4OB0B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to phenyl boronic acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
molecule tags Lyase
source organism Pseudonocardia thermophila
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
total genus 68
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob0B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob0B02
3A8MB 3WVDB 1DJ7B 4KT0E 2DXBA 2DD5A 1UGRB 3A8HB 2ZZDA 3X28B 3QZ5B 3QZ9B 2AHJB 2ZPHB 4Y28E 1IREB 4ZGJB 2DD4B 2PVGB 4XK8E 2PU9B 2PVOB 3VYGB 2CYZB 3X24B 1JB0E 2PUKB 3X26B 2D0QB 2WSCE 3VYHB 2WSFE 1GXIE 2QDYB 4OB3B 5L8RE 2ZPIB 3VYGA 4FM4B 1PSEA 2PVDB 2ZPBB 4RKUE 3HHTB 2CZ0B 4OB0B 4OB1B 1UGPB 2O01E 2DD4A 2PUOB 1UGSB 2ZCFB 3LW5E 3X20B 1QP3A 4ZGDB 2DXBB 2DXCA 2ZPFB 2CZ7B 3X25B 3A8LB 2CZ6B 1AHJB 4L6V5 3WVEB 2ZZDB 3QYGB 2DD5B 2DXCB 1PSFA 2ZPGB 3QXEB 4OB2B 1UGQB 4ZGEB 1V29B 2ZPEB 3QYHB 2WSEE 2DPPB 1QP2A 3A8OB 2CZ1B 3A8GB
chains in the Genus database with same CATH superfamily
4BACA 3A8MB 2M16A 3DL1A 1RAAB 3HBLA 2NUPB 2GFUA 2CP2A 5GAMj 2DX1A 2EPDA 1H3HA 4EOPB 4II5B 2JM8A 1OYXA 2RHIA 3QHRB 3LQ5B 2BE7D 1ZX6A 2QQBA 3SDZA 5GAN5 2VC8A 2UZEB 2DL7A 4RODA 3X26B 3CPWP 4C0DC 1Q82C 1UHFA 1WZOA 5GAMe 2EVRA 4HNTA 3G1JA 2XIDA 4EOKB 2CREA 4BI3A 3G71T 2X9HA 2E4HA 3BLHB 2RJFA 2YRVA 2L3QA 3BDLA 1VQ9T 2E5KA 2JNGA 1M90C 2DTOA 3RBBB 5CR2A 3QSUA 4AKIA 3EFSA 5GAMh 1TD6A 2OAUA 2WFYB 4F70B 1KQSP 1M2VB 4Z89A 1UGSB 2DL3A 3CCUQ 1A0NB 4CFVB 4KULA 3OMGA 2PZ1A 1UB4A 2BIVA 4M75F 4PJOF 4NC6A 3TU4K 4IMYB 3CC4T 3DOGB 2DXBB 2ABLA 2EAYA 2BZ8A 1I8FA 3A8LB 4WF2A 2FO0A 2F5KA 4CFUB 5ECAA 1W2BP 3ULRB 3JV3A 5KYXB 4RTWA 3H0IA 4BCKB 1KJWA 2JMAA 1N4MA 4A4GA 1P92A 1Q81R 1RAIB 3BW1A 4N4GA 4AT1B 2EQKA 2FPDA 2W0ZA 1VQ4A 4RTZA 2EJ9A 1X6GA 2AK5A 1JU5C 1T3LA 3QYHB 2EQMA 5GAN6 3E9FA 4C0DB 1E7PA 1KHCA 4F7UE 1YJWQ 4HCCA 4JJBA 5DY9A 3OA6A 4J9HA 3NGPA 2C06A 4CRIA 4BE2A 1U3OA 3CC2A 1S1NA 3NMZC 5CVIA 4CC4B 1N8RU 4AFSC 1X2KA 1KFZA 3OSVA 4MZMA 3TQ7P 1TH7A 5GAMf 1VQ4T 5LJ5f 2PHGA 2EYWA 4J83A 2VB6A 1MNEA 2QQRA 3NPFA 3OYDA 1OI9B 2RQRA 3CBOA 1BI2A 1VQ8Q 2CCIB 3VYHB 3EGDB 2V1QA 4FW2A 1YWPA 1K9MU 2QDJA 4MFEA 2QTXA 2NYSA 2CT4A 1BK2A 3TNHB 1WNLA 4RCCA 2DZCA 4DBHA 3TW7A 1WHJA 2FEIA 1K9MC 1TG0A 2LZ6B 4OB0B 4B9XA 3N5BB 2XDDA 2LJ3A 2V8IA 5CCAA 3OQ5A 3EG0A 4BCMB 3MEUA 3TCJA 2IVXA 2CUBA 3CC7T 2KYBA 2C0IA 5KYNA 1NM7A 4M7DC 4AMCA 1H641 1OOTA 3FIFA 3MI9B 2QA4T 3ASKA 3GTMS 1VQNQ 2AZSA 1VOLA 1GCQC 1X2QA 2E65A 2GQIA 5I11A 1OULA 1VQ7A 2KBTA 2EYZA 4EC9B 4CFXB 4HL4A 4CFUD 2LT4A 1AD6A 2O4XB 1B07A 2X4YA 2LX7A 3P8HA 3E2UA 1H25B 2QF7A 4BCGB 1Y0MA 2I0NA 4NSTB 5CKEA 3UF4A 2YLCA 5IHNA 2RI3A 1MV3A 2YUQA 4JX4A 5I22A 3A8OB 5GANd 4HCZA 2DZ9A 2D6FA 2F2XA 2OTLA 3CMAT 1WX6A 4OMOA 1YJ9A 2BE9B 1IHWA 4PJMA 5CKFA 4X34A 1FKMA 3RNJA 1Q86C 4PJJA 3THKA 4M78A 2WXVB 3RKXA 5CK9A 3ZEHA 5GAN4 5D6XA 1I81A 3SD4A 3JB9I 4XU1A 4RG8A 1Y57A 3CCUA 4ELYC 4XK8E 3TW6A 3CCJQ 3VS7A 2AZVA 3PMIA 1SSFA 1SG5A 2DO3A 1NJIU 1CSKA 4F7LB 3GPLA 4M7AA 1N8RR 2JTFA 2ZPIB 2MMPA 3CPFA 4N4HA 3G6EQ 2CDTA 2FL7A 1ZSZC 7AT1B 2BS2A 1P5EB 4FYXB 2F2WA 5CQYA 4DEYA 1AT1B 4BY6C 2V22B 2CP5A 3K7AM 3BHVB 4E7IA 3TNWB 5GAN3 1QVPA 2KMTA 1PC0A 4OVAA 3HZJA 2JVVA 3FRNA 3UPUA 1UTIA 2A08A 2L5QA 1WXTA 2DBKA 1TSFA 3ER0A 3X20B 3QHSA 1MNDA 4M77C 2JTMA 2DIGA 2DVEA 2XMFA 1Q7YC 1E7OA 3CCJT 3MKDA 1MMDA 1I5OB 3HRUA 2KY9A 2CZ6B 4BD3A 2HD0A 4CC2A 1N8RC 1YWOA 3JCMg 4FYVB 4CC3A 1VYWB 4V2SA 1BI1A 3CCET 3PGGA 3M55A 3CMAA 3EGUA 3FJ5A 4L59A 2OTLT 3LWIA 3OS1A 5IAYA 3I56Q 1TU0B 5BNJB 1RUWA 2CH4A 1VQ5T 4LDYA 3OYAA 2OTJA 2Y4XA 1T3SA 4E2FB 2DXUA 2K2MA 4HVVA 3DKMA 3JCMV 3MP6A 2C5VB 3V7CA 3M0PA 3V7SA 4F16A 4OMFB 2H3EB 5FWCA 1UGRB 3JCMP 4CI0C 1LNXA 2RQVA 1TS9A 1IB8A 2FB7A 3DB4A 3QHWB 2W10A 3CC2T 2M0OA 2ZPHB 4FX3B 2DL8A 3QKJA 2DFUA 4BY6B 1BCMA 1YIJQ 3CCRA 2HEQA 2PK2A 3DJBA 2XICA 1KD1R 3M56A 2PVGB 2HSEB 2K5IA 1X43A 1RABB 2PVOB 3E19A 5IHYA 2JN0A 2K3YA 5GAOm 3OS0A 2X4XA 4C8QE 2A37A 4C0ZA 5J39A 1ZA2B 4ZTFA 3PVLA 4MMKA 3OYMA 4ELJA 5FGKB 1OEBA 2P84A 4C0FA 4EMKA 2QEXT 3QWXX 1V76A 5C6SA 3O5ZA 2PMIB 1SRLA 2JTEA 2M9UA 4LDWA 4F04B 1VQOQ 1ARKA 2YHTA 1BIBA 1UGVA 2MF2A 2NLUA 1UGPB 4DA4A 2W2HA 5LJ5h 2QDLA 2BZXA 2UZBB 5C0MA 1RI9A 2SRCA 1PNJA 5IHKA 2JMCA 3M0SA 2X3XD 2YXYA 4C92B 1O9SA 1WJQA 1NEBA 3S3OA 1VQ7T 2IW8B 3CCSQ 1JBMA 1G3WA 1YITT 1ZHIA 1BKBA 2LRQA 4BDZA 4M7AG 2HBPA 2QYZA 2LW4A 3VUZA 3CCSA 2RK1A 2G9XB 2DEUA 4JZ3A 4Z8AA 3SWNA 2JUFA 5DLOA 1M1KR 1OKVB 4OMNA 4M7AD 2RHYA 3M5AA 5KYUA 4RCBA 2LCLA 1E6GA 2YWWA 2W99A 2CSIA 4OB2B 4JPBW 1WGSA 1TFBA 1NJIC 2K2VA 2COYA 1M3BA 3JB9H 1JXMA 2RI5A 1EFNA 3CCLA 4F6SB 4PJNA 8AT1B 4QKUA 2AT1B 4I3ZB 2LDMA 2DTIA 3LWHA 2FZCB 3AHUA 3OBYA 3JCMh 4F7SB 1OI1A 4RTTA 1YJNA 5KYXA 5LQFB 5IF1B 1YI2T 1PD1A 1VQ9A 2ENMA 1VQPT 4CFWB 4N0AA 2BKZB 5FWBA 1OIUB 2DD4B 1VQKQ 2PU9B 5LJ3g 1T0HA 3GNGA 3M9QA 4PL6A 5I2MA 1WHMA 3GP8A 1AZEA 1VA7A 3MY5B 3G7ZA 1NEGA 1W4SA 3I55Q 4PFZA 3CMEQ 1D3UB 2IG0A 4BCOB 4PJLA 1YHQQ 3TREA 3VYGA 5HBJB 4C8QC 2IN3A 2DIQA 3IQLA 2OTJQ 3OB9A 3I5SA 3QIIA 1M8MA 2K57A 4OP0A 2LQNA 3PMTA 1MMAA 4GBQA 1XJWB 1AWXA 1JSUB 2K6DA 3OYHA 4D8KA 5KCHA 1Z9ZA 4LDVA 3OYNA 1QCOA 1N27A 4DBRA 1M90R 2R5AA 1U1TA 1VQMQ 5LJ3e 2R58A 1WHGA 3HFOA 2GFAA 3RKWA 1VUBA 2DAQA 4PKCC 4GLKA 2AIRB 3CCRT 1W98B 4IURA 2PTKA 1V1CA 5GAOp 2CUDA 2EQUA 3RMQA 2ZZDB 3GBQA 4PLLA 3MJXA 1D0YA 2CSQA 2RI2A 4C92D 3QXEB 4IUVA 2X1NB 1C1AA 3OW2P 2EGAA 3A98A 2ZPEB 1XOVA 1I07A 4C5EA 2WJ9A 4A63B 1IGQA 2KSSA 4CFNB 1VYVA 2JM9A 2EGEA 2RN8A 4IIMA 3SWNB 3MP1A 4BCNB 3P8DA 2DL4A 2JJ9A 2DMEA 2ROTA 3CC7Q 1NPPA 2CKKA 3FJPA 3M0QA 4B9WA 2AHJB 3H6ZA 2L8DA 1WXUA 1LPLA 1M2VA 3BHUB 3L2WA 2KXCA 2K5LA 2VKNA 3I56T 1KD1U 4F14A 2LT1A 2LNVA 1M5Q1 1U8RA 4EDUA 1ZSGA 5FRMA 1JKWA 2H8HA 3VYGB 4C8QG 4A4FA 3X24B 4M75E 1I1JA 1KQ1A 4PJOD 1K8AU 3I35A 2WSCE 2W9ZA 4C5HA 2I40B 3EHRA 3FC3A 1YJNT 1KK7A 3TSZA 3DB3A 3MEWA 1PKTA 3V8LA 4LUDA 2CP7A 1VQLT 1GFCA 3VS3A 2ZPBB 3HHTB 4PFPA 2KAFA 2LQKA 4KBMB 1M2OA 1H1PB 4M7DE 5KYWB 1WFWA 4KGZB 4M7DG 4J9FA 2AKKA 3B57A 3PNWC 2YUOA 1UDLA 1SHGA 3M4GA 1WQWA 1Y96A 3NTIA 1RADB 1E9HB 3HKSA 1D1AA 1TUCA 5IXFA 3CBPA 3TSWA 3MPUB 3BG5A 4EOLB 1M30A 4JRKA 5LJ5d 2JT4A 3AT1B 5A0LA 2P4RA 2WMBB 4MMLA 3CMET 2RNAA 1K73R 2KE9A 5I21A 2DTHA 2CH4W 4J9CA 1RL2A 1H1SB 2W9FA 2M1HA 5IDNB 2ECZA 1JJ2A 4J6YA 2XD0A 2DD5B 1B34A 2QQAA 1QVGS 5IDPB 1BB9A 3M59A 1OU8A 1RI0A 4YC3B 5L2WB 1UE9A 2GGRA 2A7YA 1VQ6T 2QI2A 3G4ST 4J9BA 1OQKA 3OYKA 3L2QA 1OX9A 1C9BA 2DPPB 4M78F 1YNZA 2HDAA 1UJYA 4BB7A 4F6WB 2L3PA 4WTOB 2BKDN 4DBFA 5HCKA 1Q82R 1MUZA 4X1VA 3A8HB 1K0SA 1OV3A 4R0KA 3X28B 3DDQB 3CXCP 1FX7A 1FVVB 4GLMA 3S3NA 4EORB 3NHNA 1UNGD 1K8AR 1WA7A 3FDRA 5GAOq 4LUEA 1X01A 2LX9A 3I5RA 2F1LA 1X6BA 3BE3A 3C4SA 3BDUA 5I2SA 4E7LA 3V7RA 1YHQT 1NBEB 3KUFA 4IUPA 1JJ2P 1OU9A 6AT1B 4C8QA 2BZYA 1W2BS 1GUXA 4OR5B 3EH2A 4J9IA 4JX5A 5CIUA 1G5VA 2NUTA 3VJPA 1D3BA 2W96A 3H8ZA 1UUEA 3JB9D 1LOJA 1NPRA 1HJDA 3JCMQ 4Y72B 4OB1B 1K4US 1URCB 2RQUA 2VWFA 2O01E 1KC8U 2PUOB 1MGQA 4NS5A 1GH6B 1FMWA 1M8VA 4N4IA 4QQDA 2FHDA 3QG1A 3MHXA 4J7IA 4DOWA 4M7DA 2WMAB 2MCNA 4QVZA 2FVUA 3CC4Q 2FRWA 2PNIA 4ZGDB 3CXCA 2DMOA 1YJWT 2YT6A 4QW2A 1GCPA 1OZ3A 2JZ2A 2FG0A 1UFFA 5LJ3j 1YJWA 1QKXA 2WIHB 5IXBA 1LVKA 2KK4A 2C5XB 2DK3A 2FPFA 4A4HA 2A3LA 1YJ9T 4M75A 4A54A 2EUFA 9ATCB 1AISB 2VXEA 1EX4A 2CP3A 2MWOA 3R6NA 3C94A 1VQ6A 4F7NB 4TVRA 1Q82U 4RTXA 4M77E 1FMVA 4YTLA 5FLXE 5A0DA 4A53A 5LJ5e 2LJ1A 3CCVA 1DJ7B 2B8AA 2QQ8A 5EG2A 3JCMJ 2RA2A 3CD6T 4AFZC 1R8OB 3QZ9B 4ROEA 3C95A 3RDVA 3ZFJA 4PJOC 4O6JA 2RB6A 3H0HA 4XTXA 1TWBA 3EGDA 1E6HA 4IIOA 4J7FA 4OF1A 4CC7A 2XKOC 2HMAA 2EJGA 4JRQA 2IVWA 3HPWA 2O9SA 1YP5A 4JDSA 2HAXA 1WHLA 3CD6Q 1QCFA 3EGXB 4MDWA 1QVGP 4P5NA 2LC4A 4BI4A 1JB0E 2D0QB 1W2BA 1KSWA 4M4ZA 4NL2A 2LNHB 1YJNQ 3JSCA 3RIRA 4EMGA 4LDXA 5DQVA 3BHTB 2DF6A 1M1KC 1WQ7A 4RKUE 4F7UF 2L2PA 1IRXA 2J7IA 3CCLQ 2RMOA 2GNCA 1ZUUA 4M78E 2L3SA 3J80E 1W70A 1N5ZA 4ZTJA 2J6FA 1BBZA 2XDPA 3G6EA 1ZUKA 2PQWA 4HCBA 2HL3A 3EAEA 5HBEB 1K76A 1MMGA 4DOVA 1H92A 1OPLA 4M7AC 1QP3A 2O2OA 2EQJA 3JRZA 5GJVB 4NL3A 2A28A 2E70A 4PNOA 2COWA 4HNUA 3VUBA 5EFQB 4F6UB 4KGXB 4OMPA 4PFOA 4C0GA 3EJ1B 5IT9E 1QLYA 3CPWA 1VQLA 1VQ5Q 5CQXA 1YHQA 2RD1A 3OYLA 2E12A 2QGSA 3DDPB 2RO0A 4BCMD 4ZN3A 5GMKj 1QVFA 1IGUA 2QQ9A 1AWJA 1BCOA 3C12A 3QJ6A 2P0QA 2OTLQ 3L1AA 2ATCB 2D8HA 1YJ9Q 4BCPB 4C8QF 1Q7YR 3EFOB 2RPNA 4DEXA 4MDXA 2VUBA 5FU7B 2R5MA 2GTOA 4C92E 5GMKi 2KYMA 2FZGB 2YSQA 3HFNA 5GANf 4KT0E 2QK0A 1G3TA 2M02A 2LVMA 2LQWA 4M77B 4J6WA 2KRSA 4HKEA 3BY7A 3UA7A 2KMGA 5LMKB 1I0CA 1SSHA 2KT8A 3CC2Q 2E1HA 2KR6A 3JCMc 3CD6A 4IKFA 2NWMA 5GAN7 2DL5A 5FU6C 1M1GA 4AFUC 1H1RB 2I53A 3MEVA 1VIFA 2L89A 3E9GA 1VQPQ 1OPKA 2RHXA 4QSHA 1GXIE 1KG1A 1Y71A 3KFVA 3L2VA 3TVTA 2EYQA 1UEBA 1X6OA 4M75D 3UWNA 1VQMA 1AEYA 3QYEA 3M0UA 4BY7X 1R77A 3MY1B 2Y4YA 2DYBA 2EYYA 4FT2A 2PVDB 2E10A 2RJDA 4TTHA 4D8DA 2DRKA 1RLQC 1UG1A 4F17A 3VS5A 3OYJA 3UA6A 5KE2A 3EFOA 2FZKB 1NLOC 1K9MR 3CCLT 1O9KA 1CKAA 4M7DD 2DVJA 3F70A 5IN1A 3LW5E 1WIEA 1ABQA 5GANh 3CCQA 1FINB 1KQSA 1WDXA 1I5LA 4LXCA 1YCYA 2MAMA 1WI7A 1BU1A 2J6KA 4CFMB 1QLBA 4IUUA 1VINA 4YOOA 2HQXA 1SEMA 4M77A 4LD9K 1RACB 1S72T 2O31A 3GLXA 4KUDK 2LQ8A 3OBWA 1FYNA 2ZPGB 5GAMd 2YRCA 1D1BA 1W1FA 3EG1A 3CCRQ 1K0XA 5FU6B 3C0CA 3VS1A 3VU3C 3LGFA 2KRNA 4E7SA 3VRZA 2CJMB 1Q81U 1W6XA 3KXTA 1ZBXA 1U5SA 3RR6A 4RUGA 1D09B 5GMKe 3SFMA 4C92C 1BI3A 3LLRA 3CCUT 1O75A 2EWNA 4AKHA 4XTWA 1X75C 4XAXB 3SB2A 5CKDA 1GBQA 1RAFB 2V8JA 2QGFB 4HVUA 1NJIR 3L2RA 2YUPA 1D3BB 1VOMA 4KRDB 2DBMA 1H4LD 4XTUA 4ESRA 3CMAQ 3G6ET 2MK5A 3PO3S 2PK9B 2G77A 4ATOA 1PRLC 4NOYA 1B7TA 3VRYA 3L42A 4M7AB 2VASA 1HXDA 5EC7A 4EOSB 1JXOA 3LH0A 3Q1JA 3TNIB 2R57A 1QVFS 4BE1A 4A4EA 1Y7XA 2DD4A 3GF5A 2QASA 1F1BB 4EONB 4YOZA 4OMLA 4FL6A 2QQSA 1H3ZA 3H0FA 4FU6A 5CKBA 1XQHA 3VS2A 1PD0A 2QFZA 2P0PA 4M75B 3V8JA 5ACBA 2E64A 5GMKl 3QYBA 5FU7C 5M9OA 4MZTA 2BPMB 5LJ5g 1FWZA 2J6OA 2YRDA 3SHWA 4FSXA 3LX7A 1N9SA 1VQNA 2YUNA 3I9QA 3JB9F 2LCSA 3CBMA 2X51A 2DXCB 3MEAA 2Y90A 4L5GA 1KC8R 2OTJT 3D7SB 4EIKA 1VQLQ 3M53A 4O5VA 2HCKA 2SEMA 1D1CA 3VV0A 1UGQB 3PE0A 1G2BA 1XTDA 3L2UA 2MOXA 2VV5A 4ORZA 2QTVA 2QAZA 2HBWA 2RK2A 2MPXC 1T0JA 2D8JA 3A1PA 1VQ8T 5CEIB 3HB9A 5GAN8 2C5NB 1HSQA 5HQ0B 4LNPA 1SPKA 4HT8A 1WXBA 5KYYB 3DTOA 1G3SA 4XTVA 3CQTA 1G83A 1BI0A 8ATCB 4J9EA 1H1QB 1KQSS 1KXUA 1Y96B 4AFQC 1MHNA 4IUQA 1OL1B 1VYUA 1VQ8A 2RHUA 4ELZC 3CMEA 1WPYA 3FEOA 2PUKB 3RESA 2WHBB 5GAMg 2XU8A 3ME9A 5CAIA 3PIPA 3I55T 2C4GB 2RJEA 4E7KA 3GIBA 2X4JA 3G4SQ 3BLQB 1Q95G 2F2CA 1FXXA 5GANg 1PKDB 3CCMT 1HD3A 1ZSZB 3MO8A 3U23A 1K9AA 5CKHA 1M27C 1S72A 2DILA 5A0GA 1VQ4Q 4M7AE 1AVZC 3EG9A 2F2VA 3FB9A 3PT9A 4JUVA 2JGZB 2E3HA 4Q5WA 5AT1B 4M78D 3CXCS 5GANe 3CC4A 3J81E 3X25B 4ME7A 2LP5A 3HSBA 2UZLB 1D0XA 3QPHA 4KH1B 4BCFB 4M77G 3SEMA 3G33B 2P4TA 4Y91A 1ZSZA 3OYCA 2RHZA 1RAHB 5LL6S 3OW2A 3LGLA 1U06A 4HVWA 3PIOA 3PTAA 4LD6A 1BYMA 4RTUA 4EPCA 1IO6A 3QUIA 4X9CA 4C5IA 1Q86R 4J9DA 5CO7A 3A8GB 2K3XA 2O4XA 2GCXA 3TEEA 3CCVT 1QQJA 1K1ZA 4BY1X 1X27A 2K9GA 3HP9A 2DD5A 1UHCA 1C0MA 1PCXA 4XTZA 1N6AA 1M3CA 3VKHA 2A0FB 4EMKB 3VS0A 3HRTA 5KE3A 4MIMA 2DA9A 4JJCA 5LJ3d 1YI2A 2DETA 3VS6A 4JRPA 3RGFB 4BCJB 1H28B 4FYWB 5KH6A 3MCAB 2B9RA 3POMA 2FPEA 2CYZB 2PJQA 1GCQA 4FT4A 3WXMB 4R55A 3NTKA 5CYIB 1XO2A 4ZN1A 1LCKA 3OW2S 3CCJA 5L8RE 3GOXA 4IUTA 4M75C 1WLPB 3OS2A 4CRLB 4LN2A 3H9NA 5J26A 5GMKh 3JCMb 3JCMX 5HKCA 4HLQA 4EOMB 1QMCA 3CCEQ 3F5XB 1N9RA 4QVDA 1Q7YU 3CCQT 2O9VA 2A36A 1PHTA 1HYOA 1WJSA 2E41A 2K7AA 5GJWB 2RM4A 2YLBA 1TUGB 1CKBA 2M51A 4BBRM 4M78C 1D0ZA 2V26A 2KI7A 3P8BB 2WEVB 3J7AF 2CZ7B 4BDYA 2EIFA 4LE9A 1Q81C 1SRMA 1EIFA 1Z9QA 2HKQB 5AYFA 1G8XA 2KR3A 4B6MA 1VQMT 4AG2C 5LJ5j 2DEQA 4XU2A 4BCHB 2CP6A 1VQOT 2D1XA 3R6OA 2KVQG 5KCOA 2ED0A 2QXFA 2QEXA 1K8AC 4M7DF 2GTJA 4C5GA 2NUZA 2QA4Q 1QW1A 2DRMA 4PJOE 2DM1A 3M03A 4EOJB 4OGRB 2DE0X 2IIMA 4PJOA 3KBGA 1H8KA 2ZAEA 5GMKm 2BUDA 4JRIA 3M4YA 1X69A 4RTVA 5DM7R 2VYTA 4KRCB 1JOWA 1H26B 3ZBDA 2DXTA 4JS4A 1YITA 1QKWA 1WHKA 3NFCA 1IHVA 3UATA 1RAGB 2V1RA 1YN8A 2E3IA 3OYBA 2L0AA 1SHFA 1KQ2A 2DKGA 2D0NA 4M78B 4FIBA 3QJYA 3CPWS 4E47A 4OMMA 4OGEA 3EG3A 4JJNK 2QA4A 2MI6A 1NG2A 3CEYA 4FM4B 3JCMd 1MV0B 3QWYA 4ANJA 2H3JA 3PFSA 4HA8A 3M0RA 2NUTB 3REAB 3EGXA 3BG9A 4AKGA 4BI8B 2CT3A 1EZZB 2EJFA 1GY3B 1NYFA 2EBPA 2ZGWA 2GF7A 4YOSA 4C8QD 1YI2Q 2HNIA 5IH2A 3OYIA 1KC8C 4FCYA 2LJ0A 2ZCFB 4C92F 2XG8D 3QBYA 1B34B 1GRIA 4BE0A 2RH2A 2DXCA 3EG9B 2KRMA 1NE8A 4KRTA 1WHHA 1XNIA 2IW6B 1TXQA 3T9NA 1QVGA 4E6RA 4XTYA 3JCMe 1JJ2S 4K11A 5HNBB 2BS4A 1OZ2A 2DJZA 2C6TB 2VGMA 3G71A 2HSPA 3BG3A 2K3BA 2RQWA 2IW9B 2KXDA 1PSFA 3MP8A 2KQWA 3OYFA 4EMKC 5FROA 1YIJT 2RQTA 5D6YA 2GQVA 1AOJA 2DLPA 3A5ZB 4C92G 1ZP2A 2WSEE 4BCND 4BCIB 1ZA1B 4BBSM 2CZ1B 2QG9B 1QWFA 5EJCA 3WVDB 1TTHB 3SWNC 2O88A 2LMJA 3CCVQ 5HBHB 3EH1A 3RERA 1QCNA 2DXBA 2P0KA 4BXXX 4BCQB 1FMKA 4AI6A 1VQKA 3QZ5B 4D6WA 2KNBB 1Y07A 5LJ3f 1O9KB 2C0TA 4WCIA 3QDFA 1RLPC 4ZGJB 2X3WD 3URGA 3HL8A 4MFDA 2OI3A 3H41A 4KH0B 2OAWA 1YCSB 3M54A 1M90U 4PK4A 2JXBA 2QEXQ 1R0CB 2J05A 3BFMA 3VKGA 1JQQA 2CP0A 1AWOA 3JB9G 3VS4A 3CCST 4HCKA 4Z02A 1TUDA 4M77F 1Q86U 2EKOA 1OL2B 1PKSA 3L2ZA 2BS3A 2CZ0B 3NDQA 2K4YA 2RJCA 3H4CA 2VXFA 3UT1A 5D7UA 2HZYA 3HTRA 3UDCA 4Z6YA 1VQ5A 1RAEB 4Z88A 1UECA 2EYXA 3JCMf 1K73C 4UN0A 1YITQ 3EG2A 3MIAB 1TOVA 1VQ7Q 4EOOB 4JZ4A 4XU0A 1R0BG 2E6NA 4M77D 4E7HA 4XQ3A 2ESWA 4XU3A 3OY9A 3EFRA 4J6XA 2ROLA 4II1A 4QT7A 4G6LB 5KYUB 2CCHB 1WYXA 1OGUB 4EMHA 5GAOl 1ACMB 1AD5A 3HRSA 1M4ZA 2COZA 5GANj 3RUXA 1I4K1 1QMZB 2CGHA 1SKUB 1GBRA 4HT9A 2X35A 2IPOB 4X9DA 2KROA 2I2LA 1OIYB 2D9TA 2DYIA 4VUBA 3ZL7C 3JB9J 5ICPB 2QGGA 2E6ZA 3OYGA 3EIDB 3OS5A 2F5TX 3DLMA 1IXDA 2WIPB 2WACA 1M9SA 2KEAA 5HK3A 4N0AC 3HO8A 2EFIA 1HK9A 5HVYB 3OMCA 4EC8B 4C92A 2ZZDA 1PRMC 2KGTA 1M1KU 2Z0WA 2HQEA 5IHIA 5KYWA 1PWTA 4Y28E 2GBQA 1VQOA 3BLRB 1KHIA 4FSSA 3S3MA 4JX6A 3O8VA 1C6VX 2DERA 5GAOr 1VQKT 2JS0A 2J06A 3RKYA 4EOQB 3CCMQ 4ROCA 1H24B 1UJ0A 4KGVB 1IZ6A 2WSFE 2QDYB 4E7JA 4KUIA 3CCEA 4QQ6A 4A4KA 4F7JB 4OB3B 4FYYB 2DJQA 4GY5A 5KYYA 4ZNXA 2K79A 1NYGA 2LCCA 1PG5B 1G3NC 2BTTA 5D6WA 2XI9A 5I5ZB 5J3BA 1UNLD 2M0YA 1S72Q 4HNVA 1ZLMA 5GAN2 5HK0A 2MYSA 4JLIA 4J9GA 1ABOA 2VVKA 4FW1A 2F69A 1AWWA 2R7GA 3LYIA 3G4SA 4F7UB 2RF0A 3M57A 2HQHA 2JS2A 4RTYA 3CC7A 1G3YA 1VIEA 2YDLA 1JSTB 2G3RA 2LTOA 5HY6A 2C0OA 3I56A 1VQNT 3VKIA 1AHJB 1OKWB 4HXJA 1B3QA 4L6V5 3QO3A 4M6VA 2NUPA 4F7UG 4DQ2A 3QDRB 2B86A 2MIOA 3M0TA 2E5QA 2EKHA 1M3AA 2JOYA 4C8QB 1SF9A 1BU2A 2V8KA 2UUEB 4ZGEB 1V29B 1NLPC 1QP2A 2UZDB 4PJOG 4J8OA 3OYEA 5FRNA 2CS7A 1UNHD 4BCQD 2KT1A 1VQ6Q 1JEGA 1QWEA 3REBB 4OMQA 5L23A 1LJOA 3FLGA 4JJDA 5GAOn 1KIKA 3M58A 3DLLA 4PLIA 2OJ2A 3CCQQ 5DQWA 3EOCB 2HL5C 4Y92A 3O0GD 2JW4A 4PJOB 5FW9A 1VQPA 4M7AF 1IREB 2G6FX 2EQIA 1BIAA 1ZQ1A 3EHQA 1QVFP 4ELLA 2C5OB 2FYKA 3JAME 4RMOA 1OX8A 1K73U 2K5FA 1GL5A 2AKLA 4M75G 1JO8A 3PVQA 1PM3A 1H27B 5A2QE 2EGCA 2FRYA 1GUXB 2KDSA 3TN8B 2XK0A 4J5YA 3NTHA 1PSEA 4AG1C 4BUGA 4LDUA 4MZPA 1M1FA 1NZ9A 3V8KA 2OX7A 4QQGA 4M78G 4CXAB 4UC4A 2DNUA 1KD1C 3G71Q 1U1SA 3QWLA 2WPAB 4JLGA 1VYTA 3META 2ED1A 3CCMA 4QVCA 1MMNA 1YIJA 1VQ9Q 3JCMW 4OGCA 3KHIA 2ZPFB 2X4WA 3I55A 4R56A 3OYYA 4RG2A 1F5QB 4JS5A 2HKNA 2XDBA 3WVEB 4EOIB 2EW3A 3LH5A 3S6WA 3QYGB 3GNFB 1YFNA 3RMSA 1ZUYA 1WJRA 1YBYA 1J3TA 4E7ZA 4M7DB 2L3RA 1ENWA 2VGNA 4F7UA 1AZGB 2MWPA 1GFDA 5LJ3h 3OSSC 1ZBJA 3INZA 5DLQE 1JRIA 4DBQA 3E1SA 4LOCA 2XHCA
chains in the Genus database with same CATH topology
4PJOE 4BACA 3A8MB 2LDMA 2M16A 2DTIA 3HFNA 3DL1A 3LWHA 3AHUA 5GANf 4KT0E 3HBLA 3OBYA 1G3TA 3JCMh 2GFUA 2LVMA 3RUXA 1OI1A 4PJOA 3KBGA 5GAMj 1YJNA 1OYXA 1VQ9A 2RHIA 5GMKm 2BUDA 4JRIA 3M4YA 1YI2T 4M77B 1VQPT 4N0AA 4J6WA 4HKEA 3BY7A 2KMGA 5DM7R 2VYTA 2E1HA 2KR6A 2QQBA 2DD4B 3JCMc 3ZBDA 3CD6A 4IKFA 3SDZA 2PU9B 2DXTA 5LJ3g 5GAN7 2VC8A 5GAN5 4JS4A 3GNGA 3M9QA 1YITA 5FU6C 1M1GA 4PL6A 3NFCA 3X26B 3MEVA 5I2MA 4C0DC 3GP8A 1Q82C 1VIFA 2L89A 3E9GA 3G7ZA 5GAMe 3OYBA 2RHXA 1W4SA 4QSHA 1GXIE 1KG1A 4HNTA 1Y71A 3L2VA 2XIDA 1KQ2A 2DKGA 4BI3A 2IG0A 4FIBA 3QJYA 4M78B 3G71T 4E47A 3CPWS 2EYQA 1UEBA 4OGEA 4JJNK 3TREA 1X6OA 2MI6A 4M75D 3VYGA 2QA4A 3UWNA 2DIQA 2RJFA 2YRVA 3BDLA 3QYEA 4C8QC 1VQMA 3CEYA 4FM4B 3JCMd 1VQ9T 2Y4YA 4FT2A 2PVDB 2E10A 2RJDA 3OB9A 2JNGA 1M90C 2H3JA 3QIIA 3PFSA 2K57A 2DTOA 4HA8A 5CR2A 4OP0A 3BG9A 4AKGA 3PMTA 4BI8B 3OYJA 3QSUA 4AKIA 5KE2A 3EFSA 2EJFA 5GAMh 2OAUA 2ZGWA 2GF7A 3OYHA 4C8QD 5KCHA 4LDVA 3OYNA 2HNIA 3CCLT 1N27A 1UGSB 3OYIA 4M7DD 2R5AA 3F70A 1KC8C 2ZCFB 1U1TA 5IN1A 4C92F 3LW5E 4KULA 5LJ3e 2XG8D 3OMGA 2R58A 3QBYA 1UB4A 2BIVA 1B34B 4M75F 4NC6A 4PJOF 5GANh 3CCQA 3CC4T 4BE0A 1KQSA 1I5LA 2RH2A 1YCYA 3HFOA 2GFAA 2MAMA 2DXBB 3RKWA 2DXCA 1VUBA 2EAYA 2DAQA 1I8FA 4PKCC 3A8LB 1NE8A 4WF2A 2F5KA 1QLBA 1XNIA 4GLKA 3T9NA 1QVGA 4IUUA 2HQXA 3CCRT 4M77A 4XTYA 4IURA 3JCMe 1JJ2S 4LD9K 2BS4A 5GAOp 1OZ2A 2DJZA 2EQUA 3RMQA 2VGMA 2ZZDB 3G71A 4PLLA 3BG3A 1S72T 3GLXA 4KUDK 4A4GA 1P92A 2HAXA 3BW1A 1PSFA 4N4GA 2EQKA 3MP8A 2KQWA 2LQ8A 2RI2A 2ZPGB 3OBWA 4C92D 4EMKC 5GAMd 3OYFA 3QXEB 5FROA 1YIJT 1VQ4A 4IUVA 2EJ9A 5D6YA 2GQVA 2ZPEB 1XOVA 3A5ZB 4C92G 5FU6B 3QYHB 2WSEE 2EQMA 3VU3C 5GAN6 4BBSM 4C5EA 3G4SA 2CZ1B 3E9FA 4C0DB 1E7PA 1KHCA 4F7UE 5EJCA 3LGFA 2WJ9A 3WVDB 3SWNC 4HCCA 1Q81U 2KSSA 5DY9A 3KXTA 3OA6A 1ZBXA 3RERA 2C06A 2DXBA 4CRIA 2P0KA 4BE2A 5GMKe 3SFMA 3SWNB 4C92C 4AI6A 3MP1A 3CC2A 1BI3A 1VQKA 3P8DA 3LLRA 3CCUT 3QZ5B 1O75A 2EWNA 5CVIA 1N8RU 4AKHA 1NPPA 1X75C 2CKKA 3FJPA 4XAXB 4XTWA 3SB2A 2AHJB 3H6ZA 2L8DA 3OSVA 4B9WA 1Y07A 4MZMA 4D6WA 5CKDA 1TH7A 5LJ3f 5GAMf 1VQ4T 5LJ5f 3L2WA 2K5LA 2V8JA 3I56T 3L2RA 1KD1U 4ZGJB 2LT1A 2LNVA 1M5Q1 3URGA 1D3BB 1U8RA 4EDUA 4J83A 3HL8A 5FRMA 4MFDA 3VYGB 4C8QG 4A4FA 2QQRA 4XTUA 3X24B 3OYDA 4M75E 3CBOA 1KQ1A 3M54A 1BI2A 3G6ET 1K8AU 1M90U 4PJOD 2WSCE 3VYHB 1K9MU 2G77A 4ATOA 4C5HA 2QDJA 4MFEA 3FC3A 2QTXA 1YJNT 4NOYA 3BFMA 3VKGA 1WNLA 4RCCA 2DZCA 3DB3A 3L42A 3MEWA 4M7AB 3JB9G 3CCST 1HXDA 3V8LA 4Z02A 3TW7A 4M77F 1Q86U 2EKOA 1VQLT 2ZPBB 3LH0A 1K9MC 3Q1JA 3L2ZA 2BS3A 2CZ0B 3HHTB 4OB0B 2KAFA 2LQKA 2K4YA 3N5BB 4B9XA 4KBMB 2R57A 2XDDA 2RJCA 4M7DE 3H4CA 2VXFA 1QVFS 2V8IA 4BE1A 3UT1A 5CCAA 4M7DG 4A4EA 1Y7XA 3OQ5A 2DD4A 3PNWC 3GF5A 3MEUA 3TCJA 3M4GA 1WQWA 4FL6A 3UDCA 4Z6YA 1VQ5A 1Y96A 2QQSA 3CC7T 3NTIA 3HKSA 1H3ZA 3JCMf 4FU6A 1K73C 3CBPA 1XQHA 5CKBA 4M7DC 3BG5A 2QFZA 2P0PA 1H641 3FIFA 4JRKA 4M75B 3V8JA 5LJ5d 2QA4T 4XU0A 2E64A 2E6NA 4M77D 5GMKl 3ASKA 5A0LA 3QYBA 4E7HA 5FU7C 4XQ3A 4MMLA 3CMET 4XU3A 5M9OA 3OY9A 3EFRA 4MZTA 4J6XA 4II1A 5LJ5g 1FWZA 2DTHA 5I21A 2E65A 1RL2A 2M1HA 4FSXA 4EMHA 5GAOl 1N9SA 3LX7A 1VQ7A 1VQNA 3HRSA 1M4ZA 1JJ2A 4J6YA 2XD0A 5GANj 3CBMA 2DD5B 2DXCB 4HL4A 2LT4A 1VQOA 3JB9F 2O4XB 1B34A 1I4K1 2CGHA 2QQAA 2X4YA 3MEAA 2Y90A 3P8HA 3M59A 4L5GA 1QVGS 1RI0A 2X35A 4HT9A 2OTJT 2QF7A 3M53A 4X9DA 5CKEA 2D9TA 2I2LA 4O5VA 4VUBA 2A7YA 2YLCA 3VV0A 3JB9J 1UGQB 1VQ6T 2E6ZA 2QI2A 3OYGA 3G4ST 1XTDA 3OYKA 3L2UA 2RI3A 2VV5A 3L2QA 3OS5A 4M78F 2DPPB 4JX4A 3A8OB 2F5TX 3DLMA 2RK2A 5GANd 4HCZA 2DZ9A 2WACA 2D6FA 4BB7A 1M9SA 2OTLA 3CMAT 5HK3A 2BKDN 1VQ8T 3HB9A 4N0AC 3HO8A 5GAN8 2EFIA 1YJ9A 1HK9A 3OMCA 4C92A 2ZZDA 3A8HB 5CKFA 4X34A 1FKMA 1M1KU 3X28B 4HT8A 1Q86C 2HQEA 1FX7A 1G3SA 4XTVA 1BI0A 4M78A 3RKXA 3S3NA 5CK9A 1KQSS 1Y96B 4Y28E 3ZEHA 5GAN4 1MHNA 4IUQA 5D6XA 1KHIA 3S3MA 1I81A 4JX6A 3FDRA 3SD4A 3O8VA 3JB9I 1VQ8A 4XU1A 4RG8A 5GAOq 5GAOr 1X01A 2RHUA 4ELYC 4ELZC 2LX9A 3CMEA 3CCUA 3TU4K 1WPYA 4XK8E 1VQKT 3TW6A 3RKYA 4M7DA 3PMIA 1SSFA 3C4SA 3FEOA 2PUKB 3BDUA 3RESA 5I2SA 5GAMg 4E7LA 2DO3A 3V7RA 1NJIU 2XU8A 1YHQT 3ME9A 3KUFA 1IZ6A 2WSFE 4IUPA 5CAIA 3PIPA 3I55T 3GPLA 2RJEA 2QDYB 4E7JA 4E7KA 4M7AA 4KUIA 3CCEA 3GIBA 4QQ6A 4C8QA 4A4KA 2X4JA 4OB3B 2JTFA 2ZPIB 2MMPA 3CPFA 4GY5A 4N4HA 1W2BS 4JX5A 5CIUA 1G5VA 2FL7A 3VJPA 1FXXA 5GANg 2BS2A 1D3BA 3CCMT 2LCCA 5CQYA 3H8ZA 5D6WA 2XI9A 4BY6C 3JB9D 1LOJA 1NPRA 3MO8A 3JCMQ 4E7IA 5J3BA 4OB1B 5CKHA 1S72A 5A0GA 2O01E 5GAN3 1QVPA 2KMTA 4OVAA 3HZJA 4HNVA 1KC8U 5GAN2 4M7AE 5HK0A 2PUOB 2JVVA 4JLIA 1MGQA 4NS5A 3FRNA 3UPUA 2F69A 1M8VA 3FB9A 3PT9A 4JUVA 4N4IA 4Q5WA 4QQDA 2L5QA 4M78D 2FHDA 3LYIA 3MHXA 3QG1A 3ER0A 3X20B 4J7IA 4DOWA 3M57A 3QHSA 4F7UB 3CXCS 4M77C 4QVZA 2JTMA 2DIGA 5GANe 1G3YA 2DVEA 2FVUA 3J81E 3CC7A 3CC4A 4ZGDB 3CXCA 1VIEA 1Q7YC 1YJWT 3CCJT 2G3RA 3X25B 4ME7A 4QW2A 1OZ3A 2LTOA 3HSBA 2JZ2A 3HRUA 2KY9A 2CZ6B 5HY6A 2HD0A 4BD3A 5LJ3j 3I56A 1N8RC 3JCMg 1AHJB 3VKIA 1VQNT 3QPHA 1YJWA 4M77G 4V2SA 2P4TA 4L6V5 3QO3A 4M6VA 1BI1A 4Y91A 2KK4A 4DQ2A 2DK3A 3QDRB 3PGGA 2A3LA 3M55A 4A4HA 2RHZA 4F7UG 3OYCA 4M75A 4A54A 3CMAA 4L59A 2OTLT 3LWIA 2E5QA 3OS1A 5LL6S 3OW2A 2VXEA 3LGLA 5IAYA 2MWOA 2JOYA 3PIOA 3PTAA 4LD6A 1BYMA 3C94A 4C8QB 1VQ6A 2V8KA 4TVRA 4ZGEB 1V29B 4EPCA 1Q82U 3QUIA 4X9CA 4C5IA 1VQ5T 4LDYA 1QP2A 4M77E 3OYAA 2OTJA 2Y4XA 5FRNA 4PJOG 4J8OA 3OYEA 2CS7A 5CO7A 2DXUA 3A8GB 4YTLA 3DKMA 3JCMV 5FLXE 3MP6A 5A0DA 3V7CA 4A53A 5LJ5e 2K3XA 2O4XA 2GCXA 3TEEA 3V7SA 3CCVA 3CCVT 3CCET 1LJOA 1DJ7B 3FLGA 4OMFB 5GAOn 2B8AA 2DD5A 1UGRB 3HP9A 2QQ8A 3JCMP 3M58A 4CI0C 3DLLA 5EG2A 3JCMJ 1LNXA 2RA2A 4XTZA 3CD6T 4PLIA 1N6AA 1R8OB 3QZ9B 3C95A 3ZFJA 4PJOC 3VKHA 2FB7A 4EMKB 3DB4A 4O6JA 3CC2T 2RB6A 2M0OA 2ZPHB 3QKJA 4BY6B 3HRTA 4XTXA 1YJ9T 4PJOB 5KE3A 4MIMA 3CCRA 4J7FA 1VQPA 4M7AF 5LJ3d 1YI2A 1IREB 2XICA 4OF1A 1BIAA 1ZQ1A 4JRPA 2XKOC 3M56A 2EJGA 2PVGB 2IVWA 3HPWA 2K5IA 4JDSA 2FYKA 2PVOB 3E19A 3MCAB 5KH6A 3JAME 4MDWA 4RMOA 1K73U 2JN0A 2K3YA 2K5FA 2CYZB 2LC4A 4P5NA 3WXMB 4FT4A 4BI4A 5GAOm 1JB0E 2X4XA 4C8QE 4R55A 2D0QB 3NTKA 4C0ZA 5J39A 1W2BA 4M75G 4MMKA 4ZTFA 3OYMA 4ELJA 4ZN1A 4NL2A 4JRQA 5A2QE 3OW2S 3JSCA 3RIRA 4C0FA 4EMKA 3CCJA 2QEXT 4EMGA 5L8RE 5C6SA 2KDSA 2XK0A 3GOXA 4IUTA 4LDXA 4J5YA 3NTHA 2M9UA 1PSEA 4LDWA 4M75C 1M1KC 1WQ7A 4RKUE 4F7UF 3OS2A 2YHTA 5J26A 4BUGA 5GMKh 4LDUA 1BIBA 2MF2A 4MZPA 2NLUA 3JCMX 5HKCA 3JCMb 4HLQA 1UGPB 1M1FA 4DA4A 1NZ9A 3V8KA 4M78E 3J80E 4QQGA 5LJ5h 4ZTJA 2XDPA 4M78G 5C0MA 3G6EA 1N9RA 2PQWA 4QVDA 4HCBA 4UC4A 1Q7YU 1KD1C 3EAEA 3CCQT 1U1SA 3QWLA 4C92B 1O9SA 1WJQA 4JLGA 4DOVA 1WJSA 2E41A 3META 2RM4A 2YLBA 4M7AC 3CCMA 3S3OA 1QP3A 2EQJA 4QVCA 3JRZA 4NL3A 1YIJA 3JCMW 4BBRM 2E70A 4M78C 1VQ7T 4PNOA 4HNUA 3VUBA 1JBMA 1G3WA 4OGCA 3KHIA 3P8BB 4C0GA 1YITT 5IT9E 2ZPFB 2CZ7B 3J7AF 4BDYA 2EIFA 2X4WA 3I55A 3CPWA 1Q81C 1ZHIA 1VQLA 1BKBA 2LRQA 3OYYA 1EIFA 5CQXA 4R56A 1YHQA 4RG2A 2RD1A 2HBPA 4BDZA 4M7AG 3OYLA 2E12A 3VUZA 3CCSA 2RK1A 2RO0A 4JS5A 2XDBA 3WVEB 5AYFA 3SWNA 2JUFA 4ZN3A 5GMKj 5DLOA 1QVFA 2QQ9A 3S6WA 3QYGB 3GNFB 4M7AD 3C12A 3QJ6A 1VQMT 3RMSA 2P0QA 5LJ5j 2DEQA 2RHYA 3M5AA 1WJRA 1YBYA 4RCBA 2LCLA 4XU2A 4M7DB 2L3RA 3L1AA 1VQOT 2VGNA 3R6OA 4F7UA 3OS0A 4OB2B 2MWPA 2KVQG 1WGSA 5LJ3h 5KCOA 4C8QF 2QXFA 3OSSC 1NJIC 2K2VA 2QEXA 1K8AC 3JB9H 2VUBA 3INZA 5FU7B 4M7DF 4MDXA 2RI5A 5DLQE 3CCLA 2R5MA 1JRIA 4C92E 4C5GA 5GMKi 3E1SA 4LOCA 2XHCA 1QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8M B;  3WVD B;  1DJ7 B;  4KT0 E;  2DXB A;  2DD5 A;  1UGR B;  3A8H B;  2ZZD A;  3X28 B;  3QZ5 B;  3QZ9 B;  2AHJ B;  2ZPH B;  4Y28 E;  1IRE B;  4ZGJ B;  2DD4 B;  2PVG B;  4XK8 E;  2PU9 B;  2PVO B;  3VYG B;  2CYZ B;  3X24 B;  1JB0 E;  2PUK B;  3X26 B;  2D0Q B;  2WSC E;  3VYH B;  2WSF E;  1GXI E;  2QDY B;  4OB3 B;  5L8R E;  2ZPI B;  3VYG A;  4FM4 B;  1PSE A;  2PVD B;  2ZPB B;  4RKU E;  3HHT B;  2CZ0 B;  4OB0 B;  4OB1 B;  1UGP B;  2O01 E;  2DD4 A;  2PUO B;  1UGS B;  2ZCF B;  3LW5 E;  3X20 B;  1QP3 A;  4ZGD B;  2DXB B;  2DXC A;  2ZPF B;  2CZ7 B;  3X25 B;  3A8L B;  2CZ6 B;  1AHJ B;  4L6V 5;  3WVE B;  2ZZD B;  3QYG B;  2DD5 B;  2DXC B;  1PSF A;  2ZPG B;  3QXE B;  4OB2 B;  1UGQ B;  4ZGE B;  1V29 B;  2ZPE B;  3QYH B;  2WSE E;  2DPP B;  1QP2 A;  3A8O B;  2CZ1 B;  3A8G B; 
#chains in the Genus database with same CATH topology
 4BAC A;  3A8M B;  2M16 A;  3DL1 A;  1RAA B;  3HBL A;  2NUP B;  2GFU A;  2CP2 A;  5GAM j;  2DX1 A;  2EPD A;  1H3H A;  4EOP B;  4II5 B;  2JM8 A;  1OYX A;  2RHI A;  3QHR B;  3LQ5 B;  2BE7 D;  1ZX6 A;  2QQB A;  3SDZ A;  5GAN 5;  2VC8 A;  2UZE B;  2DL7 A;  4ROD A;  3X26 B;  3CPW P;  4C0D C;  1Q82 C;  1UHF A;  1WZO A;  5GAM e;  2EVR A;  4HNT A;  3G1J A;  2XID A;  4EOK B;  2CRE A;  4BI3 A;  3G71 T;  2X9H A;  2E4H A;  3BLH B;  2RJF A;  2YRV A;  2L3Q A;  3BDL A;  1VQ9 T;  2E5K A;  2JNG A;  1M90 C;  2DTO A;  3RBB B;  5CR2 A;  3QSU A;  4AKI A;  3EFS A;  5GAM h;  1TD6 A;  2OAU A;  2WFY B;  4F70 B;  1KQS P;  1M2V B;  4Z89 A;  1UGS B;  2DL3 A;  3CCU Q;  1A0N B;  4CFV B;  4KUL A;  3OMG A;  2PZ1 A;  1UB4 A;  2BIV A;  4M75 F;  4PJO F;  4NC6 A;  3TU4 K;  4IMY B;  3CC4 T;  3DOG B;  2DXB B;  2ABL A;  2EAY A;  2BZ8 A;  1I8F A;  3A8L B;  4WF2 A;  2FO0 A;  2F5K A;  4CFU B;  5ECA A;  1W2B P;  3ULR B;  3JV3 A;  5KYX B;  4RTW A;  3H0I A;  4BCK B;  1KJW A;  2JMA A;  1N4M A;  4A4G A;  1P92 A;  1Q81 R;  1RAI B;  3BW1 A;  4N4G A;  4AT1 B;  2EQK A;  2FPD A;  2W0Z A;  1VQ4 A;  4RTZ A;  2EJ9 A;  1X6G A;  2AK5 A;  1JU5 C;  1T3L A;  3QYH B;  2EQM A;  5GAN 6;  3E9F A;  4C0D B;  1E7P A;  1KHC A;  4F7U E;  1YJW Q;  4HCC A;  4JJB A;  5DY9 A;  3OA6 A;  4J9H A;  3NGP A;  2C06 A;  4CRI A;  4BE2 A;  1U3O A;  3CC2 A;  1S1N A;  3NMZ C;  5CVI A;  4CC4 B;  1N8R U;  4AFS C;  1X2K A;  1KFZ A;  3OSV A;  4MZM A;  3TQ7 P;  1TH7 A;  5GAM f;  1VQ4 T;  5LJ5 f;  2PHG A;  2EYW A;  4J83 A;  2VB6 A;  1MNE A;  2QQR A;  3NPF A;  3OYD A;  1OI9 B;  2RQR A;  3CBO A;  1BI2 A;  1VQ8 Q;  2CCI B;  3VYH B;  3EGD B;  2V1Q A;  4FW2 A;  1YWP A;  1K9M U;  2QDJ A;  4MFE A;  2QTX A;  2NYS A;  2CT4 A;  1BK2 A;  3TNH B;  1WNL A;  4RCC A;  2DZC A;  4DBH A;  3TW7 A;  1WHJ A;  2FEI A;  1K9M C;  1TG0 A;  2LZ6 B;  4OB0 B;  4B9X A;  3N5B B;  2XDD A;  2LJ3 A;  2V8I A;  5CCA A;  3OQ5 A;  3EG0 A;  4BCM B;  3MEU A;  3TCJ A;  2IVX A;  2CUB A;  3CC7 T;  2KYB A;  2C0I A;  5KYN A;  1NM7 A;  4M7D C;  4AMC A;  1H64 1;  1OOT A;  3FIF A;  3MI9 B;  2QA4 T;  3ASK A;  3GTM S;  1VQN Q;  2AZS A;  1VOL A;  1GCQ C;  1X2Q A;  2E65 A;  2GQI A;  5I11 A;  1OUL A;  1VQ7 A;  2KBT A;  2EYZ A;  4EC9 B;  4CFX B;  4HL4 A;  4CFU D;  2LT4 A;  1AD6 A;  2O4X B;  1B07 A;  2X4Y A;  2LX7 A;  3P8H A;  3E2U A;  1H25 B;  2QF7 A;  4BCG B;  1Y0M A;  2I0N A;  4NST B;  5CKE A;  3UF4 A;  2YLC A;  5IHN A;  2RI3 A;  1MV3 A;  2YUQ A;  4JX4 A;  5I22 A;  3A8O B;  5GAN d;  4HCZ A;  2DZ9 A;  2D6F A;  2F2X A;  2OTL A;  3CMA T;  1WX6 A;  4OMO A;  1YJ9 A;  2BE9 B;  1IHW A;  4PJM A;  5CKF A;  4X34 A;  1FKM A;  3RNJ A;  1Q86 C;  4PJJ A;  3THK A;  4M78 A;  2WXV B;  3RKX A;  5CK9 A;  3ZEH A;  5GAN 4;  5D6X A;  1I81 A;  3SD4 A;  3JB9 I;  4XU1 A;  4RG8 A;  1Y57 A;  3CCU A;  4ELY C;  4XK8 E;  3TW6 A;  3CCJ Q;  3VS7 A;  2AZV A;  3PMI A;  1SSF A;  1SG5 A;  2DO3 A;  1NJI U;  1CSK A;  4F7L B;  3GPL A;  4M7A A;  1N8R R;  2JTF A;  2ZPI B;  2MMP A;  3CPF A;  4N4H A;  3G6E Q;  2CDT A;  2FL7 A;  1ZSZ C;  7AT1 B;  2BS2 A;  1P5E B;  4FYX B;  2F2W A;  5CQY A;  4DEY A;  1AT1 B;  4BY6 C;  2V22 B;  2CP5 A;  3K7A M;  3BHV B;  4E7I A;  3TNW B;  5GAN 3;  1QVP A;  2KMT A;  1PC0 A;  4OVA A;  3HZJ A;  2JVV A;  3FRN A;  3UPU A;  1UTI A;  2A08 A;  2L5Q A;  1WXT A;  2DBK A;  1TSF A;  3ER0 A;  3X20 B;  3QHS A;  1MND A;  4M77 C;  2JTM A;  2DIG A;  2DVE A;  2XMF A;  1Q7Y C;  1E7O A;  3CCJ T;  3MKD A;  1MMD A;  1I5O B;  3HRU A;  2KY9 A;  2CZ6 B;  4BD3 A;  2HD0 A;  4CC2 A;  1N8R C;  1YWO A;  3JCM g;  4FYV B;  4CC3 A;  1VYW B;  4V2S A;  1BI1 A;  3CCE T;  3PGG A;  3M55 A;  3CMA A;  3EGU A;  3FJ5 A;  4L59 A;  2OTL T;  3LWI A;  3OS1 A;  5IAY A;  3I56 Q;  1TU0 B;  5BNJ B;  1RUW A;  2CH4 A;  1VQ5 T;  4LDY A;  3OYA A;  2OTJ A;  2Y4X A;  1T3S A;  4E2F B;  2DXU A;  2K2M A;  4HVV A;  3DKM A;  3JCM V;  3MP6 A;  2C5V B;  3V7C A;  3M0P A;  3V7S A;  4F16 A;  4OMF B;  2H3E B;  5FWC A;  1UGR B;  3JCM P;  4CI0 C;  1LNX A;  2RQV A;  1TS9 A;  1IB8 A;  2FB7 A;  3DB4 A;  3QHW B;  2W10 A;  3CC2 T;  2M0O A;  2ZPH B;  4FX3 B;  2DL8 A;  3QKJ A;  2DFU A;  4BY6 B;  1BCM A;  1YIJ Q;  3CCR A;  2HEQ A;  2PK2 A;  3DJB A;  2XIC A;  1KD1 R;  3M56 A;  2PVG B;  2HSE B;  2K5I A;  1X43 A;  1RAB B;  2PVO B;  3E19 A;  5IHY A;  2JN0 A;  2K3Y A;  5GAO m;  3OS0 A;  2X4X A;  4C8Q E;  2A37 A;  4C0Z A;  5J39 A;  1ZA2 B;  4ZTF A;  3PVL A;  4MMK A;  3OYM A;  4ELJ A;  5FGK B;  1OEB A;  2P84 A;  4C0F A;  4EMK A;  2QEX T;  3QWX X;  1V76 A;  5C6S A;  3O5Z A;  2PMI B;  1SRL A;  2JTE A;  2M9U A;  4LDW A;  4F04 B;  1VQO Q;  1ARK A;  2YHT A;  1BIB A;  1UGV A;  2MF2 A;  2NLU A;  1UGP B;  4DA4 A;  2W2H A;  5LJ5 h;  2QDL A;  2BZX A;  2UZB B;  5C0M A;  1RI9 A;  2SRC A;  1PNJ A;  5IHK A;  2JMC A;  3M0S A;  2X3X D;  2YXY A;  4C92 B;  1O9S A;  1WJQ A;  1NEB A;  3S3O A;  1VQ7 T;  2IW8 B;  3CCS Q;  1JBM A;  1G3W A;  1YIT T;  1ZHI A;  1BKB A;  2LRQ A;  4BDZ A;  4M7A G;  2HBP A;  2QYZ A;  2LW4 A;  3VUZ A;  3CCS A;  2RK1 A;  2G9X B;  2DEU A;  4JZ3 A;  4Z8A A;  3SWN A;  2JUF A;  5DLO A;  1M1K R;  1OKV B;  4OMN A;  4M7A D;  2RHY A;  3M5A A;  5KYU A;  4RCB A;  2LCL A;  1E6G A;  2YWW A;  2W99 A;  2CSI A;  4OB2 B;  4JPB W;  1WGS A;  1TFB A;  1NJI C;  2K2V A;  2COY A;  1M3B A;  3JB9 H;  1JXM A;  2RI5 A;  1EFN A;  3CCL A;  4F6S B;  4PJN A;  8AT1 B;  4QKU A;  2AT1 B;  4I3Z B;  2LDM A;  2DTI A;  3LWH A;  2FZC B;  3AHU A;  3OBY A;  3JCM h;  4F7S B;  1OI1 A;  4RTT A;  1YJN A;  5KYX A;  5LQF B;  5IF1 B;  1YI2 T;  1PD1 A;  1VQ9 A;  2ENM A;  1VQP T;  4CFW B;  4N0A A;  2BKZ B;  5FWB A;  1OIU B;  2DD4 B;  1VQK Q;  2PU9 B;  5LJ3 g;  1T0H A;  3GNG A;  3M9Q A;  4PL6 A;  5I2M A;  1WHM A;  3GP8 A;  1AZE A;  1VA7 A;  3MY5 B;  3G7Z A;  1NEG A;  1W4S A;  3I55 Q;  4PFZ A;  3CME Q;  1D3U B;  2IG0 A;  4BCO B;  4PJL A;  1YHQ Q;  3TRE A;  3VYG A;  5HBJ B;  4C8Q C;  2IN3 A;  2DIQ A;  3IQL A;  2OTJ Q;  3OB9 A;  3I5S A;  3QII A;  1M8M A;  2K57 A;  4OP0 A;  2LQN A;  3PMT A;  1MMA A;  4GBQ A;  1XJW B;  1AWX A;  1JSU B;  2K6D A;  3OYH A;  4D8K A;  5KCH A;  1Z9Z A;  4LDV A;  3OYN A;  1QCO A;  1N27 A;  4DBR A;  1M90 R;  2R5A A;  1U1T A;  1VQM Q;  5LJ3 e;  2R58 A;  1WHG A;  3HFO A;  2GFA A;  3RKW A;  1VUB A;  2DAQ A;  4PKC C;  4GLK A;  2AIR B;  3CCR T;  1W98 B;  4IUR A;  2PTK A;  1V1C A;  5GAO p;  2CUD A;  2EQU A;  3RMQ A;  2ZZD B;  3GBQ A;  4PLL A;  3MJX A;  1D0Y A;  2CSQ A;  2RI2 A;  4C92 D;  3QXE B;  4IUV A;  2X1N B;  1C1A A;  3OW2 P;  2EGA A;  3A98 A;  2ZPE B;  1XOV A;  1I07 A;  4C5E A;  2WJ9 A;  4A63 B;  1IGQ A;  2KSS A;  4CFN B;  1VYV A;  2JM9 A;  2EGE A;  2RN8 A;  4IIM A;  3SWN B;  3MP1 A;  4BCN B;  3P8D A;  2DL4 A;  2JJ9 A;  2DME A;  2ROT A;  3CC7 Q;  1NPP A;  2CKK A;  3FJP A;  3M0Q A;  4B9W A;  2AHJ B;  3H6Z A;  2L8D A;  1WXU A;  1LPL A;  1M2V A;  3BHU B;  3L2W A;  2KXC A;  2K5L A;  2VKN A;  3I56 T;  1KD1 U;  4F14 A;  2LT1 A;  2LNV A;  1M5Q 1;  1U8R A;  4EDU A;  1ZSG A;  5FRM A;  1JKW A;  2H8H A;  3VYG B;  4C8Q G;  4A4F A;  3X24 B;  4M75 E;  1I1J A;  1KQ1 A;  4PJO D;  1K8A U;  3I35 A;  2WSC E;  2W9Z A;  4C5H A;  2I40 B;  3EHR A;  3FC3 A;  1YJN T;  1KK7 A;  3TSZ A;  3DB3 A;  3MEW A;  1PKT A;  3V8L A;  4LUD A;  2CP7 A;  1VQL T;  1GFC A;  3VS3 A;  2ZPB B;  3HHT B;  4PFP A;  2KAF A;  2LQK A;  4KBM B;  1M2O A;  1H1P B;  4M7D E;  5KYW B;  1WFW A;  4KGZ B;  4M7D G;  4J9F A;  2AKK A;  3B57 A;  3PNW C;  2YUO A;  1UDL A;  1SHG A;  3M4G A;  1WQW A;  1Y96 A;  3NTI A;  1RAD B;  1E9H B;  3HKS A;  1D1A A;  1TUC A;  5IXF A;  3CBP A;  3TSW A;  3MPU B;  3BG5 A;  4EOL B;  1M30 A;  4JRK A;  5LJ5 d;  2JT4 A;  3AT1 B;  5A0L A;  2P4R A;  2WMB B;  4MML A;  3CME T;  2RNA A;  1K73 R;  2KE9 A;  5I21 A;  2DTH A;  2CH4 W;  4J9C A;  1RL2 A;  1H1S B;  2W9F A;  2M1H A;  5IDN B;  2ECZ A;  1JJ2 A;  4J6Y A;  2XD0 A;  2DD5 B;  1B34 A;  2QQA A;  1QVG S;  5IDP B;  1BB9 A;  3M59 A;  1OU8 A;  1RI0 A;  4YC3 B;  5L2W B;  1UE9 A;  2GGR A;  2A7Y A;  1VQ6 T;  2QI2 A;  3G4S T;  4J9B A;  1OQK A;  3OYK A;  3L2Q A;  1OX9 A;  1C9B A;  2DPP B;  4M78 F;  1YNZ A;  2HDA A;  1UJY A;  4BB7 A;  4F6W B;  2L3P A;  4WTO B;  2BKD N;  4DBF A;  5HCK A;  1Q82 R;  1MUZ A;  4X1V A;  3A8H B;  1K0S A;  1OV3 A;  4R0K A;  3X28 B;  3DDQ B;  3CXC P;  1FX7 A;  1FVV B;  4GLM A;  3S3N A;  4EOR B;  3NHN A;  1UNG D;  1K8A R;  1WA7 A;  3FDR A;  5GAO q;  4LUE A;  1X01 A;  2LX9 A;  3I5R A;  2F1L A;  1X6B A;  3BE3 A;  3C4S A;  3BDU A;  5I2S A;  4E7L A;  3V7R A;  1YHQ T;  1NBE B;  3KUF A;  4IUP A;  1JJ2 P;  1OU9 A;  6AT1 B;  4C8Q A;  2BZY A;  1W2B S;  1GUX A;  4OR5 B;  3EH2 A;  4J9I A;  4JX5 A;  5CIU A;  1G5V A;  2NUT A;  3VJP A;  1D3B A;  2W96 A;  3H8Z A;  1UUE A;  3JB9 D;  1LOJ A;  1NPR A;  1HJD A;  3JCM Q;  4Y72 B;  4OB1 B;  1K4U S;  1URC B;  2RQU A;  2VWF A;  2O01 E;  1KC8 U;  2PUO B;  1MGQ A;  4NS5 A;  1GH6 B;  1FMW A;  1M8V A;  4N4I A;  4QQD A;  2FHD A;  3QG1 A;  3MHX A;  4J7I A;  4DOW A;  4M7D A;  2WMA B;  2MCN A;  4QVZ A;  2FVU A;  3CC4 Q;  2FRW A;  2PNI A;  4ZGD B;  3CXC A;  2DMO A;  1YJW T;  2YT6 A;  4QW2 A;  1GCP A;  1OZ3 A;  2JZ2 A;  2FG0 A;  1UFF A;  5LJ3 j;  1YJW A;  1QKX A;  2WIH B;  5IXB A;  1LVK A;  2KK4 A;  2C5X B;  2DK3 A;  2FPF A;  4A4H A;  2A3L A;  1YJ9 T;  4M75 A;  4A54 A;  2EUF A;  9ATC B;  1AIS B;  2VXE A;  1EX4 A;  2CP3 A;  2MWO A;  3R6N A;  3C94 A;  1VQ6 A;  4F7N B;  4TVR A;  1Q82 U;  4RTX A;  4M77 E;  1FMV A;  4YTL A;  5FLX E;  5A0D A;  4A53 A;  5LJ5 e;  2LJ1 A;  3CCV A;  1DJ7 B;  2B8A A;  2QQ8 A;  5EG2 A;  3JCM J;  2RA2 A;  3CD6 T;  4AFZ C;  1R8O B;  3QZ9 B;  4ROE A;  3C95 A;  3RDV A;  3ZFJ A;  4PJO C;  4O6J A;  2RB6 A;  3H0H A;  4XTX A;  1TWB A;  3EGD A;  1E6H A;  4IIO A;  4J7F A;  4OF1 A;  4CC7 A;  2XKO C;  2HMA A;  2EJG A;  4JRQ A;  2IVW A;  3HPW A;  2O9S A;  1YP5 A;  4JDS A;  2HAX A;  1WHL A;  3CD6 Q;  1QCF A;  3EGX B;  4MDW A;  1QVG P;  4P5N A;  2LC4 A;  4BI4 A;  1JB0 E;  2D0Q B;  1W2B A;  1KSW A;  4M4Z A;  4NL2 A;  2LNH B;  1YJN Q;  3JSC A;  3RIR A;  4EMG A;  4LDX A;  5DQV A;  3BHT B;  2DF6 A;  1M1K C;  1WQ7 A;  4RKU E;  4F7U F;  2L2P A;  1IRX A;  2J7I A;  3CCL Q;  2RMO A;  2GNC A;  1ZUU A;  4M78 E;  2L3S A;  3J80 E;  1W70 A;  1N5Z A;  4ZTJ A;  2J6F A;  1BBZ A;  2XDP A;  3G6E A;  1ZUK A;  2PQW A;  4HCB A;  2HL3 A;  3EAE A;  5HBE B;  1K76 A;  1MMG A;  4DOV A;  1H92 A;  1OPL A;  4M7A C;  1QP3 A;  2O2O A;  2EQJ A;  3JRZ A;  5GJV B;  4NL3 A;  2A28 A;  2E70 A;  4PNO A;  2COW A;  4HNU A;  3VUB A;  5EFQ B;  4F6U B;  4KGX B;  4OMP A;  4PFO A;  4C0G A;  3EJ1 B;  5IT9 E;  1QLY A;  3CPW A;  1VQL A;  1VQ5 Q;  5CQX A;  1YHQ A;  2RD1 A;  3OYL A;  2E12 A;  2QGS A;  3DDP B;  2RO0 A;  4BCM D;  4ZN3 A;  5GMK j;  1QVF A;  1IGU A;  2QQ9 A;  1AWJ A;  1BCO A;  3C12 A;  3QJ6 A;  2P0Q A;  2OTL Q;  3L1A A;  2ATC B;  2D8H A;  1YJ9 Q;  4BCP B;  4C8Q F;  1Q7Y R;  3EFO B;  2RPN A;  4DEX A;  4MDX A;  2VUB A;  5FU7 B;  2R5M A;  2GTO A;  4C92 E;  5GMK i;  2KYM A;  2FZG B;  2YSQ A;  3HFN A;  5GAN f;  4KT0 E;  2QK0 A;  1G3T A;  2M02 A;  2LVM A;  2LQW A;  4M77 B;  4J6W A;  2KRS A;  4HKE A;  3BY7 A;  3UA7 A;  2KMG A;  5LMK B;  1I0C A;  1SSH A;  2KT8 A;  3CC2 Q;  2E1H A;  2KR6 A;  3JCM c;  3CD6 A;  4IKF A;  2NWM A;  5GAN 7;  2DL5 A;  5FU6 C;  1M1G A;  4AFU C;  1H1R B;  2I53 A;  3MEV A;  1VIF A;  2L89 A;  3E9G A;  1VQP Q;  1OPK A;  2RHX A;  4QSH A;  1GXI E;  1KG1 A;  1Y71 A;  3KFV A;  3L2V A;  3TVT A;  2EYQ A;  1UEB A;  1X6O A;  4M75 D;  3UWN A;  1VQM A;  1AEY A;  3QYE A;  3M0U A;  4BY7 X;  1R77 A;  3MY1 B;  2Y4Y A;  2DYB A;  2EYY A;  4FT2 A;  2PVD B;  2E10 A;  2RJD A;  4TTH A;  4D8D A;  2DRK A;  1RLQ C;  1UG1 A;  4F17 A;  3VS5 A;  3OYJ A;  3UA6 A;  5KE2 A;  3EFO A;  2FZK B;  1NLO C;  1K9M R;  3CCL T;  1O9K A;  1CKA A;  4M7D D;  2DVJ A;  3F70 A;  5IN1 A;  3LW5 E;  1WIE A;  1ABQ A;  5GAN h;  3CCQ A;  1FIN B;  1KQS A;  1WDX A;  1I5L A;  4LXC A;  1YCY A;  2MAM A;  1WI7 A;  1BU1 A;  2J6K A;  4CFM B;  1QLB A;  4IUU A;  1VIN A;  4YOO A;  2HQX A;  1SEM A;  4M77 A;  4LD9 K;  1RAC B;  1S72 T;  2O31 A;  3GLX A;  4KUD K;  2LQ8 A;  3OBW A;  1FYN A;  2ZPG B;  5GAM d;  2YRC A;  1D1B A;  1W1F A;  3EG1 A;  3CCR Q;  1K0X A;  5FU6 B;  3C0C A;  3VS1 A;  3VU3 C;  3LGF A;  2KRN A;  4E7S A;  3VRZ A;  2CJM B;  1Q81 U;  1W6X A;  3KXT A;  1ZBX A;  1U5S A;  3RR6 A;  4RUG A;  1D09 B;  5GMK e;  3SFM A;  4C92 C;  1BI3 A;  3LLR A;  3CCU T;  1O75 A;  2EWN A;  4AKH A;  4XTW A;  1X75 C;  4XAX B;  3SB2 A;  5CKD A;  1GBQ A;  1RAF B;  2V8J A;  2QGF B;  4HVU A;  1NJI R;  3L2R A;  2YUP A;  1D3B B;  1VOM A;  4KRD B;  2DBM A;  1H4L D;  4XTU A;  4ESR A;  3CMA Q;  3G6E T;  2MK5 A;  3PO3 S;  2PK9 B;  2G77 A;  4ATO A;  1PRL C;  4NOY A;  1B7T A;  3VRY A;  3L42 A;  4M7A B;  2VAS A;  1HXD A;  5EC7 A;  4EOS B;  1JXO A;  3LH0 A;  3Q1J A;  3TNI B;  2R57 A;  1QVF S;  4BE1 A;  4A4E A;  1Y7X A;  2DD4 A;  3GF5 A;  2QAS A;  1F1B B;  4EON B;  4YOZ A;  4OML A;  4FL6 A;  2QQS A;  1H3Z A;  3H0F A;  4FU6 A;  5CKB A;  1XQH A;  3VS2 A;  1PD0 A;  2QFZ A;  2P0P A;  4M75 B;  3V8J A;  5ACB A;  2E64 A;  5GMK l;  3QYB A;  5FU7 C;  5M9O A;  4MZT A;  2BPM B;  5LJ5 g;  1FWZ A;  2J6O A;  2YRD A;  3SHW A;  4FSX A;  3LX7 A;  1N9S A;  1VQN A;  2YUN A;  3I9Q A;  3JB9 F;  2LCS A;  3CBM A;  2X51 A;  2DXC B;  3MEA A;  2Y90 A;  4L5G A;  1KC8 R;  2OTJ T;  3D7S B;  4EIK A;  1VQL Q;  3M53 A;  4O5V A;  2HCK A;  2SEM A;  1D1C A;  3VV0 A;  1UGQ B;  3PE0 A;  1G2B A;  1XTD A;  3L2U A;  2MOX A;  2VV5 A;  4ORZ A;  2QTV A;  2QAZ A;  2HBW A;  2RK2 A;  2MPX C;  1T0J A;  2D8J A;  3A1P A;  1VQ8 T;  5CEI B;  3HB9 A;  5GAN 8;  2C5N B;  1HSQ A;  5HQ0 B;  4LNP A;  1SPK A;  4HT8 A;  1WXB A;  5KYY B;  3DTO A;  1G3S A;  4XTV A;  3CQT A;  1G83 A;  1BI0 A;  8ATC B;  4J9E A;  1H1Q B;  1KQS S;  1KXU A;  1Y96 B;  4AFQ C;  1MHN A;  4IUQ A;  1OL1 B;  1VYU A;  1VQ8 A;  2RHU A;  4ELZ C;  3CME A;  1WPY A;  3FEO A;  2PUK B;  3RES A;  2WHB B;  5GAM g;  2XU8 A;  3ME9 A;  5CAI A;  3PIP A;  3I55 T;  2C4G B;  2RJE A;  4E7K A;  3GIB A;  2X4J A;  3G4S Q;  3BLQ B;  1Q95 G;  2F2C A;  1FXX A;  5GAN g;  1PKD B;  3CCM T;  1HD3 A;  1ZSZ B;  3MO8 A;  3U23 A;  1K9A A;  5CKH A;  1M27 C;  1S72 A;  2DIL A;  5A0G A;  1VQ4 Q;  4M7A E;  1AVZ C;  3EG9 A;  2F2V A;  3FB9 A;  3PT9 A;  4JUV A;  2JGZ B;  2E3H A;  4Q5W A;  5AT1 B;  4M78 D;  3CXC S;  5GAN e;  3CC4 A;  3J81 E;  3X25 B;  4ME7 A;  2LP5 A;  3HSB A;  2UZL B;  1D0X A;  3QPH A;  4KH1 B;  4BCF B;  4M77 G;  3SEM A;  3G33 B;  2P4T A;  4Y91 A;  1ZSZ A;  3OYC A;  2RHZ A;  1RAH B;  5LL6 S;  3OW2 A;  3LGL A;  1U06 A;  4HVW A;  3PIO A;  3PTA A;  4LD6 A;  1BYM A;  4RTU A;  4EPC A;  1IO6 A;  3QUI A;  4X9C A;  4C5I A;  1Q86 R;  4J9D A;  5CO7 A;  3A8G B;  2K3X A;  2O4X A;  2GCX A;  3TEE A;  3CCV T;  1QQJ A;  1K1Z A;  4BY1 X;  1X27 A;  2K9G A;  3HP9 A;  2DD5 A;  1UHC A;  1C0M A;  1PCX A;  4XTZ A;  1N6A A;  1M3C A;  3VKH A;  2A0F B;  4EMK B;  3VS0 A;  3HRT A;  5KE3 A;  4MIM A;  2DA9 A;  4JJC A;  5LJ3 d;  1YI2 A;  2DET A;  3VS6 A;  4JRP A;  3RGF B;  4BCJ B;  1H28 B;  4FYW B;  5KH6 A;  3MCA B;  2B9R A;  3POM A;  2FPE A;  2CYZ B;  2PJQ A;  1GCQ A;  4FT4 A;  3WXM B;  4R55 A;  3NTK A;  5CYI B;  1XO2 A;  4ZN1 A;  1LCK A;  3OW2 S;  3CCJ A;  5L8R E;  3GOX A;  4IUT A;  4M75 C;  1WLP B;  3OS2 A;  4CRL B;  4LN2 A;  3H9N A;  5J26 A;  5GMK h;  3JCM b;  3JCM X;  5HKC A;  4HLQ A;  4EOM B;  1QMC A;  3CCE Q;  3F5X B;  1N9R A;  4QVD A;  1Q7Y U;  3CCQ T;  2O9V A;  2A36 A;  1PHT A;  1HYO A;  1WJS A;  2E41 A;  2K7A A;  5GJW B;  2RM4 A;  2YLB A;  1TUG B;  1CKB A;  2M51 A;  4BBR M;  4M78 C;  1D0Z A;  2V26 A;  2KI7 A;  3P8B B;  2WEV B;  3J7A F;  2CZ7 B;  4BDY A;  2EIF A;  4LE9 A;  1Q81 C;  1SRM A;  1EIF A;  1Z9Q A;  2HKQ B;  5AYF A;  1G8X A;  2KR3 A;  4B6M A;  1VQM T;  4AG2 C;  5LJ5 j;  2DEQ A;  4XU2 A;  4BCH B;  2CP6 A;  1VQO T;  2D1X A;  3R6O A;  2KVQ G;  5KCO A;  2ED0 A;  2QXF A;  2QEX A;  1K8A C;  4M7D F;  2GTJ A;  4C5G A;  2NUZ A;  2QA4 Q;  1QW1 A;  2DRM A;  4PJO E;  2DM1 A;  3M03 A;  4EOJ B;  4OGR B;  2DE0 X;  2IIM A;  4PJO A;  3KBG A;  1H8K A;  2ZAE A;  5GMK m;  2BUD A;  4JRI A;  3M4Y A;  1X69 A;  4RTV A;  5DM7 R;  2VYT A;  4KRC B;  1JOW A;  1H26 B;  3ZBD A;  2DXT A;  4JS4 A;  1YIT A;  1QKW A;  1WHK A;  3NFC A;  1IHV A;  3UAT A;  1RAG B;  2V1R A;  1YN8 A;  2E3I A;  3OYB A;  2L0A A;  1SHF A;  1KQ2 A;  2DKG A;  2D0N A;  4M78 B;  4FIB A;  3QJY A;  3CPW S;  4E47 A;  4OMM A;  4OGE A;  3EG3 A;  4JJN K;  2QA4 A;  2MI6 A;  1NG2 A;  3CEY A;  4FM4 B;  3JCM d;  1MV0 B;  3QWY A;  4ANJ A;  2H3J A;  3PFS A;  4HA8 A;  3M0R A;  2NUT B;  3REA B;  3EGX A;  3BG9 A;  4AKG A;  4BI8 B;  2CT3 A;  1EZZ B;  2EJF A;  1GY3 B;  1NYF A;  2EBP A;  2ZGW A;  2GF7 A;  4YOS A;  4C8Q D;  1YI2 Q;  2HNI A;  5IH2 A;  3OYI A;  1KC8 C;  4FCY A;  2LJ0 A;  2ZCF B;  4C92 F;  2XG8 D;  3QBY A;  1B34 B;  1GRI A;  4BE0 A;  2RH2 A;  2DXC A;  3EG9 B;  2KRM A;  1NE8 A;  4KRT A;  1WHH A;  1XNI A;  2IW6 B;  1TXQ A;  3T9N A;  1QVG A;  4E6R A;  4XTY A;  3JCM e;  1JJ2 S;  4K11 A;  5HNB B;  2BS4 A;  1OZ2 A;  2DJZ A;  2C6T B;  2VGM A;  3G71 A;  2HSP A;  3BG3 A;  2K3B A;  2RQW A;  2IW9 B;  2KXD A;  1PSF A;  3MP8 A;  2KQW A;  3OYF A;  4EMK C;  5FRO A;  1YIJ T;  2RQT A;  5D6Y A;  2GQV A;  1AOJ A;  2DLP A;  3A5Z B;  4C92 G;  1ZP2 A;  2WSE E;  4BCN D;  4BCI B;  1ZA1 B;  4BBS M;  2CZ1 B;  2QG9 B;  1QWF A;  5EJC A;  3WVD B;  1TTH B;  3SWN C;  2O88 A;  2LMJ A;  3CCV Q;  5HBH B;  3EH1 A;  3RER A;  1QCN A;  2DXB A;  2P0K A;  4BXX X;  4BCQ B;  1FMK A;  4AI6 A;  1VQK A;  3QZ5 B;  4D6W A;  2KNB B;  1Y07 A;  5LJ3 f;  1O9K B;  2C0T A;  4WCI A;  3QDF A;  1RLP C;  4ZGJ B;  2X3W D;  3URG A;  3HL8 A;  4MFD A;  2OI3 A;  3H41 A;  4KH0 B;  2OAW A;  1YCS B;  3M54 A;  1M90 U;  4PK4 A;  2JXB A;  2QEX Q;  1R0C B;  2J05 A;  3BFM A;  3VKG A;  1JQQ A;  2CP0 A;  1AWO A;  3JB9 G;  3VS4 A;  3CCS T;  4HCK A;  4Z02 A;  1TUD A;  4M77 F;  1Q86 U;  2EKO A;  1OL2 B;  1PKS A;  3L2Z A;  2BS3 A;  2CZ0 B;  3NDQ A;  2K4Y A;  2RJC A;  3H4C A;  2VXF A;  3UT1 A;  5D7U A;  2HZY A;  3HTR A;  3UDC A;  4Z6Y A;  1VQ5 A;  1RAE B;  4Z88 A;  1UEC A;  2EYX A;  3JCM f;  1K73 C;  4UN0 A;  1YIT Q;  3EG2 A;  3MIA B;  1TOV A;  1VQ7 Q;  4EOO B;  4JZ4 A;  4XU0 A;  1R0B G;  2E6N A;  4M77 D;  4E7H A;  4XQ3 A;  2ESW A;  4XU3 A;  3OY9 A;  3EFR A;  4J6X A;  2ROL A;  4II1 A;  4QT7 A;  4G6L B;  5KYU B;  2CCH B;  1WYX A;  1OGU B;  4EMH A;  5GAO l;  1ACM B;  1AD5 A;  3HRS A;  1M4Z A;  2COZ A;  5GAN j;  3RUX A;  1I4K 1;  1QMZ B;  2CGH A;  1SKU B;  1GBR A;  4HT9 A;  2X35 A;  2IPO B;  4X9D A;  2KRO A;  2I2L A;  1OIY B;  2D9T A;  2DYI A;  4VUB A;  3ZL7 C;  3JB9 J;  5ICP B;  2QGG A;  2E6Z A;  3OYG A;  3EID B;  3OS5 A;  2F5T X;  3DLM A;  1IXD A;  2WIP B;  2WAC A;  1M9S A;  2KEA A;  5HK3 A;  4N0A C;  3HO8 A;  2EFI A;  1HK9 A;  5HVY B;  3OMC A;  4EC8 B;  4C92 A;  2ZZD A;  1PRM C;  2KGT A;  1M1K U;  2Z0W A;  2HQE A;  5IHI A;  5KYW A;  1PWT A;  4Y28 E;  2GBQ A;  1VQO A;  3BLR B;  1KHI A;  4FSS A;  3S3M A;  4JX6 A;  3O8V A;  1C6V X;  2DER A;  5GAO r;  1VQK T;  2JS0 A;  2J06 A;  3RKY A;  4EOQ B;  3CCM Q;  4ROC A;  1H24 B;  1UJ0 A;  4KGV B;  1IZ6 A;  2WSF E;  2QDY B;  4E7J A;  4KUI A;  3CCE A;  4QQ6 A;  4A4K A;  4F7J B;  4OB3 B;  4FYY B;  2DJQ A;  4GY5 A;  5KYY A;  4ZNX A;  2K79 A;  1NYG A;  2LCC A;  1PG5 B;  1G3N C;  2BTT A;  5D6W A;  2XI9 A;  5I5Z B;  5J3B A;  1UNL D;  2M0Y A;  1S72 Q;  4HNV A;  1ZLM A;  5GAN 2;  5HK0 A;  2MYS A;  4JLI A;  4J9G A;  1ABO A;  2VVK A;  4FW1 A;  2F69 A;  1AWW A;  2R7G A;  3LYI A;  3G4S A;  4F7U B;  2RF0 A;  3M57 A;  2HQH A;  2JS2 A;  4RTY A;  3CC7 A;  1G3Y A;  1VIE A;  2YDL A;  1JST B;  2G3R A;  2LTO A;  5HY6 A;  2C0O A;  3I56 A;  1VQN T;  3VKI A;  1AHJ B;  1OKW B;  4HXJ A;  1B3Q A;  4L6V 5;  3QO3 A;  4M6V A;  2NUP A;  4F7U G;  4DQ2 A;  3QDR B;  2B86 A;  2MIO A;  3M0T A;  2E5Q A;  2EKH A;  1M3A A;  2JOY A;  4C8Q B;  1SF9 A;  1BU2 A;  2V8K A;  2UUE B;  4ZGE B;  1V29 B;  1NLP C;  1QP2 A;  2UZD B;  4PJO G;  4J8O A;  3OYE A;  5FRN A;  2CS7 A;  1UNH D;  4BCQ D;  2KT1 A;  1VQ6 Q;  1JEG A;  1QWE A;  3REB B;  4OMQ A;  5L23 A;  1LJO A;  3FLG A;  4JJD A;  5GAO n;  1KIK A;  3M58 A;  3DLL A;  4PLI A;  2OJ2 A;  3CCQ Q;  5DQW A;  3EOC B;  2HL5 C;  4Y92 A;  3O0G D;  2JW4 A;  4PJO B;  5FW9 A;  1VQP A;  4M7A F;  1IRE B;  2G6F X;  2EQI A;  1BIA A;  1ZQ1 A;  3EHQ A;  1QVF P;  4ELL A;  2C5O B;  2FYK A;  3JAM E;  4RMO A;  1OX8 A;  1K73 U;  2K5F A;  1GL5 A;  2AKL A;  4M75 G;  1JO8 A;  3PVQ A;  1PM3 A;  1H27 B;  5A2Q E;  2EGC A;  2FRY A;  1GUX B;  2KDS A;  3TN8 B;  2XK0 A;  4J5Y A;  3NTH A;  1PSE A;  4AG1 C;  4BUG A;  4LDU A;  4MZP A;  1M1F A;  1NZ9 A;  3V8K A;  2OX7 A;  4QQG A;  4M78 G;  4CXA B;  4UC4 A;  2DNU A;  1KD1 C;  3G71 Q;  1U1S A;  3QWL A;  2WPA B;  4JLG A;  1VYT A;  3MET A;  2ED1 A;  3CCM A;  4QVC A;  1MMN A;  1YIJ A;  1VQ9 Q;  3JCM W;  4OGC A;  3KHI A;  2ZPF B;  2X4W A;  3I55 A;  4R56 A;  3OYY A;  4RG2 A;  1F5Q B;  4JS5 A;  2HKN A;  2XDB A;  3WVE B;  4EOI B;  2EW3 A;  3LH5 A;  3S6W A;  3QYG B;  3GNF B;  1YFN A;  3RMS A;  1ZUY A;  1WJR A;  1YBY A;  1J3T A;  4E7Z A;  4M7D B;  2L3R A;  1ENW A;  2VGN A;  4F7U A;  1AZG B;  2MWP A;  1GFD A;  5LJ3 h;  3OSS C;  1ZBJ A;  3INZ A;  5DLQ E;  1JRI A;  4DBQ A;  3E1S A;  4LOC A;  2XHC A; 
#chains in the Genus database with same CATH homology
 4PJO E;  4BAC A;  3A8M B;  2LDM A;  2M16 A;  2DTI A;  3HFN A;  3DL1 A;  3LWH A;  3AHU A;  5GAN f;  4KT0 E;  3HBL A;  3OBY A;  1G3T A;  3JCM h;  2GFU A;  2LVM A;  3RUX A;  1OI1 A;  4PJO A;  3KBG A;  5GAM j;  1YJN A;  1OYX A;  1VQ9 A;  2RHI A;  5GMK m;  2BUD A;  4JRI A;  3M4Y A;  1YI2 T;  4M77 B;  1VQP T;  4N0A A;  4J6W A;  4HKE A;  3BY7 A;  2KMG A;  5DM7 R;  2VYT A;  2E1H A;  2KR6 A;  2QQB A;  2DD4 B;  3JCM c;  3ZBD A;  3CD6 A;  4IKF A;  3SDZ A;  2PU9 B;  2DXT A;  5LJ3 g;  5GAN 7;  2VC8 A;  5GAN 5;  4JS4 A;  3GNG A;  3M9Q A;  1YIT A;  5FU6 C;  1M1G A;  4PL6 A;  3NFC A;  3X26 B;  3MEV A;  5I2M A;  4C0D C;  3GP8 A;  1Q82 C;  1VIF A;  2L89 A;  3E9G A;  3G7Z A;  5GAM e;  3OYB A;  2RHX A;  1W4S A;  4QSH A;  1GXI E;  1KG1 A;  4HNT A;  1Y71 A;  3L2V A;  2XID A;  1KQ2 A;  2DKG A;  4BI3 A;  2IG0 A;  4FIB A;  3QJY A;  4M78 B;  3G71 T;  4E47 A;  3CPW S;  2EYQ A;  1UEB A;  4OGE A;  4JJN K;  3TRE A;  1X6O A;  2MI6 A;  4M75 D;  3VYG A;  2QA4 A;  3UWN A;  2DIQ A;  2RJF A;  2YRV A;  3BDL A;  3QYE A;  4C8Q C;  1VQM A;  3CEY A;  4FM4 B;  3JCM d;  1VQ9 T;  2Y4Y A;  4FT2 A;  2PVD B;  2E10 A;  2RJD A;  3OB9 A;  2JNG A;  1M90 C;  2H3J A;  3QII A;  3PFS A;  2K57 A;  2DTO A;  4HA8 A;  5CR2 A;  4OP0 A;  3BG9 A;  4AKG A;  3PMT A;  4BI8 B;  3OYJ A;  3QSU A;  4AKI A;  5KE2 A;  3EFS A;  2EJF A;  5GAM h;  2OAU A;  2ZGW A;  2GF7 A;  3OYH A;  4C8Q D;  5KCH A;  4LDV A;  3OYN A;  2HNI A;  3CCL T;  1N27 A;  1UGS B;  3OYI A;  4M7D D;  2R5A A;  3F70 A;  1KC8 C;  2ZCF B;  1U1T A;  5IN1 A;  4C92 F;  3LW5 E;  4KUL A;  5LJ3 e;  2XG8 D;  3OMG A;  2R58 A;  3QBY A;  1UB4 A;  2BIV A;  1B34 B;  4M75 F;  4NC6 A;  4PJO F;  5GAN h;  3CCQ A;  3CC4 T;  4BE0 A;  1KQS A;  1I5L A;  2RH2 A;  1YCY A;  3HFO A;  2GFA A;  2MAM A;  2DXB B;  3RKW A;  2DXC A;  1VUB A;  2EAY A;  2DAQ A;  1I8F A;  4PKC C;  3A8L B;  1NE8 A;  4WF2 A;  2F5K A;  1QLB A;  1XNI A;  4GLK A;  3T9N A;  1QVG A;  4IUU A;  2HQX A;  3CCR T;  4M77 A;  4XTY A;  4IUR A;  3JCM e;  1JJ2 S;  4LD9 K;  2BS4 A;  5GAO p;  1OZ2 A;  2DJZ A;  2EQU A;  3RMQ A;  2VGM A;  2ZZD B;  3G71 A;  4PLL A;  3BG3 A;  1S72 T;  3GLX A;  4KUD K;  4A4G A;  1P92 A;  2HAX A;  3BW1 A;  1PSF A;  4N4G A;  2EQK A;  3MP8 A;  2KQW A;  2LQ8 A;  2RI2 A;  2ZPG B;  3OBW A;  4C92 D;  4EMK C;  5GAM d;  3OYF A;  3QXE B;  5FRO A;  1YIJ T;  1VQ4 A;  4IUV A;  2EJ9 A;  5D6Y A;  2GQV A;  2ZPE B;  1XOV A;  3A5Z B;  4C92 G;  5FU6 B;  3QYH B;  2WSE E;  2EQM A;  3VU3 C;  5GAN 6;  4BBS M;  4C5E A;  3G4S A;  2CZ1 B;  3E9F A;  4C0D B;  1E7P A;  1KHC A;  4F7U E;  5EJC A;  3LGF A;  2WJ9 A;  3WVD B;  3SWN C;  4HCC A;  1Q81 U;  2KSS A;  5DY9 A;  3KXT A;  3OA6 A;  1ZBX A;  3RER A;  2C06 A;  2DXB A;  4CRI A;  2P0K A;  4BE2 A;  5GMK e;  3SFM A;  3SWN B;  4C92 C;  4AI6 A;  3MP1 A;  3CC2 A;  1BI3 A;  1VQK A;  3P8D A;  3LLR A;  3CCU T;  3QZ5 B;  1O75 A;  2EWN A;  5CVI A;  1N8R U;  4AKH A;  1NPP A;  1X75 C;  2CKK A;  3FJP A;  4XAX B;  4XTW A;  3SB2 A;  2AHJ B;  3H6Z A;  2L8D A;  3OSV A;  4B9W A;  1Y07 A;  4MZM A;  4D6W A;  5CKD A;  1TH7 A;  5LJ3 f;  5GAM f;  1VQ4 T;  5LJ5 f;  3L2W A;  2K5L A;  2V8J A;  3I56 T;  3L2R A;  1KD1 U;  4ZGJ B;  2LT1 A;  2LNV A;  1M5Q 1;  3URG A;  1D3B B;  1U8R A;  4EDU A;  4J83 A;  3HL8 A;  5FRM A;  4MFD A;  3VYG B;  4C8Q G;  4A4F A;  2QQR A;  4XTU A;  3X24 B;  3OYD A;  4M75 E;  3CBO A;  1KQ1 A;  3M54 A;  1BI2 A;  3G6E T;  1K8A U;  1M90 U;  4PJO D;  2WSC E;  3VYH B;  1K9M U;  2G77 A;  4ATO A;  4C5H A;  2QDJ A;  4MFE A;  3FC3 A;  2QTX A;  1YJN T;  4NOY A;  3BFM A;  3VKG A;  1WNL A;  4RCC A;  2DZC A;  3DB3 A;  3L42 A;  3MEW A;  4M7A B;  3JB9 G;  3CCS T;  1HXD A;  3V8L A;  4Z02 A;  3TW7 A;  4M77 F;  1Q86 U;  2EKO A;  1VQL T;  2ZPB B;  3LH0 A;  1K9M C;  3Q1J A;  3L2Z A;  2BS3 A;  2CZ0 B;  3HHT B;  4OB0 B;  2KAF A;  2LQK A;  2K4Y A;  3N5B B;  4B9X A;  4KBM B;  2R57 A;  2XDD A;  2RJC A;  4M7D E;  3H4C A;  2VXF A;  1QVF S;  2V8I A;  4BE1 A;  3UT1 A;  5CCA A;  4M7D G;  4A4E A;  1Y7X A;  3OQ5 A;  2DD4 A;  3PNW C;  3GF5 A;  3MEU A;  3TCJ A;  3M4G A;  1WQW A;  4FL6 A;  3UDC A;  4Z6Y A;  1VQ5 A;  1Y96 A;  2QQS A;  3CC7 T;  3NTI A;  3HKS A;  1H3Z A;  3JCM f;  4FU6 A;  1K73 C;  3CBP A;  1XQH A;  5CKB A;  4M7D C;  3BG5 A;  2QFZ A;  2P0P A;  1H64 1;  3FIF A;  4JRK A;  4M75 B;  3V8J A;  5LJ5 d;  2QA4 T;  4XU0 A;  2E64 A;  2E6N A;  4M77 D;  5GMK l;  3ASK A;  5A0L A;  3QYB A;  4E7H A;  5FU7 C;  4XQ3 A;  4MML A;  3CME T;  4XU3 A;  5M9O A;  3OY9 A;  3EFR A;  4MZT A;  4J6X A;  4II1 A;  5LJ5 g;  1FWZ A;  2DTH A;  5I21 A;  2E65 A;  1RL2 A;  2M1H A;  4FSX A;  4EMH A;  5GAO l;  1N9S A;  3LX7 A;  1VQ7 A;  1VQN A;  3HRS A;  1M4Z A;  1JJ2 A;  4J6Y A;  2XD0 A;  5GAN j;  3CBM A;  2DD5 B;  2DXC B;  4HL4 A;  2LT4 A;  1VQO A;  3JB9 F;  2O4X B;  1B34 A;  1I4K 1;  2CGH A;  2QQA A;  2X4Y A;  3MEA A;  2Y90 A;  3P8H A;  3M59 A;  4L5G A;  1QVG S;  1RI0 A;  2X35 A;  4HT9 A;  2OTJ T;  2QF7 A;  3M53 A;  4X9D A;  5CKE A;  2D9T A;  2I2L A;  4O5V A;  4VUB A;  2A7Y A;  2YLC A;  3VV0 A;  3JB9 J;  1UGQ B;  1VQ6 T;  2E6Z A;  2QI2 A;  3OYG A;  3G4S T;  1XTD A;  3OYK A;  3L2U A;  2RI3 A;  2VV5 A;  3L2Q A;  3OS5 A;  4M78 F;  2DPP B;  4JX4 A;  3A8O B;  2F5T X;  3DLM A;  2RK2 A;  5GAN d;  4HCZ A;  2DZ9 A;  2WAC A;  2D6F A;  4BB7 A;  1M9S A;  2OTL A;  3CMA T;  5HK3 A;  2BKD N;  1VQ8 T;  3HB9 A;  4N0A C;  3HO8 A;  5GAN 8;  2EFI A;  1YJ9 A;  1HK9 A;  3OMC A;  4C92 A;  2ZZD A;  3A8H B;  5CKF A;  4X34 A;  1FKM A;  1M1K U;  3X28 B;  4HT8 A;  1Q86 C;  2HQE A;  1FX7 A;  1G3S A;  4XTV A;  1BI0 A;  4M78 A;  3RKX A;  3S3N A;  5CK9 A;  1KQS S;  1Y96 B;  4Y28 E;  3ZEH A;  5GAN 4;  1MHN A;  4IUQ A;  5D6X A;  1KHI A;  3S3M A;  1I81 A;  4JX6 A;  3FDR A;  3SD4 A;  3O8V A;  3JB9 I;  1VQ8 A;  4XU1 A;  4RG8 A;  5GAO q;  5GAO r;  1X01 A;  2RHU A;  4ELY C;  4ELZ C;  2LX9 A;  3CME A;  3CCU A;  3TU4 K;  1WPY A;  4XK8 E;  1VQK T;  3TW6 A;  3RKY A;  4M7D A;  3PMI A;  1SSF A;  3C4S A;  3FEO A;  2PUK B;  3BDU A;  3RES A;  5I2S A;  5GAM g;  4E7L A;  2DO3 A;  3V7R A;  1NJI U;  2XU8 A;  1YHQ T;  3ME9 A;  3KUF A;  1IZ6 A;  2WSF E;  4IUP A;  5CAI A;  3PIP A;  3I55 T;  3GPL A;  2RJE A;  2QDY B;  4E7J A;  4E7K A;  4M7A A;  4KUI A;  3CCE A;  3GIB A;  4QQ6 A;  4C8Q A;  4A4K A;  2X4J A;  4OB3 B;  2JTF A;  2ZPI B;  2MMP A;  3CPF A;  4GY5 A;  4N4H A;  1W2B S;  4JX5 A;  5CIU A;  1G5V A;  2FL7 A;  3VJP A;  1FXX A;  5GAN g;  2BS2 A;  1D3B A;  3CCM T;  2LCC A;  5CQY A;  3H8Z A;  5D6W A;  2XI9 A;  4BY6 C;  3JB9 D;  1LOJ A;  1NPR A;  3MO8 A;  3JCM Q;  4E7I A;  5J3B A;  4OB1 B;  5CKH A;  1S72 A;  5A0G A;  2O01 E;  5GAN 3;  1QVP A;  2KMT A;  4OVA A;  3HZJ A;  4HNV A;  1KC8 U;  5GAN 2;  4M7A E;  5HK0 A;  2PUO B;  2JVV A;  4JLI A;  1MGQ A;  4NS5 A;  3FRN A;  3UPU A;  2F69 A;  1M8V A;  3FB9 A;  3PT9 A;  4JUV A;  4N4I A;  4Q5W A;  4QQD A;  2L5Q A;  4M78 D;  2FHD A;  3LYI A;  3MHX A;  3QG1 A;  3ER0 A;  3X20 B;  4J7I A;  4DOW A;  3M57 A;  3QHS A;  4F7U B;  3CXC S;  4M77 C;  4QVZ A;  2JTM A;  2DIG A;  5GAN e;  1G3Y A;  2DVE A;  2FVU A;  3J81 E;  3CC7 A;  3CC4 A;  4ZGD B;  3CXC A;  1VIE A;  1Q7Y C;  1YJW T;  3CCJ T;  2G3R A;  3X25 B;  4ME7 A;  4QW2 A;  1OZ3 A;  2LTO A;  3HSB A;  2JZ2 A;  3HRU A;  2KY9 A;  2CZ6 B;  5HY6 A;  2HD0 A;  4BD3 A;  5LJ3 j;  3I56 A;  1N8R C;  3JCM g;  1AHJ B;  3VKI A;  1VQN T;  3QPH A;  1YJW A;  4M77 G;  4V2S A;  2P4T A;  4L6V 5;  3QO3 A;  4M6V A;  1BI1 A;  4Y91 A;  2KK4 A;  4DQ2 A;  2DK3 A;  3QDR B;  3PGG A;  2A3L A;  3M55 A;  4A4H A;  2RHZ A;  4F7U G;  3OYC A;  4M75 A;  4A54 A;  3CMA A;  4L59 A;  2OTL T;  3LWI A;  2E5Q A;  3OS1 A;  5LL6 S;  3OW2 A;  2VXE A;  3LGL A;  5IAY A;  2MWO A;  2JOY A;  3PIO A;  3PTA A;  4LD6 A;  1BYM A;  3C94 A;  4C8Q B;  1VQ6 A;  2V8K A;  4TVR A;  4ZGE B;  1V29 B;  4EPC A;  1Q82 U;  3QUI A;  4X9C A;  4C5I A;  1VQ5 T;  4LDY A;  1QP2 A;  4M77 E;  3OYA A;  2OTJ A;  2Y4X A;  5FRN A;  4PJO G;  4J8O A;  3OYE A;  2CS7 A;  5CO7 A;  2DXU A;  3A8G B;  4YTL A;  3DKM A;  3JCM V;  5FLX E;  3MP6 A;  5A0D A;  3V7C A;  4A53 A;  5LJ5 e;  2K3X A;  2O4X A;  2GCX A;  3TEE A;  3V7S A;  3CCV A;  3CCV T;  3CCE T;  1LJO A;  1DJ7 B;  3FLG A;  4OMF B;  5GAO n;  2B8A A;  2DD5 A;  1UGR B;  3HP9 A;  2QQ8 A;  3JCM P;  3M58 A;  4CI0 C;  3DLL A;  5EG2 A;  3JCM J;  1LNX A;  2RA2 A;  4XTZ A;  3CD6 T;  4PLI A;  1N6A A;  1R8O B;  3QZ9 B;  3C95 A;  3ZFJ A;  4PJO C;  3VKH A;  2FB7 A;  4EMK B;  3DB4 A;  4O6J A;  3CC2 T;  2RB6 A;  2M0O A;  2ZPH B;  3QKJ A;  4BY6 B;  3HRT A;  4XTX A;  1YJ9 T;  4PJO B;  5KE3 A;  4MIM A;  3CCR A;  4J7F A;  1VQP A;  4M7A F;  5LJ3 d;  1YI2 A;  1IRE B;  2XIC A;  4OF1 A;  1BIA A;  1ZQ1 A;  4JRP A;  2XKO C;  3M56 A;  2EJG A;  2PVG B;  2IVW A;  3HPW A;  2K5I A;  4JDS A;  2FYK A;  2PVO B;  3E19 A;  3MCA B;  5KH6 A;  3JAM E;  4MDW A;  4RMO A;  1K73 U;  2JN0 A;  2K3Y A;  2K5F A;  2CYZ B;  2LC4 A;  4P5N A;  3WXM B;  4FT4 A;  4BI4 A;  5GAO m;  1JB0 E;  2X4X A;  4C8Q E;  4R55 A;  2D0Q B;  3NTK A;  4C0Z A;  5J39 A;  1W2B A;  4M75 G;  4MMK A;  4ZTF A;  3OYM A;  4ELJ A;  4ZN1 A;  4NL2 A;  4JRQ A;  5A2Q E;  3OW2 S;  3JSC A;  3RIR A;  4C0F A;  4EMK A;  3CCJ A;  2QEX T;  4EMG A;  5L8R E;  5C6S A;  2KDS A;  2XK0 A;  3GOX A;  4IUT A;  4LDX A;  4J5Y A;  3NTH A;  2M9U A;  1PSE A;  4LDW A;  4M75 C;  1M1K C;  1WQ7 A;  4RKU E;  4F7U F;  3OS2 A;  2YHT A;  5J26 A;  4BUG A;  5GMK h;  4LDU A;  1BIB A;  2MF2 A;  4MZP A;  2NLU A;  3JCM X;  5HKC A;  3JCM b;  4HLQ A;  1UGP B;  1M1F A;  4DA4 A;  1NZ9 A;  3V8K A;  4M78 E;  3J80 E;  4QQG A;  5LJ5 h;  4ZTJ A;  2XDP A;  4M78 G;  5C0M A;  3G6E A;  1N9R A;  2PQW A;  4QVD A;  4HCB A;  4UC4 A;  1Q7Y U;  1KD1 C;  3EAE A;  3CCQ T;  1U1S A;  3QWL A;  4C92 B;  1O9S A;  1WJQ A;  4JLG A;  4DOV A;  1WJS A;  2E41 A;  3MET A;  2RM4 A;  2YLB A;  4M7A C;  3CCM A;  3S3O A;  1QP3 A;  2EQJ A;  4QVC A;  3JRZ A;  4NL3 A;  1YIJ A;  3JCM W;  4BBR M;  2E70 A;  4M78 C;  1VQ7 T;  4PNO A;  4HNU A;  3VUB A;  1JBM A;  1G3W A;  4OGC A;  3KHI A;  3P8B B;  4C0G A;  1YIT T;  5IT9 E;  2ZPF B;  2CZ7 B;  3J7A F;  4BDY A;  2EIF A;  2X4W A;  3I55 A;  3CPW A;  1Q81 C;  1ZHI A;  1VQL A;  1BKB A;  2LRQ A;  3OYY A;  1EIF A;  5CQX A;  4R56 A;  1YHQ A;  4RG2 A;  2RD1 A;  2HBP A;  4BDZ A;  4M7A G;  3OYL A;  2E12 A;  3VUZ A;  3CCS A;  2RK1 A;  2RO0 A;  4JS5 A;  2XDB A;  3WVE B;  5AYF A;  3SWN A;  2JUF A;  4ZN3 A;  5GMK j;  5DLO A;  1QVF A;  2QQ9 A;  3S6W A;  3QYG B;  3GNF B;  4M7A D;  3C12 A;  3QJ6 A;  1VQM T;  3RMS A;  2P0Q A;  5LJ5 j;  2DEQ A;  2RHY A;  3M5A A;  1WJR A;  1YBY A;  4RCB A;  2LCL A;  4XU2 A;  4M7D B;  2L3R A;  3L1A A;  1VQO T;  2VGN A;  3R6O A;  4F7U A;  3OS0 A;  4OB2 B;  2MWP A;  2KVQ G;  1WGS A;  5LJ3 h;  5KCO A;  4C8Q F;  2QXF A;  3OSS C;  1NJI C;  2K2V A;  2QEX A;  1K8A C;  3JB9 H;  2VUB A;  3INZ A;  5FU7 B;  4M7D F;  4MDX A;  2RI5 A;  5DLQ E;  3CCL A;  2R5M A;  1JRI A;  4C92 E;  4C5G A;  5GMK i;  3E1S A;  4LOC A;  2XHC A;  1QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...