4F6UB

Crystal structure of human cdk8/cycc in complex with compound 5 (1-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]-3-[3-(morpholin-4-yl)propyl]urea)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
267
Chain Sequence
b'DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription/inhibitor
total genus 98
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB01
4I3ZB 4YOSA 5LQFB 1AISB 2QDJA 1OIUB 2WHBB 3BHVB 1W98B 4BCMD 4RODA 1GUXB 2C6TB 3BLRB 4ROEA 1FINB 4BCKB 3MI9B 4F7LB 4EOPB 3EJ1B 3EOCB 1QMZB 1O9KA 3DDQB 2UZDB 4BCJB 4EOQB 4CFXB 2I40B 4EOKB 2BKZB 4OR5B 4F7NB 5EFQB 5LMKB 4Y72B 4EOLB 5HQ0B 4YOZA 4UN0A 4EC8B 1AD6A 1E9HB 4EOSB 4CRLB 2V22B 4FX3B 1ZP2A 3TNIB 5IF1B 4F6WB 3RGFB 3F5XB 2WEVB 2C5VB 3K7AM 3M03A 2WIHB 1JOWA 2CCIB 2IW8B 2PHGA 2UZBB 3BHUB 4BCOB 3MY1B 4EOMB 4YC3B 4EONB 2PK9B 5HNBB 2UZLB 4II5B 1H1PB 4G6LB 2W2HA 2WPAB 3QHRB 1XO2A 4F70B 3EIDB 3TNWB 4CFMB 5ACBA 2I53A 1O9KB 1KXUA 1F5QB 3TNHB 5CYIB 1VYWB 1VINA 1OKVB 4BCNB 5IDPB 1H1SB 1OI9B 3O0GD 5CEIB 3BLHB 1FVVB 4EC9B 4ELJA 4F7JB 1UNLD 2R7GA 2W99A 5IDNB 4CFNB 4KRDB 4CFVB 1JSTB 4BCND 4BCQB 3DDPB 4TTHA 2W96A 3LQ5B 1UNGD 2WMAB 4OGRB 4KRCB 1GH6B 2UUEB 1OGUB 1H27B 2EUFA 4BCPB 4CFWB 3G33B 3MIAB 4F6SB 2IVXA 2IW6B 5L2WB 2X1NB 2WXVB 4NSTB 3TN8B 1P5EB 4BCQD 1OL1B 4BCIB 5HBJB 1URCB 2W9FA 2WMBB 1JKWA 2C5NB 2CCHB 2WFYB 1H1RB 1OKWB 2UZEB 4F6UB 4EOOB 2W9ZA 2F2CA 2IW9B 2CJMB 1H24B 2JGZB 4EOJB 1OL2B 2PMIB 4EORB 5ICPB 1GUXA 3DOGB 4YOOA 1VOLA 1G3NC 1H26B 3MY5B 3BHTB 4CFUB 1PKDB 3BLQB 2PK2A 5I5ZB 4ELLA 1H1QB 1BU2A 2G9XB 3H4CA 2C5OB 1D3UB 3POMA 4BCGB 5BNJB 1C9BA 5HVYB 1JSUB 4CFUD 1H4LD 4CXAB 2WIPB 4ROCA 1H25B 3QHWB 2B9RA 2C5XB 5HBHB 4EOIB 1H28B 4BCMB 2C4GB 4BCFB 4IMYB 1GY3B 1N4MA 2BPMB 5FGKB 4F7SB 4BCHB 5HBEB 1UNHD 1TFBA 1OIYB
chains in the Genus database with same CATH superfamily
4I3ZB 2QDJA 4BCKB 4F7LB 3WVDB 3DDQB 2I40B 2DD5B 1AD6A 2V22B 4F6WB 2DD4B 3K7AM 4AI6A 2CCIB 4BCOB 4EOMB 4II5B 2W2HA 2WPAB 3QHRB 1KXUA 3TW7A 1VYWB 2DMEA 5IDPB 3BLHB 4HNUA 5IDNB 4TTHA 3BG9A 1UGRB 3LQ5B 2WMAB 4KRCB 2D0QB 4AKHA 2IVXA 5L2WB 4NSTB 1P5EB 1JKWA 2WFYB 4ZGEB 2LW4A 1H1RB 4BBRM 4EOOB 2F2CA 2IW9B 2JGZB 4EOJB 5ICPB 1G3NC 3VYHB 4FM4B 2DXBB 3X28B 5I5ZB 4ELLA 1H1QB 2G9XB 1ENWA 3HB9A 3HO8A 2QQ8A 2WJ9A 1D3UB 3DTOA 4MFEA 4CXAB 2B9RA 2C5XB 4ZGDB 4BCFB 1N4MA 2BPMB 4BCHB 5HBEB 1OIYB 2AHJB 3BLRB 4EOPB 2DXCB 3EJ1B 1QMZB 2UZDB 4BCJB 4EOQB 3QZ9B 4CFXB 4EOKB 1AHJB 4OR5B 5HQ0B 4YOZA 4EOSB 3X26B 1ZP2A 3X24B 3F5XB 5DQWA 2WEVB 2C5VB 3QZ5B 3A8HB 4EONB 1H1PB 4M6VA 1XO2A 3EIDB 5ACBA 2I53A 1TD6A 4HL4A 1OKVB 1H1SB 1OI9B 4ELJA 4F7JB 1UGPB 2R7GA 4CFNB 1JSTB 4BCND 2W96A 4OGRB 2BS3A 1OGUB 4CFWB 3G33B 3MIAB 4BCQD 4MFDA 4BCIB 2CZ7B 2W9FA 4JX4A 2UZEB 2W9ZA 1OL2B 2PMIB 1GUXA 3DOGB 4YOOA 3MY5B 4CFUB 3VKHA 2PK2A 3H4CA 3POMA 5BNJB 1C9BA 3PO3S 3QHWB 5HBHB 4ZGJB 3QYGB 2C4GB 2CZ6B 2QF7A 3X20B 3BG5A 4YOSA 1AISB 2CYZB 1OIUB 2WHBB 3BHVB 4BCMD 4RODA 3A8GB 1GUXB 2C6TB 3VYGB 1FINB 3MI9B 4Z6YA 1O9KA 2CZ1B 2BKZB 4Y72B 4UN0A 4LOCA 1E9HB 4CRLB 4FX3B 3TNIB 4OB1B 5IF1B 3M03A 2WIHB 2PHGA 2DPPB 3MY1B 2ZPEB 3B57A 4OB3B 4YC3B 2PK9B 5EJCA 2UZLB 4G6LB 4HLQA 4F70B 4CFMB 3TNWB 1O9KB 1F5QB 5CYIB 3DL1A 1VINA 3O0GD 3X25B 5CEIB 1FVVB 4EC9B 2W99A 4BXXX 4CFVB 4KRDB 2KR6A 3DDPB 2EUFA 4F6SB 2IW6B 2QFZA 1OL1B 2IN3A 2WMBB 4OB2B 4JX5A 2CJMB 1UGQB 1H26B 3BHTB 3VKGA 4BY7X 1BU2A 3DJBA 4NC6A 2C5OB 5HVYB 2BS4A 2CZ0B 1UGSB 5FGKB 4F7SB 4ROCA 1TFBA 2ZPGB 5LQFB 5DQVA 1W98B 3A8MB 4ROEA 3WVEB 2BS2A 3QYHB 3EOCB 4HNVA 4F7NB 5EFQB 5LMKB 4EOLB 4JX6A 4EC8B 1E7PA 2ZPIB 2QDYB 3QWLA 3RGFB 3HHTB 1JOWA 2IW8B 2UZBB 3A8LB 3BHUB 2QGSA 3HZJA 5HNBB 4AKIA 3BG3A 3TNHB 4BCNB 3NDQA 4QSHA 2ZPBB 3QYEA 1UNLD 1IREB 3QYBA 2ZPHB 4BY1X 2ZCFB 4BCQB 4AKGA 1QLBA 1UNGD 3A8OB 1GH6B 2UUEB 1H27B 4BCPB 3QXEB 2X1NB 2WXVB 3TN8B 5HBJB 1FKMA 1URCB 2C5NB 2CCHB 4HNTA 1OKWB 4F6UB 1H24B 4BBSM 2KMGA 2ZPFB 4EORB 1V29B 1VOLA 3TW6A 1PKDB 3BLQB 2G77A 4MIMA 3GTMS 2ZZDB 4BCGB 1JSUB 4CFUD 4OB0B 1H4LD 2WIPB 1H25B 3KHIA 4EOIB 1H28B 4BCMB 3HBLA 4IMYB 2PJQA 1GY3B 5IHYA 1UNHD
chains in the Genus database with same CATH topology
4I3ZB 4YOSA 5LQFB 1AISB 2QDJA 1OIUB 2WHBB 3BHVB 1W98B 4BCMD 4RODA 1GUXB 2C6TB 3BLRB 4ROEA 1FINB 4BCKB 3MI9B 4F7LB 4EOPB 3EJ1B 3EOCB 1QMZB 1O9KA 3DDQB 2UZDB 4BCJB 4EOQB 4CFXB 2I40B 4EOKB 2BKZB 4OR5B 4F7NB 5EFQB 5LMKB 4Y72B 4EOLB 5HQ0B 4YOZA 4UN0A 4EC8B 1AD6A 1E9HB 4EOSB 4CRLB 2V22B 4FX3B 1ZP2A 3TNIB 5IF1B 4F6WB 3RGFB 3F5XB 2WEVB 2C5VB 3K7AM 3M03A 2WIHB 1JOWA 2CCIB 2IW8B 2PHGA 2UZBB 3BHUB 4BCOB 3MY1B 4EOMB 4YC3B 4EONB 2PK9B 5HNBB 2UZLB 4II5B 1H1PB 4G6LB 2W2HA 2WPAB 3QHRB 1XO2A 4F70B 3EIDB 3TNWB 4CFMB 5ACBA 2I53A 1O9KB 1KXUA 1F5QB 3TNHB 5CYIB 1VYWB 1VINA 1OKVB 4BCNB 5IDPB 1H1SB 1OI9B 3O0GD 5CEIB 3BLHB 1FVVB 4EC9B 4ELJA 4F7JB 1UNLD 2R7GA 2W99A 5IDNB 4CFNB 4KRDB 4CFVB 1JSTB 4BCND 4BCQB 3DDPB 4TTHA 2W96A 3LQ5B 1UNGD 2WMAB 4OGRB 4KRCB 1GH6B 2UUEB 1OGUB 1H27B 2EUFA 4BCPB 4CFWB 3G33B 3MIAB 4F6SB 2IVXA 2IW6B 5L2WB 2X1NB 2WXVB 4NSTB 3TN8B 1P5EB 4BCQD 1OL1B 4BCIB 5HBJB 1URCB 2W9FA 2WMBB 1JKWA 2C5NB 2CCHB 2WFYB 1H1RB 1OKWB 2UZEB 4F6UB 4EOOB 2W9ZA 2F2CA 2IW9B 2CJMB 1H24B 2JGZB 4EOJB 1OL2B 2PMIB 4EORB 5ICPB 1GUXA 3DOGB 4YOOA 1VOLA 1G3NC 1H26B 3MY5B 3BHTB 4CFUB 1PKDB 3BLQB 2PK2A 5I5ZB 4ELLA 1H1QB 1BU2A 2G9XB 3H4CA 2C5OB 1D3UB 3POMA 4BCGB 5BNJB 1C9BA 5HVYB 1JSUB 4CFUD 1H4LD 4CXAB 2WIPB 4ROCA 1H25B 3QHWB 2B9RA 2C5XB 5HBHB 4EOIB 1H28B 4BCMB 2C4GB 4BCFB 4IMYB 1GY3B 1N4MA 2BPMB 5FGKB 4F7SB 4BCHB 5HBEB 1UNHD 1TFBA 1OIYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3Z B;  4YOS A;  5LQF B;  1AIS B;  2QDJ A;  1OIU B;  2WHB B;  3BHV B;  1W98 B;  4BCM D;  4ROD A;  1GUX B;  2C6T B;  3BLR B;  4ROE A;  1FIN B;  4BCK B;  3MI9 B;  4F7L B;  4EOP B;  3EJ1 B;  3EOC B;  1QMZ B;  1O9K A;  3DDQ B;  2UZD B;  4BCJ B;  4EOQ B;  4CFX B;  2I40 B;  4EOK B;  2BKZ B;  4OR5 B;  4F7N B;  5EFQ B;  5LMK B;  4Y72 B;  4EOL B;  5HQ0 B;  4YOZ A;  4UN0 A;  4EC8 B;  1AD6 A;  1E9H B;  4EOS B;  4CRL B;  2V22 B;  4FX3 B;  1ZP2 A;  3TNI B;  5IF1 B;  4F6W B;  3RGF B;  3F5X B;  2WEV B;  2C5V B;  3K7A M;  3M03 A;  2WIH B;  1JOW A;  2CCI B;  2IW8 B;  2PHG A;  2UZB B;  3BHU B;  4BCO B;  3MY1 B;  4EOM B;  4YC3 B;  4EON B;  2PK9 B;  5HNB B;  2UZL B;  4II5 B;  1H1P B;  4G6L B;  2W2H A;  2WPA B;  3QHR B;  1XO2 A;  4F70 B;  3EID B;  3TNW B;  4CFM B;  5ACB A;  2I53 A;  1O9K B;  1KXU A;  1F5Q B;  3TNH B;  5CYI B;  1VYW B;  1VIN A;  1OKV B;  4BCN B;  5IDP B;  1H1S B;  1OI9 B;  3O0G D;  5CEI B;  3BLH B;  1FVV B;  4EC9 B;  4ELJ A;  4F7J B;  1UNL D;  2R7G A;  2W99 A;  5IDN B;  4CFN B;  4KRD B;  4CFV B;  1JST B;  4BCN D;  4BCQ B;  3DDP B;  4TTH A;  2W96 A;  3LQ5 B;  1UNG D;  2WMA B;  4OGR B;  4KRC B;  1GH6 B;  2UUE B;  1OGU B;  1H27 B;  2EUF A;  4BCP B;  4CFW B;  3G33 B;  3MIA B;  4F6S B;  2IVX A;  2IW6 B;  5L2W B;  2X1N B;  2WXV B;  4NST B;  3TN8 B;  1P5E B;  4BCQ D;  1OL1 B;  4BCI B;  5HBJ B;  1URC B;  2W9F A;  2WMB B;  1JKW A;  2C5N B;  2CCH B;  2WFY B;  1H1R B;  1OKW B;  2UZE B;  4F6U B;  4EOO B;  2W9Z A;  2F2C A;  2IW9 B;  2CJM B;  1H24 B;  2JGZ B;  4EOJ B;  1OL2 B;  2PMI B;  4EOR B;  5ICP B;  1GUX A;  3DOG B;  4YOO A;  1VOL A;  1G3N C;  1H26 B;  3MY5 B;  3BHT B;  4CFU B;  1PKD B;  3BLQ B;  2PK2 A;  5I5Z B;  4ELL A;  1H1Q B;  1BU2 A;  2G9X B;  3H4C A;  2C5O B;  1D3U B;  3POM A;  4BCG B;  5BNJ B;  1C9B A;  5HVY B;  1JSU B;  4CFU D;  1H4L D;  4CXA B;  2WIP B;  4ROC A;  1H25 B;  3QHW B;  2B9R A;  2C5X B;  5HBH B;  4EOI B;  1H28 B;  4BCM B;  2C4G B;  4BCF B;  4IMY B;  1GY3 B;  1N4M A;  2BPM B;  5FGK B;  4F7S B;  4BCH B;  5HBE B;  1UNH D;  1TFB A;  1OIY B; 
#chains in the Genus database with same CATH topology
 4I3Z B;  2QDJ A;  4BCK B;  4F7L B;  3WVD B;  3DDQ B;  2I40 B;  2DD5 B;  1AD6 A;  2V22 B;  4F6W B;  2DD4 B;  3K7A M;  4AI6 A;  2CCI B;  4BCO B;  4EOM B;  4II5 B;  2W2H A;  2WPA B;  3QHR B;  1KXU A;  3TW7 A;  1VYW B;  2DME A;  5IDP B;  3BLH B;  4HNU A;  5IDN B;  4TTH A;  3BG9 A;  1UGR B;  3LQ5 B;  2WMA B;  4KRC B;  2D0Q B;  4AKH A;  2IVX A;  5L2W B;  4NST B;  1P5E B;  1JKW A;  2WFY B;  4ZGE B;  2LW4 A;  1H1R B;  4BBR M;  4EOO B;  2F2C A;  2IW9 B;  2JGZ B;  4EOJ B;  5ICP B;  1G3N C;  3VYH B;  4FM4 B;  2DXB B;  3X28 B;  5I5Z B;  4ELL A;  1H1Q B;  2G9X B;  1ENW A;  3HB9 A;  3HO8 A;  2QQ8 A;  2WJ9 A;  1D3U B;  3DTO A;  4MFE A;  4CXA B;  2B9R A;  2C5X B;  4ZGD B;  4BCF B;  1N4M A;  2BPM B;  4BCH B;  5HBE B;  1OIY B;  2AHJ B;  3BLR B;  4EOP B;  2DXC B;  3EJ1 B;  1QMZ B;  2UZD B;  4BCJ B;  4EOQ B;  3QZ9 B;  4CFX B;  4EOK B;  1AHJ B;  4OR5 B;  5HQ0 B;  4YOZ A;  4EOS B;  3X26 B;  1ZP2 A;  3X24 B;  3F5X B;  5DQW A;  2WEV B;  2C5V B;  3QZ5 B;  3A8H B;  4EON B;  1H1P B;  4M6V A;  1XO2 A;  3EID B;  5ACB A;  2I53 A;  1TD6 A;  4HL4 A;  1OKV B;  1H1S B;  1OI9 B;  4ELJ A;  4F7J B;  1UGP B;  2R7G A;  4CFN B;  1JST B;  4BCN D;  2W96 A;  4OGR B;  2BS3 A;  1OGU B;  4CFW B;  3G33 B;  3MIA B;  4BCQ D;  4MFD A;  4BCI B;  2CZ7 B;  2W9F A;  4JX4 A;  2UZE B;  2W9Z A;  1OL2 B;  2PMI B;  1GUX A;  3DOG B;  4YOO A;  3MY5 B;  4CFU B;  3VKH A;  2PK2 A;  3H4C A;  3POM A;  5BNJ B;  1C9B A;  3PO3 S;  3QHW B;  5HBH B;  4ZGJ B;  3QYG B;  2C4G B;  2CZ6 B;  2QF7 A;  3X20 B;  3BG5 A;  4YOS A;  1AIS B;  2CYZ B;  1OIU B;  2WHB B;  3BHV B;  4BCM D;  4ROD A;  3A8G B;  1GUX B;  2C6T B;  3VYG B;  1FIN B;  3MI9 B;  4Z6Y A;  1O9K A;  2CZ1 B;  2BKZ B;  4Y72 B;  4UN0 A;  4LOC A;  1E9H B;  4CRL B;  4FX3 B;  3TNI B;  4OB1 B;  5IF1 B;  3M03 A;  2WIH B;  2PHG A;  2DPP B;  3MY1 B;  2ZPE B;  3B57 A;  4OB3 B;  4YC3 B;  2PK9 B;  5EJC A;  2UZL B;  4G6L B;  4HLQ A;  4F70 B;  4CFM B;  3TNW B;  1O9K B;  1F5Q B;  5CYI B;  3DL1 A;  1VIN A;  3O0G D;  3X25 B;  5CEI B;  1FVV B;  4EC9 B;  2W99 A;  4BXX X;  4CFV B;  4KRD B;  2KR6 A;  3DDP B;  2EUF A;  4F6S B;  2IW6 B;  2QFZ A;  1OL1 B;  2IN3 A;  2WMB B;  4OB2 B;  4JX5 A;  2CJM B;  1UGQ B;  1H26 B;  3BHT B;  3VKG A;  4BY7 X;  1BU2 A;  3DJB A;  4NC6 A;  2C5O B;  5HVY B;  2BS4 A;  2CZ0 B;  1UGS B;  5FGK B;  4F7S B;  4ROC A;  1TFB A;  2ZPG B;  5LQF B;  5DQV A;  1W98 B;  3A8M B;  4ROE A;  3WVE B;  2BS2 A;  3QYH B;  3EOC B;  4HNV A;  4F7N B;  5EFQ B;  5LMK B;  4EOL B;  4JX6 A;  4EC8 B;  1E7P A;  2ZPI B;  2QDY B;  3QWL A;  3RGF B;  3HHT B;  1JOW A;  2IW8 B;  2UZB B;  3A8L B;  3BHU B;  2QGS A;  3HZJ A;  5HNB B;  4AKI A;  3BG3 A;  3TNH B;  4BCN B;  3NDQ A;  4QSH A;  2ZPB B;  3QYE A;  1UNL D;  1IRE B;  3QYB A;  2ZPH B;  4BY1 X;  2ZCF B;  4BCQ B;  4AKG A;  1QLB A;  1UNG D;  3A8O B;  1GH6 B;  2UUE B;  1H27 B;  4BCP B;  3QXE B;  2X1N B;  2WXV B;  3TN8 B;  5HBJ B;  1FKM A;  1URC B;  2C5N B;  2CCH B;  4HNT A;  1OKW B;  4F6U B;  1H24 B;  4BBS M;  2KMG A;  2ZPF B;  4EOR B;  1V29 B;  1VOL A;  3TW6 A;  1PKD B;  3BLQ B;  2G77 A;  4MIM A;  3GTM S;  2ZZD B;  4BCG B;  1JSU B;  4CFU D;  4OB0 B;  1H4L D;  2WIP B;  1H25 B;  3KHI A;  4EOI B;  1H28 B;  4BCM B;  3HBL A;  4IMY B;  2PJQ A;  1GY3 B;  5IHY A;  1UNH D; 
#chains in the Genus database with same CATH homology
 4I3Z B;  4YOS A;  5LQF B;  1AIS B;  2QDJ A;  1OIU B;  2WHB B;  3BHV B;  1W98 B;  4BCM D;  4ROD A;  1GUX B;  2C6T B;  3BLR B;  4ROE A;  1FIN B;  4BCK B;  3MI9 B;  4F7L B;  4EOP B;  3EJ1 B;  3EOC B;  1QMZ B;  1O9K A;  3DDQ B;  2UZD B;  4BCJ B;  4EOQ B;  4CFX B;  2I40 B;  4EOK B;  2BKZ B;  4OR5 B;  4F7N B;  5EFQ B;  5LMK B;  4Y72 B;  4EOL B;  5HQ0 B;  4YOZ A;  4UN0 A;  4EC8 B;  1AD6 A;  1E9H B;  4EOS B;  4CRL B;  2V22 B;  4FX3 B;  1ZP2 A;  3TNI B;  5IF1 B;  4F6W B;  3RGF B;  3F5X B;  2WEV B;  2C5V B;  3K7A M;  3M03 A;  2WIH B;  1JOW A;  2CCI B;  2IW8 B;  2PHG A;  2UZB B;  3BHU B;  4BCO B;  3MY1 B;  4EOM B;  4YC3 B;  4EON B;  2PK9 B;  5HNB B;  2UZL B;  4II5 B;  1H1P B;  4G6L B;  2W2H A;  2WPA B;  3QHR B;  1XO2 A;  4F70 B;  3EID B;  3TNW B;  4CFM B;  5ACB A;  2I53 A;  1O9K B;  1KXU A;  1F5Q B;  3TNH B;  5CYI B;  1VYW B;  1VIN A;  1OKV B;  4BCN B;  5IDP B;  1H1S B;  1OI9 B;  3O0G D;  5CEI B;  3BLH B;  1FVV B;  4EC9 B;  4ELJ A;  4F7J B;  1UNL D;  2R7G A;  2W99 A;  5IDN B;  4CFN B;  4KRD B;  4CFV B;  1JST B;  4BCN D;  4BCQ B;  3DDP B;  4TTH A;  2W96 A;  3LQ5 B;  1UNG D;  2WMA B;  4OGR B;  4KRC B;  1GH6 B;  2UUE B;  1OGU B;  1H27 B;  2EUF A;  4BCP B;  4CFW B;  3G33 B;  3MIA B;  4F6S B;  2IVX A;  2IW6 B;  5L2W B;  2X1N B;  2WXV B;  4NST B;  3TN8 B;  1P5E B;  4BCQ D;  1OL1 B;  4BCI B;  5HBJ B;  1URC B;  2W9F A;  2WMB B;  1JKW A;  2C5N B;  2CCH B;  2WFY B;  1H1R B;  1OKW B;  2UZE B;  4F6U B;  4EOO B;  2W9Z A;  2F2C A;  2IW9 B;  2CJM B;  1H24 B;  2JGZ B;  4EOJ B;  1OL2 B;  2PMI B;  4EOR B;  5ICP B;  1GUX A;  3DOG B;  4YOO A;  1VOL A;  1G3N C;  1H26 B;  3MY5 B;  3BHT B;  4CFU B;  1PKD B;  3BLQ B;  2PK2 A;  5I5Z B;  4ELL A;  1H1Q B;  1BU2 A;  2G9X B;  3H4C A;  2C5O B;  1D3U B;  3POM A;  4BCG B;  5BNJ B;  1C9B A;  5HVY B;  1JSU B;  4CFU D;  1H4L D;  4CXA B;  2WIP B;  4ROC A;  1H25 B;  3QHW B;  2B9R A;  2C5X B;  5HBH B;  4EOI B;  1H28 B;  4BCM B;  2C4G B;  4BCF B;  4IMY B;  1GY3 B;  1N4M A;  2BPM B;  5FGK B;  4F7S B;  4BCH B;  5HBE B;  1UNH D;  1TFB A;  1OIY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...