70 A;  1N4M A;  1JQQ A;  3TNH B;  5LJ3 f;  5I22 A;  3P8D A;  4BY6 B;  3JCM h;  1H92 A;  3OYF A;  2CUD A;  1QQJ A;  4C8Q D;  4G6L B;  1QW1 A;  4EMH A;  3GNG A;  5LJ5 d;  1GBQ A;  3A8H B;  3OYM A;  3LH5 A;  1FXX A;  4E7S A;  3PO3 S;  1D1B A;  3MET A;  2FPE A;  2FO0 A;  4EON B;  3FLG A;  1O75 A;  3VYG A;  2O9V A;  1TFB A;  1ZBX A;  1Q86 C;  5ICP B;  4PNO A;  4EC9 B;  4XTY A;  4C0D B;  2KR3 A;  5HKC A;  1TUG B;  2YLC A;  3JCM V;  3I55 Q;  1RAH B;  4RUG A;  4J8O A;  3HTR A;  5D6W A;  5DLO A;  3S3M A;  2KR6 A;  4BBR M;  4JPB W;  2YDL A;  3M0T A;  3JCM e;  1BU1 A;  2IVX A;  1H1P B;  4AKG A;  1KHI A;  2E41 A;  3EFO B;  4M7A C;  5GAN f;  2CZ1 B;  4QQD A;  4LDX A;  1N8R U;  4F6U B;  5HQ0 B;  3M03 A;  4FIB A;  4M77 E;  5J26 A;  5GMK l;  4XU1 A;  2QA4 Q;  2RMO A;  1OL2 B;  3CCU T;  2M51 A;  2K2V A;  4J9H A;  1ZUY A;  1Q81 U;  3LX7 A;  2E10 A;  2DVE A;  2FL7 A;  2R7G A;  3MPU B;  2ZPB B;  1Y0M A;  4XU3 A;  4C5H A;  4RTX A;  2EYX A;  2DBM A;  1N9S A;  4M4Z A;  5CKF A;  4C92 A;  1LPL A;  1H28 B;  2RK1 A;  5LL6 S;  4FL6 A;  5CR2 A;  4M7A A;  3A8G B;  2BUD A;  3MP8 A;  5GMK j;  1F5Q B;  4HXJ A;  4M77 G;  2PJQ A;  4M75 B;  2OAU A;  1H3H A;  2ZPF B;  3HBL A;  1VQP Q;  4WTO B;  3TU4 K;  5HK0 A;  1VQP A;  1R77 A;  3CPW S;  1OPK A;  3C0C A;  1VA7 A;  2J6K A;  4ZN3 A;  1PHT A;  2DRM A;  1CKA A;  4MZT A;  5GAN 8;  5DM7 R;  1H1S B;  3CXC A;  1K9M C;  3A1P A;  3MEW A;  1QVF A;  5KYW A;  3OS1 A;  4PJO F;  2WFY B;  4LE9 A;  2O4X A;  3MEU A;  2O9S A;  4BDZ A;  2DL5 A;  5FWC A;  3H6Z A;  3QZ5 B;  4BCN B;  2VAS A;  1K73 C;  3SWN A;  1VQ9 A;  2YUP A;  8ATC B;  2CGH A;  1ZLM A;  5L2W B;  1YJ9 Q;  4ZTF A;  2QDJ A;  1U5S A;  4F7N B;  3RKX A;  3QDR B;  1WFW A;  3CCQ T;  5LJ3 e;  3HRS A;  3EH1 A;  1UHC A;  4F7U A;  2QDL A;  3CC4 Q;  4LD6 A;  1PC0 A;  2KGT A;  2DJZ A;  2DNU A;  1Y7X A;  1WZO A;  2XD0 A;  3CC4 A;  5FU6 C;  2KMG A;  2YUO A;  3M58 A;  2WMA B;  3MO8 A;  3QBY A;  4ELL A;  3CC2 T;  2V22 B;  2MK5 A;  4P5N A;  1V29 B;  3A8L B;  1VQK T;  2EYY A;  3UWN A;  1ZSZ C;  2CSI A;  4BCF B;  2RQR A;  1WQ7 A;  3L2Q A;  3BHV B;  1PM3 A;  1W4S A;  2XMF A;  5CCA A;  3G1J A;  4JJB A;  2PZ1 A;  2P4T A;  2DLP A;  1ZX6 A;  1SRL A;  2L5Q A;  1W70 A;  1W2B P;  1NJI U;  3CD6 T;  1ZBJ A;  2FG0 A;  4KUI A;  5LJ5 f;  1TSF A;  1OI1 A;  3M54 A;  3VS2 A;  2PU9 B;  4KGV B;  1BYM A;  1YHQ A;  2LT4 A;  1AWW A;  1UGQ B;  2QEX T;  1RL2 A;  1M90 C;  4BY7 X;  2UUE B;  3EGX A;  1Y07 A;  1VYV A;  4M7D E;  2DAQ A;  1JST B;  1YN8 A;  1MMA A;  1Y96 A;  3X20 B;  2OTL T;  2BZ8 A;  2RQV A;  1RAE B;  2DER A;  1UDL A;  3MKD A;  2VUB A;  1ZSZ A;  3ZL7 C;  1RLQ C;  1FIN B;  3BG3 A;  4M77 D;  1OEB A;  3C94 A;  2W9Z A;  4M6V A;  1Q7Y C;  4JX6 A;  1Q81 R;  3KUF A;  1MNE A;  4Y92 A;  2EGE A;  3X25 B;  2Y90 A;  1VQ6 Q;  2EBP A;  2QQB A;  2DZ9 A;  1VQ6 A;  2DYB A;  2RHZ A;  3IQL A;  4B9X A;  3NHN A;  2JJ9 A;  3CMA T;  1JSU B;  2RNA A;  4FSS A;  1N6A A;  3CC7 Q;  2L3Q A;  4VUB A;  3VKG A;  4OP0 A;  2PTK A;  1R8O B;  3LYI A;  2YWW A;  2WSE E;  3POM A;  4C92 B;  2K79 A;  3V8J A;  2MMP A;  1GXI E;  2EQU A;  4EOK B;  2XK0 A;  4M7A B;  1D0X A;  2E65 A;  1UG1 A;  4F70 B;  3EJ1 B;  2O88 A;  4HNT A;  1JO8 A;  3OMG A;  3RIR A;  4ESR A;  1YNZ A;  4DBF A;  1RAB B;  3DLL A;  4M78 E;  2WMB B;  4EMG A;  4MMK A;  4JUV A;  2HNI A;  1M1F A;  4XTU A;  1MMD A;  3QII A;  4JZ3 A;  2RHU A;  5L23 A;  1GUX A;  4AFU C;  3M9Q A;  4PJM A;  1TUD A;  4IUQ A;  1AIS B;  4HL4 A;  1HYO A;  4FSX A;  4YOO A;  2KK4 A;  2NUZ A;  5FGK B;  1TG0 A;  4C5G A;  3QHS A;  2DKG A;  4BDY A;  3JCM X;  5KYN A;  5KYW B;  5FWB A;  2DTI A;  4PJO C;  2O4X B;  3QWX X;  3BE3 A;  2QK0 A;  2LX9 A;  2C5V B;  3C95 A;  3DJB A;  4M78 G;  3SWN B;  1GRI A;  2RJC A;  3OW2 P;  1AOJ A;  2IW9 B;  2A28 A;  3CEY A;  3R6N A;  4KH1 B;  4BD3 A;  4F7U B;  5FLX E;  2KQW A;  3OYE A;  4DQ2 A;  1G3W A;  3DDP B;  4CRL B;  3GIB A;  2EAY A;  4QT7 A;  3SB2 A;  3I35 A;  3CCL A;  2KE9 A;  2DTH A;  4JS4 A;  3VU3 C;  5KYY A;  1E6G A;  4II5 B;  4N0A C;  1JXO A;  2DVJ A;  4BB7 A;  4OB0 B;  1T0H A;  3LGL A;  1QP3 A;  1Q86 R;  2D6F A;  1VUB A;  4QKU A;  2F2X A;  4ZN1 A;  2K3X A;  4IUP A;  2RQW A;  2YUQ A;  2DXB A;  3TRE A;  3REA B;  2DL3 A;  2BPM B;  5CO7 A;  3HO8 A;  3OYY A;  3JSC A;  3PMI A;  5D6Y A;  2KXD A;  2P0K A;  4BCG B;  2AIR B;  4LDW A;  4EMK A;  5FU6 B;  1BU2 A;  4Z8A A;  2WAC A;  1KQS P;  2HMA A;  1YJN A;  2CH4 A;  3EGX B;  5IHN A;  1Y96 B;  2WPA B;  1FKM A;  4HLQ A;  4L5G A;  2DF6 A;  1ZSG A;  3QSU A;  3QDF A;  3TN8 B;  3QKJ A;  1ZSZ B;  2LDM A;  4E7K A;  1M1K C;  4C5E A;  2JZ2 A;  4BE1 A;  2G9X B;  3QO3 A;  5A0G A;  2CZ6 B;  5GAM h;  2RHX A;  2AKK A;  2WXV B;  4OMF B;  2PK9 B;  4A4G A;  4J9I A;  1E7P A;  4IUU A;  4B9W A;  3HKS A;  1OKV B;  4M75 G;  2GGR A;  1VQP T;  2DXU A;  1JKW A;  1YJW Q;  1X6B A;  1M4Z A;  4PK4 A;  2CP2 A;  1YJW A;  4QVD A;  2XDP A;  2LZ6 B;  2K5F A;  2RHI A;  3HSB A;  2FPF A;  5I11 A;  3JB9 G;  3GOX A;  5A0D A;  2LNH B;  3E19 A;  4M78 D;  1K9M R;  3HRT A;  3BG9 A;  2R57 A;  2BIV A;  3BDU A;  2L3R A;  4TTH A;  3RGF B;  2YXY A;  1I0C A;  4XU2 A;  5GAO m;  2R5A A;  2ROL A;  1B07 A;  2X51 A;  1WHK A;  1K4U S;  3L2R A;  5FRO A;  1NBE B;  2E70 A;  1K73 R;  1VQ9 T;  4C8Q E;  2WEV B;  2I53 A;  4MFE A;  4KBM B;  1A0N B;  1VQM Q;  1YI2 Q;  3VS5 A;  1GUX B;  2M02 A;  3M4G A;  1YJ9 T;  1VQ8 A;  1YI2 A;  1BI3 A;  2GQI A;  2CRE A;  3CCE A;  3PT9 A;  2FEI A;  1VIN A;  2KI7 A;  2LC4 A;  2P0Q A;  3CC4 T;  1OOT A;  3CCJ Q;  2D0N A;  1H64 1;  3EID B;  1JJ2 P;  1PCX A;  2OX7 A;  2QQA A;  3OY9 A;  4EOR B;  1IGU A;  3OS5 A;  3VS0 A;  4LDU A;  1OPL A;  4ELY C;  1HD3 A;  1QLB A;  3QJ6 A;  2GFU A;  4FYX B;  3JCM J;  4MIM A;  1MHN A;  1KIK A;  1FYN A;  3V7C A;  4EC8 B;  3MJX A;  1BCO A;  4KRC B;  5HBH B;  3EH2 A;  4C5I A;  3TW7 A;  2M16 A;  4L59 A;  5KYU A;  5GMK h;  5HBJ B;  2E6N A;  2VV5 A;  4A4K A;  3HRU A;  2ESW A;  3ZBD A;  2EQI A;  4J83 A;  3PIO A;  1MMN A;  4RTY A;  4BBS M;  1K8A C;  5KYY B;  2G3R A;  1M90 R;  2CS7 A;  3SD4 A;  2DTO A;  3FB9 A;  4KGZ B;  4N4G A;  2C5O B;  3KBG A;  4OMQ A;  3DLM A;  5AT1 B;  2DXB B;  4XTW A;  4KH0 B;  1YBY A;  3G71 A;  3L2U A;  5ACB A;  1G3T A;  2RH2 A;  1Q7Y R;  2V8I A;  1SEM A;  4EDU A;  4M75 D;  5GMK m;  4ANJ A;  4EMK B;  2QDY B;  3E2U A;  3OW2 S;  2E3H A;  5CKE A;  2DME A;  3JCM Q;  3V8L A;  1M1K U;  3G7Z A;  1QVG P;  2X35 A;  4A63 B;  1VQ6 T;  3UT1 A;  1QCN A;  2RI3 A;  5A2Q E;  3JB9 D;  2DEU A;  1NPP A;  2EYQ A;  3H8Z A;  4E6R A;  2DD4 A;  3NMZ C;  2DD5 A;  1VQ5 Q;  3MI9 B;  1V76 A;  3QHW B;  1VQ5 A;  1VOM A;  5GAM j;  2DJQ A;  4BCN D;  4D8D A;  2DYI A;  4C92 G;  2NYS A;  3I5S A;  2GF7 A;  2QAS A;  4M7A G;  2KBT A;  1D0Z A;  4F7J B;  1C1A A;  1BB9 A;  3QYB A;  4EOM B;  4X9C A;  2C0I A;  3VS1 A;  4M77 F;  4LD9 K;  1DJ7 B;  4ELZ C;  3PFS A;  2A7Y A;  2KYM A;  5C0M A;  1TH7 A;  1UTI A;  2HKN A;  4F16 A;  3H41 A;  1U06 A;  1M3B A;  2LTO A;  3E9G A;  4II1 A;  3PGG A;  2HBP A;  2W2H A;  2LJ1 A;  1OU8 A;  4BCM D;  3OYC A;  3PE0 A;  4F7L B;  1M27 C;  3AHU A;  5IHY A;  3DKM A;  2ZPI B;  2MYS A;  5KYX A;  2LQN A;  1D3B A;  4FCY A;  2D8J A;  3NPF A;  4XTV A;  1LJO A;  3RUX A;  3EFS A;  1H8K A;  1M2O A;  1VYW B;  4RTZ A;  3I55 A;  1PWT A;  2H3E B;  1KD1 C;  2K5I A;  4LDV A;  4C0G A;  2YHT A;  1PG5 B;  1SHF A;  5GAM g;  2W10 A;  3CCL T;  2W96 A;  2PUO B;  1H24 B;  2LQW A;  2KRM A;  1WGS A;  2RI2 A;  2XID A;  2L8D A;  3NTI A;  2E4H A;  3QXE B;  4J7I A;  4AKI A;  1ABQ A;  2DIQ A;  2QA4 A;  1W98 B;  5CAI A;  3WVD B;  1BCM A;  1MGQ A;  1VYT A;  1D1A A;  1K1Z A;  3CBM A;  2OI3 A;  2DXC B;  1NEB A;  1G3S A;  4E7L A;  2P0P A;  5KYU B;  3L2W A;  1UJY A;  1T3S A;  3FC3 A;  5CK9 A;  1N9R A;  3MEV A;  1YJN T;  5GAN 4;  4JRP A;  5DY9 A;  3P8H A;  1YCS B;  3FJ5 A;  5CVI A;  2A36 A;  3ULR B;  4F7S B;  1O9K A;  2WHB B;  3CBO A;  5KCO A;  3MP1 A;  3BLR B;  3O0G D;  4C92 D;  2QF7 A;  4GBQ A;  3CPW A;  1JJ2 S;  2FYK A;  1M1K R;  2MOX A;  5LJ3 h;  1IRE B;  4M7A D;  3HZJ A;  3I56 Q;  2KMT A;  2YSQ A;  3EFR A;  3I56 A;  1VOL A;  2VGM A;  4AMC A;  3X24 B;  1Q82 C;  5FRN A;  1WHJ A;  1ACM B;  2QGS A;  4PKC C;  1BI0 A;  1WX6 A;  2VWF A;  4IIM A;  1WXB A;  2HQE A;  2P84 A;  1OUL A;  5LQF B;  2W9F A;  2J06 A;  2ABL A;  1WHG A;  1E9H B;  1YJW T;  3HHT B;  3NDQ A;  5GAM d;  2EGC A;  1I1J A;  4M7D F;  1YJ9 A;  3QYH B;  2DD4 B;  2CSQ A;  4O6J A;  3DB3 A;  3V7R A;  1B7T A;  3JRZ A;  2DD5 B;  1GBR A;  3DDQ B;  2PK2 A;  4JLG A;  3OYJ A;  5GAN h;  3JCM c;  1WXT A;  4PJL A;  2PMI B;  3J80 E;  1RAC B;  5IHI A;  2KAF A;  5IH2 A;  2LQ8 A;  4X9D A;  1M8V A;  4JX4 A;  3PMT A;  3JB9 I;  4LOC A;  3OBW A;  2V1R A;  4BCH B;  1HXD A;  5GAO r;  2YLB A;  3UA6 A;  5CYI B;  1W1F A;  3S6W A;  1VQ8 T;  4F14 A;  4EOI B;  1YI2 T;  2RPN A;  4M77 C;  2O31 A;  3CCE T;  4ATO A;  1H1Q B;  1QVG S;  2ZAE A;  2NUT A;  1TTH B;  5IDP B;  1AVZ C;  5EFQ B;  3TCJ A;  2CP5 A;  4CFV B;  4KGX B;  1Q86 U;  1KXU A;  2CUB A;  5GAN e;  4NST B;  2MAM A;  5BNJ B;  4NL2 A;  2ROT A;  3GLX A;  2RD1 A;  2MI6 A;  2DA9 A;  1MND A;  1SKU B;  2XU8 A;  3M0S A;  2EQK A;  2CP7 A;  3VYG B;  5I2M A;  4YTL A;  1KD1 U;  3EG3 A;  2KNB B;  1IHV A;  1U1T A;  1AWJ A;  2BKZ B;  5KYX B;  1D3B B;  1G83 A;  5GAN 2;  1U1S A;  4RTU A;  4EOL B;  3EOC B;  4FW2 A;  4F17 A;  2X1N B;  1UGS B;  2EGA A;  4M77 A;  4I3Z B;  4M78 F;  4FYY B;  1VQL Q;  4XU0 A;  3RNJ A;  4LUE A;  2GBQ A;  1SSF A;  2VB6 A;  1OYX A;  2DO3 A;  1YIT Q;  1K8A R;  4OMO A;  1YIT A;  1W6X A;  3LQ5 B;  5KE2 A;  1RUW A;  1WXU A;  2L3S A;  4ORZ A;  1NE8 A;  1I8F A;  1NLP C;  4QSH A;  2RN8 A;  4AT1 B;  1AT1 B;  7AT1 B;  1VQO Q;  1GFC A;  2A3L A;  1FWZ A;  2CKK A;  1VQO A;  3G71 T;  5FRM A;  1X6O A;  1ZUK A;  2KSS A;  2PNI A;  2K4Y A;  3CC7 A;  3T9N A;  2RF0 A;  1CKB A;  2JS2 A;  1M30 A;  3JCM g;  1UFF A;  4BE2 A;  3OYB A;  4EOP B;  5GAN 5;  1YIJ Q;  1O9K B;  4J9B A;  4PL6 A;  3M0U A;  8AT1 B;  1KC8 C;  1YIJ A;  3H0H A;  3M57 A;  1UEB A;  4OGC A;  1K9M U;  1OX8 A;  2RA2 A;  4A53 A;  1D3U B;  2SEM A;  3OYH A;  1G2B A;  2LQK A;  3BG5 A;  4ZGJ B;  5LJ5 h;  3A98 A;  5LJ3 j;  2BZX A;  1D0Y A;  1VQ5 T;  1K73 U;  4RCB A;  4KUL A;  1H27 B;  3TNW B;  3GTM S;  2EJG A;  1NPR A;  1KSW A;  3CME Q;  2LJ0 A;  2G77 A;  2MIO A;  3CME A;  3ER0 A;  2KT1 A;  1JXM A;  5IDN B;  3DB4 A;  3PNW C;  3QG1 A;  5GJV B;  3HFN A;  2HQH A;  2X4Y A;  4CFU D;  2M0Y A;  2X4X A;  2LMJ A;  3ZEH A;  2DM1 A;  4ROD A;  2NUP A;  1LVK A;  4D8K A;  4BAC A;  4M7D C;  2D9T A;  3CCM Q;  1AWX A;  5GAO q;  1YWP A;  2I2L A;  3FJP A;  4CC3 A;  2GFA A;  5LJ5 e;  3RMS A;  3CCM A;  2UZL B;  2LJ3 A;  2RQU A;  3DTO A;  1RLP C;  3OYG A;  5EG2 A;  2RJF A;  4MDX A;  2BZY A;  5GAN j;  2QQ9 A;  5GAN 3;  3JB9 F;  4PJO A;  4BCQ B;  1F1B B;  3EGD A;  2DFU A;  3ME9 A;  4KUD K;  2E5K A;  2B8A A;  3QYG B;  2A08 A;  3R6O A;  4OF1 A;  4E47 A;  1TS9 A;  3OB9 A;  3WXM B;  4CI0 C;  4R55 A;  3JCM d;  4WCI A;  3I55 T;  1QKW A;  4JJC A;  2O2O A;  3L2V A;  1KD1 R;  1M90 U;  1Z9Z A;  2WIH B;  4MFD A;  2V8J A;  5LJ3 g;  4M7D A;  2E6Z A;  1WLP B;  2KVQ G;  3TSZ A;  2CDT A;  3CQT A;  3CCU Q;  1S72 Q;  1RI9 A;  2P4R A;  4Z02 A;  1P92 A;  4FYV B;  2VXF A;  1S72 A;  5J3B A;  2EYZ A;  4AI6 A;  4N0A A;  1ZA1 B;  4M75 E;  2QA4 T;  1I5O B;  1Q7Y U;  1T0J A;  3FIF A;  4PJN A;  1UUE A;  1I07 A;  2DL7 A;  2JGZ B;  4C8Q F;  4XK8 E;  4L6V 5;  4F6W B;  4M78 C;  4KT0 E;  2QQS A;  2QTX A;  4PFP A;  3HFO A;  4J9C A;  4IKF A;  3HB9 A;  5GAN g;  2IG0 A;  4XAX B;  4ME7 A;  1ZP2 A;  1W2B S;  4BY6 C;  3JCM b;  1GFD A;  2EKH A;  1W2B A;  2X4J A;  3GPL A;  2V8K A;  4IMY B;  4BI8 B;  2ED0 A;  4HT9 A;  4C0F A;  4Y91 A;  2EUF A;  2VYT A;  1C0M A;  2DET A;  3I56 T;  1WJQ A;  4J9E A;  4FT4 A;  4QW2 A;  4RG8 A;  4XTZ A;  1KFZ A;  1Q82 R;  1OIU B;  4M78 A;  1WJS A;  2YRV A;  3MHX A;  1BIA A;  2RB6 A;  5FW9 A;  3GP8 A;  2CYZ B;  1BK2 A;  2B86 A;  1X69 A;  5CIU A;  4PFZ A;  1C6V X;  2YRC A;  3VUB A;  4E2F B;  3CCQ Q;  3OS0 A;  1SF9 A;  2KXC A;  5GMK i;  5IXB A;  3G33 B;  5LJ3 d;  1H1R B;  1NYG A;  1AHJ B;  3EG1 A;  1X43 A;  2UZB B;  1PSF A;  2QQR A;  4DEX A;  1VQM A;  4CFM B;  4DOW A;  2JTE A;  3PTA A;  1YFN A;  3OYL A;  2PHG A;  3BFM A;  1H4L D;  2EKO A;  2OAW A;  2LT1 A;  3CC2 Q;  2OJ2 A;  2L2P A;  3VV0 A;  2DL4 A;  2XI9 A;  5LJ5 j;  1VQK Q;  1UNH D;  4ROE A;  2PVD B;  2F69 A;  3CCJ A;  3VKH A;  2QFZ A;  4J9F A;  2JMA A;  2EWN A;  1EFN A;  2DX1 A;  1TD6 A;  3CCR Q;  1H25 B;  3BY7 A;  2PVO B;  3CCR A;  2IW6 B;  1R0B G;  3MY1 B;  3GBQ A;  1X2K A;  3VS6 A;  4BI3 A;  1QP2 A;  1JEG A;  3EG9 A;  3TEE A;  3UA7 A;  3M4Y A;  4PLL A;  5I2S A;  2QXF A;  3EFO A;  4NOY A;  3JB9 J;  3MCA B;  2NUP B;  1X01 A;  3OS2 A;  1UGP B;  4BXX X;  2QGF B;  3E1S A;  2XKO C;  5DQV A;  3CXC P;  5I5Z B;  2IVW A;  2W99 A;  2C06 A;  2HEQ A;  1QVF P;  1TUC A;  3FEO A;  3EHQ A;  3RMQ A;  3KXT A;  4BY1 X;  1N8R C;  4PJO B;  4ZNX A;  2M0O A;  2I0N A;  2HZY A;  3I9Q A;  1BIB A;  2D8H A;  1URC B;  3JCM f;  2V1Q A;  2LX7 A;  2CP0 A;  1IGQ A;  5I21 A;  2C0T A;  4OGR B;  3VS7 A;  3FRN A;  4EOS B;  1RAF B;  4V2S A;  1K0X A;  2L89 A;  4CC4 B;  4M7D B;  1TWB A;  2EPD A;  4MZP A;  1FX7 A;  4Z6Y A;  2AZV A;  5LJ5 g;  2K3Y A;  1M8M A;  4C92 E;  4DEY A;  1WPY A;  1OZ3 A;  1N5Z A;  3QJY A;  4EOJ B;  3OW2 A;  2UZD B;  4M7A E;  2CJM B;  1YIT T;  2K2M A;  4LXC A;  1YP5 A;  4HCC A;  4DBQ A;  3MIA B;  1B3Q A;  4HT8 A;  1P5E B;  1E7O A;  2RQT A;  2J7I A;  3WVE B;  1U3O A;  1I5L A;  4GLM A;  3L2Z A;  2EQJ A;  2MWP A;  1UNL D;  1VQO T;  2OTJ Q;  2LP5 A;  1BBZ A;  1M3A A;  3JB9 H;  2MCN A;  3H0I A;  3INZ A;  1WJR A;  2OTJ A;  3EHR A;  3I5R A;  3CC7 T;  2D1X A;  1Y57 A;  2JMC A;  4JRK A;  3OYA A;  2RJE A;  4C8Q C;  1BI2 A;  3G6E Q;  3HP9 A;  4J7F A;  2CCI B;  4BCK B;  1TOV A;  4E7H A;  1XQH A;  4JRQ A;  2DL8 A;  1YIJ T;  1RAA B;  1KC8 R;  1TXQ A;  4HVV A;  1PRL C;  2DEQ A;  2X4W A;  2QYZ A;  2FZC B;  4D6W A;  4JZ4 A;  1FMW A;  2DRK A;  3OYI A;  1JRI A;  3UAT A;  5CEI B;  5IAY A;  1KQS S;  4OB2 B;  2RI5 A;  1SRM A;  1KQS A;  4JJD A;  1M1G A;  4AFZ C;  4F7U E;  2H8H A;  4C8Q A;  3HPW A;  1NLO C;  1AD5 A;  4HNU A;  4NC6 A;  3JV3 A;  5HK3 A;  3JAM E;  4ZGE B;  1Y71 A;  2CP3 A;  4RKU E;  2C6T B;  5L8R E;  3PIP A;  5IXF A;  5IN1 A;  2SRC A;  3SFM A;  4RMO A;  4ZTJ A;  3CME T;  2LVM A;  1KJW A;  2BKD N;  3AT1 B;  5IT9 E;  5EC7 A;  4DA4 A;  4GY5 A;  4J6Y A;  2VKN A;  2C4G B;  5HBE B;  4OMN A;  1U8R A;  3U23 A;  1VQN Q;  1NM7 A;  3V8K A;  3C12 A;  2L3P A;  1VQ7 Q;  2KRO A;  3CCM T;  1NJI C;  1VQN A;  4F7U G;  1BKB A;  4DBH A;  1VQ7 A;  3VRZ A;  3REB B;  4ROC A;  2QTV A;  1OU9 A;  1WIE A;  1IXD A;  4HNV A;  4IUR A;  2HSP A;  4HVU A;  2WJ9 A;  4N4H A;  2F5K A;  2VXE A;  1NEG A;  2EQM A;  5IF1 B;  4C92 C;  1MMG A;  4QVC A;  3EG9 B;  2F1L A;  4J9D A;  2W0Z A;  3N5B B;  2CH4 W;  1K8A U;  2JTM A;  2R58 A;  4CXA B;  3TSW A;  2KDS A;  3LH0 A;  2F2W A;  2GCX A;  1ZQ1 A;  1OL1 B;  1S72 T;  2NWM A; 
#chains in the Genus database with same CATH homology
 1Y96 B;  5D6X A;  5KE2 A;  3CCV T;  2RO0 A;  4RG2 A;  1FKM A;  4HLQ A;  4L5G A;  4XTX A;  1NE8 A;  2VGN A;  3QYE A;  3KHI A;  1I8F A;  5CQY A;  3S3N A;  3QSU A;  4QSH A;  2FB7 A;  3QKJ A;  2RJD A;  4F7U F;  3LWI A;  4AKH A;  2WSF E;  2EIF A;  3CMA A;  1ZHI A;  2LDM A;  3UDC A;  4E7K A;  2ZCF B;  4JX5 A;  1M1K C;  2A3L A;  4C5E A;  2JZ2 A;  1KQ2 A;  1FWZ A;  4BE1 A;  2CKK A;  1VQO A;  3QO3 A;  5A0G A;  3G71 T;  2CZ6 B;  4ELJ A;  5FRM A;  1X6O A;  5GAM h;  2RHX A;  2EJ9 A;  2KSS A;  3C4S A;  2K4Y A;  4GLK A;  1JJ2 A;  3CC7 A;  3E9F A;  3T9N A;  4OMF B;  3M53 A;  3NFC A;  4JRI A;  5GMK e;  1H3Z A;  3JCM g;  5KH6 A;  4BE2 A;  4A4G A;  3MEA A;  3SWN C;  2WSC E;  1LNX A;  1UB4 A;  1XOV A;  2ZPH B;  3BW1 A;  4PLI A;  1E7P A;  4IUU A;  4B9W A;  5GAN 5;  5GAO l;  3OYB A;  3HKS A;  2JN0 A;  3G6E A;  4M75 G;  3P8B B;  1VQ4 T;  5GAO n;  4JLI A;  2M9U A;  4PL6 A;  3MP6 A;  3CBP A;  1VQP T;  3VUZ A;  2DXU A;  1KC8 C;  1YIJ A;  3RER A;  4QQG A;  1LOJ A;  1M4Z A;  3GNF B;  2HQX A;  3M57 A;  1UEB A;  4OGC A;  5KCH A;  1K9M U;  3CXC S;  4BE0 A;  4QVD A;  2Y4Y A;  3J81 E;  1YJW A;  2ZPG B;  2XDP A;  4OB1 B;  2QQ8 A;  2RA2 A;  4A53 A;  1QVF S;  2K5F A;  2LRQ A;  2RHI A;  3HSB A;  3OYH A;  2JVV A;  5CQX A;  3GOX A;  3JB9 G;  2LQK A;  1G5V A;  1B34 A;  3BG5 A;  4ZGJ B;  5A0D A;  3E19 A;  2CZ0 B;  2EFI A;  3EAE A;  5LJ5 h;  4M78 D;  5LJ3 j;  3HRT A;  3BG9 A;  3RES A;  1VQ5 T;  2R57 A;  5GAO p;  2BIV A;  1K73 U;  3BDU A;  3A8M B;  1JB0 E;  2L3R A;  4XU2 A;  4RCB A;  4KUL A;  5GAO m;  2R5A A;  4MZM A;  2DZC A;  4XQ3 A;  4M78 B;  5FU7 C;  1N27 A;  2EJG A;  1NPR A;  3L2R A;  4JDS A;  2G77 A;  1IZ6 A;  1EIF A;  2E70 A;  5FRO A;  4R56 A;  1VQ9 T;  4C8Q E;  2D0Q B;  4MFE A;  3F70 A;  3CME A;  2RHY A;  4E7J A;  4KBM B;  3ER0 A;  2FHD A;  3DB4 A;  3PNW C;  3QG1 A;  2PVG B;  3HFN A;  2X4Y A;  3M4G A;  1YJ9 T;  5LJ3 f;  2X4X A;  1VQ8 A;  2PUK B;  1YI2 A;  1BI3 A;  3P8D A;  3ZEH A;  4BY6 B;  3JCM h;  3OYF A;  1VQM T;  4BAC A;  3CCE A;  4M7D C;  2D9T A;  3PT9 A;  4C8Q D;  4EMH A;  1QW1 A;  5LJ5 d;  3GNG A;  2LC4 A;  3CC4 T;  2P0Q A;  3A8H B;  2I2L A;  3FJP A;  5GAO q;  3OYM A;  1FXX A;  2GFA A;  3CCS A;  4MDX A;  1YCY A;  5LJ5 e;  3MET A;  1H64 1;  2E5Q A;  4O5V A;  3RMS A;  3LW5 E;  3OMC A;  3CCM A;  3ASK A;  1QVG A;  3H4C A;  2M1H A;  1I4K 1;  2ZZD A;  3RKW A;  4C8Q B;  2QQA A;  3FLG A;  1O75 A;  1VIF A;  2RJF A;  5EG2 A;  3OY9 A;  3VYG A;  3OYG A;  2VC8 A;  2QQ9 A;  3CCJ T;  3OS5 A;  5GAN 3;  5GAN j;  1ZBX A;  2BS3 A;  3G4S A;  3JB9 F;  4PJO A;  1Q86 C;  4LDU A;  4J5Y A;  4PNO A;  4N4I A;  4C0D B;  4XTY A;  3ZFJ A;  1QLB A;  4ELY C;  3VKI A;  4Y28 E;  4KUD K;  3ME9 A;  3QJ6 A;  5HKC A;  2GFU A;  2B8A A;  3QYG B;  4E47 A;  3R6O A;  4OF1 A;  3CCR T;  2YLC A;  3JCM V;  3OB9 A;  3WXM B;  4BUG A;  3JCM J;  1MHN A;  4MIM A;  3OYK A;  4CI0 C;  3V7C A;  4R55 A;  4J8O A;  3JCM d;  5D6W A;  5DLO A;  3S3M A;  2EJF A;  2KR6 A;  4BBR M;  4NS5 A;  3I55 T;  2HAX A;  3JCM e;  4C5I A;  3O8V A;  4IUT A;  4AKG A;  1KHI A;  2E41 A;  3QUI A;  3L2V A;  1M90 U;  4M7A C;  4MFD A;  3TW7 A;  2M16 A;  2V8J A;  2E6Z A;  2CZ1 B;  2KVQ G;  4L59 A;  4QQD A;  5LJ3 g;  5GAN f;  1O9S A;  1N8R U;  2QI2 A;  5GMK h;  4LDX A;  2E6N A;  2VV5 A;  4A4K A;  3HRU A;  3ZBD A;  4J83 A;  3PIO A;  4FIB A;  4M77 E;  1VQL A;  4BBS M;  1M5Q 1;  1K8A C;  4Z02 A;  5J26 A;  5GMK l;  1P92 A;  4XU1 A;  3DL1 A;  2G3R A;  2O01 E;  2VXF A;  2CS7 A;  1S72 A;  5J3B A;  3SD4 A;  2DTO A;  1KHC A;  2MF2 A;  3CCU T;  3CCV A;  4AI6 A;  3FB9 A;  4N0A A;  2K2V A;  4N4G A;  4M75 E;  2QA4 T;  1Q81 U;  4PJO G;  1G3Y A;  3LX7 A;  1Q7Y U;  2E10 A;  3OSS C;  3KBG A;  4EPC A;  2DVE A;  4JJN K;  2FL7 A;  3DLM A;  2ZPB B;  2DXB B;  4XTW A;  5C6S A;  3FIF A;  4XU3 A;  3RKY A;  1YBY A;  5CKD A;  3G71 A;  3L2U A;  4C5H A;  4PJO E;  4BI4 A;  4QVZ A;  3JCM W;  1G3T A;  1N9S A;  3L1A A;  2RH2 A;  5CKF A;  2RK1 A;  2V8I A;  4XK8 E;  4C8Q F;  4L6V 5;  4C92 A;  4M75 D;  5LL6 S;  4EDU A;  4FL6 A;  4KT0 E;  4M78 C;  5GMK m;  5CR2 A;  4M7A A;  3A8G B;  2BUD A;  3MP8 A;  1HK9 A;  2QQS A;  2QTX A;  2QDY B;  4EMK B;  5GMK j;  3OW2 S;  3HFO A;  3X28 B;  1OZ2 A;  1X75 C;  4M77 G;  5CKE A;  5A0L A;  4M75 B;  3JCM Q;  3V8L A;  4IKF A;  3HB9 A;  2OAU A;  5GAN g;  1M1K U;  3G7Z A;  2X35 A;  3OBY A;  2IG0 A;  2ZPF B;  3HBL A;  1VQ6 T;  4XAX B;  2E64 A;  3UT1 A;  5A2Q E;  2RI3 A;  5M9O A;  3JB9 D;  3TU4 K;  4ME7 A;  1VQ4 A;  5HK0 A;  2RK2 A;  1VQP A;  1W2B S;  4BY6 C;  3JCM b;  3CPW S;  1W2B A;  1NPP A;  2X4J A;  3GPL A;  2V8K A;  2EYQ A;  3H8Z A;  4ZN3 A;  4BI8 B;  1Q82 U;  4HT9 A;  2DD4 A;  4MZT A;  5GAN 8;  5DM7 R;  3CXC A;  4C0F A;  2DD5 A;  2K57 A;  4Y91 A;  2OTJ T;  2VYT A;  1K9M C;  3I56 T;  3MEW A;  1QVF A;  1WJQ A;  3OS1 A;  4FT4 A;  4QW2 A;  4PJO F;  4RG8 A;  4XTZ A;  4ZGD B;  1VQ5 A;  5GAM j;  4OB3 B;  4FM4 B;  2O4X A;  3A5Z B;  3MEU A;  4M78 A;  4C92 G;  2DPP B;  1WJS A;  2GF7 A;  2YRV A;  4WF2 A;  3MHX A;  1BIA A;  2RB6 A;  4BDZ A;  3G6E T;  3GP8 A;  4M7A G;  2CYZ B;  3H6Z A;  3QZ5 B;  1K73 C;  5CIU A;  4JS5 A;  4A4H A;  3SWN A;  1VQ9 A;  2LCC A;  4J6W A;  3VUB A;  4CRI A;  2CGH A;  3OS0 A;  3QYB A;  3OYD A;  4ZTF A;  5GMK i;  2QDJ A;  4X9C A;  1WNL A;  4QQ6 A;  5LJ3 d;  4M7D A;  2HD0 A;  4M77 F;  3RKX A;  1AHJ B;  5HY6 A;  3QDR B;  3QWL A;  1DJ7 B;  3CCQ T;  4LD9 K;  4NL3 A;  4HCB A;  4ELZ C;  5LJ3 e;  3HRS A;  1PSF A;  2PQW A;  2QQR A;  2R5M A;  4F7U A;  5GAM f;  3PFS A;  2A7Y A;  1VQM A;  4DOW A;  5C0M A;  4LD6 A;  1TH7 A;  3PTA A;  2DJZ A;  5DLQ E;  3OYL A;  1Y7X A;  3BFM A;  2XD0 A;  1B34 B;  5CKB A;  3CC4 A;  3GF5 A;  5FU6 C;  2KMG A;  2EKO A;  4M75 F;  4A4E A;  3M58 A;  2LT1 A;  3VJP A;  3VV0 A;  1KG1 A;  2LTO A;  2XI9 A;  5LJ5 j;  3E9G A;  4II1 A;  1QVP A;  3MO8 A;  5CKH A;  2XG8 D;  2PVD B;  3PGG A;  2F69 A;  2HBP A;  3QBY A;  4UC4 A;  2NLU A;  3VKH A;  3CCJ A;  3CC2 T;  2QFZ A;  2EWN A;  3LLR A;  4P5N A;  1NZ9 A;  1V29 B;  4A4F A;  3A8L B;  1VQK T;  3OYC A;  3UWN A;  3AHU A;  3DKM A;  2CZ7 B;  1WQ7 A;  3BY7 A;  2ZPI B;  2PVO B;  3L2Q A;  1W4S A;  3CCR A;  5CCA A;  3JCM P;  4BI3 A;  3SDZ A;  1D3B A;  4FT2 A;  1QP2 A;  2DIG A;  5EJC A;  1PSE A;  2P4T A;  3TEE A;  3M55 A;  3M4Y A;  4PLL A;  4XTV A;  2QXF A;  5I2S A;  1NJI U;  2L5Q A;  1LJO A;  3RUX A;  3EFS A;  4NOY A;  3MCA B;  3JB9 J;  3CD6 T;  3I55 A;  1X01 A;  4KUI A;  5LJ5 f;  3OS2 A;  1UGP B;  1OI1 A;  2K5I A;  4LDV A;  4C0G A;  4EMK C;  1KD1 C;  3E1S A;  2YHT A;  3M54 A;  2XKO C;  2PU9 B;  1BYM A;  3Q1J A;  5GAM g;  1YHQ A;  2LT4 A;  1VQN T;  3CCL T;  4PJO D;  2IVW A;  1UGQ B;  1VQ7 T;  2XIC A;  2PUO B;  2QEX T;  2C06 A;  2JNG A;  2ZZD B;  1RL2 A;  1M90 C;  1WGS A;  3FEO A;  2RI2 A;  3RMQ A;  1Y07 A;  2L8D A;  2XID A;  2DAQ A;  3KXT A;  3NTI A;  1N8R C;  4M7D E;  4MML A;  1Y96 A;  4PJO B;  3X20 B;  3QXE B;  4J7I A;  5FU7 B;  4AKI A;  2DIQ A;  3CCU A;  2OTL T;  3V7S A;  2M0O A;  2LNV A;  2QA4 A;  2VUB A;  2MWO A;  4IUV A;  2KY9 A;  5CAI A;  3WVD B;  3OA6 A;  1BIB A;  3JCM f;  1MGQ A;  3UPU A;  2Y4X A;  3BG3 A;  4M77 D;  4M7D D;  5I21 A;  1RI0 A;  3C94 A;  3CBM A;  4M6V A;  1Q7Y C;  3FRN A;  4V2S A;  2K5L A;  4JX6 A;  2L89 A;  2LCL A;  2DXC B;  3KUF A;  1G3S A;  4E7L A;  4M77 B;  4M7D B;  4MZP A;  1FX7 A;  2P0P A;  4Z6Y A;  3L2W A;  3HL8 A;  5LJ5 g;  3X25 B;  2K3Y A;  2Y90 A;  4C92 E;  1BI1 A;  3FC3 A;  5CK9 A;  1N9R A;  3MEV A;  4RCC A;  1YJN T;  2H3J A;  2QQB A;  1WPY A;  5GAN 4;  1OZ3 A;  4JRP A;  2DZ9 A;  5DY9 A;  3P8H A;  3QJY A;  4C0Z A;  3OW2 A;  1VQ6 A;  4M7A E;  5CVI A;  1YIT T;  2RHZ A;  3M5A A;  3URG A;  4E7I A;  3OQ5 A;  4B9X A;  2ZPE B;  2JOY A;  3CBO A;  4HCC A;  5KE3 A;  4A54 A;  3MP1 A;  4OVA A;  5KCO A;  4HT8 A;  3CMA T;  1JBM A;  3NTH A;  3WVE B;  1I5L A;  4C92 D;  1N6A A;  2QF7 A;  4HA8 A;  3L2Z A;  3CPW A;  1YIT A;  1JJ2 S;  2EQJ A;  2FYK A;  2MWP A;  4VUB A;  3VKG A;  1VQO T;  3L42 A;  5LJ3 h;  1IRE B;  4OP0 A;  4M7A D;  3HZJ A;  3JB9 H;  1R8O B;  2KMT A;  3LYI A;  5GAN 7;  3INZ A;  1WJR A;  2WSE E;  2OTJ A;  3CC7 T;  4C92 B;  3EFR A;  4JRK A;  3OYA A;  3I56 A;  2RJE A;  2VGM A;  2F5T X;  3V8J A;  3X24 B;  2MMP A;  4C8Q C;  1Q82 C;  5FRN A;  2EQU A;  1BI2 A;  3OSV A;  1GXI E;  2DXT A;  2XK0 A;  4M7A B;  2E65 A;  1WQW A;  3HP9 A;  4PKC C;  4J7F A;  4Q5W A;  1KC8 U;  4HNT A;  3OMG A;  1BI0 A;  3RIR A;  4E7H A;  4C0D C;  3TW6 A;  1XQH A;  2HQE A;  4JRQ A;  3DLL A;  4M78 E;  3LWH A;  4EMG A;  1I81 A;  2RM4 A;  4MMK A;  4JUV A;  2FVU A;  2HNI A;  1M1F A;  5AYF A;  1XTD A;  4XTU A;  1YIJ T;  3QII A;  2RHU A;  3M9Q A;  5J39 A;  3QPH A;  2DEQ A;  2X4W A;  1YJW T;  3HHT B;  4IUQ A;  4HL4 A;  3CCQ A;  3A8O B;  4D6W A;  5GAM d;  4HCZ A;  3OYI A;  4FSX A;  1JRI A;  1YJ9 A;  4M7D F;  3QYH B;  2KK4 A;  4C5G A;  3J7A F;  5GAM e;  2DD4 B;  4O6J A;  5IAY A;  3DB3 A;  3QHS A;  2E1H A;  3V7R A;  3JRZ A;  1KQS S;  4OB2 B;  2DD5 B;  2DKG A;  3BDL A;  4BDY A;  2RI5 A;  3JCM X;  4JLG A;  1KQS A;  1M1G A;  2XHC A;  2DTI A;  3JCM c;  4F7U E;  5GAN h;  3FDR A;  3OYJ A;  4PJO C;  4C8Q A;  2O4X B;  3HPW A;  2JUF A;  4HNU A;  3J80 E;  2JTF A;  4NC6 A;  2KAF A;  5HK3 A;  3JAM E;  2LQ8 A;  3CC2 A;  4ZGE B;  1Y71 A;  1M9S A;  4JX4 A;  3PMT A;  4X9D A;  4RKU E;  3JB9 I;  2LX9 A;  1M8V A;  5L8R E;  3PIP A;  1UGR B;  3C95 A;  4LOC A;  5IN1 A;  3OBW A;  3OYN A;  4M78 G;  1VQK A;  3SFM A;  3M59 A;  3SWN B;  1HXD A;  4RMO A;  4ZTJ A;  2ZGW A;  3CME T;  2LVM A;  2RJC A;  5GAO r;  1XNI A;  2AHJ B;  2YLB A;  2BKD N;  4M7D G;  3LGF A;  3S6W A;  5IT9 E;  2XDB A;  2BS4 A;  4DA4 A;  3CEY A;  1VQ8 T;  4C92 F;  4GY5 A;  3S3O A;  4J6Y A;  1YI2 T;  4M77 C;  5GAN 6;  1U8R A;  4BD3 A;  3CD6 A;  4F7U B;  2BS2 A;  5FLX E;  4M7A F;  3CCE T;  2KQW A;  3OYE A;  4DQ2 A;  3NTK A;  1G3W A;  2XDD A;  1QVG S;  4ATO A;  4FU6 A;  3CCS T;  4TVR A;  3CPF A;  3V8K A;  3C12 A;  3TCJ A;  3GIB A;  5GAN d;  1Q86 U;  2EAY A;  3VYH B;  3CCM T;  1NJI C;  4M75 C;  3SB2 A;  4J6X A;  3CCL A;  4F7U G;  1VQN A;  1BKB A;  5GAN e;  2MAM A;  2QEX A;  1VQ7 A;  4NL2 A;  2DTH A;  4JS4 A;  3VU3 C;  4DOV A;  3GLX A;  4N0A C;  2MI6 A;  2RD1 A;  2XU8 A;  3G4S T;  2EQK A;  1VIE A;  4BB7 A;  4OB0 B;  4HNV A;  4IUR A;  4C8Q G;  3LGL A;  3VYG B;  1QP3 A;  2D6F A;  5I2M A;  2OTL A;  4YTL A;  1KD1 U;  2WJ9 A;  1VUB A;  4N4H A;  2F5K A;  4ZN1 A;  1U1T A;  2VXE A;  2K3X A;  4IUP A;  2EQM A;  2DXB A;  3TRE A;  3M56 A;  1D3B B;  4C92 C;  4QVC A;  4MDW A;  5GAN 2;  1U1S A;  5CO7 A;  4OGE A;  3HO8 A;  3OYY A;  3N5B B;  3JSC A;  2DXC A;  4HKE A;  2DK3 A;  3PMI A;  1UGS B;  5D6Y A;  4M77 A;  2P0K A;  3QZ9 B;  3X26 B;  4M78 F;  1Q81 C;  1K8A U;  2JTM A;  2GQV A;  1YHQ T;  2R58 A;  4XU0 A;  4LDW A;  4EMK A;  5FU6 B;  2KDS A;  2WAC A;  3LH0 A;  4M75 A;  1VQL T;  1SSF A;  2GCX A;  1OYX A;  1ZQ1 A;  4LDY A;  2DO3 A;  1YJN A;  1KQ1 A;  1S72 T;  4X34 A;  2E12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...