4OB0B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob0B02
2QDYB 4L6V5 3A8HB 2ZZDA 1QP2A 2ZPGB 1AHJB 2DXBB 3QYGB 1JB0E 2ZPEB 4FM4B 2WSFE 1DJ7B 1V29B 2CZ1B 1GXIE 2ZZDB 2CZ0B 4OB1B 3HHTB 3LW5E 2DD4B 2ZPIB 3A8LB 2PUOB 2CYZB 3A8MB 3WVDB 1QP3A 2PVOB 1PSFA 3X24B 2O01E 2DD5B 2PU9B 3VYHB 2PVGB 3QZ5B 2CZ7B 2D0QB 2AHJB 3X25B 2ZPFB 3QZ9B 4OB0B 3A8GB 4ZGEB 3VYGB 4KT0E 4XK8E 2CZ6B 3QXEB 2PVDB 1UGQB 4ZGDB 2ZPHB 4RKUE 2DPPB 1UGRB 1UGSB 2DD5A 4OB2B 3X26B 4ZGJB 3A8OB 3QYHB 2WSEE 3WVEB 2DXCA 1PSEA 3X28B 2DD4A 2DXBA 5L8RE 1IREB 2ZPBB 2PUKB 3X20B 2DXCB 2ZCFB 4OB3B 1UGPB 3VYGA 4Y28E 2WSCE
chains in the Genus database with same CATH superfamily
4HKEA 1HD3A 3OYEA 4YOOA 4YOZA 3PNWC 4PJNA 2CDTA 3I55T 1YJWQ 2DXUA 2J6KA 2FG0A 2DYBA 3CC4Q 4ANJA 1OGUB 1K1ZA 2RHYA 4A4GA 4YTLA 2JZ2A 1QKWA 1P5EB 1VQMT 1KIKA 3HL8A 2XD0A 1UNLD 4A4KA 3CC7Q 5KYUA 2QYZA 2LT4A 3QPHA 1OL2B 3CCLA 4IUPA 1V29B 4B6MA 2EIFA 4E47A 3GTMS 2VXEA 4UC4A 2WMBB 1AD5A 3QG1A 4RCCA 2X35A 4RODA 3VKIA 2OTJA 2VWFA 4C5HA 4M75A 1YI2T 2P84A 4DBFA 1M90U 5KYXA 4F7JB 5GAN5 3OS1A 4ROEA 3I9QA 3V8LA 3VYHB 4LD6A 2GTOA 2B9RA 2M0OA 3KUFA 4L5GA 1ZP2A 1H3ZA 2XICA 4IMYB 3EG2A 5CR2A 3CMET 1PRLC 5GMKl 4A4HA 3CD6T 3L2QA 1VQ9Q 4OMMA 5LJ5j 2KGTA 1RI0A 4XK8E 3JB9J 1YBYA 4WF2A 2MI6A 1YITA 4HCZA 1X6OA 3MKDA 2DL7A 4RG8A 1QVGS 1ZQ1A 1UUEA 4C0GA 2VASA 1WYXA 1H1RB 3JB9I 4CC2A 2K2VA 4BCHB 2CGHA 2J05A 5IN1A 4JS5A 3EH2A 4QVZA 1ZA1B 2X4YA 4HT8A 1K4US 3H4CA 4PJOD 3PMIA 2IIMA 1W2BA 1ZSZB 2JN0A 1H641 3OS2A 3X28B 1H25B 1O9KA 1Q7YC 2LC4A 2COZA 5FU7C 1RACB 2RJDA 2DXBA 1TD6A 2V26A 3BE3A 4Z8AA 3MEAA 1RAAB 2MPXC 3ZBDA 1TH7A 2RB6A 3LWHA 1MMAA 4ME7A 1UHFA 4RMOA 4FIBA 2WMAB 1I4K1 2EGCA 3REBB 4JJNK 4KGXB 3VS5A 2KRMA 2CCHB 1PKTA 1AWXA 2JGZB 2MOXA 2ZPGB 4C8QA 2HKNA 4M7DG 1NYGA 5IDNB 5KYNA 1VQOT 2KSSA 1VOMA 1VOLA 4NOYA 1M1GA 1SEMA 4D6WA 1BU2A 2CP7A 4LDYA 1NBEB 5I5ZB 2E1HA 3SWNA 4GLMA 1UTIA 2I53A 3O5ZA 5DY9A 3O0GD 1AT1B 2DZ9A 2XKOC 2PUOB 3L2WA 1S72A 1UNHD 1KHIA 3CCRQ 2KT8A 2C0TA 2HD0A 2VYTA 4I3ZB 1Q81C 4VUBA 1TU0B 1PSFA 3X24B 1Q86C 4EORB 1MV0B 3I5RA 5CYIB 2GNCA 1HYOA 2PU9B 3BW1A 4E7JA 4E2FB 4XQ3A 1ENWA 3JCMh 5D6YA 3M0SA 4CFNB 4GBQA 5A2QE 4D8KA 2V22B 3CEYA 2M0YA 4X1VA 1JJ2A 1NEBA 2BZYA 1N6AA 2PJQA 5GANh 2JW4A 3AT1B 2C6TB 2ZPHB 5LJ3f 2DVJA 1Y0MA 1U5SA 3RUXA 1K8AR 2AKKA 5I2SA 5CKHA 2UZEB 1VQ6Q 3TCJA 2CUDA 1RLPC 3CC2A 4V2SA 2KDSA 1LCKA 2LQWA 1AZGB 1M1KC 1GBRA 4XTVA 2EKOA 3M54A 5CEIB 4F70B 2H3EB 1OQKA 1K8AU 1H3HA 1WXBA 4M75F 1GFDA 1X69A 1QVGP 4BCMB 1IO6A 4X34A 2HL3A 2GBQA 1FX7A 3H8ZA 4AG2C 1FWZA 3CMAT 1KQ2A 3CCRA 4AKHA 2LZ6B 3HFNA 2KQWA 2QGSA 4EOPB 4C8QC 3MP6A 1NG2A 1MHNA 3CCRT 4KUDK 5GAMd 3URGA 2BKZB 3JCMb 2K3YA 1PHTA 1H1PB 2RO0A 2QG9B 2A7YA 1BKBA 2D9TA 4BB7A 1OIYB 2E3HA 4C92E 3OQ5A 1JU5C 5KCHA 1I1JA 1H27B 3T9NA 1YJWA 4OVAA 1VQOQ 4LE9A 3QHSA 5IXBA 2CT3A 2JJ9A 5DLOA 1WJSA 2XK0A 1H26B 4RCBA 1M5Q1 1URCB 2KR6A 1VQPQ 4LNPA 2O01E 4M78A 4MIMA 4J6WA 5EG2A 3E1SA 4F7UA 1VQ7A 2CZ7B 4PJLA 2VB6A 1VUBA 4XTXA 3H41A 1XJWB 1K73C 1KG1A 1SSFA 2CH4W 3GF5A 4MZMA 4EMHA 1BCOA 3EGDB 4ELYC 2IVWA 4FT4A 1QVFP 4OF1A 2M9UA 5HBJB 1YJNT 4F6WB 4J9HA 1WHHA 1Q95G 3CCMQ 1H8KA 1H24B 4BACA 2BS2A 3SD4A 1UEBA 4EMKA 2CCIB 2FEIA 4EONB 2RQTA 1MMNA 2LVMA 4E7SA 5CKDA 2FB7A 4F6SB 1M2OA 3OBYA 4M77G 4N0AC 1P92A 2DEQA 2C5OB 2FRYA 5ECAA 2F2VA 4M75D 5DLQE 3PE0A 2OI3A 1W98B 1YP5A 4XTYA 1YNZA 5CKBA 2LCSA 4JPBW 3H9NA 1VQPA 1EIFA 2DL8A 4L6V5 3OBWA 4DOWA 2ZZDA 2V8IA 4FX3B 2EW3A 1GRIA 2YDLA 1N8RC 4C92C 3GP8A 4F7UE 1VQ6T 2OTLT 2RQWA 3S3MA 4A54A 2XIDA 1YIJQ 4M78E 1M1KR 3V8KA 1M90R 4OMNA 5GAMj 3V7CA 4F7LB 3OYNA 1PRMC 4PFZA 2QQSA 2OTLA 2FPDA 4OMLA 3G71T 1GXIE 4Z02A 3NHNA 2BS4A 4N0AA 3FB9A 4EMKC 2W96A 4KH0B 2P4TA 2AIRB 4GLKA 2ZPIB 2BTTA 3QWLA 2MYSA 3CPWP 2E5QA 1MUZA 2XI9A 4JX4A 1OL1B 1Y96A 6AT1B 1BIAA 2UZBB 3JB9D 1FKMA 2OTJQ 4UN0A 3FDRA 5A0LA 5ACBA 2E12A 1JXOA 3VUBA 3EG3A 4M77C 1EX4A 1VA7A 1IXDA 2AHJB 1G3NC 2DJZA 2LDMA 1NJIU 1WX6A 2F5KA 1M3BA 4B9WA 3TQ7P 4PJOG 1KQSP 3QKJA 3M53A 1JJ2S 1G8XA 1KFZA 2J06A 1I0CA 4HXJA 1OULA 1I5OB 5IHKA 5GMKh 2G77A 2RA2A 4KRDB 2RM4A 3PVQA 1PKDB 5J26A 2L3QA 2EQKA 5HBEB 3CXCA 2GQVA 2M1HA 2DZCA 4TVRA 1UGSB 2DD5A 1PD0A 2DFUA 1R8OB 2DIGA 2KMTA 2KNBB 2LQKA 3CCJQ 2LCLA 4ZNXA 4FW1A 3LLRA 2RJCA 2KRNA 3M4YA 1YI2A 5FWCA 4NL2A 3JRZA 4C92B 1C9BA 4FT2A 1D1AA 3H0FA 4EDUA 1D1CA 2XMFA 1ZSZA 2HDAA 5GANe 3M0RA 3I5SA 1Z9QA 2RD1A 3PTAA 4MMKA 2YRDA 2YHTA 1K8AC 1VQ8T 2DA9A 2J6OA 2P4RA 1AHJB 2YSQA 3INZA 2RQVA 3RERA 1AISB 1H4LD 2RI3A 1M1KU 1YITT 1N9SA 1OZ2A 1VQ8A 3M57A 1D3BB 4J7IA 1X2QA 1TFBA 3UPUA 2LX7A 4XTZA 3IQLA 3QDFA 3RNJA 2C5XB 1VIFA 5GAOl 3C12A 3META 3JB9F 1VQKQ 4CRLB 2DK3A 2KXCA 2DIQA 2YT6A 1W2BS 4ORZA 2DKGA 2RH2A 1YJ9T 1N8RU 4DBHA 2DRMA 3WVDB 3HFOA 4N4IA 5FROA 4Y72B 1G5VA 3RKYA 1OPLA 1G3WA 2PVGB 3OSVA 4M77E 3VKHA 3GNFB 4CI0C 4M6VA 2FPEA 2E6ZA 1O75A 1B7TA 1GUXA 4CC4B 1UECA 2CT4A 1Q86U 3P8HA 1H92A 2ZGWA 1A0NB 3D7SB 3L2UA 5CAIA 3QSUA 1JRIA 4C92G 1UNGD 1M3CA 2QF7A 4XTUA 2DPPB 2COYA 3CCVA 4M7DF 2R5MA 4ELJA 1G3TA 5KYYB 4ZGJB 5LJ5f 3VV0A 2C5NB 2M16A 4M78B 4BCJB 3OYGA 4QVCA 3WVEB 2EVRA 1WNLA 1VQNQ 2V8KA 3C95A 1B07A 2EJGA 1VQ4T 2H3JA 3L42A 4KRTA 1QLBA 1K9AA 2PUKB 4M78D 2FZCB 5GJWB 1NJIR 4O5VA 4ZTJA 2L0AA 4FU6A 4PFPA 3M4GA 5GAMf 2KR3A 1QVFA 3F70A 1OU8A 2I40B 2AK5A 2CKKA 2YXYA 4DA4A 2CJMB 4AFQC 2JOYA 1Q7YU 1U3OA 4QQGA 5IHIA 4LD9K 3MO8A 2RJEA 3OYHA 2L3RA 3NTIA 4J7FA 2RHZA 2QTXA 2HNIA 4CFVB 2DBMA 2QEXQ 3MEWA 5EJCA 1QWFA 2EBPA 2LMJA 1U8RA 1RUWA 1YWPA 4KBMB 1MMGA 4B9XA 2CYZB 1MMDA 3EHRA 2KY9A 1HXDA 1WQWA 4AFSC 2PVOB 2BZ8A 4PKCC 2XU8A 3BHVB 4NL3A 1MNEA 2K5IA 1PWTA 4HNVA 4K11A 1D0XA 2OJ2A 1X43A 3QYEA 4KT0E 1SF9A 4C5IA 1R0BG 2BZXA 3PMTA 2K4YA 3ASKA 3H0HA 4M75C 4EOSB 1QVGA 1TG0A 2JT4A 3JCMJ 2RK1A 3JCMc 4HT9A 1M3AA 5FGKB 4BCQB 3C4SA 3I35A 3M58A 4MMLA 4C8QF 3GLXA 4PNOA 3EAEA 2P0QA 4C8QG 2L3PA 3QJYA 1PM3A 1TWBA 4FCYA 3L1AA 3JCMf 2FO0A 5GAN7 4EOIB 3KHIA 1WPYA 3EJ1B 4KGVB 5IHYA 3KXTA 4JRPA 1SHGA 1JEGA 2GGRA 1IREB 1OKVB 4LDVA 1OIUB 4WTOB 4M7AD 3GIBA 4IURA 1BI3A 3CXCP 3VU3C 5HVYB 3BG5A 1QMCA 1RAFB 1SHFA 2RMOA 3L2ZA 1UDLA 2CP6A 2R5AA 2GQIA 3ME9A 4C5EA 3VS6A 3M5AA 2EUFA 4YOSA 2D1XA 2IW9B 4LOCA 4AI6A 1M4ZA 2QA4A 4JDSA 1X6GA 2JM8A 2K9GA 2VGMA 5FU6C 3OW2S 4BCMD 4FM4B 2D6FA 1ZBJA 1FMWA 3J81E 1TUDA 2ATCB 4X9DA 4BCFB 1WHLA 3NTKA 3G4SA 3UATA 3VRYA 2LT1A 2SEMA 2EQIA 1KD1U 1Y07A 4BCGB 1E7PA 1QCOA 3JB9H 2AZVA 1RAIB 2WHBB 2YUPA 1BB9A 4R56A 2G6FX 3CCLQ 1KQSS 1MV3A 1WHMA 2NUTB 5IXFA 2EGAA 1KC8C 5LJ3g 1K73U 4OMQA 4EC9B 4RTYA 2KYMA 3REAB 2D0NA 4M78F 3I56A 4PJJA 3C94A 4MZTA 1GCPA 5LJ3h 1U1SA 2R57A 3HRUA 1X2KA 1UB4A 4JZ4A 1YHQT 2QA4T 1RADB 5HKCA 2PQWA 2Y4XA 2F69A 5GAOn 5CKEA 2KEAA 2BKDN 2DEUA 2WJ9A 2CP3A 1TUGB 2IN3A 4BY6C 1RL2A 5KYXB 3RR6A 1ABOA 5A0DA 1E6HA 4M7DB 2JM9A 4CC7A 4PFOA 1LPLA 4XU2A 3THKA 2WIPB 2WEVB 2BIVA 1C0MA 4F7NB 3OYBA 3CCSA 5CQYA 3HPWA 2K6DA 1W4SA 1QCNA 1OZ3A 1MNDA 2EYWA 3M0PA 4HA8A 5GAOp 2C0OA 1NJIC 1IGQA 2EQUA 4BDZA 4E7KA 3NGPA 2HSEB 2O9SA 4IIOA 2ESWA 4EIKA 2W2HA 4CFXB 1K0XA 4J9CA 1KQ1A 2BS3A 1YCSB 2QDJA 1T0JA 4RTXA 1BI1A 4TTHA 1Q82U 5FRNA 3I56Q 3JCMe 4F7UB 2E3IA 1JB0E 1WHJA 5D6WA 2JMCA 1VQ8Q 3G33B 1SRMA 4OP0A 2DO3A 8ATCB 2ZZDB 3MCAB 1IB8A 3RKXA 1OV3A 1RABB 3F5XB 3VS3A 4LN2A 2EYQA 3UA6A 4PJOB 4JJDA 4F7UF 3A5ZB 5CK9A 4CFUD 2QEXT 1KC8U 2JUFA 4OR5B 4ROCA 1AOJA 4FYVB 4FYYB 1OU9A 2DJQA 1VINA 5D6XA 1NE8A 5GAOr 1YWOA 3OW2P 5J3BA 1RAEB 4J9IA 1B34B 5I22A 4IUUA 5KE2A 1ZUUA 4OMFB 4L59A 4X9CA 1C1AA 4J5YA 2EJFA 3QO3A 4ZGDB 4PLLA 4ZN1A 1QQJA 1WHKA 3GPLA 3DB4A 3P8DA 1AWJA 1UJYA 2MWOA 2J7IA 5LJ3d 4EOOB 3CBPA 4IKFA 1F1BB 3G7ZA 3V8JA 2LNHB 5FWBA 4EMGA 5GAN2 7AT1B 5CKFA 1VQMQ 3RDVA 2C5VB 4LXCA 5LJ5d 1YIJT 2YRVA 4BI4A 2E5KA 2OTLQ 2UUEB 1BK2A 4M7AC 1IZ6A 2JVVA 4C0FA 4M75G 2ROLA 1VQ5T 1JSUB 5KYWA 1Y71A 3UT1A 1N4MA 5GAMe 3TNWB 3E9GA 2DMOA 3E2UA 4Q5WA 1VQ5A 5KH6A 2ECZA 2X51A 4F14A 2GCXA 4D8DA 3HTRA 4BBSM 2O88A 1JXMA 3MPUB 5EC7A 1M27C 2DAQA 2RN8A 1M1FA 1M9SA 3EFRA 2O9VA 1FVVB 4EC8B 3L2VA 3KBGA 2ABLA 5LJ5e 4Y92A 3EFOA 2K2MA 2O31A 1XO2A 2QAZA 1XNIA 4PJOA 1Q82C 3EFSA 2CZ1B 1GY3B 4BI3A 3BLRB 1Q7YR 4FSXA 4HNTA 3A8LB 2KE9A 4JX5A 9ATCB 4OGEA 1VYWB 3A8MB 1TXQA 3OYJA 3QHRB 1D3UB 3G4SQ 2O4XA 2DVEA 4M7AE 1TTHB 3CCMT 3OSSC 2UZLB 1M8MA 2E64A 3VS4A 1QVPA 2HEQA 3CC2T 4QVDA 3G6EQ 5HK3A 3QZ9B 1IHWA 2KMGA 4OB0B 4AFUC 3A8GB 1NZ9A 4A53A 1IGUA 2YUNA 4EOLB 1M90C 3DKMA 1VQ7Q 2AZSA 1OKWB 3MEVA 1S72T 5LL6S 1YFNA 1UGRB 3FIFA 3R6NA 1BI2A 1X75C 5GAN3 2VV5A 2V1RA 1N8RR 1W6XA 3ZFJA 2RPNA 1UFFA 2E4HA 3BDLA 1BBZA 4J83A 1VQ6A 2Y4YA 3G71Q 1TS9A 3ZL7C 1VQKA 3DDPB 4KH1B 2ZPBB 5FU6B 3X20B 3CQTA 1VQKT 3UA7A 5GANf 2K79A 1D09B 3OYIA 1ZUKA 3OMGA 2J6FA 1E7OA 3CBOA 2ENMA 4P5NA 3CC7T 5GAN8 3A8HB 1C6VX 4C8QE 1W1FA 5GMKi 1KD1C 3NTHA 4M7AF 1G2BA 4A4EA 1OYXA 2MAMA 3A1PA 2KXDA 3CC7A 4RTUA 4CFUB 4A4FA 2ED0A 4FYWB 4QQDA 4E6RA 2GFAA 5I2MA 4J9BA 4IUTA 3TEEA 1YITQ 1K9MU 1E6GA 3CCQA 2WSFE 2C06A 1M2VA 4E7ZA 1GUXB 2DILA 1YJNA 3HBLA 1UGVA 3OYAA 5BNJB 4HL4A 2DD4B 4F16A 2IW6B 1YCYA 2PK9B 1ZX6A 4OMOA 2CSIA 2HQHA 3CCUA 2FVUA 3TNIB 4GY5A 3TSZA 1NLOC 2HCKA 3Q1JA 3QJ6A 4O6JA 2R58A 3TVTA 3DL1A 1HSQA 3MY5B 4ESRA 3JCMd 3X25B 3PIPA 3EGXA 3TU4K 1AD6A 4E7IA 1X01A 4J6XA 1Q81R 4ZGEB 2IVXA 1RI9A 2CP0A 4RTTA 3SWNB 2DF6A 1WJRA 2QASA 1D1BA 2FHDA 3LQ5B 2QI2A 2OTJT 1Y7XA 2VC8A 2X4JA 4ELZC 2QQ9A 2RHUA 2A36A 3RBBB 1MGQA 3BDUA 1G3YA 2PK2A 3AHUA 2DTHA 4M7DD 4NSTB 3OYCA 4LUEA 2WIHB 3WXMB 4XU0A 3LH5A 4Y91A 1XTDA 2DM1A 3MJXA 3A8OB 5LJ5h 2CH4A 4EOQB 1LNXA 3MP1A 3OB9A 1VYVA 2KRSA 2LTOA 2LJ3A 1WIEA 3CCQQ 1KQSA 5EFQB 2BE7D 1WXTA 5L8RE 2RHXA 2FPFA 4KRCB 4AFZC 3BLQB 4EOMB 5HY6A 1H1SB 1RLQC 4BE2A 4PJOC 4J9DA 5GJVB 1QVFS 3HO8A 1KJWA 1QP2A 1UG1A 3OS5A 3I56T 2DTIA 2ROTA 3SHWA 1BCMA 3VS0A 4EOKB 5LQFB 1I81A 2YWWA 4QW2A 1ABQA 1GBQA 4JLGA 3CCEQ 3RMQA 4JLIA 2X1NB 2JS2A 2ZPEB 2DMEA 4ZN3A 5C6SA 3VUZA 1KSWA 4M78C 3VS7A 1DJ7B 1LJOA 1Y96B 3I55Q 5DQVA 4F17A 4E7HA 1WJQA 3V7SA 2MCNA 4IUQA 1AWWA 8AT1B 2D8HA 3LW5E 1M2VB 2DE0X 4J9GA 3POMA 1V1CA 3PFSA 1QP3A 1GFCA 4M77A 5GMKj 1Q86R 2RJFA 4BY7X 1K9MR 3L2RA 1TOVA 3CPWS 2HMAA 3BFMA 3CCST 2HQEA 2GTJA 2ED1A 3OYMA 3EHQA 4BCPB 1PCXA 3FLGA 4JJCA 1B3QA 3LH0A 5CO7A 3SEMA 2FRWA 2LJ1A 3GNGA 2CUBA 4DBRA 4RTVA 1K76A 3R6OA 2YRCA 4BI8B 1OI9B 3VYGB 5ICPB 3NMZC 4AT1B 5GMKe 4BY1X 2VKNA 3EGXB 2RQUA 2SRCA 2A08A 4RKUE 5CCAA 2L3SA 3DJBA 1PKSA 2EQMA 1GCQC 2K5LA 2QTVA 2KBTA 4CXAB 3DTOA 1NYFA 2FYKA 1XOVA 2C4GB 2W99A 4BBRM 2Z0WA 2DXCA 3CMEA 2KVQG 4YC3B 2X3XD 3CD6A 3UWNA 1U1TA 4QT7A 3C0CA 1YJ9Q 2LQNA 2DBKA 2DTOA 3TW7A 5I21A 3M0TA 3CCJA 4OB3B 2NUTA 1RAHB 5KE3A 1UGPB 4M7AA 3EFOB 4NC6A 1G83A 3TN8B 3VYGA 1WLPB 2BUDA 4RTWA 1I8FA 2IG0A 2NLUA 1WXUA 4PJMA 4EMKB 5CQXA 4C92D 2FZGB 5L23A 2NUPB 3QUIA 3NFCA 1KD1R 2W9FA 1TUCA 1SRLA 3MEUA 2DX1A 4J8OA 3M55A 2MWPA 2MF2A 2V1QA 3PVLA 4PJOF 3A98A 3O8VA 5DQWA 2PZ1A 1ZSZC 3CCET 3OW2A 2L89A 2A0FB 5GAMg 2LQ8A 3CBMA 3QYBA 2B8AA 3MI9B 1X6BA 4OB1B 2DL3A 1OI1A 2E10A 4JRKA 3EOCB 1CKAA 3RKWA 2VUBA 4F7UG 5GAN6 3H6ZA 3JCMQ 4JRQA 2XDBA 2QGGA 2W0ZA 2DD5B 4CC3A 3LWIA 4ELLA 2WACA 3UF4A 2NUPA 3RIRA 2MIOA 4ZTFA 5LJ5g 2DL4A 4JUVA 1KHCA 3CCMA 1JOWA 1OX8A 2EJ9A 5CVIA 3JCMW 4G6LB 2D8JA 4BUGA 1LVKA 2CZ6B 2K3XA 3ZEHA 4RUGA 4RG2A 1R77A 2EAYA 3KFVA 3B57A 2PHGA 2EWNA 4MFEA 2IW8B 3J7AF 2F5TX 1JKWA 2JMAA 3GOXA 3CCVQ 1JO8A 2HSPA 3S6WA 2CP5A 2DD4A 2DETA 5GAOm 1WA7A 2RF0A 3NPFA 2R7GA 4LDUA 1FMVA 2C0IA 2DXCB 2E70A 1HJDA 1IRXA 1KK7A 3G71A 2I2LA 2A37A 2X3WD 1N27A 1CKBA 2PTKA 2WSCE 4EOJB 4AG1C 1H1QB 1IHVA 4BCOB 2YLBA 4BCKB 4M78G 4FW2A 3JAME 3BG3A 3VS1A 4PLIA 1VYUA 1QKXA 1LOJA 2HBWA 3DOGB 4HNUA 1D0YA 4C5GA 2DYIA 4KGZB 3BHTB 3CPFA 2QQRA 3HKSA 3EIDB 2EYYA 2ZAEA 3HHTB 1NEGA 3M0UA 5CIUA 1O9KB 5GANj 4CFMB 5FRMA 3I55A 2DL5A 1FXXA 1WFWA 1SG5A 3JCMV 4DBQA 2LNVA 1UE9A 5HCKA 3BHUB 1WGSA 4DEXA 1X27A 4JJBA 1AZEA 4M7DC 1FYNA 3FEOA 1FMKA 5GAMh 1VQMA 2I0NA 3VKGA 5D7UA 5HK0A 1GCQA 1NM7A 4BXXX 1WHGA 1I07A 4BCIB 2JTEA 5FW9A 2X9HA 3TW6A 2RNAA 3ER0A 4OGCA 5GAOq 3N5BB 3JCMg 3MIAB 1UGQB 3HP9A 3MY1B 1VQ5Q 1NLPC 4M77F 4XTWA 4J9EA 3RMSA 1Q82R 2F2CA 3LYIA 2QK0A 4BDYA 5LMKB 1S72Q 2XG8D 3HSBA 3CMAQ 3CCQT 3SWNC 1K9MC 1T3LA 5IH2A 1KXUA 1Z9ZA 4EPCA 2A3LA 1VQ9T 1PSEA 4M4ZA 1YI2Q 3G6ET 3TREA 1AEYA 4N4HA 2RHIA 1T0HA 4M77D 3M0QA 4IUVA 3UDCA 2UZDB 1VQ4Q 4PJOE 3LGLA 1J3TA 1PG5B 4Z88A 4F6UB 1VYTA 1YJ9A 4DEYA 1PD1A 2WFYB 3CXCS 4C0DB 1NPPA 4C8QB 3CPWA 3LX7A 1PNJA 2YUOA 3TSWA 4XU3A 2EYXA 2YLCA 2W9ZA 5HNBB 1R0CB 3M59A 3PGGA 3RESA 3FC3A 3QYGB 2E6NA 1ZA2B 3CCLT 4A63B 3EG9B 1YHQQ 2EQJA 4M7DA 4HCKA 1SSHA 2FZKB 5DM7R 5HQ0B 1EZZB 3JCMP 2E65A 1WQ7A 2DXTA 2QQBA 4BE0A 4JS4A 1W2BP 4HVUA 3K7AM 1SPKA 2COWA 3BY7A 3VRZA 3OYYA 4J6YA 2CZ0B 4N4GA 4CRIA 5I11A 1U06A 2LP5A 3DLMA 1HK9A 3SFMA 3OA6A 4FSSA 4MZPA 3CCVT 3G1JA 3DB3A 2K5FA 3E19A 3E9FA 2DLPA 1KC8R 3SDZA 2L8DA 2EYZA 1K0SA 2CREA 2ZPFB 1M30A 2X4XA 1OPKA 2A28A 3S3NA 3QHWB 1VQ4A 3EG9A 1AWOA 2EPDA 4J9FA 1VQOA 3M56A 4C92A 3JB9G 1Y57A 2OX7A 4DOVA 2DRKA 4RTZA 4M75B 1QWEA 2PVDB 3FJ5A 2AT1B 2RK2A 3DDQB 4II1A 2F2XA 1QCFA 1W70A 2L5QA 2FL7A 3X26B 4JRIA 1QW1A 1ACMB 4C0ZA 1I5LA 2EGEA 1NPRA 3EGDA 4XU1A 3OYFA 3JV3A 1QMZB 2KYBA 2NUZA 1YJNQ 2F1LA 3PO3S 3OY9A 5FLXE 2CSQA 5IHNA 1JBMA 3V7RA 2KK4A 4LDWA 2DERA 3CC4A 4Y28E 3CCSQ 2JTFA 5J39A 3CCJT 1Q81U 2QDYB 1D0ZA 1VQLQ 1OX9A 2CS7A 2KT1A 2PMIB 1O9SA 3EG0A 1AVZC 2KROA 2M02A 4MDWA 3TNHB 5KCOA 4QSHA 3OYDA 4DQ2A 1VQLT 2H8HA 4OMPA 1V76A 2EKHA 2QEXA 3HB9A 2DXBB 2F2WA 2KAFA 2LJ0A 1S1NA 2AKLA 2LRQA 3HRTA 3P8BB 2BE9B 1BI0A 4PL6A 5FU7B 4FYXB 2OAUA 3GBQA 1WDXA 4CFWB 2VVKA 2G3RA 2RI2A 2X4WA 2XDDA 1OOTA 1EFNA 1WI7A 1ZHIA 3DLLA 5KYYA 2E41A 2O4XB 4M7AG 4WCIA 1N5ZA 2RQRA 4HLQA 5GAN4 3QZ5B 1T3SA 4F7SB 2D0QB 2KI7A 3CC4T 4Z89A 4AMCA 3S3OA 3OMCA 1FINB 1TSFA 3QIIA 1YIJA 3M03A 3J80E 4C8QD 2CP2A 1SKUB 5AT1B 4M75E 3QXEB 3OS0A 4M77B 3JSCA 2YUQA 2BPMB 1VQLA 1YJWT 1VQNT 1GH6B 2HL5C 3HRSA 1K73R 2K7AA 3FRNA 4PK4A 3ULRB 2QA4Q 5IAYA 3CC2Q 2G9XB 4Z6YA 4FL6A 2NWMA 1VQNA 4F04B 1M8VA 4OB2B 1UHCA 3CCEA 4MDXA 1G3SA 2O2OA 5A0GA 2GF7A 3BG9A 2WSEE 2WPAB 4C92F 4AKIA 3QBYA 4NS5A 2QFZA 2XHCA 3CMAA 5C0MA 4HCCA 4C0DC 3EG1A 3QWXX 2HZYA 4JZ3A 2IPOB 2K3BA 3JCMX 2PNIA 5HBHB 4HVVA 3HZJA 3EH1A 2RI5A 2B86A 2HKQB 5M9OA 1RAGB 1ZBXA 2JS0A 2WXVB 4R55A 3CCUT 4BCQD 4AKGA 2W10A 1QLYA 2XDPA 3NDQA 4JX6A 1H28B 4HVWA 4KULA 1JSTB 5IDPB 4E7LA 1B34A 2MK5A 4BCNB 4M7AB 1WZOA 5AYFA 2P0KA 3VS2A 3RGFB 4QQ6A 1JJ2P 2MMPA 1E9HB 4OGRB 1N9RA 1YHQA 3M9QA 4XAXB 3PT9A 1VQ7T 2HAXA 3BLHB 4M7DE 2HQXA 3CD6Q 3LGFA 1D3BA 4QKUA 1VQPT 3CMEQ 3OYLA 1F5QB 4BY6B 2EFIA 3MP8A 1UJ0A 1OEBA 1VIEA 3CCUQ 2QQAA 3SB2A 1BU1A 1ZSGA 3FJPA 3G4ST 1JQQA 2JXBA 2QGFB 5GMKm 2V8JA 2Y90A 4LUDA 2DNUA 2LW4A 1ZLMA 2HBPA 2QDLA 4HCBA 5GANd 1PC0A 2L2PA 2P0PA 1GL5A 5GANg 3EGUA 2JNGA 1CSKA 5L2WB 4BD3A 3H0IA 1YN8A 2K57A 2M51A 4MFDA 4R0KA 3VJPA 2LX9A 4BE1A 3QYHB 5IF1B 1BIBA 5KYUB 5LJ3j 2LCCA 4BCND 5KYWB 2GFUA 3MHXA 1ZUYA 2VXFA 2QXFA 2NYSA 1VQ9A 3PIOA 4KUIA 3G6EA 2ZCFB 1BYMA 3QDRB 2QQ8A 2VGNA 4LDXA 5LJ3e 3QWYA 3OYKA 2OAWA 5IT9E 1XQHA 3U23A 4ATOA 4II5B 2JTMA 4IIMA 1ARKA
chains in the Genus database with same CATH topology
4HKEA 3OYEA 4Q5WA 5GANe 1VQ5A 5KH6A 2YLBA 2RD1A 3PNWC 3PTAA 4MMKA 2YHTA 2GCXA 3I55T 2DXUA 1K8AC 4M78G 1VQ8T 4BBSM 3JAME 3BG3A 1AHJB 4PLIA 3INZA 2RHYA 3RERA 4A4GA 1LOJA 2RI3A 2DAQA 4YTLA 1YITT 1N9SA 1OZ2A 2JZ2A 1M1KU 1M1FA 1M9SA 3EFRA 3M57A 1D3BB 4J7IA 1VQMT 1VQ8A 3HL8A 3L2VA 3KBGA 2XD0A 4A4KA 3UPUA 4HNUA 2LT4A 4XTZA 5LJ5e 3QPHA 4C5GA 1VIFA 4IUPA 3CCLA 1V29B 1XNIA 5GAOl 3C12A 3EFSA 2CZ1B 3META 4BI3A 3CPFA 2EIFA 1Q82C 3JB9F 4E47A 2QQRA 2DK3A 2VXEA 3HKSA 4UC4A 3QG1A 4RCCA 2DIQA 2X35A 4FSXA 3HHTB 1W2BS 4HNTA 3A8LB 2DKGA 4JX5A 2RH2A 3VKIA 4OGEA 1YJ9T 5CIUA 1N8RU 2OTJA 3A8MB 5GANj 5FRMA 3WVDB 4C5HA 3I55A 4M75A 3OYJA 1FXXA 3JCMV 1YI2T 3HFOA 2LNVA 1M90U 4N4IA 2O4XA 5FROA 5GAN5 1G5VA 2DVEA 1WGSA 3RKYA 3OS1A 4M7AE 3V8LA 4M7DC 3CCMT 3VYHB 3FEOA 3OSVA 1G3WA 2PVGB 3OSSC 4LD6A 4M77E 5GAMh 2E64A 3VKHA 2M0OA 3GNFB 3KUFA 4L5GA 1VQMA 4CI0C 3VKGA 1QVPA 2XICA 1H3ZA 4M6VA 5CR2A 3CMET 3CC2T 4QVDA 5HK0A 5HK3A 3QZ9B 4A4HA 5GMKl 2E6ZA 3L2QA 2KMGA 4OB0B 1O75A 3CD6T 5LJ5j 3A8GB 1NZ9A 4A53A 1RI0A 1Q86U 1M90C 3DKMA 3P8HA 4XK8E 1YBYA 3JB9J 3TW6A 4WF2A 2MI6A 1YITA 3ER0A 4HCZA 1X6OA 2ZGWA 4OGCA 4RG8A 1QVGS 1ZQ1A 5GAOq 3N5BB 3JCMg 5CAIA 4C0GA 3HP9A 1UGQB 3L2UA 3QSUA 3MEVA 1S72T 1JRIA 5LL6S 3JB9I 4C92G 2QF7A 4M77F 4XTUA 2K2VA 4XTWA 2CGHA 5IN1A 2DPPB 1UGRB 3FIFA 3RMSA 4JS5A 3LYIA 4QVZA 4BDYA 2X4YA 4HT8A 1BI2A 3CCVA 1X75C 5GAN3 4M7DF 2XG8D 2VV5A 2R5MA 4ELJA 1G3TA 3HSBA 4ZGJB 3H4CA 3SWNC 3VV0A 3PMIA 2M16A 5LJ5f 3CCQT 4M78B 1W2BA 1K9MC 2JN0A 4EPCA 1H641 3ZFJA 2A3LA 3OYGA 4QVCA 3WVEB 1VQ9T 3OS2A 1PSEA 3X28B 3BDLA 1WNLA 4J83A 3G6ET 3TREA 1VQ6A 2Y4YA 1Q7YC 2LC4A 5FU7C 1VQKA 2RJDA 2RHIA 2DXBA 4N4HA 2V8KA 3C95A 2EJGA 1VQ4T 3MEAA 2H3JA 3L42A 4M77D 1QLBA 2ZPBB 4IUVA 2PUKB 3X20B 5FU6B 3UDCA 3ZBDA 1TH7A 2RB6A 4M78D 3LWHA 1VQKT 4ME7A 4O5VA 5GANf 3LGLA 4RMOA 4FIBA 4ZTJA 4FU6A 4PJOE 1I4K1 3OYIA 3M4GA 5GAMf 3OMGA 4JJNK 1YJ9A 3CBOA 4P5NA 1QVFA 3F70A 3CC7T 3CXCS 2CKKA 3A8HB 5GAN8 4C8QE 4C0DB 4DA4A 1NPPA 4C8QB 2ZPGB 3CPWA 5GMKi 3LX7A 2JOYA 1KD1C 3NTHA 4C8QA 4M7AF 4A4EA 1OYXA 2MAMA 3CC7A 4M7DG 4XU3A 1Q7YU 4QQGA 1VQOT 2KSSA 2YLCA 3M59A 3RESA 4A4FA 3MO8A 3PGGA 3FC3A 2RJEA 3OYHA 2L3RA 3QYGB 4LD9K 4QQDA 3NTIA 2E6NA 4NOYA 1M1GA 3CCLT 4J7FA 2GFAA 2RHZA 2QTXA 5I2MA 2HNIA 2EQJA 4IUTA 3TEEA 4D6WA 4M7DA 1K9MU 4LDYA 5DM7R 3CCQA 2WSFE 2E65A 2E1HA 3JCMP 3SWNA 2C06A 3MEWA 1WQ7A 2DXTA 2QQBA 4BE0A 4JS4A 5EJCA 1U8RA 1YJNA 3HBLA 5DY9A 3BY7A 3OYYA 2DZ9A 4J6YA 2CZ0B 4N4GA 3OYAA 4HL4A 2DD4B 4KBMB 2XKOC 2PUOB 4CRIA 3L2WA 4B9XA 1S72A 2CYZB 1KHIA 3DLMA 1HK9A 3SFMA 3OA6A 2KY9A 1HXDA 2HD0A 1YCYA 2VYTA 1WQWA 1Q81C 4VUBA 2PVOB 1PSFA 3X24B 4PKCC 3CCUA 4MZPA 2XU8A 3CCVT 1Q86C 2FVUA 3DB3A 4GY5A 2PU9B 3QJ6A 3Q1JA 3BW1A 4E7JA 4O6JA 2R58A 2K5FA 3E19A 4XQ3A 3E9FA 3JCMh 4NL3A 5D6YA 3SDZA 2K5IA 3DL1A 4HNVA 2L8DA 5A2QE 3JCMd 3X25B 2ZPFB 3PIPA 3CEYA 2X4XA 3TU4K 4E7IA 3QYEA 1X01A 3S3NA 1JJ2A 4J6XA 4ZGEB 1VQ4A 3SWNB 1VQOA 4KT0E 1N6AA 1WJRA 3M56A 4C5IA 4C92A 3JB9G 5GANh 4DOVA 2FHDA 3PMTA 2K4YA 2QI2A 3ASKA 4M75B 4M75C 2OTJT 1Y7XA 2PVDB 2VC8A 2X4JA 4ELZC 2ZPHB 5LJ3f 1QVGA 2QQ9A 2RHUA 3JCMJ 1MGQA 2RK1A 3BDUA 1G3YA 3RUXA 3JCMc 3AHUA 2DTHA 2RK2A 4M7DD 4HT9A 5I2SA 5CKHA 4II1A 4MMLA 3C4SA 3OYCA 3M58A 4C8QF 3GLXA 4PNOA 2L5QA 4XU0A 3EAEA 3WXMB 2P0QA 2FL7A 3TCJA 3X26B 1XTDA 4Y91A 4C8QG 3QJYA 4JRIA 3A8OB 1QW1A 5LJ5h 4C0ZA 3CC2A 3MP1A 1LNXA 3L1AA 1I5LA 4V2SA 1NPRA 2KDSA 3JCMf 4XU1A 1M1KC 3OB9A 5GAN7 2LTOA 1WPYA 3KHIA 3OYFA 4XTVA 2EKOA 3KXTA 4JRPA 3M54A 1KQSA 4PJOD 5L8RE 1IREB 1K8AU 3OY9A 5FLXE 2RHXA 4M75F 4LDVA 1JBMA 4M7AD 3V7RA 3GIBA 4IURA 2KK4A 4X34A 5HY6A 4LDWA 1FX7A 1BI3A 3H8ZA 1FWZA 3CC4A 4BE2A 3CMAT 3VU3C 1KQ2A 3CCRA 4PJOC 3BG5A 4AKHA 4Y28E 2JTFA 3HFNA 5J39A 3CCJT 1Q81U 3L2ZA 1QVFS 2QDYB 2R5AA 2KQWA 2CS7A 3ME9A 4C5EA 3HO8A 4C8QC 3MP6A 1O9SA 3M5AA 1MHNA 3CCRT 1QP2A 4KUDK 4LOCA 3OS5A 5GAMd 4MDWA 3URGA 3JCMb 3I56T 5KCOA 4QSHA 2DTIA 2K3YA 3OYDA 4DQ2A 4AI6A 1M4ZA 2QA4A 1VQLT 2RO0A 2QEXA 2A7YA 3HB9A 2DXBB 1I81A 1BKBA 2D9TA 4BB7A 2KAFA 4QW2A 4JDSA 4C92E 3OQ5A 2LRQA 3HRTA 4JLGA 2VGMA 3RMQA 5FU6C 3P8BB 5KCHA 4JLIA 3OW2S 2ZPEB 3E9GA 3T9NA 4FM4B 4ZN3A 5C6SA 4OVAA 1YJWA 3VUZA 2D6FA 4M78C 1BI0A 4PL6A 1DJ7B 1LJOA 1Y96B 3QHSA 3J81E 5FU7B 4X9DA 4E7HA 1WJQA 2OAUA 3NTKA 3V7SA 3G4SA 2LT1A 5DLOA 1Y07A 1KD1U 1WJSA 1E7PA 4IUQA 3JB9H 2G3RA 2RI2A 2XK0A 3LW5E 4RCBA 2X4WA 1M5Q1 2XDDA 2KR6A 3PFSA 1QP3A 4R56A 4M77A 5GMKj 1ZHIA 3DLLA 1KQSS 2RJFA 2E41A 2O01E 2O4XB 4M78A 4M7AG 3L2RA 4MIMA 4J6WA 5EG2A 3CPWS 3E1SA 3BFMA 4F7UA 4HLQA 3CCST 2HQEA 5GAN4 1VQ7A 3QZ5B 1KC8C 2CZ7B 3OYMA 5LJ3g 1K73U 1VUBA 4XTXA 2D0QB 3FLGA 4PJOA 1K73C 3LH0A 5CO7A 1KG1A 1SSFA 4M78F 3CC4T 3GF5A 3GNGA 4MZMA 3I56A 4EMHA 3OMCA 4ELYC 3S3OA 3C94A 4MZTA 2IVWA 3QIIA 3R6OA 4FT4A 1YIJA 5LJ3h 3J80E 1U1SA 2M9UA 2R57A 3HRUA 4OF1A 3VYGB 4BI8B 4C8QD 1YJNT 5GMKe 4M75E 3QXEB 1UB4A 3OS0A 4M77B 3JSCA 1YHQT 4BACA 2BS2A 3SD4A 5HKCA 2QA4T 1YJWT 1VQLA 2PQWA 4RKUE 2Y4XA 5CCAA 1UEBA 1VQNT 2F69A 3HRSA 5GAOn 3FRNA 2EQMA 5CKEA 4EMKA 5IAYA 2K5LA 4Z6YA 2BKDN 4FL6A 1VQNA 2WJ9A 1M8VA 4BY6C 2FYKA 4OB2B 1RL2A 1XOVA 1G3SA 5A0DA 2LVMA 3CCEA 4MDXA 4BBRM 5CKDA 2FB7A 5A0GA 2GF7A 3BG9A 2WSEE 4M7DB 2DXCA 3OBYA 3CMEA 4M77G 2KVQG 4N0AC 4XU2A 4C92F 3CD6A 4AKIA 1P92A 3UWNA 3QBYA 1U1TA 2DEQA 4NS5A 2QFZA 2BIVA 2XHCA 3OYBA 4M75D 3CMAA 5CQYA 3CCSA 5C0MA 2DTOA 3TW7A 5DLQE 3HPWA 5I21A 3CCJA 4OB3B 1W4SA 4HCCA 4XTYA 4C0DC 5KE3A 1UGPB 1OZ3A 4HA8A 5CKBA 5GAOp 1NJIC 4M7AA 4NC6A 3VYGA 2EQUA 2BUDA 4BDZA 1VQPA 4E7KA 1EIFA 1I8FA 2IG0A 2NLUA 3JCMX 4L6V5 3OBWA 4EMKB 3HZJA 4DOWA 2ZZDA 2RI5A 5CQXA 2V8IA 4C92D 5M9OA 1ZBXA 3QUIA 3NFCA 4R55A 3CCUT 1KQ1A 2BS3A 2QDJA 1BI1A 1Q82U 4AKGA 3MEUA 1N8RC 4C92C 5FRNA 2XDPA 3GP8A 4JX6A 3M55A 4J8OA 4F7UE 1VQ6T 3JCMe 4F7UB 2MWPA 2MF2A 2OTLT 4KULA 3S3MA 4A54A 4PJOF 4E7LA 2XIDA 1B34A 3O8VA 1JB0E 4M78E 3V8KA 4M7AB 5D6WA 5GAMj 3V7CA 3CCET 3OYNA 3OW2A 5AYFA 2L89A 2QQSA 2OTLA 2P0KA 3G71T 1GXIE 5GAMg 4Z02A 4OP0A 4QQ6A 2BS4A 2DO3A 2LQ8A 2MMPA 3QYBA 2B8AA 2ZZDB 3CBMA 3FB9A 4OB1B 3MCAB 4N0AA 1N9RA 1OI1A 2E10A 2P4TA 3RKXA 4EMKC 4GLKA 2ZPIB 3M9QA 1YHQA 4JRKA 3QWLA 4XAXB 3PT9A 2E5QA 2EYQA 2XI9A 4JX4A 2VUBA 3RKWA 4F7UG 5GAN6 1VQ7T 4PJOB 4F7UF 1Y96A 3H6ZA 3JCMQ 3A5ZB 4JRQA 5CK9A 2HAXA 2XDBA 1BIAA 2DD5B 4M7DE 2QEXT 1FKMA 2HQXA 3LWIA 3JB9D 2JUFA 1KC8U 2WACA 3LGFA 1D3BA 3FDRA 2E12A 5A0LA 1VQPT 5D6XA 3OYLA 1NE8A 3VUBA 4M77C 3RIRA 5GAOr 4BY6B 4ZTFA 5LJ5g 2AHJB 2DJZA 2EFIA 2LDMA 1KHCA 3MP8A 4JUVA 5J3BA 3CCMA 1NJIU 1VIEA 2F5KA 1B34B 2QQAA 2EJ9A 5CVIA 3SB2A 3FJPA 3G4ST 4B9WA 3JCMW 4IUUA 4PJOG 5KE2A 3QKJA 4BUGA 4OMFB 3M53A 1JJ2S 4L59A 2K3XA 2CZ6B 4X9CA 5GMKm 2V8JA 2Y90A 4J5YA 2EJFA 3ZEHA 2HBPA 3QO3A 5GMKh 2G77A 4HCBA 4ZGDB 2RA2A 5GANd 2RM4A 4PLLA 5J26A 4ZN1A 2P0PA 4RG2A 5GANg 3GPLA 2EQKA 2EAYA 3CXCA 2JNGA 2GQVA 2M1HA 3DB4A 2DZCA 3P8DA 4BD3A 2MWOA 5LJ3d 2K57A 4TVRA 4MFDA 3CBPA 3VJPA 1UGSB 4MFEA 2DD5A 2EWNA 1R8OB 3J7AF 2F5TX 2DIGA 2KMTA 2LX9A 3G7ZA 4BE1A 3V8JA 3QYHB 4IKFA 1BIBA 3GOXA 5LJ3j 4EMGA 5GAN2 2LQKA 2LCCA 5CKFA 3S6WA 2LCLA 5LJ5d 2DD4A 2GFUA 3MHXA 1YIJT 3LLRA 2VXFA 2YRVA 2QXFA 4BI4A 5GAOm 2RJCA 1VQ9A 4M7AC 1IZ6A 4LDUA 2JVVA 3M4YA 3PIOA 4KUIA 3G6EA 2DXCB 4C0FA 2ZCFB 2E70A 4M75G 3QDRB 1YI2A 1BYMA 2QQ8A 2VGNA 4LDXA 3G71A 2I2LA 5LJ3e 3OYKA 1N27A 3JRZA 4NL2A 1XQHA 4C92B 5IT9E 1VQ5T 4ATOA 4FT2A 1Y71A 3UT1A 2JTMA 5GAMe 2WSCE 4EDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QDY B;  4L6V 5;  3A8H B;  2ZZD A;  1QP2 A;  2ZPG B;  1AHJ B;  2DXB B;  3QYG B;  1JB0 E;  2ZPE B;  4FM4 B;  2WSF E;  1DJ7 B;  1V29 B;  2CZ1 B;  1GXI E;  2ZZD B;  2CZ0 B;  4OB1 B;  3HHT B;  3LW5 E;  2DD4 B;  2ZPI B;  3A8L B;  2PUO B;  2CYZ B;  3A8M B;  3WVD B;  1QP3 A;  2PVO B;  1PSF A;  3X24 B;  2O01 E;  2DD5 B;  2PU9 B;  3VYH B;  2PVG B;  3QZ5 B;  2CZ7 B;  2D0Q B;  2AHJ B;  3X25 B;  2ZPF B;  3QZ9 B;  4OB0 B;  3A8G B;  4ZGE B;  3VYG B;  4KT0 E;  4XK8 E;  2CZ6 B;  3QXE B;  2PVD B;  1UGQ B;  4ZGD B;  2ZPH B;  4RKU E;  2DPP B;  1UGR B;  1UGS B;  2DD5 A;  4OB2 B;  3X26 B;  4ZGJ B;  3A8O B;  3QYH B;  2WSE E;  3WVE B;  2DXC A;  1PSE A;  3X28 B;  2DD4 A;  2DXB A;  5L8R E;  1IRE B;  2ZPB B;  2PUK B;  3X20 B;  2DXC B;  2ZCF B;  4OB3 B;  1UGP B;  3VYG A;  4Y28 E;  2WSC E; 
#chains in the Genus database with same CATH topology
 4HKE A;  1HD3 A;  3OYE A;  4YOO A;  4YOZ A;  3PNW C;  4PJN A;  2CDT A;  3I55 T;  1YJW Q;  2DXU A;  2J6K A;  2FG0 A;  2DYB A;  3CC4 Q;  4ANJ A;  1OGU B;  1K1Z A;  2RHY A;  4A4G A;  4YTL A;  2JZ2 A;  1QKW A;  1P5E B;  1VQM T;  1KIK A;  3HL8 A;  2XD0 A;  1UNL D;  4A4K A;  3CC7 Q;  5KYU A;  2QYZ A;  2LT4 A;  3QPH A;  1OL2 B;  3CCL A;  4IUP A;  1V29 B;  4B6M A;  2EIF A;  4E47 A;  3GTM S;  2VXE A;  4UC4 A;  2WMB B;  1AD5 A;  3QG1 A;  4RCC A;  2X35 A;  4ROD A;  3VKI A;  2OTJ A;  2VWF A;  4C5H A;  4M75 A;  1YI2 T;  2P84 A;  4DBF A;  1M90 U;  5KYX A;  4F7J B;  5GAN 5;  3OS1 A;  4ROE A;  3I9Q A;  3V8L A;  3VYH B;  4LD6 A;  2GTO A;  2B9R A;  2M0O A;  3KUF A;  4L5G A;  1ZP2 A;  1H3Z A;  2XIC A;  4IMY B;  3EG2 A;  5CR2 A;  3CME T;  1PRL C;  5GMK l;  4A4H A;  3CD6 T;  3L2Q A;  1VQ9 Q;  4OMM A;  5LJ5 j;  2KGT A;  1RI0 A;  4XK8 E;  3JB9 J;  1YBY A;  4WF2 A;  2MI6 A;  1YIT A;  4HCZ A;  1X6O A;  3MKD A;  2DL7 A;  4RG8 A;  1QVG S;  1ZQ1 A;  1UUE A;  4C0G A;  2VAS A;  1WYX A;  1H1R B;  3JB9 I;  4CC2 A;  2K2V A;  4BCH B;  2CGH A;  2J05 A;  5IN1 A;  4JS5 A;  3EH2 A;  4QVZ A;  1ZA1 B;  2X4Y A;  4HT8 A;  1K4U S;  3H4C A;  4PJO D;  3PMI A;  2IIM A;  1W2B A;  1ZSZ B;  2JN0 A;  1H64 1;  3OS2 A;  3X28 B;  1H25 B;  1O9K A;  1Q7Y C;  2LC4 A;  2COZ A;  5FU7 C;  1RAC B;  2RJD A;  2DXB A;  1TD6 A;  2V26 A;  3BE3 A;  4Z8A A;  3MEA A;  1RAA B;  2MPX C;  3ZBD A;  1TH7 A;  2RB6 A;  3LWH A;  1MMA A;  4ME7 A;  1UHF A;  4RMO A;  4FIB A;  2WMA B;  1I4K 1;  2EGC A;  3REB B;  4JJN K;  4KGX B;  3VS5 A;  2KRM A;  2CCH B;  1PKT A;  1AWX A;  2JGZ B;  2MOX A;  2ZPG B;  4C8Q A;  2HKN A;  4M7D G;  1NYG A;  5IDN B;  5KYN A;  1VQO T;  2KSS A;  1VOM A;  1VOL A;  4NOY A;  1M1G A;  1SEM A;  4D6W A;  1BU2 A;  2CP7 A;  4LDY A;  1NBE B;  5I5Z B;  2E1H A;  3SWN A;  4GLM A;  1UTI A;  2I53 A;  3O5Z A;  5DY9 A;  3O0G D;  1AT1 B;  2DZ9 A;  2XKO C;  2PUO B;  3L2W A;  1S72 A;  1UNH D;  1KHI A;  3CCR Q;  2KT8 A;  2C0T A;  2HD0 A;  2VYT A;  4I3Z B;  1Q81 C;  4VUB A;  1TU0 B;  1PSF A;  3X24 B;  1Q86 C;  4EOR B;  1MV0 B;  3I5R A;  5CYI B;  2GNC A;  1HYO A;  2PU9 B;  3BW1 A;  4E7J A;  4E2F B;  4XQ3 A;  1ENW A;  3JCM h;  5D6Y A;  3M0S A;  4CFN B;  4GBQ A;  5A2Q E;  4D8K A;  2V22 B;  3CEY A;  2M0Y A;  4X1V A;  1JJ2 A;  1NEB A;  2BZY A;  1N6A A;  2PJQ A;  5GAN h;  2JW4 A;  3AT1 B;  2C6T B;  2ZPH B;  5LJ3 f;  2DVJ A;  1Y0M A;  1U5S A;  3RUX A;  1K8A R;  2AKK A;  5I2S A;  5CKH A;  2UZE B;  1VQ6 Q;  3TCJ A;  2CUD A;  1RLP C;  3CC2 A;  4V2S A;  2KDS A;  1LCK A;  2LQW A;  1AZG B;  1M1K C;  1GBR A;  4XTV A;  2EKO A;  3M54 A;  5CEI B;  4F70 B;  2H3E B;  1OQK A;  1K8A U;  1H3H A;  1WXB A;  4M75 F;  1GFD A;  1X69 A;  1QVG P;  4BCM B;  1IO6 A;  4X34 A;  2HL3 A;  2GBQ A;  1FX7 A;  3H8Z A;  4AG2 C;  1FWZ A;  3CMA T;  1KQ2 A;  3CCR A;  4AKH A;  2LZ6 B;  3HFN A;  2KQW A;  2QGS A;  4EOP B;  4C8Q C;  3MP6 A;  1NG2 A;  1MHN A;  3CCR T;  4KUD K;  5GAM d;  3URG A;  2BKZ B;  3JCM b;  2K3Y A;  1PHT A;  1H1P B;  2RO0 A;  2QG9 B;  2A7Y A;  1BKB A;  2D9T A;  4BB7 A;  1OIY B;  2E3H A;  4C92 E;  3OQ5 A;  1JU5 C;  5KCH A;  1I1J A;  1H27 B;  3T9N A;  1YJW A;  4OVA A;  1VQO Q;  4LE9 A;  3QHS A;  5IXB A;  2CT3 A;  2JJ9 A;  5DLO A;  1WJS A;  2XK0 A;  1H26 B;  4RCB A;  1M5Q 1;  1URC B;  2KR6 A;  1VQP Q;  4LNP A;  2O01 E;  4M78 A;  4MIM A;  4J6W A;  5EG2 A;  3E1S A;  4F7U A;  1VQ7 A;  2CZ7 B;  4PJL A;  2VB6 A;  1VUB A;  4XTX A;  3H41 A;  1XJW B;  1K73 C;  1KG1 A;  1SSF A;  2CH4 W;  3GF5 A;  4MZM A;  4EMH A;  1BCO A;  3EGD B;  4ELY C;  2IVW A;  4FT4 A;  1QVF P;  4OF1 A;  2M9U A;  5HBJ B;  1YJN T;  4F6W B;  4J9H A;  1WHH A;  1Q95 G;  3CCM Q;  1H8K A;  1H24 B;  4BAC A;  2BS2 A;  3SD4 A;  1UEB A;  4EMK A;  2CCI B;  2FEI A;  4EON B;  2RQT A;  1MMN A;  2LVM A;  4E7S A;  5CKD A;  2FB7 A;  4F6S B;  1M2O A;  3OBY A;  4M77 G;  4N0A C;  1P92 A;  2DEQ A;  2C5O B;  2FRY A;  5ECA A;  2F2V A;  4M75 D;  5DLQ E;  3PE0 A;  2OI3 A;  1W98 B;  1YP5 A;  4XTY A;  1YNZ A;  5CKB A;  2LCS A;  4JPB W;  3H9N A;  1VQP A;  1EIF A;  2DL8 A;  4L6V 5;  3OBW A;  4DOW A;  2ZZD A;  2V8I A;  4FX3 B;  2EW3 A;  1GRI A;  2YDL A;  1N8R C;  4C92 C;  3GP8 A;  4F7U E;  1VQ6 T;  2OTL T;  2RQW A;  3S3M A;  4A54 A;  2XID A;  1YIJ Q;  4M78 E;  1M1K R;  3V8K A;  1M90 R;  4OMN A;  5GAM j;  3V7C A;  4F7L B;  3OYN A;  1PRM C;  4PFZ A;  2QQS A;  2OTL A;  2FPD A;  4OML A;  3G71 T;  1GXI E;  4Z02 A;  3NHN A;  2BS4 A;  4N0A A;  3FB9 A;  4EMK C;  2W96 A;  4KH0 B;  2P4T A;  2AIR B;  4GLK A;  2ZPI B;  2BTT A;  3QWL A;  2MYS A;  3CPW P;  2E5Q A;  1MUZ A;  2XI9 A;  4JX4 A;  1OL1 B;  1Y96 A;  6AT1 B;  1BIA A;  2UZB B;  3JB9 D;  1FKM A;  2OTJ Q;  4UN0 A;  3FDR A;  5A0L A;  5ACB A;  2E12 A;  1JXO A;  3VUB A;  3EG3 A;  4M77 C;  1EX4 A;  1VA7 A;  1IXD A;  2AHJ B;  1G3N C;  2DJZ A;  2LDM A;  1NJI U;  1WX6 A;  2F5K A;  1M3B A;  4B9W A;  3TQ7 P;  4PJO G;  1KQS P;  3QKJ A;  3M53 A;  1JJ2 S;  1G8X A;  1KFZ A;  2J06 A;  1I0C A;  4HXJ A;  1OUL A;  1I5O B;  5IHK A;  5GMK h;  2G77 A;  2RA2 A;  4KRD B;  2RM4 A;  3PVQ A;  1PKD B;  5J26 A;  2L3Q A;  2EQK A;  5HBE B;  3CXC A;  2GQV A;  2M1H A;  2DZC A;  4TVR A;  1UGS B;  2DD5 A;  1PD0 A;  2DFU A;  1R8O B;  2DIG A;  2KMT A;  2KNB B;  2LQK A;  3CCJ Q;  2LCL A;  4ZNX A;  4FW1 A;  3LLR A;  2RJC A;  2KRN A;  3M4Y A;  1YI2 A;  5FWC A;  4NL2 A;  3JRZ A;  4C92 B;  1C9B A;  4FT2 A;  1D1A A;  3H0F A;  4EDU A;  1D1C A;  2XMF A;  1ZSZ A;  2HDA A;  5GAN e;  3M0R A;  3I5S A;  1Z9Q A;  2RD1 A;  3PTA A;  4MMK A;  2YRD A;  2YHT A;  1K8A C;  1VQ8 T;  2DA9 A;  2J6O A;  2P4R A;  1AHJ B;  2YSQ A;  3INZ A;  2RQV A;  3RER A;  1AIS B;  1H4L D;  2RI3 A;  1M1K U;  1YIT T;  1N9S A;  1OZ2 A;  1VQ8 A;  3M57 A;  1D3B B;  4J7I A;  1X2Q A;  1TFB A;  3UPU A;  2LX7 A;  4XTZ A;  3IQL A;  3QDF A;  3RNJ A;  2C5X B;  1VIF A;  5GAO l;  3C12 A;  3MET A;  3JB9 F;  1VQK Q;  4CRL B;  2DK3 A;  2KXC A;  2DIQ A;  2YT6 A;  1W2B S;  4ORZ A;  2DKG A;  2RH2 A;  1YJ9 T;  1N8R U;  4DBH A;  2DRM A;  3WVD B;  3HFO A;  4N4I A;  5FRO A;  4Y72 B;  1G5V A;  3RKY A;  1OPL A;  1G3W A;  2PVG B;  3OSV A;  4M77 E;  3VKH A;  3GNF B;  4CI0 C;  4M6V A;  2FPE A;  2E6Z A;  1O75 A;  1B7T A;  1GUX A;  4CC4 B;  1UEC A;  2CT4 A;  1Q86 U;  3P8H A;  1H92 A;  2ZGW A;  1A0N B;  3D7S B;  3L2U A;  5CAI A;  3QSU A;  1JRI A;  4C92 G;  1UNG D;  1M3C A;  2QF7 A;  4XTU A;  2DPP B;  2COY A;  3CCV A;  4M7D F;  2R5M A;  4ELJ A;  1G3T A;  5KYY B;  4ZGJ B;  5LJ5 f;  3VV0 A;  2C5N B;  2M16 A;  4M78 B;  4BCJ B;  3OYG A;  4QVC A;  3WVE B;  2EVR A;  1WNL A;  1VQN Q;  2V8K A;  3C95 A;  1B07 A;  2EJG A;  1VQ4 T;  2H3J A;  3L42 A;  4KRT A;  1QLB A;  1K9A A;  2PUK B;  4M78 D;  2FZC B;  5GJW B;  1NJI R;  4O5V A;  4ZTJ A;  2L0A A;  4FU6 A;  4PFP A;  3M4G A;  5GAM f;  2KR3 A;  1QVF A;  3F70 A;  1OU8 A;  2I40 B;  2AK5 A;  2CKK A;  2YXY A;  4DA4 A;  2CJM B;  4AFQ C;  2JOY A;  1Q7Y U;  1U3O A;  4QQG A;  5IHI A;  4LD9 K;  3MO8 A;  2RJE A;  3OYH A;  2L3R A;  3NTI A;  4J7F A;  2RHZ A;  2QTX A;  2HNI A;  4CFV B;  2DBM A;  2QEX Q;  3MEW A;  5EJC A;  1QWF A;  2EBP A;  2LMJ A;  1U8R A;  1RUW A;  1YWP A;  4KBM B;  1MMG A;  4B9X A;  2CYZ B;  1MMD A;  3EHR A;  2KY9 A;  1HXD A;  1WQW A;  4AFS C;  2PVO B;  2BZ8 A;  4PKC C;  2XU8 A;  3BHV B;  4NL3 A;  1MNE A;  2K5I A;  1PWT A;  4HNV A;  4K11 A;  1D0X A;  2OJ2 A;  1X43 A;  3QYE A;  4KT0 E;  1SF9 A;  4C5I A;  1R0B G;  2BZX A;  3PMT A;  2K4Y A;  3ASK A;  3H0H A;  4M75 C;  4EOS B;  1QVG A;  1TG0 A;  2JT4 A;  3JCM J;  2RK1 A;  3JCM c;  4HT9 A;  1M3A A;  5FGK B;  4BCQ B;  3C4S A;  3I35 A;  3M58 A;  4MML A;  4C8Q F;  3GLX A;  4PNO A;  3EAE A;  2P0Q A;  4C8Q G;  2L3P A;  3QJY A;  1PM3 A;  1TWB A;  4FCY A;  3L1A A;  3JCM f;  2FO0 A;  5GAN 7;  4EOI B;  3KHI A;  1WPY A;  3EJ1 B;  4KGV B;  5IHY A;  3KXT A;  4JRP A;  1SHG A;  1JEG A;  2GGR A;  1IRE B;  1OKV B;  4LDV A;  1OIU B;  4WTO B;  4M7A D;  3GIB A;  4IUR A;  1BI3 A;  3CXC P;  3VU3 C;  5HVY B;  3BG5 A;  1QMC A;  1RAF B;  1SHF A;  2RMO A;  3L2Z A;  1UDL A;  2CP6 A;  2R5A A;  2GQI A;  3ME9 A;  4C5E A;  3VS6 A;  3M5A A;  2EUF A;  4YOS A;  2D1X A;  2IW9 B;  4LOC A;  4AI6 A;  1M4Z A;  2QA4 A;  4JDS A;  1X6G A;  2JM8 A;  2K9G A;  2VGM A;  5FU6 C;  3OW2 S;  4BCM D;  4FM4 B;  2D6F A;  1ZBJ A;  1FMW A;  3J81 E;  1TUD A;  2ATC B;  4X9D A;  4BCF B;  1WHL A;  3NTK A;  3G4S A;  3UAT A;  3VRY A;  2LT1 A;  2SEM A;  2EQI A;  1KD1 U;  1Y07 A;  4BCG B;  1E7P A;  1QCO A;  3JB9 H;  2AZV A;  1RAI B;  2WHB B;  2YUP A;  1BB9 A;  4R56 A;  2G6F X;  3CCL Q;  1KQS S;  1MV3 A;  1WHM A;  2NUT B;  5IXF A;  2EGA A;  1KC8 C;  5LJ3 g;  1K73 U;  4OMQ A;  4EC9 B;  4RTY A;  2KYM A;  3REA B;  2D0N A;  4M78 F;  3I56 A;  4PJJ A;  3C94 A;  4MZT A;  1GCP A;  5LJ3 h;  1U1S A;  2R57 A;  3HRU A;  1X2K A;  1UB4 A;  4JZ4 A;  1YHQ T;  2QA4 T;  1RAD B;  5HKC A;  2PQW A;  2Y4X A;  2F69 A;  5GAO n;  5CKE A;  2KEA A;  2BKD N;  2DEU A;  2WJ9 A;  2CP3 A;  1TUG B;  2IN3 A;  4BY6 C;  1RL2 A;  5KYX B;  3RR6 A;  1ABO A;  5A0D A;  1E6H A;  4M7D B;  2JM9 A;  4CC7 A;  4PFO A;  1LPL A;  4XU2 A;  3THK A;  2WIP B;  2WEV B;  2BIV A;  1C0M A;  4F7N B;  3OYB A;  3CCS A;  5CQY A;  3HPW A;  2K6D A;  1W4S A;  1QCN A;  1OZ3 A;  1MND A;  2EYW A;  3M0P A;  4HA8 A;  5GAO p;  2C0O A;  1NJI C;  1IGQ A;  2EQU A;  4BDZ A;  4E7K A;  3NGP A;  2HSE B;  2O9S A;  4IIO A;  2ESW A;  4EIK A;  2W2H A;  4CFX B;  1K0X A;  4J9C A;  1KQ1 A;  2BS3 A;  1YCS B;  2QDJ A;  1T0J A;  4RTX A;  1BI1 A;  4TTH A;  1Q82 U;  5FRN A;  3I56 Q;  3JCM e;  4F7U B;  2E3I A;  1JB0 E;  1WHJ A;  5D6W A;  2JMC A;  1VQ8 Q;  3G33 B;  1SRM A;  4OP0 A;  2DO3 A;  8ATC B;  2ZZD B;  3MCA B;  1IB8 A;  3RKX A;  1OV3 A;  1RAB B;  3F5X B;  3VS3 A;  4LN2 A;  2EYQ A;  3UA6 A;  4PJO B;  4JJD A;  4F7U F;  3A5Z B;  5CK9 A;  4CFU D;  2QEX T;  1KC8 U;  2JUF A;  4OR5 B;  4ROC A;  1AOJ A;  4FYV B;  4FYY B;  1OU9 A;  2DJQ A;  1VIN A;  5D6X A;  1NE8 A;  5GAO r;  1YWO A;  3OW2 P;  5J3B A;  1RAE B;  4J9I A;  1B34 B;  5I22 A;  4IUU A;  5KE2 A;  1ZUU A;  4OMF B;  4L59 A;  4X9C A;  1C1A A;  4J5Y A;  2EJF A;  3QO3 A;  4ZGD B;  4PLL A;  4ZN1 A;  1QQJ A;  1WHK A;  3GPL A;  3DB4 A;  3P8D A;  1AWJ A;  1UJY A;  2MWO A;  2J7I A;  5LJ3 d;  4EOO B;  3CBP A;  4IKF A;  1F1B B;  3G7Z A;  3V8J A;  2LNH B;  5FWB A;  4EMG A;  5GAN 2;  7AT1 B;  5CKF A;  1VQM Q;  3RDV A;  2C5V B;  4LXC A;  5LJ5 d;  1YIJ T;  2YRV A;  4BI4 A;  2E5K A;  2OTL Q;  2UUE B;  1BK2 A;  4M7A C;  1IZ6 A;  2JVV A;  4C0F A;  4M75 G;  2ROL A;  1VQ5 T;  1JSU B;  5KYW A;  1Y71 A;  3UT1 A;  1N4M A;  5GAM e;  3TNW B;  3E9G A;  2DMO A;  3E2U A;  4Q5W A;  1VQ5 A;  5KH6 A;  2ECZ A;  2X51 A;  4F14 A;  2GCX A;  4D8D A;  3HTR A;  4BBS M;  2O88 A;  1JXM A;  3MPU B;  5EC7 A;  1M27 C;  2DAQ A;  2RN8 A;  1M1F A;  1M9S A;  3EFR A;  2O9V A;  1FVV B;  4EC8 B;  3L2V A;  3KBG A;  2ABL A;  5LJ5 e;  4Y92 A;  3EFO A;  2K2M A;  2O31 A;  1XO2 A;  2QAZ A;  1XNI A;  4PJO A;  1Q82 C;  3EFS A;  2CZ1 B;  1GY3 B;  4BI3 A;  3BLR B;  1Q7Y R;  4FSX A;  4HNT A;  3A8L B;  2KE9 A;  4JX5 A;  9ATC B;  4OGE A;  1VYW B;  3A8M B;  1TXQ A;  3OYJ A;  3QHR B;  1D3U B;  3G4S Q;  2O4X A;  2DVE A;  4M7A E;  1TTH B;  3CCM T;  3OSS C;  2UZL B;  1M8M A;  2E64 A;  3VS4 A;  1QVP A;  2HEQ A;  3CC2 T;  4QVD A;  3G6E Q;  5HK3 A;  3QZ9 B;  1IHW A;  2KMG A;  4OB0 B;  4AFU C;  3A8G B;  1NZ9 A;  4A53 A;  1IGU A;  2YUN A;  4EOL B;  1M90 C;  3DKM A;  1VQ7 Q;  2AZS A;  1OKW B;  3MEV A;  1S72 T;  5LL6 S;  1YFN A;  1UGR B;  3FIF A;  3R6N A;  1BI2 A;  1X75 C;  5GAN 3;  2VV5 A;  2V1R A;  1N8R R;  1W6X A;  3ZFJ A;  2RPN A;  1UFF A;  2E4H A;  3BDL A;  1BBZ A;  4J83 A;  1VQ6 A;  2Y4Y A;  3G71 Q;  1TS9 A;  3ZL7 C;  1VQK A;  3DDP B;  4KH1 B;  2ZPB B;  5FU6 B;  3X20 B;  3CQT A;  1VQK T;  3UA7 A;  5GAN f;  2K79 A;  1D09 B;  3OYI A;  1ZUK A;  3OMG A;  2J6F A;  1E7O A;  3CBO A;  2ENM A;  4P5N A;  3CC7 T;  5GAN 8;  3A8H B;  1C6V X;  4C8Q E;  1W1F A;  5GMK i;  1KD1 C;  3NTH A;  4M7A F;  1G2B A;  4A4E A;  1OYX A;  2MAM A;  3A1P A;  2KXD A;  3CC7 A;  4RTU A;  4CFU B;  4A4F A;  2ED0 A;  4FYW B;  4QQD A;  4E6R A;  2GFA A;  5I2M A;  4J9B A;  4IUT A;  3TEE A;  1YIT Q;  1K9M U;  1E6G A;  3CCQ A;  2WSF E;  2C06 A;  1M2V A;  4E7Z A;  1GUX B;  2DIL A;  1YJN A;  3HBL A;  1UGV A;  3OYA A;  5BNJ B;  4HL4 A;  2DD4 B;  4F16 A;  2IW6 B;  1YCY A;  2PK9 B;  1ZX6 A;  4OMO A;  2CSI A;  2HQH A;  3CCU A;  2FVU A;  3TNI B;  4GY5 A;  3TSZ A;  1NLO C;  2HCK A;  3Q1J A;  3QJ6 A;  4O6J A;  2R58 A;  3TVT A;  3DL1 A;  1HSQ A;  3MY5 B;  4ESR A;  3JCM d;  3X25 B;  3PIP A;  3EGX A;  3TU4 K;  1AD6 A;  4E7I A;  1X01 A;  4J6X A;  1Q81 R;  4ZGE B;  2IVX A;  1RI9 A;  2CP0 A;  4RTT A;  3SWN B;  2DF6 A;  1WJR A;  2QAS A;  1D1B A;  2FHD A;  3LQ5 B;  2QI2 A;  2OTJ T;  1Y7X A;  2VC8 A;  2X4J A;  4ELZ C;  2QQ9 A;  2RHU A;  2A36 A;  3RBB B;  1MGQ A;  3BDU A;  1G3Y A;  2PK2 A;  3AHU A;  2DTH A;  4M7D D;  4NST B;  3OYC A;  4LUE A;  2WIH B;  3WXM B;  4XU0 A;  3LH5 A;  4Y91 A;  1XTD A;  2DM1 A;  3MJX A;  3A8O B;  5LJ5 h;  2CH4 A;  4EOQ B;  1LNX A;  3MP1 A;  3OB9 A;  1VYV A;  2KRS A;  2LTO A;  2LJ3 A;  1WIE A;  3CCQ Q;  1KQS A;  5EFQ B;  2BE7 D;  1WXT A;  5L8R E;  2RHX A;  2FPF A;  4KRC B;  4AFZ C;  3BLQ B;  4EOM B;  5HY6 A;  1H1S B;  1RLQ C;  4BE2 A;  4PJO C;  4J9D A;  5GJV B;  1QVF S;  3HO8 A;  1KJW A;  1QP2 A;  1UG1 A;  3OS5 A;  3I56 T;  2DTI A;  2ROT A;  3SHW A;  1BCM A;  3VS0 A;  4EOK B;  5LQF B;  1I81 A;  2YWW A;  4QW2 A;  1ABQ A;  1GBQ A;  4JLG A;  3CCE Q;  3RMQ A;  4JLI A;  2X1N B;  2JS2 A;  2ZPE B;  2DME A;  4ZN3 A;  5C6S A;  3VUZ A;  1KSW A;  4M78 C;  3VS7 A;  1DJ7 B;  1LJO A;  1Y96 B;  3I55 Q;  5DQV A;  4F17 A;  4E7H A;  1WJQ A;  3V7S A;  2MCN A;  4IUQ A;  1AWW A;  8AT1 B;  2D8H A;  3LW5 E;  1M2V B;  2DE0 X;  4J9G A;  3POM A;  1V1C A;  3PFS A;  1QP3 A;  1GFC A;  4M77 A;  5GMK j;  1Q86 R;  2RJF A;  4BY7 X;  1K9M R;  3L2R A;  1TOV A;  3CPW S;  2HMA A;  3BFM A;  3CCS T;  2HQE A;  2GTJ A;  2ED1 A;  3OYM A;  3EHQ A;  4BCP B;  1PCX A;  3FLG A;  4JJC A;  1B3Q A;  3LH0 A;  5CO7 A;  3SEM A;  2FRW A;  2LJ1 A;  3GNG A;  2CUB A;  4DBR A;  4RTV A;  1K76 A;  3R6O A;  2YRC A;  4BI8 B;  1OI9 B;  3VYG B;  5ICP B;  3NMZ C;  4AT1 B;  5GMK e;  4BY1 X;  2VKN A;  3EGX B;  2RQU A;  2SRC A;  2A08 A;  4RKU E;  5CCA A;  2L3S A;  3DJB A;  1PKS A;  2EQM A;  1GCQ C;  2K5L A;  2QTV A;  2KBT A;  4CXA B;  3DTO A;  1NYF A;  2FYK A;  1XOV A;  2C4G B;  2W99 A;  4BBR M;  2Z0W A;  2DXC A;  3CME A;  2KVQ G;  4YC3 B;  2X3X D;  3CD6 A;  3UWN A;  1U1T A;  4QT7 A;  3C0C A;  1YJ9 Q;  2LQN A;  2DBK A;  2DTO A;  3TW7 A;  5I21 A;  3M0T A;  3CCJ A;  4OB3 B;  2NUT A;  1RAH B;  5KE3 A;  1UGP B;  4M7A A;  3EFO B;  4NC6 A;  1G83 A;  3TN8 B;  3VYG A;  1WLP B;  2BUD A;  4RTW A;  1I8F A;  2IG0 A;  2NLU A;  1WXU A;  4PJM A;  4EMK B;  5CQX A;  4C92 D;  2FZG B;  5L23 A;  2NUP B;  3QUI A;  3NFC A;  1KD1 R;  2W9F A;  1TUC A;  1SRL A;  3MEU A;  2DX1 A;  4J8O A;  3M55 A;  2MWP A;  2MF2 A;  2V1Q A;  3PVL A;  4PJO F;  3A98 A;  3O8V A;  5DQW A;  2PZ1 A;  1ZSZ C;  3CCE T;  3OW2 A;  2L89 A;  2A0F B;  5GAM g;  2LQ8 A;  3CBM A;  3QYB A;  2B8A A;  3MI9 B;  1X6B A;  4OB1 B;  2DL3 A;  1OI1 A;  2E10 A;  4JRK A;  3EOC B;  1CKA A;  3RKW A;  2VUB A;  4F7U G;  5GAN 6;  3H6Z A;  3JCM Q;  4JRQ A;  2XDB A;  2QGG A;  2W0Z A;  2DD5 B;  4CC3 A;  3LWI A;  4ELL A;  2WAC A;  3UF4 A;  2NUP A;  3RIR A;  2MIO A;  4ZTF A;  5LJ5 g;  2DL4 A;  4JUV A;  1KHC A;  3CCM A;  1JOW A;  1OX8 A;  2EJ9 A;  5CVI A;  3JCM W;  4G6L B;  2D8J A;  4BUG A;  1LVK A;  2CZ6 B;  2K3X A;  3ZEH A;  4RUG A;  4RG2 A;  1R77 A;  2EAY A;  3KFV A;  3B57 A;  2PHG A;  2EWN A;  4MFE A;  2IW8 B;  3J7A F;  2F5T X;  1JKW A;  2JMA A;  3GOX A;  3CCV Q;  1JO8 A;  2HSP A;  3S6W A;  2CP5 A;  2DD4 A;  2DET A;  5GAO m;  1WA7 A;  2RF0 A;  3NPF A;  2R7G A;  4LDU A;  1FMV A;  2C0I A;  2DXC B;  2E70 A;  1HJD A;  1IRX A;  1KK7 A;  3G71 A;  2I2L A;  2A37 A;  2X3W D;  1N27 A;  1CKB A;  2PTK A;  2WSC E;  4EOJ B;  4AG1 C;  1H1Q B;  1IHV A;  4BCO B;  2YLB A;  4BCK B;  4M78 G;  4FW2 A;  3JAM E;  3BG3 A;  3VS1 A;  4PLI A;  1VYU A;  1QKX A;  1LOJ A;  2HBW A;  3DOG B;  4HNU A;  1D0Y A;  4C5G A;  2DYI A;  4KGZ B;  3BHT B;  3CPF A;  2QQR A;  3HKS A;  3EID B;  2EYY A;  2ZAE A;  3HHT B;  1NEG A;  3M0U A;  5CIU A;  1O9K B;  5GAN j;  4CFM B;  5FRM A;  3I55 A;  2DL5 A;  1FXX A;  1WFW A;  1SG5 A;  3JCM V;  4DBQ A;  2LNV A;  1UE9 A;  5HCK A;  3BHU B;  1WGS A;  4DEX A;  1X27 A;  4JJB A;  1AZE A;  4M7D C;  1FYN A;  3FEO A;  1FMK A;  5GAM h;  1VQM A;  2I0N A;  3VKG A;  5D7U A;  5HK0 A;  1GCQ A;  1NM7 A;  4BXX X;  1WHG A;  1I07 A;  4BCI B;  2JTE A;  5FW9 A;  2X9H A;  3TW6 A;  2RNA A;  3ER0 A;  4OGC A;  5GAO q;  3N5B B;  3JCM g;  3MIA B;  1UGQ B;  3HP9 A;  3MY1 B;  1VQ5 Q;  1NLP C;  4M77 F;  4XTW A;  4J9E A;  3RMS A;  1Q82 R;  2F2C A;  3LYI A;  2QK0 A;  4BDY A;  5LMK B;  1S72 Q;  2XG8 D;  3HSB A;  3CMA Q;  3CCQ T;  3SWN C;  1K9M C;  1T3L A;  5IH2 A;  1KXU A;  1Z9Z A;  4EPC A;  2A3L A;  1VQ9 T;  1PSE A;  4M4Z A;  1YI2 Q;  3G6E T;  3TRE A;  1AEY A;  4N4H A;  2RHI A;  1T0H A;  4M77 D;  3M0Q A;  4IUV A;  3UDC A;  2UZD B;  1VQ4 Q;  4PJO E;  3LGL A;  1J3T A;  1PG5 B;  4Z88 A;  4F6U B;  1VYT A;  1YJ9 A;  4DEY A;  1PD1 A;  2WFY B;  3CXC S;  4C0D B;  1NPP A;  4C8Q B;  3CPW A;  3LX7 A;  1PNJ A;  2YUO A;  3TSW A;  4XU3 A;  2EYX A;  2YLC A;  2W9Z A;  5HNB B;  1R0C B;  3M59 A;  3PGG A;  3RES A;  3FC3 A;  3QYG B;  2E6N A;  1ZA2 B;  3CCL T;  4A63 B;  3EG9 B;  1YHQ Q;  2EQJ A;  4M7D A;  4HCK A;  1SSH A;  2FZK B;  5DM7 R;  5HQ0 B;  1EZZ B;  3JCM P;  2E65 A;  1WQ7 A;  2DXT A;  2QQB A;  4BE0 A;  4JS4 A;  1W2B P;  4HVU A;  3K7A M;  1SPK A;  2COW A;  3BY7 A;  3VRZ A;  3OYY A;  4J6Y A;  2CZ0 B;  4N4G A;  4CRI A;  5I11 A;  1U06 A;  2LP5 A;  3DLM A;  1HK9 A;  3SFM A;  3OA6 A;  4FSS A;  4MZP A;  3CCV T;  3G1J A;  3DB3 A;  2K5F A;  3E19 A;  3E9F A;  2DLP A;  1KC8 R;  3SDZ A;  2L8D A;  2EYZ A;  1K0S A;  2CRE A;  2ZPF B;  1M30 A;  2X4X A;  1OPK A;  2A28 A;  3S3N A;  3QHW B;  1VQ4 A;  3EG9 A;  1AWO A;  2EPD A;  4J9F A;  1VQO A;  3M56 A;  4C92 A;  3JB9 G;  1Y57 A;  2OX7 A;  4DOV A;  2DRK A;  4RTZ A;  4M75 B;  1QWE A;  2PVD B;  3FJ5 A;  2AT1 B;  2RK2 A;  3DDQ B;  4II1 A;  2F2X A;  1QCF A;  1W70 A;  2L5Q A;  2FL7 A;  3X26 B;  4JRI A;  1QW1 A;  1ACM B;  4C0Z A;  1I5L A;  2EGE A;  1NPR A;  3EGD A;  4XU1 A;  3OYF A;  3JV3 A;  1QMZ B;  2KYB A;  2NUZ A;  1YJN Q;  2F1L A;  3PO3 S;  3OY9 A;  5FLX E;  2CSQ A;  5IHN A;  1JBM A;  3V7R A;  2KK4 A;  4LDW A;  2DER A;  3CC4 A;  4Y28 E;  3CCS Q;  2JTF A;  5J39 A;  3CCJ T;  1Q81 U;  2QDY B;  1D0Z A;  1VQL Q;  1OX9 A;  2CS7 A;  2KT1 A;  2PMI B;  1O9S A;  3EG0 A;  1AVZ C;  2KRO A;  2M02 A;  4MDW A;  3TNH B;  5KCO A;  4QSH A;  3OYD A;  4DQ2 A;  1VQL T;  2H8H A;  4OMP A;  1V76 A;  2EKH A;  2QEX A;  3HB9 A;  2DXB B;  2F2W A;  2KAF A;  2LJ0 A;  1S1N A;  2AKL A;  2LRQ A;  3HRT A;  3P8B B;  2BE9 B;  1BI0 A;  4PL6 A;  5FU7 B;  4FYX B;  2OAU A;  3GBQ A;  1WDX A;  4CFW B;  2VVK A;  2G3R A;  2RI2 A;  2X4W A;  2XDD A;  1OOT A;  1EFN A;  1WI7 A;  1ZHI A;  3DLL A;  5KYY A;  2E41 A;  2O4X B;  4M7A G;  4WCI A;  1N5Z A;  2RQR A;  4HLQ A;  5GAN 4;  3QZ5 B;  1T3S A;  4F7S B;  2D0Q B;  2KI7 A;  3CC4 T;  4Z89 A;  4AMC A;  3S3O A;  3OMC A;  1FIN B;  1TSF A;  3QII A;  1YIJ A;  3M03 A;  3J80 E;  4C8Q D;  2CP2 A;  1SKU B;  5AT1 B;  4M75 E;  3QXE B;  3OS0 A;  4M77 B;  3JSC A;  2YUQ A;  2BPM B;  1VQL A;  1YJW T;  1VQN T;  1GH6 B;  2HL5 C;  3HRS A;  1K73 R;  2K7A A;  3FRN A;  4PK4 A;  3ULR B;  2QA4 Q;  5IAY A;  3CC2 Q;  2G9X B;  4Z6Y A;  4FL6 A;  2NWM A;  1VQN A;  4F04 B;  1M8V A;  4OB2 B;  1UHC A;  3CCE A;  4MDX A;  1G3S A;  2O2O A;  5A0G A;  2GF7 A;  3BG9 A;  2WSE E;  2WPA B;  4C92 F;  4AKI A;  3QBY A;  4NS5 A;  2QFZ A;  2XHC A;  3CMA A;  5C0M A;  4HCC A;  4C0D C;  3EG1 A;  3QWX X;  2HZY A;  4JZ3 A;  2IPO B;  2K3B A;  3JCM X;  2PNI A;  5HBH B;  4HVV A;  3HZJ A;  3EH1 A;  2RI5 A;  2B86 A;  2HKQ B;  5M9O A;  1RAG B;  1ZBX A;  2JS0 A;  2WXV B;  4R55 A;  3CCU T;  4BCQ D;  4AKG A;  2W10 A;  1QLY A;  2XDP A;  3NDQ A;  4JX6 A;  1H28 B;  4HVW A;  4KUL A;  1JST B;  5IDP B;  4E7L A;  1B34 A;  2MK5 A;  4BCN B;  4M7A B;  1WZO A;  5AYF A;  2P0K A;  3VS2 A;  3RGF B;  4QQ6 A;  1JJ2 P;  2MMP A;  1E9H B;  4OGR B;  1N9R A;  1YHQ A;  3M9Q A;  4XAX B;  3PT9 A;  1VQ7 T;  2HAX A;  3BLH B;  4M7D E;  2HQX A;  3CD6 Q;  3LGF A;  1D3B A;  4QKU A;  1VQP T;  3CME Q;  3OYL A;  1F5Q B;  4BY6 B;  2EFI A;  3MP8 A;  1UJ0 A;  1OEB A;  1VIE A;  3CCU Q;  2QQA A;  3SB2 A;  1BU1 A;  1ZSG A;  3FJP A;  3G4S T;  1JQQ A;  2JXB A;  2QGF B;  5GMK m;  2V8J A;  2Y90 A;  4LUD A;  2DNU A;  2LW4 A;  1ZLM A;  2HBP A;  2QDL A;  4HCB A;  5GAN d;  1PC0 A;  2L2P A;  2P0P A;  1GL5 A;  5GAN g;  3EGU A;  2JNG A;  1CSK A;  5L2W B;  4BD3 A;  3H0I A;  1YN8 A;  2K57 A;  2M51 A;  4MFD A;  4R0K A;  3VJP A;  2LX9 A;  4BE1 A;  3QYH B;  5IF1 B;  1BIB A;  5KYU B;  5LJ3 j;  2LCC A;  4BCN D;  5KYW B;  2GFU A;  3MHX A;  1ZUY A;  2VXF A;  2QXF A;  2NYS A;  1VQ9 A;  3PIO A;  4KUI A;  3G6E A;  2ZCF B;  1BYM A;  3QDR B;  2QQ8 A;  2VGN A;  4LDX A;  5LJ3 e;  3QWY A;  3OYK A;  2OAW A;  5IT9 E;  1XQH A;  3U23 A;  4ATO A;  4II5 B;  2JTM A;  4IIM A;  1ARK A; 
#chains in the Genus database with same CATH homology
 4HKE A;  3OYE A;  4Q5W A;  5GAN e;  1VQ5 A;  5KH6 A;  2YLB A;  2RD1 A;  3PNW C;  3PTA A;  4MMK A;  2YHT A;  2GCX A;  3I55 T;  2DXU A;  1K8A C;  4M78 G;  1VQ8 T;  4BBS M;  3JAM E;  3BG3 A;  1AHJ B;  4PLI A;  3INZ A;  2RHY A;  3RER A;  4A4G A;  1LOJ A;  2RI3 A;  2DAQ A;  4YTL A;  1YIT T;  1N9S A;  1OZ2 A;  2JZ2 A;  1M1K U;  1M1F A;  1M9S A;  3EFR A;  3M57 A;  1D3B B;  4J7I A;  1VQM T;  1VQ8 A;  3HL8 A;  3L2V A;  3KBG A;  2XD0 A;  4A4K A;  3UPU A;  4HNU A;  2LT4 A;  4XTZ A;  5LJ5 e;  3QPH A;  4C5G A;  1VIF A;  4IUP A;  3CCL A;  1V29 B;  1XNI A;  5GAO l;  3C12 A;  3EFS A;  2CZ1 B;  3MET A;  4BI3 A;  3CPF A;  2EIF A;  1Q82 C;  3JB9 F;  4E47 A;  2QQR A;  2DK3 A;  2VXE A;  3HKS A;  4UC4 A;  3QG1 A;  4RCC A;  2DIQ A;  2X35 A;  4FSX A;  3HHT B;  1W2B S;  4HNT A;  3A8L B;  2DKG A;  4JX5 A;  2RH2 A;  3VKI A;  4OGE A;  1YJ9 T;  5CIU A;  1N8R U;  2OTJ A;  3A8M B;  5GAN j;  5FRM A;  3WVD B;  4C5H A;  3I55 A;  4M75 A;  3OYJ A;  1FXX A;  3JCM V;  1YI2 T;  3HFO A;  2LNV A;  1M90 U;  4N4I A;  2O4X A;  5FRO A;  5GAN 5;  1G5V A;  2DVE A;  1WGS A;  3RKY A;  3OS1 A;  4M7A E;  3V8L A;  4M7D C;  3CCM T;  3VYH B;  3FEO A;  3OSV A;  1G3W A;  2PVG B;  3OSS C;  4LD6 A;  4M77 E;  5GAM h;  2E64 A;  3VKH A;  2M0O A;  3GNF B;  3KUF A;  4L5G A;  1VQM A;  4CI0 C;  3VKG A;  1QVP A;  2XIC A;  1H3Z A;  4M6V A;  5CR2 A;  3CME T;  3CC2 T;  4QVD A;  5HK0 A;  5HK3 A;  3QZ9 B;  4A4H A;  5GMK l;  2E6Z A;  3L2Q A;  2KMG A;  4OB0 B;  1O75 A;  3CD6 T;  5LJ5 j;  3A8G B;  1NZ9 A;  4A53 A;  1RI0 A;  1Q86 U;  1M90 C;  3DKM A;  3P8H A;  4XK8 E;  1YBY A;  3JB9 J;  3TW6 A;  4WF2 A;  2MI6 A;  1YIT A;  3ER0 A;  4HCZ A;  1X6O A;  2ZGW A;  4OGC A;  4RG8 A;  1QVG S;  1ZQ1 A;  5GAO q;  3N5B B;  3JCM g;  5CAI A;  4C0G A;  3HP9 A;  1UGQ B;  3L2U A;  3QSU A;  3MEV A;  1S72 T;  1JRI A;  5LL6 S;  3JB9 I;  4C92 G;  2QF7 A;  4M77 F;  4XTU A;  2K2V A;  4XTW A;  2CGH A;  5IN1 A;  2DPP B;  1UGR B;  3FIF A;  3RMS A;  4JS5 A;  3LYI A;  4QVZ A;  4BDY A;  2X4Y A;  4HT8 A;  1BI2 A;  3CCV A;  1X75 C;  5GAN 3;  4M7D F;  2XG8 D;  2VV5 A;  2R5M A;  4ELJ A;  1G3T A;  3HSB A;  4ZGJ B;  3H4C A;  3SWN C;  3VV0 A;  3PMI A;  2M16 A;  5LJ5 f;  3CCQ T;  4M78 B;  1W2B A;  1K9M C;  2JN0 A;  4EPC A;  1H64 1;  3ZFJ A;  2A3L A;  3OYG A;  4QVC A;  3WVE B;  1VQ9 T;  3OS2 A;  1PSE A;  3X28 B;  3BDL A;  1WNL A;  4J83 A;  3G6E T;  3TRE A;  1VQ6 A;  2Y4Y A;  1Q7Y C;  2LC4 A;  5FU7 C;  1VQK A;  2RJD A;  2RHI A;  2DXB A;  4N4H A;  2V8K A;  3C95 A;  2EJG A;  1VQ4 T;  3MEA A;  2H3J A;  3L42 A;  4M77 D;  1QLB A;  2ZPB B;  4IUV A;  2PUK B;  3X20 B;  5FU6 B;  3UDC A;  3ZBD A;  1TH7 A;  2RB6 A;  4M78 D;  3LWH A;  1VQK T;  4ME7 A;  4O5V A;  5GAN f;  3LGL A;  4RMO A;  4FIB A;  4ZTJ A;  4FU6 A;  4PJO E;  1I4K 1;  3OYI A;  3M4G A;  5GAM f;  3OMG A;  4JJN K;  1YJ9 A;  3CBO A;  4P5N A;  1QVF A;  3F70 A;  3CC7 T;  3CXC S;  2CKK A;  3A8H B;  5GAN 8;  4C8Q E;  4C0D B;  4DA4 A;  1NPP A;  4C8Q B;  2ZPG B;  3CPW A;  5GMK i;  3LX7 A;  2JOY A;  1KD1 C;  3NTH A;  4C8Q A;  4M7A F;  4A4E A;  1OYX A;  2MAM A;  3CC7 A;  4M7D G;  4XU3 A;  1Q7Y U;  4QQG A;  1VQO T;  2KSS A;  2YLC A;  3M59 A;  3RES A;  4A4F A;  3MO8 A;  3PGG A;  3FC3 A;  2RJE A;  3OYH A;  2L3R A;  3QYG B;  4LD9 K;  4QQD A;  3NTI A;  2E6N A;  4NOY A;  1M1G A;  3CCL T;  4J7F A;  2GFA A;  2RHZ A;  2QTX A;  5I2M A;  2HNI A;  2EQJ A;  4IUT A;  3TEE A;  4D6W A;  4M7D A;  1K9M U;  4LDY A;  5DM7 R;  3CCQ A;  2WSF E;  2E65 A;  2E1H A;  3JCM P;  3SWN A;  2C06 A;  3MEW A;  1WQ7 A;  2DXT A;  2QQB A;  4BE0 A;  4JS4 A;  5EJC A;  1U8R A;  1YJN A;  3HBL A;  5DY9 A;  3BY7 A;  3OYY A;  2DZ9 A;  4J6Y A;  2CZ0 B;  4N4G A;  3OYA A;  4HL4 A;  2DD4 B;  4KBM B;  2XKO C;  2PUO B;  4CRI A;  3L2W A;  4B9X A;  1S72 A;  2CYZ B;  1KHI A;  3DLM A;  1HK9 A;  3SFM A;  3OA6 A;  2KY9 A;  1HXD A;  2HD0 A;  1YCY A;  2VYT A;  1WQW A;  1Q81 C;  4VUB A;  2PVO B;  1PSF A;  3X24 B;  4PKC C;  3CCU A;  4MZP A;  2XU8 A;  3CCV T;  1Q86 C;  2FVU A;  3DB3 A;  4GY5 A;  2PU9 B;  3QJ6 A;  3Q1J A;  3BW1 A;  4E7J A;  4O6J A;  2R58 A;  2K5F A;  3E19 A;  4XQ3 A;  3E9F A;  3JCM h;  4NL3 A;  5D6Y A;  3SDZ A;  2K5I A;  3DL1 A;  4HNV A;  2L8D A;  5A2Q E;  3JCM d;  3X25 B;  2ZPF B;  3PIP A;  3CEY A;  2X4X A;  3TU4 K;  4E7I A;  3QYE A;  1X01 A;  3S3N A;  1JJ2 A;  4J6X A;  4ZGE B;  1VQ4 A;  3SWN B;  1VQO A;  4KT0 E;  1N6A A;  1WJR A;  3M56 A;  4C5I A;  4C92 A;  3JB9 G;  5GAN h;  4DOV A;  2FHD A;  3PMT A;  2K4Y A;  2QI2 A;  3ASK A;  4M75 B;  4M75 C;  2OTJ T;  1Y7X A;  2PVD B;  2VC8 A;  2X4J A;  4ELZ C;  2ZPH B;  5LJ3 f;  1QVG A;  2QQ9 A;  2RHU A;  3JCM J;  1MGQ A;  2RK1 A;  3BDU A;  1G3Y A;  3RUX A;  3JCM c;  3AHU A;  2DTH A;  2RK2 A;  4M7D D;  4HT9 A;  5I2S A;  5CKH A;  4II1 A;  4MML A;  3C4S A;  3OYC A;  3M58 A;  4C8Q F;  3GLX A;  4PNO A;  2L5Q A;  4XU0 A;  3EAE A;  3WXM B;  2P0Q A;  2FL7 A;  3TCJ A;  3X26 B;  1XTD A;  4Y91 A;  4C8Q G;  3QJY A;  4JRI A;  3A8O B;  1QW1 A;  5LJ5 h;  4C0Z A;  3CC2 A;  3MP1 A;  1LNX A;  3L1A A;  1I5L A;  4V2S A;  1NPR A;  2KDS A;  3JCM f;  4XU1 A;  1M1K C;  3OB9 A;  5GAN 7;  2LTO A;  1WPY A;  3KHI A;  3OYF A;  4XTV A;  2EKO A;  3KXT A;  4JRP A;  3M54 A;  1KQS A;  4PJO D;  5L8R E;  1IRE B;  1K8A U;  3OY9 A;  5FLX E;  2RHX A;  4M75 F;  4LDV A;  1JBM A;  4M7A D;  3V7R A;  3GIB A;  4IUR A;  2KK4 A;  4X34 A;  5HY6 A;  4LDW A;  1FX7 A;  1BI3 A;  3H8Z A;  1FWZ A;  3CC4 A;  4BE2 A;  3CMA T;  3VU3 C;  1KQ2 A;  3CCR A;  4PJO C;  3BG5 A;  4AKH A;  4Y28 E;  2JTF A;  3HFN A;  5J39 A;  3CCJ T;  1Q81 U;  3L2Z A;  1QVF S;  2QDY B;  2R5A A;  2KQW A;  2CS7 A;  3ME9 A;  4C5E A;  3HO8 A;  4C8Q C;  3MP6 A;  1O9S A;  3M5A A;  1MHN A;  3CCR T;  1QP2 A;  4KUD K;  4LOC A;  3OS5 A;  5GAM d;  4MDW A;  3URG A;  3JCM b;  3I56 T;  5KCO A;  4QSH A;  2DTI A;  2K3Y A;  3OYD A;  4DQ2 A;  4AI6 A;  1M4Z A;  2QA4 A;  1VQL T;  2RO0 A;  2QEX A;  2A7Y A;  3HB9 A;  2DXB B;  1I81 A;  1BKB A;  2D9T A;  4BB7 A;  2KAF A;  4QW2 A;  4JDS A;  4C92 E;  3OQ5 A;  2LRQ A;  3HRT A;  4JLG A;  2VGM A;  3RMQ A;  5FU6 C;  3P8B B;  5KCH A;  4JLI A;  3OW2 S;  2ZPE B;  3E9G A;  3T9N A;  4FM4 B;  4ZN3 A;  5C6S A;  4OVA A;  1YJW A;  3VUZ A;  2D6F A;  4M78 C;  1BI0 A;  4PL6 A;  1DJ7 B;  1LJO A;  1Y96 B;  3QHS A;  3J81 E;  5FU7 B;  4X9D A;  4E7H A;  1WJQ A;  2OAU A;  3NTK A;  3V7S A;  3G4S A;  2LT1 A;  5DLO A;  1Y07 A;  1KD1 U;  1WJS A;  1E7P A;  4IUQ A;  3JB9 H;  2G3R A;  2RI2 A;  2XK0 A;  3LW5 E;  4RCB A;  2X4W A;  1M5Q 1;  2XDD A;  2KR6 A;  3PFS A;  1QP3 A;  4R56 A;  4M77 A;  5GMK j;  1ZHI A;  3DLL A;  1KQS S;  2RJF A;  2E41 A;  2O01 E;  2O4X B;  4M78 A;  4M7A G;  3L2R A;  4MIM A;  4J6W A;  5EG2 A;  3CPW S;  3E1S A;  3BFM A;  4F7U A;  4HLQ A;  3CCS T;  2HQE A;  5GAN 4;  1VQ7 A;  3QZ5 B;  1KC8 C;  2CZ7 B;  3OYM A;  5LJ3 g;  1K73 U;  1VUB A;  4XTX A;  2D0Q B;  3FLG A;  4PJO A;  1K73 C;  3LH0 A;  5CO7 A;  1KG1 A;  1SSF A;  4M78 F;  3CC4 T;  3GF5 A;  3GNG A;  4MZM A;  3I56 A;  4EMH A;  3OMC A;  4ELY C;  3S3O A;  3C94 A;  4MZT A;  2IVW A;  3QII A;  3R6O A;  4FT4 A;  1YIJ A;  5LJ3 h;  3J80 E;  1U1S A;  2M9U A;  2R57 A;  3HRU A;  4OF1 A;  3VYG B;  4BI8 B;  4C8Q D;  1YJN T;  5GMK e;  4M75 E;  3QXE B;  1UB4 A;  3OS0 A;  4M77 B;  3JSC A;  1YHQ T;  4BAC A;  2BS2 A;  3SD4 A;  5HKC A;  2QA4 T;  1YJW T;  1VQL A;  2PQW A;  4RKU E;  2Y4X A;  5CCA A;  1UEB A;  1VQN T;  2F69 A;  3HRS A;  5GAO n;  3FRN A;  2EQM A;  5CKE A;  4EMK A;  5IAY A;  2K5L A;  4Z6Y A;  2BKD N;  4FL6 A;  1VQN A;  2WJ9 A;  1M8V A;  4BY6 C;  2FYK A;  4OB2 B;  1RL2 A;  1XOV A;  1G3S A;  5A0D A;  2LVM A;  3CCE A;  4MDX A;  4BBR M;  5CKD A;  2FB7 A;  5A0G A;  2GF7 A;  3BG9 A;  2WSE E;  4M7D B;  2DXC A;  3OBY A;  3CME A;  4M77 G;  2KVQ G;  4N0A C;  4XU2 A;  4C92 F;  3CD6 A;  4AKI A;  1P92 A;  3UWN A;  3QBY A;  1U1T A;  2DEQ A;  4NS5 A;  2QFZ A;  2BIV A;  2XHC A;  3OYB A;  4M75 D;  3CMA A;  5CQY A;  3CCS A;  5C0M A;  2DTO A;  3TW7 A;  5DLQ E;  3HPW A;  5I21 A;  3CCJ A;  4OB3 B;  1W4S A;  4HCC A;  4XTY A;  4C0D C;  5KE3 A;  1UGP B;  1OZ3 A;  4HA8 A;  5CKB A;  5GAO p;  1NJI C;  4M7A A;  4NC6 A;  3VYG A;  2EQU A;  2BUD A;  4BDZ A;  1VQP A;  4E7K A;  1EIF A;  1I8F A;  2IG0 A;  2NLU A;  3JCM X;  4L6V 5;  3OBW A;  4EMK B;  3HZJ A;  4DOW A;  2ZZD A;  2RI5 A;  5CQX A;  2V8I A;  4C92 D;  5M9O A;  1ZBX A;  3QUI A;  3NFC A;  4R55 A;  3CCU T;  1KQ1 A;  2BS3 A;  2QDJ A;  1BI1 A;  1Q82 U;  4AKG A;  3MEU A;  1N8R C;  4C92 C;  5FRN A;  2XDP A;  3GP8 A;  4JX6 A;  3M55 A;  4J8O A;  4F7U E;  1VQ6 T;  3JCM e;  4F7U B;  2MWP A;  2MF2 A;  2OTL T;  4KUL A;  3S3M A;  4A54 A;  4PJO F;  4E7L A;  2XID A;  1B34 A;  3O8V A;  1JB0 E;  4M78 E;  3V8K A;  4M7A B;  5D6W A;  5GAM j;  3V7C A;  3CCE T;  3OYN A;  3OW2 A;  5AYF A;  2L89 A;  2QQS A;  2OTL A;  2P0K A;  3G71 T;  1GXI E;  5GAM g;  4Z02 A;  4OP0 A;  4QQ6 A;  2BS4 A;  2DO3 A;  2LQ8 A;  2MMP A;  3QYB A;  2B8A A;  2ZZD B;  3CBM A;  3FB9 A;  4OB1 B;  3MCA B;  4N0A A;  1N9R A;  1OI1 A;  2E10 A;  2P4T A;  3RKX A;  4EMK C;  4GLK A;  2ZPI B;  3M9Q A;  1YHQ A;  4JRK A;  3QWL A;  4XAX B;  3PT9 A;  2E5Q A;  2EYQ A;  2XI9 A;  4JX4 A;  2VUB A;  3RKW A;  4F7U G;  5GAN 6;  1VQ7 T;  4PJO B;  4F7U F;  1Y96 A;  3H6Z A;  3JCM Q;  3A5Z B;  4JRQ A;  5CK9 A;  2HAX A;  2XDB A;  1BIA A;  2DD5 B;  4M7D E;  2QEX T;  1FKM A;  2HQX A;  3LWI A;  3JB9 D;  2JUF A;  1KC8 U;  2WAC A;  3LGF A;  1D3B A;  3FDR A;  2E12 A;  5A0L A;  1VQP T;  5D6X A;  3OYL A;  1NE8 A;  3VUB A;  4M77 C;  3RIR A;  5GAO r;  4BY6 B;  4ZTF A;  5LJ5 g;  2AHJ B;  2DJZ A;  2EFI A;  2LDM A;  1KHC A;  3MP8 A;  4JUV A;  5J3B A;  3CCM A;  1NJI U;  1VIE A;  2F5K A;  1B34 B;  2QQA A;  2EJ9 A;  5CVI A;  3SB2 A;  3FJP A;  3G4S T;  4B9W A;  3JCM W;  4IUU A;  4PJO G;  5KE2 A;  3QKJ A;  4BUG A;  4OMF B;  3M53 A;  1JJ2 S;  4L59 A;  2K3X A;  2CZ6 B;  4X9C A;  5GMK m;  2V8J A;  2Y90 A;  4J5Y A;  2EJF A;  3ZEH A;  2HBP A;  3QO3 A;  5GMK h;  2G77 A;  4HCB A;  4ZGD B;  2RA2 A;  5GAN d;  2RM4 A;  4PLL A;  5J26 A;  4ZN1 A;  2P0P A;  4RG2 A;  5GAN g;  3GPL A;  2EQK A;  2EAY A;  3CXC A;  2JNG A;  2GQV A;  2M1H A;  3DB4 A;  2DZC A;  3P8D A;  4BD3 A;  2MWO A;  5LJ3 d;  2K57 A;  4TVR A;  4MFD A;  3CBP A;  3VJP A;  1UGS B;  4MFE A;  2DD5 A;  2EWN A;  1R8O B;  3J7A F;  2F5T X;  2DIG A;  2KMT A;  2LX9 A;  3G7Z A;  4BE1 A;  3V8J A;  3QYH B;  4IKF A;  1BIB A;  3GOX A;  5LJ3 j;  4EMG A;  5GAN 2;  2LQK A;  2LCC A;  5CKF A;  3S6W A;  2LCL A;  5LJ5 d;  2DD4 A;  2GFU A;  3MHX A;  1YIJ T;  3LLR A;  2VXF A;  2YRV A;  2QXF A;  4BI4 A;  5GAO m;  2RJC A;  1VQ9 A;  4M7A C;  1IZ6 A;  4LDU A;  2JVV A;  3M4Y A;  3PIO A;  4KUI A;  3G6E A;  2DXC B;  4C0F A;  2ZCF B;  2E70 A;  4M75 G;  3QDR B;  1YI2 A;  1BYM A;  2QQ8 A;  2VGN A;  4LDX A;  3G71 A;  2I2L A;  5LJ3 e;  3OYK A;  1N27 A;  3JRZ A;  4NL2 A;  1XQH A;  4C92 B;  5IT9 E;  1VQ5 T;  4ATO A;  4FT2 A;  1Y71 A;  3UT1 A;  2JTM A;  5GAM e;  2WSC E;  4EDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...