1IREB

Crystal structure of co-type nitrile hydratase from pseudonocardia thermophila
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase
publication title Crystal structure of cobalt-containing nitrile hydratase.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2001-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ireB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ireB02
2QDYB 3X25B 3X28B 1GXIE 3A8GB 2DXBB 1AHJB 3A8LB 2DD4B 5L8RE 2DPPB 4KT0E 2DXBA 2DD4A 3VYGB 1UGPB 4ZGEB 3WVEB 1QP2A 3VYGA 3QXEB 1DJ7B 2WSCE 2D0QB 2ZPHB 2ZZDB 2DD5B 1V29B 3VYHB 4L6V5 2ZPFB 2PVDB 2ZZDA 4RKUE 3X26B 2ZPEB 4FM4B 4OB3B 4XK8E 1PSEA 2CZ7B 4ZGJB 3X24B 2DXCB 2O01E 1QP3A 3QYHB 1UGQB 2PUOB 2DXCA 3A8OB 2CZ1B 3A8MB 2PU9B 2DD5A 2AHJB 2WSFE 3WVDB 1UGSB 3HHTB 4ZGDB 2CZ6B 4OB0B 3QZ5B 2PVGB 4OB2B 3QZ9B 2PVOB 1IREB 1JB0E 2ZCFB 2ZPIB 2ZPGB 2WSEE 2CYZB 3A8HB 1PSFA 2PUKB 3QYGB 4OB1B 1UGRB 3X20B 2ZPBB 4Y28E 3LW5E 2CZ0B
chains in the Genus database with same CATH superfamily
5BNJB 3X28B 2QTVA 3HZJA 2JN0A 3MPUB 2EQMA 3VU3C 4F6UB 5AT1B 4ZN3A 1YNZA 4KH0B 1UB4A 4QKUA 2KYBA 3VYGB 1KG1A 2BKZB 5FW9A 3KBGA 1OU8A 4E2FB 2HBPA 2DFUA 4WCIA 2QGFB 2HDAA 3CCJQ 2MIOA 1WPYA 3B57A 2C6TB 4J9EA 4KGXB 4C8QG 3UDCA 3M56A 1PCXA 2DILA 1ZP2A 3CCQA 4A4GA 1BIAA 1OPKA 4Z02A 1YIJA 1MHNA 2JS2A 4FM4B 4BCJB 4ESRA 3M0TA 3QBYA 2RHXA 1YFNA 4MZMA 1JSUB 2BE7D 4BCND 1PSEA 2K57A 1M90U 3HKSA 2E3IA 2K3BA 5I5ZB 1YJNA 2E12A 5J39A 2DMOA 2HQXA 1Q82C 2CP5A 3RERA 1OPLA 1Y07A 2J7IA 1Q7YR 2KT8A 4Z88A 4QQ6A 1PD0A 2LMJA 4N0AA 1XO2A 1QMZB 2E4HA 4EIKA 1VQKQ 1M3CA 1MNDA 4BCMB 2C5XB 2DL7A 5FU6B 3GBQA 4QVDA 3G6EQ 2CCIB 4LNPA 4M7AF 5GMKl 1UFFA 4HT9A 4R55A 1H3ZA 2VXFA 1OX8A 2DL3A 1X2KA 4A54A 2GNCA 1WHGA 1BI3A 2O4XB 5HVYB 2J06A 2HD0A 2C0OA 2CP6A 3OW2A 1VYUA 1E9HB 2DA9A 3EIDB 1WHHA 5GJVB 1IHVA 2L8DA 4C5GA 1BIBA 3C4SA 1SRMA 1UJ0A 2VV5A 2EYZA 1N9SA 4B6MA 2EW3A 1KQ2A 2RQRA 1H25B 4DBFA 3BHVB 5HKCA 3PNWC 1XNIA 3PFSA 1BU1A 3NDQA 2CP3A 2E6NA 1W1FA 2R5AA 4JS4A 1M8VA 4LDVA 5GAOm 1WXBA 5FU7C 2BPMB 2GFAA 4HCKA 5LL6S 2CT3A 1VQ7Q 4BI3A 3HPWA 1YN8A 2AKKA 4DOWA 1JJ2P 2DX1A 1UDLA 2YT6A 3THKA 2FB7A 3GPLA 3CCLT 1YI2Q 3CCMQ 2C5NB 1GCPA 3BLRB 2QG9B 1I07A 3VRZA 2RB6A 3CCEQ 3CMET 4L6V5 5EFQB 5HY6A 5GMKe 3KXTA 3RMSA 3V7SA 1YJWA 3QDRB 5GAN6 3E1SA 1LNXA 2FPEA 3DJBA 4J9GA 4AKIA 5LJ3e 2QGSA 3RESA 1ZA1B 3M9QA 4Z8AA 1P5EB 5DQVA 3PIOA 2QA4T 4IUTA 3M59A 2CKKA 2FZCB 1TFBA 2RI3A 1URCB 3NFCA 5I11A 3TNIB 3PMIA 3EFOA 3LYIA 3LWHA 1ZUUA 5IHIA 2HCKA 4UN0A 4M78C 1AZEA 1VQPQ 1K8AR 4ZTFA 2I53A 2KMTA 4FSXA 2LJ0A 1B07A 3JSCA 4KBMB 2K6DA 1YIJQ 1WJRA 1SHGA 1H1SB 2IPOB 2EYWA 1KSWA 4FSSA 3VKGA 3OYBA 2EBPA 3DB4A 5CK9A 1JJ2S 2L89A 2W96A 2NUTB 2H8HA 3V8JA 2K2MA 2QXFA 3VS2A 2JVVA 1GFDA 3J80E 4C0GA 2ESWA 2K4YA 4C8QA 2DJZA 3R6OA 2ZPGB 5L23A 4GBQA 1QVPA 1M2VB 1H3HA 1FMKA 2KXDA 2RJEA 4BE0A 4A53A 3HP9A 2DVJA 3RR6A 3I55Q 5LJ5e 3BE3A 2DERA 2DXBB 1PD1A 1RACB 1N4MA 3G4SQ 5FRMA 4KT0E 5ICPB 1JKWA 4C92B 3KHIA 4OGRB 1X75C 2YDLA 1OX9A 4BCOB 4OMMA 4AFSC 1GCQA 2OTJQ 4BE2A 3SWNA 2YUOA 1FYNA 3TEEA 4OMPA 1LJOA 2KRNA 4LD6A 4M75C 1IZ6A 3DOGB 1OU9A 4BBSM 1G3TA 3RKWA 1NEGA 4MDWA 2DXUA 2VYTA 2DNUA 2HAXA 1D3BA 2ZPEB 1JBMA 1OZ2A 2GQVA 2O2OA 2DAQA 3CMAA 1GFCA 3LGFA 1CKBA 3P8DA 4JZ4A 2LZ6B 5CEIB 4HVVA 2EQJA 3JB9H 4M7AG 2IN3A 2F5KA 1SG5A 2AK5A 5CR2A 2J6KA 1VQ7T 3M0SA 4M78B 1U1SA 1Y57A 4XQ3A 4PJOE 1T3LA 1IB8A 4XTVA 3M0PA 3DDQB 1YI2T 5CIUA 4K11A 4L5GA 3RKXA 4F7LB 5LJ3f 3MY1B 2PK9B 5DLOA 1JXMA 4F6SB 3CCET 1K0SA 3DKMA 4DBRA 2HL5C 5LJ3g 4NL2A 2XICA 2K5IA 1OKVB 2HQEA 1F5QB 5GMKj 3PO3S 4KUIA 2RI5A 2F1LA 1BCOA 2FPDA 2PVOB 1IREB 3OSSC 1IXDA 4C0DC 5GAOl 1YWOA 1I81A 4C92D 2WSEE 1SF9A 5LJ3j 4C5IA 2CGHA 2VASA 4J8OA 1AWJA 3GTMS 1UGRB 1KHIA 2WMBB 1VQPT 2RO0A 3MKDA 2CZ0B 2X4WA 1WFWA 2JOYA 3FB9A 2WIPB 1SPKA 2AZVA 2QQ9A 2CH4A 1Y71A 4WF2A 5GAN8 1YIJT 3HO8A 5IDNB 2Y4YA 5GANe 2E10A 4EOOB 2FRWA 3H8ZA 2LQNA 4F7UB 1PG5B 4A63B 1V76A 2DD4A 2KT1A 1R77A 1TXQA 3NPFA 1WNLA 3CC7Q 2MK5A 1K73C 2V26A 3G1JA 2L3RA 5CQYA 2UUEB 1Y96A 1ZBXA 2DO3A 2FO0A 1Q81C 1N8RR 2QQ8A 5LJ5f 2Z0WA 1TUCA 1VA7A 5L2WB 2QK0A 4NOYA 2C4GB 1RAFB 3A98A 1WJSA 4IUQA 2VVKA 4CXAB 3CCUQ 2RH2A 4FT2A 4M78D 4EOSB 1HJDA 4LUDA 2CH4W 5A2QE 5LJ5g 1VQ9A 4RKUE 2YRDA 1ARKA 3LWIA 1ZA2B 2M51A 5GANd 1K8AU 3I55T 4PLIA 4D6WA 1WLPB 1OI9B 1TSFA 4ZGJB 4BY6B 3REBB 2R5MA 3G4ST 3QG1A 3EGUA 2B9RA 5LJ5j 2PTKA 5DLQE 2D6FA 3BHUB 4BCGB 3RKYA 2RPNA 3E2UA 2P0QA 1H26B 4JX5A 1UTIA 1OEBA 4CFUB 1B7TA 3A8MB 5IH2A 2M0OA 3L2WA 1AD6A 3QWLA 3GP8A 3RDVA 4EMKC 1HD3A 1W70A 1BKBA 4DOVA 1NJIC 5GMKi 2PQWA 2AIRB 5GAN4 1MMNA 1KD1C 3CMAQ 3CCLA 3P8HA 4OMLA 1RI0A 2OI3A 2CUDA 5D6XA 2WJ9A 3H4CA 3E19A 1K1ZA 1HYOA 2DVEA 2K2VA 1YITA 2VKNA 4C0DB 3CMEA 2HZYA 2CUBA 2FG0A 3A8HB 1PSFA 2ABLA 4JJDA 5IXBA 5IF1B 5I21A 4GLKA 1KK7A 4P5NA 3LW5E 4J9CA 2QDYB 3X25B 4EDUA 1SSFA 3A8GB 4M7AA 3OB9A 2HNIA 4AG1C 5HK3A 3FC3A 1QMCA 1Y0MA 1Z9QA 2RMOA 2PJQA 1YJ9Q 1LPLA 2O9SA 1OKWB 1H8KA 2DK3A 5D6YA 4N4HA 1BB9A 3CCJA 4FT4A 1UGPB 4ZGEB 2HBWA 3WVEB 4R56A 2KROA 2XG8D 1X43A 2K3YA 3OA6A 3CPWA 2LRQA 2QFZA 1I0CA 1NYFA 1OYXA 3ULRB 4FW2A 5GMKh 2EUFA 1OZ3A 4GLMA 2KDSA 1ZSZA 3EG2A 4ATOA 1ACMB 2PVDB 4EC8B 4CFUD 2EJGA 4OMFB 3S6WA 2ECZA 4HCCA 4E7KA 1NYGA 1R8OB 3V7CA 5LJ3h 1QCNA 4YTLA 1NEBA 1WDXA 1YHQQ 4YOZA 4EOKB 2A7YA 4JJCA 3QUIA 2IW9B 4M7AE 2M0YA 2COYA 2RK1A 1RLPC 1QWEA 1VQ6Q 3H41A 4J83A 5IHNA 4RODA 4JPBW 1HSQA 4OP0A 4RTUA 1VQKA 3J7AF 5GANj 2RHIA 3G6EA 3CC7T 3O0GD 5CKDA 2COWA 2RA2A 5KYXB 4NSTB 2DL4A 4EMKB 4BI8B 4EOLB 1VQ9Q 4JLGA 1PC0A 4F17A 3BLHB 3CCUT 4OB0B 3F70A 1C0MA 3VUZA 4AFQC 2EIFA 1G83A 4RTZA 2A28A 1ZUYA 2RHYA 5GAN2 3CCRA 2G6FX 1ZLMA 4IUPA 2CSQA 4C92F 3CC4A 2G77A 2CT4A 1WXUA 4BD3A 3T9NA 1FINB 3QHRB 3TREA 1VIEA 1D0ZA 3JCMe 4Q5WA 5GAOn 2ROLA 1VOLA 3GIBA 4XTZA 2M1HA 5LJ5h 4BE1A 1QWFA 1KIKA 2CS7A 1N8RU 2X4JA 3E9FA 2KYMA 1X01A 4OGEA 1FXXA 2DRKA 2KSSA 4HVUA 2X1NB 3VUBA 2FHDA 3C12A 1TG0A 2P0KA 2V8JA 4FL6A 4YOOA 1S72A 3JCMQ 3CMAT 3TN8B 1PWTA 2DRMA 1YI2A 3GNFB 3RIRA 3CCMA 3M57A 1K9MR 4M77C 1MUZA 2EJ9A 3JCMd 1VQLQ 3CCEA 4F6WB 3TW7A 4M78F 2IVXA 2LCCA 2RI2A 5IT9E 1ZX6A 2JTEA 4BDZA 3MCAB 4BACA 2L3QA 1D3UB 2WEVB 1RL2A 1JO8A 1N27A 5HNBB 4XU0A 2LJ1A 5CKEA 1MMGA 4NL3A 4KH1B 1Q86U 4EOQB 2JM9A 1MV3A 2MPXC 2CZ7B 3QWXX 2O01E 4M7DB 2LQWA 3DB3A 1IHWA 1YJ9T 4Y72B 1VQPA 2YUPA 4CFNB 2NYSA 3QIIA 1JU5C 4RG2A 4M6VA 4EOJB 3QJ6A 1ENWA 1UHFA 2B8AA 4BCIB 2DD5A 2HL3A 4XTUA 3OYMA 3NGPA 2I2LA 1AISB 2D1XA 2W99A 2JGZB 2E64A 4E7ZA 1BYMA 2MF2A 5IHKA 4HKEA 5IAYA 1FX7A 1O9KA 2DBKA 3RUXA 2QASA 4RCCA 2L5QA 1G2BA 4EOIB 1VUBA 3V8LA 4IIMA 5LQFB 1OI1A 1E7PA 3EJ1B 3QZ9B 1W6XA 4F7UF 2RNAA 4C0FA 5CCAA 1YHQT 2EKOA 2FZKB 1AWOA 3OSVA 4KUDK 4PJOC 4RTTA 1KQSA 4EOPB 3SWNC 1VQ6T 2M9UA 4BCFB 2OX7A 2P4TA 3DLLA 3VKHA 3MP8A 3I55A 4OGCA 3L2UA 2X51A 3LGLA 4FCYA 2ZPBB 3LX7A 3G4SA 3OQ5A 2LT4A 3VV0A 3JB9I 2WMAB 5GANh 2V8KA 2VXEA 2QEXQ 1VQ9T 3M0UA 5EC7A 1UE9A 1WHMA 2QDLA 1QCOA 2OTJA 3CCRQ 4DA4A 2ATCB 2BZYA 1PKTA 3CC4Q 4E7IA 4CRLB 4M77B 3G71A 3EFOB 4M7DD 2KXCA 2X3WD 3AT1B 3VYGA 3BG5A 1M1KR 4IUUA 1RI9A 1UG1A 3MEUA 3DTOA 2MYSA 3EG1A 2YLBA 3J81E 3LQ5B 2KRMA 4QVZA 1KC8U 1UJYA 3VS7A 1QW1A 3M03A 4JX4A 1H641 2KBTA 2CREA 1KXUA 3C95A 4D8DA 2V1QA 3SD4A 1S72Q 3IQLA 1J3TA 3QYHB 1M1GA 2K9GA 1VQOQ 3M54A 4EMGA 2FVUA 1GBQA 1UGQB 1G3YA 1YCSB 4EC9B 3FEOA 3FJ5A 1YITT 1S1NA 4R0KA 1OOTA 3OMGA 4N4GA 3EFSA 3OYEA 3OYNA 4RTXA 2EVRA 4YOSA 3VS3A 3L2ZA 4C92G 4CFWB 1XTDA 2JMAA 5GAOp 1TUGB 2O31A 2V1RA 3O5ZA 5IDPB 2CP0A 3EH2A 3HRUA 1IGQA 1WYXA 1C1AA 1T0HA 9ATCB 2O4XA 1PNJA 4MMKA 2KRSA 1H28B 5CVIA 4PJOB 2DZCA 4O6JA 4HNVA 3UA6A 2XKOC 2CYZB 2DKGA 3CCJT 1OL2B 3R6NA 2BS2A 1KFZA 4BY1X 1TUDA 4M77D 2GTJA 2XK0A 2OAWA 2DLPA 3TQ7P 2ENMA 3CBPA 1K9MU 4J9DA 1ABOA 1Z9ZA 4AT1B 1PRMC 2E3HA 3GOXA 3AHUA 1UUEA 2QF7A 2YWWA 4M78G 2HKQB 4JRIA 3MEVA 4PFOA 3CC7A 1QKXA 2BS4A 3TU4K 1K0XA 4BI4A 1Q86C 4KGVB 3L1AA 5KYUB 4BXXX 1QP2A 3EG9B 2EAYA 3V8KA 3CCUA 3O8VA 4J6XA 1VQKT 2OAUA 2ZPHB 5CKHA 3CPWS 3G6ET 2B86A 1WHLA 2DXTA 3Q1JA 5FU7B 2QQSA 2GF7A 4LD9K 1B34B 4OB3B 1M9SA 2L0AA 3EG3A 1SRLA 4C0ZA 2X4XA 3LLRA 1WHKA 1H24B 3SDZA 1NG2A 2KVQG 2QEXT 3CCVA 1ZHIA 2JW4A 1M90C 2IG0A 5KYWB 3MP6A 3CCRT 3JB9J 4C8QE 3G71Q 1GUXB 2ZGWA 1VYWB 5IN1A 1WA7A 4JLIA 5GAMe 3CC4T 2BUDA 4ELYC 2BE9B 4BCKB 2GQIA 4PJOD 3VRYA 5GAOq 1NM7A 4F7UG 1QKWA 2VWFA 1Q7YU 3UPUA 4M4ZA 2DEUA 1Q82R 2WHBB 4PJMA 1UGVA 3QZ5B 1N6AA 3BY7A 1H27B 4J9IA 1PKSA 4OB2B 4FYXB 4FW1A 2NUPB 2RQTA 5GAMd 1S72T 3M4YA 2HSEB 3JCMh 1VQ4Q 3CCMT 1VQOT 3DDPB 2ZAEA 5FRNA 2D0NA 2XDDA 4OB1B 2UZBB 1VQ8Q 1M2VA 3KUFA 1ZSZC 3OYJA 5AYFA 3JAME 3G7ZA 2EGEA 2RHZA 5KH6A 2A08A 4MDXA 4PFZA 1YJ9A 1QLBA 3M53A 5L8RE 2F69A 2C5OB 2LCSA 2DXBA 2KR3A 3OS1A 4AKGA 3VKIA 5HQ0B 1KC8C 4BCHB 1MV0B 1VQ5A 6AT1B 4CFMB 4M7DF 4C92A 4HT8A 4FYVB 5ACBA 5CKFA 2CDTA 1OL1B 3FLGA 4X9CA 2W9FA 3UWNA 2ZZDB 3QDFA 1AZGB 1V29B 3FJPA 3MJXA 2LDMA 3FDRA 3MEAA 2ZPFB 2DTOA 3MY5B 4HLQA 2KY9A 2JM8A 3GLXA 4KULA 1RAIB 2WXVB 1YHQA 3X26B 2PHGA 5FLXE 4F16A 2BIVA 3PVLA 4ROCA 1VQ6A 4MIMA 2SEMA 4AFZC 2DXCB 1AEYA 4JRQA 2RD1A 4J6WA 4KRDB 5FWBA 3E9GA 4M75B 2PUOB 1WXTA 1IRXA 3OW2P 1VQMQ 4OVAA 2IIMA 2H3EB 4C92E 2MWOA 2WSFE 4M78A 2G3RA 2I40B 1R0CB 3K7AM 3EGXB 2BS3A 3M4GA 2XDPA 4RTVA 3G33B 4DBHA 2VB6A 3OYHA 1W2BA 1VIFA 1MGQA 2DL5A 2PVGB 3QO3A 3CCVQ 2DM1A 3HTRA 2EJFA 2OTJT 1JEGA 3H0HA 2GGRA 1UECA 2XU8A 4M77F 3VS0A 1NE8A 2D9TA 3NMZC 1KQSS 3G71T 2X4YA 1X27A 1HXDA 4F7SB 3OYLA 4QQDA 3MEWA 4O5VA 3OYCA 3JCMX 3A1PA 1NLOC 4M78E 4LUEA 2XI9A 2MMPA 3PVQA 3HSBA 1ZBJA 4XAXB 2RJCA 2VUBA 3PIPA 3LH5A 3OW2S 1N5ZA 2QQBA 1VQLA 4ZNXA 4Z6YA 5CYIB 2L3PA 2CJMB 3VS5A 2R58A 1VQNQ 3REAB 1AWXA 3JB9D 1G3NC 1C9BA 1X6OA 1QLYA 2EWNA 4M75D 4LDXA 4A4KA 2QTXA 5FGKB 4VUBA 1TWBA 3OYDA 1M30A 4HA8A 4MMLA 2RM4A 5KYYA 2KEAA 5C0MA 3OS0A 3JCMW 1M90R 2FYKA 4LDUA 1H1PB 2OTLA 2LNHB 1QCFA 1Q7YC 2K5FA 3S3NA 4C5HA 1Q82U 4E7SA 2P4RA 1M3AA 1VQ5Q 3S3MA 4J7FA 2JTMA 2DF6A 4N0AC 1JOWA 2YLCA 3ME9A 4PJOF 1H1RB 1BI2A 5GANf 2M02A 2A37A 3BFMA 2LJ3A 3PT9A 3L2QA 1D1BA 1M4ZA 1WJQA 5DY9A 1V1CA 1N9RA 5GANg 1OIYB 2DMEA 4MFEA 1RLQC 4A4HA 2O9VA 3TNHB 4A4EA 3EGDB 2LQ8A 1H4LD 2QDJA 2FPFA 4E47A 2PNIA 3NTKA 4JUVA 2RQWA 1H1QB 1YWPA 2ZPIB 2HSPA 2G9XB 2PUKB 3QKJA 4RCBA 1LOJA 2OJ2A 3TVTA 1VQMT 1H92A 4LE9A 1CSKA 2LQKA 4M7DG 4F7NB 2QEXA 3UT1A 1RAEB 3CCSQ 1RADB 4JX6A 5GAOr 3I56A 3M58A 2C5VB 4HL4A 2DTIA 2J6OA 5KE2A 4PNOA 4XTYA 1M2OA 1U1TA 4PFPA 3L42A 5FWCA 3OYKA 3CCVT 2EYXA 4L59A 1WIEA 3RBBB 3QXEB 2DJQA 2D0QB 2DD5B 3OMCA 2K79A 4TTHA 1D09B 2KGTA 1SEMA 4F70B 4Y91A 4EMHA 1EFNA 1BI1A 4II5B 2RN8A 2W2HA 3PGGA 3QHSA 1K73R 4LOCA 1BCMA 1Q81R 2P0PA 5FU6C 2COZA 4CRIA 2RJDA 3SHWA 2E6ZA 1FWZA 1VQOA 1M27C 2AKLA 1K8AC 3NTHA 4HCZA 1OIUB 3P8BB 2SRCA 2JT4A 1QVGA 1B3QA 5GAMh 2JZ2A 2CSIA 3MP1A 2DYBA 5FROA 3TNWB 2ED1A 4B9XA 4AI6A 2L2PA 1NZ9A 2K5LA 1VQNT 3OBWA 4HVWA 4IIOA 1W98B 5IHYA 5D7UA 3EOCB 5J3BA 1UEBA 1TTHB 1D0XA 2DTHA 5KYXA 4M77G 2E5QA 2MOXA 4EMKA 2OTLQ 4PL6A 3VS6A 2XDBA 4C8QC 2EQKA 2IW8B 2VC8A 4NS5A 2RJFA 2QA4Q 1NJIR 1M1FA 4CFVB 3OYYA 4RMOA 4RG8A 2QAZA 2LP5A 1KD1R 1VQ5T 1VYTA 1PRLC 2BKDN 2YSQA 3OS5A 5C6SA 2J6FA 4QSHA 2RQUA 4E7JA 1HK9A 1K9AA 2X9HA 3CC2A 3HB9A 5KYNA 2DIGA 1GY3B 1AHJB 3EHRA 4WTOB 3TSWA 2DPPB 3L2RA 2KE9A 3C0CA 2ED0A 1GCQC 1WHJA 3CXCA 1T0JA 1LVKA 2JTFA 5HBHB 4UC4A 1I8FA 3JB9F 5IXFA 1FMWA 4KGZB 3UATA 4M75F 3OBYA 1W2BP 1G5VA 2EYQA 4J9FA 2XIDA 4BCQB 3META 1C6VX 4LDWA 2DE0X 4PJOG 2PK2A 3RNJA 3I56Q 5GJWB 5EJCA 3JCMf 2GBQA 2LNVA 2W10A 4JJNK 2QI2A 3CCST 1NBEB 1NPRA 1P92A 3DLMA 1OQKA 2DBMA 2KNBB 3I5RA 4D8KA 2XHCA 2VGNA 1VYVA 5A0GA 4E7HA 3JCMg 4PJJA 1I5LA 2F2XA 2EFIA 4M7DA 3N5BB 4JDSA 2CZ1B 3JCMP 2EPDA 3GNGA 7AT1B 4YC3B 3M0RA 1I4K1 5CQXA 2WFYB 2UZLB 3C94A 3QWYA 1RAHB 3H0FA 1AD5A 2R7GA 2LW4A 2E1HA 4BDYA 2KI7A 1LCKA 3BDLA 4C8QB 2EKHA 2WPAB 2FRYA 2X3XD 1W2BS 1VQ4A 2QGGA 4ELLA 2E41A 3UA7A 2HEQA 4C92C 5GAN3 1RAAB 5LMKB 1VQLT 3EAEA 1VQ8A 3EHQA 3NTIA 1QVFA 1MMAA 4M7DE 2CP7A 2MI6A 4CFXB 8ATCB 1NPPA 2C06A 2M16A 3CPWP 1TS9A 4Y28E 2LX7A 4LXCA 3HFOA 3QPHA 1GXIE 4QQGA 2E5KA 4FYYB 3A8LB 4BCQD 1N8RC 2DETA 4FIBA 1R0BG 4J9HA 1WQ7A 4AG2C 4BCMD 2OTLT 3SWNB 1K73U 4J5YA 2J05A 4CC2A 1Q81U 1E6GA 4B9WA 1JRIA 2CCHB 2JS0A 4IKFA 3OYGA 2W0ZA 3CEYA 4FU6A 4M77A 2H3JA 3H9NA 3HRTA 1XQHA 3VYHB 3BHTB 1D3BB 2FEIA 3CC2Q 3HL8A 4FYWB 2HQHA 4KRCB 4EORB 2BTTA 4ROEA 2KAFA 4N4IA 3CCQQ 1BBZA 8AT1B 3CQTA 2MAMA 2XD0A 4PJLA 3URGA 3X24B 4KRTA 1VOMA 4F7JB 5LJ3d 4RTYA 4XU1A 1BK2A 5HBJB 4E6RA 1VQMA 4C8QD 5D6WA 1YJNQ 3HBLA 2C0TA 2HMAA 4CC4B 4XTXA 2HKNA 4J7IA 1WGSA 1NJIU 1TD6A 3SFMA 3WVDB 3HHTB 2K3XA 2LC4A 4M77E 1KD1U 1O9SA 4MZPA 3VS1A 1I1JA 3CD6A 2RK2A 1U06A 3CBMA 3LH0A 4XU2A 4ORZA 1OGUB 3I56T 3SB2A 3JCMJ 4PK4A 5I2SA 2UZEB 4JRKA 5M9OA 1PM3A 4XU3A 3BLQB 4EOMB 2AT1B 1JB0E 3JV3A 2MCNA 5KE3A 2LVMA 3ZFJA 3KFVA 1SHFA 4PJOA 1ZSGA 3QYGB 1RUWA 4OR5B 3H0IA 1M5Q1 1QVGP 4AKHA 5CO7A 3PTAA 2P84A 4M7AC 3JB9G 1ABQA 4QW2A 4M75G 1EZZB 2YHTA 5LJ5d 2DD4B 5HCKA 4FX3B 2A0FB 1MMDA 2NUTA 4HXJA 5DM7R 2E65A 4E7LA 4HCBA 1Y96B 4XTWA 1VQNA 5A0LA 2QQAA 2K7AA 2V8IA 4BY6C 3MIAB 2GFUA 2QYZA 2WACA 4F04B 3RMQA 1UHCA 1KHCA 3FIFA 3PMTA 1FVVB 2AZSA 5KYUA 3EG9A 1PKDB 1JSTB 3MHXA 2A36A 1M1KU 2BZ8A 2KK4A 4BUGA 4LN2A 4BCPB 1X2QA 2IVWA 2LTOA 4XK8E 1JXOA 1IO6A 4JRPA 1YJWQ 3BG9A 1B34A 1GH6B 4MFDA 1UNGD 1EX4A 3OY9A 1G3WA 2X35A 1CKAA 3I9QA 4Z89A 3A8OB 1QVGS 3I5SA 3F5XB 5KYWA 3BW1A 1YCYA 3QSUA 1GUXA 4Y92A 2YUQA 1KQSP 1D1AA 3TW6A 3CXCP 3OYIA 1OULA 5I22A 2V22B 1WZOA 2W9ZA 1UGSB 4TVRA 5EG2A 3PE0A 3DL1A 4JZ3A 2LT1A 5KCHA 3INZA 4BB7A 3CC2T 4OMOA 3TCJA 1TH7A 4RUGA 3OYAA 1ZQ1A 3M0QA 4EONB 1GRIA 3CCQT 1FKMA 3MI9B 2E70A 1Y7XA 2GCXA 2NUPA 5CAIA 3TSZA 1BI0A 1YJNT 3QJYA 3UF4A 2L3SA 2Y4XA 3CCSA 4OF1A 1E6HA 3OS2A 2F2CA 1I5OB 4M7AB 2QQRA 3VS4A 2RHUA 3U23A 3EH1A 2EGCA 4IURA 5GAMf 5KYYB 3CD6Q 1K9MC 3SEMA 3ZBDA 1YP5A 2DEQA 3NHNA 5A0DA 1M8MA 2UZDB 1AOJA 1AT1B 5GAMg 3OYFA 3MO8A 4CC3A 2MWPA 5HBEB 3ZEHA 4A4FA 4F14A 3CXCS 1F1BB 1AWWA 4G6LB 4AMCA 1ZSZB 2WSCE 4CC7A 5DQWA 4DEYA 2JJ9A 5GAMj 4I3ZB 2ZZDA 1Q86R 4PJNA 1KJWA 2PZ1A 2DYIA 1XOVA 1W4SA 3ASKA 1QVFP 4BY7X 1OV3A 4F7UA 1GL5A 2JUFA 4RTWA 4C8QF 2GTOA 4OMQA 4JJBA 2DXCA 1VQ4T 4ANJA 3M55A 4IMYB 4M75A 2JXBA 2I0NA 3BDUA 1UNHD 3POMA 2PU9B 2AHJB 1X6BA 2YXYA 1VQ8T 2FL7A 1KQ1A 4PKCC 2LX9A 4DBQA 4ZGDB 1G8XA 4ME7A 3VJPA 1JJ2A 1NLPC 4M7AD 3EGXA 3H6ZA 2QA4A 5ECAA 4OMNA 2EYYA 1RABB 1WQWA 1M3BA 2XMFA 2DZ9A 2F5TX 1T3SA 1YJWT 1VINA 1QQJA 4CI0C 4MZTA 2WIHB 2C0IA 4F7UE 2ZCFB 2NWMA 2EQUA 4X9DA 3S3OA 3EFRA 1WX6A 5GMKm 3QYEA 1BU2A 3M5AA 3WXMB 1G3SA 3QYBA 4X34A 5KCOA 4IUVA 1PHTA 4X1VA 3CBOA 1QVFS 2D8JA 4M75E 2BZXA 1X6GA 2A3LA 2RF0A 4EPCA 1M1KC 3GF5A 2DL8A 2Y90A 1XJWB 4ZTJA 4J6YA 1D0YA 2KMGA 4II1A 5HK0A 2JNGA 4M7DC 1SKUB 3CPFA 1DJ7B 1U3OA 4QVCA 5I2MA 2RQVA 3JRZA 3HFNA 3ZL7C 1KC8R 2LCLA 2VGMA 3JCMc 1O75A 1GBRA 1AVZC 4V2SA 2YRCA 1UNLD 4ZN1A 4HNTA 1RAGB 3JCMb 2KR6A 2CP2A 3L2VA 1YBYA 2NLUA 1SSHA 2F2WA 3RGFB 4GY5A 1JQQA 3CD6T 1TOVA 1A0NB 3I35A 1D1CA 1QP3A 2JMCA 1X69A 3ER0A 2O88A 1K76A 1IGUA 3QHWB 1FMVA 2ROTA 4PLLA 3BG3A 2IW6B 4ELZC 5GAN5 1WI7A 1MNEA 3JCMV 2NUZA 2DIQA 1O9KB 3D7SB 2FZGB 4BCNB 2CZ6B 4AFUC 4LDYA 3EG0A 5J26A 4BBRM 4DEXA 2YRVA 1U5SA 2EQIA 3EGDA 1EIFA 2D8HA 2R57A 1VQ7A 4J9BA 1K4US 3CCLQ 4JS5A 2YUNA 2PMIB 1ZUKA 1Q95G 1YITQ 5CKBA 3CMEQ 2F2VA 1E7OA 3V7RA 2KQWA 3FRNA 1U8RA 4NC6A 4HNUA 1TU0B 3A5ZB 4QT7A 2EGAA 4C5EA 3X20B 5GAN7 4ELJA 3HRSA 4DQ2A
chains in the Genus database with same CATH topology
2RHZA 2QDYB 3X25B 5KH6A 3HFOA 3QPHA 3X28B 4EDUA 4MDXA 1GXIE 4QQGA 3HZJA 1SSFA 3A8GB 4M7AA 3OB9A 2HNIA 1YJ9A 2JN0A 3A8LB 1QLBA 3M53A 1N8RC 5L8RE 2F69A 2EQMA 4FIBA 3VU3C 5HK3A 3FC3A 1WQ7A 2DXBA 4ZN3A 3OS1A 2OTLT 4AKGA 3SWNB 3VKIA 1KC8C 1K73U 2DK3A 4J5YA 1UB4A 5D6YA 4N4HA 3VYGB 3CCJA 1Q81U 1VQ5A 1KG1A 4FT4A 4M7DF 4C92A 1UGPB 5CKFA 4HT8A 4ZGEB 4B9WA 1JRIA 3KBGA 2HBPA 3WVEB 3OYGA 4R56A 4IKFA 3CEYA 4FU6A 2XG8D 2K3YA 3FLGA 3OA6A 3CPWA 4X9CA 2LRQA 2QFZA 1WPYA 4M77A 1OYXA 2H3JA 3UWNA 3HRTA 2ZZDB 1XQHA 5GMKh 4C8QG 1OZ3A 1V29B 3VYHB 2KDSA 3FJPA 3UDCA 4ATOA 2LDMA 1D3BB 3FDRA 3M56A 2ZPFB 2DTOA 2KY9A 4HLQA 2PVDB 3MEAA 2EJGA 3S6WA 4OMFB 4A4GA 3CCQA 3GLXA 1BIAA 4KULA 4Z02A 3HL8A 4HCCA 1YIJA 1YHQA 1MHNA 4E7KA 3X26B 1R8OB 3V7CA 5FLXE 4FM4B 1VQNT 2KAFA 5LJ3h 4N4IA 2BIVA 3QBYA 4YTLA 2RHXA 4MZMA 1VQ6A 1PSEA 2K57A 2MAMA 4MIMA 2A7YA 1M90U 3HKSA 3QUIA 3URGA 2XD0A 3X24B 4M7AE 2DXCB 1YJNA 4JRQA 2RD1A 2RK1A 4J6WA 2E12A 5LJ3d 4XU1A 5J39A 4J83A 1VQMA 3E9GA 4M75B 2HQXA 4C8QD 2PUOB 5D6WA 1Q82C 3RERA 3HBLA 4OP0A 1Y07A 1VQKA 3J7AF 5GANj 4OVAA 2RHIA 4XTXA 3G6EA 4QQ6A 3CC7T 4N0AA 4C92E 5CKDA 2MWOA 2WSFE 4J7IA 5FU6B 2RA2A 1WGSA 4M78A 2G3RA 4QVDA 1NJIU 3SFMA 4EMKB 3WVDB 3HHTB 2K3XA 4BI8B 1VQNA 2LC4A 2BS3A 4JLGA 4M77E 5GMKl 4HT9A 3M4GA 1KD1U 4M7AF 2XDPA 3CCUT 4R55A 1O9SA 4MZPA 4OB0B 3F70A 1H3ZA 2VXFA 3VUZA 3CD6A 4A54A 3OYHA 1W2BA 1BI3A 2EIFA 2O4XB 2RK2A 3CBMA 1VIFA 3LH0A 4XU2A 1MGQA 3I56T 2PVGB 2RHYA 5GAN2 3QO3A 2HD0A 3SB2A 3CCRA 4IUPA 3JCMJ 5I2SA 3OW2A 4C92F 4JRKA 2EJFA 2G77A 4XU3A 5M9OA 3CC4A 2OTJT 1JB0E 4BD3A 3T9NA 5KE3A 2LVMA 3TREA 3ZFJA 2XU8A 4M77F 2L8DA 1VIEA 4PJOA 4C5GA 1BIBA 1NE8A 2D9TA 3C4SA 2VV5A 4Q5WA 3JCMe 3G71T 1KQSS 1N9SA 3QYGB 2X4YA 5GAOn 1KQ2A 1HXDA 1M5Q1 3GIBA 4AKHA 3HRSA 4XTZA 5CO7A 2M1HA 5LJ5h 3PTAA 4BE1A 4M7AC 3JB9G 3OYLA 5HKCA 3PNWC 4QQDA 4QW2A 1XNIA 2CS7A 3MEWA 3PFSA 1N8RU 4M75G 2X4JA 3E9FA 2YHTA 4O5VA 1X01A 4OGEA 2E6NA 3JCMX 1FXXA 3OYCA 2KSSA 2R5AA 4M78E 5LJ5d 2DD4B 2XI9A 3VUBA 2MMPA 4JS4A 1M8VA 4LDVA 5GAOm 3HSBA 2FHDA 3C12A 5DM7R 5FU7C 2GFAA 2P0KA 4XAXB 2V8JA 2E65A 4FL6A 5LL6S 4E7LA 4HCBA 1S72A 2RJCA 2VUBA 1Y96B 3PIPA 3OW2S 4BI3A 3JCMQ 4XTWA 3CMAT 2QQBA 2QQAA 5A0LA 3HPWA 3GNFB 3RIRA 4DOWA 3CCMA 1YI2A 4Z6YA 3M57A 1VQLA 2V8IA 4BY6C 4M77C 2GFUA 2R58A 2WACA 2FB7A 3RMQA 3GPLA 3CCLT 2EJ9A 3JCMd 3CCEA 3FIFA 1KHCA 1X6OA 3JB9D 3PMTA 3TW7A 2EWNA 4M75D 4LDXA 4M78F 4A4KA 2QTXA 2RB6A 4VUBA 3OYDA 4HA8A 3CMET 3MHXA 4MMLA 2LCCA 2RI2A 4L6V5 5HY6A 1M1KU 5GMKe 5IT9E 4BDZA 2KK4A 3MCAB 3KXTA 4BACA 4BUGA 3RMSA 2RM4A 3V7SA 1YJWA 2IVWA 3QDRB 1RL2A 5C0MA 3OS0A 2FYKA 2LTOA 3JCMW 1N27A 4LDUA 5GAN6 4XU0A 3E1SA 4XK8E 1LNXA 2OTLA 5CKEA 4NL3A 1Q7YC 4JRPA 1Q86U 3BG9A 4AKIA 5LJ3e 1B34A 2K5FA 3S3NA 3RESA 2CZ7B 3M9QA 4C5HA 4MFDA 2O01E 3PIOA 2QA4T 4M7DB 1Q82U 4IUTA 3M59A 1G3WA 2CKKA 2X35A 3OY9A 2RI3A 3DB3A 3S3MA 1YJ9T 4J7FA 2JTMA 3NFCA 1VQPA 4N0AC 3PMIA 2YLCA 3A8OB 3LYIA 3ME9A 3QIIA 4PJOF 3LWHA 1QVGS 4RG2A 1BI2A 5GANf 4M6VA 4M78C 3BW1A 1YCYA 3BFMA 3QJ6A 3QSUA 2B8AA 4ZTFA 2DD5A 2KMTA 3TW6A 3PT9A 4FSXA 3OYIA 4XTUA 3OYMA 3L2QA 1M4ZA 2I2LA 1WJQA 2E64A 1UGSB 5DY9A 3JSCA 4TVRA 1BYMA 4KBMB 1N9RA 5EG2A 1WJRA 5GANg 3JAME 3DL1A 2MF2A 2LT1A 5KCHA 4MFEA 3INZA 4BB7A 4HKEA 3CC2T 4A4HA 5IAYA 1FX7A 4A4EA 3VKGA 3OYBA 3TCJA 3RUXA 2LQ8A 1TH7A 3DB4A 4RCCA 2L5QA 1VUBA 5CK9A 3OYAA 1JJ2S 2L89A 1ZQ1A 2QDJA 3V8LA 3V8JA 4E47A 2QXFA 1OI1A 3CCQT 1E7PA 1FKMA 2JVVA 3QZ9B 3NTKA 4F7UF 4C0GA 5CCAA 4C0FA 2K4YA 2E70A 1Y7XA 2EKOA 4JUVA 3J80E 1YHQT 4C8QA 2DJZA 3OSVA 4KUDK 4PJOC 3R6OA 1KQSA 2GCXA 3SWNC 2ZPIB 2ZPGB 1VQ6T 5CAIA 1QVPA 1BI0A 2M9UA 2RJEA 2PUKB 2P4TA 3DLLA 3VKHA 3MP8A 4BE0A 1YJNT 3QKJA 4RCBA 3QJYA 4A53A 1LOJA 4OGCA 3HP9A 3I55A 3L2UA 2Y4XA 3CCSA 1VQMT 3LGLA 4OF1A 3OS2A 4M7AB 2LQKA 4M7DG 2QQRA 2ZPBB 3LX7A 2QEXA 3UT1A 2RHUA 5LJ5e 3G4SA 4IURA 3OQ5A 2LT4A 3VV0A 5GAMf 3JB9I 4JX6A 5GAOr 2DXBB 5GANh 2V8KA 3I56A 1K9MC 3M58A 4HL4A 2VXEA 2DTIA 1VQ9T 3ZBDA 5KE2A 5A0DA 2DEQA 4KT0E 5FRMA 4PNOA 4XTYA 2OTJA 4C92B 3KHIA 4DA4A 1X75C 1U1TA 5GAMg 3OYFA 3MO8A 2MWPA 4E7IA 3L42A 4BE2A 3SWNA 3OYKA 4M77B 3ZEHA 4A4FA 3CCVT 4L59A 3CXCS 3G71A 4M7DD 3VYGA 3QXEB 3BG5A 3TEEA 2WSCE 1LJOA 4LD6A 4IUUA 4M75C 3MEUA 2D0QB 1IZ6A 2DD5B 3OMCA 5GAMj 4Y91A 2YLBA 3J81E 4EMHA 4BBSM 1BI1A 1G3TA 4QVZA 3RKWA 3PGGA 2ZZDA 3QHSA 4MDWA 4LOCA 2DXUA 1KC8U 2VYTA 2HAXA 1QW1A 2P0PA 1D3BA 5FU6C 2ZPEB 4JX4A 4CRIA 1JBMA 1H641 1OZ2A 1XOVA 2GQVA 1W4SA 2RJDA 3ASKA 3C95A 2E6ZA 1FWZA 2DAQA 3CMAA 4F7UA 3P8DA 3LGFA 1VQOA 3SD4A 1K8AC 2JUFA 3NTHA 4HCZA 3P8BB 3QYHB 4C8QF 3JB9H 2EQJA 1QVGA 4M7AG 1M1GA 2F5KA 3M54A 5GAMh 4EMGA 2FVUA 1UGQB 1G3YA 2DXCA 5CR2A 1VQ7T 2JZ2A 1VQ4T 3FEOA 1YITT 3M55A 3MP1A 4M78B 1U1SA 3OMGA 4N4GA 4M75A 3EFSA 5FROA 3OYNA 3BDUA 3OYEA 4XQ3A 4B9XA 4PJOE 2PU9B 4AI6A 4XTVA 2AHJB 1NZ9A 2K5LA 3OBWA 5CIUA 1YI2T 3L2ZA 4C92G 2FL7A 1VQ8T 1KQ1A 4L5GA 1XTDA 3RKXA 5GAOp 5LJ3f 4PKCC 5J3BA 2LX9A 5DLOA 1UEBA 4ZGDB 4ME7A 3VJPA 3CCET 2DTHA 1JJ2A 4M77G 2E5QA 4EMKA 4M7AD 3H6ZA 3DKMA 4PL6A 2QA4A 3HRUA 5LJ3g 1WQWA 4NL2A 2XDBA 2K5IA 2XICA 4C8QC 2HQEA 2EQKA 2DZ9A 2VC8A 4KUIA 5GMKj 2RI5A 4NS5A 2O4XA 2RJFA 2F5TX 2PVOB 1YJWT 4MMKA 1IREB 4CI0C 1M1FA 4MZTA 5CVIA 3OSSC 2DZCA 4PJOB 4C0DC 5GAOl 3OYYA 4O6JA 1I81A 4F7UE 2ZCFB 4RG8A 4C92D 4HNVA 4RMOA 2XKOC 2WSEE 2CYZB 2DKGA 3CCJT 1VQ5T 2EQUA 4X9DA 3S3OA 2BKDN 3EFRA 5GMKm 5LJ3j 2BS2A 3QYEA 2CGHA 3OS5A 4J8OA 4C5IA 3M5AA 3WXMB 5C6SA 4M77D 1UGRB 1G3SA 3QYBA 1KHIA 2XK0A 4QSHA 4X34A 5KCOA 4IUVA 4E7JA 1HK9A 1VQPT 2RO0A 3CC2A 3CBOA 3CBPA 1QVFS 2CZ0B 4M75E 1K9MU 3HB9A 2X4WA 2A3LA 2JOYA 2DIGA 3GOXA 3FB9A 1AHJB 4EPCA 3AHUA 2QQ9A 4WF2A 1Y71A 2DPPB 5GAN8 1YIJT 2QF7A 3HO8A 2Y4YA 4M78G 5GANe 3L2RA 2E10A 4JRIA 3H8ZA 1M1KC 4F7UB 3GF5A 3MEVA 2DD4A 3CC7A 2Y90A 3CXCA 4ZTJA 4J6YA 2KMGA 2BS4A 2JTFA 4II1A 4UC4A 1I8FA 5HK0A 3TU4K 1WNLA 4BI4A 1K73C 3JB9F 5CQYA 2L3RA 1Y96A 1Q86C 1ZBXA 2DO3A 2JNGA 3L1AA 4M75F 3OBYA 1Q81C 4M7DC 1QP2A 2QQ8A 2EAYA 5LJ5f 3CPFA 3V8KA 1DJ7B 3CCUA 3O8VA 1G5VA 4QVCA 4NOYA 4J6XA 5I2MA 1VQKT 2OAUA 3JRZA 2ZPHB 3HFNA 2LCLA 5CKHA 2VGMA 2EYQA 1WJSA 4IUQA 1O75A 3JCMc 3CPWS 2XIDA 3G6ET 2RH2A 4FT2A 3META 4M78D 4V2SA 2DXTA 3Q1JA 4LDWA 5A2QE 1VQ9A 4PJOG 5LJ5g 4RKUE 5FU7B 4ZN1A 4HNTA 2GF7A 2QQSA 1B34B 3LWIA 3JCMb 2KR6A 4OB3B 4LD9K 1M9SA 5GANd 3L2VA 1YBYA 5EJCA 2NLUA 3JCMf 2LNVA 3I55T 4JJNK 2QI2A 4PLIA 3CCST 1K8AU 4D6WA 4GY5A 1NPRA 1P92A 3DLMA 3CD6T 4C0ZA 2X4XA 3LLRA 4ZGJB 4BY6B 2QEXT 3SDZA 2KVQG 2R5MA 1QP3A 3G4ST 3CCVA 1ZHIA 3QG1A 5LJ5j 1M90C 2IG0A 5DLQE 2XHCA 3ER0A 2VGNA 3MP6A 5A0GA 3RKYA 4E7HA 2D6FA 3CCRT 3JCMg 3JB9J 1I5LA 4C8QE 2EFIA 4M7DA 2P0QA 2ZGWA 5IN1A 5GAMe 4JLIA 3CC4T 3N5BB 4JDSA 4JX5A 2CZ1B 2BUDA 4ELYC 3JCMP 4PLLA 3GNGA 3BG3A 4ELZC 5GAN5 4PJOD 3A8MB 1I4K1 5CQXA 5GAOq 2M0OA 3L2WA 4F7UG 1Q7YU 3JCMV 3UPUA 3QWLA 3GP8A 4EMKC 3C94A 2DIQA 2CZ6B 4DOVA 1BKBA 2E1HA 4BDYA 5GMKi 4LDYA 1NJIC 2PQWA 5GAN4 5J26A 1KD1C 3QZ5B 1N6AA 3BY7A 4BBRM 3CCLA 3P8HA 3BDLA 2YRVA 1RI0A 4C8QB 4OB2B 5D6XA 2WJ9A 3H4CA 1EIFA 3E19A 2R57A 1W2BS 1VQ7A 1VQ4A 2DVEA 1YITA 2K2VA 2E41A 4C0DB 3CMEA 4JS5A 5GAMd 4C92C 5GAN3 1S72T 3M4YA 3JCMh 3CCMT 1VQLT 3EAEA 1VQOT 3A8HB 1VQ8A 1PSFA 5CKBA 5FRNA 2XDDA 3V7RA 4OB1B 3NTIA 2KQWA 3FRNA 1U8RA 4NC6A 4HNUA 1QVFA 3A5ZB 5I21A 4GLKA 4M7DE 2MI6A 4C5EA 3X20B 5GAN7 1NPPA 2C06A 2M16A 4P5NA 3KUFA 3OYJA 5AYFA 4Y28E 4ELJA 3G7ZA 3LW5E 4DQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  3X25 B;  3X28 B;  1GXI E;  3A8G B;  2DXB B;  1AHJ B;  3A8L B;  2DD4 B;  5L8R E;  2DPP B;  4KT0 E;  2DXB A;  2DD4 A;  3VYG B;  1UGP B;  4ZGE B;  3WVE B;  1QP2 A;  3VYG A;  3QXE B;  1DJ7 B;  2WSC E;  2D0Q B;  2ZPH B;  2ZZD B;  2DD5 B;  1V29 B;  3VYH B;  4L6V 5;  2ZPF B;  2PVD B;  2ZZD A;  4RKU E;  3X26 B;  2ZPE B;  4FM4 B;  4OB3 B;  4XK8 E;  1PSE A;  2CZ7 B;  4ZGJ B;  3X24 B;  2DXC B;  2O01 E;  1QP3 A;  3QYH B;  1UGQ B;  2PUO B;  2DXC A;  3A8O B;  2CZ1 B;  3A8M B;  2PU9 B;  2DD5 A;  2AHJ B;  2WSF E;  3WVD B;  1UGS B;  3HHT B;  4ZGD B;  2CZ6 B;  4OB0 B;  3QZ5 B;  2PVG B;  4OB2 B;  3QZ9 B;  2PVO B;  1IRE B;  1JB0 E;  2ZCF B;  2ZPI B;  2ZPG B;  2WSE E;  2CYZ B;  3A8H B;  1PSF A;  2PUK B;  3QYG B;  4OB1 B;  1UGR B;  3X20 B;  2ZPB B;  4Y28 E;  3LW5 E;  2CZ0 B; 
#chains in the Genus database with same CATH topology
 5BNJ B;  3X28 B;  2QTV A;  3HZJ A;  2JN0 A;  3MPU B;  2EQM A;  3VU3 C;  4F6U B;  5AT1 B;  4ZN3 A;  1YNZ A;  4KH0 B;  1UB4 A;  4QKU A;  2KYB A;  3VYG B;  1KG1 A;  2BKZ B;  5FW9 A;  3KBG A;  1OU8 A;  4E2F B;  2HBP A;  2DFU A;  4WCI A;  2QGF B;  2HDA A;  3CCJ Q;  2MIO A;  1WPY A;  3B57 A;  2C6T B;  4J9E A;  4KGX B;  4C8Q G;  3UDC A;  3M56 A;  1PCX A;  2DIL A;  1ZP2 A;  3CCQ A;  4A4G A;  1BIA A;  1OPK A;  4Z02 A;  1YIJ A;  1MHN A;  2JS2 A;  4FM4 B;  4BCJ B;  4ESR A;  3M0T A;  3QBY A;  2RHX A;  1YFN A;  4MZM A;  1JSU B;  2BE7 D;  4BCN D;  1PSE A;  2K57 A;  1M90 U;  3HKS A;  2E3I A;  2K3B A;  5I5Z B;  1YJN A;  2E12 A;  5J39 A;  2DMO A;  2HQX A;  1Q82 C;  2CP5 A;  3RER A;  1OPL A;  1Y07 A;  2J7I A;  1Q7Y R;  2KT8 A;  4Z88 A;  4QQ6 A;  1PD0 A;  2LMJ A;  4N0A A;  1XO2 A;  1QMZ B;  2E4H A;  4EIK A;  1VQK Q;  1M3C A;  1MND A;  4BCM B;  2C5X B;  2DL7 A;  5FU6 B;  3GBQ A;  4QVD A;  3G6E Q;  2CCI B;  4LNP A;  4M7A F;  5GMK l;  1UFF A;  4HT9 A;  4R55 A;  1H3Z A;  2VXF A;  1OX8 A;  2DL3 A;  1X2K A;  4A54 A;  2GNC A;  1WHG A;  1BI3 A;  2O4X B;  5HVY B;  2J06 A;  2HD0 A;  2C0O A;  2CP6 A;  3OW2 A;  1VYU A;  1E9H B;  2DA9 A;  3EID B;  1WHH A;  5GJV B;  1IHV A;  2L8D A;  4C5G A;  1BIB A;  3C4S A;  1SRM A;  1UJ0 A;  2VV5 A;  2EYZ A;  1N9S A;  4B6M A;  2EW3 A;  1KQ2 A;  2RQR A;  1H25 B;  4DBF A;  3BHV B;  5HKC A;  3PNW C;  1XNI A;  3PFS A;  1BU1 A;  3NDQ A;  2CP3 A;  2E6N A;  1W1F A;  2R5A A;  4JS4 A;  1M8V A;  4LDV A;  5GAO m;  1WXB A;  5FU7 C;  2BPM B;  2GFA A;  4HCK A;  5LL6 S;  2CT3 A;  1VQ7 Q;  4BI3 A;  3HPW A;  1YN8 A;  2AKK A;  4DOW A;  1JJ2 P;  2DX1 A;  1UDL A;  2YT6 A;  3THK A;  2FB7 A;  3GPL A;  3CCL T;  1YI2 Q;  3CCM Q;  2C5N B;  1GCP A;  3BLR B;  2QG9 B;  1I07 A;  3VRZ A;  2RB6 A;  3CCE Q;  3CME T;  4L6V 5;  5EFQ B;  5HY6 A;  5GMK e;  3KXT A;  3RMS A;  3V7S A;  1YJW A;  3QDR B;  5GAN 6;  3E1S A;  1LNX A;  2FPE A;  3DJB A;  4J9G A;  4AKI A;  5LJ3 e;  2QGS A;  3RES A;  1ZA1 B;  3M9Q A;  4Z8A A;  1P5E B;  5DQV A;  3PIO A;  2QA4 T;  4IUT A;  3M59 A;  2CKK A;  2FZC B;  1TFB A;  2RI3 A;  1URC B;  3NFC A;  5I11 A;  3TNI B;  3PMI A;  3EFO A;  3LYI A;  3LWH A;  1ZUU A;  5IHI A;  2HCK A;  4UN0 A;  4M78 C;  1AZE A;  1VQP Q;  1K8A R;  4ZTF A;  2I53 A;  2KMT A;  4FSX A;  2LJ0 A;  1B07 A;  3JSC A;  4KBM B;  2K6D A;  1YIJ Q;  1WJR A;  1SHG A;  1H1S B;  2IPO B;  2EYW A;  1KSW A;  4FSS A;  3VKG A;  3OYB A;  2EBP A;  3DB4 A;  5CK9 A;  1JJ2 S;  2L89 A;  2W96 A;  2NUT B;  2H8H A;  3V8J A;  2K2M A;  2QXF A;  3VS2 A;  2JVV A;  1GFD A;  3J80 E;  4C0G A;  2ESW A;  2K4Y A;  4C8Q A;  2DJZ A;  3R6O A;  2ZPG B;  5L23 A;  4GBQ A;  1QVP A;  1M2V B;  1H3H A;  1FMK A;  2KXD A;  2RJE A;  4BE0 A;  4A53 A;  3HP9 A;  2DVJ A;  3RR6 A;  3I55 Q;  5LJ5 e;  3BE3 A;  2DER A;  2DXB B;  1PD1 A;  1RAC B;  1N4M A;  3G4S Q;  5FRM A;  4KT0 E;  5ICP B;  1JKW A;  4C92 B;  3KHI A;  4OGR B;  1X75 C;  2YDL A;  1OX9 A;  4BCO B;  4OMM A;  4AFS C;  1GCQ A;  2OTJ Q;  4BE2 A;  3SWN A;  2YUO A;  1FYN A;  3TEE A;  4OMP A;  1LJO A;  2KRN A;  4LD6 A;  4M75 C;  1IZ6 A;  3DOG B;  1OU9 A;  4BBS M;  1G3T A;  3RKW A;  1NEG A;  4MDW A;  2DXU A;  2VYT A;  2DNU A;  2HAX A;  1D3B A;  2ZPE B;  1JBM A;  1OZ2 A;  2GQV A;  2O2O A;  2DAQ A;  3CMA A;  1GFC A;  3LGF A;  1CKB A;  3P8D A;  4JZ4 A;  2LZ6 B;  5CEI B;  4HVV A;  2EQJ A;  3JB9 H;  4M7A G;  2IN3 A;  2F5K A;  1SG5 A;  2AK5 A;  5CR2 A;  2J6K A;  1VQ7 T;  3M0S A;  4M78 B;  1U1S A;  1Y57 A;  4XQ3 A;  4PJO E;  1T3L A;  1IB8 A;  4XTV A;  3M0P A;  3DDQ B;  1YI2 T;  5CIU A;  4K11 A;  4L5G A;  3RKX A;  4F7L B;  5LJ3 f;  3MY1 B;  2PK9 B;  5DLO A;  1JXM A;  4F6S B;  3CCE T;  1K0S A;  3DKM A;  4DBR A;  2HL5 C;  5LJ3 g;  4NL2 A;  2XIC A;  2K5I A;  1OKV B;  2HQE A;  1F5Q B;  5GMK j;  3PO3 S;  4KUI A;  2RI5 A;  2F1L A;  1BCO A;  2FPD A;  2PVO B;  1IRE B;  3OSS C;  1IXD A;  4C0D C;  5GAO l;  1YWO A;  1I81 A;  4C92 D;  2WSE E;  1SF9 A;  5LJ3 j;  4C5I A;  2CGH A;  2VAS A;  4J8O A;  1AWJ A;  3GTM S;  1UGR B;  1KHI A;  2WMB B;  1VQP T;  2RO0 A;  3MKD A;  2CZ0 B;  2X4W A;  1WFW A;  2JOY A;  3FB9 A;  2WIP B;  1SPK A;  2AZV A;  2QQ9 A;  2CH4 A;  1Y71 A;  4WF2 A;  5GAN 8;  1YIJ T;  3HO8 A;  5IDN B;  2Y4Y A;  5GAN e;  2E10 A;  4EOO B;  2FRW A;  3H8Z A;  2LQN A;  4F7U B;  1PG5 B;  4A63 B;  1V76 A;  2DD4 A;  2KT1 A;  1R77 A;  1TXQ A;  3NPF A;  1WNL A;  3CC7 Q;  2MK5 A;  1K73 C;  2V26 A;  3G1J A;  2L3R A;  5CQY A;  2UUE B;  1Y96 A;  1ZBX A;  2DO3 A;  2FO0 A;  1Q81 C;  1N8R R;  2QQ8 A;  5LJ5 f;  2Z0W A;  1TUC A;  1VA7 A;  5L2W B;  2QK0 A;  4NOY A;  2C4G B;  1RAF B;  3A98 A;  1WJS A;  4IUQ A;  2VVK A;  4CXA B;  3CCU Q;  2RH2 A;  4FT2 A;  4M78 D;  4EOS B;  1HJD A;  4LUD A;  2CH4 W;  5A2Q E;  5LJ5 g;  1VQ9 A;  4RKU E;  2YRD A;  1ARK A;  3LWI A;  1ZA2 B;  2M51 A;  5GAN d;  1K8A U;  3I55 T;  4PLI A;  4D6W A;  1WLP B;  1OI9 B;  1TSF A;  4ZGJ B;  4BY6 B;  3REB B;  2R5M A;  3G4S T;  3QG1 A;  3EGU A;  2B9R A;  5LJ5 j;  2PTK A;  5DLQ E;  2D6F A;  3BHU B;  4BCG B;  3RKY A;  2RPN A;  3E2U A;  2P0Q A;  1H26 B;  4JX5 A;  1UTI A;  1OEB A;  4CFU B;  1B7T A;  3A8M B;  5IH2 A;  2M0O A;  3L2W A;  1AD6 A;  3QWL A;  3GP8 A;  3RDV A;  4EMK C;  1HD3 A;  1W70 A;  1BKB A;  4DOV A;  1NJI C;  5GMK i;  2PQW A;  2AIR B;  5GAN 4;  1MMN A;  1KD1 C;  3CMA Q;  3CCL A;  3P8H A;  4OML A;  1RI0 A;  2OI3 A;  2CUD A;  5D6X A;  2WJ9 A;  3H4C A;  3E19 A;  1K1Z A;  1HYO A;  2DVE A;  2K2V A;  1YIT A;  2VKN A;  4C0D B;  3CME A;  2HZY A;  2CUB A;  2FG0 A;  3A8H B;  1PSF A;  2ABL A;  4JJD A;  5IXB A;  5IF1 B;  5I21 A;  4GLK A;  1KK7 A;  4P5N A;  3LW5 E;  4J9C A;  2QDY B;  3X25 B;  4EDU A;  1SSF A;  3A8G B;  4M7A A;  3OB9 A;  2HNI A;  4AG1 C;  5HK3 A;  3FC3 A;  1QMC A;  1Y0M A;  1Z9Q A;  2RMO A;  2PJQ A;  1YJ9 Q;  1LPL A;  2O9S A;  1OKW B;  1H8K A;  2DK3 A;  5D6Y A;  4N4H A;  1BB9 A;  3CCJ A;  4FT4 A;  1UGP B;  4ZGE B;  2HBW A;  3WVE B;  4R56 A;  2KRO A;  2XG8 D;  1X43 A;  2K3Y A;  3OA6 A;  3CPW A;  2LRQ A;  2QFZ A;  1I0C A;  1NYF A;  1OYX A;  3ULR B;  4FW2 A;  5GMK h;  2EUF A;  1OZ3 A;  4GLM A;  2KDS A;  1ZSZ A;  3EG2 A;  4ATO A;  1ACM B;  2PVD B;  4EC8 B;  4CFU D;  2EJG A;  4OMF B;  3S6W A;  2ECZ A;  4HCC A;  4E7K A;  1NYG A;  1R8O B;  3V7C A;  5LJ3 h;  1QCN A;  4YTL A;  1NEB A;  1WDX A;  1YHQ Q;  4YOZ A;  4EOK B;  2A7Y A;  4JJC A;  3QUI A;  2IW9 B;  4M7A E;  2M0Y A;  2COY A;  2RK1 A;  1RLP C;  1QWE A;  1VQ6 Q;  3H41 A;  4J83 A;  5IHN A;  4ROD A;  4JPB W;  1HSQ A;  4OP0 A;  4RTU A;  1VQK A;  3J7A F;  5GAN j;  2RHI A;  3G6E A;  3CC7 T;  3O0G D;  5CKD A;  2COW A;  2RA2 A;  5KYX B;  4NST B;  2DL4 A;  4EMK B;  4BI8 B;  4EOL B;  1VQ9 Q;  4JLG A;  1PC0 A;  4F17 A;  3BLH B;  3CCU T;  4OB0 B;  3F70 A;  1C0M A;  3VUZ A;  4AFQ C;  2EIF A;  1G83 A;  4RTZ A;  2A28 A;  1ZUY A;  2RHY A;  5GAN 2;  3CCR A;  2G6F X;  1ZLM A;  4IUP A;  2CSQ A;  4C92 F;  3CC4 A;  2G77 A;  2CT4 A;  1WXU A;  4BD3 A;  3T9N A;  1FIN B;  3QHR B;  3TRE A;  1VIE A;  1D0Z A;  3JCM e;  4Q5W A;  5GAO n;  2ROL A;  1VOL A;  3GIB A;  4XTZ A;  2M1H A;  5LJ5 h;  4BE1 A;  1QWF A;  1KIK A;  2CS7 A;  1N8R U;  2X4J A;  3E9F A;  2KYM A;  1X01 A;  4OGE A;  1FXX A;  2DRK A;  2KSS A;  4HVU A;  2X1N B;  3VUB A;  2FHD A;  3C12 A;  1TG0 A;  2P0K A;  2V8J A;  4FL6 A;  4YOO A;  1S72 A;  3JCM Q;  3CMA T;  3TN8 B;  1PWT A;  2DRM A;  1YI2 A;  3GNF B;  3RIR A;  3CCM A;  3M57 A;  1K9M R;  4M77 C;  1MUZ A;  2EJ9 A;  3JCM d;  1VQL Q;  3CCE A;  4F6W B;  3TW7 A;  4M78 F;  2IVX A;  2LCC A;  2RI2 A;  5IT9 E;  1ZX6 A;  2JTE A;  4BDZ A;  3MCA B;  4BAC A;  2L3Q A;  1D3U B;  2WEV B;  1RL2 A;  1JO8 A;  1N27 A;  5HNB B;  4XU0 A;  2LJ1 A;  5CKE A;  1MMG A;  4NL3 A;  4KH1 B;  1Q86 U;  4EOQ B;  2JM9 A;  1MV3 A;  2MPX C;  2CZ7 B;  3QWX X;  2O01 E;  4M7D B;  2LQW A;  3DB3 A;  1IHW A;  1YJ9 T;  4Y72 B;  1VQP A;  2YUP A;  4CFN B;  2NYS A;  3QII A;  1JU5 C;  4RG2 A;  4M6V A;  4EOJ B;  3QJ6 A;  1ENW A;  1UHF A;  2B8A A;  4BCI B;  2DD5 A;  2HL3 A;  4XTU A;  3OYM A;  3NGP A;  2I2L A;  1AIS B;  2D1X A;  2W99 A;  2JGZ B;  2E64 A;  4E7Z A;  1BYM A;  2MF2 A;  5IHK A;  4HKE A;  5IAY A;  1FX7 A;  1O9K A;  2DBK A;  3RUX A;  2QAS A;  4RCC A;  2L5Q A;  1G2B A;  4EOI B;  1VUB A;  3V8L A;  4IIM A;  5LQF B;  1OI1 A;  1E7P A;  3EJ1 B;  3QZ9 B;  1W6X A;  4F7U F;  2RNA A;  4C0F A;  5CCA A;  1YHQ T;  2EKO A;  2FZK B;  1AWO A;  3OSV A;  4KUD K;  4PJO C;  4RTT A;  1KQS A;  4EOP B;  3SWN C;  1VQ6 T;  2M9U A;  4BCF B;  2OX7 A;  2P4T A;  3DLL A;  3VKH A;  3MP8 A;  3I55 A;  4OGC A;  3L2U A;  2X51 A;  3LGL A;  4FCY A;  2ZPB B;  3LX7 A;  3G4S A;  3OQ5 A;  2LT4 A;  3VV0 A;  3JB9 I;  2WMA B;  5GAN h;  2V8K A;  2VXE A;  2QEX Q;  1VQ9 T;  3M0U A;  5EC7 A;  1UE9 A;  1WHM A;  2QDL A;  1QCO A;  2OTJ A;  3CCR Q;  4DA4 A;  2ATC B;  2BZY A;  1PKT A;  3CC4 Q;  4E7I A;  4CRL B;  4M77 B;  3G71 A;  3EFO B;  4M7D D;  2KXC A;  2X3W D;  3AT1 B;  3VYG A;  3BG5 A;  1M1K R;  4IUU A;  1RI9 A;  1UG1 A;  3MEU A;  3DTO A;  2MYS A;  3EG1 A;  2YLB A;  3J81 E;  3LQ5 B;  2KRM A;  4QVZ A;  1KC8 U;  1UJY A;  3VS7 A;  1QW1 A;  3M03 A;  4JX4 A;  1H64 1;  2KBT A;  2CRE A;  1KXU A;  3C95 A;  4D8D A;  2V1Q A;  3SD4 A;  1S72 Q;  3IQL A;  1J3T A;  3QYH B;  1M1G A;  2K9G A;  1VQO Q;  3M54 A;  4EMG A;  2FVU A;  1GBQ A;  1UGQ B;  1G3Y A;  1YCS B;  4EC9 B;  3FEO A;  3FJ5 A;  1YIT T;  1S1N A;  4R0K A;  1OOT A;  3OMG A;  4N4G A;  3EFS A;  3OYE A;  3OYN A;  4RTX A;  2EVR A;  4YOS A;  3VS3 A;  3L2Z A;  4C92 G;  4CFW B;  1XTD A;  2JMA A;  5GAO p;  1TUG B;  2O31 A;  2V1R A;  3O5Z A;  5IDP B;  2CP0 A;  3EH2 A;  3HRU A;  1IGQ A;  1WYX A;  1C1A A;  1T0H A;  9ATC B;  2O4X A;  1PNJ A;  4MMK A;  2KRS A;  1H28 B;  5CVI A;  4PJO B;  2DZC A;  4O6J A;  4HNV A;  3UA6 A;  2XKO C;  2CYZ B;  2DKG A;  3CCJ T;  1OL2 B;  3R6N A;  2BS2 A;  1KFZ A;  4BY1 X;  1TUD A;  4M77 D;  2GTJ A;  2XK0 A;  2OAW A;  2DLP A;  3TQ7 P;  2ENM A;  3CBP A;  1K9M U;  4J9D A;  1ABO A;  1Z9Z A;  4AT1 B;  1PRM C;  2E3H A;  3GOX A;  3AHU A;  1UUE A;  2QF7 A;  2YWW A;  4M78 G;  2HKQ B;  4JRI A;  3MEV A;  4PFO A;  3CC7 A;  1QKX A;  2BS4 A;  3TU4 K;  1K0X A;  4BI4 A;  1Q86 C;  4KGV B;  3L1A A;  5KYU B;  4BXX X;  1QP2 A;  3EG9 B;  2EAY A;  3V8K A;  3CCU A;  3O8V A;  4J6X A;  1VQK T;  2OAU A;  2ZPH B;  5CKH A;  3CPW S;  3G6E T;  2B86 A;  1WHL A;  2DXT A;  3Q1J A;  5FU7 B;  2QQS A;  2GF7 A;  4LD9 K;  1B34 B;  4OB3 B;  1M9S A;  2L0A A;  3EG3 A;  1SRL A;  4C0Z A;  2X4X A;  3LLR A;  1WHK A;  1H24 B;  3SDZ A;  1NG2 A;  2KVQ G;  2QEX T;  3CCV A;  1ZHI A;  2JW4 A;  1M90 C;  2IG0 A;  5KYW B;  3MP6 A;  3CCR T;  3JB9 J;  4C8Q E;  3G71 Q;  1GUX B;  2ZGW A;  1VYW B;  5IN1 A;  1WA7 A;  4JLI A;  5GAM e;  3CC4 T;  2BUD A;  4ELY C;  2BE9 B;  4BCK B;  2GQI A;  4PJO D;  3VRY A;  5GAO q;  1NM7 A;  4F7U G;  1QKW A;  2VWF A;  1Q7Y U;  3UPU A;  4M4Z A;  2DEU A;  1Q82 R;  2WHB B;  4PJM A;  1UGV A;  3QZ5 B;  1N6A A;  3BY7 A;  1H27 B;  4J9I A;  1PKS A;  4OB2 B;  4FYX B;  4FW1 A;  2NUP B;  2RQT A;  5GAM d;  1S72 T;  3M4Y A;  2HSE B;  3JCM h;  1VQ4 Q;  3CCM T;  1VQO T;  3DDP B;  2ZAE A;  5FRN A;  2D0N A;  2XDD A;  4OB1 B;  2UZB B;  1VQ8 Q;  1M2V A;  3KUF A;  1ZSZ C;  3OYJ A;  5AYF A;  3JAM E;  3G7Z A;  2EGE A;  2RHZ A;  5KH6 A;  2A08 A;  4MDX A;  4PFZ A;  1YJ9 A;  1QLB A;  3M53 A;  5L8R E;  2F69 A;  2C5O B;  2LCS A;  2DXB A;  2KR3 A;  3OS1 A;  4AKG A;  3VKI A;  5HQ0 B;  1KC8 C;  4BCH B;  1MV0 B;  1VQ5 A;  6AT1 B;  4CFM B;  4M7D F;  4C92 A;  4HT8 A;  4FYV B;  5ACB A;  5CKF A;  2CDT A;  1OL1 B;  3FLG A;  4X9C A;  2W9F A;  3UWN A;  2ZZD B;  3QDF A;  1AZG B;  1V29 B;  3FJP A;  3MJX A;  2LDM A;  3FDR A;  3MEA A;  2ZPF B;  2DTO A;  3MY5 B;  4HLQ A;  2KY9 A;  2JM8 A;  3GLX A;  4KUL A;  1RAI B;  2WXV B;  1YHQ A;  3X26 B;  2PHG A;  5FLX E;  4F16 A;  2BIV A;  3PVL A;  4ROC A;  1VQ6 A;  4MIM A;  2SEM A;  4AFZ C;  2DXC B;  1AEY A;  4JRQ A;  2RD1 A;  4J6W A;  4KRD B;  5FWB A;  3E9G A;  4M75 B;  2PUO B;  1WXT A;  1IRX A;  3OW2 P;  1VQM Q;  4OVA A;  2IIM A;  2H3E B;  4C92 E;  2MWO A;  2WSF E;  4M78 A;  2G3R A;  2I40 B;  1R0C B;  3K7A M;  3EGX B;  2BS3 A;  3M4G A;  2XDP A;  4RTV A;  3G33 B;  4DBH A;  2VB6 A;  3OYH A;  1W2B A;  1VIF A;  1MGQ A;  2DL5 A;  2PVG B;  3QO3 A;  3CCV Q;  2DM1 A;  3HTR A;  2EJF A;  2OTJ T;  1JEG A;  3H0H A;  2GGR A;  1UEC A;  2XU8 A;  4M77 F;  3VS0 A;  1NE8 A;  2D9T A;  3NMZ C;  1KQS S;  3G71 T;  2X4Y A;  1X27 A;  1HXD A;  4F7S B;  3OYL A;  4QQD A;  3MEW A;  4O5V A;  3OYC A;  3JCM X;  3A1P A;  1NLO C;  4M78 E;  4LUE A;  2XI9 A;  2MMP A;  3PVQ A;  3HSB A;  1ZBJ A;  4XAX B;  2RJC A;  2VUB A;  3PIP A;  3LH5 A;  3OW2 S;  1N5Z A;  2QQB A;  1VQL A;  4ZNX A;  4Z6Y A;  5CYI B;  2L3P A;  2CJM B;  3VS5 A;  2R58 A;  1VQN Q;  3REA B;  1AWX A;  3JB9 D;  1G3N C;  1C9B A;  1X6O A;  1QLY A;  2EWN A;  4M75 D;  4LDX A;  4A4K A;  2QTX A;  5FGK B;  4VUB A;  1TWB A;  3OYD A;  1M30 A;  4HA8 A;  4MML A;  2RM4 A;  5KYY A;  2KEA A;  5C0M A;  3OS0 A;  3JCM W;  1M90 R;  2FYK A;  4LDU A;  1H1P B;  2OTL A;  2LNH B;  1QCF A;  1Q7Y C;  2K5F A;  3S3N A;  4C5H A;  1Q82 U;  4E7S A;  2P4R A;  1M3A A;  1VQ5 Q;  3S3M A;  4J7F A;  2JTM A;  2DF6 A;  4N0A C;  1JOW A;  2YLC A;  3ME9 A;  4PJO F;  1H1R B;  1BI2 A;  5GAN f;  2M02 A;  2A37 A;  3BFM A;  2LJ3 A;  3PT9 A;  3L2Q A;  1D1B A;  1M4Z A;  1WJQ A;  5DY9 A;  1V1C A;  1N9R A;  5GAN g;  1OIY B;  2DME A;  4MFE A;  1RLQ C;  4A4H A;  2O9V A;  3TNH B;  4A4E A;  3EGD B;  2LQ8 A;  1H4L D;  2QDJ A;  2FPF A;  4E47 A;  2PNI A;  3NTK A;  4JUV A;  2RQW A;  1H1Q B;  1YWP A;  2ZPI B;  2HSP A;  2G9X B;  2PUK B;  3QKJ A;  4RCB A;  1LOJ A;  2OJ2 A;  3TVT A;  1VQM T;  1H92 A;  4LE9 A;  1CSK A;  2LQK A;  4M7D G;  4F7N B;  2QEX A;  3UT1 A;  1RAE B;  3CCS Q;  1RAD B;  4JX6 A;  5GAO r;  3I56 A;  3M58 A;  2C5V B;  4HL4 A;  2DTI A;  2J6O A;  5KE2 A;  4PNO A;  4XTY A;  1M2O A;  1U1T A;  4PFP A;  3L42 A;  5FWC A;  3OYK A;  3CCV T;  2EYX A;  4L59 A;  1WIE A;  3RBB B;  3QXE B;  2DJQ A;  2D0Q B;  2DD5 B;  3OMC A;  2K79 A;  4TTH A;  1D09 B;  2KGT A;  1SEM A;  4F70 B;  4Y91 A;  4EMH A;  1EFN A;  1BI1 A;  4II5 B;  2RN8 A;  2W2H A;  3PGG A;  3QHS A;  1K73 R;  4LOC A;  1BCM A;  1Q81 R;  2P0P A;  5FU6 C;  2COZ A;  4CRI A;  2RJD A;  3SHW A;  2E6Z A;  1FWZ A;  1VQO A;  1M27 C;  2AKL A;  1K8A C;  3NTH A;  4HCZ A;  1OIU B;  3P8B B;  2SRC A;  2JT4 A;  1QVG A;  1B3Q A;  5GAM h;  2JZ2 A;  2CSI A;  3MP1 A;  2DYB A;  5FRO A;  3TNW B;  2ED1 A;  4B9X A;  4AI6 A;  2L2P A;  1NZ9 A;  2K5L A;  1VQN T;  3OBW A;  4HVW A;  4IIO A;  1W98 B;  5IHY A;  5D7U A;  3EOC B;  5J3B A;  1UEB A;  1TTH B;  1D0X A;  2DTH A;  5KYX A;  4M77 G;  2E5Q A;  2MOX A;  4EMK A;  2OTL Q;  4PL6 A;  3VS6 A;  2XDB A;  4C8Q C;  2EQK A;  2IW8 B;  2VC8 A;  4NS5 A;  2RJF A;  2QA4 Q;  1NJI R;  1M1F A;  4CFV B;  3OYY A;  4RMO A;  4RG8 A;  2QAZ A;  2LP5 A;  1KD1 R;  1VQ5 T;  1VYT A;  1PRL C;  2BKD N;  2YSQ A;  3OS5 A;  5C6S A;  2J6F A;  4QSH A;  2RQU A;  4E7J A;  1HK9 A;  1K9A A;  2X9H A;  3CC2 A;  3HB9 A;  5KYN A;  2DIG A;  1GY3 B;  1AHJ B;  3EHR A;  4WTO B;  3TSW A;  2DPP B;  3L2R A;  2KE9 A;  3C0C A;  2ED0 A;  1GCQ C;  1WHJ A;  3CXC A;  1T0J A;  1LVK A;  2JTF A;  5HBH B;  4UC4 A;  1I8F A;  3JB9 F;  5IXF A;  1FMW A;  4KGZ B;  3UAT A;  4M75 F;  3OBY A;  1W2B P;  1G5V A;  2EYQ A;  4J9F A;  2XID A;  4BCQ B;  3MET A;  1C6V X;  4LDW A;  2DE0 X;  4PJO G;  2PK2 A;  3RNJ A;  3I56 Q;  5GJW B;  5EJC A;  3JCM f;  2GBQ A;  2LNV A;  2W10 A;  4JJN K;  2QI2 A;  3CCS T;  1NBE B;  1NPR A;  1P92 A;  3DLM A;  1OQK A;  2DBM A;  2KNB B;  3I5R A;  4D8K A;  2XHC A;  2VGN A;  1VYV A;  5A0G A;  4E7H A;  3JCM g;  4PJJ A;  1I5L A;  2F2X A;  2EFI A;  4M7D A;  3N5B B;  4JDS A;  2CZ1 B;  3JCM P;  2EPD A;  3GNG A;  7AT1 B;  4YC3 B;  3M0R A;  1I4K 1;  5CQX A;  2WFY B;  2UZL B;  3C94 A;  3QWY A;  1RAH B;  3H0F A;  1AD5 A;  2R7G A;  2LW4 A;  2E1H A;  4BDY A;  2KI7 A;  1LCK A;  3BDL A;  4C8Q B;  2EKH A;  2WPA B;  2FRY A;  2X3X D;  1W2B S;  1VQ4 A;  2QGG A;  4ELL A;  2E41 A;  3UA7 A;  2HEQ A;  4C92 C;  5GAN 3;  1RAA B;  5LMK B;  1VQL T;  3EAE A;  1VQ8 A;  3EHQ A;  3NTI A;  1QVF A;  1MMA A;  4M7D E;  2CP7 A;  2MI6 A;  4CFX B;  8ATC B;  1NPP A;  2C06 A;  2M16 A;  3CPW P;  1TS9 A;  4Y28 E;  2LX7 A;  4LXC A;  3HFO A;  3QPH A;  1GXI E;  4QQG A;  2E5K A;  4FYY B;  3A8L B;  4BCQ D;  1N8R C;  2DET A;  4FIB A;  1R0B G;  4J9H A;  1WQ7 A;  4AG2 C;  4BCM D;  2OTL T;  3SWN B;  1K73 U;  4J5Y A;  2J05 A;  4CC2 A;  1Q81 U;  1E6G A;  4B9W A;  1JRI A;  2CCH B;  2JS0 A;  4IKF A;  3OYG A;  2W0Z A;  3CEY A;  4FU6 A;  4M77 A;  2H3J A;  3H9N A;  3HRT A;  1XQH A;  3VYH B;  3BHT B;  1D3B B;  2FEI A;  3CC2 Q;  3HL8 A;  4FYW B;  2HQH A;  4KRC B;  4EOR B;  2BTT A;  4ROE A;  2KAF A;  4N4I A;  3CCQ Q;  1BBZ A;  8AT1 B;  3CQT A;  2MAM A;  2XD0 A;  4PJL A;  3URG A;  3X24 B;  4KRT A;  1VOM A;  4F7J B;  5LJ3 d;  4RTY A;  4XU1 A;  1BK2 A;  5HBJ B;  4E6R A;  1VQM A;  4C8Q D;  5D6W A;  1YJN Q;  3HBL A;  2C0T A;  2HMA A;  4CC4 B;  4XTX A;  2HKN A;  4J7I A;  1WGS A;  1NJI U;  1TD6 A;  3SFM A;  3WVD B;  3HHT B;  2K3X A;  2LC4 A;  4M77 E;  1KD1 U;  1O9S A;  4MZP A;  3VS1 A;  1I1J A;  3CD6 A;  2RK2 A;  1U06 A;  3CBM A;  3LH0 A;  4XU2 A;  4ORZ A;  1OGU B;  3I56 T;  3SB2 A;  3JCM J;  4PK4 A;  5I2S A;  2UZE B;  4JRK A;  5M9O A;  1PM3 A;  4XU3 A;  3BLQ B;  4EOM B;  2AT1 B;  1JB0 E;  3JV3 A;  2MCN A;  5KE3 A;  2LVM A;  3ZFJ A;  3KFV A;  1SHF A;  4PJO A;  1ZSG A;  3QYG B;  1RUW A;  4OR5 B;  3H0I A;  1M5Q 1;  1QVG P;  4AKH A;  5CO7 A;  3PTA A;  2P84 A;  4M7A C;  3JB9 G;  1ABQ A;  4QW2 A;  4M75 G;  1EZZ B;  2YHT A;  5LJ5 d;  2DD4 B;  5HCK A;  4FX3 B;  2A0F B;  1MMD A;  2NUT A;  4HXJ A;  5DM7 R;  2E65 A;  4E7L A;  4HCB A;  1Y96 B;  4XTW A;  1VQN A;  5A0L A;  2QQA A;  2K7A A;  2V8I A;  4BY6 C;  3MIA B;  2GFU A;  2QYZ A;  2WAC A;  4F04 B;  3RMQ A;  1UHC A;  1KHC A;  3FIF A;  3PMT A;  1FVV B;  2AZS A;  5KYU A;  3EG9 A;  1PKD B;  1JST B;  3MHX A;  2A36 A;  1M1K U;  2BZ8 A;  2KK4 A;  4BUG A;  4LN2 A;  4BCP B;  1X2Q A;  2IVW A;  2LTO A;  4XK8 E;  1JXO A;  1IO6 A;  4JRP A;  1YJW Q;  3BG9 A;  1B34 A;  1GH6 B;  4MFD A;  1UNG D;  1EX4 A;  3OY9 A;  1G3W A;  2X35 A;  1CKA A;  3I9Q A;  4Z89 A;  3A8O B;  1QVG S;  3I5S A;  3F5X B;  5KYW A;  3BW1 A;  1YCY A;  3QSU A;  1GUX A;  4Y92 A;  2YUQ A;  1KQS P;  1D1A A;  3TW6 A;  3CXC P;  3OYI A;  1OUL A;  5I22 A;  2V22 B;  1WZO A;  2W9Z A;  1UGS B;  4TVR A;  5EG2 A;  3PE0 A;  3DL1 A;  4JZ3 A;  2LT1 A;  5KCH A;  3INZ A;  4BB7 A;  3CC2 T;  4OMO A;  3TCJ A;  1TH7 A;  4RUG A;  3OYA A;  1ZQ1 A;  3M0Q A;  4EON B;  1GRI A;  3CCQ T;  1FKM A;  3MI9 B;  2E70 A;  1Y7X A;  2GCX A;  2NUP A;  5CAI A;  3TSZ A;  1BI0 A;  1YJN T;  3QJY A;  3UF4 A;  2L3S A;  2Y4X A;  3CCS A;  4OF1 A;  1E6H A;  3OS2 A;  2F2C A;  1I5O B;  4M7A B;  2QQR A;  3VS4 A;  2RHU A;  3U23 A;  3EH1 A;  2EGC A;  4IUR A;  5GAM f;  5KYY B;  3CD6 Q;  1K9M C;  3SEM A;  3ZBD A;  1YP5 A;  2DEQ A;  3NHN A;  5A0D A;  1M8M A;  2UZD B;  1AOJ A;  1AT1 B;  5GAM g;  3OYF A;  3MO8 A;  4CC3 A;  2MWP A;  5HBE B;  3ZEH A;  4A4F A;  4F14 A;  3CXC S;  1F1B B;  1AWW A;  4G6L B;  4AMC A;  1ZSZ B;  2WSC E;  4CC7 A;  5DQW A;  4DEY A;  2JJ9 A;  5GAM j;  4I3Z B;  2ZZD A;  1Q86 R;  4PJN A;  1KJW A;  2PZ1 A;  2DYI A;  1XOV A;  1W4S A;  3ASK A;  1QVF P;  4BY7 X;  1OV3 A;  4F7U A;  1GL5 A;  2JUF A;  4RTW A;  4C8Q F;  2GTO A;  4OMQ A;  4JJB A;  2DXC A;  1VQ4 T;  4ANJ A;  3M55 A;  4IMY B;  4M75 A;  2JXB A;  2I0N A;  3BDU A;  1UNH D;  3POM A;  2PU9 B;  2AHJ B;  1X6B A;  2YXY A;  1VQ8 T;  2FL7 A;  1KQ1 A;  4PKC C;  2LX9 A;  4DBQ A;  4ZGD B;  1G8X A;  4ME7 A;  3VJP A;  1JJ2 A;  1NLP C;  4M7A D;  3EGX A;  3H6Z A;  2QA4 A;  5ECA A;  4OMN A;  2EYY A;  1RAB B;  1WQW A;  1M3B A;  2XMF A;  2DZ9 A;  2F5T X;  1T3S A;  1YJW T;  1VIN A;  1QQJ A;  4CI0 C;  4MZT A;  2WIH B;  2C0I A;  4F7U E;  2ZCF B;  2NWM A;  2EQU A;  4X9D A;  3S3O A;  3EFR A;  1WX6 A;  5GMK m;  3QYE A;  1BU2 A;  3M5A A;  3WXM B;  1G3S A;  3QYB A;  4X34 A;  5KCO A;  4IUV A;  1PHT A;  4X1V A;  3CBO A;  1QVF S;  2D8J A;  4M75 E;  2BZX A;  1X6G A;  2A3L A;  2RF0 A;  4EPC A;  1M1K C;  3GF5 A;  2DL8 A;  2Y90 A;  1XJW B;  4ZTJ A;  4J6Y A;  1D0Y A;  2KMG A;  4II1 A;  5HK0 A;  2JNG A;  4M7D C;  1SKU B;  3CPF A;  1DJ7 B;  1U3O A;  4QVC A;  5I2M A;  2RQV A;  3JRZ A;  3HFN A;  3ZL7 C;  1KC8 R;  2LCL A;  2VGM A;  3JCM c;  1O75 A;  1GBR A;  1AVZ C;  4V2S A;  2YRC A;  1UNL D;  4ZN1 A;  4HNT A;  1RAG B;  3JCM b;  2KR6 A;  2CP2 A;  3L2V A;  1YBY A;  2NLU A;  1SSH A;  2F2W A;  3RGF B;  4GY5 A;  1JQQ A;  3CD6 T;  1TOV A;  1A0N B;  3I35 A;  1D1C A;  1QP3 A;  2JMC A;  1X69 A;  3ER0 A;  2O88 A;  1K76 A;  1IGU A;  3QHW B;  1FMV A;  2ROT A;  4PLL A;  3BG3 A;  2IW6 B;  4ELZ C;  5GAN 5;  1WI7 A;  1MNE A;  3JCM V;  2NUZ A;  2DIQ A;  1O9K B;  3D7S B;  2FZG B;  4BCN B;  2CZ6 B;  4AFU C;  4LDY A;  3EG0 A;  5J26 A;  4BBR M;  4DEX A;  2YRV A;  1U5S A;  2EQI A;  3EGD A;  1EIF A;  2D8H A;  2R57 A;  1VQ7 A;  4J9B A;  1K4U S;  3CCL Q;  4JS5 A;  2YUN A;  2PMI B;  1ZUK A;  1Q95 G;  1YIT Q;  5CKB A;  3CME Q;  2F2V A;  1E7O A;  3V7R A;  2KQW A;  3FRN A;  1U8R A;  4NC6 A;  4HNU A;  1TU0 B;  3A5Z B;  4QT7 A;  2EGA A;  4C5E A;  3X20 B;  5GAN 7;  4ELJ A;  3HRS A;  4DQ2 A; 
#chains in the Genus database with same CATH homology
 2RHZ A;  2QDY B;  3X25 B;  5KH6 A;  3HFO A;  3QPH A;  3X28 B;  4EDU A;  4MDX A;  1GXI E;  4QQG A;  3HZJ A;  1SSF A;  3A8G B;  4M7A A;  3OB9 A;  2HNI A;  1YJ9 A;  2JN0 A;  3A8L B;  1QLB A;  3M53 A;  1N8R C;  5L8R E;  2F69 A;  2EQM A;  4FIB A;  3VU3 C;  5HK3 A;  3FC3 A;  1WQ7 A;  2DXB A;  4ZN3 A;  3OS1 A;  2OTL T;  4AKG A;  3SWN B;  3VKI A;  1KC8 C;  1K73 U;  2DK3 A;  4J5Y A;  1UB4 A;  5D6Y A;  4N4H A;  3VYG B;  3CCJ A;  1Q81 U;  1VQ5 A;  1KG1 A;  4FT4 A;  4M7D F;  4C92 A;  1UGP B;  5CKF A;  4HT8 A;  4ZGE B;  4B9W A;  1JRI A;  3KBG A;  2HBP A;  3WVE B;  3OYG A;  4R56 A;  4IKF A;  3CEY A;  4FU6 A;  2XG8 D;  2K3Y A;  3FLG A;  3OA6 A;  3CPW A;  4X9C A;  2LRQ A;  2QFZ A;  1WPY A;  4M77 A;  1OYX A;  2H3J A;  3UWN A;  3HRT A;  2ZZD B;  1XQH A;  5GMK h;  4C8Q G;  1OZ3 A;  1V29 B;  3VYH B;  2KDS A;  3FJP A;  3UDC A;  4ATO A;  2LDM A;  1D3B B;  3FDR A;  3M56 A;  2ZPF B;  2DTO A;  2KY9 A;  4HLQ A;  2PVD B;  3MEA A;  2EJG A;  3S6W A;  4OMF B;  4A4G A;  3CCQ A;  3GLX A;  1BIA A;  4KUL A;  4Z02 A;  3HL8 A;  4HCC A;  1YIJ A;  1YHQ A;  1MHN A;  4E7K A;  3X26 B;  1R8O B;  3V7C A;  5FLX E;  4FM4 B;  1VQN T;  2KAF A;  5LJ3 h;  4N4I A;  2BIV A;  3QBY A;  4YTL A;  2RHX A;  4MZM A;  1VQ6 A;  1PSE A;  2K57 A;  2MAM A;  4MIM A;  2A7Y A;  1M90 U;  3HKS A;  3QUI A;  3URG A;  2XD0 A;  3X24 B;  4M7A E;  2DXC B;  1YJN A;  4JRQ A;  2RD1 A;  2RK1 A;  4J6W A;  2E12 A;  5LJ3 d;  4XU1 A;  5J39 A;  4J83 A;  1VQM A;  3E9G A;  4M75 B;  2HQX A;  4C8Q D;  2PUO B;  5D6W A;  1Q82 C;  3RER A;  3HBL A;  4OP0 A;  1Y07 A;  1VQK A;  3J7A F;  5GAN j;  4OVA A;  2RHI A;  4XTX A;  3G6E A;  4QQ6 A;  3CC7 T;  4N0A A;  4C92 E;  5CKD A;  2MWO A;  2WSF E;  4J7I A;  5FU6 B;  2RA2 A;  1WGS A;  4M78 A;  2G3R A;  4QVD A;  1NJI U;  3SFM A;  4EMK B;  3WVD B;  3HHT B;  2K3X A;  4BI8 B;  1VQN A;  2LC4 A;  2BS3 A;  4JLG A;  4M77 E;  5GMK l;  4HT9 A;  3M4G A;  1KD1 U;  4M7A F;  2XDP A;  3CCU T;  4R55 A;  1O9S A;  4MZP A;  4OB0 B;  3F70 A;  1H3Z A;  2VXF A;  3VUZ A;  3CD6 A;  4A54 A;  3OYH A;  1W2B A;  1BI3 A;  2EIF A;  2O4X B;  2RK2 A;  3CBM A;  1VIF A;  3LH0 A;  4XU2 A;  1MGQ A;  3I56 T;  2PVG B;  2RHY A;  5GAN 2;  3QO3 A;  2HD0 A;  3SB2 A;  3CCR A;  4IUP A;  3JCM J;  5I2S A;  3OW2 A;  4C92 F;  4JRK A;  2EJF A;  2G77 A;  4XU3 A;  5M9O A;  3CC4 A;  2OTJ T;  1JB0 E;  4BD3 A;  3T9N A;  5KE3 A;  2LVM A;  3TRE A;  3ZFJ A;  2XU8 A;  4M77 F;  2L8D A;  1VIE A;  4PJO A;  4C5G A;  1BIB A;  1NE8 A;  2D9T A;  3C4S A;  2VV5 A;  4Q5W A;  3JCM e;  3G71 T;  1KQS S;  1N9S A;  3QYG B;  2X4Y A;  5GAO n;  1KQ2 A;  1HXD A;  1M5Q 1;  3GIB A;  4AKH A;  3HRS A;  4XTZ A;  5CO7 A;  2M1H A;  5LJ5 h;  3PTA A;  4BE1 A;  4M7A C;  3JB9 G;  3OYL A;  5HKC A;  3PNW C;  4QQD A;  4QW2 A;  1XNI A;  2CS7 A;  3MEW A;  3PFS A;  1N8R U;  4M75 G;  2X4J A;  3E9F A;  2YHT A;  4O5V A;  1X01 A;  4OGE A;  2E6N A;  3JCM X;  1FXX A;  3OYC A;  2KSS A;  2R5A A;  4M78 E;  5LJ5 d;  2DD4 B;  2XI9 A;  3VUB A;  2MMP A;  4JS4 A;  1M8V A;  4LDV A;  5GAO m;  3HSB A;  2FHD A;  3C12 A;  5DM7 R;  5FU7 C;  2GFA A;  2P0K A;  4XAX B;  2V8J A;  2E65 A;  4FL6 A;  5LL6 S;  4E7L A;  4HCB A;  1S72 A;  2RJC A;  2VUB A;  1Y96 B;  3PIP A;  3OW2 S;  4BI3 A;  3JCM Q;  4XTW A;  3CMA T;  2QQB A;  2QQA A;  5A0L A;  3HPW A;  3GNF B;  3RIR A;  4DOW A;  3CCM A;  1YI2 A;  4Z6Y A;  3M57 A;  1VQL A;  2V8I A;  4BY6 C;  4M77 C;  2GFU A;  2R58 A;  2WAC A;  2FB7 A;  3RMQ A;  3GPL A;  3CCL T;  2EJ9 A;  3JCM d;  3CCE A;  3FIF A;  1KHC A;  1X6O A;  3JB9 D;  3PMT A;  3TW7 A;  2EWN A;  4M75 D;  4LDX A;  4M78 F;  4A4K A;  2QTX A;  2RB6 A;  4VUB A;  3OYD A;  4HA8 A;  3CME T;  3MHX A;  4MML A;  2LCC A;  2RI2 A;  4L6V 5;  5HY6 A;  1M1K U;  5GMK e;  5IT9 E;  4BDZ A;  2KK4 A;  3MCA B;  3KXT A;  4BAC A;  4BUG A;  3RMS A;  2RM4 A;  3V7S A;  1YJW A;  2IVW A;  3QDR B;  1RL2 A;  5C0M A;  3OS0 A;  2FYK A;  2LTO A;  3JCM W;  1N27 A;  4LDU A;  5GAN 6;  4XU0 A;  3E1S A;  4XK8 E;  1LNX A;  2OTL A;  5CKE A;  4NL3 A;  1Q7Y C;  4JRP A;  1Q86 U;  3BG9 A;  4AKI A;  5LJ3 e;  1B34 A;  2K5F A;  3S3N A;  3RES A;  2CZ7 B;  3M9Q A;  4C5H A;  4MFD A;  2O01 E;  3PIO A;  2QA4 T;  4M7D B;  1Q82 U;  4IUT A;  3M59 A;  1G3W A;  2CKK A;  2X35 A;  3OY9 A;  2RI3 A;  3DB3 A;  3S3M A;  1YJ9 T;  4J7F A;  2JTM A;  3NFC A;  1VQP A;  4N0A C;  3PMI A;  2YLC A;  3A8O B;  3LYI A;  3ME9 A;  3QII A;  4PJO F;  3LWH A;  1QVG S;  4RG2 A;  1BI2 A;  5GAN f;  4M6V A;  4M78 C;  3BW1 A;  1YCY A;  3BFM A;  3QJ6 A;  3QSU A;  2B8A A;  4ZTF A;  2DD5 A;  2KMT A;  3TW6 A;  3PT9 A;  4FSX A;  3OYI A;  4XTU A;  3OYM A;  3L2Q A;  1M4Z A;  2I2L A;  1WJQ A;  2E64 A;  1UGS B;  5DY9 A;  3JSC A;  4TVR A;  1BYM A;  4KBM B;  1N9R A;  5EG2 A;  1WJR A;  5GAN g;  3JAM E;  3DL1 A;  2MF2 A;  2LT1 A;  5KCH A;  4MFE A;  3INZ A;  4BB7 A;  4HKE A;  3CC2 T;  4A4H A;  5IAY A;  1FX7 A;  4A4E A;  3VKG A;  3OYB A;  3TCJ A;  3RUX A;  2LQ8 A;  1TH7 A;  3DB4 A;  4RCC A;  2L5Q A;  1VUB A;  5CK9 A;  3OYA A;  1JJ2 S;  2L89 A;  1ZQ1 A;  2QDJ A;  3V8L A;  3V8J A;  4E47 A;  2QXF A;  1OI1 A;  3CCQ T;  1E7P A;  1FKM A;  2JVV A;  3QZ9 B;  3NTK A;  4F7U F;  4C0G A;  5CCA A;  4C0F A;  2K4Y A;  2E70 A;  1Y7X A;  2EKO A;  4JUV A;  3J80 E;  1YHQ T;  4C8Q A;  2DJZ A;  3OSV A;  4KUD K;  4PJO C;  3R6O A;  1KQS A;  2GCX A;  3SWN C;  2ZPI B;  2ZPG B;  1VQ6 T;  5CAI A;  1QVP A;  1BI0 A;  2M9U A;  2RJE A;  2PUK B;  2P4T A;  3DLL A;  3VKH A;  3MP8 A;  4BE0 A;  1YJN T;  3QKJ A;  4RCB A;  3QJY A;  4A53 A;  1LOJ A;  4OGC A;  3HP9 A;  3I55 A;  3L2U A;  2Y4X A;  3CCS A;  1VQM T;  3LGL A;  4OF1 A;  3OS2 A;  4M7A B;  2LQK A;  4M7D G;  2QQR A;  2ZPB B;  3LX7 A;  2QEX A;  3UT1 A;  2RHU A;  5LJ5 e;  3G4S A;  4IUR A;  3OQ5 A;  2LT4 A;  3VV0 A;  5GAM f;  3JB9 I;  4JX6 A;  5GAO r;  2DXB B;  5GAN h;  2V8K A;  3I56 A;  1K9M C;  3M58 A;  4HL4 A;  2VXE A;  2DTI A;  1VQ9 T;  3ZBD A;  5KE2 A;  5A0D A;  2DEQ A;  4KT0 E;  5FRM A;  4PNO A;  4XTY A;  2OTJ A;  4C92 B;  3KHI A;  4DA4 A;  1X75 C;  1U1T A;  5GAM g;  3OYF A;  3MO8 A;  2MWP A;  4E7I A;  3L42 A;  4BE2 A;  3SWN A;  3OYK A;  4M77 B;  3ZEH A;  4A4F A;  3CCV T;  4L59 A;  3CXC S;  3G71 A;  4M7D D;  3VYG A;  3QXE B;  3BG5 A;  3TEE A;  2WSC E;  1LJO A;  4LD6 A;  4IUU A;  4M75 C;  3MEU A;  2D0Q B;  1IZ6 A;  2DD5 B;  3OMC A;  5GAM j;  4Y91 A;  2YLB A;  3J81 E;  4EMH A;  4BBS M;  1BI1 A;  1G3T A;  4QVZ A;  3RKW A;  3PGG A;  2ZZD A;  3QHS A;  4MDW A;  4LOC A;  2DXU A;  1KC8 U;  2VYT A;  2HAX A;  1QW1 A;  2P0P A;  1D3B A;  5FU6 C;  2ZPE B;  4JX4 A;  4CRI A;  1JBM A;  1H64 1;  1OZ2 A;  1XOV A;  2GQV A;  1W4S A;  2RJD A;  3ASK A;  3C95 A;  2E6Z A;  1FWZ A;  2DAQ A;  3CMA A;  4F7U A;  3P8D A;  3LGF A;  1VQO A;  3SD4 A;  1K8A C;  2JUF A;  3NTH A;  4HCZ A;  3P8B B;  3QYH B;  4C8Q F;  3JB9 H;  2EQJ A;  1QVG A;  4M7A G;  1M1G A;  2F5K A;  3M54 A;  5GAM h;  4EMG A;  2FVU A;  1UGQ B;  1G3Y A;  2DXC A;  5CR2 A;  1VQ7 T;  2JZ2 A;  1VQ4 T;  3FEO A;  1YIT T;  3M55 A;  3MP1 A;  4M78 B;  1U1S A;  3OMG A;  4N4G A;  4M75 A;  3EFS A;  5FRO A;  3OYN A;  3BDU A;  3OYE A;  4XQ3 A;  4B9X A;  4PJO E;  2PU9 B;  4AI6 A;  4XTV A;  2AHJ B;  1NZ9 A;  2K5L A;  3OBW A;  5CIU A;  1YI2 T;  3L2Z A;  4C92 G;  2FL7 A;  1VQ8 T;  1KQ1 A;  4L5G A;  1XTD A;  3RKX A;  5GAO p;  5LJ3 f;  4PKC C;  5J3B A;  2LX9 A;  5DLO A;  1UEB A;  4ZGD B;  4ME7 A;  3VJP A;  3CCE T;  2DTH A;  1JJ2 A;  4M77 G;  2E5Q A;  4EMK A;  4M7A D;  3H6Z A;  3DKM A;  4PL6 A;  2QA4 A;  3HRU A;  5LJ3 g;  1WQW A;  4NL2 A;  2XDB A;  2K5I A;  2XIC A;  4C8Q C;  2HQE A;  2EQK A;  2DZ9 A;  2VC8 A;  4KUI A;  5GMK j;  2RI5 A;  4NS5 A;  2O4X A;  2RJF A;  2F5T X;  2PVO B;  1YJW T;  4MMK A;  1IRE B;  4CI0 C;  1M1F A;  4MZT A;  5CVI A;  3OSS C;  2DZC A;  4PJO B;  4C0D C;  5GAO l;  3OYY A;  4O6J A;  1I81 A;  4F7U E;  2ZCF B;  4RG8 A;  4C92 D;  4HNV A;  4RMO A;  2XKO C;  2WSE E;  2CYZ B;  2DKG A;  3CCJ T;  1VQ5 T;  2EQU A;  4X9D A;  3S3O A;  2BKD N;  3EFR A;  5GMK m;  5LJ3 j;  2BS2 A;  3QYE A;  2CGH A;  3OS5 A;  4J8O A;  4C5I A;  3M5A A;  3WXM B;  5C6S A;  4M77 D;  1UGR B;  1G3S A;  3QYB A;  1KHI A;  2XK0 A;  4QSH A;  4X34 A;  5KCO A;  4IUV A;  4E7J A;  1HK9 A;  1VQP T;  2RO0 A;  3CC2 A;  3CBO A;  3CBP A;  1QVF S;  2CZ0 B;  4M75 E;  1K9M U;  3HB9 A;  2X4W A;  2A3L A;  2JOY A;  2DIG A;  3GOX A;  3FB9 A;  1AHJ B;  4EPC A;  3AHU A;  2QQ9 A;  4WF2 A;  1Y71 A;  2DPP B;  5GAN 8;  1YIJ T;  2QF7 A;  3HO8 A;  2Y4Y A;  4M78 G;  5GAN e;  3L2R A;  2E10 A;  4JRI A;  3H8Z A;  1M1K C;  4F7U B;  3GF5 A;  3MEV A;  2DD4 A;  3CC7 A;  2Y90 A;  3CXC A;  4ZTJ A;  4J6Y A;  2KMG A;  2BS4 A;  2JTF A;  4II1 A;  4UC4 A;  1I8F A;  5HK0 A;  3TU4 K;  1WNL A;  4BI4 A;  1K73 C;  3JB9 F;  5CQY A;  2L3R A;  1Y96 A;  1Q86 C;  1ZBX A;  2DO3 A;  2JNG A;  3L1A A;  4M75 F;  3OBY A;  1Q81 C;  4M7D C;  1QP2 A;  2QQ8 A;  2EAY A;  5LJ5 f;  3CPF A;  3V8K A;  1DJ7 B;  3CCU A;  3O8V A;  1G5V A;  4QVC A;  4NOY A;  4J6X A;  5I2M A;  1VQK T;  2OAU A;  3JRZ A;  2ZPH B;  3HFN A;  2LCL A;  5CKH A;  2VGM A;  2EYQ A;  1WJS A;  4IUQ A;  1O75 A;  3JCM c;  3CPW S;  2XID A;  3G6E T;  2RH2 A;  4FT2 A;  3MET A;  4M78 D;  4V2S A;  2DXT A;  3Q1J A;  4LDW A;  5A2Q E;  1VQ9 A;  4PJO G;  5LJ5 g;  4RKU E;  5FU7 B;  4ZN1 A;  4HNT A;  2GF7 A;  2QQS A;  1B34 B;  3LWI A;  3JCM b;  2KR6 A;  4OB3 B;  4LD9 K;  1M9S A;  5GAN d;  3L2V A;  1YBY A;  5EJC A;  2NLU A;  3JCM f;  2LNV A;  3I55 T;  4JJN K;  2QI2 A;  4PLI A;  3CCS T;  1K8A U;  4D6W A;  4GY5 A;  1NPR A;  1P92 A;  3DLM A;  3CD6 T;  4C0Z A;  2X4X A;  3LLR A;  4ZGJ B;  4BY6 B;  2QEX T;  3SDZ A;  2KVQ G;  2R5M A;  1QP3 A;  3G4S T;  3CCV A;  1ZHI A;  3QG1 A;  5LJ5 j;  1M90 C;  2IG0 A;  5DLQ E;  2XHC A;  3ER0 A;  2VGN A;  3MP6 A;  5A0G A;  3RKY A;  4E7H A;  2D6F A;  3CCR T;  3JCM g;  3JB9 J;  1I5L A;  4C8Q E;  2EFI A;  4M7D A;  2P0Q A;  2ZGW A;  5IN1 A;  5GAM e;  4JLI A;  3CC4 T;  3N5B B;  4JDS A;  4JX5 A;  2CZ1 B;  2BUD A;  4ELY C;  3JCM P;  4PLL A;  3GNG A;  3BG3 A;  4ELZ C;  5GAN 5;  4PJO D;  3A8M B;  1I4K 1;  5CQX A;  5GAO q;  2M0O A;  3L2W A;  4F7U G;  1Q7Y U;  3JCM V;  3UPU A;  3QWL A;  3GP8 A;  4EMK C;  3C94 A;  2DIQ A;  2CZ6 B;  4DOV A;  1BKB A;  2E1H A;  4BDY A;  5GMK i;  4LDY A;  1NJI C;  2PQW A;  5GAN 4;  5J26 A;  1KD1 C;  3QZ5 B;  1N6A A;  3BY7 A;  4BBR M;  3CCL A;  3P8H A;  3BDL A;  2YRV A;  1RI0 A;  4C8Q B;  4OB2 B;  5D6X A;  2WJ9 A;  3H4C A;  1EIF A;  3E19 A;  2R57 A;  1W2B S;  1VQ7 A;  1VQ4 A;  2DVE A;  1YIT A;  2K2V A;  2E41 A;  4C0D B;  3CME A;  4JS5 A;  5GAM d;  4C92 C;  5GAN 3;  1S72 T;  3M4Y A;  3JCM h;  3CCM T;  1VQL T;  3EAE A;  1VQO T;  3A8H B;  1VQ8 A;  1PSF A;  5CKB A;  5FRN A;  2XDD A;  3V7R A;  4OB1 B;  3NTI A;  2KQW A;  3FRN A;  1U8R A;  4NC6 A;  4HNU A;  1QVF A;  3A5Z B;  5I21 A;  4GLK A;  4M7D E;  2MI6 A;  4C5E A;  3X20 B;  5GAN 7;  1NPP A;  2C06 A;  2M16 A;  4P5N A;  3KUF A;  3OYJ A;  5AYF A;  4Y28 E;  4ELJ A;  3G7Z A;  3LW5 E;  4DQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...