4F6UB

Crystal structure of human cdk8/cycc in complex with compound 5 (1-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]-3-[3-(morpholin-4-yl)propyl]urea)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
267
structure length
267
Chain Sequence
DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription/inhibitor
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f6uB01
4TTHA 5EFQB 5CEIB 5ICPB 1O9KA 1G3NC 1O9KB 1ZP2A 2F2CA 2WIPB 2EUFA 2CCHB 4CXAB 3TN8B 5IDPB 2WPAB 3O0GD 2CCIB 1UNHD 4BCQB 4EOQB 5L2WB 4CFXB 5HBEB 1JSTB 2I40B 4UN0A 2C5VB 1KXUA 1F5QB 2JGZB 4EOJB 2B9RA 1OGUB 3H4CA 4BCND 2UZDB 3DDQB 1OL1B 1H1RB 1JSUB 2UZBB 1H27B 1H1QB 4BCPB 4IMYB 2WMAB 5IF1B 4EOKB 4EC9B 2G9XB 4OGRB 2PK9B 1XO2A 4KRCB 3K7AM 3DDPB 5HVYB 3LQ5B 3QHWB 4OR5B 4F6WB 1P5EB 4BCOB 3MY5B 4BCGB 4F7NB 3EIDB 3EJ1B 2W96A 5BNJB 4BCQD 2PMIB 3TNWB 4CFNB 1TFBA 3MY1B 2IW9B 1FINB 1UNLD 2R7GA 1JKWA 2W9FA 2WXVB 3BHUB 3F5XB 1H1PB 2C6TB 3EOCB 4NSTB 4EOPB 3TNIB 4EOSB 4ROEA 1QMZB 4F7SB 3M03A 1VYWB 4EC8B 2PK2A 4YOSA 3QHRB 1JOWA 2BKZB 3BLRB 5IDNB 2BPMB 4F7LB 5HNBB 2W9ZA 3RGFB 1C9BA 3G33B 1H1SB 1D3UB 1VOLA 3DOGB 2I53A 3BLHB 4G6LB 1GY3B 3BHTB 4BCMB 1H25B 4CFUB 2C5OB 4II5B 1H24B 4KRDB 4BCKB 2X1NB 3MI9B 5FGKB 5CYIB 2C5NB 2W99A 1E9HB 5HQ0B 2WMBB 5ACBA 4YC3B 5LQFB 3MIAB 1VINA 2C5XB 1OIUB 4CFWB 2W2HA 3BLQB 4CFMB 1OKVB 4FX3B 4BCJB 4BCFB 3TNHB 1N4MA 2UZLB 1OIYB 4ELLA 4F6UB 1OI9B 4ROCA 1AISB 4Y72B 4CRLB 4EOLB 2IVXA 2UUEB 4I3ZB 2WEVB 4YOZA 4F70B 1GH6B 4CFVB 1H4LD 1H28B 1UNGD 4EOOB 4BCMD 2IW6B 2CJMB 1OKWB 4CFUD 5I5ZB 1GUXA 4BCHB 4EORB 4RODA 5LMKB 3POMA 1FVVB 1GUXB 2V22B 2WFYB 2WHBB 4YOOA 4BCIB 4BCNB 1W98B 2IW8B 1PKDB 5HBJB 1OL2B 1H26B 2C4GB 4EOMB 2PHGA 1URCB 2QDJA 4F6SB 5HBHB 2WIHB 4EONB 4ELJA 4EOIB 3BHVB 1BU2A 1AD6A 2UZEB 4F7JB
chains in the Genus database with same CATH superfamily
2CZ0B 4OB2B 1ZP2A 2F2CA 2WIPB 4BBRM 5IDPB 1UNHD 3QYHB 4UN0A 2C5VB 1KXUA 2JGZB 2KMGA 2LW4A 4BCND 2UZDB 3WVEB 2UZBB 1H27B 4BCPB 4IMYB 2BS4A 2CZ7B 2PJQA 3QHWB 4BCOB 3EIDB 5BNJB 3TNWB 2QDYB 5DQVA 1FINB 4HNUA 2R7GA 1JKWA 3EOCB 4EOPB 3WVDB 3VYHB 4ROEA 1VYWB 4EC8B 4ZGDB 5IDNB 4HL4A 2W9ZA 1D3UB 2QF7A 2ZPIB 1GY3B 2QFZA 2W99A 1E9HB 5HQ0B 5LQFB 1VINA 1OIUB 4OB1B 1OKVB 3QYGB 2DMEA 4CRLB 4Z6YA 2QGSA 4EOLB 2WEVB 4F70B 3A8GB 1UNGD 4JX4A 4BCMD 2DD4B 4RODA 4EORB 3DL1A 5LMKB 2WFYB 2WHBB 4BCIB 4BCNB 1H26B 1URCB 5HBHB 4EONB 3BHVB 2AHJB 4AKIA 4OB0B 2CZ1B 4QSHA 1ENWA 3QZ5B 2CCHB 1FKMA 3O0GD 4EOQB 2ZPGB 1JSTB 3KHIA 1JSUB 4AKGA 5IF1B 4BBSM 2ZPFB 3K7AM 3MY5B 4BCGB 4F7NB 3DJBA 2QQ8A 1UGQB 3QYBA 4ZGJB 3MY1B 1UNLD 2WXVB 2ZPBB 2CYZB 3F5XB 1H1PB 2C6TB 4NSTB 4F7SB 3M03A 4YOSA 3BLRB 2BPMB 4BCMB 1H25B 1H24B 3MI9B 2WJ9A 5FGKB 5CYIB 3QXEB 2DXCB 4CFWB 2W2HA 4CFMB 2ZPEB 3QZ9B 3TNHB 1N4MA 2UZLB 1AISB 4Y72B 3A8MB 1E7PA 2BS3A 2IVXA 4I3ZB 4CFVB 1H4LD 1H28B 4EOOB 2IW6B 1OKWB 4CFUD 4ZGEB 1W98B 2PHGA 2QDJA 3BG5A 5EJCA 4LOCA 5DQWA 4ELJA 4EOIB 3TW6A 1BU2A 2UZEB 4TTHA 5EFQB 4AI6A 4BXXX 1G3NC 2DPPB 2EUFA 4CXAB 1IREB 2WPAB 2CCIB 2ZCFB 3HHTB 4CFXB 3HBLA 4MIMA 1F5QB 4EOJB 4HNTA 2B9RA 1OGUB 3H4CA 1OL1B 3A8LB 1H1RB 1H1QB 4AKHA 4EC9B 2G9XB 4OGRB 3HZJA 4JX6A 2PK9B 4KRCB 3DDPB 3LQ5B 4OR5B 4F6WB 1P5EB 2BS2A 3B57A 2G77A 3VKGA 4BCQD 1AHJB 1UGRB 3X20B 3BHUB 1TD6A 1UGPB 3A8OB 3BG3A 3TNIB 3QWLA 2BKZB 1H1SB 3QYEA 3HO8A 2I53A 3BLHB 3BHTB 3PO3S 4CFUB 2C5OB 4II5B 4BCKB 2X1NB 3VYGB 4NC6A 2C5NB 5ACBA 4YC3B 4JX5A 3BLQB 3GTMS 4FX3B 4MFDA 1V29B 4BCJB 1OIYB 4F6UB 1OI9B 4ROCA 2UUEB 1GH6B 1UGSB 4OB3B 2CJMB 1GUXA 4BCHB 1GUXB 2V22B 3VKHA 5HBJB 2C4GB 4EOMB 4F6SB 2WIHB 1AD6A 4F7JB 5CEIB 2CZ6B 5ICPB 2D0QB 1O9KA 1O9KB 3TN8B 2DD5B 4BCQB 5L2WB 5HBEB 2I40B 3TW7A 3DDQB 4M6VA 3NDQA 2WMAB 4EOKB 1XO2A 5HVYB 3EJ1B 2W96A 2PMIB 4CFNB 1TFBA 2IW9B 2W9FA 4BY7X 3X24B 4EOSB 1QMZB 4FM4B 2PK2A 3QHRB 1JOWA 4F7LB 5HNBB 3RGFB 1C9BA 2DXBB 3G33B 1QLBA 3A8HB 5IHYA 3X26B 1VOLA 3DOGB 4G6LB 2ZZDB 4BY1X 3BG9A 4KRDB 2WMBB 2KR6A 3MIAB 2C5XB 4HNVA 4HLQA 3X28B 4BCFB 4ELLA 3HB9A 4MFEA 4YOZA 5I5ZB 3POMA 1FVVB 4YOOA 2IN3A 2IW8B 1PKDB 1OL2B 2ZPHB 3DTOA 3X25B
chains in the Genus database with same CATH topology
4TTHA 5EFQB 5CEIB 5ICPB 1O9KA 1G3NC 1O9KB 1ZP2A 2F2CA 2WIPB 2EUFA 2CCHB 4CXAB 3TN8B 5IDPB 2WPAB 3O0GD 2CCIB 1UNHD 4BCQB 4EOQB 5L2WB 4CFXB 5HBEB 1JSTB 2I40B 4UN0A 2C5VB 1KXUA 1F5QB 2JGZB 4EOJB 2B9RA 1OGUB 3H4CA 4BCND 2UZDB 3DDQB 1OL1B 1H1RB 1JSUB 2UZBB 1H27B 1H1QB 4BCPB 4IMYB 2WMAB 5IF1B 4EOKB 4EC9B 2G9XB 4OGRB 2PK9B 1XO2A 4KRCB 3K7AM 3DDPB 5HVYB 3LQ5B 3QHWB 4OR5B 4F6WB 1P5EB 4BCOB 3MY5B 4BCGB 4F7NB 3EIDB 3EJ1B 2W96A 5BNJB 4BCQD 2PMIB 3TNWB 4CFNB 1TFBA 3MY1B 2IW9B 1FINB 1UNLD 2R7GA 1JKWA 2W9FA 2WXVB 3BHUB 3F5XB 1H1PB 2C6TB 3EOCB 4NSTB 4EOPB 3TNIB 4EOSB 4ROEA 1QMZB 4F7SB 3M03A 1VYWB 4EC8B 2PK2A 4YOSA 3QHRB 1JOWA 2BKZB 3BLRB 5IDNB 2BPMB 4F7LB 5HNBB 2W9ZA 3RGFB 1C9BA 3G33B 1H1SB 1D3UB 1VOLA 3DOGB 2I53A 3BLHB 4G6LB 1GY3B 3BHTB 4BCMB 1H25B 4CFUB 2C5OB 4II5B 1H24B 4KRDB 4BCKB 2X1NB 3MI9B 5FGKB 5CYIB 2C5NB 2W99A 1E9HB 5HQ0B 2WMBB 5ACBA 4YC3B 5LQFB 3MIAB 1VINA 2C5XB 1OIUB 4CFWB 2W2HA 3BLQB 4CFMB 1OKVB 4FX3B 4BCJB 4BCFB 3TNHB 1N4MA 2UZLB 1OIYB 4ELLA 4F6UB 1OI9B 4ROCA 1AISB 4Y72B 4CRLB 4EOLB 2IVXA 2UUEB 4I3ZB 2WEVB 4YOZA 4F70B 1GH6B 4CFVB 1H4LD 1H28B 1UNGD 4EOOB 4BCMD 2IW6B 2CJMB 1OKWB 4CFUD 5I5ZB 1GUXA 4BCHB 4EORB 4RODA 5LMKB 3POMA 1FVVB 1GUXB 2V22B 2WFYB 2WHBB 4YOOA 4BCIB 4BCNB 1W98B 2IW8B 1PKDB 5HBJB 1OL2B 1H26B 2C4GB 4EOMB 2PHGA 1URCB 2QDJA 4F6SB 5HBHB 2WIHB 4EONB 4ELJA 4EOIB 3BHVB 1BU2A 1AD6A 2UZEB 4F7JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TTH A;  5EFQ B;  5CEI B;  5ICP B;  1O9K A;  1G3N C;  1O9K B;  1ZP2 A;  2F2C A;  2WIP B;  2EUF A;  2CCH B;  4CXA B;  3TN8 B;  5IDP B;  2WPA B;  3O0G D;  2CCI B;  1UNH D;  4BCQ B;  4EOQ B;  5L2W B;  4CFX B;  5HBE B;  1JST B;  2I40 B;  4UN0 A;  2C5V B;  1KXU A;  1F5Q B;  2JGZ B;  4EOJ B;  2B9R A;  1OGU B;  3H4C A;  4BCN D;  2UZD B;  3DDQ B;  1OL1 B;  1H1R B;  1JSU B;  2UZB B;  1H27 B;  1H1Q B;  4BCP B;  4IMY B;  2WMA B;  5IF1 B;  4EOK B;  4EC9 B;  2G9X B;  4OGR B;  2PK9 B;  1XO2 A;  4KRC B;  3K7A M;  3DDP B;  5HVY B;  3LQ5 B;  3QHW B;  4OR5 B;  4F6W B;  1P5E B;  4BCO B;  3MY5 B;  4BCG B;  4F7N B;  3EID B;  3EJ1 B;  2W96 A;  5BNJ B;  4BCQ D;  2PMI B;  3TNW B;  4CFN B;  1TFB A;  3MY1 B;  2IW9 B;  1FIN B;  1UNL D;  2R7G A;  1JKW A;  2W9F A;  2WXV B;  3BHU B;  3F5X B;  1H1P B;  2C6T B;  3EOC B;  4NST B;  4EOP B;  3TNI B;  4EOS B;  4ROE A;  1QMZ B;  4F7S B;  3M03 A;  1VYW B;  4EC8 B;  2PK2 A;  4YOS A;  3QHR B;  1JOW A;  2BKZ B;  3BLR B;  5IDN B;  2BPM B;  4F7L B;  5HNB B;  2W9Z A;  3RGF B;  1C9B A;  3G33 B;  1H1S B;  1D3U B;  1VOL A;  3DOG B;  2I53 A;  3BLH B;  4G6L B;  1GY3 B;  3BHT B;  4BCM B;  1H25 B;  4CFU B;  2C5O B;  4II5 B;  1H24 B;  4KRD B;  4BCK B;  2X1N B;  3MI9 B;  5FGK B;  5CYI B;  2C5N B;  2W99 A;  1E9H B;  5HQ0 B;  2WMB B;  5ACB A;  4YC3 B;  5LQF B;  3MIA B;  1VIN A;  2C5X B;  1OIU B;  4CFW B;  2W2H A;  3BLQ B;  4CFM B;  1OKV B;  4FX3 B;  4BCJ B;  4BCF B;  3TNH B;  1N4M A;  2UZL B;  1OIY B;  4ELL A;  4F6U B;  1OI9 B;  4ROC A;  1AIS B;  4Y72 B;  4CRL B;  4EOL B;  2IVX A;  2UUE B;  4I3Z B;  2WEV B;  4YOZ A;  4F70 B;  1GH6 B;  4CFV B;  1H4L D;  1H28 B;  1UNG D;  4EOO B;  4BCM D;  2IW6 B;  2CJM B;  1OKW B;  4CFU D;  5I5Z B;  1GUX A;  4BCH B;  4EOR B;  4ROD A;  5LMK B;  3POM A;  1FVV B;  1GUX B;  2V22 B;  2WFY B;  2WHB B;  4YOO A;  4BCI B;  4BCN B;  1W98 B;  2IW8 B;  1PKD B;  5HBJ B;  1OL2 B;  1H26 B;  2C4G B;  4EOM B;  2PHG A;  1URC B;  2QDJ A;  4F6S B;  5HBH B;  2WIH B;  4EON B;  4ELJ A;  4EOI B;  3BHV B;  1BU2 A;  1AD6 A;  2UZE B;  4F7J B; 
#chains in the Genus database with same CATH topology
 2CZ0 B;  4OB2 B;  1ZP2 A;  2F2C A;  2WIP B;  4BBR M;  5IDP B;  1UNH D;  3QYH B;  4UN0 A;  2C5V B;  1KXU A;  2JGZ B;  2KMG A;  2LW4 A;  4BCN D;  2UZD B;  3WVE B;  2UZB B;  1H27 B;  4BCP B;  4IMY B;  2BS4 A;  2CZ7 B;  2PJQ A;  3QHW B;  4BCO B;  3EID B;  5BNJ B;  3TNW B;  2QDY B;  5DQV A;  1FIN B;  4HNU A;  2R7G A;  1JKW A;  3EOC B;  4EOP B;  3WVD B;  3VYH B;  4ROE A;  1VYW B;  4EC8 B;  4ZGD B;  5IDN B;  4HL4 A;  2W9Z A;  1D3U B;  2QF7 A;  2ZPI B;  1GY3 B;  2QFZ A;  2W99 A;  1E9H B;  5HQ0 B;  5LQF B;  1VIN A;  1OIU B;  4OB1 B;  1OKV B;  3QYG B;  2DME A;  4CRL B;  4Z6Y A;  2QGS A;  4EOL B;  2WEV B;  4F70 B;  3A8G B;  1UNG D;  4JX4 A;  4BCM D;  2DD4 B;  4ROD A;  4EOR B;  3DL1 A;  5LMK B;  2WFY B;  2WHB B;  4BCI B;  4BCN B;  1H26 B;  1URC B;  5HBH B;  4EON B;  3BHV B;  2AHJ B;  4AKI A;  4OB0 B;  2CZ1 B;  4QSH A;  1ENW A;  3QZ5 B;  2CCH B;  1FKM A;  3O0G D;  4EOQ B;  2ZPG B;  1JST B;  3KHI A;  1JSU B;  4AKG A;  5IF1 B;  4BBS M;  2ZPF B;  3K7A M;  3MY5 B;  4BCG B;  4F7N B;  3DJB A;  2QQ8 A;  1UGQ B;  3QYB A;  4ZGJ B;  3MY1 B;  1UNL D;  2WXV B;  2ZPB B;  2CYZ B;  3F5X B;  1H1P B;  2C6T B;  4NST B;  4F7S B;  3M03 A;  4YOS A;  3BLR B;  2BPM B;  4BCM B;  1H25 B;  1H24 B;  3MI9 B;  2WJ9 A;  5FGK B;  5CYI B;  3QXE B;  2DXC B;  4CFW B;  2W2H A;  4CFM B;  2ZPE B;  3QZ9 B;  3TNH B;  1N4M A;  2UZL B;  1AIS B;  4Y72 B;  3A8M B;  1E7P A;  2BS3 A;  2IVX A;  4I3Z B;  4CFV B;  1H4L D;  1H28 B;  4EOO B;  2IW6 B;  1OKW B;  4CFU D;  4ZGE B;  1W98 B;  2PHG A;  2QDJ A;  3BG5 A;  5EJC A;  4LOC A;  5DQW A;  4ELJ A;  4EOI B;  3TW6 A;  1BU2 A;  2UZE B;  4TTH A;  5EFQ B;  4AI6 A;  4BXX X;  1G3N C;  2DPP B;  2EUF A;  4CXA B;  1IRE B;  2WPA B;  2CCI B;  2ZCF B;  3HHT B;  4CFX B;  3HBL A;  4MIM A;  1F5Q B;  4EOJ B;  4HNT A;  2B9R A;  1OGU B;  3H4C A;  1OL1 B;  3A8L B;  1H1R B;  1H1Q B;  4AKH A;  4EC9 B;  2G9X B;  4OGR B;  3HZJ A;  4JX6 A;  2PK9 B;  4KRC B;  3DDP B;  3LQ5 B;  4OR5 B;  4F6W B;  1P5E B;  2BS2 A;  3B57 A;  2G77 A;  3VKG A;  4BCQ D;  1AHJ B;  1UGR B;  3X20 B;  3BHU B;  1TD6 A;  1UGP B;  3A8O B;  3BG3 A;  3TNI B;  3QWL A;  2BKZ B;  1H1S B;  3QYE A;  3HO8 A;  2I53 A;  3BLH B;  3BHT B;  3PO3 S;  4CFU B;  2C5O B;  4II5 B;  4BCK B;  2X1N B;  3VYG B;  4NC6 A;  2C5N B;  5ACB A;  4YC3 B;  4JX5 A;  3BLQ B;  3GTM S;  4FX3 B;  4MFD A;  1V29 B;  4BCJ B;  1OIY B;  4F6U B;  1OI9 B;  4ROC A;  2UUE B;  1GH6 B;  1UGS B;  4OB3 B;  2CJM B;  1GUX A;  4BCH B;  1GUX B;  2V22 B;  3VKH A;  5HBJ B;  2C4G B;  4EOM B;  4F6S B;  2WIH B;  1AD6 A;  4F7J B;  5CEI B;  2CZ6 B;  5ICP B;  2D0Q B;  1O9K A;  1O9K B;  3TN8 B;  2DD5 B;  4BCQ B;  5L2W B;  5HBE B;  2I40 B;  3TW7 A;  3DDQ B;  4M6V A;  3NDQ A;  2WMA B;  4EOK B;  1XO2 A;  5HVY B;  3EJ1 B;  2W96 A;  2PMI B;  4CFN B;  1TFB A;  2IW9 B;  2W9F A;  4BY7 X;  3X24 B;  4EOS B;  1QMZ B;  4FM4 B;  2PK2 A;  3QHR B;  1JOW A;  4F7L B;  5HNB B;  3RGF B;  1C9B A;  2DXB B;  3G33 B;  1QLB A;  3A8H B;  5IHY A;  3X26 B;  1VOL A;  3DOG B;  4G6L B;  2ZZD B;  4BY1 X;  3BG9 A;  4KRD B;  2WMB B;  2KR6 A;  3MIA B;  2C5X B;  4HNV A;  4HLQ A;  3X28 B;  4BCF B;  4ELL A;  3HB9 A;  4MFE A;  4YOZ A;  5I5Z B;  3POM A;  1FVV B;  4YOO A;  2IN3 A;  2IW8 B;  1PKD B;  1OL2 B;  2ZPH B;  3DTO A;  3X25 B; 
#chains in the Genus database with same CATH homology
 4TTH A;  5EFQ B;  5CEI B;  5ICP B;  1O9K A;  1G3N C;  1O9K B;  1ZP2 A;  2F2C A;  2WIP B;  2EUF A;  2CCH B;  4CXA B;  3TN8 B;  5IDP B;  2WPA B;  3O0G D;  2CCI B;  1UNH D;  4BCQ B;  4EOQ B;  5L2W B;  4CFX B;  5HBE B;  1JST B;  2I40 B;  4UN0 A;  2C5V B;  1KXU A;  1F5Q B;  2JGZ B;  4EOJ B;  2B9R A;  1OGU B;  3H4C A;  4BCN D;  2UZD B;  3DDQ B;  1OL1 B;  1H1R B;  1JSU B;  2UZB B;  1H27 B;  1H1Q B;  4BCP B;  4IMY B;  2WMA B;  5IF1 B;  4EOK B;  4EC9 B;  2G9X B;  4OGR B;  2PK9 B;  1XO2 A;  4KRC B;  3K7A M;  3DDP B;  5HVY B;  3LQ5 B;  3QHW B;  4OR5 B;  4F6W B;  1P5E B;  4BCO B;  3MY5 B;  4BCG B;  4F7N B;  3EID B;  3EJ1 B;  2W96 A;  5BNJ B;  4BCQ D;  2PMI B;  3TNW B;  4CFN B;  1TFB A;  3MY1 B;  2IW9 B;  1FIN B;  1UNL D;  2R7G A;  1JKW A;  2W9F A;  2WXV B;  3BHU B;  3F5X B;  1H1P B;  2C6T B;  3EOC B;  4NST B;  4EOP B;  3TNI B;  4EOS B;  4ROE A;  1QMZ B;  4F7S B;  3M03 A;  1VYW B;  4EC8 B;  2PK2 A;  4YOS A;  3QHR B;  1JOW A;  2BKZ B;  3BLR B;  5IDN B;  2BPM B;  4F7L B;  5HNB B;  2W9Z A;  3RGF B;  1C9B A;  3G33 B;  1H1S B;  1D3U B;  1VOL A;  3DOG B;  2I53 A;  3BLH B;  4G6L B;  1GY3 B;  3BHT B;  4BCM B;  1H25 B;  4CFU B;  2C5O B;  4II5 B;  1H24 B;  4KRD B;  4BCK B;  2X1N B;  3MI9 B;  5FGK B;  5CYI B;  2C5N B;  2W99 A;  1E9H B;  5HQ0 B;  2WMB B;  5ACB A;  4YC3 B;  5LQF B;  3MIA B;  1VIN A;  2C5X B;  1OIU B;  4CFW B;  2W2H A;  3BLQ B;  4CFM B;  1OKV B;  4FX3 B;  4BCJ B;  4BCF B;  3TNH B;  1N4M A;  2UZL B;  1OIY B;  4ELL A;  4F6U B;  1OI9 B;  4ROC A;  1AIS B;  4Y72 B;  4CRL B;  4EOL B;  2IVX A;  2UUE B;  4I3Z B;  2WEV B;  4YOZ A;  4F70 B;  1GH6 B;  4CFV B;  1H4L D;  1H28 B;  1UNG D;  4EOO B;  4BCM D;  2IW6 B;  2CJM B;  1OKW B;  4CFU D;  5I5Z B;  1GUX A;  4BCH B;  4EOR B;  4ROD A;  5LMK B;  3POM A;  1FVV B;  1GUX B;  2V22 B;  2WFY B;  2WHB B;  4YOO A;  4BCI B;  4BCN B;  1W98 B;  2IW8 B;  1PKD B;  5HBJ B;  1OL2 B;  1H26 B;  2C4G B;  4EOM B;  2PHG A;  1URC B;  2QDJ A;  4F6S B;  5HBH B;  2WIH B;  4EON B;  4ELJ A;  4EOI B;  3BHV B;  1BU2 A;  1AD6 A;  2UZE B;  4F7J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...