4OB0B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob0B02
2DXBB 2CZ0B 2WSCE 2PUKB 2DXCB 4OB1B 2ZZDA 1QP2A 4ZGEB 1JB0E 3VYHB 2ZZDB 4OB3B 2DD4A 2PU9B 2ZPEB 2ZPIB 1UGPB 4L6V5 2DD4B 2CYZB 1PSFA 4ZGJB 2ZPBB 3VYGA 2CZ1B 3WVDB 4XK8E 2ZCFB 3A8MB 2DD5A 2ZPGB 3VYGB 2D0QB 2WSFE 3A8GB 2DD5B 1UGRB 3QZ5B 1UGQB 2WSEE 1DJ7B 3QXEB 1PSEA 4ZGDB 4RKUE 2DPPB 3WVEB 4KT0E 1AHJB 3X20B 3X25B 1IREB 3QYHB 4OB2B 1V29B 2PVOB 4OB0B 3X24B 1QP3A 3HHTB 1GXIE 5L8RE 2O01E 3QYGB 3A8LB 2CZ7B 3A8OB 2PVDB 3X26B 3X28B 4Y28E 2ZPFB 2PUOB 3LW5E 2PVGB 2QDYB 2CZ6B 3A8HB 2AHJB 4FM4B 2DXBA 1UGSB 3QZ9B 2ZPHB 2DXCA
chains in the Genus database with same CATH superfamily
3HBLA 4M75F 2DBMA 2LW4A 1I07A 3UPUA 2DF6A 5IHKA 1JB0E 5D7UA 4RG2A 3S3OA 3MY1B 3GNGA 1WJQA 4C8QE 2CH4A 1ZP2A 2DYBA 2EIFA 3CCMT 1D1CA 1WXUA 2MOXA 1QCOA 1OGUB 1K73R 5IH2A 2CZ1B 1B34B 4Q5WA 2LRQA 1WZOA 2UZLB 4QW2A 1VQ5T 3P8DA 2W96A 1WHMA 1VQPA 1QVFS 2OTLT 2V1RA 2EKHA 2RH2A 1YJNQ 1FXXA 2AZSA 4NL3A 1UGQB 4M78G 1UHFA 2DERA 4ZGDB 4HVVA 4PK4A 3TQ7P 4ZN1A 3WVEB 2BZYA 3PE0A 3JAME 4RCBA 1MNDA 2OTJT 3UA7A 1BYMA 2M0YA 2LQKA 1E7OA 2BZ8A 3MO8A 1GUXA 1VINA 1VA7A 2QQ8A 4F14A 3I56T 3QYHB 2F1LA 3JB9H 3PIPA 1YCSB 5FW9A 3OMCA 1GUXB 1B3QA 1K8AC 1KD1C 1YI2A 1D1BA 4C5IA 2P84A 2AIRB 3RKYA 2F2CA 1I1JA 3QO3A 1UNGD 4PJOA 3CCJT 3M0SA 5J3BA 1AEYA 2QGFB 2JM8A 2FYKA 1C0MA 4PJOB 1KHIA 2HDAA 2P0QA 1X6BA 2EWNA 2QK0A 4Y28E 1MHNA 2UUEB 1VYWB 4ORZA 2XDPA 4JZ4A 2F2WA 1P92A 5AT1B 4J9DA 4C92A 1QCNA 3TNHB 3L2ZA 1RAHB 3C4SA 3A8HB 1WJSA 1SSFA 2QQ9A 1NG2A 3GNFB 4C92B 3TW7A 1LJOA 3EGUA 4C8QD 4J9EA 4II5B 3CCMQ 2BPMB 4PLLA 1Q95G 3JSCA 4JRIA 4FYXB 1VOLA 2HAXA 4M7DE 4F7LB 1H1PB 1H26B 1NBEB 1U1SA 4FU6A 1VQ5Q 2D8JA 4NL2A 2OTLQ 2C0IA 2YT6A 1LVKA 1YJ9A 1GH6B 3NPFA 2W10A 1UGPB 5C0MA 1C6VX 1UFFA 4L6V5 2X4JA 4F6SB 2KRNA 2I2LA 2K57A 1QLYA 2QQAA 4BCGB 5GAN3 3FEOA 4J9BA 2JXBA 2OTJQ 3O5ZA 5A0LA 4JPBW 2ESWA 5KYUA 4DQ2A 2JUFA 4C0GA 3I56Q 2A3LA 2XDBA 5KYUB 4II1A 1JOWA 2DBKA 2JTEA 4TVRA 4I3ZB 3OB9A 3EG1A 5HBEB 1I4K1 4FYVB 4QQ6A 3M0TA 3CCJQ 1M1KC 1K9MR 4XTXA 2KVQG 2OAUA 4OGRB 2NWMA 2H3EB 1UE9A 1ZX6A 1PCXA 2MCNA 4HVUA 2K2VA 3I5RA 4A4KA 4UN0A 4O6JA 2YSQA 5GAMh 3SD4A 3CCUT 1ENWA 3S6WA 1KQ2A 1UJYA 3AHUA 3CCMA 2WPAB 2BS4A 3JV3A 1KJWA 5I22A 2YUPA 1GFCA 3A8OB 1NJIU 1VQ5A 2OTLA 1SEMA 2V26A 8AT1B 4LUDA 2DL5A 5LQFB 2FRWA 1G83A 4YOOA 2KROA 1UB4A 2LT1A 4HNTA 1H8KA 4F16A 2K6DA 4J6YA 3META 4KH0B 3CCET 2DXBA 2LCCA 2PQWA 2QEXT 2ATCB 1HJDA 3TEEA 1PD0A 3OYAA 5GJWB 2OTJA 1NLOC 2DXBB 4YOZA 4F6WB 4MFEA 2QDJA 3LH0A 1M27C 3I56A 3E1SA 4J7IA 3VS7A 1UG1A 3HO8A 1YITT 2L3QA 2K5IA 2V1QA 1UEBA 2J6OA 4JUVA 4FX3B 2VGNA 2DD4A 3T9NA 2C5XB 3HSBA 1OPLA 4M78D 1YP5A 1KQ1A 2CUBA 2PJQA 2F2XA 2BTTA 3VKHA 2X9HA 2DD4B 2DIGA 1RACB 1Y0MA 1JJ2A 2QTXA 2KE9A 4JJNK 1H25B 2HSEB 3VYGA 2DM1A 1TUCA 3M4GA 5LJ5j 2FB7A 2CJMB 2RK2A 2YLCA 4AFUC 1OKWB 3VYGB 2VXEA 4A4FA 5GAMe 3CMET 5GMKh 4PJOF 2M51A 3QXEB 1AWOA 4D6WA 2BIVA 2JTFA 1ZSGA 2K4YA 3OYHA 4BE2A 3BHTB 1UNLD 3KFVA 2DAQA 2LCSA 4Y91A 3RR6A 4CXAB 1VQMT 3CPWA 3JB9G 2JTMA 4XTWA 2YDLA 5CR2A 2XK0A 2K9GA 4N0AC 3CC7T 5GANh 4MZMA 4M75G 1M3BA 3HHTB 1FX7A 1U5SA 3CCEQ 4J6WA 2G9XB 2QEXQ 1TSFA 1NM7A 5KYYA 1PWTA 1U3OA 1AT1B 2O4XA 1XTDA 3X28B 5KYYB 2CS7A 1YITQ 1JXMA 2O4XB 1W98B 2PVGB 4HLQA 3PMTA 1XJWB 3KUFA 4IUQA 1BI0A 2ROTA 2F5TX 3OW2P 3EH1A 2RHXA 2R57A 1WDXA 1I5OB 1R77A 1M9SA 4F7NB 1H1SB 1KG1A 2PUKB 3DOGB 4PL6A 2ZZDA 3M03A 1MGQA 1UUEA 3QUIA 4RTTA 5ECAA 9ATCB 3QJ6A 1YHQT 2JS2A 2Z0WA 3M0PA 2ZZDB 2C5VB 3CMEQ 2L3PA 1K73U 2E1HA 5GMKe 4ME7A 2CYZB 1EZZB 1WHJA 4OR5B 1ZBJA 2O2OA 3EFRA 3NTKA 3CC2T 3G71T 1WIEA 1VQMQ 4PFOA 1I8FA 2L0AA 4V2SA 3DB4A 3TW6A 2D0QB 5KE2A 5KYXA 1X75C 2QEXA 3CC7Q 2RMOA 1DJ7B 3C0CA 5GANe 1X2QA 3CCQQ 1RAEB 2YRVA 2LJ3A 5KYXB 4OP0A 4BCQB 4X9CA 2HQHA 3CBPA 3H41A 4ESRA 4R55A 1YITA 3V7RA 4N0AA 5HKCA 5CQYA 2QQBA 2R7GA 1EFNA 2EQMA 2O9VA 3OYFA 5CCAA 2EW3A 3JCMd 4OB0B 3REBB 1YCYA 5L8RE 2O01E 3CC4T 4M6VA 1RL2A 4KBMB 5DM7R 2KNBB 2HCKA 3VS6A 2YLBA 3M59A 4F7UE 5GAN6 3I55Q 1FVVB 2PK9B 3R6NA 3EG0A 2GFUA 3L2RA 1KFZA 1BI3A 2CREA 2RHZA 1WX6A 3VJPA 4PNOA 3QBYA 4KUDK 2L2PA 1YHQQ 1HSQA 2RJEA 1LCKA 4X34A 1RAFB 1M8VA 3TNIB 4FW2A 5CQXA 1VQKT 3TSZA 3CCVT 1NJIC 1WYXA 5IDNB 5HCKA 5KH6A 1VQMA 1PRMC 2X3WD 1UECA 2RI5A 4J9FA 4BB7A 2RO0A 1JEGA 3IQLA 3O8VA 3CC2Q 3EG3A 1XQHA 4EC9B 1H1RB 1GRIA 3CC7A 3CCQA 1B7TA 1JQQA 5IHYA 2DK3A 5HK0A 4B6MA 2PU9B 3QHWB 2JVVA 1IHVA 1FWZA 4BACA 3BE3A 3QHSA 2C5OB 3RKXA 2CUDA 3M53A 4BXXX 5GAOn 3CCST 4M7AC 4WCIA 3S3NA 1ACMB 1YFNA 2GTJA 2GTOA 4M77C 1K9MU 5LJ3d 2KYBA 5IXFA 4OF1A 1H3ZA 4M75D 3OW2S 1YWPA 1QW1A 4NC6A 2I53A 4RTYA 4RKUE 4BBSM 3I55A 1QCFA 2LNHB 5LL6S 2L89A 1OQKA 3MEWA 2X4YA 2QQRA 3VU3C 1YHQA 2YRDA 2JM9A 3HTRA 2RJCA 3I5SA 3G33B 2V8KA 3FRNA 5GAMf 2XHCA 4XTZA 4IIMA 1VQNA 1E9HB 2PVOB 5LMKB 2KT1A 4C8QC 1XO2A 4C0ZA 1NE8A 2GQIA 1AD6A 3F5XB 1VQKQ 1M2VA 3BLQB 1N4MA 3EHQA 3ZEHA 3MI9B 1TS9A 3HP9A 4CC7A 3M55A 4OMMA 2PVDB 1M2VB 1RABB 2MPXC 4E7SA 4L5GA 4OMQA 5J26A 6AT1B 3RUXA 2D8HA 2MIOA 4A54A 3KHIA 4KGXB 1T0HA 3OYCA 4N4HA 2CP2A 4AMCA 2RHYA 3V7CA 4GBQA 3CCLT 4KRTA 2X35A 8ATCB 4R56A 1UNHD 4PJMA 3DB3A 1BCMA 4L59A 3QZ9B 2ZPHB 1OI9B 2K7AA 4EOLB 2FHDA 4EMHA 3OYBA 2RM4A 1Q81R 4PJOG 4ELJA 1E6GA 3CCSQ 4AI6A 3DTOA 2EGCA 5IDPB 4DA4A 2QG9B 2DYIA 2ABLA 3EAEA 3EH2A 3BLHB 1X01A 2DXTA 2F69A 4FW1A 2RPNA 1QMCA 3RIRA 2RI2A 2EYQA 1PM3A 2B9RA 1GCPA 2HBPA 1AWWA 3M0UA 4PLIA 3TN8B 3JB9F 4QT7A 1KHCA 2KYMA 4FIBA 1JJ2P 4C92G 4F04B 2HQEA 3SHWA 4M7AB 4AFSC 1OIYB 4M77A 5FROA 1D09B 4JX6A 2G6FX 5GAOl 4M77B 4F70B 1N8RR 2R5AA 1I0CA 4XU3A 1K73C 4BCJB 1MMNA 1VQKA 3SB2A 2E6NA 3JCMb 2KXDA 2FZGB 4EMKC 4M7DC 3G4ST 4A63B 4PJLA 4HT9A 3CPWP 1NPRA 5HBHB 1M90R 4Z8AA 1HYOA 4C8QA 2KR6A 5FWCA 3REAB 5CAIA 1VQ9A 5HY6A 5DQWA 1V29B 2W0ZA 1BI1A 4JDSA 5D6WA 4C8QB 5GANf 4Z89A 1KSWA 2KRSA 1RADB 2OX7A 3CCLQ 5GAMj 3OS0A 3M56A 1PKTA 5DQVA 2EQJA 2EPDA 2HEQA 3A8LB 2CZ7B 2FG0A 1ZBXA 1Z9QA 3EG2A 3RESA 1T3SA 4IUUA 1KC8U 2CCIB 2QDYB 2M02A 3QWXX 3MEVA 4DEXA 2K3BA 4WTOB 4X9DA 2HKQB 2RQUA 5CVIA 4ZTFA 3NFCA 4J6XA 4XU2A 3G7ZA 2YUNA 2XI9A 4BI3A 1PKDB 3HKSA 5GAMg 2DL7A 1GCQC 3FC3A 3THKA 4OMOA 3DL1A 2ZGWA 1QP2A 1BU1A 2IN3A 5EJCA 3MCAB 3QDFA 1URCB 3Q1JA 3H0IA 3H6ZA 4ZTJA 5A0DA 2JMCA 2DRKA 4ZGJB 3RKWA 2DVJA 3F70A 4RTUA 3CCRT 1K8AR 1KD1R 4AT1B 3G4SQ 3FIFA 4XK8E 2LDMA 3DLMA 1K76A 1OL2B 1KQSA 1YJNA 4D8DA 1JBMA 2C06A 5HNBB 1O9KA 1RLQC 1VQOT 2EYZA 3CCLA 2H3JA 1OOTA 4EMKA 2HD0A 4M7DA 3OYKA 1X2KA 1O9KB 1YWOA 3S3MA 4EMKB 4M7DB 1R0BG 5GAOm 2V8JA 3DDPB 2E10A 5GMKj 1IREB 1Y71A 4MDXA 4YTLA 1K9MC 3H0FA 4E7HA 2LQWA 3MEUA 1KXUA 4EOMB 2DTOA 4M78E 1TG0A 4RG8A 1VYTA 1JJ2S 4J5YA 3BG3A 3FLGA 4ZNXA 2IW8B 2DILA 5GANj 4J8OA 3MPUB 4PJOD 3PVLA 1TD6A 2X1NB 5D6YA 4LE9A 1GCQA 5GAOq 4FYYB 4EOQB 1PG5B 5KYWA 4M7AF 4LOCA 4HL4A 1FYNA 3EG9A 4C92D 3CCRQ 4M77F 2DMOA 2XD0A 4CFUB 4HA8A 1IRXA 1G3TA 3EG9B 4MDWA 5GANg 3CPWS 1ZA2B 3A5ZB 3VUBA 1QKXA 2COYA 2XG8D 2QQSA 3NTHA 2G3RA 1H4LD 4MZPA 2IPOB 5HBJB 3WXMB 3OYDA 2ZPIB 2BE9B 1VQ4T 2A0FB 3MP6A 4LDWA 4OMFB 1PSFA 3NHNA 1SSHA 1XOVA 4F7SB 1PKSA 4JJBA 3JCMV 3KBGA 5D6XA 1YIJT 4OGEA 1OX8A 2W9ZA 1Q7YU 2YHTA 3HPWA 5IN1A 5GAN2 3CEYA 1VQ8T 2LZ6B 3BDLA 3CCJA 3L42A 3RNJA 3B57A 1OI1A 2HL3A 1NZ9A 2DPPB 3K7AM 1U06A 2B86A 3LLRA 1M4ZA 1TH7A 2COZA 1J3TA 2LT4A 4DBFA 2C0OA 5CKBA 5M9OA 1QVGA 2W2HA 2J7IA 4JJDA 4AFQC 2LTOA 4OB2B 3R6OA 4GLMA 4XTVA 5GAN4 3CCUQ 1QP3A 4BCMB 2A28A 2MAMA 4BCPB 1IO6A 1JO8A 4MMLA 3VS3A 3CCRA 2NUTA 4CC2A 3RERA 1WFWA 5DLOA 3QYGB 2QGGA 4LDUA 1TU0B 2NUTB 2RHUA 4FSXA 2GQVA 4BE0A 2KMTA 1SF9A 2RA2A 1N9SA 3LYIA 2D0NA 1Q86R 4PFZA 4C92F 3BY7A 3BG9A 2DL4A 3QWLA 2JN0A 4HCBA 3NMZC 2E3IA 1VQ4Q 4J9CA 1Q81U 4LDXA 4HT8A 4BY1X 2FPFA 3ZFJA 2VWFA 2E65A 1YIJQ 3MP8A 1WNLA 2QXFA 5EFQB 1IB8A 1WHLA 4EPCA 1BBZA 2HQXA 1KC8C 4K11A 2W99A 2ED1A 1Y07A 3EGDA 1FMKA 3VYHB 3OYNA 1MV0B 4OB3B 1D0YA 1VQ8Q 3ZL7C 4M7DF 1VQLT 5IAYA 3EGDB 2VB6A 2QDLA 2A36A 2CT4A 3JCMh 3PMIA 4N4IA 1W4SA 1GFDA 4EOSB 4X1VA 2R58A 1N8RU 1GY3B 4NSTB 4BCNB 1D1AA 3QYEA 3CCUA 1RAGB 2DTHA 2BS2A 3POMA 3OS1A 2P4TA 4E7ZA 1ZA1B 3QZ5B 2HZYA 2VVKA 3OMGA 3N5BB 4Y92A 4A4EA 2QI2A 2UZDB 3EFOA 4DEYA 2IIMA 2MWOA 4KT0E 1VQ7T 3EFOB 4RUGA 4EDUA 1H641 4RTWA 4BI8B 5FRMA 4BDYA 1B07A 5CKHA 3VKGA 2D1XA 4JX5A 2BE7D 1FMVA 4JRQA 2WFYB 2EQIA 5I2MA 1VQ4A 1H92A 2MYSA 2I0NA 2CDTA 3CCEA 1TTHB 2WACA 3VV0A 1IHWA 4HCZA 2NYSA 2OI3A 4KGZB 3QKJA 5C6SA 2RF0A 1RAAB 3G1JA 2JGZB 2AT1B 1WHHA 5GAOp 2RD1A 3PGGA 1VQ8A 2E64A 4BCHB 3MY5B 3OYMA 4M75E 5LJ5h 5I2SA 1VQLQ 2KBTA 2EVRA 4QQDA 3M9QA 1D3UB 4AKGA 3QG1A 4HCKA 1K0XA 2DXCA 5LJ3h 2CZ0B 2K2MA 2YXYA 2EJGA 3L1AA 1ZUKA 1K0SA 2DXCB 2KI7A 4C0FA 3TNWB 2COWA 3CQTA 3MHXA 3QJYA 2QA4T 2E4HA 4LD9K 5CIUA 4BCIB 3CMEA 3TU4K 3UDCA 3LQ5B 3M0RA 2O31A 1BK2A 2UZEB 2PHGA 4F7UA 1O75A 1LOJA 2JNGA 1K1ZA 5GJVB 1M30A 4F7UB 4HVWA 2I40B 4AKIA 1VQ7Q 1M8MA 1V76A 1U8RA 2RN8A 3V8KA 1X69A 1KQSP 3M0QA 2LJ0A 3G71Q 4IURA 1M5Q1 4LNPA 2C5NB 2Y4XA 1X43A 2RQWA 2CP6A 4LDVA 2BZXA 3SDZA 5I11A 3OYJA 1OIUB 1UJ0A 1YBYA 1G3WA 1R0CB 2EQUA 1SKUB 4KUIA 4JRKA 2RNAA 3JB9I 3M5AA 4BCQD 4CFVB 1EX4A 1Q7YC 3HRSA 4XU1A 3PFSA 4M7AG 4E7IA 3VS1A 1W1FA 5LJ5d 1S72T 3JB9D 4QVZA 4BUGA 1VQLA 1F5QB 2EJ9A 2DO3A 2IW6B 2KXCA 3M54A 4M77G 3H9NA 1JSTB 2EUFA 2VKNA 1W2BA 4D8KA 4IUTA 4FYWB 2LMJA 2XDDA 2CCHB 2JMAA 3FJ5A 3OYLA 3TSWA 3CC4Q 2DIQA 2DZ9A 4E7JA 3HFNA 1X6OA 2EAYA 1ZSZC 2LP5A 3LW5E 4QVCA 1SHGA 3CBMA 1JKWA 1Q82R 4ROEA 2AKKA 1NPPA 4B9WA 1OULA 2KAFA 1YI2T 4C8QG 1RI9A 5CKDA 1WHGA 2CH4W 2EQKA 4EIKA 2MF2A 3CCVQ 3LWIA 3INZA 2WSCE 1TFBA 3CC2A 2QF7A 3G71A 2E12A 4RCCA 2O9SA 2MMPA 1X27A 4EOKB 4A4GA 3QDRB 4J9IA 2M16A 1Q81C 3OBWA 2HMAA 4RTZA 2Y4YA 1VQ6T 2X4WA 4Z02A 2RQTA 1N6AA 2LCLA 4KULA 3DLLA 2DL3A 2KT8A 2DKGA 4HXJA 1IXDA 3G6ET 2ZCFB 3SWNC 3U23A 7AT1B 2ZPGB 1BU2A 2E5KA 4FSSA 1S72Q 4GLKA 2LX9A 2WSFE 2DETA 3ER0A 2RB6A 2VASA 3NTIA 2D6FA 2A08A 2F2VA 1YJ9T 3CC4A 3QIIA 5GAN7 4A53A 4HCCA 1M3CA 4OVAA 2K79A 1OU8A 2ED0A 3O0GD 2VGMA 2CP7A 2RHIA 3X20B 4M7AE 4F17A 2KSSA 1H1QB 4CI0C 1QVGP 2FRYA 2DL8A 2LJ1A 2EYXA 1SRLA 2WEVB 4DBQA 2OAWA 1QMZB 3UATA 3QYBA 2MWPA 3OA6A 3P8BB 4LDYA 4CRIA 4P5NA 3CCVA 1YI2Q 3UT1A 1SPKA 2D9TA 2PMIB 1ZSZA 3PIOA 4QVDA 3QHRB 2GF7A 5EC7A 4JZ3A 4M7DG 1OV3A 5KYNA 1GBRA 3TREA 1ZSZB 1Q86U 4CRLB 2GBQA 1AZEA 2P4RA 5IHIA 2KDSA 3J81E 1KQSS 1TWBA 2E6ZA 2V8IA 2BUDA 1NEGA 3TCJA 4J9GA 2P0PA 3QWYA 4F7UF 2AHJB 2LC4A 2DJQA 2OJ2A 4Z88A 4FM4B 2HNIA 4F6UB 3JCMX 2EGAA 1UGSB 1B34A 5L2WB 1Y96A 5GMKi 4AKHA 1VQ6Q 2RQRA 1LNXA 2PTKA 3BLRB 2IVWA 2P0KA 3CCSA 3CD6T 2BS3A 3ULRB 1Y96B 3UWNA 3BDUA 3V8LA 3CXCA 1S72A 3G6EQ 2VXFA 1NLPC 2C4GB 2E70A 4E47A 4RMOA 1OYXA 2CT3A 1JXOA 5ACBA 4M78C 1WQWA 5FLXE 1NEBA 3H8ZA 2ZPEB 2WJ9A 1YJ9Q 5J39A 2FZKB 4XQ3A 3GTMS 4IMYB 3SWNA 1ARKA 4MFDA 2W9FA 5EG2A 1K9AA 3JCMf 4CFXB 4F7JB 2EYWA 3SWNB 4OMLA 4AG1C 4LN2A 4PJOE 4BBRM 1GBQA 2J06A 4C5GA 1WI7A 4M7AD 3JCMW 1EIFA 3C95A 3MJXA 3GF5A 4GY5A 3BHUB 3M58A 5IT9E 2DA9A 4M77D 4NS5A 2M0OA 3E19A 1M3AA 3FDRA 2X51A 2DE0X 1PC0A 4G6LB 1TOVA 1HXDA 1YNZA 4C92E 5I5ZB 1T0JA 2WXVB 1I81A 2CKKA 2QTVA 3DKMA 3E9FA 2PNIA 3PT9A 5KCHA 1AWJA 3L2WA 2VYTA 1QVPA 3JCMQ 4ELLA 2DTIA 3PNWC 3NGPA 4IUPA 1T3LA 1VQ6A 5CK9A 1HD3A 4KRDB 1G3SA 5FRNA 3CBOA 1S1NA 2E41A 2UZBB 3VRZA 3HFOA 1P5EB 1H24B 3G6EA 2C6TB 3CD6Q 2SRCA 5BNJB 4WF2A 1QVFA 3OYEA 4CC3A 4EOJB 2EFIA 3M4YA 1IGQA 2LQ8A 3L2VA 1X6GA 2KGTA 5A2QE 5DLQE 3RDVA 5LJ5f 3OY9A 4AFZC 1SRMA 3GPLA 3HRTA 3QSUA 3I9QA 1LPLA 3KXTA 2J05A 5LJ3f 2YUQA 2LVMA 1ABOA 1QVGS 4M78A 4OMNA 4FCYA 2EGEA 4QQGA 3ZBDA 2QFZA 1VYVA 2KMGA 4M78B 2DJZA 1HK9A 3E9GA 3JCMJ 4EOOB 1KIKA 2FPEA 4E2FB 5HQ0B 1OZ3A 3RMSA 3G4SA 4M4ZA 5I21A 2DX1A 1M1GA 5KYWB 3PO3S 2DFUA 2Y90A 3WVDB 2X3XD 3VS5A 3UF4A 2DD5A 2C0TA 1VYUA 3NDQA 4CFNB 1M1KR 5CKFA 2WIHB 2HSPA 3A98A 2XICA 1G3NC 3RMQA 2DD5B 4CC4B 4OGCA 4BY7X 1ZUYA 1VQOQ 1TUGB 2RJDA 1TXQA 5KCOA 2J6KA 2L3SA 1MV3A 2FVUA 5GAN5 4BDZA 3CD6A 1SG5A 1VIFA 2EYYA 3VS0A 1PNJA 3LGLA 1AHJB 2IG0A 4M7DD 1NYFA 3X25B 4HNUA 4C8QF 2FZCB 5HK3A 2MK5A 4EC8B 2G77A 2F5KA 3EIDB 5DY9A 3JCMg 1WJRA 1RI0A 3X24B 2WMBB 4BCFB 4J7FA 1W2BP 3D7SB 1UDLA 1VIEA 2JS0A 1UGVA 3JRZA 2ENMA 4ATOA 2GCXA 3HB9A 4A4HA 3HRUA 1AISB 1Q82U 2XIDA 4FT2A 2DNUA 2ZPFB 2PUOB 3E2UA 3VS2A 4DBHA 1OPKA 4YOSA 1QKWA 1FINB 3MIAB 2KQWA 2GGRA 1D0XA 1JRIA 4KRCB 1MUZA 2EKOA 1Q86C 5GAMd 4C0DC 4EORB 1YN8A 2CSIA 3UA6A 4MIMA 4RODA 3C12A 2GFAA 4CFUD 2ECZA 4JJCA 1VQOA 4LXCA 3EJ1B 2O88A 4NOYA 5LJ3j 2NUZA 5FU7C 3C94A 1PRLC 1AVZC 2QASA 2M9UA 1Z9ZA 2JW4A 1KK7A 1WA7A 2K5FA 1PHTA 3RGFB 5HVYB 1RLPC 1AWXA 2DEQA 3EFSA 3A8MB 4JLGA 5LJ5g 2H8HA 4E7LA 2A37A 1F1BB 3CMAT 1N9RA 4M75C 4J9HA 5LJ3g 3CCQT 1D3BA 3RBBB 4PJJA 2RI3A 1D3BB 1BIBA 2AZVA 1U1TA 1WGSA 2CP5A 4F7UG 4JX4A 4BD3A 1TUDA 3GLXA 3I35A 1BCOA 5CYIB 4OMPA 5GAOr 2WIPB 3ASKA 2K3YA 1AOJA 4XAXB 3OSVA 1RUWA 4IIOA 1KC8R 1JU5C 4PFPA 2X4XA 5GMKl 4VUBA 1GL5A 4BCMD 1W6XA 3MEAA 1IZ6A 5CKEA 2B8AA 3A1PA 3I55T 3OQ5A 1ZHIA 1M90U 1W70A 4M78F 1Y7XA 1N5ZA 2L5QA 3V7SA 5IXBA 4C5EA 3L2UA 1H28B 1OL1B 4RTVA 4ROCA 2BKDN 2CZ6B 3VKIA 1VQNT 3PTAA 2CGHA 4C0DB 1YIJA 2SEMA 1CKBA 4Z6YA 4JS5A 1WPYA 2VUBA 2CP3A 5GANd 3CXCP 3H0HA 1WQ7A 4B9XA 3JB9J 4C5HA 4ZGEB 4MMKA 2KY9A 3CPFA 4TTHA 5FU7B 3CMAQ 3OYGA 1YJWT 4HKEA 4JS4A 1G2BA 2L8DA 3M57A 1W2BS 4BCKB 2GNCA 4XTYA 1H27B 1FKMA 4BE1A 2DRMA 1H3HA 3HZJA 1OEBA 3JCMe 1I5LA 4MZTA 3EHRA 2V22B 3TVTA 1WXTA 4M75A 2EJFA 3BFMA 3ME9A 1CSKA 3H4CA 4PKCC 2LX7A 4BCND 3A8GB 4M75B 3LGFA 1BB9A 4EMGA 2DXUA 1VOMA 2WSEE 4XTUA 3BG5A 1PSEA 2XKOC 1K8AU 4IKFA 1KD1U 4CFWB 3URGA 4DOVA 3DDQB 1WXBA 2IW9B 3EOCB 3VRYA 4QKUA 4FT4A 3LX7A 4Y72B 1WHKA 2IVXA 2QYZA 4PJNA 1BKBA 1ZUUA 2QGSA 2NUPA 2ROLA 1NYGA 5FGKB 2E5QA 3FB9A 1GXIE 2NUPB 1G8XA 1RAIB 1VQNQ 2VC8A 1AD5A 3J7AF 4BY6C 2LQNA 3VS4A 2KK4A 2KR3A 5KE3A 1ZQ1A 1ABQA 4ELYC 5IHNA 3J80E 5A0GA 2K3XA 2RK1A 1QWEA 3X26B 1N27A 2HL5C 2HKNA 3CMAA 5GMKm 1NJIR 3EGXA 1M1FA 1QVFP 2CP0A 2R5MA 1OKVB 5CEIB 2JT4A 2PK2A 1VQPT 1JSUB 1VQ9T 2K5LA 1E6HA 3EGXB 3GIBA 1YJWQ 5FU6C 2JZ2A 4EOPB 5LJ5e 4E7KA 2HBWA 4YC3B 2DMEA 1Q82C 4KGVB 2DLPA 4XU0A 1Y57A 4JLIA 1MMDA 4UC4A 5LJ3e 2MI6A 3BHVB 4OB1B 4DOWA 4KH1B 2YUOA 3OS5A 5CO7A 3FJPA 1BI2A 1WLPB 2WMAB 3PVQA 1UTIA 4DBRA 1V1CA 2QA4Q 4AG2C 1Q7YR 2BKZB 3GOXA 5FWBA 1K4US 1M2OA 3VUZA 4BCOB 3JCMc 1OZ2A 3GP8A 2CSQA 1VQ7A 4QSHA 5IF1B 1CKAA 2VV5A 2ZPBB 3LWHA 1M1KU 2RJFA 3LH5A 2FPDA 2J6FA 4RTXA 2A7YA 4N4GA 2KEAA 3JCMP 4R0KA 1R8OB 1IGUA 1UHCA 3OYIA 2FEIA 4ELZC 2QAZA 1FMWA 2LNVA 1VUBA 1UGRB 3SFMA 2XU8A 2AK5A 1D0ZA 2YWWA 1QWFA 3AT1B 4BI4A 2JJ9A 2M1HA 2E3HA 2YRCA 5GAN8 1O9SA 1MMAA 2RQVA 2WHBB 2PZ1A 1MNEA 2JOYA 3CXCS 3GBQA 3HL8A 4E6RA 1BIAA 1C9BA 1MMGA 1SHFA 4ZN3A 3V8JA 4EOIB 4IUVA 3QPHA 1PD1A 3MKDA 2ZAEA 1YJWA 1YJNT 5L23A 4FL6A 4LUEA 4ANJA 3OSSC 3DJBA 2FL7A 5ICPB 1VQPQ 4HNVA 1VQ9Q 1QQJA 4BY6B 3SEMA 2EBPA 3P8HA 3OS2A 1OU9A 2DZCA 2L3RA 5AYFA 1N8RC 4EONB 1ZLMA 4O5VA 4PJOC 1C1AA 1OX9A 3L2QA 3MP1A 2QA4A 4JRPA 4LD6A 1QLBA 4CFMB 2NLUA 2DEUA 1AZGB 4M77E 1E7PA 3BW1A 1XNIA 3OBYA 5FU6B 3OW2A 2KRMA 1A0NB 4J83A 4M7AA 1G3YA 2XMFA 1M90C 2FO0A 1G5VA 2DVEA 4C92C 2AKLA 3OYYA
chains in the Genus database with same CATH topology
3HBLA 3ZFJA 3KXTA 1VQMA 2E65A 5LJ3f 2RI5A 4BB7A 3MP8A 1WNLA 2LVMA 2RO0A 4M75F 2QXFA 1QVGS 1KC8C 4EPCA 4M78A 2HQXA 3O8VA 1XQHA 3UPUA 3CC7A 1JB0E 4QQGA 3ZBDA 2QFZA 1Y07A 2KMGA 3VYHB 4M78B 4RG2A 3OYNA 3CCQA 3S3OA 4OB3B 2DJZA 1HK9A 2DK3A 3E9GA 5HK0A 3JCMJ 3GNGA 4M7DF 1VQLT 5IAYA 1WJQA 2PU9B 2JVVA 4C8QE 1FWZA 4BACA 2EIFA 3CCMT 1OZ3A 3RMSA 3JCMh 3G4SA 3QHSA 3PMIA 4N4IA 5I21A 1M1GA 1W4SA 3RKXA 3M53A 5GAOn 1N8RU 2R58A 2CZ1B 1B34B 2Y90A 3WVDB 4Q5WA 3CCST 4M7AC 2LRQA 4QW2A 3S3NA 2DD5A 1VQ5T 3QYEA 3P8DA 3CCUA 1VQPA 1QVFS 5CKFA 2OTLT 2DTHA 2BS2A 2XICA 4M77C 3RMQA 2RH2A 2DD5B 2P4TA 3OS1A 1FXXA 3QZ5B 4OGCA 5LJ3d 1UGQB 4NL3A 1K9MU 3OMGA 4M78G 3N5BB 4OF1A 1H3ZA 4M75D 3OW2S 4A4EA 1QW1A 4NC6A 2QI2A 4ZGDB 2RJDA 4RKUE 5KCOA 5FRMA 4BDZA 5GAN5 2FVUA 4ZN1A 3CD6A 4BBSM 3WVEB 3I55A 2MWOA 5LL6S 4KT0E 1VIFA 1VQ7T 2L89A 3JAME 4RCBA 3MEWA 3LGLA 1AHJB 2X4YA 2IG0A 1H641 2QQRA 4BI8B 3X25B 4EDUA 2LQKA 3MO8A 5CKHA 3VU3C 4BDYA 1YHQA 1BYMA 4HNUA 2QQ8A 3I56T 3QYHB 3VKGA 2RJCA 2V8KA 4C8QF 4JX5A 3JB9H 3PIPA 3FRNA 5HK3A 5GAMf 3OMCA 2XHCA 4JRQA 4XTZA 5I2MA 2G77A 1VQ4A 2F5KA 1K8AC 1KD1C 5DY9A 3JCMg 1VQNA 2PVOB 1YI2A 1WJRA 1RI0A 4C5IA 3CCEA 3X24B 2WACA 3RKYA 3VV0A 4C8QC 3QO3A 4J7FA 4PJOA 3CCJT 4HCZA 5J3BA 4C0ZA 1NE8A 1VIEA 3QKJA 3JRZA 2FYKA 3ZEHA 5C6SA 3HP9A 4PJOB 4ATOA 3M55A 2GCXA 3HB9A 4A4HA 2PVDB 1KHIA 3HRUA 2P0QA 1Q82U 4L5GA 2EWNA 2XIDA 4Y28E 4FT2A 2ZPFB 2PUOB 5J26A 1MHNA 3RUXA 5GAOp 2RD1A 3PGGA 1VQ8A 2E64A 2XDPA 1P92A 4A54A 3OYMA 4C92A 3KHIA 4M75E 3L2ZA 5LJ5h 3C4SA 3A8HB 1WJSA 3OYCA 1SSFA 4N4HA 5I2SA 2QQ9A 2KQWA 2RHYA 3V7CA 1JRIA 3GNFB 3CCLT 2X35A 4C92B 4QQDA 3TW7A 1LJOA 3M9QA 3DB3A 4C8QD 4R56A 4AKGA 4L59A 3QZ9B 2EKOA 3QG1A 4PLLA 2ZPHB 4C0DC 5GAMd 1Q86C 2DXCA 3JSCA 5LJ3h 2CZ0B 2FHDA 4JRIA 2EJGA 4EMHA 3OYBA 2HAXA 3L1AA 2RM4A 4M7DE 4MIMA 4PJOG 4ELJA 3C12A 2GFAA 2DXCB 4FU6A 1U1SA 4AI6A 4C0FA 4DA4A 3MHXA 3QJYA 3EAEA 4NL2A 2QA4T 4LD9K 1X01A 2DXTA 2F69A 5CIUA 1VQOA 3CMEA 4NOYA 3TU4K 3UDCA 5LJ3j 1YJ9A 3RIRA 2RI2A 2OTJT 2EYQA 5FU7C 3C94A 4F7UA 2HBPA 1UGPB 5C0MA 4L6V5 1O75A 2M9UA 4PLIA 3JB9F 1LOJA 1KHCA 2JNGA 2X4JA 4FIBA 2I2LA 2K5FA 2K57A 4F7UB 4C92G 2QQAA 4AKIA 2HQEA 4M7AB 3FEOA 5GAN3 4M77A 1U8RA 5FROA 2DEQA 3EFSA 5A0LA 3A8MB 3V8KA 4JLGA 5LJ5g 4DQ2A 4JX6A 3QSUA 2JUFA 4IURA 4C0GA 1M5Q1 4M77B 5GAOl 4E7LA 2R5AA 2Y4XA 4XU3A 2A3LA 1K73C 2XDBA 3CMAT 4II1A 1N9RA 4LDVA 4M75C 4TVRA 3CCQT 5LJ3g 3SDZA 1D3BA 3OB9A 1VQKA 3OYJA 1YBYA 3SB2A 2E6NA 3JCMb 1I4K1 2RI3A 4QQ6A 1G3WA 1M1KC 2EQUA 4KUIA 3JB9I 4JRKA 1D3BB 4XTXA 1BIBA 2KVQG 2OAUA 1U1TA 3M5AA 4EMKC 4M7DC 1WGSA 3G4ST 1Q7YC 4F7UG 2K2VA 3HRSA 4A4KA 4XU1A 3PFSA 4JX4A 4M7AG 4HT9A 4E7IA 4O6JA 4M7DD 1NPRA 5LJ5d 4BD3A 1S72T 3JB9D 4QVZA 3GLXA 4C8QA 2KR6A 4BUGA 5GAMh 5GAOr 5CAIA 3ASKA 3SD4A 1VQLA 1VQ9A 2EJ9A 3CCUT 2DO3A 3M54A 5HY6A 4M77G 1V29B 4JDSA 1BI1A 3S6WA 1KQ2A 2K3YA 4XAXB 5D6WA 3OSVA 4C8QB 5GANf 3AHUA 3CCMA 2X4XA 5GMKl 2BS4A 1W2BA 4VUBA 4IUTA 3MEAA 5GAMj 2XDDA 1IZ6A 3M56A 3OS0A 5CKEA 3OYLA 2EQJA 2B8AA 2DIQA 2DZ9A 4E7JA 3I55T 3HFNA 3A8LB 1X6OA 1ZHIA 2CZ7B 3A8OB 2EAYA 3OQ5A 1NJIU 1M90U 1VQ5A 4M78F 1Y7XA 2OTLA 1ZBXA 2L5QA 3RESA 3V7SA 3L2UA 4C5EA 4IUUA 3LW5E 4QVCA 3CBMA 1KC8U 2QDYB 1UB4A 2BKDN 2LT1A 1NPPA 4HNTA 4B9WA 3MEVA 4X9DA 4J6YA 2CZ6B 5CVIA 3VKIA 2KAFA 4ZTFA 1VQNT 3PTAA 1YI2T 2CGHA 3META 3NFCA 2DXBA 4J6XA 2LCCA 2PQWA 4C8QG 2QEXT 3CCET 5CKDA 4XU2A 2EQKA 3G7ZA 3TEEA 4C0DB 3OYAA 3CPWS 1YIJA 2MF2A 2OTJA 2XI9A 4JS5A 4Z6YA 4BI3A 1WPYA 3HKSA 5GAMg 2DXBB 3LWIA 3INZA 2VUBA 2WSCE 4MFEA 2QDJA 2QF7A 3LH0A 3G71A 3I56A 3FC3A 3E1SA 3CC2A 4J7IA 5GANd 2E12A 4RCCA 1WQ7A 4B9XA 3HO8A 3JB9J 1YITT 2MMPA 3DL1A 2ZGWA 4C5HA 1QP2A 2K5IA 4ZGEB 5EJCA 1UEBA 3MCAB 4JUVA 4MMKA 4A4GA 2KY9A 3QDRB 3CPFA 2M16A 2VGNA 2DD4A 5FU7B 3T9NA 1Q81C 3OBWA 3OYGA 1YJWT 3HSBA 4HKEA 4JS4A 4M78D 1KQ1A 3Q1JA 3VKHA 2L8DA 3M57A 2DD4B 1W2BS 2DIGA 2Y4YA 1VQ6T 4ZTJA 3H6ZA 1JJ2A 5A0DA 2X4WA 4Z02A 2QTXA 4ZGJB 4XTYA 1N6AA 2LCLA 3RKWA 1FKMA 3F70A 4KULA 3DLLA 3CCRT 4JJNK 4BE1A 3HZJA 3VYGA 2DKGA 3JCMe 3FIFA 1I5LA 4XK8E 2LDMA 4MZTA 3G6ET 3DLMA 2ZCFB 3SWNC 3M4GA 2EJFA 3BFMA 2FB7A 3ME9A 4M75A 5LJ5j 1KQSA 2RK2A 2YLCA 2ZPGB 3H4CA 4PKCC 1YJNA 3VYGB 2VXEA 4GLKA 4A4FA 2LX9A 1JBMA 2WSFE 3A8GB 4M75B 3ER0A 5GAMe 3LGFA 2C06A 2RB6A 3NTIA 1VQOT 2D6FA 3CCLA 4EMGA 3CMET 5GMKh 2H3JA 4EMKA 2DXUA 2HD0A 2WSEE 4XTUA 4PJOF 3OYKA 3BG5A 3QXEB 1PSEA 2XKOC 3QIIA 1YJ9T 4D6WA 1K8AU 1KD1U 5GAN7 3CC4A 4A53A 3URGA 4HCCA 2BIVA 2JTFA 4DOVA 3S3MA 4OVAA 4EMKB 4M7DB 2K4YA 3OYHA 5GAOm 4BE2A 2DAQA 2VGMA 2V8JA 4Y91A 4FT4A 2RHIA 3X20B 2E10A 3LX7A 4M7AE 5GMKj 1IREB 1VQMT 3CPWA 2KSSA 1Y71A 5GMKe 2JTMA 3JB9G 4XTWA 4MDXA 4CI0C 5CR2A 1BKBA 4YTLA 1K9MC 2XK0A 4E7HA 3MEUA 4N0AC 3CC7T 2E5QA 5GANh 2DTOA 4M78E 3FB9A 4MZMA 4M75G 3QYBA 2MWPA 3OA6A 3HHTB 3P8BB 1FX7A 4LDYA 4CRIA 1GXIE 4P5NA 3CCVA 3J7AF 2VC8A 4RG8A 3UT1A 1JJ2S 4BY6C 4J6WA 2KK4A 2D9TA 4J5YA 3BG3A 3PIOA 4QVDA 5KE3A 1ZQ1A 3FLGA 4ELYC 2GF7A 3J80E 5A0GA 2K3XA 5GANj 4J8OA 4M7DG 2RK1A 2O4XA 1XTDA 3TREA 1Q86U 3X26B 4PJOD 3J81E 3X28B 2KDSA 1KQSS 1N27A 2E6ZA 2V8IA 3CMAA 2CS7A 2BUDA 5GMKm 2O4XB 1M1FA 3TCJA 2PVGB 4HLQA 2R5MA 3PMTA 5D6YA 1VQPT 4IUQA 3KUFA 1BI0A 2K5LA 1VQ9T 2P0PA 4F7UF 2F5TX 3GIBA 5GAOq 2AHJB 2LC4A 3JCMX 4FM4B 2HNIA 4M7AF 4LOCA 5FU6C 4HL4A 1UGSB 1B34A 1Y96A 2JZ2A 5LJ5e 5GMKi 4AKHA 4E7KA 2RHXA 1LNXA 2R57A 2IVWA 2P0KA 1Q82C 4C92D 3CCSA 3CD6T 2BS3A 4M77F 2XD0A 1Y96B 4HA8A 3BDUA 1M9SA 4XU0A 3UWNA 3V8LA 3CXCA 4JLIA 4UC4A 1S72A 1KG1A 1G3TA 2MI6A 2PUKB 4MDWA 5LJ3e 5GANg 4OB1B 2VXFA 3A5ZB 4PL6A 2ZZDA 4DOWA 1MGQA 3VUBA 3QUIA 3OS5A 5CO7A 2XG8D 3FJPA 2E70A 2QQSA 4E47A 4IKFA 1BI2A 3QJ6A 1YHQT 3NTHA 4RMOA 1OYXA 2ZZDB 2G3RA 4M78C 4MZPA 1WQWA 5FLXE 3WXMB 3H8ZA 3OYDA 3GOXA 2ZPEB 2ZPIB 1VQ4T 2WJ9A 1K73U 3VUZA 3MP6A 2E1HA 4LDWA 3JCMc 4XQ3A 4ME7A 2CYZB 1OZ2A 1PSFA 4OMFB 5J39A 3SWNA 1XOVA 3GP8A 1VQ7A 4MFDA 4QSHA 3JCMV 3KBGA 5EG2A 3JCMf 2VV5A 5D6XA 2ZPBB 3LWHA 1YIJT 4OGEA 1M1KU 2RJFA 3SWNB 4PJOE 4BBRM 2A7YA 3EFRA 3NTKA 4N4GA 4C5GA 3JCMP 3CC2T 3G71T 4M7AD 3JCMW 4M7DA 1EIFA 1R8OB 3C95A 1Q7YU 1I8FA 4V2SA 3DB4A 2YHTA 3OYIA 3HPWA 3TW6A 4ELZC 3GF5A 5IN1A 2D0QB 4GY5A 5GAN2 3M58A 2LNVA 5IT9E 1VUBA 3CEYA 1UGRB 3SFMA 2XU8A 4M77D 4NS5A 1X75C 2M0OA 3E19A 5KE2A 2QEXA 3BDLA 3CCJA 3L42A 4BI4A 1DJ7B 3FDRA 5GANe 1OI1A 2M1HA 2YRVA 1NZ9A 2DPPB 5GAN8 4OP0A 1O9SA 4X9CA 1HXDA 4C92E 3CBPA 3LLRA 1M4ZA 1TH7A 1I81A 2CKKA 2JOYA 4R55A 3CXCS 1YITA 3HL8A 2LT4A 3V7RA 1BIAA 4N0AA 5CKBA 3DKMA 3E9FA 3PT9A 5CQYA 5KCHA 5M9OA 5HKCA 4ZN3A 3L2WA 2QQBA 1QVGA 2VYTA 3V8JA 2EQMA 1QVPA 4IUVA 3QPHA 3JCMQ 3OYFA 2DTIA 3PNWC 1YJWA 2LTOA 5CCAA 4IUPA 5KH6A 4OB2B 1YJNT 3R6OA 4XTVA 3JCMd 4FL6A 5GAN4 3OSSC 4OB0B 2FL7A 1VQ6A 4HNVA 5CK9A 1QP3A 1VQ8T 2MAMA 1G3SA 5FRNA 1YCYA 3CBOA 4BY6B 4MMLA 5L8RE 3CCRA 2O01E 2E41A 3RERA 3P8HA 4M6VA 1RL2A 3HFOA 4KBMB 5DM7R 3OS2A 3CC4T 5DLOA 3QYGB 2DZCA 2L3RA 5AYFA 1N8RC 4LDUA 3G6EA 2YLBA 4O5VA 3M59A 4F7UE 2RHUA 5GAN6 4PJOC 4FSXA 2GQVA 4BE0A 2KMTA 4WF2A 3L2RA 2GFUA 3MP1A 3L2QA 2RA2A 2QA4A 4JRPA 4LD6A 1BI3A 2RHZA 3VJPA 4PNOA 3QBYA 1QLBA 1N9SA 3LYIA 4KUDK 1QVFA 3OYEA 2NLUA 2EFIA 2RJEA 3M4YA 4M77E 1E7PA 4C92F 3BW1A 1XNIA 2LQ8A 3L2VA 3BY7A 4X34A 3BG9A 3QWLA 3OBYA 1M8VA 2JN0A 5FU6B 4HCBA 5A2QE 3OW2A 5DLQE 5LJ5f 3OY9A 4J83A 4M7AA 5CQXA 1Q81U 1G3YA 1VQKT 1M90C 3CCVT 1NJIC 4HT8A 4LDXA 1G5VA 2DVEA 4C92C 3GPLA 3HRTA 3OYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXB B;  2CZ0 B;  2WSC E;  2PUK B;  2DXC B;  4OB1 B;  2ZZD A;  1QP2 A;  4ZGE B;  1JB0 E;  3VYH B;  2ZZD B;  4OB3 B;  2DD4 A;  2PU9 B;  2ZPE B;  2ZPI B;  1UGP B;  4L6V 5;  2DD4 B;  2CYZ B;  1PSF A;  4ZGJ B;  2ZPB B;  3VYG A;  2CZ1 B;  3WVD B;  4XK8 E;  2ZCF B;  3A8M B;  2DD5 A;  2ZPG B;  3VYG B;  2D0Q B;  2WSF E;  3A8G B;  2DD5 B;  1UGR B;  3QZ5 B;  1UGQ B;  2WSE E;  1DJ7 B;  3QXE B;  1PSE A;  4ZGD B;  4RKU E;  2DPP B;  3WVE B;  4KT0 E;  1AHJ B;  3X20 B;  3X25 B;  1IRE B;  3QYH B;  4OB2 B;  1V29 B;  2PVO B;  4OB0 B;  3X24 B;  1QP3 A;  3HHT B;  1GXI E;  5L8R E;  2O01 E;  3QYG B;  3A8L B;  2CZ7 B;  3A8O B;  2PVD B;  3X26 B;  3X28 B;  4Y28 E;  2ZPF B;  2PUO B;  3LW5 E;  2PVG B;  2QDY B;  2CZ6 B;  3A8H B;  2AHJ B;  4FM4 B;  2DXB A;  1UGS B;  3QZ9 B;  2ZPH B;  2DXC A; 
#chains in the Genus database with same CATH topology
 3HBL A;  4M75 F;  2DBM A;  2LW4 A;  1I07 A;  3UPU A;  2DF6 A;  5IHK A;  1JB0 E;  5D7U A;  4RG2 A;  3S3O A;  3MY1 B;  3GNG A;  1WJQ A;  4C8Q E;  2CH4 A;  1ZP2 A;  2DYB A;  2EIF A;  3CCM T;  1D1C A;  1WXU A;  2MOX A;  1QCO A;  1OGU B;  1K73 R;  5IH2 A;  2CZ1 B;  1B34 B;  4Q5W A;  2LRQ A;  1WZO A;  2UZL B;  4QW2 A;  1VQ5 T;  3P8D A;  2W96 A;  1WHM A;  1VQP A;  1QVF S;  2OTL T;  2V1R A;  2EKH A;  2RH2 A;  1YJN Q;  1FXX A;  2AZS A;  4NL3 A;  1UGQ B;  4M78 G;  1UHF A;  2DER A;  4ZGD B;  4HVV A;  4PK4 A;  3TQ7 P;  4ZN1 A;  3WVE B;  2BZY A;  3PE0 A;  3JAM E;  4RCB A;  1MND A;  2OTJ T;  3UA7 A;  1BYM A;  2M0Y A;  2LQK A;  1E7O A;  2BZ8 A;  3MO8 A;  1GUX A;  1VIN A;  1VA7 A;  2QQ8 A;  4F14 A;  3I56 T;  3QYH B;  2F1L A;  3JB9 H;  3PIP A;  1YCS B;  5FW9 A;  3OMC A;  1GUX B;  1B3Q A;  1K8A C;  1KD1 C;  1YI2 A;  1D1B A;  4C5I A;  2P84 A;  2AIR B;  3RKY A;  2F2C A;  1I1J A;  3QO3 A;  1UNG D;  4PJO A;  3CCJ T;  3M0S A;  5J3B A;  1AEY A;  2QGF B;  2JM8 A;  2FYK A;  1C0M A;  4PJO B;  1KHI A;  2HDA A;  2P0Q A;  1X6B A;  2EWN A;  2QK0 A;  4Y28 E;  1MHN A;  2UUE B;  1VYW B;  4ORZ A;  2XDP A;  4JZ4 A;  2F2W A;  1P92 A;  5AT1 B;  4J9D A;  4C92 A;  1QCN A;  3TNH B;  3L2Z A;  1RAH B;  3C4S A;  3A8H B;  1WJS A;  1SSF A;  2QQ9 A;  1NG2 A;  3GNF B;  4C92 B;  3TW7 A;  1LJO A;  3EGU A;  4C8Q D;  4J9E A;  4II5 B;  3CCM Q;  2BPM B;  4PLL A;  1Q95 G;  3JSC A;  4JRI A;  4FYX B;  1VOL A;  2HAX A;  4M7D E;  4F7L B;  1H1P B;  1H26 B;  1NBE B;  1U1S A;  4FU6 A;  1VQ5 Q;  2D8J A;  4NL2 A;  2OTL Q;  2C0I A;  2YT6 A;  1LVK A;  1YJ9 A;  1GH6 B;  3NPF A;  2W10 A;  1UGP B;  5C0M A;  1C6V X;  1UFF A;  4L6V 5;  2X4J A;  4F6S B;  2KRN A;  2I2L A;  2K57 A;  1QLY A;  2QQA A;  4BCG B;  5GAN 3;  3FEO A;  4J9B A;  2JXB A;  2OTJ Q;  3O5Z A;  5A0L A;  4JPB W;  2ESW A;  5KYU A;  4DQ2 A;  2JUF A;  4C0G A;  3I56 Q;  2A3L A;  2XDB A;  5KYU B;  4II1 A;  1JOW A;  2DBK A;  2JTE A;  4TVR A;  4I3Z B;  3OB9 A;  3EG1 A;  5HBE B;  1I4K 1;  4FYV B;  4QQ6 A;  3M0T A;  3CCJ Q;  1M1K C;  1K9M R;  4XTX A;  2KVQ G;  2OAU A;  4OGR B;  2NWM A;  2H3E B;  1UE9 A;  1ZX6 A;  1PCX A;  2MCN A;  4HVU A;  2K2V A;  3I5R A;  4A4K A;  4UN0 A;  4O6J A;  2YSQ A;  5GAM h;  3SD4 A;  3CCU T;  1ENW A;  3S6W A;  1KQ2 A;  1UJY A;  3AHU A;  3CCM A;  2WPA B;  2BS4 A;  3JV3 A;  1KJW A;  5I22 A;  2YUP A;  1GFC A;  3A8O B;  1NJI U;  1VQ5 A;  2OTL A;  1SEM A;  2V26 A;  8AT1 B;  4LUD A;  2DL5 A;  5LQF B;  2FRW A;  1G83 A;  4YOO A;  2KRO A;  1UB4 A;  2LT1 A;  4HNT A;  1H8K A;  4F16 A;  2K6D A;  4J6Y A;  3MET A;  4KH0 B;  3CCE T;  2DXB A;  2LCC A;  2PQW A;  2QEX T;  2ATC B;  1HJD A;  3TEE A;  1PD0 A;  3OYA A;  5GJW B;  2OTJ A;  1NLO C;  2DXB B;  4YOZ A;  4F6W B;  4MFE A;  2QDJ A;  3LH0 A;  1M27 C;  3I56 A;  3E1S A;  4J7I A;  3VS7 A;  1UG1 A;  3HO8 A;  1YIT T;  2L3Q A;  2K5I A;  2V1Q A;  1UEB A;  2J6O A;  4JUV A;  4FX3 B;  2VGN A;  2DD4 A;  3T9N A;  2C5X B;  3HSB A;  1OPL A;  4M78 D;  1YP5 A;  1KQ1 A;  2CUB A;  2PJQ A;  2F2X A;  2BTT A;  3VKH A;  2X9H A;  2DD4 B;  2DIG A;  1RAC B;  1Y0M A;  1JJ2 A;  2QTX A;  2KE9 A;  4JJN K;  1H25 B;  2HSE B;  3VYG A;  2DM1 A;  1TUC A;  3M4G A;  5LJ5 j;  2FB7 A;  2CJM B;  2RK2 A;  2YLC A;  4AFU C;  1OKW B;  3VYG B;  2VXE A;  4A4F A;  5GAM e;  3CME T;  5GMK h;  4PJO F;  2M51 A;  3QXE B;  1AWO A;  4D6W A;  2BIV A;  2JTF A;  1ZSG A;  2K4Y A;  3OYH A;  4BE2 A;  3BHT B;  1UNL D;  3KFV A;  2DAQ A;  2LCS A;  4Y91 A;  3RR6 A;  4CXA B;  1VQM T;  3CPW A;  3JB9 G;  2JTM A;  4XTW A;  2YDL A;  5CR2 A;  2XK0 A;  2K9G A;  4N0A C;  3CC7 T;  5GAN h;  4MZM A;  4M75 G;  1M3B A;  3HHT B;  1FX7 A;  1U5S A;  3CCE Q;  4J6W A;  2G9X B;  2QEX Q;  1TSF A;  1NM7 A;  5KYY A;  1PWT A;  1U3O A;  1AT1 B;  2O4X A;  1XTD A;  3X28 B;  5KYY B;  2CS7 A;  1YIT Q;  1JXM A;  2O4X B;  1W98 B;  2PVG B;  4HLQ A;  3PMT A;  1XJW B;  3KUF A;  4IUQ A;  1BI0 A;  2ROT A;  2F5T X;  3OW2 P;  3EH1 A;  2RHX A;  2R57 A;  1WDX A;  1I5O B;  1R77 A;  1M9S A;  4F7N B;  1H1S B;  1KG1 A;  2PUK B;  3DOG B;  4PL6 A;  2ZZD A;  3M03 A;  1MGQ A;  1UUE A;  3QUI A;  4RTT A;  5ECA A;  9ATC B;  3QJ6 A;  1YHQ T;  2JS2 A;  2Z0W A;  3M0P A;  2ZZD B;  2C5V B;  3CME Q;  2L3P A;  1K73 U;  2E1H A;  5GMK e;  4ME7 A;  2CYZ B;  1EZZ B;  1WHJ A;  4OR5 B;  1ZBJ A;  2O2O A;  3EFR A;  3NTK A;  3CC2 T;  3G71 T;  1WIE A;  1VQM Q;  4PFO A;  1I8F A;  2L0A A;  4V2S A;  3DB4 A;  3TW6 A;  2D0Q B;  5KE2 A;  5KYX A;  1X75 C;  2QEX A;  3CC7 Q;  2RMO A;  1DJ7 B;  3C0C A;  5GAN e;  1X2Q A;  3CCQ Q;  1RAE B;  2YRV A;  2LJ3 A;  5KYX B;  4OP0 A;  4BCQ B;  4X9C A;  2HQH A;  3CBP A;  3H41 A;  4ESR A;  4R55 A;  1YIT A;  3V7R A;  4N0A A;  5HKC A;  5CQY A;  2QQB A;  2R7G A;  1EFN A;  2EQM A;  2O9V A;  3OYF A;  5CCA A;  2EW3 A;  3JCM d;  4OB0 B;  3REB B;  1YCY A;  5L8R E;  2O01 E;  3CC4 T;  4M6V A;  1RL2 A;  4KBM B;  5DM7 R;  2KNB B;  2HCK A;  3VS6 A;  2YLB A;  3M59 A;  4F7U E;  5GAN 6;  3I55 Q;  1FVV B;  2PK9 B;  3R6N A;  3EG0 A;  2GFU A;  3L2R A;  1KFZ A;  1BI3 A;  2CRE A;  2RHZ A;  1WX6 A;  3VJP A;  4PNO A;  3QBY A;  4KUD K;  2L2P A;  1YHQ Q;  1HSQ A;  2RJE A;  1LCK A;  4X34 A;  1RAF B;  1M8V A;  3TNI B;  4FW2 A;  5CQX A;  1VQK T;  3TSZ A;  3CCV T;  1NJI C;  1WYX A;  5IDN B;  5HCK A;  5KH6 A;  1VQM A;  1PRM C;  2X3W D;  1UEC A;  2RI5 A;  4J9F A;  4BB7 A;  2RO0 A;  1JEG A;  3IQL A;  3O8V A;  3CC2 Q;  3EG3 A;  1XQH A;  4EC9 B;  1H1R B;  1GRI A;  3CC7 A;  3CCQ A;  1B7T A;  1JQQ A;  5IHY A;  2DK3 A;  5HK0 A;  4B6M A;  2PU9 B;  3QHW B;  2JVV A;  1IHV A;  1FWZ A;  4BAC A;  3BE3 A;  3QHS A;  2C5O B;  3RKX A;  2CUD A;  3M53 A;  4BXX X;  5GAO n;  3CCS T;  4M7A C;  4WCI A;  3S3N A;  1ACM B;  1YFN A;  2GTJ A;  2GTO A;  4M77 C;  1K9M U;  5LJ3 d;  2KYB A;  5IXF A;  4OF1 A;  1H3Z A;  4M75 D;  3OW2 S;  1YWP A;  1QW1 A;  4NC6 A;  2I53 A;  4RTY A;  4RKU E;  4BBS M;  3I55 A;  1QCF A;  2LNH B;  5LL6 S;  2L89 A;  1OQK A;  3MEW A;  2X4Y A;  2QQR A;  3VU3 C;  1YHQ A;  2YRD A;  2JM9 A;  3HTR A;  2RJC A;  3I5S A;  3G33 B;  2V8K A;  3FRN A;  5GAM f;  2XHC A;  4XTZ A;  4IIM A;  1VQN A;  1E9H B;  2PVO B;  5LMK B;  2KT1 A;  4C8Q C;  1XO2 A;  4C0Z A;  1NE8 A;  2GQI A;  1AD6 A;  3F5X B;  1VQK Q;  1M2V A;  3BLQ B;  1N4M A;  3EHQ A;  3ZEH A;  3MI9 B;  1TS9 A;  3HP9 A;  4CC7 A;  3M55 A;  4OMM A;  2PVD B;  1M2V B;  1RAB B;  2MPX C;  4E7S A;  4L5G A;  4OMQ A;  5J26 A;  6AT1 B;  3RUX A;  2D8H A;  2MIO A;  4A54 A;  3KHI A;  4KGX B;  1T0H A;  3OYC A;  4N4H A;  2CP2 A;  4AMC A;  2RHY A;  3V7C A;  4GBQ A;  3CCL T;  4KRT A;  2X35 A;  8ATC B;  4R56 A;  1UNH D;  4PJM A;  3DB3 A;  1BCM A;  4L59 A;  3QZ9 B;  2ZPH B;  1OI9 B;  2K7A A;  4EOL B;  2FHD A;  4EMH A;  3OYB A;  2RM4 A;  1Q81 R;  4PJO G;  4ELJ A;  1E6G A;  3CCS Q;  4AI6 A;  3DTO A;  2EGC A;  5IDP B;  4DA4 A;  2QG9 B;  2DYI A;  2ABL A;  3EAE A;  3EH2 A;  3BLH B;  1X01 A;  2DXT A;  2F69 A;  4FW1 A;  2RPN A;  1QMC A;  3RIR A;  2RI2 A;  2EYQ A;  1PM3 A;  2B9R A;  1GCP A;  2HBP A;  1AWW A;  3M0U A;  4PLI A;  3TN8 B;  3JB9 F;  4QT7 A;  1KHC A;  2KYM A;  4FIB A;  1JJ2 P;  4C92 G;  4F04 B;  2HQE A;  3SHW A;  4M7A B;  4AFS C;  1OIY B;  4M77 A;  5FRO A;  1D09 B;  4JX6 A;  2G6F X;  5GAO l;  4M77 B;  4F70 B;  1N8R R;  2R5A A;  1I0C A;  4XU3 A;  1K73 C;  4BCJ B;  1MMN A;  1VQK A;  3SB2 A;  2E6N A;  3JCM b;  2KXD A;  2FZG B;  4EMK C;  4M7D C;  3G4S T;  4A63 B;  4PJL A;  4HT9 A;  3CPW P;  1NPR A;  5HBH B;  1M90 R;  4Z8A A;  1HYO A;  4C8Q A;  2KR6 A;  5FWC A;  3REA B;  5CAI A;  1VQ9 A;  5HY6 A;  5DQW A;  1V29 B;  2W0Z A;  1BI1 A;  4JDS A;  5D6W A;  4C8Q B;  5GAN f;  4Z89 A;  1KSW A;  2KRS A;  1RAD B;  2OX7 A;  3CCL Q;  5GAM j;  3OS0 A;  3M56 A;  1PKT A;  5DQV A;  2EQJ A;  2EPD A;  2HEQ A;  3A8L B;  2CZ7 B;  2FG0 A;  1ZBX A;  1Z9Q A;  3EG2 A;  3RES A;  1T3S A;  4IUU A;  1KC8 U;  2CCI B;  2QDY B;  2M02 A;  3QWX X;  3MEV A;  4DEX A;  2K3B A;  4WTO B;  4X9D A;  2HKQ B;  2RQU A;  5CVI A;  4ZTF A;  3NFC A;  4J6X A;  4XU2 A;  3G7Z A;  2YUN A;  2XI9 A;  4BI3 A;  1PKD B;  3HKS A;  5GAM g;  2DL7 A;  1GCQ C;  3FC3 A;  3THK A;  4OMO A;  3DL1 A;  2ZGW A;  1QP2 A;  1BU1 A;  2IN3 A;  5EJC A;  3MCA B;  3QDF A;  1URC B;  3Q1J A;  3H0I A;  3H6Z A;  4ZTJ A;  5A0D A;  2JMC A;  2DRK A;  4ZGJ B;  3RKW A;  2DVJ A;  3F70 A;  4RTU A;  3CCR T;  1K8A R;  1KD1 R;  4AT1 B;  3G4S Q;  3FIF A;  4XK8 E;  2LDM A;  3DLM A;  1K76 A;  1OL2 B;  1KQS A;  1YJN A;  4D8D A;  1JBM A;  2C06 A;  5HNB B;  1O9K A;  1RLQ C;  1VQO T;  2EYZ A;  3CCL A;  2H3J A;  1OOT A;  4EMK A;  2HD0 A;  4M7D A;  3OYK A;  1X2K A;  1O9K B;  1YWO A;  3S3M A;  4EMK B;  4M7D B;  1R0B G;  5GAO m;  2V8J A;  3DDP B;  2E10 A;  5GMK j;  1IRE B;  1Y71 A;  4MDX A;  4YTL A;  1K9M C;  3H0F A;  4E7H A;  2LQW A;  3MEU A;  1KXU A;  4EOM B;  2DTO A;  4M78 E;  1TG0 A;  4RG8 A;  1VYT A;  1JJ2 S;  4J5Y A;  3BG3 A;  3FLG A;  4ZNX A;  2IW8 B;  2DIL A;  5GAN j;  4J8O A;  3MPU B;  4PJO D;  3PVL A;  1TD6 A;  2X1N B;  5D6Y A;  4LE9 A;  1GCQ A;  5GAO q;  4FYY B;  4EOQ B;  1PG5 B;  5KYW A;  4M7A F;  4LOC A;  4HL4 A;  1FYN A;  3EG9 A;  4C92 D;  3CCR Q;  4M77 F;  2DMO A;  2XD0 A;  4CFU B;  4HA8 A;  1IRX A;  1G3T A;  3EG9 B;  4MDW A;  5GAN g;  3CPW S;  1ZA2 B;  3A5Z B;  3VUB A;  1QKX A;  2COY A;  2XG8 D;  2QQS A;  3NTH A;  2G3R A;  1H4L D;  4MZP A;  2IPO B;  5HBJ B;  3WXM B;  3OYD A;  2ZPI B;  2BE9 B;  1VQ4 T;  2A0F B;  3MP6 A;  4LDW A;  4OMF B;  1PSF A;  3NHN A;  1SSH A;  1XOV A;  4F7S B;  1PKS A;  4JJB A;  3JCM V;  3KBG A;  5D6X A;  1YIJ T;  4OGE A;  1OX8 A;  2W9Z A;  1Q7Y U;  2YHT A;  3HPW A;  5IN1 A;  5GAN 2;  3CEY A;  1VQ8 T;  2LZ6 B;  3BDL A;  3CCJ A;  3L42 A;  3RNJ A;  3B57 A;  1OI1 A;  2HL3 A;  1NZ9 A;  2DPP B;  3K7A M;  1U06 A;  2B86 A;  3LLR A;  1M4Z A;  1TH7 A;  2COZ A;  1J3T A;  2LT4 A;  4DBF A;  2C0O A;  5CKB A;  5M9O A;  1QVG A;  2W2H A;  2J7I A;  4JJD A;  4AFQ C;  2LTO A;  4OB2 B;  3R6O A;  4GLM A;  4XTV A;  5GAN 4;  3CCU Q;  1QP3 A;  4BCM B;  2A28 A;  2MAM A;  4BCP B;  1IO6 A;  1JO8 A;  4MML A;  3VS3 A;  3CCR A;  2NUT A;  4CC2 A;  3RER A;  1WFW A;  5DLO A;  3QYG B;  2QGG A;  4LDU A;  1TU0 B;  2NUT B;  2RHU A;  4FSX A;  2GQV A;  4BE0 A;  2KMT A;  1SF9 A;  2RA2 A;  1N9S A;  3LYI A;  2D0N A;  1Q86 R;  4PFZ A;  4C92 F;  3BY7 A;  3BG9 A;  2DL4 A;  3QWL A;  2JN0 A;  4HCB A;  3NMZ C;  2E3I A;  1VQ4 Q;  4J9C A;  1Q81 U;  4LDX A;  4HT8 A;  4BY1 X;  2FPF A;  3ZFJ A;  2VWF A;  2E65 A;  1YIJ Q;  3MP8 A;  1WNL A;  2QXF A;  5EFQ B;  1IB8 A;  1WHL A;  4EPC A;  1BBZ A;  2HQX A;  1KC8 C;  4K11 A;  2W99 A;  2ED1 A;  1Y07 A;  3EGD A;  1FMK A;  3VYH B;  3OYN A;  1MV0 B;  4OB3 B;  1D0Y A;  1VQ8 Q;  3ZL7 C;  4M7D F;  1VQL T;  5IAY A;  3EGD B;  2VB6 A;  2QDL A;  2A36 A;  2CT4 A;  3JCM h;  3PMI A;  4N4I A;  1W4S A;  1GFD A;  4EOS B;  4X1V A;  2R58 A;  1N8R U;  1GY3 B;  4NST B;  4BCN B;  1D1A A;  3QYE A;  3CCU A;  1RAG B;  2DTH A;  2BS2 A;  3POM A;  3OS1 A;  2P4T A;  4E7Z A;  1ZA1 B;  3QZ5 B;  2HZY A;  2VVK A;  3OMG A;  3N5B B;  4Y92 A;  4A4E A;  2QI2 A;  2UZD B;  3EFO A;  4DEY A;  2IIM A;  2MWO A;  4KT0 E;  1VQ7 T;  3EFO B;  4RUG A;  4EDU A;  1H64 1;  4RTW A;  4BI8 B;  5FRM A;  4BDY A;  1B07 A;  5CKH A;  3VKG A;  2D1X A;  4JX5 A;  2BE7 D;  1FMV A;  4JRQ A;  2WFY B;  2EQI A;  5I2M A;  1VQ4 A;  1H92 A;  2MYS A;  2I0N A;  2CDT A;  3CCE A;  1TTH B;  2WAC A;  3VV0 A;  1IHW A;  4HCZ A;  2NYS A;  2OI3 A;  4KGZ B;  3QKJ A;  5C6S A;  2RF0 A;  1RAA B;  3G1J A;  2JGZ B;  2AT1 B;  1WHH A;  5GAO p;  2RD1 A;  3PGG A;  1VQ8 A;  2E64 A;  4BCH B;  3MY5 B;  3OYM A;  4M75 E;  5LJ5 h;  5I2S A;  1VQL Q;  2KBT A;  2EVR A;  4QQD A;  3M9Q A;  1D3U B;  4AKG A;  3QG1 A;  4HCK A;  1K0X A;  2DXC A;  5LJ3 h;  2CZ0 B;  2K2M A;  2YXY A;  2EJG A;  3L1A A;  1ZUK A;  1K0S A;  2DXC B;  2KI7 A;  4C0F A;  3TNW B;  2COW A;  3CQT A;  3MHX A;  3QJY A;  2QA4 T;  2E4H A;  4LD9 K;  5CIU A;  4BCI B;  3CME A;  3TU4 K;  3UDC A;  3LQ5 B;  3M0R A;  2O31 A;  1BK2 A;  2UZE B;  2PHG A;  4F7U A;  1O75 A;  1LOJ A;  2JNG A;  1K1Z A;  5GJV B;  1M30 A;  4F7U B;  4HVW A;  2I40 B;  4AKI A;  1VQ7 Q;  1M8M A;  1V76 A;  1U8R A;  2RN8 A;  3V8K A;  1X69 A;  1KQS P;  3M0Q A;  2LJ0 A;  3G71 Q;  4IUR A;  1M5Q 1;  4LNP A;  2C5N B;  2Y4X A;  1X43 A;  2RQW A;  2CP6 A;  4LDV A;  2BZX A;  3SDZ A;  5I11 A;  3OYJ A;  1OIU B;  1UJ0 A;  1YBY A;  1G3W A;  1R0C B;  2EQU A;  1SKU B;  4KUI A;  4JRK A;  2RNA A;  3JB9 I;  3M5A A;  4BCQ D;  4CFV B;  1EX4 A;  1Q7Y C;  3HRS A;  4XU1 A;  3PFS A;  4M7A G;  4E7I A;  3VS1 A;  1W1F A;  5LJ5 d;  1S72 T;  3JB9 D;  4QVZ A;  4BUG A;  1VQL A;  1F5Q B;  2EJ9 A;  2DO3 A;  2IW6 B;  2KXC A;  3M54 A;  4M77 G;  3H9N A;  1JST B;  2EUF A;  2VKN A;  1W2B A;  4D8K A;  4IUT A;  4FYW B;  2LMJ A;  2XDD A;  2CCH B;  2JMA A;  3FJ5 A;  3OYL A;  3TSW A;  3CC4 Q;  2DIQ A;  2DZ9 A;  4E7J A;  3HFN A;  1X6O A;  2EAY A;  1ZSZ C;  2LP5 A;  3LW5 E;  4QVC A;  1SHG A;  3CBM A;  1JKW A;  1Q82 R;  4ROE A;  2AKK A;  1NPP A;  4B9W A;  1OUL A;  2KAF A;  1YI2 T;  4C8Q G;  1RI9 A;  5CKD A;  1WHG A;  2CH4 W;  2EQK A;  4EIK A;  2MF2 A;  3CCV Q;  3LWI A;  3INZ A;  2WSC E;  1TFB A;  3CC2 A;  2QF7 A;  3G71 A;  2E12 A;  4RCC A;  2O9S A;  2MMP A;  1X27 A;  4EOK B;  4A4G A;  3QDR B;  4J9I A;  2M16 A;  1Q81 C;  3OBW A;  2HMA A;  4RTZ A;  2Y4Y A;  1VQ6 T;  2X4W A;  4Z02 A;  2RQT A;  1N6A A;  2LCL A;  4KUL A;  3DLL A;  2DL3 A;  2KT8 A;  2DKG A;  4HXJ A;  1IXD A;  3G6E T;  2ZCF B;  3SWN C;  3U23 A;  7AT1 B;  2ZPG B;  1BU2 A;  2E5K A;  4FSS A;  1S72 Q;  4GLK A;  2LX9 A;  2WSF E;  2DET A;  3ER0 A;  2RB6 A;  2VAS A;  3NTI A;  2D6F A;  2A08 A;  2F2V A;  1YJ9 T;  3CC4 A;  3QII A;  5GAN 7;  4A53 A;  4HCC A;  1M3C A;  4OVA A;  2K79 A;  1OU8 A;  2ED0 A;  3O0G D;  2VGM A;  2CP7 A;  2RHI A;  3X20 B;  4M7A E;  4F17 A;  2KSS A;  1H1Q B;  4CI0 C;  1QVG P;  2FRY A;  2DL8 A;  2LJ1 A;  2EYX A;  1SRL A;  2WEV B;  4DBQ A;  2OAW A;  1QMZ B;  3UAT A;  3QYB A;  2MWP A;  3OA6 A;  3P8B B;  4LDY A;  4CRI A;  4P5N A;  3CCV A;  1YI2 Q;  3UT1 A;  1SPK A;  2D9T A;  2PMI B;  1ZSZ A;  3PIO A;  4QVD A;  3QHR B;  2GF7 A;  5EC7 A;  4JZ3 A;  4M7D G;  1OV3 A;  5KYN A;  1GBR A;  3TRE A;  1ZSZ B;  1Q86 U;  4CRL B;  2GBQ A;  1AZE A;  2P4R A;  5IHI A;  2KDS A;  3J81 E;  1KQS S;  1TWB A;  2E6Z A;  2V8I A;  2BUD A;  1NEG A;  3TCJ A;  4J9G A;  2P0P A;  3QWY A;  4F7U F;  2AHJ B;  2LC4 A;  2DJQ A;  2OJ2 A;  4Z88 A;  4FM4 B;  2HNI A;  4F6U B;  3JCM X;  2EGA A;  1UGS B;  1B34 A;  5L2W B;  1Y96 A;  5GMK i;  4AKH A;  1VQ6 Q;  2RQR A;  1LNX A;  2PTK A;  3BLR B;  2IVW A;  2P0K A;  3CCS A;  3CD6 T;  2BS3 A;  3ULR B;  1Y96 B;  3UWN A;  3BDU A;  3V8L A;  3CXC A;  1S72 A;  3G6E Q;  2VXF A;  1NLP C;  2C4G B;  2E70 A;  4E47 A;  4RMO A;  1OYX A;  2CT3 A;  1JXO A;  5ACB A;  4M78 C;  1WQW A;  5FLX E;  1NEB A;  3H8Z A;  2ZPE B;  2WJ9 A;  1YJ9 Q;  5J39 A;  2FZK B;  4XQ3 A;  3GTM S;  4IMY B;  3SWN A;  1ARK A;  4MFD A;  2W9F A;  5EG2 A;  1K9A A;  3JCM f;  4CFX B;  4F7J B;  2EYW A;  3SWN B;  4OML A;  4AG1 C;  4LN2 A;  4PJO E;  4BBR M;  1GBQ A;  2J06 A;  4C5G A;  1WI7 A;  4M7A D;  3JCM W;  1EIF A;  3C95 A;  3MJX A;  3GF5 A;  4GY5 A;  3BHU B;  3M58 A;  5IT9 E;  2DA9 A;  4M77 D;  4NS5 A;  2M0O A;  3E19 A;  1M3A A;  3FDR A;  2X51 A;  2DE0 X;  1PC0 A;  4G6L B;  1TOV A;  1HXD A;  1YNZ A;  4C92 E;  5I5Z B;  1T0J A;  2WXV B;  1I81 A;  2CKK A;  2QTV A;  3DKM A;  3E9F A;  2PNI A;  3PT9 A;  5KCH A;  1AWJ A;  3L2W A;  2VYT A;  1QVP A;  3JCM Q;  4ELL A;  2DTI A;  3PNW C;  3NGP A;  4IUP A;  1T3L A;  1VQ6 A;  5CK9 A;  1HD3 A;  4KRD B;  1G3S A;  5FRN A;  3CBO A;  1S1N A;  2E41 A;  2UZB B;  3VRZ A;  3HFO A;  1P5E B;  1H24 B;  3G6E A;  2C6T B;  3CD6 Q;  2SRC A;  5BNJ B;  4WF2 A;  1QVF A;  3OYE A;  4CC3 A;  4EOJ B;  2EFI A;  3M4Y A;  1IGQ A;  2LQ8 A;  3L2V A;  1X6G A;  2KGT A;  5A2Q E;  5DLQ E;  3RDV A;  5LJ5 f;  3OY9 A;  4AFZ C;  1SRM A;  3GPL A;  3HRT A;  3QSU A;  3I9Q A;  1LPL A;  3KXT A;  2J05 A;  5LJ3 f;  2YUQ A;  2LVM A;  1ABO A;  1QVG S;  4M78 A;  4OMN A;  4FCY A;  2EGE A;  4QQG A;  3ZBD A;  2QFZ A;  1VYV A;  2KMG A;  4M78 B;  2DJZ A;  1HK9 A;  3E9G A;  3JCM J;  4EOO B;  1KIK A;  2FPE A;  4E2F B;  5HQ0 B;  1OZ3 A;  3RMS A;  3G4S A;  4M4Z A;  5I21 A;  2DX1 A;  1M1G A;  5KYW B;  3PO3 S;  2DFU A;  2Y90 A;  3WVD B;  2X3X D;  3VS5 A;  3UF4 A;  2DD5 A;  2C0T A;  1VYU A;  3NDQ A;  4CFN B;  1M1K R;  5CKF A;  2WIH B;  2HSP A;  3A98 A;  2XIC A;  1G3N C;  3RMQ A;  2DD5 B;  4CC4 B;  4OGC A;  4BY7 X;  1ZUY A;  1VQO Q;  1TUG B;  2RJD A;  1TXQ A;  5KCO A;  2J6K A;  2L3S A;  1MV3 A;  2FVU A;  5GAN 5;  4BDZ A;  3CD6 A;  1SG5 A;  1VIF A;  2EYY A;  3VS0 A;  1PNJ A;  3LGL A;  1AHJ B;  2IG0 A;  4M7D D;  1NYF A;  3X25 B;  4HNU A;  4C8Q F;  2FZC B;  5HK3 A;  2MK5 A;  4EC8 B;  2G77 A;  2F5K A;  3EID B;  5DY9 A;  3JCM g;  1WJR A;  1RI0 A;  3X24 B;  2WMB B;  4BCF B;  4J7F A;  1W2B P;  3D7S B;  1UDL A;  1VIE A;  2JS0 A;  1UGV A;  3JRZ A;  2ENM A;  4ATO A;  2GCX A;  3HB9 A;  4A4H A;  3HRU A;  1AIS B;  1Q82 U;  2XID A;  4FT2 A;  2DNU A;  2ZPF B;  2PUO B;  3E2U A;  3VS2 A;  4DBH A;  1OPK A;  4YOS A;  1QKW A;  1FIN B;  3MIA B;  2KQW A;  2GGR A;  1D0X A;  1JRI A;  4KRC B;  1MUZ A;  2EKO A;  1Q86 C;  5GAM d;  4C0D C;  4EOR B;  1YN8 A;  2CSI A;  3UA6 A;  4MIM A;  4ROD A;  3C12 A;  2GFA A;  4CFU D;  2ECZ A;  4JJC A;  1VQO A;  4LXC A;  3EJ1 B;  2O88 A;  4NOY A;  5LJ3 j;  2NUZ A;  5FU7 C;  3C94 A;  1PRL C;  1AVZ C;  2QAS A;  2M9U A;  1Z9Z A;  2JW4 A;  1KK7 A;  1WA7 A;  2K5F A;  1PHT A;  3RGF B;  5HVY B;  1RLP C;  1AWX A;  2DEQ A;  3EFS A;  3A8M B;  4JLG A;  5LJ5 g;  2H8H A;  4E7L A;  2A37 A;  1F1B B;  3CMA T;  1N9R A;  4M75 C;  4J9H A;  5LJ3 g;  3CCQ T;  1D3B A;  3RBB B;  4PJJ A;  2RI3 A;  1D3B B;  1BIB A;  2AZV A;  1U1T A;  1WGS A;  2CP5 A;  4F7U G;  4JX4 A;  4BD3 A;  1TUD A;  3GLX A;  3I35 A;  1BCO A;  5CYI B;  4OMP A;  5GAO r;  2WIP B;  3ASK A;  2K3Y A;  1AOJ A;  4XAX B;  3OSV A;  1RUW A;  4IIO A;  1KC8 R;  1JU5 C;  4PFP A;  2X4X A;  5GMK l;  4VUB A;  1GL5 A;  4BCM D;  1W6X A;  3MEA A;  1IZ6 A;  5CKE A;  2B8A A;  3A1P A;  3I55 T;  3OQ5 A;  1ZHI A;  1M90 U;  1W70 A;  4M78 F;  1Y7X A;  1N5Z A;  2L5Q A;  3V7S A;  5IXB A;  4C5E A;  3L2U A;  1H28 B;  1OL1 B;  4RTV A;  4ROC A;  2BKD N;  2CZ6 B;  3VKI A;  1VQN T;  3PTA A;  2CGH A;  4C0D B;  1YIJ A;  2SEM A;  1CKB A;  4Z6Y A;  4JS5 A;  1WPY A;  2VUB A;  2CP3 A;  5GAN d;  3CXC P;  3H0H A;  1WQ7 A;  4B9X A;  3JB9 J;  4C5H A;  4ZGE B;  4MMK A;  2KY9 A;  3CPF A;  4TTH A;  5FU7 B;  3CMA Q;  3OYG A;  1YJW T;  4HKE A;  4JS4 A;  1G2B A;  2L8D A;  3M57 A;  1W2B S;  4BCK B;  2GNC A;  4XTY A;  1H27 B;  1FKM A;  4BE1 A;  2DRM A;  1H3H A;  3HZJ A;  1OEB A;  3JCM e;  1I5L A;  4MZT A;  3EHR A;  2V22 B;  3TVT A;  1WXT A;  4M75 A;  2EJF A;  3BFM A;  3ME9 A;  1CSK A;  3H4C A;  4PKC C;  2LX7 A;  4BCN D;  3A8G B;  4M75 B;  3LGF A;  1BB9 A;  4EMG A;  2DXU A;  1VOM A;  2WSE E;  4XTU A;  3BG5 A;  1PSE A;  2XKO C;  1K8A U;  4IKF A;  1KD1 U;  4CFW B;  3URG A;  4DOV A;  3DDQ B;  1WXB A;  2IW9 B;  3EOC B;  3VRY A;  4QKU A;  4FT4 A;  3LX7 A;  4Y72 B;  1WHK A;  2IVX A;  2QYZ A;  4PJN A;  1BKB A;  1ZUU A;  2QGS A;  2NUP A;  2ROL A;  1NYG A;  5FGK B;  2E5Q A;  3FB9 A;  1GXI E;  2NUP B;  1G8X A;  1RAI B;  1VQN Q;  2VC8 A;  1AD5 A;  3J7A F;  4BY6 C;  2LQN A;  3VS4 A;  2KK4 A;  2KR3 A;  5KE3 A;  1ZQ1 A;  1ABQ A;  4ELY C;  5IHN A;  3J80 E;  5A0G A;  2K3X A;  2RK1 A;  1QWE A;  3X26 B;  1N27 A;  2HL5 C;  2HKN A;  3CMA A;  5GMK m;  1NJI R;  3EGX A;  1M1F A;  1QVF P;  2CP0 A;  2R5M A;  1OKV B;  5CEI B;  2JT4 A;  2PK2 A;  1VQP T;  1JSU B;  1VQ9 T;  2K5L A;  1E6H A;  3EGX B;  3GIB A;  1YJW Q;  5FU6 C;  2JZ2 A;  4EOP B;  5LJ5 e;  4E7K A;  2HBW A;  4YC3 B;  2DME A;  1Q82 C;  4KGV B;  2DLP A;  4XU0 A;  1Y57 A;  4JLI A;  1MMD A;  4UC4 A;  5LJ3 e;  2MI6 A;  3BHV B;  4OB1 B;  4DOW A;  4KH1 B;  2YUO A;  3OS5 A;  5CO7 A;  3FJP A;  1BI2 A;  1WLP B;  2WMA B;  3PVQ A;  1UTI A;  4DBR A;  1V1C A;  2QA4 Q;  4AG2 C;  1Q7Y R;  2BKZ B;  3GOX A;  5FWB A;  1K4U S;  1M2O A;  3VUZ A;  4BCO B;  3JCM c;  1OZ2 A;  3GP8 A;  2CSQ A;  1VQ7 A;  4QSH A;  5IF1 B;  1CKA A;  2VV5 A;  2ZPB B;  3LWH A;  1M1K U;  2RJF A;  3LH5 A;  2FPD A;  2J6F A;  4RTX A;  2A7Y A;  4N4G A;  2KEA A;  3JCM P;  4R0K A;  1R8O B;  1IGU A;  1UHC A;  3OYI A;  2FEI A;  4ELZ C;  2QAZ A;  1FMW A;  2LNV A;  1VUB A;  1UGR B;  3SFM A;  2XU8 A;  2AK5 A;  1D0Z A;  2YWW A;  1QWF A;  3AT1 B;  4BI4 A;  2JJ9 A;  2M1H A;  2E3H A;  2YRC A;  5GAN 8;  1O9S A;  1MMA A;  2RQV A;  2WHB B;  2PZ1 A;  1MNE A;  2JOY A;  3CXC S;  3GBQ A;  3HL8 A;  4E6R A;  1BIA A;  1C9B A;  1MMG A;  1SHF A;  4ZN3 A;  3V8J A;  4EOI B;  4IUV A;  3QPH A;  1PD1 A;  3MKD A;  2ZAE A;  1YJW A;  1YJN T;  5L23 A;  4FL6 A;  4LUE A;  4ANJ A;  3OSS C;  3DJB A;  2FL7 A;  5ICP B;  1VQP Q;  4HNV A;  1VQ9 Q;  1QQJ A;  4BY6 B;  3SEM A;  2EBP A;  3P8H A;  3OS2 A;  1OU9 A;  2DZC A;  2L3R A;  5AYF A;  1N8R C;  4EON B;  1ZLM A;  4O5V A;  4PJO C;  1C1A A;  1OX9 A;  3L2Q A;  3MP1 A;  2QA4 A;  4JRP A;  4LD6 A;  1QLB A;  4CFM B;  2NLU A;  2DEU A;  1AZG B;  4M77 E;  1E7P A;  3BW1 A;  1XNI A;  3OBY A;  5FU6 B;  3OW2 A;  2KRM A;  1A0N B;  4J83 A;  4M7A A;  1G3Y A;  2XMF A;  1M90 C;  2FO0 A;  1G5V A;  2DVE A;  4C92 C;  2AKL A;  3OYY A; 
#chains in the Genus database with same CATH homology
 3HBL A;  3ZFJ A;  3KXT A;  1VQM A;  2E65 A;  5LJ3 f;  2RI5 A;  4BB7 A;  3MP8 A;  1WNL A;  2LVM A;  2RO0 A;  4M75 F;  2QXF A;  1QVG S;  1KC8 C;  4EPC A;  4M78 A;  2HQX A;  3O8V A;  1XQH A;  3UPU A;  3CC7 A;  1JB0 E;  4QQG A;  3ZBD A;  2QFZ A;  1Y07 A;  2KMG A;  3VYH B;  4M78 B;  4RG2 A;  3OYN A;  3CCQ A;  3S3O A;  4OB3 B;  2DJZ A;  1HK9 A;  2DK3 A;  3E9G A;  5HK0 A;  3JCM J;  3GNG A;  4M7D F;  1VQL T;  5IAY A;  1WJQ A;  2PU9 B;  2JVV A;  4C8Q E;  1FWZ A;  4BAC A;  2EIF A;  3CCM T;  1OZ3 A;  3RMS A;  3JCM h;  3G4S A;  3QHS A;  3PMI A;  4N4I A;  5I21 A;  1M1G A;  1W4S A;  3RKX A;  3M53 A;  5GAO n;  1N8R U;  2R58 A;  2CZ1 B;  1B34 B;  2Y90 A;  3WVD B;  4Q5W A;  3CCS T;  4M7A C;  2LRQ A;  4QW2 A;  3S3N A;  2DD5 A;  1VQ5 T;  3QYE A;  3P8D A;  3CCU A;  1VQP A;  1QVF S;  5CKF A;  2OTL T;  2DTH A;  2BS2 A;  2XIC A;  4M77 C;  3RMQ A;  2RH2 A;  2DD5 B;  2P4T A;  3OS1 A;  1FXX A;  3QZ5 B;  4OGC A;  5LJ3 d;  1UGQ B;  4NL3 A;  1K9M U;  3OMG A;  4M78 G;  3N5B B;  4OF1 A;  1H3Z A;  4M75 D;  3OW2 S;  4A4E A;  1QW1 A;  4NC6 A;  2QI2 A;  4ZGD B;  2RJD A;  4RKU E;  5KCO A;  5FRM A;  4BDZ A;  5GAN 5;  2FVU A;  4ZN1 A;  3CD6 A;  4BBS M;  3WVE B;  3I55 A;  2MWO A;  5LL6 S;  4KT0 E;  1VIF A;  1VQ7 T;  2L89 A;  3JAM E;  4RCB A;  3MEW A;  3LGL A;  1AHJ B;  2X4Y A;  2IG0 A;  1H64 1;  2QQR A;  4BI8 B;  3X25 B;  4EDU A;  2LQK A;  3MO8 A;  5CKH A;  3VU3 C;  4BDY A;  1YHQ A;  1BYM A;  4HNU A;  2QQ8 A;  3I56 T;  3QYH B;  3VKG A;  2RJC A;  2V8K A;  4C8Q F;  4JX5 A;  3JB9 H;  3PIP A;  3FRN A;  5HK3 A;  5GAM f;  3OMC A;  2XHC A;  4JRQ A;  4XTZ A;  5I2M A;  2G77 A;  1VQ4 A;  2F5K A;  1K8A C;  1KD1 C;  5DY9 A;  3JCM g;  1VQN A;  2PVO B;  1YI2 A;  1WJR A;  1RI0 A;  4C5I A;  3CCE A;  3X24 B;  2WAC A;  3RKY A;  3VV0 A;  4C8Q C;  3QO3 A;  4J7F A;  4PJO A;  3CCJ T;  4HCZ A;  5J3B A;  4C0Z A;  1NE8 A;  1VIE A;  3QKJ A;  3JRZ A;  2FYK A;  3ZEH A;  5C6S A;  3HP9 A;  4PJO B;  4ATO A;  3M55 A;  2GCX A;  3HB9 A;  4A4H A;  2PVD B;  1KHI A;  3HRU A;  2P0Q A;  1Q82 U;  4L5G A;  2EWN A;  2XID A;  4Y28 E;  4FT2 A;  2ZPF B;  2PUO B;  5J26 A;  1MHN A;  3RUX A;  5GAO p;  2RD1 A;  3PGG A;  1VQ8 A;  2E64 A;  2XDP A;  1P92 A;  4A54 A;  3OYM A;  4C92 A;  3KHI A;  4M75 E;  3L2Z A;  5LJ5 h;  3C4S A;  3A8H B;  1WJS A;  3OYC A;  1SSF A;  4N4H A;  5I2S A;  2QQ9 A;  2KQW A;  2RHY A;  3V7C A;  1JRI A;  3GNF B;  3CCL T;  2X35 A;  4C92 B;  4QQD A;  3TW7 A;  1LJO A;  3M9Q A;  3DB3 A;  4C8Q D;  4R56 A;  4AKG A;  4L59 A;  3QZ9 B;  2EKO A;  3QG1 A;  4PLL A;  2ZPH B;  4C0D C;  5GAM d;  1Q86 C;  2DXC A;  3JSC A;  5LJ3 h;  2CZ0 B;  2FHD A;  4JRI A;  2EJG A;  4EMH A;  3OYB A;  2HAX A;  3L1A A;  2RM4 A;  4M7D E;  4MIM A;  4PJO G;  4ELJ A;  3C12 A;  2GFA A;  2DXC B;  4FU6 A;  1U1S A;  4AI6 A;  4C0F A;  4DA4 A;  3MHX A;  3QJY A;  3EAE A;  4NL2 A;  2QA4 T;  4LD9 K;  1X01 A;  2DXT A;  2F69 A;  5CIU A;  1VQO A;  3CME A;  4NOY A;  3TU4 K;  3UDC A;  5LJ3 j;  1YJ9 A;  3RIR A;  2RI2 A;  2OTJ T;  2EYQ A;  5FU7 C;  3C94 A;  4F7U A;  2HBP A;  1UGP B;  5C0M A;  4L6V 5;  1O75 A;  2M9U A;  4PLI A;  3JB9 F;  1LOJ A;  1KHC A;  2JNG A;  2X4J A;  4FIB A;  2I2L A;  2K5F A;  2K57 A;  4F7U B;  4C92 G;  2QQA A;  4AKI A;  2HQE A;  4M7A B;  3FEO A;  5GAN 3;  4M77 A;  1U8R A;  5FRO A;  2DEQ A;  3EFS A;  5A0L A;  3A8M B;  3V8K A;  4JLG A;  5LJ5 g;  4DQ2 A;  4JX6 A;  3QSU A;  2JUF A;  4IUR A;  4C0G A;  1M5Q 1;  4M77 B;  5GAO l;  4E7L A;  2R5A A;  2Y4X A;  4XU3 A;  2A3L A;  1K73 C;  2XDB A;  3CMA T;  4II1 A;  1N9R A;  4LDV A;  4M75 C;  4TVR A;  3CCQ T;  5LJ3 g;  3SDZ A;  1D3B A;  3OB9 A;  1VQK A;  3OYJ A;  1YBY A;  3SB2 A;  2E6N A;  3JCM b;  1I4K 1;  2RI3 A;  4QQ6 A;  1G3W A;  1M1K C;  2EQU A;  4KUI A;  3JB9 I;  4JRK A;  1D3B B;  4XTX A;  1BIB A;  2KVQ G;  2OAU A;  1U1T A;  3M5A A;  4EMK C;  4M7D C;  1WGS A;  3G4S T;  1Q7Y C;  4F7U G;  2K2V A;  3HRS A;  4A4K A;  4XU1 A;  3PFS A;  4JX4 A;  4M7A G;  4HT9 A;  4E7I A;  4O6J A;  4M7D D;  1NPR A;  5LJ5 d;  4BD3 A;  1S72 T;  3JB9 D;  4QVZ A;  3GLX A;  4C8Q A;  2KR6 A;  4BUG A;  5GAM h;  5GAO r;  5CAI A;  3ASK A;  3SD4 A;  1VQL A;  1VQ9 A;  2EJ9 A;  3CCU T;  2DO3 A;  3M54 A;  5HY6 A;  4M77 G;  1V29 B;  4JDS A;  1BI1 A;  3S6W A;  1KQ2 A;  2K3Y A;  4XAX B;  5D6W A;  3OSV A;  4C8Q B;  5GAN f;  3AHU A;  3CCM A;  2X4X A;  5GMK l;  2BS4 A;  1W2B A;  4VUB A;  4IUT A;  3MEA A;  5GAM j;  2XDD A;  1IZ6 A;  3M56 A;  3OS0 A;  5CKE A;  3OYL A;  2EQJ A;  2B8A A;  2DIQ A;  2DZ9 A;  4E7J A;  3I55 T;  3HFN A;  3A8L B;  1X6O A;  1ZHI A;  2CZ7 B;  3A8O B;  2EAY A;  3OQ5 A;  1NJI U;  1M90 U;  1VQ5 A;  4M78 F;  1Y7X A;  2OTL A;  1ZBX A;  2L5Q A;  3RES A;  3V7S A;  3L2U A;  4C5E A;  4IUU A;  3LW5 E;  4QVC A;  3CBM A;  1KC8 U;  2QDY B;  1UB4 A;  2BKD N;  2LT1 A;  1NPP A;  4HNT A;  4B9W A;  3MEV A;  4X9D A;  4J6Y A;  2CZ6 B;  5CVI A;  3VKI A;  2KAF A;  4ZTF A;  1VQN T;  3PTA A;  1YI2 T;  2CGH A;  3MET A;  3NFC A;  2DXB A;  4J6X A;  2LCC A;  2PQW A;  4C8Q G;  2QEX T;  3CCE T;  5CKD A;  4XU2 A;  2EQK A;  3G7Z A;  3TEE A;  4C0D B;  3OYA A;  3CPW S;  1YIJ A;  2MF2 A;  2OTJ A;  2XI9 A;  4JS5 A;  4Z6Y A;  4BI3 A;  1WPY A;  3HKS A;  5GAM g;  2DXB B;  3LWI A;  3INZ A;  2VUB A;  2WSC E;  4MFE A;  2QDJ A;  2QF7 A;  3LH0 A;  3G71 A;  3I56 A;  3FC3 A;  3E1S A;  3CC2 A;  4J7I A;  5GAN d;  2E12 A;  4RCC A;  1WQ7 A;  4B9X A;  3HO8 A;  3JB9 J;  1YIT T;  2MMP A;  3DL1 A;  2ZGW A;  4C5H A;  1QP2 A;  2K5I A;  4ZGE B;  5EJC A;  1UEB A;  3MCA B;  4JUV A;  4MMK A;  4A4G A;  2KY9 A;  3QDR B;  3CPF A;  2M16 A;  2VGN A;  2DD4 A;  5FU7 B;  3T9N A;  1Q81 C;  3OBW A;  3OYG A;  1YJW T;  3HSB A;  4HKE A;  4JS4 A;  4M78 D;  1KQ1 A;  3Q1J A;  3VKH A;  2L8D A;  3M57 A;  2DD4 B;  1W2B S;  2DIG A;  2Y4Y A;  1VQ6 T;  4ZTJ A;  3H6Z A;  1JJ2 A;  5A0D A;  2X4W A;  4Z02 A;  2QTX A;  4ZGJ B;  4XTY A;  1N6A A;  2LCL A;  3RKW A;  1FKM A;  3F70 A;  4KUL A;  3DLL A;  3CCR T;  4JJN K;  4BE1 A;  3HZJ A;  3VYG A;  2DKG A;  3JCM e;  3FIF A;  1I5L A;  4XK8 E;  2LDM A;  4MZT A;  3G6E T;  3DLM A;  2ZCF B;  3SWN C;  3M4G A;  2EJF A;  3BFM A;  2FB7 A;  3ME9 A;  4M75 A;  5LJ5 j;  1KQS A;  2RK2 A;  2YLC A;  2ZPG B;  3H4C A;  4PKC C;  1YJN A;  3VYG B;  2VXE A;  4GLK A;  4A4F A;  2LX9 A;  1JBM A;  2WSF E;  3A8G B;  4M75 B;  3ER0 A;  5GAM e;  3LGF A;  2C06 A;  2RB6 A;  3NTI A;  1VQO T;  2D6F A;  3CCL A;  4EMG A;  3CME T;  5GMK h;  2H3J A;  4EMK A;  2DXU A;  2HD0 A;  2WSE E;  4XTU A;  4PJO F;  3OYK A;  3BG5 A;  3QXE B;  1PSE A;  2XKO C;  3QII A;  1YJ9 T;  4D6W A;  1K8A U;  1KD1 U;  5GAN 7;  3CC4 A;  4A53 A;  3URG A;  4HCC A;  2BIV A;  2JTF A;  4DOV A;  3S3M A;  4OVA A;  4EMK B;  4M7D B;  2K4Y A;  3OYH A;  5GAO m;  4BE2 A;  2DAQ A;  2VGM A;  2V8J A;  4Y91 A;  4FT4 A;  2RHI A;  3X20 B;  2E10 A;  3LX7 A;  4M7A E;  5GMK j;  1IRE B;  1VQM T;  3CPW A;  2KSS A;  1Y71 A;  5GMK e;  2JTM A;  3JB9 G;  4XTW A;  4MDX A;  4CI0 C;  5CR2 A;  1BKB A;  4YTL A;  1K9M C;  2XK0 A;  4E7H A;  3MEU A;  4N0A C;  3CC7 T;  2E5Q A;  5GAN h;  2DTO A;  4M78 E;  3FB9 A;  4MZM A;  4M75 G;  3QYB A;  2MWP A;  3OA6 A;  3HHT B;  3P8B B;  1FX7 A;  4LDY A;  4CRI A;  1GXI E;  4P5N A;  3CCV A;  3J7A F;  2VC8 A;  4RG8 A;  3UT1 A;  1JJ2 S;  4BY6 C;  4J6W A;  2KK4 A;  2D9T A;  4J5Y A;  3BG3 A;  3PIO A;  4QVD A;  5KE3 A;  1ZQ1 A;  3FLG A;  4ELY C;  2GF7 A;  3J80 E;  5A0G A;  2K3X A;  5GAN j;  4J8O A;  4M7D G;  2RK1 A;  2O4X A;  1XTD A;  3TRE A;  1Q86 U;  3X26 B;  4PJO D;  3J81 E;  3X28 B;  2KDS A;  1KQS S;  1N27 A;  2E6Z A;  2V8I A;  3CMA A;  2CS7 A;  2BUD A;  5GMK m;  2O4X B;  1M1F A;  3TCJ A;  2PVG B;  4HLQ A;  2R5M A;  3PMT A;  5D6Y A;  1VQP T;  4IUQ A;  3KUF A;  1BI0 A;  2K5L A;  1VQ9 T;  2P0P A;  4F7U F;  2F5T X;  3GIB A;  5GAO q;  2AHJ B;  2LC4 A;  3JCM X;  4FM4 B;  2HNI A;  4M7A F;  4LOC A;  5FU6 C;  4HL4 A;  1UGS B;  1B34 A;  1Y96 A;  2JZ2 A;  5LJ5 e;  5GMK i;  4AKH A;  4E7K A;  2RHX A;  1LNX A;  2R57 A;  2IVW A;  2P0K A;  1Q82 C;  4C92 D;  3CCS A;  3CD6 T;  2BS3 A;  4M77 F;  2XD0 A;  1Y96 B;  4HA8 A;  3BDU A;  1M9S A;  4XU0 A;  3UWN A;  3V8L A;  3CXC A;  4JLI A;  4UC4 A;  1S72 A;  1KG1 A;  1G3T A;  2MI6 A;  2PUK B;  4MDW A;  5LJ3 e;  5GAN g;  4OB1 B;  2VXF A;  3A5Z B;  4PL6 A;  2ZZD A;  4DOW A;  1MGQ A;  3VUB A;  3QUI A;  3OS5 A;  5CO7 A;  2XG8 D;  3FJP A;  2E70 A;  2QQS A;  4E47 A;  4IKF A;  1BI2 A;  3QJ6 A;  1YHQ T;  3NTH A;  4RMO A;  1OYX A;  2ZZD B;  2G3R A;  4M78 C;  4MZP A;  1WQW A;  5FLX E;  3WXM B;  3H8Z A;  3OYD A;  3GOX A;  2ZPE B;  2ZPI B;  1VQ4 T;  2WJ9 A;  1K73 U;  3VUZ A;  3MP6 A;  2E1H A;  4LDW A;  3JCM c;  4XQ3 A;  4ME7 A;  2CYZ B;  1OZ2 A;  1PSF A;  4OMF B;  5J39 A;  3SWN A;  1XOV A;  3GP8 A;  1VQ7 A;  4MFD A;  4QSH A;  3JCM V;  3KBG A;  5EG2 A;  3JCM f;  2VV5 A;  5D6X A;  2ZPB B;  3LWH A;  1YIJ T;  4OGE A;  1M1K U;  2RJF A;  3SWN B;  4PJO E;  4BBR M;  2A7Y A;  3EFR A;  3NTK A;  4N4G A;  4C5G A;  3JCM P;  3CC2 T;  3G71 T;  4M7A D;  3JCM W;  4M7D A;  1EIF A;  1R8O B;  3C95 A;  1Q7Y U;  1I8F A;  4V2S A;  3DB4 A;  2YHT A;  3OYI A;  3HPW A;  3TW6 A;  4ELZ C;  3GF5 A;  5IN1 A;  2D0Q B;  4GY5 A;  5GAN 2;  3M58 A;  2LNV A;  5IT9 E;  1VUB A;  3CEY A;  1UGR B;  3SFM A;  2XU8 A;  4M77 D;  4NS5 A;  1X75 C;  2M0O A;  3E19 A;  5KE2 A;  2QEX A;  3BDL A;  3CCJ A;  3L42 A;  4BI4 A;  1DJ7 B;  3FDR A;  5GAN e;  1OI1 A;  2M1H A;  2YRV A;  1NZ9 A;  2DPP B;  5GAN 8;  4OP0 A;  1O9S A;  4X9C A;  1HXD A;  4C92 E;  3CBP A;  3LLR A;  1M4Z A;  1TH7 A;  1I81 A;  2CKK A;  2JOY A;  4R55 A;  3CXC S;  1YIT A;  3HL8 A;  2LT4 A;  3V7R A;  1BIA A;  4N0A A;  5CKB A;  3DKM A;  3E9F A;  3PT9 A;  5CQY A;  5KCH A;  5M9O A;  5HKC A;  4ZN3 A;  3L2W A;  2QQB A;  1QVG A;  2VYT A;  3V8J A;  2EQM A;  1QVP A;  4IUV A;  3QPH A;  3JCM Q;  3OYF A;  2DTI A;  3PNW C;  1YJW A;  2LTO A;  5CCA A;  4IUP A;  5KH6 A;  4OB2 B;  1YJN T;  3R6O A;  4XTV A;  3JCM d;  4FL6 A;  5GAN 4;  3OSS C;  4OB0 B;  2FL7 A;  1VQ6 A;  4HNV A;  5CK9 A;  1QP3 A;  1VQ8 T;  2MAM A;  1G3S A;  5FRN A;  1YCY A;  3CBO A;  4BY6 B;  4MML A;  5L8R E;  3CCR A;  2O01 E;  2E41 A;  3RER A;  3P8H A;  4M6V A;  1RL2 A;  3HFO A;  4KBM B;  5DM7 R;  3OS2 A;  3CC4 T;  5DLO A;  3QYG B;  2DZC A;  2L3R A;  5AYF A;  1N8R C;  4LDU A;  3G6E A;  2YLB A;  4O5V A;  3M59 A;  4F7U E;  2RHU A;  5GAN 6;  4PJO C;  4FSX A;  2GQV A;  4BE0 A;  2KMT A;  4WF2 A;  3L2R A;  2GFU A;  3MP1 A;  3L2Q A;  2RA2 A;  2QA4 A;  4JRP A;  4LD6 A;  1BI3 A;  2RHZ A;  3VJP A;  4PNO A;  3QBY A;  1QLB A;  1N9S A;  3LYI A;  4KUD K;  1QVF A;  3OYE A;  2NLU A;  2EFI A;  2RJE A;  3M4Y A;  4M77 E;  1E7P A;  4C92 F;  3BW1 A;  1XNI A;  2LQ8 A;  3L2V A;  3BY7 A;  4X34 A;  3BG9 A;  3QWL A;  3OBY A;  1M8V A;  2JN0 A;  5FU6 B;  4HCB A;  5A2Q E;  3OW2 A;  5DLQ E;  5LJ5 f;  3OY9 A;  4J83 A;  4M7A A;  5CQX A;  1Q81 U;  1G3Y A;  1VQK T;  1M90 C;  3CCV T;  1NJI C;  4HT8 A;  4LDX A;  1G5V A;  2DVE A;  4C92 C;  3GPL A;  3HRT A;  3OYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...