4OB0B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob0B02
2PVDB 3QXEB 4ZGJB 2DD5B 2ZZDA 4RKUE 2ZPFB 2PUOB 3WVDB 2ZCFB 3VYGA 3QZ5B 2AHJB 2DD5A 2PVGB 2ZPIB 2WSCE 1UGSB 2QDYB 3X20B 2ZPEB 4XK8E 1AHJB 1QP2A 1DJ7B 1V29B 3A8OB 1UGPB 2DXBB 1PSEA 3HHTB 1UGRB 2CYZB 4OB3B 2PUKB 3QYGB 4OB2B 1UGQB 2DPPB 2PU9B 2WSEE 3VYGB 2ZPGB 2D0QB 3QZ9B 2O01E 4OB0B 5L8RE 2DD4B 3A8LB 2CZ7B 3A8HB 1QP3A 2ZPHB 3LW5E 3WVEB 2CZ6B 4L6V5 2WSFE 3QYHB 4ZGDB 3VYHB 4Y28E 2ZPBB 2DXCB 3X28B 4KT0E 2CZ0B 1IREB 2DD4A 3A8GB 3A8MB 3X25B 1JB0E 2CZ1B 2DXBA 2ZZDB 3X24B 3X26B 2PVOB 1PSFA 4FM4B 2DXCA 1GXIE 4ZGEB 4OB1B
chains in the Genus database with same CATH superfamily
4FYYB 2KROA 2D1XA 4CFMB 4CC4B 2E64A 2A3LA 2LQNA 1ZQ1A 3I56Q 1R0CB 5CQXA 2W0ZA 1VQPT 5AT1B 5LJ3f 4EMHA 2EKOA 4HKEA 1YITA 4M7DG 1Q82R 3OYDA 5EJCA 2QYZA 2RD1A 4FL6A 4HCCA 2RQWA 3J7AF 4AKGA 3BFMA 5HBHB 4B6MA 2WACA 1G5VA 4M77B 3QSUA 1UUEA 1BIBA 3OYCA 1R77A 2GFAA 3X20B 5IHNA 4HVVA 3EG9B 2COYA 2FEIA 1NBEB 3V7RA 2C06A 1SF9A 1WDXA 2XIDA 5FGKB 2KI7A 1V29B 2LQWA 3A1PA 4N0AC 1H25B 1M5Q1 2LJ1A 3M9QA 5HKCA 4Z02A 1X75C 2KDSA 3VU3C 4ROCA 1YIJA 4J6WA 3VS7A 3JCMP 1FVVB 4J6YA 2ZGWA 4BDYA 4LUDA 2X4JA 2GF7A 5I21A 5FRMA 3VYGB 3EG3A 2ZPGB 5DQWA 2JS0A 4M75G 4C5GA 2C4GB 4C92B 2O2OA 2MMPA 5D6XA 5GANj 1M8VA 2RI2A 4BY6C 1OKVB 3JCMX 2DX1A 4HT8A 5L23A 3LLRA 3OYIA 2RF0A 2D0NA 4MFDA 1RUWA 5FW9A 1MV3A 4M6VA 1BK2A 3MPUB 2RA2A 2E65A 1W1FA 3NTHA 1KJWA 1WJQA 2F69A 4N4HA 5HNBB 5GAN5 1C9BA 4LDYA 1IREB 3SHWA 3OYFA 3EH2A 3THKA 1GFCA 2BS4A 4M7DD 3JB9I 2CP3A 1RI9A 1BI3A 2IN3A 4NS5A 2LNVA 4FX3B 3CC4T 2HDAA 1VQNT 2Y4XA 2DXCA 2M0OA 5EG2A 2QEXQ 1IB8A 3FJ5A 2Y4YA 1SEMA 2WMAB 5KYXB 1M1KU 3CCJA 4CFVB 2IVXA 1QVPA 2L89A 4ZN1A 4BBRM 1WQ7A 3MCAB 1X6BA 1XQHA 2EGEA 2JS2A 3G6ET 4BCKB 1XTDA 3G71Q 2QA4Q 3MEWA 4ORZA 3JV3A 2EYZA 2GCXA 3I9QA 4RTTA 2WEVB 1KQ1A 2MWPA 2YT6A 2NUTA 4BCPB 1GL5A 5CKDA 4N4GA 1VYUA 4OP0A 1WPYA 2CT4A 3DLMA 2XDPA 4M75D 1OU8A 2DXTA 4M7DA 5BNJB 2DJZA 4BCIB 1BKBA 5CK9A 2IIMA 1D3UB 1YHQQ 3SWNA 2LW4A 1QCFA 1IZ6A 1NZ9A 5CKHA 2JMCA 1D3BB 1VQ5T 5D6YA 2SRCA 1KXUA 4EMGA 2X35A 2EQUA 4MDXA 1YJ9T 4A53A 5CO7A 1UGQB 1KD1U 3MY1B 2FG0A 1GCQC 4C92F 3G4ST 1K9AA 2LCCA 3CXCP 4LDVA 4E7IA 1Q7YC 1SRMA 3BW1A 3UF4A 3JCMe 5FROA 1U1TA 2EYQA 1F1BB 2P0KA 3CCEQ 2E12A 5ACBA 1BCOA 1G8XA 1OULA 2XKOC 1AWJA 2ZPHB 3G7ZA 3HZJA 4EOKB 1H28B 5I11A 1HXDA 2LMJA 3MEVA 3TCJA 4XU0A 3I55Q 3JB9D 3CCRQ 2RN8A 3V8JA 4F7LB 5AYFA 3BDUA 1AWWA 2ZPBB 4QW2A 3TNHB 3DL1A 4M77E 2J6OA 3NHNA 4FYVB 1PD0A 1YJWT 2UZDB 2KGTA 3CMET 1BI1A 1VQ4T 2JNGA 2IVWA 2BPMB 5CCAA 3FIFA 4XAXB 6AT1B 1JOWA 4PFPA 3VKHA 3NGPA 1M3AA 1MV0B 1AOJA 1JEGA 4F04B 1GH6B 3OS0A 1ZUYA 4M7AA 3I35A 1QVGP 3HTRA 1X6GA 1VQKT 1G3WA 2X51A 5FU7B 2H3EB 5HBJB 2UZEB 3T9NA 3OMGA 5KYNA 1X6OA 3QHRB 2VASA 4HNVA 3GIBA 1WLPB 4R56A 3CC7A 4C92E 2MK5A 2W99A 3PIPA 4Y72B 3EHQA 2CP5A 2ECZA 2ZCFB 3CCLQ 3S3NA 2K79A 1YFNA 1XNIA 4LDXA 3ZEHA 3EG1A 1Q81R 2CH4A 1TTHB 5GAN2 4JX5A 2X4YA 5A0DA 2WSCE 3I56A 3UPUA 2QF7A 1GRIA 3O5ZA 4XK8E 3PVQA 5LJ3d 4PJOC 1QP2A 2QAZA 4WTOB 1TU0B 3JB9H 4CFUB 4AMCA 1K73R 2K3BA 2JM8A 4XTUA 1I0CA 3GOXA 3AHUA 2RJCA 4GLKA 4A4EA 1NPRA 2MF2A 3HKSA 3LWIA 2HEQA 2VVKA 2DL4A 3RGFB 3ZBDA 4FYXB 3CCMT 3H0IA 2XDBA 1B3QA 1JBMA 1M1KR 1WQWA 3HFOA 3REAB 2J06A 4UN0A 4A54A 1OX9A 1WXBA 4KGZB 4F6WB 1B7TA 3CXCA 3CXCS 1WX6A 2SEMA 5KYYA 3JRZA 3ULRB 5M9OA 3DDPB 3KHIA 2CJMB 3BHUB 3JSCA 2L0AA 3RMSA 1WXUA 4NSTB 2YRVA 3QHSA 2EIFA 3CPFA 4EMKB 3A8GB 1H4LD 2EJGA 2L3SA 4F7UF 4ESRA 1VQLT 2QQ9A 1C1AA 5CIUA 2LDMA 2JN0A 3P8HA 2NUPA 2XICA 2M1HA 5KCHA 3CCUQ 2K57A 3CMAT 2PVOB 2YSQA 2DEUA 3OSVA 1OV3A 1OI9B 1B34A 2QQAA 4XTXA 3MP1A 2OX7A 1AZGB 2KXCA 4GY5A 5GAOq 3PTAA 1OGUB 2C5VB 1N9SA 4AG1C 3CCQT 3GNFB 4JZ3A 3OB9A 2CCIB 3JCMf 2DD5B 4ROEA 2ZZDA 4JRPA 1ZSZC 3JCMh 4J9CA 2MIOA 2KSSA 5CKBA 3IQLA 1WFWA 3S6WA 1K9MC 1QVGA 4EOOB 2JTMA 3UT1A 1QVGS 2P4TA 2M9UA 1XJWB 2FPFA 4KULA 1MNDA 1VOMA 2QEXA 1U3OA 1VQ8T 1NYFA 4CC3A 3OYGA 1VUBA 2ZPIB 3JB9J 3L2VA 2QDYB 4IUQA 2E1HA 1PC0A 4BCMD 1KK7A 4HVWA 4UC4A 4C92D 1TOVA 2QA4A 2LX9A 4BE0A 3RKWA 1YI2T 4BY7X 3M0PA 3MKDA 1Q7YU 4E7KA 2DZCA 4M77A 3REBB 5GAN3 4JS4A 2EJFA 3BG9A 4NL3A 2RHUA 1RAAB 5GAN8 2FVUA 3EG9A 3PVLA 1ZA1B 1S72A 2RJEA 3GF5A 2KYBA 2D0QB 2O01E 3CBOA 2F2VA 4J9GA 4IUVA 3EGDB 1RI0A 2MYSA 3MJXA 1M27C 2KNBB 3MY5B 3CC2A 1KC8C 3VYHB 4M75B 4BY6B 1OL1B 3EJ1B 4C92A 4EOMB 3UATA 2EKHA 3OW2P 3RESA 4C8QG 4EOIB 4BCOB 2R5AA 1UEBA 3RMQA 3GPLA 4Y92A 3CCEA 4C8QC 2V8JA 1YJNA 3E9FA 5LQFB 4BDZA 1WI7A 4HCZA 2KMGA 1X2KA 1VQMQ 3BLRB 5LJ3e 1TFBA 3TNWB 3AT1B 2PK2A 2UZLB 4F7UG 2YXYA 4PLLA 2DILA 2E6NA 4ZGEB 1TG0A 3M59A 2PVDB 1H3HA 1VQOQ 1NJIC 2JOYA 2VWFA 4CC2A 3VS5A 2FPEA 1AISB 4J9HA 3H9NA 4X34A 3OS1A 4J5YA 2WIHB 3RUXA 4BACA 5KYXA 1UDLA 4R55A 2A36A 4J9BA 4LXCA 4EOSB 3EGXB 4B9WA 3M0RA 5DLOA 3M0UA 4AKIA 8ATCB 3FB9A 3GNGA 4C5IA 2QGFB 4OVAA 3PGGA 3DLLA 2JM9A 3OYYA 2GBQA 1UJ0A 4GBQA 3E1SA 1VQPQ 2KXDA 2D6FA 2XU8A 2DVJA 3M56A 4PFOA 2DYBA 2K6DA 2PMIB 3FC3A 3BLQB 2HCKA 4KGXB 3GLXA 3CCLA 1QKXA 1YITT 5GAOm 3M4YA 2VYTA 2LC4A 3JCMW 1ABOA 2NYSA 2CUDA 2RQUA 2X1NB 5GMKj 4R0KA 1HJDA 1Q95G 2RH2A 1UHCA 1N5ZA 3N5BB 1AD6A 2HBWA 1WIEA 3R6NA 1AZEA 4ELLA 3GBQA 4ZNXA 3QYHB 3H4CA 3TU4K 2NLUA 3TREA 3L2UA 4KT0E 4DOVA 1H1SB 4E7SA 4JS5A 1VQ6T 1FXXA 5ICPB 1NM7A 1Y96B 1KQSP 4HL4A 1D0YA 1PG5B 1RL2A 2LJ3A 4FT2A 1SHFA 1I81A 3X26B 2J6KA 2K2VA 2AIRB 3OW2A 3OW2S 4JLGA 3MO8A 4FM4B 1WHMA 2VGMA 3ZL7C 4OB1B 1K9MU 1R8OB 1HK9A 1TS9A 3L2QA 4M78C 1URCB 3B57A 4YTLA 1HSQA 5GMKi 4EIKA 2ATCB 2EPDA 4E7ZA 1VQNQ 1B07A 2LX7A 3QKJA 2LT4A 1IHWA 3M03A 4JJNK 3VS1A 1FX7A 3OYJA 5DY9A 4M75E 4BI4A 3CCJT 3G6EQ 1UNHD 1E6HA 1UTIA 1M1FA 3PNWC 4AG2C 5GANg 5HVYB 2E4HA 3OYAA 1R0BG 1H24B 3QJ6A 2X4WA 4OMNA 4LDUA 1VYWB 2DTIA 1TUGB 3HHTB 5LJ3h 2DK3A 1XO2A 4IURA 2R5MA 4FSSA 3MEAA 3MP6A 5LJ5g 2QG9B 4E6RA 2BUDA 2HL5C 1D1CA 1H1QB 3G1JA 4HT9A 2DMOA 4KRCB 4PNOA 4YOSA 4AFUC 2V8IA 1FINB 3G33B 4Z6YA 2AKLA 2ED1A 3OSSC 4XTWA 1KC8U 1VQ5Q 1N8RR 1Y71A 2JMAA 2QQBA 4XTVA 3NTKA 2RHZA 1ARKA 2LP5A 2I2LA 1SG5A 3FRNA 4QVCA 5GMKl 2I40B 2J7IA 2VC8A 5IHIA 2CP7A 2MPXC 1BYMA 1VQ7T 2CT3A 4OGCA 1O9KB 1WHGA 4E2FB 1ACMB 4FW1A 3VJPA 3E19A 4QVZA 3SWNC 1GY3B 4BCMB 5GAN6 1ZBXA 4ZTJA 2W10A 1OPKA 2A08A 3CCSQ 3X24B 2V26A 5IH2A 4MIMA 3SEMA 4J7IA 4C0GA 4DEXA 4A4GA 3Q1JA 1NJIU 2RK1A 1KQSA 3RIRA 3LYIA 1K4US 1AWOA 1KQSS 2ZPFB 5LJ5j 2XD0A 4EMKA 3D7SB 1AT1B 2KEAA 1YJWQ 3CMEQ 3QYBA 1VQ4Q 3MI9B 2H3JA 1W4SA 2MAMA 5IXFA 2GTOA 5HY6A 1U8RA 1E7OA 4IIOA 2C0TA 2DEQA 1M3CA 2DM1A 2VXEA 4AI6A 3PIOA 1QLYA 5HCKA 2MWOA 2EQMA 3OS5A 1GFDA 4O6JA 1Y57A 2AHJB 5KYUA 1VQKQ 2DIGA 4BCHB 2DD5A 4CC7A 1VQOA 4MZMA 5GANf 2LJ0A 2HL3A 1KQ2A 4Z88A 2DLPA 3UA7A 1M90C 2DBKA 1P92A 4C0DC 1UB4A 4FSXA 1RAHB 2JW4A 1UE9A 2FPDA 2RQRA 4PJOF 3CC7T 4RMOA 2V1QA 2Y90A 1QLBA 2EUFA 2AK5A 2YUPA 4M7AC 3EGUA 2F2WA 1OPLA 5FU6B 3C94A 2LQ8A 2WSEE 1H92A 4BCQD 3NMZC 3QWXX 3I56T 2PK9B 3P8DA 1VIFA 1M8MA 4RTYA 3WVEB 5D7UA 2I53A 5HBEB 4L6V5 3H0HA 3ASKA 2YUOA 2W9FA 3CCMQ 3CCVA 3VS3A 2QK0A 4KH1B 2UUEB 2EW3A 3NTIA 4JRKA 2D9TA 3EGDA 4CXAB 3U23A 1ZUUA 1M9SA 2X3XD 4QQDA 2DXBA 4PJMA 3OYEA 2JVVA 3SDZA 2FHDA 1RAFB 4PK4A 5EFQB 3VKIA 4M75A 2HSEB 1PRMC 1QMZB 2GTJA 2LVMA 2E6ZA 4RTVA 4C8QB 3H6ZA 1IRXA 2C5XB 4ATOA 2OTJT 5CAIA 1Z9ZA 5CQYA 2QTVA 4RODA 3QXEB 1VQLQ 3C12A 4EOPB 4XU2A 3V8LA 2HZYA 4PKCC 3CMAQ 3QBYA 4F70B 4F7UB 3TVTA 1I07A 1KC8R 1VQ9Q 2GQIA 4RCCA 3PT9A 1H1RB 4KRTA 4XQ3A 1KG1A 2FZKB 3QZ5B 5GAMg 1UECA 2K3XA 2A37A 2K5FA 4OMFB 3CCQQ 1LCKA 1H26B 1GBQA 1RACB 4MMLA 4LN2A 1IHVA 2EYXA 5IF1B 2EAYA 2DXUA 4A4KA 2LNHB 3OA6A 1JQQA 1VQNA 3OMCA 4BB7A 3JCMV 1JXOA 2QGSA 2JJ9A 5GAOp 1YP5A 3EGXA 1Q82C 3I5SA 1K8AC 1QMCA 4M4ZA 1LOJA 1AEYA 4OB3B 2E3HA 1UJYA 4IUPA 4IUUA 3KBGA 4C0FA 2DTHA 2QEXT 2VB6A 2PU9B 3HRUA 4PJOG 5KE3A 4BI8B 2RB6A 3CPWA 2RQTA 4ELJA 4II5B 3BHTB 1LJOA 1C6VX 2FZGB 4FYWB 1YI2Q 2DD4B 3DB3A 2UZBB 2COZA 1I1JA 2RHXA 5FRNA 1QW1A 2JTEA 4RG2A 3A8HB 2QA4T 1QVFA 2QDLA 1PD1A 3LW5E 4ANJA 1WYXA 4OR5B 1NYGA 4ZGDB 2EQJA 2Z0WA 4Y28E 4A4FA 3BLHB 1SPKA 5GAMj 4QKUA 3POMA 2OTLQ 2KR6A 1S72T 4BY1X 2LRQA 2B86A 2BS2A 1VQ5A 1NLOC 4JDSA 2CZ1B 2L3PA 1MHNA 1ZP2A 2YRDA 4M77C 1TD6A 3CD6Q 1A0NB 4OGEA 2YRCA 3EH1A 4C8QF 5HK0A 2K5LA 3CC2T 1JRIA 1Y96A 2DBMA 3QG1A 1VYVA 2QI2A 4EPCA 2QQSA 2BE9B 4JJCA 2IW9B 2ZAEA 2B9RA 2DRMA 3OYNA 3CCSA 3L2WA 2ROLA 1RAEB 2F5KA 1BBZA 4FCYA 3UDCA 4XU3A 2J05A 1TXQA 3BHVB 4M78B 3CCET 1AD5A 2X3WD 5KCOA 1YJNT 3S3MA 1FMWA 4X1VA 5J26A 5KYWA 1OEBA 2DYIA 4PJOD 1M90U 1ABQA 1QWEA 1VINA 3CMEA 4BE2A 4ELYC 1UHFA 1WNLA 4RTXA 1K76A 2CP2A 1W6XA 2KBTA 1KD1R 4D8KA 4OGRB 3QYEA 3LWHA 3DJBA 1QWFA 4II1A 2ROTA 4OF1A 1FWZA 4QQGA 4AFZC 2YHTA 2JXBA 1OZ2A 1CSKA 1FMVA 1E9HB 5HK3A 3VS6A 2PZ1A 5I22A 2LCSA 5GANd 2DAQA 1VQKA 1GCPA 1Q86C 1U06A 1TH7A 3QYGB 2RK2A 4C8QE 1M3BA 1PM3A 1CKBA 2X9HA 2QXFA 5LJ5d 1YCSB 1FYNA 4LDWA 3SB2A 4DBQA 2HD0A 3G71A 4DA4A 2DETA 2CZ7B 2V22B 4HA8A 2H8HA 1D09B 4F7UE 3VS0A 4MZTA 3CCLT 1YWOA 2MCNA 1H1PB 3L2ZA 2QGGA 2WJ9A 1NEGA 3VS4A 1JKWA 1E7PA 1YHQA 1QKWA 4J9DA 4V2SA 5FWBA 4ZN3A 2DF6A 1H641 5GAOr 4F16A 3BY7A 2IW6B 3VYGA 2PQWA 1Z9QA 4ME7A 2AT1B 4PJLA 1VQ6Q 2RHYA 2GFUA 4BCQB 1V76A 1MNEA 4KUIA 2B8AA 4EOQB 3DOGB 4G6LB 4N4IA 4M78F 4C0ZA 5D6WA 3M57A 2A7YA 2KYMA 2CS7A 1XOVA 3A5ZB 2QQRA 4BUGA 1GUXB 3FDRA 2G77A 2LT1A 3FEOA 3TW7A 3I55A 3CCRA 5DLQE 3FLGA 2KAFA 1SHGA 2CREA 1K0XA 4LNPA 2CSQA 3CBPA 5CEIB 2BZ8A 1Q82U 2M16A 1K8AU 1AHJB 3L42A 3A8OB 2DERA 3UWNA 3R6OA 1OKWB 1VQ9A 4RG8A 4PFZA 1MUZA 1UGRB 2YUQA 3RERA 4F7SB 1ZUKA 2K9GA 3CCJQ 2PUKB 3INZA 1Q81C 3M54A 4EORB 2RO0A 4OB0B 3FJPA 3H8ZA 2KRMA 4M7AB 1M4ZA 4YC3B 5L8RE 2M51A 3KFVA 4BXXX 1G3NC 2D8JA 2RNAA 2JGZB 4B9XA 4JZ4A 2K5IA 3CEYA 4E7HA 1QP3A 1K73C 2DVEA 5EC7A 4EC8B 5FU7C 2XDDA 3VUBA 4M78E 1IO6A 4CI0C 4OMPA 1HD3A 1D0ZA 4J8OA 5IDPB 2K3YA 4JJBA 4C8QD 1SSHA 1PHTA 3TEEA 3M58A 1BI2A 1ZA2B 3QIIA 3X25B 2CP0A 1YI2A 1JB0E 1D3BA 4XU1A 1EFNA 4IUTA 3EG2A 3EFSA 4K11A 3EAEA 4E47A 2O31A 1X43A 1VQ7Q 1W98B 1YIJT 1J3TA 3V7SA 4BCFB 2OTLA 2HBPA 3JCMQ 2IPOB 4BCNB 5GANe 2CKKA 3RKYA 2O9SA 2R58A 3CD6A 4CRIA 5CVIA 3UA6A 3GP8A 3WVDB 5GJWB 4C8QA 5LJ5e 2EYYA 4F7JB 4KBMB 1VA7A 2BS3A 5KYYB 4M78G 4J6XA 1CKAA 1YNZA 1Q7YR 3MHXA 4TTHA 1N27A 4NOYA 4I3ZB 3RNJA 4L59A 3MIAB 3WXMB 5IDNB 2NWMA 4F7UA 2XG8D 4HVUA 3HPWA 3CC4Q 5GAMd 4D6WA 1Q86U 2CGHA 3CCUA 3PMIA 2CH4W 4EMKC 1TSFA 3KXTA 9ATCB 2F2XA 1I5LA 4DEYA 4FIBA 2DNUA 4M7AF 2HMAA 4OB2B 2V8KA 1I4K1 1B34B 3BDLA 1SKUB 2KT1A 2FYKA 3PE0A 2G9XB 1VQOT 1W70A 3HBLA 2WIPB 4F7NB 3KUFA 2VKNA 4IKFA 1NPPA 1KIKA 4QT7A 2CDTA 4DBFA 4J83A 4DBHA 4BCGB 4PJOB 7AT1B 1X69A 2QASA 3OYMA 2KQWA 1Y07A 1IXDA 4LUEA 2CZ0B 2DD4A 1Y7XA 3QWYA 4MDWA 5KE2A 3M0TA 5A0LA 1V1CA 2QTXA 3L1AA 1K8AR 1MMAA 2C6TB 2DIQA 4M78D 1YJ9Q 1T3SA 4M7DC 2C5NB 5J3BA 3ZFJA 3G4SQ 4Y91A 1JSUB 3NPFA 2HQHA 2E41A 3CCVT 3TSZA 1ZHIA 2ESWA 2KK4A 3C0CA 4JRQA 4M7AE 5GAN4 1ZLMA 1NEBA 3TN8B 3P8BB 1VYTA 5LMKB 2DJQA 3QO3A 1M2VB 5J39A 3LGLA 3VKGA 2G6FX 2O9VA 2OTJQ 2J6FA 2FO0A 1VQ6A 2PVGB 4MFEA 4MZPA 2W2HA 2BZXA 1OU9A 2E5KA 2ZPEB 4J7FA 4M78A 5I2SA 5CR2A 4OMOA 2DO3A 4M75C 1JJ2P 4DBRA 2L8DA 2P84A 4NL2A 3TNIB 1Q81U 1VQMA 1ZSZB 1ZX6A 5CKFA 1ENWA 2XMFA 1O75A 3E2UA 5GJVB 1T0HA 2LZ6B 1G3YA 5GANh 4L5GA 1K73U 1JSTB 1F5QB 1S1NA 2P4RA 4ZTFA 4RTUA 3A8LB 3PO3S 4RUGA 4M7AG 4MMKA 2W96A 1H8KA 1KHIA 5LJ5f 3EIDB 1ZSGA 5LJ5h 3CPWP 2WSFE 2HAXA 3JB9G 2COWA 2O88A 3VV0A 3EFOB 1C0MA 3HSBA 3EOCB 1AWXA 1QVFP 2CP6A 1VQPA 2L5QA 4Z8AA 1K9MR 1IGUA 4JLIA 1G3SA 1G83A 2JUFA 2KRNA 1TWBA 4M77F 4N0AA 1WJRA 1Q86R 3V8KA 2DL3A 5GAMe 2M02A 3VS2A 3J80E 1SSFA 1TUCA 1S72Q 4EOJB 4BCJB 1OIUB 1WZOA 2WHBB 3OYHA 4YOZA 1N9RA 3RBBB 3L2RA 5GAOl 1ZBJA 4PL6A 1YCYA 4JJDA 4Q5WA 2VV5A 3DKMA 4CFNB 2X4XA 1VQ7A 2JTFA 1MMGA 3CC2Q 2EFIA 1OX8A 2K2MA 2DL8A 3RKXA 3M55A 3M5AA 3QHWB 2RMOA 2BKDN 1AVZC 4HCBA 3QUIA 4PJOE 3M0SA 5C0MA 4OMQA 1G2BA 1PNJA 2KY9A 3NFCA 4M7AD 1OZ3A 2A28A 2BZYA 1BU1A 3I5RA 2EWNA 2JZ2A 4X9DA 1YJNQ 4RCBA 4KUDK 3QWLA 1GUXA 1WHLA 4JUVA 3CCST 2O4XB 1G3TA 1M30A 4TVRA 1JJ2A 4DOWA 2VUBA 1JJ2S 3TW6A 2EYWA 2E3IA 1JXMA 1UNLD 1YN8A 2W9ZA 3JCMc 4EOLB 3HL8A 2WMBB 2NUZA 3HO8A 2EQIA 2HQXA 2RJDA 5IAYA 2FRWA 1HYOA 3CC4A 4OMLA 2RI3A 2PHGA 1VOLA 3S3OA 1GBRA 2WFYB 2F2CA 5IHYA 2RI5A 1VQ8Q 2F5TX 1JU5C 1UFFA 1PCXA 1SRLA 2P0PA 1NJIR 3BE3A 3OYKA 3X28B 4YOOA 1LVKA 1RAGB 3G6EA 2MI6A 3A8MB 4XTZA 2DMEA 1OYXA 3CPWS 3VUZA 3JCMg 1W2BP 4BCND 3BG3A 1WHJA 3DTOA 4BD3A 1RADB 1N8RC 2MOXA 1PKSA 3G71T 1YBYA 2E10A 2DL5A 2XI9A 4CRLB 1QVFS 3LH0A 1GXIE 2YUNA 1N4MA 2XHCA 2KT8A 1WGSA 3OYLA 2DTOA 1RLQC 1K1ZA 4M77G 2IG0A 4E7JA 1JO8A 3META 2HKQB 1GCQA 2RM4A 1WA7A 1WHHA 1YHQT 1BB9A 2KE9A 3BG5A 3CQTA 3F70A 3EG0A 1YJ9A 1OIYB 2L3RA 3G4SA 2R57A 2HSPA 3J81E 3TQ7P 4A4HA 2C0OA 1OOTA 4OMMA 2BE7D 2RPNA 4KGVB 1DJ7B 1U1SA 1I8FA 4NC6A 4C92G 4JPBW 4ELZC 2ED0A 1LPLA 2PTKA 1PSEA 2EGCA 3JCMJ 3LGFA 2OTJA 1TUDA 5GAMf 4C92C 4EC9B 2CYZB 5GAMh 1UGVA 4FT4A 4HXJA 1FKMA 2DFUA 1YJWA 2DPPB 3I55T 2M0YA 4LOCA 1D0XA 5FWCA 3CCRT 3QZ9B 1BI0A 2HKNA 1VQ4A 3QJYA 1UG1A 4IMYB 4VUBA 4WCIA 2DRKA 1Y0MA 3O8VA 4AKHA 2YLCA 1MGQA 3C95A 1BIAA 1WXTA 1O9SA 1VQ9T 2KMTA 1OI1A 2OAWA 1OQKA 1QQJA 4LE9A 2DXCB 4M77D 2L3QA 2RJFA 5KYUB 5A0GA 3OBWA 2I0NA 5A2QE 1OL2B 2F1LA 4EDUA 4C5HA 2BIVA 1KFZA 2EGAA 2RHIA 3OBYA 4F6UB 1QCOA 3RR6A 4PJOA 1YITQ 2OI3A 5KH6A 3RDVA 1W2BA 2BKZB 3HRTA 1W2BS 5GMKe 5DQVA 2NUTB 1PKTA 1KHCA 4PLIA 3JAME 4O5VA 4ZGJB 1WHKA 4M7DB 2PJQA 5GMKm 4Z89A 4CFWB 4F14A 1X01A 4XTYA 2LCLA 5FU6C 2JT4A 3LH5A 5DM7R 3SWNB 2C5OB 2V1RA 3NDQA 4JX4A 4BI3A 1YIJQ 1H27B 1EIFA 1PKDB 2L2PA 1O9KA 5I5ZB 4LD6A 2BTTA 2FRYA 4WF2A 3C4SA 3CCMA 1D1BA 1KSWA 3JCMb 3M4GA 1P5EB 1UGSB 5ECAA 2DKGA 2HNIA 2OTLT 1D1AA 2KRSA 2HQEA 1K0SA 2WPAB 1E6GA 4AFSC 4E7LA 1BU2A 1M2VA 2CUBA 1UGPB 2E70A 2DXBB 3CD6T 2DL7A 3M53A 3VRYA 5FLXE 5I2MA 1BCMA 3F5XB 5IN1A 2P0QA 4F17A 5IT9E 4PJJA 3H0FA 3OQ5A 2IW8B 1NG2A 1VQLA 1M2OA 4KH0B 3DDQB 1PRLC 4BE1A 3CBMA 2OAUA 4QVDA 4F6SB 3CMAA 1ZSZA 2D8HA 4JX6A 1IGQA 2GNCA 1T0JA 4PJNA 2E5QA 3CCUT 3HFNA 4C0DB 3O0GD 3SD4A 2DE0X 1NE8A 4FW2A 3CCQA 4JRIA 2EJ9A 1N8RU 2K4YA 5HQ0B 3E9GA 3HB9A 2ENMA 3H41A 3MP8A 4AT1B 1MMNA 1MMDA 2GQVA 2R7GA 1PSFA 4QQ6A 1VQ8A 4AFQC 2AZSA 3EFOA 5L2WB 3PFSA 1FMKA 2DZ9A 3M0QA 3URGA 1X27A 1NLPC 4M7DF 1X2QA 1N6AA 4DQ2A 3EFRA 4CFXB 4HNUA 5CKEA 1M90R 3QDRB 1RLPC 3V7CA 3PMTA 4RKUE 2QQ8A 1M1KC 4J9IA 4BBSM 1VIEA 1U5SA 4RTZA 2PUOB 3HP9A 3A98A 2YLBA 2LTOA 5LJ3g 5C6SA 2ABLA 2VGNA 3LX7A 5IHKA 3CCVQ 3LQ5B 3HRSA 2AKKA 3EHRA 1M1GA 4FU6A 2EBPA 2YWWA 4QSHA 4EONB 2FL7A 2OJ2A 2FZCB 3ER0A 4A63B 3OYBA 3DB4A 1I5OB 4IIMA 4RTWA 3TSWA 4KRDB 3VRZA 2PNIA 3OY9A 4M75F 5IXBA 2KVQG 3MEUA 4X9CA 1YWPA 1QCNA 5GMKh 1LNXA 2AZVA 2GGRA 2C0IA 4J9FA 1RABB 2EQKA 4HNTA 2DA9A 1H3ZA 2O4XA 4M7DE 4J9EA 2G3RA 3QDFA 1KD1C 2WXVB 2FB7A 1RAIB 2K7AA 3SFMA 5CYIB 2CZ6B 2NUPB 4HLQA 4P5NA 3OS2A 1T3LA 1VQMT 2EVRA 3QPHA 5LJ3j 2CCHB 2QFZA 5GAOn 5KYWB 2LQKA 2CSIA 3K7AM 1PWTA 3GTMS 2XK0A 3ME9A 2KR3A 2RQVA 2ZZDB 3CC7Q 2YDLA 4LD9K 4GLMA 1EX4A 4D8DA 2QDJA 3JB9F 4CFUD 1EZZB 8AT1B 5GAN7 5LL6S 4C5EA 2A0FB 1UNGD 4HCKA 2VXFA 1WJSA 3JCMd
chains in the Genus database with same CATH topology
3J80E 1SSFA 2PVDB 1JRIA 1Y96A 3QG1A 1NJIC 2E64A 2JOYA 2A3LA 2QI2A 4EPCA 1ZQ1A 3OYHA 1N9RA 2QQSA 3L2RA 5GAOl 5CQXA 4X34A 3OS1A 4J5YA 4PL6A 1YCYA 3OYNA 3CCSA 3L2WA 3RUXA 4Q5WA 1VQPT 2F5KA 2VV5A 3UDCA 5LJ3f 4EMHA 2EKOA 3DKMA 4HKEA 4M78B 4XU3A 4BACA 1YITA 4M7DG 3CCET 3OYDA 5EJCA 2RD1A 2X4XA 2JTFA 4FL6A 5KCOA 1YJNT 2EFIA 1VQ7A 4HCCA 3S3MA 3RKXA 5J26A 4R55A 3M55A 3J7AF 4AKGA 3BFMA 2WACA 4PJOD 1M90U 3M5AA 4B9WA 2BKDN 4M77B 5DLOA 4E7IA 3QUIA 4HCBA 3QSUA 4AKIA 3CMEA 4PJOE 1BIBA 5C0MA 3OYCA 2GFAA 3FB9A 3GNGA 4C5IA 4ELYC 4BE2A 1WNLA 2KY9A 3NFCA 3PGGA 3OYYA 3X20B 4OVAA 3DLLA 3E1SA 4M7AD 1OZ3A 2D6FA 2XU8A 3V7RA 2C06A 2EWNA 3M56A 3QYEA 3LWHA 2JZ2A 4X9DA 2XIDA 4II1A 1V29B 4N0AC 4OF1A 1FWZA 4QQGA 1M5Q1 3M9QA 4RCBA 2YHTA 3QWLA 1OZ2A 4JUVA 4Z02A 1X75C 5HKCA 2KDSA 3VU3C 3CCST 2O4XB 3GLXA 1YIJA 3CCLA 4J6WA 5HK3A 3JCMP 1YITT 1G3TA 5GAOm 3M4YA 2VYTA 2LC4A 3JCMW 4J6YA 4TVRA 5GANd 2DAQA 2ZGWA 1JJ2A 4DOWA 1VQKA 4BDYA 1Q86C 2VUBA 1JJ2S 3TW6A 1TH7A 3QYGB 2GF7A 2X4JA 5I21A 2RK2A 5GMKj 5FRMA 3VYGB 4C8QE 2ZPGB 3JCMc 4M75G 4C5GA 3HL8A 2RH2A 4C92B 3HO8A 2MMPA 2QXFA 5D6XA 5LJ5d 2HQXA 2RJDA 5GANj 4LDWA 1M8VA 2RI2A 3SB2A 5IAYA 3N5BB 2HD0A 3CC4A 3G71A 4BY6C 3JCMX 4DA4A 2RI3A 2CZ7B 4HT8A 4HA8A 3S3OA 3LLRA 3OYIA 4MFDA 4F7UE 2RI5A 4MZTA 4M6VA 3CCLT 2F5TX 3QYHB 2RA2A 2E65A 3NTHA 3H4CA 1WJQA 2P0PA 2F69A 4N4HA 3TU4K 1G5VA 2NLUA 3OYKA 5GAN5 3X28B 3L2ZA 4LDYA 3TREA 4KT0E 3L2UA 1IREB 4DOVA 2WJ9A 3OYFA 3G6EA 2MI6A 4JS5A 1VQ6T 3A8MB 1E7PA 1FXXA 4XTZA 1OYXA 1Y96B 3CPWS 3VUZA 1YHQA 4HL4A 3JCMg 2BS4A 4M7DD 3BG3A 3JB9I 4V2SA 1BI3A 1RL2A 4ZN3A 4BD3A 1H641 4FT2A 5GAOr 1N8RC 1I81A 4NS5A 3X26B 2K2VA 2LNVA 3OW2A 3CC4T 3G71T 1YBYA 1VQNT 3OW2S 2E10A 3BY7A 4JLGA 2XI9A 1QVFS 2Y4XA 4FM4B 3LH0A 3MO8A 2DXCA 1GXIE 2M0OA 5EG2A 2VGMA 3VYGA 2Y4YA 4OB1B 2XHCA 1M1KU 3CCJA 1WGSA 2PQWA 4ME7A 3OYLA 2DTOA 2RHYA 1QVPA 1R8OB 2L89A 1HK9A 2GFUA 4BBRM 4ZN1A 1K9MU 3L2QA 4M78C 1WQ7A 3MCAB 1XQHA 4M77G 4YTLA 2IG0A 4E7JA 4KUIA 3META 3CCRT 2B8AA 3G6ET 2RM4A 4N4IA 4M78F 4C0ZA 5GMKi 1XTDA 1YHQT 3MEWA 5D6WA 3M57A 2A7YA 2GCXA 3QKJA 3BG5A 2CS7A 3F70A 1XOVA 3A5ZB 2LT4A 1KQ1A 2MWPA 2QQRA 1YJ9A 5CKDA 4BUGA 4N4GA 3FDRA 2G77A 2L3RA 2LT1A 3TW7A 1WPYA 3FEOA 4OP0A 3I55A 3G4SA 3DLMA 3CCRA 4JJNK 2XDPA 2R57A 5DLQE 4M75D 2DXTA 3FLGA 1FX7A 2KAFA 3OYJA 4M7DA 2DJZA 1BKBA 5DY9A 4M75E 4BI4A 5CK9A 3J81E 3CCJT 4A4HA 3CBPA 1M1FA 3PNWC 5GANg 1Q82U 2M16A 1K8AU 1AHJB 3SWNA 3OYAA 1DJ7B 3L42A 1IZ6A 1NZ9A 5CKHA 3QJ6A 1U1SA 2X4WA 3A8OB 1D3BB 1I8FA 4NC6A 4C92G 4ELZC 1VQ5T 4LDUA 5D6YA 2DTIA 3UWNA 1PSEA 3R6OA 1VQ9A 3HHTB 5LJ3h 2DK3A 4RG8A 3JCMJ 3LGFA 4IURA 2R5MA 4EMGA 2X35A 3MEAA 3MP6A 5GAMf 1UGRB 2EQUA 4C92C 5LJ5g 2CYZB 4MDXA 5GAMh 3RERA 4FT4A 2BUDA 1FKMA 1YJ9T 2PUKB 4A53A 4HT9A 3INZA 5CO7A 1Q81C 1UGQB 2DPPB 3I55T 1YJWA 1KD1U 3M54A 4LOCA 4PNOA 4C92F 2LCCA 3QZ9B 1BI0A 4LDVA 2RO0A 3G4ST 4OB0B 2V8IA 3FJPA 3H8ZA 4M7AB 1M4ZA 3QJYA 1VQ4A 3BW1A 4Z6YA 5L8RE 3OSSC 3JCMe 5FROA 4XTWA 1U1TA 1KC8U 4VUBA 2EYQA 1Y71A 2P0KA 2E12A 3O8VA 2QQBA 2XKOC 4XTVA 4B9XA 2K5IA 2RHZA 3CEYA 4AKHA 1QP3A 2DVEA 3NTKA 2YLCA 4E7HA 1MGQA 2ZPHB 1K73C 5FU7C 2XDDA 3G7ZA 3HZJA 3VUBA 3C95A 2I2LA 1HXDA 1BIAA 3FRNA 3MEVA 4M78E 4QVCA 3TCJA 5GMKl 2VC8A 4CI0C 1VQ9T 1O9SA 4XU0A 1Q7YC 3JB9D 1BYMA 1VQ7T 3V8JA 2KMTA 4OGCA 1OI1A 4J8OA 2K3YA 5AYFA 3BDUA 2ZPBB 2DXCB 4M77D 4QW2A 4C8QD 3VJPA 3E19A 4QVZA 3SWNC 2RJFA 3M58A 3TEEA 5A0GA 1BI2A 3DL1A 4M77E 3QIIA 3X25B 1YJWT 5GAN6 3CMET 3OBWA 1ZBXA 1YI2A 5A2QE 4ZTJA 1BI1A 1D3BA 1JB0E 1VQ4T 4XU1A 4EDUA 4C5HA 2JNGA 2BIVA 4IUTA 3X24B 2IVWA 4MIMA 2RHIA 5CCAA 3FIFA 3OBYA 4XAXB 4J7IA 3EFSA 4C0GA 4PJOA 4A4GA 3VKHA 3EAEA 3Q1JA 4E47A 1NJIU 5KH6A 2RK1A 5GAN2 1KQSA 3RIRA 1W2BA 3LYIA 1KQSS 3HRTA 2ZPFB 5LJ5j 1W2BS 5GMKe 3OS0A 1YIJT 2XD0A 4EMKA 4M7AA 3V7SA 2OTLA 2HBPA 1KHCA 4PLIA 3QYBA 3JAME 4O5VA 3JCMQ 1VQKT 1G3WA 2H3JA 5FU7B 4ZGJB 1W4SA 2MAMA 5GANe 4M7DB 5GMKm 2CKKA 3T9NA 3OMGA 1X6OA 3RKYA 4HNVA 5HY6A 1U8RA 3GIBA 4R56A 1X01A 3CC7A 4XTYA 2LCLA 2R58A 2DEQA 4C92E 5FU6C 3CD6A 4CRIA 3PIPA 2VXEA 5CVIA 4AI6A 5DM7R 3SWNB 3GP8A 3PIOA 3WVDB 4C8QA 2MWOA 4JX4A 2ZCFB 4BI3A 5LJ5e 3S3NA 1EIFA 2EQMA 3OS5A 4KBMB 1XNIA 4LD6A 2BS3A 4O6JA 4M78G 4WF2A 4LDXA 3C4SA 3ZEHA 2AHJB 3CCMA 2DIGA 4J6XA 2DD5A 3MHXA 1VQOA 1N27A 4MZMA 4NOYA 4JX5A 2X4YA 5A0DA 3JCMb 3M4GA 5GANf 2WSCE 1UGSB 3I56A 1KQ2A 4L59A 3UPUA 2QF7A 4XK8E 3WXMB 2DKGA 2HNIA 2OTLT 2HQEA 1M90C 5LJ3d 4PJOC 4F7UA 1P92A 1QP2A 2XG8D 4C0DC 1UB4A 4E7LA 3JB9H 3HPWA 4FSXA 5GAMd 4D6WA 1Q86U 1UGPB 2CGHA 2E70A 4PJOF 2DXBB 4RMOA 3PMIA 3CCUA 3CC7T 2Y90A 4XTUA 3GOXA 3AHUA 1QLBA 3M53A 4EMKC 3CD6T 3KXTA 2RJCA 5FLXE 4M7AC 4GLKA 4A4EA 5I2MA 1NPRA 2MF2A 3HKSA 1I5LA 3LWIA 4FIBA 5FU6B 3C94A 5IN1A 4M7AF 4OB2B 2V8KA 2P0QA 5IT9E 1I4K1 2LQ8A 2WSEE 1B34B 3ZBDA 3BDLA 3CCMT 2XDBA 1JBMA 2FYKA 3OQ5A 1WQWA 3HFOA 1VQOT 1VQLA 4A54A 3I56T 4BE1A 3P8DA 3CBMA 3HBLA 1VIFA 2OAUA 4QVDA 3KUFA 3CXCA 3CMAA 4JX6A 3CXCS 3CC2T 4IKFA 1NPPA 2E5QA 3JRZA 2OTJA 3WVEB 4J83A 5M9OA 4L6V5 3CCUT 3KHIA 4PJOB 3HFNA 3JSCA 4C0DB 3ASKA 3SD4A 3RMSA 3OYMA 1NE8A 3CCVA 2KQWA 3CCQA 1Y07A 2YRVA 3QHSA 2EIFA 2EJ9A 4JRIA 2CZ0B 2DD4A 3NTIA 1N8RU 4JRKA 1Y7XA 3CPFA 4EMKB 3A8GB 4MDWA 5KE2A 2K4YA 2D9TA 2EJGA 3E9GA 4F7UF 3HB9A 1M9SA 4QQDA 5A0LA 1VQLT 2QQ9A 5CIUA 2DXBA 2QTXA 3L1AA 3OYEA 2JVVA 2LDMA 3SDZA 2JN0A 3P8HA 2FHDA 2XICA 2M1HA 3MP8A 5KCHA 2K57A 2DIQA 3VKIA 2GQVA 2PVOB 4M75A 3CMAT 1PSFA 4M78D 3OSVA 4QQ6A 1VQ8A 4M7DC 5J3BA 2LVMA 3PFSA 2E6ZA 1B34A 2QQAA 4XTXA 4C8QB 3MP1A 3H6ZA 3ZFJA 2DZ9A 4Y91A 3URGA 4ATOA 5CAIA 2OTJT 4GY5A 5GAOq 5CQYA 3PTAA 4M7DF 4DQ2A 1N6AA 2E41A 3CCVT 1N9SA 3EFRA 3CCQT 3QXEB 3GNFB 3JCMf 4HNUA 3C12A 3OB9A 2DD5B 2ZZDA 3QDRB 4XU2A 5CKEA 3JCMh 4JRPA 1ZHIA 2KK4A 3PMTA 3V7CA 4RKUE 2QQ8A 4JRQA 1M1KC 2KSSA 3V8LA 5CKBA 5GAN4 4M7AE 4BBSM 1VIEA 4PKCC 3S6WA 1K9MC 1QVGA 3QBYA 2PUOB 3HP9A 2JTMA 3P8BB 3UT1A 4F7UB 1QVGS 2YLBA 2P4TA 5J39A 3QO3A 2M9UA 3LGLA 3VKGA 4RCCA 2LTOA 3PT9A 4KULA 5LJ3g 5C6SA 4XQ3A 2QEXA 1KG1A 2VGNA 3LX7A 3QZ5B 5GAMg 3HRSA 2K3XA 1VQ8T 2K5FA 4OMFB 2PVGB 3OYGA 1VQ6A 1M1GA 4FU6A 1VUBA 2ZPIB 4QSHA 3JB9J 4MFEA 2FL7A 4MZPA 2QDYB 4IUQA 4MMLA 2E1HA 3L2VA 3ER0A 2ZPEB 4J7FA 3OYBA 3DB4A 2EAYA 4M78A 2DXUA 4UC4A 4A4KA 4C92D 5I2SA 5CR2A 2DO3A 4M75C 3OA6A 2LX9A 2QA4A 4BE0A 4KUDK 3RKWA 1VQNA 2L8DA 3OMCA 1YI2T 4NL2A 4BB7A 3JCMV 1Q81U 5GAOp 3OY9A 4M75F 1VQMA 1Q7YU 1Q82C 2KVQG 2DZCA 3MEUA 4M77A 4X9CA 4E7KA 1K8AC 5GAN3 1LOJA 5CKFA 4JS4A 2EJFA 4OB3B 4IUPA 3BG9A 5GMKh 4NL3A 2RHUA 5GAN8 4IUUA 1LNXA 1O75A 2FVUA 3KBGA 4C0FA 2DTHA 2QEXT 2PU9B 3HRUA 1S72A 2RJEA 4PJOG 5KE3A 3GF5A 2D0QB 2O01E 2RB6A 4BI8B 3CPWA 4ELJA 1G3YA 5GANh 4L5GA 1K73U 1LJOA 3CBOA 3FC3A 2EQKA 4HNTA 2DD4B 3DB3A 4ZTFA 1H3ZA 2RHXA 5FRNA 2O4XA 4M7DE 1KD1C 2G3RA 3A8LB 1QW1A 4M7AG 2FB7A 4IUVA 4MMKA 4RG2A 1RI0A 1KHIA 3A8HB 3SFMA 5LJ5f 2QA4T 1QVFA 3LW5E 5LJ5h 3CC2A 1KC8C 2CZ6B 4HLQA 4P5NA 2WSFE 3OS2A 1VQMT 2HAXA 3QPHA 4ZGDB 3VYHB 2EQJA 4M75B 5LJ3j 4BY6B 2QFZA 4Y28E 4A4FA 5GAOn 4C92A 3JB9G 2LQKA 3VV0A 5GAMj 3HSBA 3RESA 4C8QG 2KR6A 1S72T 2XK0A 2R5AA 2LRQA 1VQPA 2L5QA 2BS2A 1UEBA 3RMQA 3GPLA 1VQ5A 3ME9A 2CZ1B 4JDSA 1MHNA 2ZZDB 3CCEA 4M77C 2V8JA 4C8QC 4LD9K 1YJNA 3E9FA 4OGEA 4BDZA 2QDJA 4JLIA 3JB9F 1G3SA 2KMGA 4HCZA 5GAN7 5LJ3e 5LL6S 4C5EA 2JUFA 4M77F 4N0AA 4C8QF 1WJRA 5HK0A 3V8KA 2K5LA 4F7UG 4PLLA 2VXFA 2E6NA 4ZGEB 5GAMe 1WJSA 3JCMd 3M59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PVD B;  3QXE B;  4ZGJ B;  2DD5 B;  2ZZD A;  4RKU E;  2ZPF B;  2PUO B;  3WVD B;  2ZCF B;  3VYG A;  3QZ5 B;  2AHJ B;  2DD5 A;  2PVG B;  2ZPI B;  2WSC E;  1UGS B;  2QDY B;  3X20 B;  2ZPE B;  4XK8 E;  1AHJ B;  1QP2 A;  1DJ7 B;  1V29 B;  3A8O B;  1UGP B;  2DXB B;  1PSE A;  3HHT B;  1UGR B;  2CYZ B;  4OB3 B;  2PUK B;  3QYG B;  4OB2 B;  1UGQ B;  2DPP B;  2PU9 B;  2WSE E;  3VYG B;  2ZPG B;  2D0Q B;  3QZ9 B;  2O01 E;  4OB0 B;  5L8R E;  2DD4 B;  3A8L B;  2CZ7 B;  3A8H B;  1QP3 A;  2ZPH B;  3LW5 E;  3WVE B;  2CZ6 B;  4L6V 5;  2WSF E;  3QYH B;  4ZGD B;  3VYH B;  4Y28 E;  2ZPB B;  2DXC B;  3X28 B;  4KT0 E;  2CZ0 B;  1IRE B;  2DD4 A;  3A8G B;  3A8M B;  3X25 B;  1JB0 E;  2CZ1 B;  2DXB A;  2ZZD B;  3X24 B;  3X26 B;  2PVO B;  1PSF A;  4FM4 B;  2DXC A;  1GXI E;  4ZGE B;  4OB1 B; 
#chains in the Genus database with same CATH topology
 4FYY B;  2KRO A;  2D1X A;  4CFM B;  4CC4 B;  2E64 A;  2A3L A;  2LQN A;  1ZQ1 A;  3I56 Q;  1R0C B;  5CQX A;  2W0Z A;  1VQP T;  5AT1 B;  5LJ3 f;  4EMH A;  2EKO A;  4HKE A;  1YIT A;  4M7D G;  1Q82 R;  3OYD A;  5EJC A;  2QYZ A;  2RD1 A;  4FL6 A;  4HCC A;  2RQW A;  3J7A F;  4AKG A;  3BFM A;  5HBH B;  4B6M A;  2WAC A;  1G5V A;  4M77 B;  3QSU A;  1UUE A;  1BIB A;  3OYC A;  1R77 A;  2GFA A;  3X20 B;  5IHN A;  4HVV A;  3EG9 B;  2COY A;  2FEI A;  1NBE B;  3V7R A;  2C06 A;  1SF9 A;  1WDX A;  2XID A;  5FGK B;  2KI7 A;  1V29 B;  2LQW A;  3A1P A;  4N0A C;  1H25 B;  1M5Q 1;  2LJ1 A;  3M9Q A;  5HKC A;  4Z02 A;  1X75 C;  2KDS A;  3VU3 C;  4ROC A;  1YIJ A;  4J6W A;  3VS7 A;  3JCM P;  1FVV B;  4J6Y A;  2ZGW A;  4BDY A;  4LUD A;  2X4J A;  2GF7 A;  5I21 A;  5FRM A;  3VYG B;  3EG3 A;  2ZPG B;  5DQW A;  2JS0 A;  4M75 G;  4C5G A;  2C4G B;  4C92 B;  2O2O A;  2MMP A;  5D6X A;  5GAN j;  1M8V A;  2RI2 A;  4BY6 C;  1OKV B;  3JCM X;  2DX1 A;  4HT8 A;  5L23 A;  3LLR A;  3OYI A;  2RF0 A;  2D0N A;  4MFD A;  1RUW A;  5FW9 A;  1MV3 A;  4M6V A;  1BK2 A;  3MPU B;  2RA2 A;  2E65 A;  1W1F A;  3NTH A;  1KJW A;  1WJQ A;  2F69 A;  4N4H A;  5HNB B;  5GAN 5;  1C9B A;  4LDY A;  1IRE B;  3SHW A;  3OYF A;  3EH2 A;  3THK A;  1GFC A;  2BS4 A;  4M7D D;  3JB9 I;  2CP3 A;  1RI9 A;  1BI3 A;  2IN3 A;  4NS5 A;  2LNV A;  4FX3 B;  3CC4 T;  2HDA A;  1VQN T;  2Y4X A;  2DXC A;  2M0O A;  5EG2 A;  2QEX Q;  1IB8 A;  3FJ5 A;  2Y4Y A;  1SEM A;  2WMA B;  5KYX B;  1M1K U;  3CCJ A;  4CFV B;  2IVX A;  1QVP A;  2L89 A;  4ZN1 A;  4BBR M;  1WQ7 A;  3MCA B;  1X6B A;  1XQH A;  2EGE A;  2JS2 A;  3G6E T;  4BCK B;  1XTD A;  3G71 Q;  2QA4 Q;  3MEW A;  4ORZ A;  3JV3 A;  2EYZ A;  2GCX A;  3I9Q A;  4RTT A;  2WEV B;  1KQ1 A;  2MWP A;  2YT6 A;  2NUT A;  4BCP B;  1GL5 A;  5CKD A;  4N4G A;  1VYU A;  4OP0 A;  1WPY A;  2CT4 A;  3DLM A;  2XDP A;  4M75 D;  1OU8 A;  2DXT A;  4M7D A;  5BNJ B;  2DJZ A;  4BCI B;  1BKB A;  5CK9 A;  2IIM A;  1D3U B;  1YHQ Q;  3SWN A;  2LW4 A;  1QCF A;  1IZ6 A;  1NZ9 A;  5CKH A;  2JMC A;  1D3B B;  1VQ5 T;  5D6Y A;  2SRC A;  1KXU A;  4EMG A;  2X35 A;  2EQU A;  4MDX A;  1YJ9 T;  4A53 A;  5CO7 A;  1UGQ B;  1KD1 U;  3MY1 B;  2FG0 A;  1GCQ C;  4C92 F;  3G4S T;  1K9A A;  2LCC A;  3CXC P;  4LDV A;  4E7I A;  1Q7Y C;  1SRM A;  3BW1 A;  3UF4 A;  3JCM e;  5FRO A;  1U1T A;  2EYQ A;  1F1B B;  2P0K A;  3CCE Q;  2E12 A;  5ACB A;  1BCO A;  1G8X A;  1OUL A;  2XKO C;  1AWJ A;  2ZPH B;  3G7Z A;  3HZJ A;  4EOK B;  1H28 B;  5I11 A;  1HXD A;  2LMJ A;  3MEV A;  3TCJ A;  4XU0 A;  3I55 Q;  3JB9 D;  3CCR Q;  2RN8 A;  3V8J A;  4F7L B;  5AYF A;  3BDU A;  1AWW A;  2ZPB B;  4QW2 A;  3TNH B;  3DL1 A;  4M77 E;  2J6O A;  3NHN A;  4FYV B;  1PD0 A;  1YJW T;  2UZD B;  2KGT A;  3CME T;  1BI1 A;  1VQ4 T;  2JNG A;  2IVW A;  2BPM B;  5CCA A;  3FIF A;  4XAX B;  6AT1 B;  1JOW A;  4PFP A;  3VKH A;  3NGP A;  1M3A A;  1MV0 B;  1AOJ A;  1JEG A;  4F04 B;  1GH6 B;  3OS0 A;  1ZUY A;  4M7A A;  3I35 A;  1QVG P;  3HTR A;  1X6G A;  1VQK T;  1G3W A;  2X51 A;  5FU7 B;  2H3E B;  5HBJ B;  2UZE B;  3T9N A;  3OMG A;  5KYN A;  1X6O A;  3QHR B;  2VAS A;  4HNV A;  3GIB A;  1WLP B;  4R56 A;  3CC7 A;  4C92 E;  2MK5 A;  2W99 A;  3PIP A;  4Y72 B;  3EHQ A;  2CP5 A;  2ECZ A;  2ZCF B;  3CCL Q;  3S3N A;  2K79 A;  1YFN A;  1XNI A;  4LDX A;  3ZEH A;  3EG1 A;  1Q81 R;  2CH4 A;  1TTH B;  5GAN 2;  4JX5 A;  2X4Y A;  5A0D A;  2WSC E;  3I56 A;  3UPU A;  2QF7 A;  1GRI A;  3O5Z A;  4XK8 E;  3PVQ A;  5LJ3 d;  4PJO C;  1QP2 A;  2QAZ A;  4WTO B;  1TU0 B;  3JB9 H;  4CFU B;  4AMC A;  1K73 R;  2K3B A;  2JM8 A;  4XTU A;  1I0C A;  3GOX A;  3AHU A;  2RJC A;  4GLK A;  4A4E A;  1NPR A;  2MF2 A;  3HKS A;  3LWI A;  2HEQ A;  2VVK A;  2DL4 A;  3RGF B;  3ZBD A;  4FYX B;  3CCM T;  3H0I A;  2XDB A;  1B3Q A;  1JBM A;  1M1K R;  1WQW A;  3HFO A;  3REA B;  2J06 A;  4UN0 A;  4A54 A;  1OX9 A;  1WXB A;  4KGZ B;  4F6W B;  1B7T A;  3CXC A;  3CXC S;  1WX6 A;  2SEM A;  5KYY A;  3JRZ A;  3ULR B;  5M9O A;  3DDP B;  3KHI A;  2CJM B;  3BHU B;  3JSC A;  2L0A A;  3RMS A;  1WXU A;  4NST B;  2YRV A;  3QHS A;  2EIF A;  3CPF A;  4EMK B;  3A8G B;  1H4L D;  2EJG A;  2L3S A;  4F7U F;  4ESR A;  1VQL T;  2QQ9 A;  1C1A A;  5CIU A;  2LDM A;  2JN0 A;  3P8H A;  2NUP A;  2XIC A;  2M1H A;  5KCH A;  3CCU Q;  2K57 A;  3CMA T;  2PVO B;  2YSQ A;  2DEU A;  3OSV A;  1OV3 A;  1OI9 B;  1B34 A;  2QQA A;  4XTX A;  3MP1 A;  2OX7 A;  1AZG B;  2KXC A;  4GY5 A;  5GAO q;  3PTA A;  1OGU B;  2C5V B;  1N9S A;  4AG1 C;  3CCQ T;  3GNF B;  4JZ3 A;  3OB9 A;  2CCI B;  3JCM f;  2DD5 B;  4ROE A;  2ZZD A;  4JRP A;  1ZSZ C;  3JCM h;  4J9C A;  2MIO A;  2KSS A;  5CKB A;  3IQL A;  1WFW A;  3S6W A;  1K9M C;  1QVG A;  4EOO B;  2JTM A;  3UT1 A;  1QVG S;  2P4T A;  2M9U A;  1XJW B;  2FPF A;  4KUL A;  1MND A;  1VOM A;  2QEX A;  1U3O A;  1VQ8 T;  1NYF A;  4CC3 A;  3OYG A;  1VUB A;  2ZPI B;  3JB9 J;  3L2V A;  2QDY B;  4IUQ A;  2E1H A;  1PC0 A;  4BCM D;  1KK7 A;  4HVW A;  4UC4 A;  4C92 D;  1TOV A;  2QA4 A;  2LX9 A;  4BE0 A;  3RKW A;  1YI2 T;  4BY7 X;  3M0P A;  3MKD A;  1Q7Y U;  4E7K A;  2DZC A;  4M77 A;  3REB B;  5GAN 3;  4JS4 A;  2EJF A;  3BG9 A;  4NL3 A;  2RHU A;  1RAA B;  5GAN 8;  2FVU A;  3EG9 A;  3PVL A;  1ZA1 B;  1S72 A;  2RJE A;  3GF5 A;  2KYB A;  2D0Q B;  2O01 E;  3CBO A;  2F2V A;  4J9G A;  4IUV A;  3EGD B;  1RI0 A;  2MYS A;  3MJX A;  1M27 C;  2KNB B;  3MY5 B;  3CC2 A;  1KC8 C;  3VYH B;  4M75 B;  4BY6 B;  1OL1 B;  3EJ1 B;  4C92 A;  4EOM B;  3UAT A;  2EKH A;  3OW2 P;  3RES A;  4C8Q G;  4EOI B;  4BCO B;  2R5A A;  1UEB A;  3RMQ A;  3GPL A;  4Y92 A;  3CCE A;  4C8Q C;  2V8J A;  1YJN A;  3E9F A;  5LQF B;  4BDZ A;  1WI7 A;  4HCZ A;  2KMG A;  1X2K A;  1VQM Q;  3BLR B;  5LJ3 e;  1TFB A;  3TNW B;  3AT1 B;  2PK2 A;  2UZL B;  4F7U G;  2YXY A;  4PLL A;  2DIL A;  2E6N A;  4ZGE B;  1TG0 A;  3M59 A;  2PVD B;  1H3H A;  1VQO Q;  1NJI C;  2JOY A;  2VWF A;  4CC2 A;  3VS5 A;  2FPE A;  1AIS B;  4J9H A;  3H9N A;  4X34 A;  3OS1 A;  4J5Y A;  2WIH B;  3RUX A;  4BAC A;  5KYX A;  1UDL A;  4R55 A;  2A36 A;  4J9B A;  4LXC A;  4EOS B;  3EGX B;  4B9W A;  3M0R A;  5DLO A;  3M0U A;  4AKI A;  8ATC B;  3FB9 A;  3GNG A;  4C5I A;  2QGF B;  4OVA A;  3PGG A;  3DLL A;  2JM9 A;  3OYY A;  2GBQ A;  1UJ0 A;  4GBQ A;  3E1S A;  1VQP Q;  2KXD A;  2D6F A;  2XU8 A;  2DVJ A;  3M56 A;  4PFO A;  2DYB A;  2K6D A;  2PMI B;  3FC3 A;  3BLQ B;  2HCK A;  4KGX B;  3GLX A;  3CCL A;  1QKX A;  1YIT T;  5GAO m;  3M4Y A;  2VYT A;  2LC4 A;  3JCM W;  1ABO A;  2NYS A;  2CUD A;  2RQU A;  2X1N B;  5GMK j;  4R0K A;  1HJD A;  1Q95 G;  2RH2 A;  1UHC A;  1N5Z A;  3N5B B;  1AD6 A;  2HBW A;  1WIE A;  3R6N A;  1AZE A;  4ELL A;  3GBQ A;  4ZNX A;  3QYH B;  3H4C A;  3TU4 K;  2NLU A;  3TRE A;  3L2U A;  4KT0 E;  4DOV A;  1H1S B;  4E7S A;  4JS5 A;  1VQ6 T;  1FXX A;  5ICP B;  1NM7 A;  1Y96 B;  1KQS P;  4HL4 A;  1D0Y A;  1PG5 B;  1RL2 A;  2LJ3 A;  4FT2 A;  1SHF A;  1I81 A;  3X26 B;  2J6K A;  2K2V A;  2AIR B;  3OW2 A;  3OW2 S;  4JLG A;  3MO8 A;  4FM4 B;  1WHM A;  2VGM A;  3ZL7 C;  4OB1 B;  1K9M U;  1R8O B;  1HK9 A;  1TS9 A;  3L2Q A;  4M78 C;  1URC B;  3B57 A;  4YTL A;  1HSQ A;  5GMK i;  4EIK A;  2ATC B;  2EPD A;  4E7Z A;  1VQN Q;  1B07 A;  2LX7 A;  3QKJ A;  2LT4 A;  1IHW A;  3M03 A;  4JJN K;  3VS1 A;  1FX7 A;  3OYJ A;  5DY9 A;  4M75 E;  4BI4 A;  3CCJ T;  3G6E Q;  1UNH D;  1E6H A;  1UTI A;  1M1F A;  3PNW C;  4AG2 C;  5GAN g;  5HVY B;  2E4H A;  3OYA A;  1R0B G;  1H24 B;  3QJ6 A;  2X4W A;  4OMN A;  4LDU A;  1VYW B;  2DTI A;  1TUG B;  3HHT B;  5LJ3 h;  2DK3 A;  1XO2 A;  4IUR A;  2R5M A;  4FSS A;  3MEA A;  3MP6 A;  5LJ5 g;  2QG9 B;  4E6R A;  2BUD A;  2HL5 C;  1D1C A;  1H1Q B;  3G1J A;  4HT9 A;  2DMO A;  4KRC B;  4PNO A;  4YOS A;  4AFU C;  2V8I A;  1FIN B;  3G33 B;  4Z6Y A;  2AKL A;  2ED1 A;  3OSS C;  4XTW A;  1KC8 U;  1VQ5 Q;  1N8R R;  1Y71 A;  2JMA A;  2QQB A;  4XTV A;  3NTK A;  2RHZ A;  1ARK A;  2LP5 A;  2I2L A;  1SG5 A;  3FRN A;  4QVC A;  5GMK l;  2I40 B;  2J7I A;  2VC8 A;  5IHI A;  2CP7 A;  2MPX C;  1BYM A;  1VQ7 T;  2CT3 A;  4OGC A;  1O9K B;  1WHG A;  4E2F B;  1ACM B;  4FW1 A;  3VJP A;  3E19 A;  4QVZ A;  3SWN C;  1GY3 B;  4BCM B;  5GAN 6;  1ZBX A;  4ZTJ A;  2W10 A;  1OPK A;  2A08 A;  3CCS Q;  3X24 B;  2V26 A;  5IH2 A;  4MIM A;  3SEM A;  4J7I A;  4C0G A;  4DEX A;  4A4G A;  3Q1J A;  1NJI U;  2RK1 A;  1KQS A;  3RIR A;  3LYI A;  1K4U S;  1AWO A;  1KQS S;  2ZPF B;  5LJ5 j;  2XD0 A;  4EMK A;  3D7S B;  1AT1 B;  2KEA A;  1YJW Q;  3CME Q;  3QYB A;  1VQ4 Q;  3MI9 B;  2H3J A;  1W4S A;  2MAM A;  5IXF A;  2GTO A;  5HY6 A;  1U8R A;  1E7O A;  4IIO A;  2C0T A;  2DEQ A;  1M3C A;  2DM1 A;  2VXE A;  4AI6 A;  3PIO A;  1QLY A;  5HCK A;  2MWO A;  2EQM A;  3OS5 A;  1GFD A;  4O6J A;  1Y57 A;  2AHJ B;  5KYU A;  1VQK Q;  2DIG A;  4BCH B;  2DD5 A;  4CC7 A;  1VQO A;  4MZM A;  5GAN f;  2LJ0 A;  2HL3 A;  1KQ2 A;  4Z88 A;  2DLP A;  3UA7 A;  1M90 C;  2DBK A;  1P92 A;  4C0D C;  1UB4 A;  4FSX A;  1RAH B;  2JW4 A;  1UE9 A;  2FPD A;  2RQR A;  4PJO F;  3CC7 T;  4RMO A;  2V1Q A;  2Y90 A;  1QLB A;  2EUF A;  2AK5 A;  2YUP A;  4M7A C;  3EGU A;  2F2W A;  1OPL A;  5FU6 B;  3C94 A;  2LQ8 A;  2WSE E;  1H92 A;  4BCQ D;  3NMZ C;  3QWX X;  3I56 T;  2PK9 B;  3P8D A;  1VIF A;  1M8M A;  4RTY A;  3WVE B;  5D7U A;  2I53 A;  5HBE B;  4L6V 5;  3H0H A;  3ASK A;  2YUO A;  2W9F A;  3CCM Q;  3CCV A;  3VS3 A;  2QK0 A;  4KH1 B;  2UUE B;  2EW3 A;  3NTI A;  4JRK A;  2D9T A;  3EGD A;  4CXA B;  3U23 A;  1ZUU A;  1M9S A;  2X3X D;  4QQD A;  2DXB A;  4PJM A;  3OYE A;  2JVV A;  3SDZ A;  2FHD A;  1RAF B;  4PK4 A;  5EFQ B;  3VKI A;  4M75 A;  2HSE B;  1PRM C;  1QMZ B;  2GTJ A;  2LVM A;  2E6Z A;  4RTV A;  4C8Q B;  3H6Z A;  1IRX A;  2C5X B;  4ATO A;  2OTJ T;  5CAI A;  1Z9Z A;  5CQY A;  2QTV A;  4ROD A;  3QXE B;  1VQL Q;  3C12 A;  4EOP B;  4XU2 A;  3V8L A;  2HZY A;  4PKC C;  3CMA Q;  3QBY A;  4F70 B;  4F7U B;  3TVT A;  1I07 A;  1KC8 R;  1VQ9 Q;  2GQI A;  4RCC A;  3PT9 A;  1H1R B;  4KRT A;  4XQ3 A;  1KG1 A;  2FZK B;  3QZ5 B;  5GAM g;  1UEC A;  2K3X A;  2A37 A;  2K5F A;  4OMF B;  3CCQ Q;  1LCK A;  1H26 B;  1GBQ A;  1RAC B;  4MML A;  4LN2 A;  1IHV A;  2EYX A;  5IF1 B;  2EAY A;  2DXU A;  4A4K A;  2LNH B;  3OA6 A;  1JQQ A;  1VQN A;  3OMC A;  4BB7 A;  3JCM V;  1JXO A;  2QGS A;  2JJ9 A;  5GAO p;  1YP5 A;  3EGX A;  1Q82 C;  3I5S A;  1K8A C;  1QMC A;  4M4Z A;  1LOJ A;  1AEY A;  4OB3 B;  2E3H A;  1UJY A;  4IUP A;  4IUU A;  3KBG A;  4C0F A;  2DTH A;  2QEX T;  2VB6 A;  2PU9 B;  3HRU A;  4PJO G;  5KE3 A;  4BI8 B;  2RB6 A;  3CPW A;  2RQT A;  4ELJ A;  4II5 B;  3BHT B;  1LJO A;  1C6V X;  2FZG B;  4FYW B;  1YI2 Q;  2DD4 B;  3DB3 A;  2UZB B;  2COZ A;  1I1J A;  2RHX A;  5FRN A;  1QW1 A;  2JTE A;  4RG2 A;  3A8H B;  2QA4 T;  1QVF A;  2QDL A;  1PD1 A;  3LW5 E;  4ANJ A;  1WYX A;  4OR5 B;  1NYG A;  4ZGD B;  2EQJ A;  2Z0W A;  4Y28 E;  4A4F A;  3BLH B;  1SPK A;  5GAM j;  4QKU A;  3POM A;  2OTL Q;  2KR6 A;  1S72 T;  4BY1 X;  2LRQ A;  2B86 A;  2BS2 A;  1VQ5 A;  1NLO C;  4JDS A;  2CZ1 B;  2L3P A;  1MHN A;  1ZP2 A;  2YRD A;  4M77 C;  1TD6 A;  3CD6 Q;  1A0N B;  4OGE A;  2YRC A;  3EH1 A;  4C8Q F;  5HK0 A;  2K5L A;  3CC2 T;  1JRI A;  1Y96 A;  2DBM A;  3QG1 A;  1VYV A;  2QI2 A;  4EPC A;  2QQS A;  2BE9 B;  4JJC A;  2IW9 B;  2ZAE A;  2B9R A;  2DRM A;  3OYN A;  3CCS A;  3L2W A;  2ROL A;  1RAE B;  2F5K A;  1BBZ A;  4FCY A;  3UDC A;  4XU3 A;  2J05 A;  1TXQ A;  3BHV B;  4M78 B;  3CCE T;  1AD5 A;  2X3W D;  5KCO A;  1YJN T;  3S3M A;  1FMW A;  4X1V A;  5J26 A;  5KYW A;  1OEB A;  2DYI A;  4PJO D;  1M90 U;  1ABQ A;  1QWE A;  1VIN A;  3CME A;  4BE2 A;  4ELY C;  1UHF A;  1WNL A;  4RTX A;  1K76 A;  2CP2 A;  1W6X A;  2KBT A;  1KD1 R;  4D8K A;  4OGR B;  3QYE A;  3LWH A;  3DJB A;  1QWF A;  4II1 A;  2ROT A;  4OF1 A;  1FWZ A;  4QQG A;  4AFZ C;  2YHT A;  2JXB A;  1OZ2 A;  1CSK A;  1FMV A;  1E9H B;  5HK3 A;  3VS6 A;  2PZ1 A;  5I22 A;  2LCS A;  5GAN d;  2DAQ A;  1VQK A;  1GCP A;  1Q86 C;  1U06 A;  1TH7 A;  3QYG B;  2RK2 A;  4C8Q E;  1M3B A;  1PM3 A;  1CKB A;  2X9H A;  2QXF A;  5LJ5 d;  1YCS B;  1FYN A;  4LDW A;  3SB2 A;  4DBQ A;  2HD0 A;  3G71 A;  4DA4 A;  2DET A;  2CZ7 B;  2V22 B;  4HA8 A;  2H8H A;  1D09 B;  4F7U E;  3VS0 A;  4MZT A;  3CCL T;  1YWO A;  2MCN A;  1H1P B;  3L2Z A;  2QGG A;  2WJ9 A;  1NEG A;  3VS4 A;  1JKW A;  1E7P A;  1YHQ A;  1QKW A;  4J9D A;  4V2S A;  5FWB A;  4ZN3 A;  2DF6 A;  1H64 1;  5GAO r;  4F16 A;  3BY7 A;  2IW6 B;  3VYG A;  2PQW A;  1Z9Q A;  4ME7 A;  2AT1 B;  4PJL A;  1VQ6 Q;  2RHY A;  2GFU A;  4BCQ B;  1V76 A;  1MNE A;  4KUI A;  2B8A A;  4EOQ B;  3DOG B;  4G6L B;  4N4I A;  4M78 F;  4C0Z A;  5D6W A;  3M57 A;  2A7Y A;  2KYM A;  2CS7 A;  1XOV A;  3A5Z B;  2QQR A;  4BUG A;  1GUX B;  3FDR A;  2G77 A;  2LT1 A;  3FEO A;  3TW7 A;  3I55 A;  3CCR A;  5DLQ E;  3FLG A;  2KAF A;  1SHG A;  2CRE A;  1K0X A;  4LNP A;  2CSQ A;  3CBP A;  5CEI B;  2BZ8 A;  1Q82 U;  2M16 A;  1K8A U;  1AHJ B;  3L42 A;  3A8O B;  2DER A;  3UWN A;  3R6O A;  1OKW B;  1VQ9 A;  4RG8 A;  4PFZ A;  1MUZ A;  1UGR B;  2YUQ A;  3RER A;  4F7S B;  1ZUK A;  2K9G A;  3CCJ Q;  2PUK B;  3INZ A;  1Q81 C;  3M54 A;  4EOR B;  2RO0 A;  4OB0 B;  3FJP A;  3H8Z A;  2KRM A;  4M7A B;  1M4Z A;  4YC3 B;  5L8R E;  2M51 A;  3KFV A;  4BXX X;  1G3N C;  2D8J A;  2RNA A;  2JGZ B;  4B9X A;  4JZ4 A;  2K5I A;  3CEY A;  4E7H A;  1QP3 A;  1K73 C;  2DVE A;  5EC7 A;  4EC8 B;  5FU7 C;  2XDD A;  3VUB A;  4M78 E;  1IO6 A;  4CI0 C;  4OMP A;  1HD3 A;  1D0Z A;  4J8O A;  5IDP B;  2K3Y A;  4JJB A;  4C8Q D;  1SSH A;  1PHT A;  3TEE A;  3M58 A;  1BI2 A;  1ZA2 B;  3QII A;  3X25 B;  2CP0 A;  1YI2 A;  1JB0 E;  1D3B A;  4XU1 A;  1EFN A;  4IUT A;  3EG2 A;  3EFS A;  4K11 A;  3EAE A;  4E47 A;  2O31 A;  1X43 A;  1VQ7 Q;  1W98 B;  1YIJ T;  1J3T A;  3V7S A;  4BCF B;  2OTL A;  2HBP A;  3JCM Q;  2IPO B;  4BCN B;  5GAN e;  2CKK A;  3RKY A;  2O9S A;  2R58 A;  3CD6 A;  4CRI A;  5CVI A;  3UA6 A;  3GP8 A;  3WVD B;  5GJW B;  4C8Q A;  5LJ5 e;  2EYY A;  4F7J B;  4KBM B;  1VA7 A;  2BS3 A;  5KYY B;  4M78 G;  4J6X A;  1CKA A;  1YNZ A;  1Q7Y R;  3MHX A;  4TTH A;  1N27 A;  4NOY A;  4I3Z B;  3RNJ A;  4L59 A;  3MIA B;  3WXM B;  5IDN B;  2NWM A;  4F7U A;  2XG8 D;  4HVU A;  3HPW A;  3CC4 Q;  5GAM d;  4D6W A;  1Q86 U;  2CGH A;  3CCU A;  3PMI A;  2CH4 W;  4EMK C;  1TSF A;  3KXT A;  9ATC B;  2F2X A;  1I5L A;  4DEY A;  4FIB A;  2DNU A;  4M7A F;  2HMA A;  4OB2 B;  2V8K A;  1I4K 1;  1B34 B;  3BDL A;  1SKU B;  2KT1 A;  2FYK A;  3PE0 A;  2G9X B;  1VQO T;  1W70 A;  3HBL A;  2WIP B;  4F7N B;  3KUF A;  2VKN A;  4IKF A;  1NPP A;  1KIK A;  4QT7 A;  2CDT A;  4DBF A;  4J83 A;  4DBH A;  4BCG B;  4PJO B;  7AT1 B;  1X69 A;  2QAS A;  3OYM A;  2KQW A;  1Y07 A;  1IXD A;  4LUE A;  2CZ0 B;  2DD4 A;  1Y7X A;  3QWY A;  4MDW A;  5KE2 A;  3M0T A;  5A0L A;  1V1C A;  2QTX A;  3L1A A;  1K8A R;  1MMA A;  2C6T B;  2DIQ A;  4M78 D;  1YJ9 Q;  1T3S A;  4M7D C;  2C5N B;  5J3B A;  3ZFJ A;  3G4S Q;  4Y91 A;  1JSU B;  3NPF A;  2HQH A;  2E41 A;  3CCV T;  3TSZ A;  1ZHI A;  2ESW A;  2KK4 A;  3C0C A;  4JRQ A;  4M7A E;  5GAN 4;  1ZLM A;  1NEB A;  3TN8 B;  3P8B B;  1VYT A;  5LMK B;  2DJQ A;  3QO3 A;  1M2V B;  5J39 A;  3LGL A;  3VKG A;  2G6F X;  2O9V A;  2OTJ Q;  2J6F A;  2FO0 A;  1VQ6 A;  2PVG B;  4MFE A;  4MZP A;  2W2H A;  2BZX A;  1OU9 A;  2E5K A;  2ZPE B;  4J7F A;  4M78 A;  5I2S A;  5CR2 A;  4OMO A;  2DO3 A;  4M75 C;  1JJ2 P;  4DBR A;  2L8D A;  2P84 A;  4NL2 A;  3TNI B;  1Q81 U;  1VQM A;  1ZSZ B;  1ZX6 A;  5CKF A;  1ENW A;  2XMF A;  1O75 A;  3E2U A;  5GJV B;  1T0H A;  2LZ6 B;  1G3Y A;  5GAN h;  4L5G A;  1K73 U;  1JST B;  1F5Q B;  1S1N A;  2P4R A;  4ZTF A;  4RTU A;  3A8L B;  3PO3 S;  4RUG A;  4M7A G;  4MMK A;  2W96 A;  1H8K A;  1KHI A;  5LJ5 f;  3EID B;  1ZSG A;  5LJ5 h;  3CPW P;  2WSF E;  2HAX A;  3JB9 G;  2COW A;  2O88 A;  3VV0 A;  3EFO B;  1C0M A;  3HSB A;  3EOC B;  1AWX A;  1QVF P;  2CP6 A;  1VQP A;  2L5Q A;  4Z8A A;  1K9M R;  1IGU A;  4JLI A;  1G3S A;  1G83 A;  2JUF A;  2KRN A;  1TWB A;  4M77 F;  4N0A A;  1WJR A;  1Q86 R;  3V8K A;  2DL3 A;  5GAM e;  2M02 A;  3VS2 A;  3J80 E;  1SSF A;  1TUC A;  1S72 Q;  4EOJ B;  4BCJ B;  1OIU B;  1WZO A;  2WHB B;  3OYH A;  4YOZ A;  1N9R A;  3RBB B;  3L2R A;  5GAO l;  1ZBJ A;  4PL6 A;  1YCY A;  4JJD A;  4Q5W A;  2VV5 A;  3DKM A;  4CFN B;  2X4X A;  1VQ7 A;  2JTF A;  1MMG A;  3CC2 Q;  2EFI A;  1OX8 A;  2K2M A;  2DL8 A;  3RKX A;  3M55 A;  3M5A A;  3QHW B;  2RMO A;  2BKD N;  1AVZ C;  4HCB A;  3QUI A;  4PJO E;  3M0S A;  5C0M A;  4OMQ A;  1G2B A;  1PNJ A;  2KY9 A;  3NFC A;  4M7A D;  1OZ3 A;  2A28 A;  2BZY A;  1BU1 A;  3I5R A;  2EWN A;  2JZ2 A;  4X9D A;  1YJN Q;  4RCB A;  4KUD K;  3QWL A;  1GUX A;  1WHL A;  4JUV A;  3CCS T;  2O4X B;  1G3T A;  1M30 A;  4TVR A;  1JJ2 A;  4DOW A;  2VUB A;  1JJ2 S;  3TW6 A;  2EYW A;  2E3I A;  1JXM A;  1UNL D;  1YN8 A;  2W9Z A;  3JCM c;  4EOL B;  3HL8 A;  2WMB B;  2NUZ A;  3HO8 A;  2EQI A;  2HQX A;  2RJD A;  5IAY A;  2FRW A;  1HYO A;  3CC4 A;  4OML A;  2RI3 A;  2PHG A;  1VOL A;  3S3O A;  1GBR A;  2WFY B;  2F2C A;  5IHY A;  2RI5 A;  1VQ8 Q;  2F5T X;  1JU5 C;  1UFF A;  1PCX A;  1SRL A;  2P0P A;  1NJI R;  3BE3 A;  3OYK A;  3X28 B;  4YOO A;  1LVK A;  1RAG B;  3G6E A;  2MI6 A;  3A8M B;  4XTZ A;  2DME A;  1OYX A;  3CPW S;  3VUZ A;  3JCM g;  1W2B P;  4BCN D;  3BG3 A;  1WHJ A;  3DTO A;  4BD3 A;  1RAD B;  1N8R C;  2MOX A;  1PKS A;  3G71 T;  1YBY A;  2E10 A;  2DL5 A;  2XI9 A;  4CRL B;  1QVF S;  3LH0 A;  1GXI E;  2YUN A;  1N4M A;  2XHC A;  2KT8 A;  1WGS A;  3OYL A;  2DTO A;  1RLQ C;  1K1Z A;  4M77 G;  2IG0 A;  4E7J A;  1JO8 A;  3MET A;  2HKQ B;  1GCQ A;  2RM4 A;  1WA7 A;  1WHH A;  1YHQ T;  1BB9 A;  2KE9 A;  3BG5 A;  3CQT A;  3F70 A;  3EG0 A;  1YJ9 A;  1OIY B;  2L3R A;  3G4S A;  2R57 A;  2HSP A;  3J81 E;  3TQ7 P;  4A4H A;  2C0O A;  1OOT A;  4OMM A;  2BE7 D;  2RPN A;  4KGV B;  1DJ7 B;  1U1S A;  1I8F A;  4NC6 A;  4C92 G;  4JPB W;  4ELZ C;  2ED0 A;  1LPL A;  2PTK A;  1PSE A;  2EGC A;  3JCM J;  3LGF A;  2OTJ A;  1TUD A;  5GAM f;  4C92 C;  4EC9 B;  2CYZ B;  5GAM h;  1UGV A;  4FT4 A;  4HXJ A;  1FKM A;  2DFU A;  1YJW A;  2DPP B;  3I55 T;  2M0Y A;  4LOC A;  1D0X A;  5FWC A;  3CCR T;  3QZ9 B;  1BI0 A;  2HKN A;  1VQ4 A;  3QJY A;  1UG1 A;  4IMY B;  4VUB A;  4WCI A;  2DRK A;  1Y0M A;  3O8V A;  4AKH A;  2YLC A;  1MGQ A;  3C95 A;  1BIA A;  1WXT A;  1O9S A;  1VQ9 T;  2KMT A;  1OI1 A;  2OAW A;  1OQK A;  1QQJ A;  4LE9 A;  2DXC B;  4M77 D;  2L3Q A;  2RJF A;  5KYU B;  5A0G A;  3OBW A;  2I0N A;  5A2Q E;  1OL2 B;  2F1L A;  4EDU A;  4C5H A;  2BIV A;  1KFZ A;  2EGA A;  2RHI A;  3OBY A;  4F6U B;  1QCO A;  3RR6 A;  4PJO A;  1YIT Q;  2OI3 A;  5KH6 A;  3RDV A;  1W2B A;  2BKZ B;  3HRT A;  1W2B S;  5GMK e;  5DQV A;  2NUT B;  1PKT A;  1KHC A;  4PLI A;  3JAM E;  4O5V A;  4ZGJ B;  1WHK A;  4M7D B;  2PJQ A;  5GMK m;  4Z89 A;  4CFW B;  4F14 A;  1X01 A;  4XTY A;  2LCL A;  5FU6 C;  2JT4 A;  3LH5 A;  5DM7 R;  3SWN B;  2C5O B;  2V1R A;  3NDQ A;  4JX4 A;  4BI3 A;  1YIJ Q;  1H27 B;  1EIF A;  1PKD B;  2L2P A;  1O9K A;  5I5Z B;  4LD6 A;  2BTT A;  2FRY A;  4WF2 A;  3C4S A;  3CCM A;  1D1B A;  1KSW A;  3JCM b;  3M4G A;  1P5E B;  1UGS B;  5ECA A;  2DKG A;  2HNI A;  2OTL T;  1D1A A;  2KRS A;  2HQE A;  1K0S A;  2WPA B;  1E6G A;  4AFS C;  4E7L A;  1BU2 A;  1M2V A;  2CUB A;  1UGP B;  2E70 A;  2DXB B;  3CD6 T;  2DL7 A;  3M53 A;  3VRY A;  5FLX E;  5I2M A;  1BCM A;  3F5X B;  5IN1 A;  2P0Q A;  4F17 A;  5IT9 E;  4PJJ A;  3H0F A;  3OQ5 A;  2IW8 B;  1NG2 A;  1VQL A;  1M2O A;  4KH0 B;  3DDQ B;  1PRL C;  4BE1 A;  3CBM A;  2OAU A;  4QVD A;  4F6S B;  3CMA A;  1ZSZ A;  2D8H A;  4JX6 A;  1IGQ A;  2GNC A;  1T0J A;  4PJN A;  2E5Q A;  3CCU T;  3HFN A;  4C0D B;  3O0G D;  3SD4 A;  2DE0 X;  1NE8 A;  4FW2 A;  3CCQ A;  4JRI A;  2EJ9 A;  1N8R U;  2K4Y A;  5HQ0 B;  3E9G A;  3HB9 A;  2ENM A;  3H41 A;  3MP8 A;  4AT1 B;  1MMN A;  1MMD A;  2GQV A;  2R7G A;  1PSF A;  4QQ6 A;  1VQ8 A;  4AFQ C;  2AZS A;  3EFO A;  5L2W B;  3PFS A;  1FMK A;  2DZ9 A;  3M0Q A;  3URG A;  1X27 A;  1NLP C;  4M7D F;  1X2Q A;  1N6A A;  4DQ2 A;  3EFR A;  4CFX B;  4HNU A;  5CKE A;  1M90 R;  3QDR B;  1RLP C;  3V7C A;  3PMT A;  4RKU E;  2QQ8 A;  1M1K C;  4J9I A;  4BBS M;  1VIE A;  1U5S A;  4RTZ A;  2PUO B;  3HP9 A;  3A98 A;  2YLB A;  2LTO A;  5LJ3 g;  5C6S A;  2ABL A;  2VGN A;  3LX7 A;  5IHK A;  3CCV Q;  3LQ5 B;  3HRS A;  2AKK A;  3EHR A;  1M1G A;  4FU6 A;  2EBP A;  2YWW A;  4QSH A;  4EON B;  2FL7 A;  2OJ2 A;  2FZC B;  3ER0 A;  4A63 B;  3OYB A;  3DB4 A;  1I5O B;  4IIM A;  4RTW A;  3TSW A;  4KRD B;  3VRZ A;  2PNI A;  3OY9 A;  4M75 F;  5IXB A;  2KVQ G;  3MEU A;  4X9C A;  1YWP A;  1QCN A;  5GMK h;  1LNX A;  2AZV A;  2GGR A;  2C0I A;  4J9F A;  1RAB B;  2EQK A;  4HNT A;  2DA9 A;  1H3Z A;  2O4X A;  4M7D E;  4J9E A;  2G3R A;  3QDF A;  1KD1 C;  2WXV B;  2FB7 A;  1RAI B;  2K7A A;  3SFM A;  5CYI B;  2CZ6 B;  2NUP B;  4HLQ A;  4P5N A;  3OS2 A;  1T3L A;  1VQM T;  2EVR A;  3QPH A;  5LJ3 j;  2CCH B;  2QFZ A;  5GAO n;  5KYW B;  2LQK A;  2CSI A;  3K7A M;  1PWT A;  3GTM S;  2XK0 A;  3ME9 A;  2KR3 A;  2RQV A;  2ZZD B;  3CC7 Q;  2YDL A;  4LD9 K;  4GLM A;  1EX4 A;  4D8D A;  2QDJ A;  3JB9 F;  4CFU D;  1EZZ B;  8AT1 B;  5GAN 7;  5LL6 S;  4C5E A;  2A0F B;  1UNG D;  4HCK A;  2VXF A;  1WJS A;  3JCM d; 
#chains in the Genus database with same CATH homology
 3J80 E;  1SSF A;  2PVD B;  1JRI A;  1Y96 A;  3QG1 A;  1NJI C;  2E64 A;  2JOY A;  2A3L A;  2QI2 A;  4EPC A;  1ZQ1 A;  3OYH A;  1N9R A;  2QQS A;  3L2R A;  5GAO l;  5CQX A;  4X34 A;  3OS1 A;  4J5Y A;  4PL6 A;  1YCY A;  3OYN A;  3CCS A;  3L2W A;  3RUX A;  4Q5W A;  1VQP T;  2F5K A;  2VV5 A;  3UDC A;  5LJ3 f;  4EMH A;  2EKO A;  3DKM A;  4HKE A;  4M78 B;  4XU3 A;  4BAC A;  1YIT A;  4M7D G;  3CCE T;  3OYD A;  5EJC A;  2RD1 A;  2X4X A;  2JTF A;  4FL6 A;  5KCO A;  1YJN T;  2EFI A;  1VQ7 A;  4HCC A;  3S3M A;  3RKX A;  5J26 A;  4R55 A;  3M55 A;  3J7A F;  4AKG A;  3BFM A;  2WAC A;  4PJO D;  1M90 U;  3M5A A;  4B9W A;  2BKD N;  4M77 B;  5DLO A;  4E7I A;  3QUI A;  4HCB A;  3QSU A;  4AKI A;  3CME A;  4PJO E;  1BIB A;  5C0M A;  3OYC A;  2GFA A;  3FB9 A;  3GNG A;  4C5I A;  4ELY C;  4BE2 A;  1WNL A;  2KY9 A;  3NFC A;  3PGG A;  3OYY A;  3X20 B;  4OVA A;  3DLL A;  3E1S A;  4M7A D;  1OZ3 A;  2D6F A;  2XU8 A;  3V7R A;  2C06 A;  2EWN A;  3M56 A;  3QYE A;  3LWH A;  2JZ2 A;  4X9D A;  2XID A;  4II1 A;  1V29 B;  4N0A C;  4OF1 A;  1FWZ A;  4QQG A;  1M5Q 1;  3M9Q A;  4RCB A;  2YHT A;  3QWL A;  1OZ2 A;  4JUV A;  4Z02 A;  1X75 C;  5HKC A;  2KDS A;  3VU3 C;  3CCS T;  2O4X B;  3GLX A;  1YIJ A;  3CCL A;  4J6W A;  5HK3 A;  3JCM P;  1YIT T;  1G3T A;  5GAO m;  3M4Y A;  2VYT A;  2LC4 A;  3JCM W;  4J6Y A;  4TVR A;  5GAN d;  2DAQ A;  2ZGW A;  1JJ2 A;  4DOW A;  1VQK A;  4BDY A;  1Q86 C;  2VUB A;  1JJ2 S;  3TW6 A;  1TH7 A;  3QYG B;  2GF7 A;  2X4J A;  5I21 A;  2RK2 A;  5GMK j;  5FRM A;  3VYG B;  4C8Q E;  2ZPG B;  3JCM c;  4M75 G;  4C5G A;  3HL8 A;  2RH2 A;  4C92 B;  3HO8 A;  2MMP A;  2QXF A;  5D6X A;  5LJ5 d;  2HQX A;  2RJD A;  5GAN j;  4LDW A;  1M8V A;  2RI2 A;  3SB2 A;  5IAY A;  3N5B B;  2HD0 A;  3CC4 A;  3G71 A;  4BY6 C;  3JCM X;  4DA4 A;  2RI3 A;  2CZ7 B;  4HT8 A;  4HA8 A;  3S3O A;  3LLR A;  3OYI A;  4MFD A;  4F7U E;  2RI5 A;  4MZT A;  4M6V A;  3CCL T;  2F5T X;  3QYH B;  2RA2 A;  2E65 A;  3NTH A;  3H4C A;  1WJQ A;  2P0P A;  2F69 A;  4N4H A;  3TU4 K;  1G5V A;  2NLU A;  3OYK A;  5GAN 5;  3X28 B;  3L2Z A;  4LDY A;  3TRE A;  4KT0 E;  3L2U A;  1IRE B;  4DOV A;  2WJ9 A;  3OYF A;  3G6E A;  2MI6 A;  4JS5 A;  1VQ6 T;  3A8M B;  1E7P A;  1FXX A;  4XTZ A;  1OYX A;  1Y96 B;  3CPW S;  3VUZ A;  1YHQ A;  4HL4 A;  3JCM g;  2BS4 A;  4M7D D;  3BG3 A;  3JB9 I;  4V2S A;  1BI3 A;  1RL2 A;  4ZN3 A;  4BD3 A;  1H64 1;  4FT2 A;  5GAO r;  1N8R C;  1I81 A;  4NS5 A;  3X26 B;  2K2V A;  2LNV A;  3OW2 A;  3CC4 T;  3G71 T;  1YBY A;  1VQN T;  3OW2 S;  2E10 A;  3BY7 A;  4JLG A;  2XI9 A;  1QVF S;  2Y4X A;  4FM4 B;  3LH0 A;  3MO8 A;  2DXC A;  1GXI E;  2M0O A;  5EG2 A;  2VGM A;  3VYG A;  2Y4Y A;  4OB1 B;  2XHC A;  1M1K U;  3CCJ A;  1WGS A;  2PQW A;  4ME7 A;  3OYL A;  2DTO A;  2RHY A;  1QVP A;  1R8O B;  2L89 A;  1HK9 A;  2GFU A;  4BBR M;  4ZN1 A;  1K9M U;  3L2Q A;  4M78 C;  1WQ7 A;  3MCA B;  1XQH A;  4M77 G;  4YTL A;  2IG0 A;  4E7J A;  4KUI A;  3MET A;  3CCR T;  2B8A A;  3G6E T;  2RM4 A;  4N4I A;  4M78 F;  4C0Z A;  5GMK i;  1XTD A;  1YHQ T;  3MEW A;  5D6W A;  3M57 A;  2A7Y A;  2GCX A;  3QKJ A;  3BG5 A;  2CS7 A;  3F70 A;  1XOV A;  3A5Z B;  2LT4 A;  1KQ1 A;  2MWP A;  2QQR A;  1YJ9 A;  5CKD A;  4BUG A;  4N4G A;  3FDR A;  2G77 A;  2L3R A;  2LT1 A;  3TW7 A;  1WPY A;  3FEO A;  4OP0 A;  3I55 A;  3G4S A;  3DLM A;  3CCR A;  4JJN K;  2XDP A;  2R57 A;  5DLQ E;  4M75 D;  2DXT A;  3FLG A;  1FX7 A;  2KAF A;  3OYJ A;  4M7D A;  2DJZ A;  1BKB A;  5DY9 A;  4M75 E;  4BI4 A;  5CK9 A;  3J81 E;  3CCJ T;  4A4H A;  3CBP A;  1M1F A;  3PNW C;  5GAN g;  1Q82 U;  2M16 A;  1K8A U;  1AHJ B;  3SWN A;  3OYA A;  1DJ7 B;  3L42 A;  1IZ6 A;  1NZ9 A;  5CKH A;  3QJ6 A;  1U1S A;  2X4W A;  3A8O B;  1D3B B;  1I8F A;  4NC6 A;  4C92 G;  4ELZ C;  1VQ5 T;  4LDU A;  5D6Y A;  2DTI A;  3UWN A;  1PSE A;  3R6O A;  1VQ9 A;  3HHT B;  5LJ3 h;  2DK3 A;  4RG8 A;  3JCM J;  3LGF A;  4IUR A;  2R5M A;  4EMG A;  2X35 A;  3MEA A;  3MP6 A;  5GAM f;  1UGR B;  2EQU A;  4C92 C;  5LJ5 g;  2CYZ B;  4MDX A;  5GAM h;  3RER A;  4FT4 A;  2BUD A;  1FKM A;  1YJ9 T;  2PUK B;  4A53 A;  4HT9 A;  3INZ A;  5CO7 A;  1Q81 C;  1UGQ B;  2DPP B;  3I55 T;  1YJW A;  1KD1 U;  3M54 A;  4LOC A;  4PNO A;  4C92 F;  2LCC A;  3QZ9 B;  1BI0 A;  4LDV A;  2RO0 A;  3G4S T;  4OB0 B;  2V8I A;  3FJP A;  3H8Z A;  4M7A B;  1M4Z A;  3QJY A;  1VQ4 A;  3BW1 A;  4Z6Y A;  5L8R E;  3OSS C;  3JCM e;  5FRO A;  4XTW A;  1U1T A;  1KC8 U;  4VUB A;  2EYQ A;  1Y71 A;  2P0K A;  2E12 A;  3O8V A;  2QQB A;  2XKO C;  4XTV A;  4B9X A;  2K5I A;  2RHZ A;  3CEY A;  4AKH A;  1QP3 A;  2DVE A;  3NTK A;  2YLC A;  4E7H A;  1MGQ A;  2ZPH B;  1K73 C;  5FU7 C;  2XDD A;  3G7Z A;  3HZJ A;  3VUB A;  3C95 A;  2I2L A;  1HXD A;  1BIA A;  3FRN A;  3MEV A;  4M78 E;  4QVC A;  3TCJ A;  5GMK l;  2VC8 A;  4CI0 C;  1VQ9 T;  1O9S A;  4XU0 A;  1Q7Y C;  3JB9 D;  1BYM A;  1VQ7 T;  3V8J A;  2KMT A;  4OGC A;  1OI1 A;  4J8O A;  2K3Y A;  5AYF A;  3BDU A;  2ZPB B;  2DXC B;  4M77 D;  4QW2 A;  4C8Q D;  3VJP A;  3E19 A;  4QVZ A;  3SWN C;  2RJF A;  3M58 A;  3TEE A;  5A0G A;  1BI2 A;  3DL1 A;  4M77 E;  3QII A;  3X25 B;  1YJW T;  5GAN 6;  3CME T;  3OBW A;  1ZBX A;  1YI2 A;  5A2Q E;  4ZTJ A;  1BI1 A;  1D3B A;  1JB0 E;  1VQ4 T;  4XU1 A;  4EDU A;  4C5H A;  2JNG A;  2BIV A;  4IUT A;  3X24 B;  2IVW A;  4MIM A;  2RHI A;  5CCA A;  3FIF A;  3OBY A;  4XAX B;  4J7I A;  3EFS A;  4C0G A;  4PJO A;  4A4G A;  3VKH A;  3EAE A;  3Q1J A;  4E47 A;  1NJI U;  5KH6 A;  2RK1 A;  5GAN 2;  1KQS A;  3RIR A;  1W2B A;  3LYI A;  1KQS S;  3HRT A;  2ZPF B;  5LJ5 j;  1W2B S;  5GMK e;  3OS0 A;  1YIJ T;  2XD0 A;  4EMK A;  4M7A A;  3V7S A;  2OTL A;  2HBP A;  1KHC A;  4PLI A;  3QYB A;  3JAM E;  4O5V A;  3JCM Q;  1VQK T;  1G3W A;  2H3J A;  5FU7 B;  4ZGJ B;  1W4S A;  2MAM A;  5GAN e;  4M7D B;  5GMK m;  2CKK A;  3T9N A;  3OMG A;  1X6O A;  3RKY A;  4HNV A;  5HY6 A;  1U8R A;  3GIB A;  4R56 A;  1X01 A;  3CC7 A;  4XTY A;  2LCL A;  2R58 A;  2DEQ A;  4C92 E;  5FU6 C;  3CD6 A;  4CRI A;  3PIP A;  2VXE A;  5CVI A;  4AI6 A;  5DM7 R;  3SWN B;  3GP8 A;  3PIO A;  3WVD B;  4C8Q A;  2MWO A;  4JX4 A;  2ZCF B;  4BI3 A;  5LJ5 e;  3S3N A;  1EIF A;  2EQM A;  3OS5 A;  4KBM B;  1XNI A;  4LD6 A;  2BS3 A;  4O6J A;  4M78 G;  4WF2 A;  4LDX A;  3C4S A;  3ZEH A;  2AHJ B;  3CCM A;  2DIG A;  4J6X A;  2DD5 A;  3MHX A;  1VQO A;  1N27 A;  4MZM A;  4NOY A;  4JX5 A;  2X4Y A;  5A0D A;  3JCM b;  3M4G A;  5GAN f;  2WSC E;  1UGS B;  3I56 A;  1KQ2 A;  4L59 A;  3UPU A;  2QF7 A;  4XK8 E;  3WXM B;  2DKG A;  2HNI A;  2OTL T;  2HQE A;  1M90 C;  5LJ3 d;  4PJO C;  4F7U A;  1P92 A;  1QP2 A;  2XG8 D;  4C0D C;  1UB4 A;  4E7L A;  3JB9 H;  3HPW A;  4FSX A;  5GAM d;  4D6W A;  1Q86 U;  1UGP B;  2CGH A;  2E70 A;  4PJO F;  2DXB B;  4RMO A;  3PMI A;  3CCU A;  3CC7 T;  2Y90 A;  4XTU A;  3GOX A;  3AHU A;  1QLB A;  3M53 A;  4EMK C;  3CD6 T;  3KXT A;  2RJC A;  5FLX E;  4M7A C;  4GLK A;  4A4E A;  5I2M A;  1NPR A;  2MF2 A;  3HKS A;  1I5L A;  3LWI A;  4FIB A;  5FU6 B;  3C94 A;  5IN1 A;  4M7A F;  4OB2 B;  2V8K A;  2P0Q A;  5IT9 E;  1I4K 1;  2LQ8 A;  2WSE E;  1B34 B;  3ZBD A;  3BDL A;  3CCM T;  2XDB A;  1JBM A;  2FYK A;  3OQ5 A;  1WQW A;  3HFO A;  1VQO T;  1VQL A;  4A54 A;  3I56 T;  4BE1 A;  3P8D A;  3CBM A;  3HBL A;  1VIF A;  2OAU A;  4QVD A;  3KUF A;  3CXC A;  3CMA A;  4JX6 A;  3CXC S;  3CC2 T;  4IKF A;  1NPP A;  2E5Q A;  3JRZ A;  2OTJ A;  3WVE B;  4J83 A;  5M9O A;  4L6V 5;  3CCU T;  3KHI A;  4PJO B;  3HFN A;  3JSC A;  4C0D B;  3ASK A;  3SD4 A;  3RMS A;  3OYM A;  1NE8 A;  3CCV A;  2KQW A;  3CCQ A;  1Y07 A;  2YRV A;  3QHS A;  2EIF A;  2EJ9 A;  4JRI A;  2CZ0 B;  2DD4 A;  3NTI A;  1N8R U;  4JRK A;  1Y7X A;  3CPF A;  4EMK B;  3A8G B;  4MDW A;  5KE2 A;  2K4Y A;  2D9T A;  2EJG A;  3E9G A;  4F7U F;  3HB9 A;  1M9S A;  4QQD A;  5A0L A;  1VQL T;  2QQ9 A;  5CIU A;  2DXB A;  2QTX A;  3L1A A;  3OYE A;  2JVV A;  2LDM A;  3SDZ A;  2JN0 A;  3P8H A;  2FHD A;  2XIC A;  2M1H A;  3MP8 A;  5KCH A;  2K57 A;  2DIQ A;  3VKI A;  2GQV A;  2PVO B;  4M75 A;  3CMA T;  1PSF A;  4M78 D;  3OSV A;  4QQ6 A;  1VQ8 A;  4M7D C;  5J3B A;  2LVM A;  3PFS A;  2E6Z A;  1B34 A;  2QQA A;  4XTX A;  4C8Q B;  3MP1 A;  3H6Z A;  3ZFJ A;  2DZ9 A;  4Y91 A;  3URG A;  4ATO A;  5CAI A;  2OTJ T;  4GY5 A;  5GAO q;  5CQY A;  3PTA A;  4M7D F;  4DQ2 A;  1N6A A;  2E41 A;  3CCV T;  1N9S A;  3EFR A;  3CCQ T;  3QXE B;  3GNF B;  3JCM f;  4HNU A;  3C12 A;  3OB9 A;  2DD5 B;  2ZZD A;  3QDR B;  4XU2 A;  5CKE A;  3JCM h;  4JRP A;  1ZHI A;  2KK4 A;  3PMT A;  3V7C A;  4RKU E;  2QQ8 A;  4JRQ A;  1M1K C;  2KSS A;  3V8L A;  5CKB A;  5GAN 4;  4M7A E;  4BBS M;  1VIE A;  4PKC C;  3S6W A;  1K9M C;  1QVG A;  3QBY A;  2PUO B;  3HP9 A;  2JTM A;  3P8B B;  3UT1 A;  4F7U B;  1QVG S;  2YLB A;  2P4T A;  5J39 A;  3QO3 A;  2M9U A;  3LGL A;  3VKG A;  4RCC A;  2LTO A;  3PT9 A;  4KUL A;  5LJ3 g;  5C6S A;  4XQ3 A;  2QEX A;  1KG1 A;  2VGN A;  3LX7 A;  3QZ5 B;  5GAM g;  3HRS A;  2K3X A;  1VQ8 T;  2K5F A;  4OMF B;  2PVG B;  3OYG A;  1VQ6 A;  1M1G A;  4FU6 A;  1VUB A;  2ZPI B;  4QSH A;  3JB9 J;  4MFE A;  2FL7 A;  4MZP A;  2QDY B;  4IUQ A;  4MML A;  2E1H A;  3L2V A;  3ER0 A;  2ZPE B;  4J7F A;  3OYB A;  3DB4 A;  2EAY A;  4M78 A;  2DXU A;  4UC4 A;  4A4K A;  4C92 D;  5I2S A;  5CR2 A;  2DO3 A;  4M75 C;  3OA6 A;  2LX9 A;  2QA4 A;  4BE0 A;  4KUD K;  3RKW A;  1VQN A;  2L8D A;  3OMC A;  1YI2 T;  4NL2 A;  4BB7 A;  3JCM V;  1Q81 U;  5GAO p;  3OY9 A;  4M75 F;  1VQM A;  1Q7Y U;  1Q82 C;  2KVQ G;  2DZC A;  3MEU A;  4M77 A;  4X9C A;  4E7K A;  1K8A C;  5GAN 3;  1LOJ A;  5CKF A;  4JS4 A;  2EJF A;  4OB3 B;  4IUP A;  3BG9 A;  5GMK h;  4NL3 A;  2RHU A;  5GAN 8;  4IUU A;  1LNX A;  1O75 A;  2FVU A;  3KBG A;  4C0F A;  2DTH A;  2QEX T;  2PU9 B;  3HRU A;  1S72 A;  2RJE A;  4PJO G;  5KE3 A;  3GF5 A;  2D0Q B;  2O01 E;  2RB6 A;  4BI8 B;  3CPW A;  4ELJ A;  1G3Y A;  5GAN h;  4L5G A;  1K73 U;  1LJO A;  3CBO A;  3FC3 A;  2EQK A;  4HNT A;  2DD4 B;  3DB3 A;  4ZTF A;  1H3Z A;  2RHX A;  5FRN A;  2O4X A;  4M7D E;  1KD1 C;  2G3R A;  3A8L B;  1QW1 A;  4M7A G;  2FB7 A;  4IUV A;  4MMK A;  4RG2 A;  1RI0 A;  1KHI A;  3A8H B;  3SFM A;  5LJ5 f;  2QA4 T;  1QVF A;  3LW5 E;  5LJ5 h;  3CC2 A;  1KC8 C;  2CZ6 B;  4HLQ A;  4P5N A;  2WSF E;  3OS2 A;  1VQM T;  2HAX A;  3QPH A;  4ZGD B;  3VYH B;  2EQJ A;  4M75 B;  5LJ3 j;  4BY6 B;  2QFZ A;  4Y28 E;  4A4F A;  5GAO n;  4C92 A;  3JB9 G;  2LQK A;  3VV0 A;  5GAM j;  3HSB A;  3RES A;  4C8Q G;  2KR6 A;  1S72 T;  2XK0 A;  2R5A A;  2LRQ A;  1VQP A;  2L5Q A;  2BS2 A;  1UEB A;  3RMQ A;  3GPL A;  1VQ5 A;  3ME9 A;  2CZ1 B;  4JDS A;  1MHN A;  2ZZD B;  3CCE A;  4M77 C;  2V8J A;  4C8Q C;  4LD9 K;  1YJN A;  3E9F A;  4OGE A;  4BDZ A;  2QDJ A;  4JLI A;  3JB9 F;  1G3S A;  2KMG A;  4HCZ A;  5GAN 7;  5LJ3 e;  5LL6 S;  4C5E A;  2JUF A;  4M77 F;  4N0A A;  4C8Q F;  1WJR A;  5HK0 A;  3V8K A;  2K5L A;  4F7U G;  4PLL A;  2VXF A;  2E6N A;  4ZGE B;  5GAM e;  1WJS A;  3JCM d;  3M59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...