4OB0B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob0B02
1IREB 2DD4B 4OB3B 4RKUE 1UGSB 2PVDB 1PSFA 3VYGB 2CZ0B 2WSCE 2DXCA 4XK8E 3WVDB 2ZPEB 1PSEA 4Y28E 2DPPB 1AHJB 4OB1B 4ZGJB 4OB2B 1DJ7B 2WSFE 1UGPB 2DXCB 2O01E 3X28B 2ZPHB 3X25B 2CZ7B 2CZ1B 2ZCFB 2ZZDA 3QYHB 2ZPBB 4FM4B 2WSEE 1QP2A 2QDYB 3X26B 3A8LB 3QXEB 2PUKB 3A8OB 3A8MB 1V29B 3X20B 2ZZDB 3VYHB 2AHJB 2PVOB 4ZGDB 3X24B 2DD5A 4OB0B 4KT0E 4ZGEB 2DXBA 4L6V5 1JB0E 3QZ9B 1UGRB 2PU9B 3A8GB 2CYZB 2PUOB 1UGQB 2D0QB 3QZ5B 3QYGB 2DD5B 2DXBB 3LW5E 2PVGB 2ZPIB 3A8HB 2DD4A 3WVEB 1GXIE 5L8RE 3HHTB 2CZ6B 2ZPFB 1QP3A 3VYGA 2ZPGB
chains in the Genus database with same CATH superfamily
2XDPA 2LX9A 1YJNQ 1X6GA 1K8AC 4XAXB 1Q82C 5FU6B 2O2OA 3QJYA 1ZSGA 2ABLA 3QWXX 3JV3A 2KRSA 1MNDA 1HXDA 2FRWA 2HCKA 3BG5A 2E5QA 3L2UA 3DLLA 1OX9A 2UZBB 5HVYB 3VS6A 3OY9A 1PSEA 2OTJQ 2OTLA 3PMIA 1QLBA 3MEVA 2LCSA 3FB9A 5FWCA 5KE2A 1AHJB 1M90U 4C92G 3JCMd 1V76A 1H1SB 3X28B 2WEVB 4V2SA 3UF4A 4BCHB 1LNXA 3NHNA 4M78F 5CCAA 1H8KA 1X69A 1BCOA 5FLXE 4ROCA 1NLPC 1RLPC 4M75G 2W99A 2WMBB 3A1PA 1OPLA 4KGXB 2DJZA 1X01A 2K57A 3CC7A 3DB4A 2F2CA 3HPWA 2ZZDB 3S3MA 3HO8A 2X51A 1G5VA 1OPKA 4ZGDB 2CP0A 5FRNA 3JCMP 1HYOA 3M56A 2DD5A 3CCEA 2FL7A 2CP3A 3DJBA 4J9CA 3OQ5A 2LRQA 4J9HA 1U1SA 1VQ5Q 4IKFA 5I5ZB 4OR5B 2RM4A 5LJ3e 3ME9A 1H25B 4C5IA 3NTHA 3OYFA 4M4ZA 5AT1B 5IN1A 3ZEHA 1I8FA 1OQKA 4C8QA 5LL6S 4AI6A 4BE2A 3M0UA 5FWBA 4N0AC 3EFRA 2QGFB 2MOXA 4OF1A 1TS9A 2EWNA 3DLMA 2VYTA 1URCB 4LD6A 2KY9A 6AT1B 5GAN4 1VQKA 5DQWA 4X1VA 2OTLT 3I5RA 5A0GA 2VASA 5GAMd 2V8JA 5EFQB 1IGQA 5A0DA 1U3OA 2DX1A 4HXJA 5KYWB 1NYGA 4JRIA 1Y96B 2KVQG 3VRZA 1RI0A 4ELYC 4EOIB 3E9FA 4FW1A 1D1CA 4F7UF 4RKUE 2HKQB 3EOCB 1VQOA 4QKUA 1E9HB 2W0ZA 1AD6A 2B9RA 3G6EQ 5CR2A 2BZXA 2DXCA 1OZ2A 3DTOA 4J9GA 4EOSB 4OMLA 3INZA 2P0KA 4E7JA 3RERA 2DMOA 5GMKe 4KRDB 5FROA 4FIBA 3JCMb 4IMYB 4QT7A 3Q1JA 3PIOA 1UDLA 3CMEA 3GIBA 1U1TA 3EG3A 3QIIA 3G7ZA 3PO3S 2LP5A 2GGRA 1QW1A 3KHIA 5LJ3j 3CPWA 1F5QB 2Y90A 3HL8A 3H9NA 1QMZB 3V8JA 3VS1A 5I11A 9ATCB 4M7AE 3CD6A 3V8LA 3VS3A 1JO8A 1SHGA 1S72A 3CCET 2QG9B 1Y71A 1WHKA 4A63B 1O9KA 3UATA 4J9FA 3LH0A 2MAMA 1WQ7A 4ZN1A 2L5QA 1M1KC 2CUBA 3L1AA 1KQSP 3G4SA 4M78C 3EH2A 3VS2A 1UTIA 2JW4A 2XU8A 4BY1X 2QQ8A 2KYMA 1ACMB 3C0CA 2MCNA 3TEEA 1QQJA 3M59A 1BI0A 3QZ9B 3UDCA 1UGRB 2RN8A 2QTXA 4KRCB 1T0JA 2YUOA 2BS2A 4M78B 1TG0A 5GMKj 2EYZA 2F2XA 3EFOB 4J7FA 2EAYA 1G3WA 4PK4A 1J3TA 3C95A 3QWYA 3OS2A 3M53A 3REAB 3WVEB 1KFZA 1BYMA 1WHHA 1Q86R 2KYBA 4NS5A 5HBEB 1M4ZA 2BIVA 4BCPB 3TVTA 2IVWA 3VS4A 1M3BA 4TVRA 3CCJA 3CMET 2XIDA 4M77E 3V7RA 2KR6A 5CAIA 1IB8A 2QQAA 2DBKA 1NYFA 5IXFA 2PHGA 4J9IA 2X9HA 1GFDA 3BFMA 3VKHA 5HBHB 2CP5A 2FVUA 3CMAQ 4E7SA 3BLQB 3CD6T 1JBMA 2W96A 4JDSA 1MV3A 1RAAB 1YHQQ 1S72T 5AYFA 3SWNA 3CBOA 3JRZA 1W70A 2QQRA 2RD1A 2O01E 1UNHD 5GAN2 4D6WA 2D8HA 3FEOA 1AWXA 4F70B 3G4ST 1HK9A 1ZP2A 2NUZA 4M6VA 1KIKA 1B07A 2OAUA 1OOTA 1QP2A 2XDBA 3RBBB 2K5LA 2QDYB 1MGQA 1MMNA 3EHRA 5IHYA 2EUFA 4II1A 3QKJA 3U23A 1WHMA 2C5VB 1A0NB 4MZMA 4UC4A 3R6OA 4EDUA 2NUTB 3G71Q 4WCIA 1Y57A 2X35A 1G8XA 2LJ1A 4L6V5 1OIYB 2EPDA 4RTVA 4J6YA 4M7DC 1RUWA 2RJCA 2E6ZA 3MP6A 2EBPA 3CCJT 1WJSA 2AZVA 1WHGA 1IRXA 2W10A 4ATOA 1BI3A 2BE7D 4M7DB 2YRDA 5KYYB 3QYBA 3QHSA 3OYLA 1YIJA 2J6OA 1PHTA 4PJLA 3EH1A 1KQSA 1TU0B 2DXTA 1LVKA 2G77A 1KSWA 2H3EB 1VOMA 3VRYA 2C5NB 1GBRA 3OBWA 3V7SA 2UZLB 5LJ3d 2P4TA 3JCMh 2VWFA 3EG9A 1YWOA 4LN2A 4PJNA 1I1JA 4PJOC 2E3IA 2FZKB 5GAOl 4KH1B 4M78D 5IXBA 5HKCA 2J6KA 1JOWA 3CCQQ 1ZBXA 2CS7A 3URGA 4AKGA 3P8BB 3KFVA 1G3NC 4OGCA 4PLLA 1WPYA 5CK9A 3HP9A 4PJOB 2DERA 2BZ8A 2DRMA 4GLMA 1GH6B 4EMKC 2MMPA 3L2VA 3CCLA 1S1NA 2CUDA 1OKWB 2LT1A 2IG0A 2QK0A 4Y92A 2AT1B 2FRYA 2YXYA 1X27A 1MMAA 1QVPA 1JEGA 1LCKA 1JKWA 4Y91A 1VQLA 2PVOB 1WIEA 3OS5A 1YJNA 4B9WA 3MEAA 3EG1A 4EMKB 2KRNA 1JQQA 2LMJA 2Z0WA 5GANe 3TU4K 1NJIR 2RJFA 1X75C 2E10A 3JSCA 1WLPB 1M1KU 4MFEA 1ZHIA 2CREA 1YIJT 4BXXX 2CYZB 1VOLA 4M75E 3OYGA 4IUPA 3BLHB 3QUIA 1OI9B 3JCMW 2FZCB 2EJ9A 3T9NA 5GAMh 4LXCA 1VQ7A 5DLOA 3OS0A 2YLBA 3OYHA 3VUBA 2LDMA 1GCQA 1N5ZA 2MIOA 2BS4A 3LWHA 2V8IA 2P0QA 1OU8A 1QLYA 5EG2A 1H24B 1D3BA 2DD4B 4KRTA 4AFZC 3CXCP 4BCFB 4PFZA 5LJ5f 4RTUA 2EJGA 1NEGA 2SEMA 4RG2A 2DNUA 2WSCE 4XK8E 3D7SB 5FRMA 3CCMQ 2PTKA 4M7AF 1N27A 3PVLA 2E1HA 4J7IA 3L42A 1BK2A 2COZA 2C0OA 4PKCC 4M7DE 3OW2P 2KEAA 1OEBA 4MZTA 5GANj 2MF2A 2QQBA 4JX6A 3HTRA 3DOGB 1UGPB 1TUGB 1VA7A 1WHJA 2UZEB 2HDAA 2D8JA 4AMCA 2DVJA 1VQ5A 2RHXA 2LJ0A 4MDWA 4YOSA 1VQLT 1NEBA 1R77A 1YJNT 2CKKA 2RA2A 4M7DD 3MP8A 1AWWA 1UE9A 1ABQA 1WQWA 3POMA 1TTHB 2BS3A 2H8HA 3A8LB 3E9GA 5DY9A 1N9RA 3QXEB 3V7CA 2IW9B 1X6BA 4UN0A 1V29B 2DA9A 4WTOB 1YNZA 2DTIA 4C8QF 2RI5A 1IZ6A 4RMOA 5CO7A 2QQ9A 5KYXA 1YFNA 2IN3A 1ABOA 2KXDA 2LQKA 2OAWA 2EQMA 2BUDA 3OYMA 1YWPA 1Q86C 4DQ2A 3BG9A 2EYXA 2JJ9A 1M3CA 3JB9F 2AZSA 1QCFA 4NSTB 2EIFA 3TN8B 1XJWB 1K9AA 1YI2Q 3A5ZB 1BCMA 4AT1B 2E12A 2DXBB 3OS1A 5KCHA 4IUVA 1SPKA 1KC8R 1X43A 4C0GA 2MWPA 5A0LA 4PJOD 1KK7A 4EMGA 4Y72B 1W4SA 1AISB 5HBJB 3TNHB 1SHFA 2EGAA 2V8KA 4JZ4A 4II5B 1RAHB 4NL2A 1IREB 4ESRA 1Y7XA 4FT2A 4D8DA 3M4YA 2L0AA 3HRSA 2M0YA 4M78G 5HCKA 1VINA 3KUFA 1VQ5T 3OBYA 1R8OB 1YCSB 1H1QB 2DBMA 3CPWP 1YITQ 5CVIA 4F7NB 4BY7X 3CPWS 2PMIB 2K79A 1VQNQ 4JLIA 4X34A 2LTOA 3H0IA 2HL3A 1H641 4RG8A 4KUDK 1TSFA 5IDNB 2M16A 3MIAB 1B34A 2E4HA 4EOMB 3VV0A 1WHLA 4JRKA 2DL4A 1M27C 2EJFA 3R6NA 1WI7A 5ICPB 1OI1A 4BI8B 1WJQA 4C0ZA 3CXCA 4OMFB 1SSFA 2V1QA 3G6ET 2O88A 2FPFA 2HEQA 1KG1A 3TSWA 1KD1R 1JSUB 3A8MB 2COYA 1N9SA 3X20B 3BE3A 4ZTJA 2RB6A 4E6RA 2F2VA 4A4HA 1QWEA 3RMSA 1RAFB 2AHJB 2RH2A 2C4GB 3BLRB 1H3ZA 3BDLA 3QSUA 2B8AA 3OMGA 4J6WA 3H4CA 4XTUA 3MKDA 4M7AA 2LJ3A 3OW2A 4E47A 2DRKA 2M1HA 3THKA 2PU9B 3H6ZA 4LE9A 2CSIA 2EFIA 5J3BA 3CMAA 2XMFA 1I4K1 2DD5B 1GY3B 1RADB 2C0TA 1IO6A 4C5HA 1U5SA 4BCGB 1M5Q1 4EPCA 4FSXA 1BIBA 2ZPIB 3QYEA 1PRMC 1QCOA 4A4FA 4LDYA 1E7PA 2VUBA 3EGXB 4PFOA 4ZTFA 1JJ2P 2QA4Q 1WXTA 3OSVA 4KUIA 5CYIB 2EQIA 4ME7A 2K4YA 2FG0A 4BCQB 5I21A 1AT1B 5GAN5 5LJ5h 4CC4B 5LJ3h 2I53A 1M2VA 2DKGA 1TH7A 4AFSC 1OKVB 5GANd 2E3HA 2JS2A 4OMPA 3L2ZA 4BY6C 3DDPB 1H1PB 4M7DG 3S3NA 4EOLB 4TTHA 4XTXA 3G71A 2HQXA 4XU3A 1DJ7B 1VQMQ 2WHBB 3VS0A 2DXCB 4BBRM 4M77A 2KXCA 4ROEA 5IT9E 4C92F 4QVCA 4ELZC 4BY6B 3JCMJ 1YN8A 4Q5WA 2P84A 3CC2Q 4DBFA 1G83A 4B6MA 3RUXA 1QKXA 3F5XB 1EFNA 4KGVB 2A37A 3N5BB 1UGVA 2VKNA 4IUTA 1KHCA 3FDRA 1TWBA 1VQ9Q 4QVDA 2FO0A 3JCMf 5GMKh 1NJIC 4M75F 4JLGA 1M9SA 2JT4A 1M3AA 3LLRA 4F7LB 3CMAT 4OMNA 2KDSA 4HT8A 4JX4A 2RK1A 5CKBA 3BHTB 4YTLA 2DTOA 1O9KB 1UNLD 3UA6A 3G1JA 2QEXQ 2DIQA 3M0PA 1VQ6Q 2QDJA 4HVWA 5GANg 2LC4A 5CKFA 2JM8A 2L3SA 3I35A 3MCAB 4PJOG 1D1BA 3M4GA 3KBGA 4D8KA 3SFMA 4C5GA 1TD6A 4EMHA 3DDQB 2D0QB 4HVVA 3JCMc 2HQHA 4EORB 3M58A 2GFUA 3ER0A 1KQSS 1VIEA 1C6VX 1MMGA 2EKOA 2KE9A 4DBHA 3CQTA 1Q86U 5KYUA 1ZUUA 5GJWB 2ZPFB 2QGGA 3CCQA 2FYKA 1W98B 1E6HA 1W2BP 5C6SA 4KH0B 1UFFA 2R5AA 2VXEA 4F7JB 3G71T 4OB3B 3M03A 4EONB 4BCJB 1FINB 2K3YA 2HD0A 2JVVA 2CSQA 1SKUB 3CCUQ 2C5OB 3UPUA 4HNVA 2JXBA 5GAMf 3PIPA 2KT1A 1QVGP 3LQ5B 2DZ9A 5GAN7 3QDRB 1NZ9A 3O5ZA 3SWNC 4QSHA 2G3RA 4OB1B 2QASA 2X4YA 2K5FA 4BCMB 2ED1A 3PE0A 4YOOA 1M1FA 5HQ0B 2JM9A 5HNBB 4CXAB 1VQ8Q 3SWNB 1JJ2A 1BI1A 4F6SB 4XQ3A 2ZPBB 1OL2B 7AT1B 4VUBA 4EOQB 4C8QD 2UZDB 3A8OB 4BCQD 3HFOA 3M0RA 5IHIA 2M0OA 1OX8A 1D0YA 1FMWA 3H8ZA 2BTTA 2K3BA 2EYWA 2BZYA 4DA4A 2V1RA 2F2WA 3MI9B 4JJDA 2K2MA 4Z02A 4J9DA 2RPNA 2KBTA 4N4GA 1AOJA 1VYVA 2NUPA 2HBPA 3JCMX 1K4US 3CC7Q 4KGZB 1KC8C 3P8DA 1Q7YR 2IIMA 3M9QA 1YCYA 4F7UB 3TREA 2RI3A 4LNPA 3CCQT 1FMKA 1K76A 1K73R 3TW6A 4DBQA 3OYEA 3CCMA 4XU1A 4BE1A 2P0PA 3FLGA 3IQLA 4EC9B 4BBSM 3NFCA 4N4HA 4C92A 4EOJB 2CH4A 3JB9H 2BPMB 4J6XA 3JAME 2RJEA 4CRLB 1EZZB 1X2KA 1CSKA 5ACBA 2IVXA 2X1NB 1D3UB 5GMKi 1JRIA 4PJJA 3M0QA 4ORZA 3OB9A 5D6XA 3M5AA 1K8AR 1Q82R 4GBQA 3VYGA 5FU7C 2HSEB 5J26A 1ARKA 1K1ZA 2ATCB 4M75A 2RQUA 4QQDA 2DILA 2XKOC 4AKIA 2MI6A 1VQKQ 1WGSA 4BB7A 1YBYA 1RACB 4RCBA 4E7IA 4BCIB 3OYBA 3LYIA 1PSFA 5GAN3 3DL1A 2ZPEB 4JRPA 2YUQA 1Q81R 5FU7B 3PT9A 1VQOQ 1AEYA 4F16A 4ZGJB 2G9XB 1PNJA 3GLXA 2EQKA 4OGEA 3TCJA 2DL7A 1N6AA 3I55Q 2CT4A 4LDXA 3EG9B 1KD1C 2CZ7B 1WDXA 2DEQA 3PGGA 1XQHA 4M78E 1AWOA 4J8OA 2DF6A 3M0TA 1UJYA 1W2BA 4F6UB 1W6XA 2NYSA 3OYCA 3X26B 2DEUA 2DAQA 2ZGWA 3FC3A 1SSHA 1BB9A 4PL6A 3RKXA 1AZGB 1UHFA 3BG3A 1ZBJA 3FIFA 3CCMT 2GQIA 2RO0A 4WF2A 2GF7A 3B57A 3RGFB 1G2BA 1QVGA 1YJWQ 2GTJA 2K9GA 2BE9B 4JUVA 1NJIU 1JB0E 3O8VA 3ZFJA 2QXFA 5KH6A 4ELJA 1WFWA 2YWWA 3P8HA 1HD3A 3AHUA 1YITA 3K7AM 4BCMD 3EIDB 2DETA 1VQNA 2O4XB 2HL5C 2XHCA 4LUDA 2LCLA 1PC0A 1R0BG 3EGUA 2G6FX 2CT3A 1PKTA 4FYYB 2CP2A 2KT8A 1SEMA 5GANh 2RHIA 3NTKA 2BKDN 1T3SA 1WJRA 4KBMB 1CKBA 2K6DA 3EGDA 2HAXA 2YHTA 2OTJA 2ROTA 4F7UE 2UUEB 4LOCA 2R7GA 1RI9A 4HA8A 3RKWA 2CGHA 2DK3A 3C4SA 5HK3A 3M55A 3E1SA 4J9EA 2GQVA 2QTVA 5I22A 1YI2T 3JCMQ 1O9SA 1T0HA 2EQJA 5I2SA 2EVRA 4YOZA 3MO8A 3M57A 4MFDA 3OYIA 4ELLA 1N8RR 2WSFE 2W9FA 3L2QA 5GAMe 1FMVA 2COWA 2IW8B 4BI3A 1CKAA 5DLQE 2VV5A 1H27B 3CXCS 2XK0A 5LJ3f 2C5XB 4OP0A 4CI0C 1MUZA 3WXMB 3NDQA 2D9TA 3GBQA 3M0SA 1RLQC 2CP6A 1SG5A 2LNVA 1PD1A 2K7AA 2WIHB 3ZBDA 3QDFA 3H0HA 1E6GA 4CFNB 2J7IA 1VQPQ 4BE0A 3OW2S 2LQWA 5D6YA 3AT1B 1YITT 2QA4A 4EOPB 1VQNT 2IW6B 2GBQA 2CH4W 3L2RA 3CCVQ 1BBZA 1OYXA 1QWFA 2E6NA 2LT4A 4BDZA 2NLUA 1PM3A 2DL3A 1M8VA 3QBYA 1N4MA 2QGSA 4K11A 2GCXA 3HKSA 2X4WA 1KHIA 5KYXB 2DJQA 4HCKA 2A28A 2OTJT 1UG1A 2I0NA 2L8DA 1LOJA 2AK5A 3SD4A 3EG2A 1KC8U 4L59A 2QF7A 2PVGB 4JX5A 4AFUC 5GAMj 1VQMA 2DXUA 4FW2A 4A53A 3MY5B 2JTFA 2CZ6B 1K9MR 4IUUA 4DOWA 4MMLA 2EGEA 2JZ2A 2ZPGB 1WNLA 4XTYA 3G6EA 3CCRQ 2H3JA 3GPLA 2OJ2A 4BACA 1PD0A 4RCCA 3CPFA 4PJOE 5GJVB 3CEYA 2W9ZA 3I5SA 1XO2A 4M77F 1KXUA 1H1RB 2DL8A 2JMCA 2MPXC 3F70A 1VQ9A 1UGSB 1ZSZA 1H28B 2LX7A 4N4IA 5I2MA 1QVFA 3O0GD 1QMCA 2DPPB 1H26B 3SDZA 5CKDA 4RTTA 5EJCA 1WX6A 2QEXA 2OX7A 3VJPA 3H0FA 3OA6A 2ZPHB 3OMCA 3UWNA 2KGTA 2QA4T 2ECZA 4EC8B 1JU5C 1EX4A 1T3LA 2PQWA 4A54A 1GBQA 1PG5B 3CCSQ 3RNJA 1I07A 2QI2A 1B3QA 1SRLA 1B34B 2RHYA 1KD1U 2ZAEA 1YJ9Q 1P92A 3JB9J 1K73C 3NTIA 1ZX6A 1WA7A 4JPBW 2LVMA 2K2VA 3SEMA 1C0MA 1TUCA 4E2FB 2LNHB 3ZL7C 1FWZA 3CCLQ 4M7AC 2CP7A 2DVEA 1VQMT 4KT0E 4HVUA 1VQ4Q 2EYQA 3LGFA 3TQ7P 1GUXA 4AKHA 1RL2A 2LZ6B 1OL1B 4C0FA 4CC3A 3CCUA 4I3ZB 4CFXB 4C5EA 5LQFB 3CC2T 2MK5A 3MPUB 1UGQB 4LD9K 2PK9B 3G33B 1IHWA 1OV3A 3KXTA 5IF1B 2FPEA 4RTWA 4M7AB 2HBWA 1I5LA 2PNIA 2SRCA 3GTMS 3OSSC 4A4GA 1UEBA 2A36A 5BNJB 1VQ9T 4JZ3A 4E7HA 3J80E 5L8RE 2CCHB 1VUBA 4FYVB 3JB9I 4EIKA 4E7LA 4JS5A 4BDYA 1LPLA 1Q81C 1VQ8A 1VQ7Q 4HLQA 4F7UG 3I56Q 4BD3A 2QEXT 2FHDA 4C8QC 1VQ6T 3FRNA 3ULRB 2JTMA 4FYXB 1UB4A 3QO3A 1YHQA 2PVDB 5D6WA 1YP5A 4Z89A 3J7AF 3SHWA 2YRVA 1MV0B 4O5VA 2L89A 4FCYA 2RI2A 2DYBA 2XDDA 1M2VB 2X3XD 1TFBA 1NG2A 4C8QB 2WFYB 4MIMA 3QG1A 1MNEA 1PWTA 1JJ2S 3CBPA 1TXQA 3VU3C 2RK2A 3UA7A 5IH2A 4M77C 5CEIB 2M9UA 4HNUA 1M90R 1I81A 1W1FA 3MHXA 3VUZA 1Z9ZA 3HB9A 3CC4Q 2ZZDA 2EYYA 2RHUA 2ED0A 4FM4B 1GCPA 4M77B 2DZCA 5LJ5e 3H41A 4OMMA 2YDLA 3CCUT 2W2HA 2C06A 4BCOB 3EGXA 4FU6A 2IPOB 3PNWC 2KR3A 3RR6A 3VYHB 4JRQA 2JNGA 1ZQ1A 2HQEA 4KULA 4X9CA 8ATCB 4HCCA 2QDLA 4QW2A 3JCMg 2Y4XA 1NPRA 1K0XA 1UHCA 2J05A 4BCKB 2HNIA 2JS0A 1OU9A 2DMEA 2R58A 1LJOA 4A4KA 1RAGB 2A0FB 5HK0A 1VQ8T 3OYYA 1SRMA 4BUGA 4EOKB 5D7UA 2HSPA 4R55A 2DYIA 5KYWA 1YHQT 3MY1B 2RQVA 3A8HB 1Y96A 4N0AA 4F14A 1GL5A 1M8MA 4PNOA 3I55A 2RQTA 2O9VA 2D0NA 2PZ1A 3JCMV 4HCBA 1JXMA 1HJDA 1AVZC 1RAEB 2JOYA 5LJ5j 5L23A 5KYUB 3CC7T 1GRIA 1N8RC 3HBLA 1Z9QA 1SF9A 4CRIA 1UNGD 4Z8AA 5C0MA 1UECA 4OGRB 1I0CA 3TW7A 3EG0A 2E5KA 2D6FA 4CFMB 5CKEA 4M7DF 1YJWA 1W2BS 1D0ZA 2JGZB 1NM7A 2VC8A 4AG1C 5GAMg 5GANf 1ZUKA 3MEWA 4M7AD 3X25B 4MDXA 2WMAB 2CCIB 1I5OB 4FX3B 4CFVB 2XI9A 4O6JA 3RKYA 3QJ6A 3QYHB 3EAEA 4OMOA 4FYWB 2XICA 2WSEE 1TOVA 1VQKT 4FL6A 2EGCA 2YSQA 2YUPA 3PFSA 4ANJA 4P5NA 1WZOA 1O75A 1QVGS 2KAFA 4OVAA 3GF5A 1KJWA 3FJ5A 1U8RA 4Z88A 4XU0A 4J9BA 2QQSA 4C8QE 2OTLQ 1RAIB 4HCZA 2QYZA 1VQOT 3C12A 1FYNA 2B86A 1MHNA 4M78A 4LDWA 4BCNB 1ZA2B 3EFOA 2CDTA 5CQYA 1Q7YU 1QCNA 2FEIA 3I55T 2FZGB 2X4JA 2LCCA 1K73U 1OULA 1K9MC 4JS4A 1ZLMA 3GP8A 3GNGA 1KQ2A 2PUOB 4PJOF 3REBB 2X3WD 1U06A 2NUPB 4C92C 2PJQA 4F17A 1NBEB 2C6TB 1BKBA 2E41A 2MWOA 3OYKA 3PTAA 4RODA 4AG2C 3JB9D 2VXFA 4ZN3A 1GXIE 1K8AU 4IIMA 1Q82U 4M77D 4C92B 4G6LB 3NGPA 3HZJA 4M75C 3MEUA 1BU1A 1YJWT 4RUGA 2YT6A 2XG8D 3BHVB 3V8KA 3CCEQ 1IHVA 3RDVA 4CC2A 5M9OA 3GNFB 1VQPA 3VYGB 1Q81U 5GMKl 4PLIA 4M75B 4RTYA 5ECAA 4GLKA 3A98A 1M30A 2Y4YA 2DE0X 1R0CB 2BKZB 3CCVA 4HL4A 2OI3A 1X2QA 2KI7A 2DFUA 4F7UA 2KSSA 3BY7A 1K0SA 4JJBA 2CZ1B 1UJ0A 2KROA 4A4EA 2ZCFB 4JJNK 1Y0MA 4DEYA 5FGKB 2KQWA 4XTZA 3HRTA 2E64A 3QHRB 2VB6A 4F04B 2NUTA 3RESA 4NC6A 2PUKB 1MMDA 4E7ZA 4OMQA 4J83A 1D09B 2AKLA 2F69A 3RIRA 3CCRA 1M1GA 1TUDA 3S3OA 3OYAA 4EOOB 2JMAA 3OYDA 4QQ6A 3CMEQ 1YI2A 2L3PA 2L3RA 1PKSA 4FT4A 4IUQA 5IDPB 5DQVA 2A3LA 4M7DA 4B9XA 3A8GB 3VKIA 2L3QA 1HSQA 1AD5A 4PJMA 2AIRB 2JN0A 1G3SA 3DKMA 5GMKm 1VYWB 3QYGB 5KYYA 3CD6Q 2QAZA 1E7OA 4XTVA 1S72Q 3TSZA 2E70A 3LH5A 3JCMe 4AFQC 5LJ5d 3QHWB 1VYUA 1VQPT 3VKGA 3ASKA 1D1AA 1FKMA 3EJ1B 4NL3A 4HKEA 1V1CA 4GY5A 1QVFP 3CBMA 1C1AA 3G4SQ 2YLCA 1VIFA 1QVFS 5HY6A 4FSSA 3CCVT 4LDUA 1XNIA 3HRUA 1IGUA 2KNBB 4DBRA 2RJDA 3CCSA 1C9BA 5GAN6 1M90C 1QKWA 3OYNA 2V22B 5GAN8 4M7AG 4DOVA 2GTOA 1RABB 2CZ0B 1VYTA 1YJ9A 3M54A 1F1BB 1OZ3A 4BCND 3META 2PK2A 4RTZA 1GCQC 1G3YA 3EGDB 3PVQA 4Y28E 3S6WA 3SB2A 5IHKA 4CFUB 4ZNXA 4MZPA 1PKDB 2HKNA 3BDUA 1D0XA 1Q95G 2KMGA 3J81E 4HNTA 4F7SB 1B7TA 1OGUB 1H3HA 2K5IA 1N8RU 4OB2B 4PJOA 2EKHA 1VQ4A 2QFZA 3OYJA 2R57A 2GNCA 2R5MA 4C92E 3QPHA 5CKHA 3NMZC 1PRLC 1UUEA 2YRCA 3CCRT 2O4XA 5IAYA 2P4RA 2RMOA 1G3TA 3CCJQ 1H92A 1FX7A 3LGLA 4E7KA 1D3BB 3MJXA 2C0IA 5FW9A 5LJ5g 4C92D 4C0DC 2RNAA 5LJ3g 4EMKA 2J6FA 5GAOn 5GAOr 3L2WA 4C8QG 3RMQA 1ENWA 2I2LA 2M02A 1OIUB 1NPPA 1AZEA 1H4LD 2WJ9A 2KK4A 5GAOm 3I56A 2ESWA 5IHNA 4C0DB 4JJCA 4OB0B 1X6OA 4M75D 3HSBA 3JB9G 1XOVA 4R0KA 1NE8A 4YC3B 4M77G 1XTDA 2O31A 1M1KR 1EIFA 3NPFA 2VGMA 4X9DA 2JUFA 1JXOA 3QWLA 3TNIB 3CCST 2LQNA 3LW5E 1M2OA 1Y07A 3MP1A 2GFAA 4IIOA 2WACA 2CJMB 2DD4A 3E2UA 1YJ9T 2HMAA 1K9MU 2HZYA 3EHQA 4CFWB 2DO3A 2X4XA 5L2WB 3E19A 2YUNA 1IXDA 2WIPB 2O9SA 4IURA 3CCLT 2I40B 2F1LA 3CC4A 4J5YA 2RF0A 1P5EB 4L5GA 4QVZA 1VQ4T 1FVVB 1ZSZC 2EW3A 5CQXA 3UT1A 2K3XA 2A08A 3WVDB 4Z6YA 2V26A 3VS7A 4HT9A 1ZA1B 2LQ8A 4QQGA 3EFSA 5GAOp 4XU2A 2DL5A 4LDVA 1AWJA 2F5KA 4CC7A 2ROLA 1BIAA 1ZSZB 1GFCA 3CC2A 1WXBA 3FJPA 2RHZA 2DLPA 2DTHA 5EC7A 4RTXA 2XD0A 2E65A 2JTEA 5KE3A 2DIGA 2KRMA 2F5TX 2M51A 4DEXA 1YIJQ 1VQ7T 2NWMA 1BI2A 3I56T 2A7YA 2VVKA 1BU2A 2WXVB 2MYSA 3HFNA 2L2PA 3I9QA 1KQ1A 3LX7A 2AKKA 4MMKA 3TNWB 3VS5A 5KCOA 1PCXA 4F6WB 1VQ6A 1WXUA 4BI4A 2WPAB 2ENMA 2KMTA 8AT1B 5GAOq 3PMTA 3BW1A 1JSTB 2VGNA 4R56A 3X24B 1ZUYA 5DM7R 4LUEA 2DM1A 5J39A 2EQUA 5KYNA 4ZGEB 3GOXA 2DXBA 4CFUD 1FXXA 2RQRA 3DB3A 4NOYA 1WYXA 1Q7YC 3CC4T 3QZ5B 1NLOC 4PFPA 2FPDA 4XTWA 2LW4A 3LWIA 5CIUA 1GUXB 5LMKB 5FU6C 5A2QE 3BHUB 3C94A 2FB7A 2RQWA 3HHTB 2D1XA 1QP3A 2J06A 1VQLQ
chains in the Genus database with same CATH topology
2V8IA 2XDPA 5FU7C 5J26A 2LX9A 2P0QA 4HCBA 5EG2A 1K8AC 4M75A 4XAXB 1Q82C 4QQDA 1D3BA 2DD4B 2JOYA 5FU6B 5LJ5j 2XKOC 4AKIA 2MI6A 3CC7T 3QJYA 1WGSA 4BB7A 1YBYA 4RCBA 5LJ5f 1N8RC 1HXDA 4E7IA 3OYBA 2EJGA 3HBLA 3BG5A 1PSFA 2E5QA 3LYIA 3DL1A 4RG2A 5GAN3 2WSCE 3L2UA 4CRIA 4XK8E 3DLLA 2ZPEB 5C0MA 4JRPA 3OY9A 5FRMA 1PSEA 4M7AF 2OTLA 3PMIA 1QLBA 1N27A 5FU7B 3MEVA 3TW7A 3FB9A 3PT9A 2E1HA 4J7IA 5KE2A 3L42A 1AHJB 2D6FA 5CKEA 4PKCC 4M7DE 4M7DF 4ZGJB 4MZTA 3GLXA 1YJWA 1W2BS 5GANj 2MF2A 2QQBA 1M90U 4C92G 4JX6A 2EQKA 2VC8A 1UGPB 4OGEA 3JCMd 5GAMg 5GANf 3X28B 3TCJA 3MEWA 1N6AA 4M7AD 1VQ5A 4V2SA 4LDXA 3X25B 2RHXA 2CZ7B 1KD1C 4MDXA 4MDWA 2DEQA 3PGGA 1VQLT 1XQHA 2XI9A 4M78E 4O6JA 1LNXA 4J8OA 4M78F 3RKYA 2CKKA 2RA2A 3QJ6A 5CCAA 1YJNT 1W2BA 4M7DD 3QYHB 3EAEA 3MP8A 5FLXE 1WQWA 2XICA 2WSEE 1VQKT 4FL6A 3OYCA 3X26B 3PFSA 2BS3A 2DAQA 3A8LB 1O75A 2ZGWA 3E9GA 4M75G 4P5NA 1N9RA 2KAFA 5DY9A 4OVAA 3FC3A 1QVGS 3QXEB 3GF5A 3V7CA 1U8RA 2DJZA 4PL6A 3RKXA 4XU0A 1X01A 2K57A 3BG3A 1V29B 3CC7A 3DB4A 3FIFA 3CCMT 3HPWA 2ZZDB 2DTIA 2QQSA 4C8QE 3S3MA 4HCZA 2RI5A 3HO8A 4C8QF 1IZ6A 1G5VA 4RMOA 2RO0A 5CO7A 4WF2A 1VQOT 2GF7A 3C12A 4ZGDB 5FRNA 3JCMP 1MHNA 4M78A 2QQ9A 1QVGA 3M56A 4LDWA 2DD5A 4JUVA 2LQKA 3CCEA 5CQYA 2FL7A 1Q7YU 1NJIU 1JB0E 2LRQA 3OQ5A 3O8VA 1U1SA 2EQMA 3I55T 3ZFJA 4IKFA 2QXFA 2BUDA 4ELJA 2LCCA 2X4JA 5KH6A 3OYMA 4DQ2A 1Q86C 1K73U 3BG9A 3P8HA 2RM4A 5LJ3e 3ME9A 1K9MC 3AHUA 4JS4A 4C5IA 3OYFA 3GNGA 3NTHA 2EIFA 3GP8A 1YITA 2PUOB 4PJOF 1KQ2A 5IN1A 3ZEHA 3A5ZB 2O4XB 4C92C 1I8FA 1VQNA 4C8QA 2XHCA 2E12A 5LL6S 2LCLA 4AI6A 2DXBB 1BKBA 2E41A 2MWOA 3OS1A 5KCHA 4BE2A 3OYKA 4N0AC 3EFRA 3PTAA 4IUVA 4OF1A 4C0GA 2MWPA 2EWNA 3JB9D 2VXFA 3DLMA 2VYTA 4LD6A 4ZN3A 2KY9A 5A0LA 4PJOD 1GXIE 4EMGA 1K8AU 1W4SA 5GAN4 1Q82U 1VQKA 2V8KA 4M77D 2OTLT 5A0GA 5GAMd 5GANh 2RHIA 2V8JA 3NTKA 4C92B 2BKDN 4NL2A 1WJRA 1IREB 4KBMB 5A0DA 3HZJA 1Y7XA 4M75C 3MEUA 4FT2A 4JRIA 1YJWT 2HAXA 1Y96B 2KVQG 2YHTA 1RI0A 3M4YA 2XG8D 4ELYC 2OTJA 3HRSA 3V8KA 4F7UE 3E9FA 4F7UF 4RKUE 4M78G 4LOCA 1VQOA 3KUFA 4HA8A 3OBYA 3RKWA 5M9OA 2CGHA 3GNFB 1VQ5T 2DK3A 1VQPA 3VYGB 1R8OB 3C4SA 3M55A 5HK3A 5CR2A 2DXCA 3E1SA 1OZ2A 1Q81U 5GMKl 2GQVA 5CVIA 4PLIA 4M75B 1YI2T 3JCMQ 3CPWS 3INZA 2P0KA 4JLIA 4GLKA 4X34A 4E7JA 1O9SA 2EQJA 2LTOA 3RERA 5I2SA 5GMKe 5FROA 1H641 4FIBA 2Y4YA 4RG8A 3JCMb 3MO8A 3CCVA 4HL4A 3Q1JA 3PIOA 3M57A 4MFDA 3CMEA 3OYIA 4KUDK 1U1TA 3GIBA 2M16A 3QIIA 2WSFE 3L2QA 5GAMe 3G7ZA 4F7UA 1QW1A 3KHIA 2KSSA 4BI3A 5DLQE 3BY7A 2VV5A 5LJ3j 3CPWA 3CXCS 2Y90A 3HL8A 2CZ1B 1B34A 2XK0A 5LJ3f 4A4EA 2ZCFB 4OP0A 4CI0C 3WXMB 3V8JA 4JJNK 2D9TA 3VV0A 4M7AE 3CD6A 2KQWA 4JRKA 4XTZA 3V8LA 2LNVA 1S72A 2EJFA 3CCET 3HRTA 1Y71A 2E64A 3ZBDA 1OI1A 3RESA 1WJQA 4BI8B 4C0ZA 3CXCA 4NC6A 4OMFB 1SSFA 2PUKB 3G6ET 4BE0A 1KG1A 3OW2S 3A8MB 5D6YA 1N9SA 4J83A 3X20B 3LH0A 1YITT 2MAMA 4ZTJA 1WQ7A 4ZN1A 2RB6A 2L5QA 2QA4A 1M1KC 1VQNT 3L1AA 4A4HA 3RMSA 2F69A 3RIRA 3G4SA 2AHJB 2RH2A 1M1GA 4M78C 3CCRA 1H3ZA 3L2RA 3BDLA 3S3OA 3QSUA 2B8AA 3OYAA 2XU8A 3OMGA 4J6WA 3H4CA 4XTUA 3OYDA 2E6NA 1OYXA 2QQ8A 4QQ6A 1YI2A 2LT4A 2L3RA 4M7AA 4BDZA 2NLUA 3TEEA 3OW2A 3M59A 4FT4A 4IUQA 4E47A 1BI0A 3QZ9B 2M1HA 3UDCA 1UGRB 2A3LA 2PU9B 3H6ZA 1M8VA 2QTXA 3QBYA 4M7DA 4B9XA 3A8GB 3VKIA 2BS2A 2GCXA 3HKSA 2EFIA 4M78B 5J3BA 2JN0A 1G3SA 3DKMA 5GMKm 2X4WA 5GMKj 3CMAA 3QYGB 1I4K1 1KHIA 2DD5B 4J7FA 2OTJT 2EAYA 4XTVA 1G3WA 4C5HA 2L8DA 1LOJA 1M5Q1 4FSXA 3SD4A 4EPCA 1BIBA 2E70A 1KC8U 3C95A 4L59A 2QF7A 2PVGB 4JX5A 2ZPIB 3JCMe 5GAMj 5LJ5d 3QYEA 3OS2A 2DXUA 1VQMA 3M53A 3WVEB 1VQPT 4A53A 3VKGA 4LDYA 4A4FA 2JTFA 1BYMA 1E7PA 2VUBA 3ASKA 1FKMA 2CZ6B 4ZTFA 4IUUA 4DOWA 4MMLA 4NS5A 4NL3A 4HKEA 4GY5A 2BIVA 1M4ZA 2JZ2A 3CBMA 2ZPGB 1WNLA 2YLCA 4XTYA 1VIFA 3OSVA 4KUIA 2H3JA 4ME7A 5HY6A 2IVWA 3G6EA 3GPLA 2K4YA 4RCCA 4BACA 5I21A 3CPFA 4TVRA 4PJOE 5GAN5 5LJ5h 3CCJA 3CEYA 3CCVT 4LDUA 5LJ3h 3CMET 2XIDA 4M77E 1XNIA 3HRUA 3V7RA 4M77F 2KR6A 2RJDA 3CCSA 5CAIA 2DKGA 1TH7A 3F70A 2QQAA 5GAN6 1UGSB 5GANd 1M90C 1VQ9A 3OYNA 5GAN8 4M7AG 4DOVA 2CZ0B 1YJ9A 3BFMA 3M54A 4N4IA 5I2MA 1OZ3A 1QVFA 3VKHA 3META 3L2ZA 1G3YA 4BY6C 4Y28E 3S6WA 3SB2A 2FVUA 4M7DG 4MZPA 3CD6T 1JBMA 2DPPB 3BDUA 4JDSA 2KMGA 3J81E 3S3NA 1S72T 4HNTA 5AYFA 3SDZA 3SWNA 4XTXA 5CKDA 3G71A 5EJCA 2HQXA 3CBOA 3JRZA 2K5IA 2QEXA 1N8RU 4OB2B 2QQRA 4XU3A 1DJ7B 4PJOA 2RD1A 3VJPA 2DXCB 4BBRM 2O01E 1VQ4A 2QFZA 3OA6A 4M77A 2ZPHB 3OYJA 2R57A 2R5MA 4C92E 3OMCA 5GAN2 3QPHA 5IT9E 4C92F 4QVCA 5CKHA 4D6WA 3FEOA 3UWNA 4BY6B 4ELZC 2QA4T 3JCMJ 4Q5WA 3G4ST 1HK9A 3CCRT 4M6VA 2O4XA 5IAYA 2OAUA 1G3TA 3RUXA 1FX7A 3LGLA 4E7KA 4A54A 1QP2A 2PQWA 1D3BB 3N5BB 2XDBA 2K5LA 2QDYB 4IUTA 1KHCA 3FDRA 5LJ5g 2QI2A 4C92D 4C0DC 1MGQA 4QVDA 5LJ3g 3JCMf 4EMKA 1B34B 2RHYA 5GMKh 5GAOn 5GAOr 1NJIC 3L2WA 4C8QG 1KD1U 4M75F 4JLGA 1P92A 3JB9J 1M9SA 3RMQA 4II1A 3QKJA 1K73C 3LLRA 3NTIA 2I2LA 3CMAT 1NPPA 2KDSA 2LVMA 2K2VA 4HT8A 4MZMA 4JX4A 2RK1A 4UC4A 3R6OA 5CKBA 4EDUA 2WJ9A 1FWZA 4YTLA 2KK4A 2DTOA 5GAOm 3I56A 4M7AC 4C0DB 2DIQA 2DVEA 1VQMT 2X35A 2QDJA 4OB0B 4KT0E 1X6OA 4M75D 3HSBA 5GANg 2LC4A 4L6V5 5CKFA 2EYQA 3LGFA 3JB9G 1XOVA 1NE8A 3MCAB 4J6YA 4M7DC 4AKHA 1RL2A 4PJOG 3M4GA 3KBGA 4C0FA 3CCUA 3SFMA 4M77G 1XTDA 4C5EA 4C5GA 1EIFA 2RJCA 3CC2T 4LD9K 1UGQB 4EMHA 2D0QB 2E6ZA 3MP6A 3KXTA 2VGMA 4X9DA 3CCJT 1WJSA 2JUFA 4M7AB 1I5LA 3OSSC 3QWLA 3JCMc 4A4GA 1UEBA 3CCST 3M58A 3LW5E 2GFUA 1Y07A 3ER0A 2GFAA 3MP1A 1VQ9T 1KQSS 1BI3A 4ATOA 2WACA 1VIEA 2DD4A 4M7DB 2EKOA 4E7HA 3J80E 1Q86U 1YJ9T 5L8RE 1K9MU 2ZPFB 4HCCA 1QVFS 2DO3A 2FYKA 3QYBA 3CCQA 1VUBA 3QHSA 5C6SA 2X4XA 3JB9I 3E19A 4E7LA 3OYLA 4JS5A 4BDYA 1YIJA 1Q81C 1VQ8A 4IURA 3CCLT 2R5AA 4HLQA 2VXEA 4F7UG 1KQSA 3CC4A 4J5YA 4BD3A 3G71T 2QEXT 2FHDA 4OB3B 4L5GA 4C8QC 1VQ6T 4QVZA 3FRNA 2DXTA 1VQ4T 2JTMA 5CQXA 2G77A 1UB4A 3QO3A 3UT1A 1YHQA 2PVDB 2K3YA 2HD0A 5D6WA 2JVVA 2K3XA 3J7AF 2YRVA 3WVDB 4Z6YA 3OBWA 4O5VA 4HNVA 3V7SA 5LJ3d 2L89A 2P4TA 3UPUA 3JCMh 4HT9A 2LQ8A 5GAMf 4QQGA 2RI2A 3PIPA 3EFSA 2DZ9A 5GAN7 5GAOp 4XU2A 2XDDA 3QDRB 1NZ9A 3SWNC 4C8QB 4LDVA 2F5KA 4MIMA 4QSHA 3QG1A 2G3RA 4PJOC 1JJ2S 4OB1B 3CBPA 1BIAA 2RK2A 3VU3C 3CC2A 5GAOl 4M77C 2M9UA 4M78D 4HNUA 2X4YA 2K5FA 3FJPA 1I81A 2RHZA 5HKCA 3MHXA 2DTHA 2XD0A 1M1FA 2E65A 5KE3A 2DIGA 3VUZA 1ZBXA 2CS7A 2F5TX 3URGA 4AKGA 3P8BB 1VQ7T 3HB9A 1BI2A 3SWNB 4OGCA 1JJ2A 4PLLA 1BI1A 2ZZDA 1WPYA 2A7YA 2RHUA 4XQ3A 3HP9A 5CK9A 2ZPBB 3I56T 4PJOB 4FM4B 3HFNA 4M77B 4VUBA 2DZCA 4C8QD 5LJ5e 1KQ1A 4EMKC 3LX7A 3JB9F 2MMPA 4MMKA 5KCOA 3L2VA 3CCLA 3CCUT 3A8OB 3HFOA 2C06A 2LT1A 2M0OA 2IG0A 3H8ZA 4FU6A 1VQ6A 3LWHA 4BI4A 3PNWC 3VYHB 4JRQA 2KMTA 4DA4A 1QVPA 2JNGA 1ZQ1A 4Z02A 4Y91A 2HQEA 3BW1A 3PMTA 4KULA 2PVOB 4X9CA 5GAOq 1VQLA 2VGNA 4QW2A 3JCMg 4R56A 3OS5A 3X24B 4N4GA 1YJNA 4B9WA 3MEAA 5DM7R 2HBPA 2Y4XA 1NPRA 4EMKB 5J39A 2EQUA 3JCMX 4ZGEB 5GANe 2DXBA 3GOXA 3TU4K 3P8DA 1KC8C 1FXXA 2HNIA 3DB3A 4NOYA 2RJFA 3M9QA 1X75C 1YCYA 4F7UB 3TREA 2RI3A 2R58A 3CCQT 2E10A 1LJOA 3JSCA 4A4KA 3TW6A 4MFEA 1M1KU 1ZHIA 1YIJT 5HK0A 1VQ8T 2CYZB 3OYYA 4M75E 3OYEA 3OYGA 4XU1A 3CCMA 4BE1A 1Q7YC 2P0PA 4BUGA 3QZ5B 3FLGA 3CC4T 4IUPA 4BBSM 3NFCA 3QUIA 4N4HA 4C92A 3JCMW 4R55A 2EJ9A 3T9NA 5GAMh 3JB9H 4XTWA 4J6XA 3JAME 2RJEA 5CIUA 3LWIA 1VQ7A 5A2QE 5FU6C 1YHQT 4N0AA 3A8HB 1Y96A 5DLOA 3OS0A 3C94A 2YLBA 3OYHA 3VUBA 4PNOA 5GMKi 1JRIA 2LDMA 2FB7A 3OB9A 5D6XA 3HHTB 3I55A 2BS4A 3M5AA 1QP3A 3JCMV 3VYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IRE B;  2DD4 B;  4OB3 B;  4RKU E;  1UGS B;  2PVD B;  1PSF A;  3VYG B;  2CZ0 B;  2WSC E;  2DXC A;  4XK8 E;  3WVD B;  2ZPE B;  1PSE A;  4Y28 E;  2DPP B;  1AHJ B;  4OB1 B;  4ZGJ B;  4OB2 B;  1DJ7 B;  2WSF E;  1UGP B;  2DXC B;  2O01 E;  3X28 B;  2ZPH B;  3X25 B;  2CZ7 B;  2CZ1 B;  2ZCF B;  2ZZD A;  3QYH B;  2ZPB B;  4FM4 B;  2WSE E;  1QP2 A;  2QDY B;  3X26 B;  3A8L B;  3QXE B;  2PUK B;  3A8O B;  3A8M B;  1V29 B;  3X20 B;  2ZZD B;  3VYH B;  2AHJ B;  2PVO B;  4ZGD B;  3X24 B;  2DD5 A;  4OB0 B;  4KT0 E;  4ZGE B;  2DXB A;  4L6V 5;  1JB0 E;  3QZ9 B;  1UGR B;  2PU9 B;  3A8G B;  2CYZ B;  2PUO B;  1UGQ B;  2D0Q B;  3QZ5 B;  3QYG B;  2DD5 B;  2DXB B;  3LW5 E;  2PVG B;  2ZPI B;  3A8H B;  2DD4 A;  3WVE B;  1GXI E;  5L8R E;  3HHT B;  2CZ6 B;  2ZPF B;  1QP3 A;  3VYG A;  2ZPG B; 
#chains in the Genus database with same CATH topology
 2XDP A;  2LX9 A;  1YJN Q;  1X6G A;  1K8A C;  4XAX B;  1Q82 C;  5FU6 B;  2O2O A;  3QJY A;  1ZSG A;  2ABL A;  3QWX X;  3JV3 A;  2KRS A;  1MND A;  1HXD A;  2FRW A;  2HCK A;  3BG5 A;  2E5Q A;  3L2U A;  3DLL A;  1OX9 A;  2UZB B;  5HVY B;  3VS6 A;  3OY9 A;  1PSE A;  2OTJ Q;  2OTL A;  3PMI A;  1QLB A;  3MEV A;  2LCS A;  3FB9 A;  5FWC A;  5KE2 A;  1AHJ B;  1M90 U;  4C92 G;  3JCM d;  1V76 A;  1H1S B;  3X28 B;  2WEV B;  4V2S A;  3UF4 A;  4BCH B;  1LNX A;  3NHN A;  4M78 F;  5CCA A;  1H8K A;  1X69 A;  1BCO A;  5FLX E;  4ROC A;  1NLP C;  1RLP C;  4M75 G;  2W99 A;  2WMB B;  3A1P A;  1OPL A;  4KGX B;  2DJZ A;  1X01 A;  2K57 A;  3CC7 A;  3DB4 A;  2F2C A;  3HPW A;  2ZZD B;  3S3M A;  3HO8 A;  2X51 A;  1G5V A;  1OPK A;  4ZGD B;  2CP0 A;  5FRN A;  3JCM P;  1HYO A;  3M56 A;  2DD5 A;  3CCE A;  2FL7 A;  2CP3 A;  3DJB A;  4J9C A;  3OQ5 A;  2LRQ A;  4J9H A;  1U1S A;  1VQ5 Q;  4IKF A;  5I5Z B;  4OR5 B;  2RM4 A;  5LJ3 e;  3ME9 A;  1H25 B;  4C5I A;  3NTH A;  3OYF A;  4M4Z A;  5AT1 B;  5IN1 A;  3ZEH A;  1I8F A;  1OQK A;  4C8Q A;  5LL6 S;  4AI6 A;  4BE2 A;  3M0U A;  5FWB A;  4N0A C;  3EFR A;  2QGF B;  2MOX A;  4OF1 A;  1TS9 A;  2EWN A;  3DLM A;  2VYT A;  1URC B;  4LD6 A;  2KY9 A;  6AT1 B;  5GAN 4;  1VQK A;  5DQW A;  4X1V A;  2OTL T;  3I5R A;  5A0G A;  2VAS A;  5GAM d;  2V8J A;  5EFQ B;  1IGQ A;  5A0D A;  1U3O A;  2DX1 A;  4HXJ A;  5KYW B;  1NYG A;  4JRI A;  1Y96 B;  2KVQ G;  3VRZ A;  1RI0 A;  4ELY C;  4EOI B;  3E9F A;  4FW1 A;  1D1C A;  4F7U F;  4RKU E;  2HKQ B;  3EOC B;  1VQO A;  4QKU A;  1E9H B;  2W0Z A;  1AD6 A;  2B9R A;  3G6E Q;  5CR2 A;  2BZX A;  2DXC A;  1OZ2 A;  3DTO A;  4J9G A;  4EOS B;  4OML A;  3INZ A;  2P0K A;  4E7J A;  3RER A;  2DMO A;  5GMK e;  4KRD B;  5FRO A;  4FIB A;  3JCM b;  4IMY B;  4QT7 A;  3Q1J A;  3PIO A;  1UDL A;  3CME A;  3GIB A;  1U1T A;  3EG3 A;  3QII A;  3G7Z A;  3PO3 S;  2LP5 A;  2GGR A;  1QW1 A;  3KHI A;  5LJ3 j;  3CPW A;  1F5Q B;  2Y90 A;  3HL8 A;  3H9N A;  1QMZ B;  3V8J A;  3VS1 A;  5I11 A;  9ATC B;  4M7A E;  3CD6 A;  3V8L A;  3VS3 A;  1JO8 A;  1SHG A;  1S72 A;  3CCE T;  2QG9 B;  1Y71 A;  1WHK A;  4A63 B;  1O9K A;  3UAT A;  4J9F A;  3LH0 A;  2MAM A;  1WQ7 A;  4ZN1 A;  2L5Q A;  1M1K C;  2CUB A;  3L1A A;  1KQS P;  3G4S A;  4M78 C;  3EH2 A;  3VS2 A;  1UTI A;  2JW4 A;  2XU8 A;  4BY1 X;  2QQ8 A;  2KYM A;  1ACM B;  3C0C A;  2MCN A;  3TEE A;  1QQJ A;  3M59 A;  1BI0 A;  3QZ9 B;  3UDC A;  1UGR B;  2RN8 A;  2QTX A;  4KRC B;  1T0J A;  2YUO A;  2BS2 A;  4M78 B;  1TG0 A;  5GMK j;  2EYZ A;  2F2X A;  3EFO B;  4J7F A;  2EAY A;  1G3W A;  4PK4 A;  1J3T A;  3C95 A;  3QWY A;  3OS2 A;  3M53 A;  3REA B;  3WVE B;  1KFZ A;  1BYM A;  1WHH A;  1Q86 R;  2KYB A;  4NS5 A;  5HBE B;  1M4Z A;  2BIV A;  4BCP B;  3TVT A;  2IVW A;  3VS4 A;  1M3B A;  4TVR A;  3CCJ A;  3CME T;  2XID A;  4M77 E;  3V7R A;  2KR6 A;  5CAI A;  1IB8 A;  2QQA A;  2DBK A;  1NYF A;  5IXF A;  2PHG A;  4J9I A;  2X9H A;  1GFD A;  3BFM A;  3VKH A;  5HBH B;  2CP5 A;  2FVU A;  3CMA Q;  4E7S A;  3BLQ B;  3CD6 T;  1JBM A;  2W96 A;  4JDS A;  1MV3 A;  1RAA B;  1YHQ Q;  1S72 T;  5AYF A;  3SWN A;  3CBO A;  3JRZ A;  1W70 A;  2QQR A;  2RD1 A;  2O01 E;  1UNH D;  5GAN 2;  4D6W A;  2D8H A;  3FEO A;  1AWX A;  4F70 B;  3G4S T;  1HK9 A;  1ZP2 A;  2NUZ A;  4M6V A;  1KIK A;  1B07 A;  2OAU A;  1OOT A;  1QP2 A;  2XDB A;  3RBB B;  2K5L A;  2QDY B;  1MGQ A;  1MMN A;  3EHR A;  5IHY A;  2EUF A;  4II1 A;  3QKJ A;  3U23 A;  1WHM A;  2C5V B;  1A0N B;  4MZM A;  4UC4 A;  3R6O A;  4EDU A;  2NUT B;  3G71 Q;  4WCI A;  1Y57 A;  2X35 A;  1G8X A;  2LJ1 A;  4L6V 5;  1OIY B;  2EPD A;  4RTV A;  4J6Y A;  4M7D C;  1RUW A;  2RJC A;  2E6Z A;  3MP6 A;  2EBP A;  3CCJ T;  1WJS A;  2AZV A;  1WHG A;  1IRX A;  2W10 A;  4ATO A;  1BI3 A;  2BE7 D;  4M7D B;  2YRD A;  5KYY B;  3QYB A;  3QHS A;  3OYL A;  1YIJ A;  2J6O A;  1PHT A;  4PJL A;  3EH1 A;  1KQS A;  1TU0 B;  2DXT A;  1LVK A;  2G77 A;  1KSW A;  2H3E B;  1VOM A;  3VRY A;  2C5N B;  1GBR A;  3OBW A;  3V7S A;  2UZL B;  5LJ3 d;  2P4T A;  3JCM h;  2VWF A;  3EG9 A;  1YWO A;  4LN2 A;  4PJN A;  1I1J A;  4PJO C;  2E3I A;  2FZK B;  5GAO l;  4KH1 B;  4M78 D;  5IXB A;  5HKC A;  2J6K A;  1JOW A;  3CCQ Q;  1ZBX A;  2CS7 A;  3URG A;  4AKG A;  3P8B B;  3KFV A;  1G3N C;  4OGC A;  4PLL A;  1WPY A;  5CK9 A;  3HP9 A;  4PJO B;  2DER A;  2BZ8 A;  2DRM A;  4GLM A;  1GH6 B;  4EMK C;  2MMP A;  3L2V A;  3CCL A;  1S1N A;  2CUD A;  1OKW B;  2LT1 A;  2IG0 A;  2QK0 A;  4Y92 A;  2AT1 B;  2FRY A;  2YXY A;  1X27 A;  1MMA A;  1QVP A;  1JEG A;  1LCK A;  1JKW A;  4Y91 A;  1VQL A;  2PVO B;  1WIE A;  3OS5 A;  1YJN A;  4B9W A;  3MEA A;  3EG1 A;  4EMK B;  2KRN A;  1JQQ A;  2LMJ A;  2Z0W A;  5GAN e;  3TU4 K;  1NJI R;  2RJF A;  1X75 C;  2E10 A;  3JSC A;  1WLP B;  1M1K U;  4MFE A;  1ZHI A;  2CRE A;  1YIJ T;  4BXX X;  2CYZ B;  1VOL A;  4M75 E;  3OYG A;  4IUP A;  3BLH B;  3QUI A;  1OI9 B;  3JCM W;  2FZC B;  2EJ9 A;  3T9N A;  5GAM h;  4LXC A;  1VQ7 A;  5DLO A;  3OS0 A;  2YLB A;  3OYH A;  3VUB A;  2LDM A;  1GCQ A;  1N5Z A;  2MIO A;  2BS4 A;  3LWH A;  2V8I A;  2P0Q A;  1OU8 A;  1QLY A;  5EG2 A;  1H24 B;  1D3B A;  2DD4 B;  4KRT A;  4AFZ C;  3CXC P;  4BCF B;  4PFZ A;  5LJ5 f;  4RTU A;  2EJG A;  1NEG A;  2SEM A;  4RG2 A;  2DNU A;  2WSC E;  4XK8 E;  3D7S B;  5FRM A;  3CCM Q;  2PTK A;  4M7A F;  1N27 A;  3PVL A;  2E1H A;  4J7I A;  3L42 A;  1BK2 A;  2COZ A;  2C0O A;  4PKC C;  4M7D E;  3OW2 P;  2KEA A;  1OEB A;  4MZT A;  5GAN j;  2MF2 A;  2QQB A;  4JX6 A;  3HTR A;  3DOG B;  1UGP B;  1TUG B;  1VA7 A;  1WHJ A;  2UZE B;  2HDA A;  2D8J A;  4AMC A;  2DVJ A;  1VQ5 A;  2RHX A;  2LJ0 A;  4MDW A;  4YOS A;  1VQL T;  1NEB A;  1R77 A;  1YJN T;  2CKK A;  2RA2 A;  4M7D D;  3MP8 A;  1AWW A;  1UE9 A;  1ABQ A;  1WQW A;  3POM A;  1TTH B;  2BS3 A;  2H8H A;  3A8L B;  3E9G A;  5DY9 A;  1N9R A;  3QXE B;  3V7C A;  2IW9 B;  1X6B A;  4UN0 A;  1V29 B;  2DA9 A;  4WTO B;  1YNZ A;  2DTI A;  4C8Q F;  2RI5 A;  1IZ6 A;  4RMO A;  5CO7 A;  2QQ9 A;  5KYX A;  1YFN A;  2IN3 A;  1ABO A;  2KXD A;  2LQK A;  2OAW A;  2EQM A;  2BUD A;  3OYM A;  1YWP A;  1Q86 C;  4DQ2 A;  3BG9 A;  2EYX A;  2JJ9 A;  1M3C A;  3JB9 F;  2AZS A;  1QCF A;  4NST B;  2EIF A;  3TN8 B;  1XJW B;  1K9A A;  1YI2 Q;  3A5Z B;  1BCM A;  4AT1 B;  2E12 A;  2DXB B;  3OS1 A;  5KCH A;  4IUV A;  1SPK A;  1KC8 R;  1X43 A;  4C0G A;  2MWP A;  5A0L A;  4PJO D;  1KK7 A;  4EMG A;  4Y72 B;  1W4S A;  1AIS B;  5HBJ B;  3TNH B;  1SHF A;  2EGA A;  2V8K A;  4JZ4 A;  4II5 B;  1RAH B;  4NL2 A;  1IRE B;  4ESR A;  1Y7X A;  4FT2 A;  4D8D A;  3M4Y A;  2L0A A;  3HRS A;  2M0Y A;  4M78 G;  5HCK A;  1VIN A;  3KUF A;  1VQ5 T;  3OBY A;  1R8O B;  1YCS B;  1H1Q B;  2DBM A;  3CPW P;  1YIT Q;  5CVI A;  4F7N B;  4BY7 X;  3CPW S;  2PMI B;  2K79 A;  1VQN Q;  4JLI A;  4X34 A;  2LTO A;  3H0I A;  2HL3 A;  1H64 1;  4RG8 A;  4KUD K;  1TSF A;  5IDN B;  2M16 A;  3MIA B;  1B34 A;  2E4H A;  4EOM B;  3VV0 A;  1WHL A;  4JRK A;  2DL4 A;  1M27 C;  2EJF A;  3R6N A;  1WI7 A;  5ICP B;  1OI1 A;  4BI8 B;  1WJQ A;  4C0Z A;  3CXC A;  4OMF B;  1SSF A;  2V1Q A;  3G6E T;  2O88 A;  2FPF A;  2HEQ A;  1KG1 A;  3TSW A;  1KD1 R;  1JSU B;  3A8M B;  2COY A;  1N9S A;  3X20 B;  3BE3 A;  4ZTJ A;  2RB6 A;  4E6R A;  2F2V A;  4A4H A;  1QWE A;  3RMS A;  1RAF B;  2AHJ B;  2RH2 A;  2C4G B;  3BLR B;  1H3Z A;  3BDL A;  3QSU A;  2B8A A;  3OMG A;  4J6W A;  3H4C A;  4XTU A;  3MKD A;  4M7A A;  2LJ3 A;  3OW2 A;  4E47 A;  2DRK A;  2M1H A;  3THK A;  2PU9 B;  3H6Z A;  4LE9 A;  2CSI A;  2EFI A;  5J3B A;  3CMA A;  2XMF A;  1I4K 1;  2DD5 B;  1GY3 B;  1RAD B;  2C0T A;  1IO6 A;  4C5H A;  1U5S A;  4BCG B;  1M5Q 1;  4EPC A;  4FSX A;  1BIB A;  2ZPI B;  3QYE A;  1PRM C;  1QCO A;  4A4F A;  4LDY A;  1E7P A;  2VUB A;  3EGX B;  4PFO A;  4ZTF A;  1JJ2 P;  2QA4 Q;  1WXT A;  3OSV A;  4KUI A;  5CYI B;  2EQI A;  4ME7 A;  2K4Y A;  2FG0 A;  4BCQ B;  5I21 A;  1AT1 B;  5GAN 5;  5LJ5 h;  4CC4 B;  5LJ3 h;  2I53 A;  1M2V A;  2DKG A;  1TH7 A;  4AFS C;  1OKV B;  5GAN d;  2E3H A;  2JS2 A;  4OMP A;  3L2Z A;  4BY6 C;  3DDP B;  1H1P B;  4M7D G;  3S3N A;  4EOL B;  4TTH A;  4XTX A;  3G71 A;  2HQX A;  4XU3 A;  1DJ7 B;  1VQM Q;  2WHB B;  3VS0 A;  2DXC B;  4BBR M;  4M77 A;  2KXC A;  4ROE A;  5IT9 E;  4C92 F;  4QVC A;  4ELZ C;  4BY6 B;  3JCM J;  1YN8 A;  4Q5W A;  2P84 A;  3CC2 Q;  4DBF A;  1G83 A;  4B6M A;  3RUX A;  1QKX A;  3F5X B;  1EFN A;  4KGV B;  2A37 A;  3N5B B;  1UGV A;  2VKN A;  4IUT A;  1KHC A;  3FDR A;  1TWB A;  1VQ9 Q;  4QVD A;  2FO0 A;  3JCM f;  5GMK h;  1NJI C;  4M75 F;  4JLG A;  1M9S A;  2JT4 A;  1M3A A;  3LLR A;  4F7L B;  3CMA T;  4OMN A;  2KDS A;  4HT8 A;  4JX4 A;  2RK1 A;  5CKB A;  3BHT B;  4YTL A;  2DTO A;  1O9K B;  1UNL D;  3UA6 A;  3G1J A;  2QEX Q;  2DIQ A;  3M0P A;  1VQ6 Q;  2QDJ A;  4HVW A;  5GAN g;  2LC4 A;  5CKF A;  2JM8 A;  2L3S A;  3I35 A;  3MCA B;  4PJO G;  1D1B A;  3M4G A;  3KBG A;  4D8K A;  3SFM A;  4C5G A;  1TD6 A;  4EMH A;  3DDQ B;  2D0Q B;  4HVV A;  3JCM c;  2HQH A;  4EOR B;  3M58 A;  2GFU A;  3ER0 A;  1KQS S;  1VIE A;  1C6V X;  1MMG A;  2EKO A;  2KE9 A;  4DBH A;  3CQT A;  1Q86 U;  5KYU A;  1ZUU A;  5GJW B;  2ZPF B;  2QGG A;  3CCQ A;  2FYK A;  1W98 B;  1E6H A;  1W2B P;  5C6S A;  4KH0 B;  1UFF A;  2R5A A;  2VXE A;  4F7J B;  3G71 T;  4OB3 B;  3M03 A;  4EON B;  4BCJ B;  1FIN B;  2K3Y A;  2HD0 A;  2JVV A;  2CSQ A;  1SKU B;  3CCU Q;  2C5O B;  3UPU A;  4HNV A;  2JXB A;  5GAM f;  3PIP A;  2KT1 A;  1QVG P;  3LQ5 B;  2DZ9 A;  5GAN 7;  3QDR B;  1NZ9 A;  3O5Z A;  3SWN C;  4QSH A;  2G3R A;  4OB1 B;  2QAS A;  2X4Y A;  2K5F A;  4BCM B;  2ED1 A;  3PE0 A;  4YOO A;  1M1F A;  5HQ0 B;  2JM9 A;  5HNB B;  4CXA B;  1VQ8 Q;  3SWN B;  1JJ2 A;  1BI1 A;  4F6S B;  4XQ3 A;  2ZPB B;  1OL2 B;  7AT1 B;  4VUB A;  4EOQ B;  4C8Q D;  2UZD B;  3A8O B;  4BCQ D;  3HFO A;  3M0R A;  5IHI A;  2M0O A;  1OX8 A;  1D0Y A;  1FMW A;  3H8Z A;  2BTT A;  2K3B A;  2EYW A;  2BZY A;  4DA4 A;  2V1R A;  2F2W A;  3MI9 B;  4JJD A;  2K2M A;  4Z02 A;  4J9D A;  2RPN A;  2KBT A;  4N4G A;  1AOJ A;  1VYV A;  2NUP A;  2HBP A;  3JCM X;  1K4U S;  3CC7 Q;  4KGZ B;  1KC8 C;  3P8D A;  1Q7Y R;  2IIM A;  3M9Q A;  1YCY A;  4F7U B;  3TRE A;  2RI3 A;  4LNP A;  3CCQ T;  1FMK A;  1K76 A;  1K73 R;  3TW6 A;  4DBQ A;  3OYE A;  3CCM A;  4XU1 A;  4BE1 A;  2P0P A;  3FLG A;  3IQL A;  4EC9 B;  4BBS M;  3NFC A;  4N4H A;  4C92 A;  4EOJ B;  2CH4 A;  3JB9 H;  2BPM B;  4J6X A;  3JAM E;  2RJE A;  4CRL B;  1EZZ B;  1X2K A;  1CSK A;  5ACB A;  2IVX A;  2X1N B;  1D3U B;  5GMK i;  1JRI A;  4PJJ A;  3M0Q A;  4ORZ A;  3OB9 A;  5D6X A;  3M5A A;  1K8A R;  1Q82 R;  4GBQ A;  3VYG A;  5FU7 C;  2HSE B;  5J26 A;  1ARK A;  1K1Z A;  2ATC B;  4M75 A;  2RQU A;  4QQD A;  2DIL A;  2XKO C;  4AKI A;  2MI6 A;  1VQK Q;  1WGS A;  4BB7 A;  1YBY A;  1RAC B;  4RCB A;  4E7I A;  4BCI B;  3OYB A;  3LYI A;  1PSF A;  5GAN 3;  3DL1 A;  2ZPE B;  4JRP A;  2YUQ A;  1Q81 R;  5FU7 B;  3PT9 A;  1VQO Q;  1AEY A;  4F16 A;  4ZGJ B;  2G9X B;  1PNJ A;  3GLX A;  2EQK A;  4OGE A;  3TCJ A;  2DL7 A;  1N6A A;  3I55 Q;  2CT4 A;  4LDX A;  3EG9 B;  1KD1 C;  2CZ7 B;  1WDX A;  2DEQ A;  3PGG A;  1XQH A;  4M78 E;  1AWO A;  4J8O A;  2DF6 A;  3M0T A;  1UJY A;  1W2B A;  4F6U B;  1W6X A;  2NYS A;  3OYC A;  3X26 B;  2DEU A;  2DAQ A;  2ZGW A;  3FC3 A;  1SSH A;  1BB9 A;  4PL6 A;  3RKX A;  1AZG B;  1UHF A;  3BG3 A;  1ZBJ A;  3FIF A;  3CCM T;  2GQI A;  2RO0 A;  4WF2 A;  2GF7 A;  3B57 A;  3RGF B;  1G2B A;  1QVG A;  1YJW Q;  2GTJ A;  2K9G A;  2BE9 B;  4JUV A;  1NJI U;  1JB0 E;  3O8V A;  3ZFJ A;  2QXF A;  5KH6 A;  4ELJ A;  1WFW A;  2YWW A;  3P8H A;  1HD3 A;  3AHU A;  1YIT A;  3K7A M;  4BCM D;  3EID B;  2DET A;  1VQN A;  2O4X B;  2HL5 C;  2XHC A;  4LUD A;  2LCL A;  1PC0 A;  1R0B G;  3EGU A;  2G6F X;  2CT3 A;  1PKT A;  4FYY B;  2CP2 A;  2KT8 A;  1SEM A;  5GAN h;  2RHI A;  3NTK A;  2BKD N;  1T3S A;  1WJR A;  4KBM B;  1CKB A;  2K6D A;  3EGD A;  2HAX A;  2YHT A;  2OTJ A;  2ROT A;  4F7U E;  2UUE B;  4LOC A;  2R7G A;  1RI9 A;  4HA8 A;  3RKW A;  2CGH A;  2DK3 A;  3C4S A;  5HK3 A;  3M55 A;  3E1S A;  4J9E A;  2GQV A;  2QTV A;  5I22 A;  1YI2 T;  3JCM Q;  1O9S A;  1T0H A;  2EQJ A;  5I2S A;  2EVR A;  4YOZ A;  3MO8 A;  3M57 A;  4MFD A;  3OYI A;  4ELL A;  1N8R R;  2WSF E;  2W9F A;  3L2Q A;  5GAM e;  1FMV A;  2COW A;  2IW8 B;  4BI3 A;  1CKA A;  5DLQ E;  2VV5 A;  1H27 B;  3CXC S;  2XK0 A;  5LJ3 f;  2C5X B;  4OP0 A;  4CI0 C;  1MUZ A;  3WXM B;  3NDQ A;  2D9T A;  3GBQ A;  3M0S A;  1RLQ C;  2CP6 A;  1SG5 A;  2LNV A;  1PD1 A;  2K7A A;  2WIH B;  3ZBD A;  3QDF A;  3H0H A;  1E6G A;  4CFN B;  2J7I A;  1VQP Q;  4BE0 A;  3OW2 S;  2LQW A;  5D6Y A;  3AT1 B;  1YIT T;  2QA4 A;  4EOP B;  1VQN T;  2IW6 B;  2GBQ A;  2CH4 W;  3L2R A;  3CCV Q;  1BBZ A;  1OYX A;  1QWF A;  2E6N A;  2LT4 A;  4BDZ A;  2NLU A;  1PM3 A;  2DL3 A;  1M8V A;  3QBY A;  1N4M A;  2QGS A;  4K11 A;  2GCX A;  3HKS A;  2X4W A;  1KHI A;  5KYX B;  2DJQ A;  4HCK A;  2A28 A;  2OTJ T;  1UG1 A;  2I0N A;  2L8D A;  1LOJ A;  2AK5 A;  3SD4 A;  3EG2 A;  1KC8 U;  4L59 A;  2QF7 A;  2PVG B;  4JX5 A;  4AFU C;  5GAM j;  1VQM A;  2DXU A;  4FW2 A;  4A53 A;  3MY5 B;  2JTF A;  2CZ6 B;  1K9M R;  4IUU A;  4DOW A;  4MML A;  2EGE A;  2JZ2 A;  2ZPG B;  1WNL A;  4XTY A;  3G6E A;  3CCR Q;  2H3J A;  3GPL A;  2OJ2 A;  4BAC A;  1PD0 A;  4RCC A;  3CPF A;  4PJO E;  5GJV B;  3CEY A;  2W9Z A;  3I5S A;  1XO2 A;  4M77 F;  1KXU A;  1H1R B;  2DL8 A;  2JMC A;  2MPX C;  3F70 A;  1VQ9 A;  1UGS B;  1ZSZ A;  1H28 B;  2LX7 A;  4N4I A;  5I2M A;  1QVF A;  3O0G D;  1QMC A;  2DPP B;  1H26 B;  3SDZ A;  5CKD A;  4RTT A;  5EJC A;  1WX6 A;  2QEX A;  2OX7 A;  3VJP A;  3H0F A;  3OA6 A;  2ZPH B;  3OMC A;  3UWN A;  2KGT A;  2QA4 T;  2ECZ A;  4EC8 B;  1JU5 C;  1EX4 A;  1T3L A;  2PQW A;  4A54 A;  1GBQ A;  1PG5 B;  3CCS Q;  3RNJ A;  1I07 A;  2QI2 A;  1B3Q A;  1SRL A;  1B34 B;  2RHY A;  1KD1 U;  2ZAE A;  1YJ9 Q;  1P92 A;  3JB9 J;  1K73 C;  3NTI A;  1ZX6 A;  1WA7 A;  4JPB W;  2LVM A;  2K2V A;  3SEM A;  1C0M A;  1TUC A;  4E2F B;  2LNH B;  3ZL7 C;  1FWZ A;  3CCL Q;  4M7A C;  2CP7 A;  2DVE A;  1VQM T;  4KT0 E;  4HVU A;  1VQ4 Q;  2EYQ A;  3LGF A;  3TQ7 P;  1GUX A;  4AKH A;  1RL2 A;  2LZ6 B;  1OL1 B;  4C0F A;  4CC3 A;  3CCU A;  4I3Z B;  4CFX B;  4C5E A;  5LQF B;  3CC2 T;  2MK5 A;  3MPU B;  1UGQ B;  4LD9 K;  2PK9 B;  3G33 B;  1IHW A;  1OV3 A;  3KXT A;  5IF1 B;  2FPE A;  4RTW A;  4M7A B;  2HBW A;  1I5L A;  2PNI A;  2SRC A;  3GTM S;  3OSS C;  4A4G A;  1UEB A;  2A36 A;  5BNJ B;  1VQ9 T;  4JZ3 A;  4E7H A;  3J80 E;  5L8R E;  2CCH B;  1VUB A;  4FYV B;  3JB9 I;  4EIK A;  4E7L A;  4JS5 A;  4BDY A;  1LPL A;  1Q81 C;  1VQ8 A;  1VQ7 Q;  4HLQ A;  4F7U G;  3I56 Q;  4BD3 A;  2QEX T;  2FHD A;  4C8Q C;  1VQ6 T;  3FRN A;  3ULR B;  2JTM A;  4FYX B;  1UB4 A;  3QO3 A;  1YHQ A;  2PVD B;  5D6W A;  1YP5 A;  4Z89 A;  3J7A F;  3SHW A;  2YRV A;  1MV0 B;  4O5V A;  2L89 A;  4FCY A;  2RI2 A;  2DYB A;  2XDD A;  1M2V B;  2X3X D;  1TFB A;  1NG2 A;  4C8Q B;  2WFY B;  4MIM A;  3QG1 A;  1MNE A;  1PWT A;  1JJ2 S;  3CBP A;  1TXQ A;  3VU3 C;  2RK2 A;  3UA7 A;  5IH2 A;  4M77 C;  5CEI B;  2M9U A;  4HNU A;  1M90 R;  1I81 A;  1W1F A;  3MHX A;  3VUZ A;  1Z9Z A;  3HB9 A;  3CC4 Q;  2ZZD A;  2EYY A;  2RHU A;  2ED0 A;  4FM4 B;  1GCP A;  4M77 B;  2DZC A;  5LJ5 e;  3H41 A;  4OMM A;  2YDL A;  3CCU T;  2W2H A;  2C06 A;  4BCO B;  3EGX A;  4FU6 A;  2IPO B;  3PNW C;  2KR3 A;  3RR6 A;  3VYH B;  4JRQ A;  2JNG A;  1ZQ1 A;  2HQE A;  4KUL A;  4X9C A;  8ATC B;  4HCC A;  2QDL A;  4QW2 A;  3JCM g;  2Y4X A;  1NPR A;  1K0X A;  1UHC A;  2J05 A;  4BCK B;  2HNI A;  2JS0 A;  1OU9 A;  2DME A;  2R58 A;  1LJO A;  4A4K A;  1RAG B;  2A0F B;  5HK0 A;  1VQ8 T;  3OYY A;  1SRM A;  4BUG A;  4EOK B;  5D7U A;  2HSP A;  4R55 A;  2DYI A;  5KYW A;  1YHQ T;  3MY1 B;  2RQV A;  3A8H B;  1Y96 A;  4N0A A;  4F14 A;  1GL5 A;  1M8M A;  4PNO A;  3I55 A;  2RQT A;  2O9V A;  2D0N A;  2PZ1 A;  3JCM V;  4HCB A;  1JXM A;  1HJD A;  1AVZ C;  1RAE B;  2JOY A;  5LJ5 j;  5L23 A;  5KYU B;  3CC7 T;  1GRI A;  1N8R C;  3HBL A;  1Z9Q A;  1SF9 A;  4CRI A;  1UNG D;  4Z8A A;  5C0M A;  1UEC A;  4OGR B;  1I0C A;  3TW7 A;  3EG0 A;  2E5K A;  2D6F A;  4CFM B;  5CKE A;  4M7D F;  1YJW A;  1W2B S;  1D0Z A;  2JGZ B;  1NM7 A;  2VC8 A;  4AG1 C;  5GAM g;  5GAN f;  1ZUK A;  3MEW A;  4M7A D;  3X25 B;  4MDX A;  2WMA B;  2CCI B;  1I5O B;  4FX3 B;  4CFV B;  2XI9 A;  4O6J A;  3RKY A;  3QJ6 A;  3QYH B;  3EAE A;  4OMO A;  4FYW B;  2XIC A;  2WSE E;  1TOV A;  1VQK T;  4FL6 A;  2EGC A;  2YSQ A;  2YUP A;  3PFS A;  4ANJ A;  4P5N A;  1WZO A;  1O75 A;  1QVG S;  2KAF A;  4OVA A;  3GF5 A;  1KJW A;  3FJ5 A;  1U8R A;  4Z88 A;  4XU0 A;  4J9B A;  2QQS A;  4C8Q E;  2OTL Q;  1RAI B;  4HCZ A;  2QYZ A;  1VQO T;  3C12 A;  1FYN A;  2B86 A;  1MHN A;  4M78 A;  4LDW A;  4BCN B;  1ZA2 B;  3EFO A;  2CDT A;  5CQY A;  1Q7Y U;  1QCN A;  2FEI A;  3I55 T;  2FZG B;  2X4J A;  2LCC A;  1K73 U;  1OUL A;  1K9M C;  4JS4 A;  1ZLM A;  3GP8 A;  3GNG A;  1KQ2 A;  2PUO B;  4PJO F;  3REB B;  2X3W D;  1U06 A;  2NUP B;  4C92 C;  2PJQ A;  4F17 A;  1NBE B;  2C6T B;  1BKB A;  2E41 A;  2MWO A;  3OYK A;  3PTA A;  4ROD A;  4AG2 C;  3JB9 D;  2VXF A;  4ZN3 A;  1GXI E;  1K8A U;  4IIM A;  1Q82 U;  4M77 D;  4C92 B;  4G6L B;  3NGP A;  3HZJ A;  4M75 C;  3MEU A;  1BU1 A;  1YJW T;  4RUG A;  2YT6 A;  2XG8 D;  3BHV B;  3V8K A;  3CCE Q;  1IHV A;  3RDV A;  4CC2 A;  5M9O A;  3GNF B;  1VQP A;  3VYG B;  1Q81 U;  5GMK l;  4PLI A;  4M75 B;  4RTY A;  5ECA A;  4GLK A;  3A98 A;  1M30 A;  2Y4Y A;  2DE0 X;  1R0C B;  2BKZ B;  3CCV A;  4HL4 A;  2OI3 A;  1X2Q A;  2KI7 A;  2DFU A;  4F7U A;  2KSS A;  3BY7 A;  1K0S A;  4JJB A;  2CZ1 B;  1UJ0 A;  2KRO A;  4A4E A;  2ZCF B;  4JJN K;  1Y0M A;  4DEY A;  5FGK B;  2KQW A;  4XTZ A;  3HRT A;  2E64 A;  3QHR B;  2VB6 A;  4F04 B;  2NUT A;  3RES A;  4NC6 A;  2PUK B;  1MMD A;  4E7Z A;  4OMQ A;  4J83 A;  1D09 B;  2AKL A;  2F69 A;  3RIR A;  3CCR A;  1M1G A;  1TUD A;  3S3O A;  3OYA A;  4EOO B;  2JMA A;  3OYD A;  4QQ6 A;  3CME Q;  1YI2 A;  2L3P A;  2L3R A;  1PKS A;  4FT4 A;  4IUQ A;  5IDP B;  5DQV A;  2A3L A;  4M7D A;  4B9X A;  3A8G B;  3VKI A;  2L3Q A;  1HSQ A;  1AD5 A;  4PJM A;  2AIR B;  2JN0 A;  1G3S A;  3DKM A;  5GMK m;  1VYW B;  3QYG B;  5KYY A;  3CD6 Q;  2QAZ A;  1E7O A;  4XTV A;  1S72 Q;  3TSZ A;  2E70 A;  3LH5 A;  3JCM e;  4AFQ C;  5LJ5 d;  3QHW B;  1VYU A;  1VQP T;  3VKG A;  3ASK A;  1D1A A;  1FKM A;  3EJ1 B;  4NL3 A;  4HKE A;  1V1C A;  4GY5 A;  1QVF P;  3CBM A;  1C1A A;  3G4S Q;  2YLC A;  1VIF A;  1QVF S;  5HY6 A;  4FSS A;  3CCV T;  4LDU A;  1XNI A;  3HRU A;  1IGU A;  2KNB B;  4DBR A;  2RJD A;  3CCS A;  1C9B A;  5GAN 6;  1M90 C;  1QKW A;  3OYN A;  2V22 B;  5GAN 8;  4M7A G;  4DOV A;  2GTO A;  1RAB B;  2CZ0 B;  1VYT A;  1YJ9 A;  3M54 A;  1F1B B;  1OZ3 A;  4BCN D;  3MET A;  2PK2 A;  4RTZ A;  1GCQ C;  1G3Y A;  3EGD B;  3PVQ A;  4Y28 E;  3S6W A;  3SB2 A;  5IHK A;  4CFU B;  4ZNX A;  4MZP A;  1PKD B;  2HKN A;  3BDU A;  1D0X A;  1Q95 G;  2KMG A;  3J81 E;  4HNT A;  4F7S B;  1B7T A;  1OGU B;  1H3H A;  2K5I A;  1N8R U;  4OB2 B;  4PJO A;  2EKH A;  1VQ4 A;  2QFZ A;  3OYJ A;  2R57 A;  2GNC A;  2R5M A;  4C92 E;  3QPH A;  5CKH A;  3NMZ C;  1PRL C;  1UUE A;  2YRC A;  3CCR T;  2O4X A;  5IAY A;  2P4R A;  2RMO A;  1G3T A;  3CCJ Q;  1H92 A;  1FX7 A;  3LGL A;  4E7K A;  1D3B B;  3MJX A;  2C0I A;  5FW9 A;  5LJ5 g;  4C92 D;  4C0D C;  2RNA A;  5LJ3 g;  4EMK A;  2J6F A;  5GAO n;  5GAO r;  3L2W A;  4C8Q G;  3RMQ A;  1ENW A;  2I2L A;  2M02 A;  1OIU B;  1NPP A;  1AZE A;  1H4L D;  2WJ9 A;  2KK4 A;  5GAO m;  3I56 A;  2ESW A;  5IHN A;  4C0D B;  4JJC A;  4OB0 B;  1X6O A;  4M75 D;  3HSB A;  3JB9 G;  1XOV A;  4R0K A;  1NE8 A;  4YC3 B;  4M77 G;  1XTD A;  2O31 A;  1M1K R;  1EIF A;  3NPF A;  2VGM A;  4X9D A;  2JUF A;  1JXO A;  3QWL A;  3TNI B;  3CCS T;  2LQN A;  3LW5 E;  1M2O A;  1Y07 A;  3MP1 A;  2GFA A;  4IIO A;  2WAC A;  2CJM B;  2DD4 A;  3E2U A;  1YJ9 T;  2HMA A;  1K9M U;  2HZY A;  3EHQ A;  4CFW B;  2DO3 A;  2X4X A;  5L2W B;  3E19 A;  2YUN A;  1IXD A;  2WIP B;  2O9S A;  4IUR A;  3CCL T;  2I40 B;  2F1L A;  3CC4 A;  4J5Y A;  2RF0 A;  1P5E B;  4L5G A;  4QVZ A;  1VQ4 T;  1FVV B;  1ZSZ C;  2EW3 A;  5CQX A;  3UT1 A;  2K3X A;  2A08 A;  3WVD B;  4Z6Y A;  2V26 A;  3VS7 A;  4HT9 A;  1ZA1 B;  2LQ8 A;  4QQG A;  3EFS A;  5GAO p;  4XU2 A;  2DL5 A;  4LDV A;  1AWJ A;  2F5K A;  4CC7 A;  2ROL A;  1BIA A;  1ZSZ B;  1GFC A;  3CC2 A;  1WXB A;  3FJP A;  2RHZ A;  2DLP A;  2DTH A;  5EC7 A;  4RTX A;  2XD0 A;  2E65 A;  2JTE A;  5KE3 A;  2DIG A;  2KRM A;  2F5T X;  2M51 A;  4DEX A;  1YIJ Q;  1VQ7 T;  2NWM A;  1BI2 A;  3I56 T;  2A7Y A;  2VVK A;  1BU2 A;  2WXV B;  2MYS A;  3HFN A;  2L2P A;  3I9Q A;  1KQ1 A;  3LX7 A;  2AKK A;  4MMK A;  3TNW B;  3VS5 A;  5KCO A;  1PCX A;  4F6W B;  1VQ6 A;  1WXU A;  4BI4 A;  2WPA B;  2ENM A;  2KMT A;  8AT1 B;  5GAO q;  3PMT A;  3BW1 A;  1JST B;  2VGN A;  4R56 A;  3X24 B;  1ZUY A;  5DM7 R;  4LUE A;  2DM1 A;  5J39 A;  2EQU A;  5KYN A;  4ZGE B;  3GOX A;  2DXB A;  4CFU D;  1FXX A;  2RQR A;  3DB3 A;  4NOY A;  1WYX A;  1Q7Y C;  3CC4 T;  3QZ5 B;  1NLO C;  4PFP A;  2FPD A;  4XTW A;  2LW4 A;  3LWI A;  5CIU A;  1GUX B;  5LMK B;  5FU6 C;  5A2Q E;  3BHU B;  3C94 A;  2FB7 A;  2RQW A;  3HHT B;  2D1X A;  1QP3 A;  2J06 A;  1VQL Q; 
#chains in the Genus database with same CATH homology
 2V8I A;  2XDP A;  5FU7 C;  5J26 A;  2LX9 A;  2P0Q A;  4HCB A;  5EG2 A;  1K8A C;  4M75 A;  4XAX B;  1Q82 C;  4QQD A;  1D3B A;  2DD4 B;  2JOY A;  5FU6 B;  5LJ5 j;  2XKO C;  4AKI A;  2MI6 A;  3CC7 T;  3QJY A;  1WGS A;  4BB7 A;  1YBY A;  4RCB A;  5LJ5 f;  1N8R C;  1HXD A;  4E7I A;  3OYB A;  2EJG A;  3HBL A;  3BG5 A;  1PSF A;  2E5Q A;  3LYI A;  3DL1 A;  4RG2 A;  5GAN 3;  2WSC E;  3L2U A;  4CRI A;  4XK8 E;  3DLL A;  2ZPE B;  5C0M A;  4JRP A;  3OY9 A;  5FRM A;  1PSE A;  4M7A F;  2OTL A;  3PMI A;  1QLB A;  1N27 A;  5FU7 B;  3MEV A;  3TW7 A;  3FB9 A;  3PT9 A;  2E1H A;  4J7I A;  5KE2 A;  3L42 A;  1AHJ B;  2D6F A;  5CKE A;  4PKC C;  4M7D E;  4M7D F;  4ZGJ B;  4MZT A;  3GLX A;  1YJW A;  1W2B S;  5GAN j;  2MF2 A;  2QQB A;  1M90 U;  4C92 G;  4JX6 A;  2EQK A;  2VC8 A;  1UGP B;  4OGE A;  3JCM d;  5GAM g;  5GAN f;  3X28 B;  3TCJ A;  3MEW A;  1N6A A;  4M7A D;  1VQ5 A;  4V2S A;  4LDX A;  3X25 B;  2RHX A;  2CZ7 B;  1KD1 C;  4MDX A;  4MDW A;  2DEQ A;  3PGG A;  1VQL T;  1XQH A;  2XI9 A;  4M78 E;  4O6J A;  1LNX A;  4J8O A;  4M78 F;  3RKY A;  2CKK A;  2RA2 A;  3QJ6 A;  5CCA A;  1YJN T;  1W2B A;  4M7D D;  3QYH B;  3EAE A;  3MP8 A;  5FLX E;  1WQW A;  2XIC A;  2WSE E;  1VQK T;  4FL6 A;  3OYC A;  3X26 B;  3PFS A;  2BS3 A;  2DAQ A;  3A8L B;  1O75 A;  2ZGW A;  3E9G A;  4M75 G;  4P5N A;  1N9R A;  2KAF A;  5DY9 A;  4OVA A;  3FC3 A;  1QVG S;  3QXE B;  3GF5 A;  3V7C A;  1U8R A;  2DJZ A;  4PL6 A;  3RKX A;  4XU0 A;  1X01 A;  2K57 A;  3BG3 A;  1V29 B;  3CC7 A;  3DB4 A;  3FIF A;  3CCM T;  3HPW A;  2ZZD B;  2DTI A;  2QQS A;  4C8Q E;  3S3M A;  4HCZ A;  2RI5 A;  3HO8 A;  4C8Q F;  1IZ6 A;  1G5V A;  4RMO A;  2RO0 A;  5CO7 A;  4WF2 A;  1VQO T;  2GF7 A;  3C12 A;  4ZGD B;  5FRN A;  3JCM P;  1MHN A;  4M78 A;  2QQ9 A;  1QVG A;  3M56 A;  4LDW A;  2DD5 A;  4JUV A;  2LQK A;  3CCE A;  5CQY A;  2FL7 A;  1Q7Y U;  1NJI U;  1JB0 E;  2LRQ A;  3OQ5 A;  3O8V A;  1U1S A;  2EQM A;  3I55 T;  3ZFJ A;  4IKF A;  2QXF A;  2BUD A;  4ELJ A;  2LCC A;  2X4J A;  5KH6 A;  3OYM A;  4DQ2 A;  1Q86 C;  1K73 U;  3BG9 A;  3P8H A;  2RM4 A;  5LJ3 e;  3ME9 A;  1K9M C;  3AHU A;  4JS4 A;  4C5I A;  3OYF A;  3GNG A;  3NTH A;  2EIF A;  3GP8 A;  1YIT A;  2PUO B;  4PJO F;  1KQ2 A;  5IN1 A;  3ZEH A;  3A5Z B;  2O4X B;  4C92 C;  1I8F A;  1VQN A;  4C8Q A;  2XHC A;  2E12 A;  5LL6 S;  2LCL A;  4AI6 A;  2DXB B;  1BKB A;  2E41 A;  2MWO A;  3OS1 A;  5KCH A;  4BE2 A;  3OYK A;  4N0A C;  3EFR A;  3PTA A;  4IUV A;  4OF1 A;  4C0G A;  2MWP A;  2EWN A;  3JB9 D;  2VXF A;  3DLM A;  2VYT A;  4LD6 A;  4ZN3 A;  2KY9 A;  5A0L A;  4PJO D;  1GXI E;  4EMG A;  1K8A U;  1W4S A;  5GAN 4;  1Q82 U;  1VQK A;  2V8K A;  4M77 D;  2OTL T;  5A0G A;  5GAM d;  5GAN h;  2RHI A;  2V8J A;  3NTK A;  4C92 B;  2BKD N;  4NL2 A;  1WJR A;  1IRE B;  4KBM B;  5A0D A;  3HZJ A;  1Y7X A;  4M75 C;  3MEU A;  4FT2 A;  4JRI A;  1YJW T;  2HAX A;  1Y96 B;  2KVQ G;  2YHT A;  1RI0 A;  3M4Y A;  2XG8 D;  4ELY C;  2OTJ A;  3HRS A;  3V8K A;  4F7U E;  3E9F A;  4F7U F;  4RKU E;  4M78 G;  4LOC A;  1VQO A;  3KUF A;  4HA8 A;  3OBY A;  3RKW A;  5M9O A;  2CGH A;  3GNF B;  1VQ5 T;  2DK3 A;  1VQP A;  3VYG B;  1R8O B;  3C4S A;  3M55 A;  5HK3 A;  5CR2 A;  2DXC A;  3E1S A;  1OZ2 A;  1Q81 U;  5GMK l;  2GQV A;  5CVI A;  4PLI A;  4M75 B;  1YI2 T;  3JCM Q;  3CPW S;  3INZ A;  2P0K A;  4JLI A;  4GLK A;  4X34 A;  4E7J A;  1O9S A;  2EQJ A;  2LTO A;  3RER A;  5I2S A;  5GMK e;  5FRO A;  1H64 1;  4FIB A;  2Y4Y A;  4RG8 A;  3JCM b;  3MO8 A;  3CCV A;  4HL4 A;  3Q1J A;  3PIO A;  3M57 A;  4MFD A;  3CME A;  3OYI A;  4KUD K;  1U1T A;  3GIB A;  2M16 A;  3QII A;  2WSF E;  3L2Q A;  5GAM e;  3G7Z A;  4F7U A;  1QW1 A;  3KHI A;  2KSS A;  4BI3 A;  5DLQ E;  3BY7 A;  2VV5 A;  5LJ3 j;  3CPW A;  3CXC S;  2Y90 A;  3HL8 A;  2CZ1 B;  1B34 A;  2XK0 A;  5LJ3 f;  4A4E A;  2ZCF B;  4OP0 A;  4CI0 C;  3WXM B;  3V8J A;  4JJN K;  2D9T A;  3VV0 A;  4M7A E;  3CD6 A;  2KQW A;  4JRK A;  4XTZ A;  3V8L A;  2LNV A;  1S72 A;  2EJF A;  3CCE T;  3HRT A;  1Y71 A;  2E64 A;  3ZBD A;  1OI1 A;  3RES A;  1WJQ A;  4BI8 B;  4C0Z A;  3CXC A;  4NC6 A;  4OMF B;  1SSF A;  2PUK B;  3G6E T;  4BE0 A;  1KG1 A;  3OW2 S;  3A8M B;  5D6Y A;  1N9S A;  4J83 A;  3X20 B;  3LH0 A;  1YIT T;  2MAM A;  4ZTJ A;  1WQ7 A;  4ZN1 A;  2RB6 A;  2L5Q A;  2QA4 A;  1M1K C;  1VQN T;  3L1A A;  4A4H A;  3RMS A;  2F69 A;  3RIR A;  3G4S A;  2AHJ B;  2RH2 A;  1M1G A;  4M78 C;  3CCR A;  1H3Z A;  3L2R A;  3BDL A;  3S3O A;  3QSU A;  2B8A A;  3OYA A;  2XU8 A;  3OMG A;  4J6W A;  3H4C A;  4XTU A;  3OYD A;  2E6N A;  1OYX A;  2QQ8 A;  4QQ6 A;  1YI2 A;  2LT4 A;  2L3R A;  4M7A A;  4BDZ A;  2NLU A;  3TEE A;  3OW2 A;  3M59 A;  4FT4 A;  4IUQ A;  4E47 A;  1BI0 A;  3QZ9 B;  2M1H A;  3UDC A;  1UGR B;  2A3L A;  2PU9 B;  3H6Z A;  1M8V A;  2QTX A;  3QBY A;  4M7D A;  4B9X A;  3A8G B;  3VKI A;  2BS2 A;  2GCX A;  3HKS A;  2EFI A;  4M78 B;  5J3B A;  2JN0 A;  1G3S A;  3DKM A;  5GMK m;  2X4W A;  5GMK j;  3CMA A;  3QYG B;  1I4K 1;  1KHI A;  2DD5 B;  4J7F A;  2OTJ T;  2EAY A;  4XTV A;  1G3W A;  4C5H A;  2L8D A;  1LOJ A;  1M5Q 1;  4FSX A;  3SD4 A;  4EPC A;  1BIB A;  2E70 A;  1KC8 U;  3C95 A;  4L59 A;  2QF7 A;  2PVG B;  4JX5 A;  2ZPI B;  3JCM e;  5GAM j;  5LJ5 d;  3QYE A;  3OS2 A;  2DXU A;  1VQM A;  3M53 A;  3WVE B;  1VQP T;  4A53 A;  3VKG A;  4LDY A;  4A4F A;  2JTF A;  1BYM A;  1E7P A;  2VUB A;  3ASK A;  1FKM A;  2CZ6 B;  4ZTF A;  4IUU A;  4DOW A;  4MML A;  4NS5 A;  4NL3 A;  4HKE A;  4GY5 A;  2BIV A;  1M4Z A;  2JZ2 A;  3CBM A;  2ZPG B;  1WNL A;  2YLC A;  4XTY A;  1VIF A;  3OSV A;  4KUI A;  2H3J A;  4ME7 A;  5HY6 A;  2IVW A;  3G6E A;  3GPL A;  2K4Y A;  4RCC A;  4BAC A;  5I21 A;  3CPF A;  4TVR A;  4PJO E;  5GAN 5;  5LJ5 h;  3CCJ A;  3CEY A;  3CCV T;  4LDU A;  5LJ3 h;  3CME T;  2XID A;  4M77 E;  1XNI A;  3HRU A;  3V7R A;  4M77 F;  2KR6 A;  2RJD A;  3CCS A;  5CAI A;  2DKG A;  1TH7 A;  3F70 A;  2QQA A;  5GAN 6;  1UGS B;  5GAN d;  1M90 C;  1VQ9 A;  3OYN A;  5GAN 8;  4M7A G;  4DOV A;  2CZ0 B;  1YJ9 A;  3BFM A;  3M54 A;  4N4I A;  5I2M A;  1OZ3 A;  1QVF A;  3VKH A;  3MET A;  3L2Z A;  1G3Y A;  4BY6 C;  4Y28 E;  3S6W A;  3SB2 A;  2FVU A;  4M7D G;  4MZP A;  3CD6 T;  1JBM A;  2DPP B;  3BDU A;  4JDS A;  2KMG A;  3J81 E;  3S3N A;  1S72 T;  4HNT A;  5AYF A;  3SDZ A;  3SWN A;  4XTX A;  5CKD A;  3G71 A;  5EJC A;  2HQX A;  3CBO A;  3JRZ A;  2K5I A;  2QEX A;  1N8R U;  4OB2 B;  2QQR A;  4XU3 A;  1DJ7 B;  4PJO A;  2RD1 A;  3VJP A;  2DXC B;  4BBR M;  2O01 E;  1VQ4 A;  2QFZ A;  3OA6 A;  4M77 A;  2ZPH B;  3OYJ A;  2R57 A;  2R5M A;  4C92 E;  3OMC A;  5GAN 2;  3QPH A;  5IT9 E;  4C92 F;  4QVC A;  5CKH A;  4D6W A;  3FEO A;  3UWN A;  4BY6 B;  4ELZ C;  2QA4 T;  3JCM J;  4Q5W A;  3G4S T;  1HK9 A;  3CCR T;  4M6V A;  2O4X A;  5IAY A;  2OAU A;  1G3T A;  3RUX A;  1FX7 A;  3LGL A;  4E7K A;  4A54 A;  1QP2 A;  2PQW A;  1D3B B;  3N5B B;  2XDB A;  2K5L A;  2QDY B;  4IUT A;  1KHC A;  3FDR A;  5LJ5 g;  2QI2 A;  4C92 D;  4C0D C;  1MGQ A;  4QVD A;  5LJ3 g;  3JCM f;  4EMK A;  1B34 B;  2RHY A;  5GMK h;  5GAO n;  5GAO r;  1NJI C;  3L2W A;  4C8Q G;  1KD1 U;  4M75 F;  4JLG A;  1P92 A;  3JB9 J;  1M9S A;  3RMQ A;  4II1 A;  3QKJ A;  1K73 C;  3LLR A;  3NTI A;  2I2L A;  3CMA T;  1NPP A;  2KDS A;  2LVM A;  2K2V A;  4HT8 A;  4MZM A;  4JX4 A;  2RK1 A;  4UC4 A;  3R6O A;  5CKB A;  4EDU A;  2WJ9 A;  1FWZ A;  4YTL A;  2KK4 A;  2DTO A;  5GAO m;  3I56 A;  4M7A C;  4C0D B;  2DIQ A;  2DVE A;  1VQM T;  2X35 A;  2QDJ A;  4OB0 B;  4KT0 E;  1X6O A;  4M75 D;  3HSB A;  5GAN g;  2LC4 A;  4L6V 5;  5CKF A;  2EYQ A;  3LGF A;  3JB9 G;  1XOV A;  1NE8 A;  3MCA B;  4J6Y A;  4M7D C;  4AKH A;  1RL2 A;  4PJO G;  3M4G A;  3KBG A;  4C0F A;  3CCU A;  3SFM A;  4M77 G;  1XTD A;  4C5E A;  4C5G A;  1EIF A;  2RJC A;  3CC2 T;  4LD9 K;  1UGQ B;  4EMH A;  2D0Q B;  2E6Z A;  3MP6 A;  3KXT A;  2VGM A;  4X9D A;  3CCJ T;  1WJS A;  2JUF A;  4M7A B;  1I5L A;  3OSS C;  3QWL A;  3JCM c;  4A4G A;  1UEB A;  3CCS T;  3M58 A;  3LW5 E;  2GFU A;  1Y07 A;  3ER0 A;  2GFA A;  3MP1 A;  1VQ9 T;  1KQS S;  1BI3 A;  4ATO A;  2WAC A;  1VIE A;  2DD4 A;  4M7D B;  2EKO A;  4E7H A;  3J80 E;  1Q86 U;  1YJ9 T;  5L8R E;  1K9M U;  2ZPF B;  4HCC A;  1QVF S;  2DO3 A;  2FYK A;  3QYB A;  3CCQ A;  1VUB A;  3QHS A;  5C6S A;  2X4X A;  3JB9 I;  3E19 A;  4E7L A;  3OYL A;  4JS5 A;  4BDY A;  1YIJ A;  1Q81 C;  1VQ8 A;  4IUR A;  3CCL T;  2R5A A;  4HLQ A;  2VXE A;  4F7U G;  1KQS A;  3CC4 A;  4J5Y A;  4BD3 A;  3G71 T;  2QEX T;  2FHD A;  4OB3 B;  4L5G A;  4C8Q C;  1VQ6 T;  4QVZ A;  3FRN A;  2DXT A;  1VQ4 T;  2JTM A;  5CQX A;  2G77 A;  1UB4 A;  3QO3 A;  3UT1 A;  1YHQ A;  2PVD B;  2K3Y A;  2HD0 A;  5D6W A;  2JVV A;  2K3X A;  3J7A F;  2YRV A;  3WVD B;  4Z6Y A;  3OBW A;  4O5V A;  4HNV A;  3V7S A;  5LJ3 d;  2L89 A;  2P4T A;  3UPU A;  3JCM h;  4HT9 A;  2LQ8 A;  5GAM f;  4QQG A;  2RI2 A;  3PIP A;  3EFS A;  2DZ9 A;  5GAN 7;  5GAO p;  4XU2 A;  2XDD A;  3QDR B;  1NZ9 A;  3SWN C;  4C8Q B;  4LDV A;  2F5K A;  4MIM A;  4QSH A;  3QG1 A;  2G3R A;  4PJO C;  1JJ2 S;  4OB1 B;  3CBP A;  1BIA A;  2RK2 A;  3VU3 C;  3CC2 A;  5GAO l;  4M77 C;  2M9U A;  4M78 D;  4HNU A;  2X4Y A;  2K5F A;  3FJP A;  1I81 A;  2RHZ A;  5HKC A;  3MHX A;  2DTH A;  2XD0 A;  1M1F A;  2E65 A;  5KE3 A;  2DIG A;  3VUZ A;  1ZBX A;  2CS7 A;  2F5T X;  3URG A;  4AKG A;  3P8B B;  1VQ7 T;  3HB9 A;  1BI2 A;  3SWN B;  4OGC A;  1JJ2 A;  4PLL A;  1BI1 A;  2ZZD A;  1WPY A;  2A7Y A;  2RHU A;  4XQ3 A;  3HP9 A;  5CK9 A;  2ZPB B;  3I56 T;  4PJO B;  4FM4 B;  3HFN A;  4M77 B;  4VUB A;  2DZC A;  4C8Q D;  5LJ5 e;  1KQ1 A;  4EMK C;  3LX7 A;  3JB9 F;  2MMP A;  4MMK A;  5KCO A;  3L2V A;  3CCL A;  3CCU T;  3A8O B;  3HFO A;  2C06 A;  2LT1 A;  2M0O A;  2IG0 A;  3H8Z A;  4FU6 A;  1VQ6 A;  3LWH A;  4BI4 A;  3PNW C;  3VYH B;  4JRQ A;  2KMT A;  4DA4 A;  1QVP A;  2JNG A;  1ZQ1 A;  4Z02 A;  4Y91 A;  2HQE A;  3BW1 A;  3PMT A;  4KUL A;  2PVO B;  4X9C A;  5GAO q;  1VQL A;  2VGN A;  4QW2 A;  3JCM g;  4R56 A;  3OS5 A;  3X24 B;  4N4G A;  1YJN A;  4B9W A;  3MEA A;  5DM7 R;  2HBP A;  2Y4X A;  1NPR A;  4EMK B;  5J39 A;  2EQU A;  3JCM X;  4ZGE B;  5GAN e;  2DXB A;  3GOX A;  3TU4 K;  3P8D A;  1KC8 C;  1FXX A;  2HNI A;  3DB3 A;  4NOY A;  2RJF A;  3M9Q A;  1X75 C;  1YCY A;  4F7U B;  3TRE A;  2RI3 A;  2R58 A;  3CCQ T;  2E10 A;  1LJO A;  3JSC A;  4A4K A;  3TW6 A;  4MFE A;  1M1K U;  1ZHI A;  1YIJ T;  5HK0 A;  1VQ8 T;  2CYZ B;  3OYY A;  4M75 E;  3OYE A;  3OYG A;  4XU1 A;  3CCM A;  4BE1 A;  1Q7Y C;  2P0P A;  4BUG A;  3QZ5 B;  3FLG A;  3CC4 T;  4IUP A;  4BBS M;  3NFC A;  3QUI A;  4N4H A;  4C92 A;  3JCM W;  4R55 A;  2EJ9 A;  3T9N A;  5GAM h;  3JB9 H;  4XTW A;  4J6X A;  3JAM E;  2RJE A;  5CIU A;  3LWI A;  1VQ7 A;  5A2Q E;  5FU6 C;  1YHQ T;  4N0A A;  3A8H B;  1Y96 A;  5DLO A;  3OS0 A;  3C94 A;  2YLB A;  3OYH A;  3VUB A;  4PNO A;  5GMK i;  1JRI A;  2LDM A;  2FB7 A;  3OB9 A;  5D6X A;  3HHT B;  3I55 A;  2BS4 A;  3M5A A;  1QP3 A;  3JCM V;  3VYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...