4F6UB

Crystal structure of human cdk8/cycc in complex with compound 5 (1-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]-3-[3-(morpholin-4-yl)propyl]urea)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
267
Chain Sequence
DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription/inhibitor
total genus 98
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB01
5IF1B 3BLHB 2EUFA 5HBJB 2IW6B 5EFQB 4F7LB 4BCOB 1JKWA 2UZDB 1PKDB 2CCIB 3G33B 1H1PB 4BCMB 2WIPB 1VYWB 3H4CA 1AISB 2IW8B 1H24B 1OL1B 1XO2A 2PMIB 4G6LB 5IDNB 2QDJA 4EOKB 1OIUB 4CFNB 4OGRB 1H1RB 2WMAB 4BCQD 4EOQB 2C5VB 2C6TB 4YOSA 4BCFB 2BPMB 2UZLB 1UNLD 3EJ1B 1GH6B 4EOJB 5HVYB 4FX3B 1UNHD 3EIDB 2WHBB 1AD6A 1G3NC 1TFBA 3MY5B 4CXAB 5HQ0B 4EONB 4F7JB 4II5B 5HBEB 3TNIB 1JSTB 4Y72B 4YOOA 2X1NB 2W9FA 2C5XB 2I53A 4NSTB 4BCHB 4CFMB 2IVXA 4CFWB 4CRLB 4ROCA 1UNGD 5ACBA 1H26B 1KXUA 1ZP2A 3K7AM 3TNWB 2G9XB 5CEIB 1C9BA 4BCMD 1E9HB 2JGZB 1H28B 5I5ZB 1OGUB 4ROEA 1OI9B 1JOWA 3DDPB 4YC3B 4EOMB 4CFXB 1JSUB 2WFYB 1GUXB 1GUXA 5IDPB 3TNHB 4I3ZB 4F6WB 4TTHA 3BHUB 1H1SB 1OIYB 4RODA 1FINB 4F7SB 2PK9B 1F5QB 4BCIB 3MI9B 3RGFB 3DOGB 1VINA 2WEVB 3MIAB 4BCJB 1OKVB 4UN0A 5ICPB 4ELLA 4F6SB 2W9ZA 2PHGA 4BCGB 4CFUB 3O0GD 4EOPB 4EOIB 2I40B 4CFUD 4EOOB 1H1QB 1QMZB 4CFVB 5L2WB 2PK2A 2W2HA 4BCNB 1BU2A 2C5NB 3DDQB 4F7NB 1H4LD 2C5OB 2W96A 3M03A 3TN8B 3BHVB 4BCPB 4BCND 5LQFB 4YOZA 1D3UB 3QHRB 4EORB 1H27B 1URCB 1FVVB 2WMBB 1W98B 4EC9B 4EOSB 4OR5B 1OL2B 3BLQB 2WPAB 5BNJB 1GY3B 3QHWB 3F5XB 1N4MA 3BLRB 2F2CA 2UZEB 2UUEB 2IW9B 2B9RA 1OKWB 2R7GA 4ELJA 1P5EB 4BCQB 4BCKB 3MY1B 4EOLB 1O9KB 4IMYB 5CYIB 1O9KA 4EC8B 2C4GB 2CCHB 2WXVB 3LQ5B 5LMKB 4F6UB 2UZBB 5FGKB 1VOLA 4KRDB 2W99A 3POMA 1H25B 3EOCB 3BHTB 2BKZB 2V22B 5HBHB 4KRCB 5HNBB 2CJMB 4F70B 2WIHB
chains in the Genus database with same CATH superfamily
2EUFA 3BG3A 2IW6B 5EFQB 2CCIB 2WIPB 1AISB 2IN3A 1H24B 1XO2A 5IDNB 3HB9A 2WMAB 4BCQD 3HO8A 4EOQB 2C5VB 2CYZB 4EOJB 2PJQA 5HVYB 1UNHD 3QZ9B 2WHBB 2QDYB 4BXXX 2DMEA 2I53A 2AHJB 3TNWB 2DD5B 2G9XB 5CEIB 1AHJB 1H28B 4ROEA 4YC3B 4CFXB 2WFYB 1GUXB 4I3ZB 1FINB 3DOGB 1OKVB 3TW7A 2PHGA 3O0GD 4EOIB 4JX4A 4CFVB 5L2WB 2W2HA 1BU2A 3PO3S 2W96A 4BCPB 4ZGEB 2KR6A 4OR5B 4Z6YA 3X26B 1N4MA 2F2CA 2DXCB 4ELJA 4EOLB 1O9KB 5CYIB 3BG9A 1UGPB 3QWLA 2WXVB 3VKGA 2DPPB 2UZBB 1VOLA 3WVEB 4MFDA 3NDQA 1UGRB 1E7PA 4QSHA 2WIHB 5IF1B 3BLHB 5HBJB 4F7LB 4AKIA 4OB0B 4BCOB 1PKDB 2CZ1B 3TW6A 3G33B 1H1PB 3QYHB 3H4CA 3BG5A 2BS3A 4BY7X 4EOKB 4OGRB 1H1RB 2QFZA 2BPMB 2UZLB 1UNLD 2CZ7B 2ZPBB 4FX3B 1TFBA 4CXAB 1TD6A 1JSTB 4YOOA 2X1NB 1IREB 3A8GB 4NSTB 4CFMB 4CRLB 2JGZB 3DDPB 4EOMB 1GUXA 5IDPB 4TTHA 3X20B 4HL4A 4RODA 3A8HB 4CFUB 1QLBA 4CFUD 3QYGB 5DQVA 2G77A 4BCNB 3DDQB 1H4LD 4BCND 3BHVB 4YOZA 2WMBB 1GY3B 3F5XB 5DQWA 4ZGDB 2UZEB 2CZ6B 2B9RA 1OKWB 2R7GA 1O9KA 4AI6A 2C4GB 2CCHB 3LQ5B 1FKMA 2QF7A 2W99A 3POMA 1H25B 2ZPFB 3BHTB 4KRCB 1JKWA 2UZDB 4BCMB 1VYWB 4G6LB 4AKHA 2QDJA 4CFNB 2ZPEB 2C6TB 4BCFB 2ZPIB 3VKHA 3HBLA 3EIDB 4BY1X 1AD6A 1G3NC 4BBSM 4EONB 2ZZDB 4OB2B 4LOCA 3TNIB 4Y72B 2W9FA 4MFEA 4BCHB 4ROCA 2IVXA 3X28B 1UNGD 5ACBA 1H26B 1KXUA 1ZP2A 3QYBA 4NC6A 1OGUB 1UGSB 1OI9B 1JOWA 4JX5A 4HNUA 4HNTA 3A8LB 2ZPGB 4F7SB 2PK9B 3MI9B 4OB3B 3RGFB 1VINA 2WEVB 4BCJB 4UN0A 4ELLA 4EOPB 3B57A 3VYHB 2D0QB 4ZGJB 1QMZB 2PK2A 3M03A 3TN8B 3A8OB 4EORB 3QYEA 4EC9B 4EOSB 3HZJA 2UUEB 2IW9B 3A8MB 3X24B 4BCQB 4BCKB 3MY1B 4EC8B 5FGKB 3EOCB 4M6VA 5HBHB 5HNBB 5EJCA 3VYGB 2CJMB 4HNVA 2CZ0B 1UGQB 4HLQA 2IW8B 2PMIB 1OL1B 2DXBB 1OIUB 4YOSA 3HHTB 3EJ1B 1GH6B 4MIMA 2KMGA 3X25B 3DL1A 3MY5B 5HQ0B 4F7JB 3GTMS 4II5B 5HBEB 3KHIA 2WJ9A 2C5XB 4OB1B 2LW4A 3QZ5B 5IHYA 3DTOA 4CFWB 3DJBA 3QXEB 3K7AM 1C9BA 4FM4B 4BCMD 1E9HB 5I5ZB 4JX6A 2ZCFB 1JSUB 3TNHB 4F6WB 2ZPHB 4BBRM 3BHUB 1H1SB 1OIYB 2DD4B 1F5QB 4BCIB 3MIAB 5ICPB 4F6SB 2W9ZA 4BCGB 3WVDB 2I40B 4EOOB 4AKGA 1H1QB 1ENWA 2C5NB 4F7NB 2C5OB 1D3UB 5LQFB 2BS4A 3QHRB 1H27B 1URCB 1FVVB 1W98B 1OL2B 3BLQB 2WPAB 5BNJB 3QHWB 2QGSA 3BLRB 1P5EB 4IMYB 2BS2A 5LMKB 4F6UB 4KRDB 1V29B 2BKZB 2V22B 2QQ8A 4F70B
chains in the Genus database with same CATH topology
5IF1B 3BLHB 2EUFA 5HBJB 2IW6B 5EFQB 4F7LB 4BCOB 1JKWA 2UZDB 1PKDB 2CCIB 3G33B 1H1PB 4BCMB 2WIPB 1VYWB 3H4CA 1AISB 2IW8B 1H24B 1OL1B 1XO2A 2PMIB 4G6LB 5IDNB 2QDJA 4EOKB 1OIUB 4CFNB 4OGRB 1H1RB 2WMAB 4BCQD 4EOQB 2C5VB 2C6TB 4YOSA 4BCFB 2BPMB 2UZLB 1UNLD 3EJ1B 1GH6B 4EOJB 5HVYB 4FX3B 1UNHD 3EIDB 2WHBB 1AD6A 1G3NC 1TFBA 3MY5B 4CXAB 5HQ0B 4EONB 4F7JB 4II5B 5HBEB 3TNIB 1JSTB 4Y72B 4YOOA 2X1NB 2W9FA 2C5XB 2I53A 4NSTB 4BCHB 4CFMB 2IVXA 4CFWB 4CRLB 4ROCA 1UNGD 5ACBA 1H26B 1KXUA 1ZP2A 3K7AM 3TNWB 2G9XB 5CEIB 1C9BA 4BCMD 1E9HB 2JGZB 1H28B 5I5ZB 1OGUB 4ROEA 1OI9B 1JOWA 3DDPB 4YC3B 4EOMB 4CFXB 1JSUB 2WFYB 1GUXB 1GUXA 5IDPB 3TNHB 4I3ZB 4F6WB 4TTHA 3BHUB 1H1SB 1OIYB 4RODA 1FINB 4F7SB 2PK9B 1F5QB 4BCIB 3MI9B 3RGFB 3DOGB 1VINA 2WEVB 3MIAB 4BCJB 1OKVB 4UN0A 5ICPB 4ELLA 4F6SB 2W9ZA 2PHGA 4BCGB 4CFUB 3O0GD 4EOPB 4EOIB 2I40B 4CFUD 4EOOB 1H1QB 1QMZB 4CFVB 5L2WB 2PK2A 2W2HA 4BCNB 1BU2A 2C5NB 3DDQB 4F7NB 1H4LD 2C5OB 2W96A 3M03A 3TN8B 3BHVB 4BCPB 4BCND 5LQFB 4YOZA 1D3UB 3QHRB 4EORB 1H27B 1URCB 1FVVB 2WMBB 1W98B 4EC9B 4EOSB 4OR5B 1OL2B 3BLQB 2WPAB 5BNJB 1GY3B 3QHWB 3F5XB 1N4MA 3BLRB 2F2CA 2UZEB 2UUEB 2IW9B 2B9RA 1OKWB 2R7GA 4ELJA 1P5EB 4BCQB 4BCKB 3MY1B 4EOLB 1O9KB 4IMYB 5CYIB 1O9KA 4EC8B 2C4GB 2CCHB 2WXVB 3LQ5B 5LMKB 4F6UB 2UZBB 5FGKB 1VOLA 4KRDB 2W99A 3POMA 1H25B 3EOCB 3BHTB 2BKZB 2V22B 5HBHB 4KRCB 5HNBB 2CJMB 4F70B 2WIHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IF1 B;  3BLH B;  2EUF A;  5HBJ B;  2IW6 B;  5EFQ B;  4F7L B;  4BCO B;  1JKW A;  2UZD B;  1PKD B;  2CCI B;  3G33 B;  1H1P B;  4BCM B;  2WIP B;  1VYW B;  3H4C A;  1AIS B;  2IW8 B;  1H24 B;  1OL1 B;  1XO2 A;  2PMI B;  4G6L B;  5IDN B;  2QDJ A;  4EOK B;  1OIU B;  4CFN B;  4OGR B;  1H1R B;  2WMA B;  4BCQ D;  4EOQ B;  2C5V B;  2C6T B;  4YOS A;  4BCF B;  2BPM B;  2UZL B;  1UNL D;  3EJ1 B;  1GH6 B;  4EOJ B;  5HVY B;  4FX3 B;  1UNH D;  3EID B;  2WHB B;  1AD6 A;  1G3N C;  1TFB A;  3MY5 B;  4CXA B;  5HQ0 B;  4EON B;  4F7J B;  4II5 B;  5HBE B;  3TNI B;  1JST B;  4Y72 B;  4YOO A;  2X1N B;  2W9F A;  2C5X B;  2I53 A;  4NST B;  4BCH B;  4CFM B;  2IVX A;  4CFW B;  4CRL B;  4ROC A;  1UNG D;  5ACB A;  1H26 B;  1KXU A;  1ZP2 A;  3K7A M;  3TNW B;  2G9X B;  5CEI B;  1C9B A;  4BCM D;  1E9H B;  2JGZ B;  1H28 B;  5I5Z B;  1OGU B;  4ROE A;  1OI9 B;  1JOW A;  3DDP B;  4YC3 B;  4EOM B;  4CFX B;  1JSU B;  2WFY B;  1GUX B;  1GUX A;  5IDP B;  3TNH B;  4I3Z B;  4F6W B;  4TTH A;  3BHU B;  1H1S B;  1OIY B;  4ROD A;  1FIN B;  4F7S B;  2PK9 B;  1F5Q B;  4BCI B;  3MI9 B;  3RGF B;  3DOG B;  1VIN A;  2WEV B;  3MIA B;  4BCJ B;  1OKV B;  4UN0 A;  5ICP B;  4ELL A;  4F6S B;  2W9Z A;  2PHG A;  4BCG B;  4CFU B;  3O0G D;  4EOP B;  4EOI B;  2I40 B;  4CFU D;  4EOO B;  1H1Q B;  1QMZ B;  4CFV B;  5L2W B;  2PK2 A;  2W2H A;  4BCN B;  1BU2 A;  2C5N B;  3DDQ B;  4F7N B;  1H4L D;  2C5O B;  2W96 A;  3M03 A;  3TN8 B;  3BHV B;  4BCP B;  4BCN D;  5LQF B;  4YOZ A;  1D3U B;  3QHR B;  4EOR B;  1H27 B;  1URC B;  1FVV B;  2WMB B;  1W98 B;  4EC9 B;  4EOS B;  4OR5 B;  1OL2 B;  3BLQ B;  2WPA B;  5BNJ B;  1GY3 B;  3QHW B;  3F5X B;  1N4M A;  3BLR B;  2F2C A;  2UZE B;  2UUE B;  2IW9 B;  2B9R A;  1OKW B;  2R7G A;  4ELJ A;  1P5E B;  4BCQ B;  4BCK B;  3MY1 B;  4EOL B;  1O9K B;  4IMY B;  5CYI B;  1O9K A;  4EC8 B;  2C4G B;  2CCH B;  2WXV B;  3LQ5 B;  5LMK B;  4F6U B;  2UZB B;  5FGK B;  1VOL A;  4KRD B;  2W99 A;  3POM A;  1H25 B;  3EOC B;  3BHT B;  2BKZ B;  2V22 B;  5HBH B;  4KRC B;  5HNB B;  2CJM B;  4F70 B;  2WIH B; 
#chains in the Genus database with same CATH topology
 2EUF A;  3BG3 A;  2IW6 B;  5EFQ B;  2CCI B;  2WIP B;  1AIS B;  2IN3 A;  1H24 B;  1XO2 A;  5IDN B;  3HB9 A;  2WMA B;  4BCQ D;  3HO8 A;  4EOQ B;  2C5V B;  2CYZ B;  4EOJ B;  2PJQ A;  5HVY B;  1UNH D;  3QZ9 B;  2WHB B;  2QDY B;  4BXX X;  2DME A;  2I53 A;  2AHJ B;  3TNW B;  2DD5 B;  2G9X B;  5CEI B;  1AHJ B;  1H28 B;  4ROE A;  4YC3 B;  4CFX B;  2WFY B;  1GUX B;  4I3Z B;  1FIN B;  3DOG B;  1OKV B;  3TW7 A;  2PHG A;  3O0G D;  4EOI B;  4JX4 A;  4CFV B;  5L2W B;  2W2H A;  1BU2 A;  3PO3 S;  2W96 A;  4BCP B;  4ZGE B;  2KR6 A;  4OR5 B;  4Z6Y A;  3X26 B;  1N4M A;  2F2C A;  2DXC B;  4ELJ A;  4EOL B;  1O9K B;  5CYI B;  3BG9 A;  1UGP B;  3QWL A;  2WXV B;  3VKG A;  2DPP B;  2UZB B;  1VOL A;  3WVE B;  4MFD A;  3NDQ A;  1UGR B;  1E7P A;  4QSH A;  2WIH B;  5IF1 B;  3BLH B;  5HBJ B;  4F7L B;  4AKI A;  4OB0 B;  4BCO B;  1PKD B;  2CZ1 B;  3TW6 A;  3G33 B;  1H1P B;  3QYH B;  3H4C A;  3BG5 A;  2BS3 A;  4BY7 X;  4EOK B;  4OGR B;  1H1R B;  2QFZ A;  2BPM B;  2UZL B;  1UNL D;  2CZ7 B;  2ZPB B;  4FX3 B;  1TFB A;  4CXA B;  1TD6 A;  1JST B;  4YOO A;  2X1N B;  1IRE B;  3A8G B;  4NST B;  4CFM B;  4CRL B;  2JGZ B;  3DDP B;  4EOM B;  1GUX A;  5IDP B;  4TTH A;  3X20 B;  4HL4 A;  4ROD A;  3A8H B;  4CFU B;  1QLB A;  4CFU D;  3QYG B;  5DQV A;  2G77 A;  4BCN B;  3DDQ B;  1H4L D;  4BCN D;  3BHV B;  4YOZ A;  2WMB B;  1GY3 B;  3F5X B;  5DQW A;  4ZGD B;  2UZE B;  2CZ6 B;  2B9R A;  1OKW B;  2R7G A;  1O9K A;  4AI6 A;  2C4G B;  2CCH B;  3LQ5 B;  1FKM A;  2QF7 A;  2W99 A;  3POM A;  1H25 B;  2ZPF B;  3BHT B;  4KRC B;  1JKW A;  2UZD B;  4BCM B;  1VYW B;  4G6L B;  4AKH A;  2QDJ A;  4CFN B;  2ZPE B;  2C6T B;  4BCF B;  2ZPI B;  3VKH A;  3HBL A;  3EID B;  4BY1 X;  1AD6 A;  1G3N C;  4BBS M;  4EON B;  2ZZD B;  4OB2 B;  4LOC A;  3TNI B;  4Y72 B;  2W9F A;  4MFE A;  4BCH B;  4ROC A;  2IVX A;  3X28 B;  1UNG D;  5ACB A;  1H26 B;  1KXU A;  1ZP2 A;  3QYB A;  4NC6 A;  1OGU B;  1UGS B;  1OI9 B;  1JOW A;  4JX5 A;  4HNU A;  4HNT A;  3A8L B;  2ZPG B;  4F7S B;  2PK9 B;  3MI9 B;  4OB3 B;  3RGF B;  1VIN A;  2WEV B;  4BCJ B;  4UN0 A;  4ELL A;  4EOP B;  3B57 A;  3VYH B;  2D0Q B;  4ZGJ B;  1QMZ B;  2PK2 A;  3M03 A;  3TN8 B;  3A8O B;  4EOR B;  3QYE A;  4EC9 B;  4EOS B;  3HZJ A;  2UUE B;  2IW9 B;  3A8M B;  3X24 B;  4BCQ B;  4BCK B;  3MY1 B;  4EC8 B;  5FGK B;  3EOC B;  4M6V A;  5HBH B;  5HNB B;  5EJC A;  3VYG B;  2CJM B;  4HNV A;  2CZ0 B;  1UGQ B;  4HLQ A;  2IW8 B;  2PMI B;  1OL1 B;  2DXB B;  1OIU B;  4YOS A;  3HHT B;  3EJ1 B;  1GH6 B;  4MIM A;  2KMG A;  3X25 B;  3DL1 A;  3MY5 B;  5HQ0 B;  4F7J B;  3GTM S;  4II5 B;  5HBE B;  3KHI A;  2WJ9 A;  2C5X B;  4OB1 B;  2LW4 A;  3QZ5 B;  5IHY A;  3DTO A;  4CFW B;  3DJB A;  3QXE B;  3K7A M;  1C9B A;  4FM4 B;  4BCM D;  1E9H B;  5I5Z B;  4JX6 A;  2ZCF B;  1JSU B;  3TNH B;  4F6W B;  2ZPH B;  4BBR M;  3BHU B;  1H1S B;  1OIY B;  2DD4 B;  1F5Q B;  4BCI B;  3MIA B;  5ICP B;  4F6S B;  2W9Z A;  4BCG B;  3WVD B;  2I40 B;  4EOO B;  4AKG A;  1H1Q B;  1ENW A;  2C5N B;  4F7N B;  2C5O B;  1D3U B;  5LQF B;  2BS4 A;  3QHR B;  1H27 B;  1URC B;  1FVV B;  1W98 B;  1OL2 B;  3BLQ B;  2WPA B;  5BNJ B;  3QHW B;  2QGS A;  3BLR B;  1P5E B;  4IMY B;  2BS2 A;  5LMK B;  4F6U B;  4KRD B;  1V29 B;  2BKZ B;  2V22 B;  2QQ8 A;  4F70 B; 
#chains in the Genus database with same CATH homology
 5IF1 B;  3BLH B;  2EUF A;  5HBJ B;  2IW6 B;  5EFQ B;  4F7L B;  4BCO B;  1JKW A;  2UZD B;  1PKD B;  2CCI B;  3G33 B;  1H1P B;  4BCM B;  2WIP B;  1VYW B;  3H4C A;  1AIS B;  2IW8 B;  1H24 B;  1OL1 B;  1XO2 A;  2PMI B;  4G6L B;  5IDN B;  2QDJ A;  4EOK B;  1OIU B;  4CFN B;  4OGR B;  1H1R B;  2WMA B;  4BCQ D;  4EOQ B;  2C5V B;  2C6T B;  4YOS A;  4BCF B;  2BPM B;  2UZL B;  1UNL D;  3EJ1 B;  1GH6 B;  4EOJ B;  5HVY B;  4FX3 B;  1UNH D;  3EID B;  2WHB B;  1AD6 A;  1G3N C;  1TFB A;  3MY5 B;  4CXA B;  5HQ0 B;  4EON B;  4F7J B;  4II5 B;  5HBE B;  3TNI B;  1JST B;  4Y72 B;  4YOO A;  2X1N B;  2W9F A;  2C5X B;  2I53 A;  4NST B;  4BCH B;  4CFM B;  2IVX A;  4CFW B;  4CRL B;  4ROC A;  1UNG D;  5ACB A;  1H26 B;  1KXU A;  1ZP2 A;  3K7A M;  3TNW B;  2G9X B;  5CEI B;  1C9B A;  4BCM D;  1E9H B;  2JGZ B;  1H28 B;  5I5Z B;  1OGU B;  4ROE A;  1OI9 B;  1JOW A;  3DDP B;  4YC3 B;  4EOM B;  4CFX B;  1JSU B;  2WFY B;  1GUX B;  1GUX A;  5IDP B;  3TNH B;  4I3Z B;  4F6W B;  4TTH A;  3BHU B;  1H1S B;  1OIY B;  4ROD A;  1FIN B;  4F7S B;  2PK9 B;  1F5Q B;  4BCI B;  3MI9 B;  3RGF B;  3DOG B;  1VIN A;  2WEV B;  3MIA B;  4BCJ B;  1OKV B;  4UN0 A;  5ICP B;  4ELL A;  4F6S B;  2W9Z A;  2PHG A;  4BCG B;  4CFU B;  3O0G D;  4EOP B;  4EOI B;  2I40 B;  4CFU D;  4EOO B;  1H1Q B;  1QMZ B;  4CFV B;  5L2W B;  2PK2 A;  2W2H A;  4BCN B;  1BU2 A;  2C5N B;  3DDQ B;  4F7N B;  1H4L D;  2C5O B;  2W96 A;  3M03 A;  3TN8 B;  3BHV B;  4BCP B;  4BCN D;  5LQF B;  4YOZ A;  1D3U B;  3QHR B;  4EOR B;  1H27 B;  1URC B;  1FVV B;  2WMB B;  1W98 B;  4EC9 B;  4EOS B;  4OR5 B;  1OL2 B;  3BLQ B;  2WPA B;  5BNJ B;  1GY3 B;  3QHW B;  3F5X B;  1N4M A;  3BLR B;  2F2C A;  2UZE B;  2UUE B;  2IW9 B;  2B9R A;  1OKW B;  2R7G A;  4ELJ A;  1P5E B;  4BCQ B;  4BCK B;  3MY1 B;  4EOL B;  1O9K B;  4IMY B;  5CYI B;  1O9K A;  4EC8 B;  2C4G B;  2CCH B;  2WXV B;  3LQ5 B;  5LMK B;  4F6U B;  2UZB B;  5FGK B;  1VOL A;  4KRD B;  2W99 A;  3POM A;  1H25 B;  3EOC B;  3BHT B;  2BKZ B;  2V22 B;  5HBH B;  4KRC B;  5HNB B;  2CJM B;  4F70 B;  2WIH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...