2ZPIB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpiB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpiB02
2DXCA 3HHTB 1UGSB 4OB1B 2AHJB 2CZ7B 3A8LB 3X25B 2DPPB 2QDYB 3VYGA 3QYGB 2PVDB 4ZGJB 1AHJB 2ZPBB 3QZ9B 4FM4B 1IREB 2ZPEB 2ZCFB 2DD5A 1DJ7B 4L6V5 3X20B 4ZGEB 2DD4B 2PVOB 4OB2B 3QYHB 1QP3A 3WVDB 3A8OB 1UGRB 4OB0B 4KT0E 2WSCE 3A8HB 3LW5E 4OB3B 2CZ6B 2O01E 2WSFE 2ZPFB 2D0QB 3A8MB 3X26B 1PSFA 3QXEB 2DD4A 2PUKB 5L8RE 4ZGDB 4XK8E 3X28B 2PU9B 2ZZDA 2DXBB 2ZZDB 2CYZB 3X24B 1V29B 2CZ0B 3A8GB 1QP2A 3VYHB 1JB0E 4Y28E 2PVGB 2DXCB 1UGPB 1GXIE 2PUOB 2ZPHB 2DXBA 3WVEB 3VYGB 1UGQB 2ZPGB 2ZPIB 2CZ1B 2DD5B 3QZ5B 1PSEA 4RKUE 2WSEE
chains in the Genus database with same CATH superfamily
4JRQA 3MY1B 2RQTA 1VQPA 2RJEA 4M7AG 3CD6Q 2KR3A 2RQUA 3JAME 2MI6A 4BXXX 4OMPA 1KQSA 4JDSA 5GAMh 3CCUT 2JS2A 3RKWA 2JTFA 1YI2T 4M78E 1W98B 4AG2C 4L6V5 4BCNB 1OI9B 2EYQA 2HZYA 1UE9A 1N9SA 4HVUA 1KQSS 2NYSA 1Q86R 3QSUA 2LC4A 3M0PA 9ATCB 3CC7T 2PVOB 4OB2B 1BKBA 3QYHB 1FYNA 1B7TA 5DY9A 1YWOA 1BYMA 2UZDB 4MZMA 5HK3A 2BS3A 3A8OB 3JCMW 1SHGA 1VQOT 1AWWA 3OYKA 1LVKA 1Z9QA 3EGDA 1I5LA 2L3RA 4N0AC 5KYYB 2EQKA 2KRSA 4M77G 3SWNC 1NLOC 2DO3A 2HCKA 2HKNA 2DNUA 1KC8R 3JCMP 1K0SA 1H4LD 2WEVB 3VRYA 1R8OB 2FZKB 2K79A 1QCOA 1BCOA 2BE9B 4XTXA 2EYZA 2QQSA 2XI9A 2QK0A 5CKFA 3BG3A 2EIFA 1Y96B 3S3NA 3TU4K 1M3BA 2LQ8A 3MP1A 2LQWA 1VQLQ 2E12A 4J9HA 3EFOB 1ABQA 5EC7A 3M0TA 5GMKm 2E3IA 4A4KA 2DXBA 1QLYA 1TU0B 2MMPA 2KEAA 4CFNB 2RJDA 2JOYA 5KCHA 4HXJA 1B3QA 4BACA 1KQ2A 3QJYA 2LW4A 5FW9A 2KNBB 1PSEA 4QT7A 3RMQA 2A36A 3EFSA 3BDUA 2LQKA 1WXTA 2JXBA 2QGSA 1BIAA 3M0UA 2KXCA 3EIDB 2AHJB 5EFQB 2K7AA 3EG0A 3CC2A 3CCST 4ZGJB 3VV0A 1X75C 4HT8A 2OTJT 1PC0A 1VA7A 4M7DG 3OYEA 3G71A 1PNJA 3I9QA 4C8QA 1NM7A 4C8QB 2AZVA 3N5BB 2W2HA 2DD4B 4FSXA 1X69A 3RESA 3G6ET 1VQ5A 2X9HA 3JCMg 1WZOA 2M9UA 3CCRA 2YWWA 1BCMA 3OYNA 3M4GA 2KSSA 4EMHA 2HAXA 1AVZC 1OOTA 3CCLQ 2LVMA 4M7AF 1YHQQ 2DXUA 1OIYB 2VUBA 2BS4A 1GUXA 2PUKB 4GBQA 4A54A 1AWJA 4OMNA 1GUXB 1I0CA 3I56Q 1TFBA 1WHKA 2YSQA 1I07A 2DIQA 2EQMA 1NJIR 1GFCA 5ACBA 2C0IA 1VQ4Q 1OGUB 3VS7A 4M75B 2YHTA 4J8OA 2QA4T 1M90R 5CYIB 2EYYA 2X4YA 3MI9B 1JB0E 4M78G 5KYUA 5GAOq 2K5IA 5KYUB 3MPUB 4C0ZA 3V7SA 3EH1A 3HFNA 5LJ3h 1TUCA 1OIUB 2DXCB 2RNAA 5FRMA 3C0CA 1SG5A 2MK5A 5A0LA 3F5XB 5I22A 1VYVA 4OGCA 1EZZB 3JCMJ 1KC8C 3BHTB 3SB2A 2FL7A 3JCMh 4AFQC 3CD6A 2DL5A 3J81E 2KY9A 3SFMA 4Z02A 1TSFA 1IGQA 4RKUE 4BI3A 3JB9H 1M4ZA 2JTMA 2JUFA 1RUWA 3NPFA 4A4FA 4J9DA 1BI1A 2W9FA 4FCYA 2IW6B 2QAZA 5CO7A 3AHUA 1QLBA 2HL5C 2NUTB 2YXYA 4A4GA 1AWOA 2RN8A 1VQ7Q 3RR6A 4A4EA 3PE0A 2LJ3A 5KCOA 2DZCA 1K8AC 2K57A 3CCEQ 1SHFA 2PZ1A 4EONB 2ABLA 1SF9A 3SEMA 4ZGEB 1KFZA 4TTHA 3RERA 4AFUC 3CCQQ 5DLQE 1VYWB 3I5SA 4RTYA 1OKWB 4MMLA 3META 3GF5A 3M54A 4IUPA 2B9RA 2W99A 4ZN3A 2F1LA 3HTRA 3R6NA 2KE9A 4G6LB 1P92A 4OB3B 2LTOA 5GANg 1TD6A 2QEXT 3MY5B 1LPLA 4C0DB 1PKSA 2IW8B 3UDCA 5D6XA 1RADB 4M7DF 3M59A 5L2WB 2DJZA 4JS5A 2CKKA 2C0TA 4M6VA 2QYZA 3HP9A 5KYXA 2CS7A 2HDAA 1VQLA 3MHXA 3JB9F 2D0NA 4EC8B 2WHBB 5L23A 1X2QA 4II1A 4PFZA 4E47A 3CC2T 1WHJA 4IIOA 5KYWB 4JJCA 2XHCA 4OGRB 1I4K1 2KT1A 1VIEA 5EJCA 3G7ZA 2LCSA 3L2UA 1ARKA 3G71T 5IHYA 1M27C 4ZN1A 4N4GA 4QSHA 1NLPC 2IVWA 3T9NA 1Q82R 1E6GA 4XQ3A 1NJIC 3QDFA 2DBKA 3OY9A 1X6OA 3M5AA 1BI0A 1M90C 2K2MA 1WHHA 4EOIB 2BS2A 1JEGA 2MPXC 5GANh 4MIMA 4C8QD 2CP2A 3CBPA 4EMKA 4OB1B 4EMKB 2MCNA 1VQKT 1UG1A 3MP6A 3VYGA 2DFUA 2FPEA 3UATA 3QJ6A 1NBEB 5DLOA 5IHNA 4Y92A 2PMIB 4IIMA 3VUBA 5HBEB 3KHIA 2ZCFB 5CKHA 4J6WA 1QVFP 3OYJA 2CUBA 5LMKB 1KC8U 4JJBA 1UTIA 1Y57A 5FU6C 1EX4A 4KRDB 2CCIB 3B57A 1N9RA 2QG9B 1H8KA 3EJ1B 3CEYA 2DL7A 1YHQA 3EG1A 2R58A 4AMCA 4F7LB 1QP3A 2EVRA 2FPDA 4F7JB 4N4IA 3BY7A 1M30A 4PJOA 4EOJB 2E6ZA 4M75D 4PJOB 1SRMA 3QPHA 1VQ4A 5GMKj 1VQPQ 1VIFA 4PJLA 4E7HA 4O5VA 5LL6S 2WIHB 2YT6A 4HCKA 1RAAB 4CC4B 3CMEQ 4C8QC 2C5NB 3CD6T 1VUBA 1K8AU 4ESRA 4ZGDB 2V8KA 1SSFA 2L8DA 1JKWA 4PJNA 4GLMA 5D6WA 1WA7A 5GMKe 1M5Q1 2RO0A 1JSUB 3HFOA 3OSVA 3HRUA 1PHTA 1FXXA 5I5ZB 1X43A 1QMCA 4EIKA 4YC3B 1JJ2P 3QBYA 1YCSB 4MFDA 3H0IA 3CCMQ 2J6OA 2CT4A 2F69A 1WHLA 1N4MA 3TCJA 1I81A 2O88A 2IW9B 2DRKA 4XU0A 2JM9A 4M75C 1JQQA 1VQ7A 4Z6YA 2HQEA 4L5GA 3OW2S 1RLPC 4F70B 3CCEA 4RCBA 2M51A 3QIIA 2RF0A 2FG0A 4DA4A 1D1AA 2RB6A 4CC7A 3LWHA 1X6BA 3QYGB 3CCQA 1AZEA 1A0NB 2D1XA 3K7AM 1E7OA 3VS1A 1Q82C 4BCJB 4EDUA 2DA9A 3TNWB 5LJ3d 1YNZA 1G3SA 3MCAB 3HSBA 1O9SA 1WI7A 1VQLT 2C06A 2DLPA 1NJIU 3CPWP 2K5LA 1N27A 2MAMA 3GNGA 3JCMd 4C8QE 1M90U 1NG2A 4CRLB 5LJ3f 3WVDB 1PRLC 3QKJA 2EJGA 4ZTJA 2YUOA 3M9QA 1GCQC 3JCMf 5LJ5e 1D0ZA 4C0GA 5KYNA 2O01E 4PLLA 1MGQA 1YJ9Q 2KAFA 2DETA 1JO8A 3OS1A 2GQVA 1OL2B 1KG1A 2RHYA 2AKKA 4X34A 1BI2A 1TXQA 1WIEA 4P5NA 5GAN2 3P8HA 2WFYB 3DLMA 1KQ1A 4J9BA 2QGFB 2A28A 1MNDA 1M3AA 5CAIA 1QVGP 3JB9J 4BUGA 4Y28E 4L59A 1W4SA 4J9IA 2FVUA 4ROCA 5I2SA 2EKHA 3L42A 4NL2A 4MMKA 1NPRA 4C0DC 1GXIE 3CCRQ 4J9GA 1VQMQ 2DTIA 3POMA 2RA2A 2QQBA 3HRTA 2DIGA 2J05A 2VXFA 3URGA 1ZQ1A 2JN0A 3CCLT 3JCMV 3FC3A 2IIMA 1GFDA 1HK9A 1RI0A 3I55Q 3I56T 2KROA 4J6YA 1MV0B 1WFWA 1VQ4T 1JXMA 1PD1A 3G33B 4LUEA 3GTMS 2D8JA 3PMIA 2CSIA 4C92B 3G1JA 1FMVA 1Z9ZA 1IGUA 3OYGA 1LNXA 4ELYC 3CMAQ 4RMOA 3CC4Q 4AI6A 1X01A 2D6FA 3GPLA 2DD5A 4PJOD 2BKDN 3E9GA 2UZEB 3LWIA 4E7ZA 2VWFA 2XDDA 2E4HA 4RCCA 4PKCC 3BDLA 4HKEA 3THKA 1VQNQ 1ZBXA 3NMZC 5GJWB 1LCKA 1X2KA 4II5B 3V7RA 5IN1A 3LYIA 2CT3A 1QCNA 4CC2A 3CMEA 1M1GA 4EMKC 3VJPA 4FX3B 1JU5C 4HCBA 2XICA 4Q5WA 2BZ8A 5GANd 1BK2A 2FB7A 3ZFJA 1U1SA 4HCZA 4DOWA 1M1KC 4JPBW 4R0KA 2C5VB 2CZ6B 2LX9A 3BLQB 3RGFB 2ZPFB 4KULA 1VQ8A 3UF4A 1PSFA 1TG0A 4IUQA 4A4HA 4RTZA 5GANf 2GCXA 3FLGA 1H1PB 1Q82U 1PCXA 1VQ7T 2O31A 3VS6A 5FU7B 1QCFA 2G9XB 4JZ3A 4FT4A 1QQJA 3CCET 1O9KB 2FRYA 2WACA 3CCMA 4RG2A 4O6JA 2MF2A 4HL4A 1XJWB 5KYYA 1U5SA 4PJOC 3CCQT 2HNIA 4PLIA 4BCIB 4RTUA 2DL4A 4BD3A 2X3WD 2JNGA 1ENWA 2YUPA 5HCKA 4C8QG 3H9NA 1VQ6T 2EAYA 1YITQ 4FYYB 1V1CA 1WX6A 2M02A 3CPFA 3TSZA 4F7UA 4ELZC 2WJ9A 4F7UB 5IT9E 1PRMC 2EW3A 2HKQB 2WMBB 1BB9A 2F2VA 1Y96A 2L3QA 1AEYA 1Q81R 4NC6A 2QQ9A 3EFOA 2W96A 1IO6A 3GNFB 2DPPB 2RQWA 4EORB 1K8AR 2OI3A 4QVZA 1AHJB 3OS0A 4FM4B 4MDWA 1WQ7A 2I2LA 2RHIA 1UDLA 4OMLA 4DBRA 3HPWA 3OS2A 4M75G 4XTYA 5I2MA 2BZYA 2CH4W 3JV3A 2KQWA 4UC4A 4C5IA 1TUGB 2JGZB 3DDPB 4OR5B 4F7NB 1YJ9A 3ZEHA 5HY6A 4JJNK 2HL3A 1C6VX 1IZ6A 1UNHD 2YLCA 1O75A 1Q95G 6AT1B 4LDVA 1MMAA 2LRQA 3OQ5A 5D6YA 4QVCA 4IMYB 3EOCB 4TVRA 1M9SA 4OMOA 3JB9G 1MHNA 2Z0WA 3VU3C 1WLPB 4PFPA 4ATOA 1V76A 5DQWA 2DD4A 3CCVQ 1ZHIA 1K73C 4PJOE 2O2OA 4Y72B 4HLQA 4E7KA 1NEGA 4EOPB 1KHIA 8AT1B 2PU9B 3O8VA 1UECA 4M77B 2FO0A 1SRLA 1MMDA 4B9XA 3UWNA 2RMOA 1U8RA 3FDRA 4LXCA 1EFNA 2VXEA 1H1RB 1VQMA 1IXDA 2EQIA 2MWPA 3MP8A 5CVIA 2VC8A 4RUGA 1LOJA 3CXCP 5J26A 1N8RR 4HCCA 3MEVA 1KHCA 2DE0X 1PM3A 2M0OA 1T0HA 4OMQA 4IUTA 3PVQA 3I55A 1M1KU 1S72Q 5FRNA 3C4SA 4M75A 1D1BA 2G6FX 4RTXA 3OSSC 1VQPT 4C92D 2LZ6B 3FJ5A 4MFEA 4KRTA 1KQSP 3H41A 3PT9A 2RM4A 3LQ5B 3DTOA 3A98A 5D7UA 4C5HA 3CMAA 3BFMA 3CC4A 3HO8A 3M4YA 4MZPA 1GCPA 2DXCA 1FMWA 3VS2A 2KMGA 4CXAB 3A8LB 1N6AA 2P84A 2ED0A 2QDYB 2NUPB 5GAMe 2E5KA 1VQNA 2MIOA 2DYIA 2RI3A 1OPKA 1UHCA 4OGEA 1QVFS 2K2VA 1PWTA 4BBRM 4C8QF 1PKTA 2PQWA 2KK4A 1D0XA 2NUTA 1QMZB 4BE2A 4IUUA 3MEAA 2D8HA 5GMKh 1Q81C 1WYXA 3OYYA 4PJMA 1GCQA 3EHQA 3SDZA 2R57A 2GFAA 4KT0E 3M53A 4OVAA 2WPAB 2DTOA 4NSTB 1YI2Q 5GAN8 5DM7R 3A8MB 2O9VA 2VYTA 2EGEA 2LP5A 3QXEB 1G3TA 1UHFA 3L2QA 3NDQA 3PFSA 2A7YA 2LT4A 2GGRA 2OX7A 3KUFA 2XD0A 2OAUA 3ASKA 2V1QA 1ZX6A 3P8BB 4R56A 1M1FA 2E41A 4M75F 2RHXA 5LJ5g 1SKUB 5GAN7 1H24B 4Y91A 4AKIA 1YITA 3C95A 2L89A 1F5QB 4OMMA 4CRIA 4EOOB 4RTVA 2ENMA 3OBWA 4OF1A 5FWBA 3EHRA 1JJ2S 4M78B 1OU8A 2WIPB 5AYFA 3RMSA 2XKOC 3TNIB 2I53A 1G5VA 4F17A 4C5GA 3JCMQ 1OX9A 5FU7C 3S3OA 4BY7X 1K73U 3JSCA 4QQ6A 3KBGA 4BDYA 3MKDA 1ZUKA 1YJ9T 4AKGA 5KYWA 4K11A 3V7CA 2W0ZA 4C0FA 5HK0A 5HVYB 4LDUA 2VASA 2K4YA 3PTAA 3GIBA 2VGMA 3QYBA 4PJOG 3HHTB 2OTLQ 2BTTA 2P0PA 2XK0A 3G4SQ 1N8RC 5J39A 2NLUA 2LT1A 1GBQA 5C6SA 4BE0A 4QW2A 2RJCA 3QZ9B 2FPFA 2GBQA 4DQ2A 2QTXA 4RTTA 3TEEA 1VQ5T 2OAWA 3TNHB 2L2PA 3QO3A 1OKVB 5HBJB 2KRNA 2EFIA 1WPYA 3CCRT 1R0BG 3EG9A 1RAFB 2AIRB 1VQMT 1WJSA 2RH2A 3CPWS 3EG9B 4R55A 2LJ0A 2EGAA 3CCVA 1H26B 2V8JA 1XO2A 4M77D 3RKXA 4ZTFA 3I55T 2JS0A 2HQHA 1H1QB 4B9WA 2KVQG 4BDZA 2CJMB 1OI1A 3VKHA 1WHMA 3LGFA 4JRIA 2JJ9A 2LNVA 3G6EQ 2ZZDA 2E70A 1OV3A 1QW1A 4KGZB 2C5OB 3CMAT 2ZZDB 3CC4T 5IXBA 1QP2A 3QUIA 1GL5A 2XMFA 4BCPB 1M2OA 4ROEA 1S72A 4HNUA 4VUBA 5KE3A 4QQGA 2IN3A 2VB6A 3FB9A 1H641 1G3NC 2DVEA 1AZGB 1H1SB 1Q81U 4BY6B 2HBPA 2UZBB 1VQNT 1WNLA 2LMJA 5LJ3e 4LN2A 5IF1B 2PVGB 1UGPB 4CFVB 1R77A 2YDLA 3FJPA 2ZPHB 1BI3A 2KBTA 1UGQB 2YRVA 3DKMA 3BE3A 2PHGA 4JS4A 4M77C 2ZPIB 1VQ8Q 2YRDA 3H6ZA 3SWNB 1TWBA 4BCHB 4RTWA 2BIVA 1G8XA 2E5QA 1U3OA 1QVPA 5GAN4 2CGHA 3VS3A 3EGXA 1W2BA 1G2BA 5CQYA 1ZP2A 2EPDA 1K76A 3EGXB 4CC3A 3J80E 3S3MA 2JM8A 4LNPA 4M7DD 2O9SA 3M03A 4F7UE 1D3BA 3TW7A 3X25B 3OBYA 1D3BB 2J6KA 1D1CA 1RACB 1QKWA 2QQRA 2PVDB 3ER0A 1W2BS 3OW2A 2JMAA 2GQIA 3EH2A 2C5XB 2A37A 1B07A 2SEMA 3OA6A 1E6HA 2P0QA 1ZUUA 2RK1A 2K6DA 4YTLA 3JCMb 3OB9A 2HEQA 3PIOA 1YI2A 2R5AA 2X51A 3OYCA 3C12A 4EOMB 5GMKi 1YITT 1C1AA 2DKGA 1AWXA 2F2CA 1M1KR 1I8FA 4LOCA 1GY3B 1AD6A 4BI8B 2O4XA 2V22B 2H3JA 4A53A 4J9EA 3TVTA 2O4XB 2WSCE 2G77A 1N8RU 4PJOF 1WGSA 4JZ4A 2L3SA 4CFXB 4XTZA 2HSPA 4JRPA 3IQLA 5LJ5j 2FEIA 1TUDA 1EIFA 4Z8AA 1H25B 2EYWA 2KR6A 3X28B 1SEMA 1CKAA 3BW1A 3RBBB 2XG8D 4M78D 2JT4A 1UGVA 4AT1B 4ELJA 3F70A 1YIJQ 2SRCA 2RI5A 4JX6A 4FIBA 3HRSA 4BE1A 4M4ZA 1H27B 1MNEA 2ROLA 4KBMB 2R5MA 4XTVA 4XU2A 2ZAEA 2QEXQ 3OYMA 1YFNA 3O0GD 1TS9A 1FX7A 4NL3A 4BY1X 3HB9A 4HT9A 3MJXA 3PO3S 1KK7A 2ZPGB 1UJ0A 2E65A 2DK3A 5A0DA 3UA7A 2OTLA 3G4SA 1WXBA 1WQWA 2GFUA 4CI0C 4BCMB 3NTHA 3MIAB 1JXOA 2FHDA 3INZA 3CCVT 4M75E 2EBPA 2LX7A 1VOLA 3PMTA 3GBQA 3OYBA 1OPLA 1Q7YC 2QGGA 2BUDA 2L3PA 4Z89A 1AISB 2RPNA 2DILA 3L2ZA 5HBHB 2HBWA 5I21A 3C94A 4BCGB 1K4US 2HMAA 5FLXE 1RAHB 3V8LA 1GH6B 1DJ7B 1YHQT 5CEIB 2X3XD 3KFVA 1K0XA 3KXTA 7AT1B 3BG5A 3ULRB 5GAOl 1S72T 2KT8A 2DZ9A 3OMCA 1BU1A 4OMFB 1QKXA 5GAMg 1VQKQ 2C4GB 2WXVB 4PJJA 4C92A 5GAN6 1NE8A 4F7SB 4FT2A 4LDXA 4HNVA 1UGRB 4FL6A 4XU1A 3G6EA 1NPPA 3A8HB 4ZNXA 3BG9A 1K73R 4DBFA 2MOXA 2D0QB 2Y90A 1VYTA 3R6OA 1M3CA 1ZA1B 4GY5A 1T3SA 2DAQA 4XAXB 4RODA 2EJ9A 4XK8E 1W1FA 2AKLA 2EYXA 4J7FA 4F7UG 3SD4A 4J7IA 4HVWA 2NWMA 5LJ5d 4V2SA 1JSTB 1K1ZA 3M0QA 3X24B 4EC9B 4BCKB 1VYUA 3HZJA 2QF7A 3OW2P 1W6XA 3UT1A 1JBMA 2DL8A 5ECAA 1YCYA 2A0FB 4EMGA 3CCJQ 1OZ2A 2QA4A 3QHRB 2X4WA 4WTOB 5LJ5f 3LH0A 2RI2A 3A5ZB 3CXCS 5A2QE 1CSKA 3JCMX 2KRMA 1ABOA 2K3YA 3E2UA 1RI9A 2FYKA 3WVEB 1ZUYA 2RQRA 5KE2A 1IB8A 1YJNQ 1OQKA 1O9KA 4GLKA 1UFFA 2JMCA 2J06A 2BKZB 1UUEA 4JRKA 4QKUA 3QWYA 5FROA 1IHWA 4JX4A 3DDQB 2ESWA 5GJVB 4XU3A 2E3HA 2A08A 4BY6C 4BCOB 1PG5B 1WHGA 3FEOA 4IUVA 2DBMA 2P4RA 1YN8A 2GF7A 3M58A 2AT1B 2ROTA 4C92F 1WJQA 1KXUA 3M57A 5C0MA 3EGDB 3NTIA 2IVXA 4D8DA 2F5TX 5HQ0B 4PL6A 3RKYA 4YOZA 2KYMA 2CUDA 3L1AA 5M9OA 1ZSZA 2RD1A 1MV3A 1ZSZB 3LGLA 4QQDA 1Y07A 5CQXA 3LX7A 4M7AA 5CKBA 2K9GA 2X4JA 3TSWA 4M7AB 3HKSA 1Q7YU 2VGNA 2IG0A 1YIJA 4MZTA 2DVJA 2BE7D 4AKHA 5IHKA 4MDXA 4WF2A 2OTLT 3G4ST 3L2RA 1KIKA 5L8RE 4F6UB 2X1NB 2QEXA 1CKBA 2VVKA 2DXBB 1KJWA 2FZGB 4B6MA 2QQAA 4Z88A 4XTUA 3RUXA 5GAN3 2I0NA 3ZL7C 4CFUB 1M8VA 5FU6B 3EG3A 5CIUA 4BCMD 1S1NA 2RHUA 4PFOA 4XTWA 1VQ9Q 2DF6A 2NUZA 4HA8A 5GAOp 3MEWA 1J3TA 5FGKB 3L2VA 1X6GA 1YP5A 2JZ2A 4M77A 1UEBA 1MUZA 4EOSB 1QWEA 3TREA 1OULA 1AOJA 1QWFA 3ME9A 1K9MR 4JUVA 1LJOA 2LCCA 2CZ1B 3VUZA 3QZ5B 1E7PA 3CQTA 4J9CA 4F7UF 1RLQC 1XNIA 4FW2A 5LJ3g 2K5FA 4KGXB 4HVVA 2AZSA 1D3UB 3QWXX 4OP0A 2CZ7B 3E19A 3BHUB 2D9TA 5GAOr 5GAOn 4ELLA 1D0YA 1IREB 1RL2A 4F04B 2A3LA 1VQKA 3DB3A 1WXUA 5GAMj 1K9AA 3UA6A 3M56A 3X20B 3CMET 1X27A 2DJQA 4BBSM 4KH1B 2KMTA 4LD6A 2E1HA 2P0KA 3BHVB 1Q86C 1OL1B 2EKOA 1YJWQ 2NUPA 2CP5A 2LQNA 4F16A 2ED1A 4FW1A 3TQ7P 4E7JA 1VQ8T 4LDYA 1ZA2B 2QI2A 1QVFA 2KXDA 4RG8A 4F6SB 2DMOA 3QHWB 5HNBB 2V26A 2J6FA 2WSFE 1HYOA 3UPUA 2CDTA 1KD1R 5HKCA 3X26B 4M7DA 2HQXA 4M7DB 1OYXA 2LDMA 3CCMT 1PKDB 5GAN5 4E7LA 3CCJA 2CCHB 2FRWA 3U23A 3OYIA 3MO8A 2DMEA 2CP0A 2JVVA 4M77F 2COZA 1V29B 3RNJA 2YLBA 3S6WA 3A8GB 2L5QA 3D7SB 3CCUQ 4N4HA 4C92C 4AG1C 3HL8A 4J5YA 1YJNA 5IXFA 3A1PA 2E10A 1GBRA 3QYEA 4BCND 2BZXA 1B34A 4DEYA 2MYSA 4BCFB 1B34B 2XDPA 1OZ3A 1PD0A 2Y4XA 2M1HA 4KUIA 5IDNB 3V8JA 3CC7Q 3JRZA 4PNOA 1G3WA 4FYVB 4ME7A 1H28B 5GAOm 3M0SA 2PTKA 3DB4A 1G3YA 1NEBA 1FMKA 1XTDA 5IDPB 4KGVB 4LUDA 1VQOQ 3EFRA 2COWA 4EOLB 1JJ2A 1HXDA 1NYFA 2WSEE 3VS4A 4HNTA 2KGTA 1P5EB 2X35A 2KDSA 5BNJB 3DL1A 1ACMB 2X4XA 3GLXA 1M8MA 2DEQA 1UGSB 4M78A 4F14A 2LCLA 2XDBA 2WMAB 1G83A 3VS5A 2EQUA 1YIJT 4NOYA 2IPOB 2YUNA 2V1RA 1VQ6Q 4YOSA 2MWOA 3AT1B 3EAEA 3VKGA 2F2WA 3NGPA 1IHVA 5KH6A 3REAB 4M7AD 4EPCA 8ATCB 1U06A 3OYFA 1D09B 2VV5A 3NTKA 3H4CA 1K9MC 1SPKA 3H0HA 1BBZA 5GAMd 4FU6A 3RDVA 2Y4YA 2B86A 1Y71A 1UJYA 1E9HB 5KYXB 3EGUA 1XOVA 5LQFB 5GAMf 2I40B 1URCB 4DBQA 5LJ5h 4JLIA 2QQ8A 3BLHB 1HSQA 2JW4A 3PIPA 4CFUD 3CPWA 4LD9K 1U1TA 4C92E 2DEUA 4UN0A 1OU9A 1I5OB 4DOVA 2P4TA 5DQVA 2RQVA 3CBOA 3M55A 3FIFA 2QTVA 3Q1JA 3JB9I 2DL3A 1YWPA 1ZSGA 2DRMA 1VQ9A 1YBYA 2CYZB 4X1VA 4E7SA 3H8ZA 2PNIA 5CK9A 3CCSQ 2GTJA 5IHIA 5ICPB 1ZSZC 1UNLD 3VYHB 1IRXA 2OTJQ 1Q86U 4M7AC 1RAIB 1OX8A 2QASA 5FWCA 3E1SA 4EOKB 1HJDA 1KD1C 2B8AA 5CKEA 4BCQB 4M78F 2EQJA 3VYGB 3VKIA 5LJ3j 1QVGA 2FZCB 1H3ZA 4JLGA 3P8DA 5CR2A 3OYAA 3PNWC 1W70A 5IH2A 1NYGA 2PK2A 1QVGS 1Q7YR 4JX5A 1FKMA 2G3RA 3CBMA 5AT1B 2VKNA 1M2VA 2DERA 3CCLA 1M2VB 4PK4A 2RHZA 2UZLB 2M0YA 2J7IA 2EWNA 1RABB 3JCMe 1VOMA 2ZPBB 3I56A 3I35A 1AT1B 2M16A 4N0AA 2H3EB 2QA4Q 3HBLA 4E6RA 1UNGD 2F5KA 2ZPEB 1YJWA 3SWNA 3CCJT 4IURA 2QFZA 3BLRB 3REBB 2GNCA 2EJFA 2YUQA 3LLRA 2C0OA 2PK9B 5GMKl 4FSSA 1KSWA 5A0GA 1YJNT 4AFZC 2E6NA 3JB9D 1GRIA 1MMGA 3OMGA 4I3ZB 4OB0B 3DOGB 4A63B 5CKDA 3LW5E 2CP6A 1VINA 3DJBA 3E9FA 1TOVA 3CCUA 1T3LA 4M7AE 2UUEB 3NFCA 1FWZA 2EUFA 2K3BA 4C5EA 4E7IA 2YRCA 3JCMc 4LE9A 2L0AA 1Y7XA 3M0RA 1K9MU 1TTHB 3CC7A 3ZBDA 3NHNA 1MMNA 1JOWA 1C0MA 4DEXA 1JRIA 1OEBA 4CFWB 4E2FB 2QDLA 2KYBA 4D6WA 1VQOA 1BIBA 3WXMB 2XU8A 1AD5A 4M7DC 4FYXB 2COYA 2PUOB 4BI4A 4BB7A 1ZLMA 1T0JA 5J3BA 2RK2A 3OYHA 1FINB 3MEUA 1HD3A 1TH7A 1H3HA 3DLLA 3SHWA 1VQ6A 3GOXA 3O5ZA 4M77E 4X9DA 3QWLA 2PJQA 4C92G 4CFMB 1BU2A 2C6TB 2E64A 3LH5A 2BPMB 2AK5A 5GANj 4D8KA 3H0FA 2JTEA 4JJDA 4EOQB 2XIDA 2HSEB 2V8IA 1SSHA 1ZBJA 4LDWA 4KH0B 1KD1U 1WJRA 5EG2A 2KI7A 5GANe 1VQ9T 3CC2Q 4KRCB 3FRNA 2F2XA 2CREA 4KUDK 3L2WA 2RJFA 4J83A 1RAGB 3G71Q 2W10A 2ZGWA 2LJ1A 4M78C 2H8HA 2QXFA 2DX1A 3QHSA 5CCAA 4FYWB 4YOOA 1RAEB 4F6WB 3EG2A 1XQHA 2DM1A 3TN8B 2LNHB 3CCSA 5I11A 1VQ5Q 1H92A 2GTOA 2QDJA 2OTJA 2DTHA 1WDXA 1Y0MA 3PVLA 1C9BA 1I1JA 5IAYA 3V8KA 1UB4A 4IKFA 3QDRB 2K3XA 1R0CB 2ATCB 2OJ2A 4NS5A 4ANJA 2CH4A 2CSQA 4M7DE 4BCQD 3OYLA 3J7AF 2R7GA 2CZ0B 4J9FA 2DXTA 3PGGA 1FVVB 3QG1A 3OS5A 2DYBA 4WCIA 3TW6A 3VRZA 1NZ9A 4X9CA 3OYDA 4DBHA 4J6XA 1YJWT 3GP8A 1W2BP 1F1BB 2HD0A 3VS0A 1N5ZA 2ECZA 4AFSC 2CP3A 2W9ZA 4ORZA 2EGCA 3I5RA 3CXCA 2CP7A 3RIRA 2DD5B 4QVDA
chains in the Genus database with same CATH topology
4F7UF 4C0FA 5HK0A 4JRQA 1XNIA 5LJ3g 3CCEA 4LDUA 1VQPA 4RCBA 2K4YA 2K5FA 3QIIA 3PTAA 3GIBA 2RJEA 3QYBA 2VGMA 4PJOG 3HHTB 4M7AG 4DA4A 2XK0A 2P0PA 1N8RC 4OP0A 2CZ7B 2RB6A 3LWHA 5J39A 2NLUA 3E19A 3JAME 3QYGB 2MI6A 3CCQA 2LT1A 1KQSA 2D9TA 4JDSA 5C6SA 5GAMh 5GAOn 4QW2A 3CCUT 4BE0A 5GAOr 2RJCA 3QZ9B 1IREB 1RL2A 2JTFA 3RKWA 1YI2T 4DQ2A 2QTXA 4M78E 1Q82C 2A3LA 1VQKA 4EDUA 3DB3A 3TEEA 4L6V5 5LJ3d 5GAMj 1G3SA 1VQ5T 3MCAB 2EYQA 3HSBA 3M56A 1N9SA 3QO3A 1KQSS 3X20B 3CMET 1O9SA 3QSUA 4BBSM 2EFIA 1VQLT 2C06A 2LC4A 2KMTA 4LD6A 3CC7T 2PVOB 1NJIU 4OB2B 1BKBA 2E1HA 3QYHB 1WPYA 3CCRT 2K5LA 1N27A 2MAMA 2P0KA 3GNGA 3JCMd 5DY9A 1VQMT 1Q86C 1WJSA 2RH2A 4C8QE 1M90U 3CPWS 2EKOA 4R55A 1BYMA 5LJ3f 3WVDB 3CCVA 3QKJA 4MZMA 2EJGA 4E7JA 5HK3A 1VQ8T 2BS3A 2V8JA 2QI2A 4LDYA 3A8OB 4M77D 3JCMW 1QVFA 4RG8A 1VQOT 3RKXA 4ZTJA 3OYKA 1I5LA 3M9QA 3JCMf 5LJ5e 4ZTFA 2L3RA 4C0GA 3I55T 4N0AC 2O01E 2WSFE 4PLLA 1MGQA 2EQKA 4M77G 2KAFA 3UPUA 5HKCA 3X26B 4M7DA 3SWNC 2HQXA 2DO3A 3OS1A 2GQVA 4M7DB 4B9WA 1KG1A 1OYXA 2LDMA 2RHYA 3CCMT 3JCMP 2KVQG 4BDZA 5GAN5 4E7LA 1OI1A 4X34A 3VKHA 1BI2A 3LGFA 4JRIA 3CCJA 2LNVA 4P5NA 3OYIA 2ZZDA 3MO8A 2E70A 1QW1A 5GAN2 1R8OB 3CMAT 2ZZDB 3P8HA 2JVVA 3DLMA 1KQ1A 4M77F 1V29B 3CC4T 2YLBA 3S6WA 3A8GB 1QP2A 2L5QA 3QUIA 1S72A 4N4HA 4HNUA 4VUBA 4C92C 5KE3A 5CAIA 4QQGA 3JB9J 4XTXA 3FB9A 3HL8A 1H641 2QQSA 4Y28E 4J5YA 4BUGA 2DVEA 1YJNA 2E10A 4L59A 3QYEA 1Q81U 1W4SA 2XI9A 4BY6B 2HBPA 1VQNT 1B34A 5CKFA 3BG3A 2EIFA 2FVUA 1WNLA 5I2SA 1Y96B 3L42A 5LJ3e 1B34B 2XDPA 1OZ3A 4NL2A 2Y4XA 4MMKA 3TU4K 2LQ8A 1NPRA 2M1HA 2PVGB 3MP1A 2E12A 4KUIA 3V8JA 4C0DC 1UGPB 3JRZA 4PNOA 1G3WA 4ME7A 1GXIE 5GAOm 3FJPA 5GMKm 2DTIA 2ZPHB 4A4KA 1BI3A 2DXBA 3DB4A 2MMPA 2RA2A 1G3YA 1UGQB 2QQBA 2YRVA 3DKMA 4JS4A 2RJDA 1XTDA 3HRTA 2ZPIB 4M77C 2DIGA 3URGA 2VXFA 2JOYA 5KCHA 1ZQ1A 2JN0A 3CCLT 4BACA 1KQ2A 3QJYA 3EFRA 3H6ZA 3SWNB 3JCMV 3FC3A 1JJ2A 1HXDA 2BIVA 1PSEA 1HK9A 2E5QA 2WSEE 1QVPA 1RI0A 4HNTA 3RMQA 5GAN4 2CGHA 3EFSA 3BDUA 2LQKA 2X35A 3I56T 1W2BA 2KDSA 3DL1A 1BIAA 5CQYA 4J6YA 2X4XA 3GLXA 1VQ4T 2DEQA 3J80E 1UGSB 4M78A 3S3MA 2LCLA 4F7UE 2XDBA 1D3BA 2AHJB 3TW7A 3X25B 2EQUA 3OBYA 1YIJT 1D3BB 3CC2A 4NOYA 3PMIA 3CCST 2QQRA 2PVDB 4ZGJB 4C92B 3VV0A 3ER0A 3OYGA 1X75C 1W2BS 2MWOA 1LNXA 3OW2A 4HT8A 4M7DG 4ELYC 2OTJT 3EAEA 4RMOA 3OYEA 3VKGA 3G71A 4AI6A 1X01A 2D6FA 3OA6A 3GPLA 5KH6A 4C8QA 2DD5A 4PJOD 2BKDN 2P0QA 4M7AD 4C8QB 3E9GA 4EPCA 3LWIA 2RK1A 3N5BB 4YTLA 3JCMb 2XDDA 3OB9A 4RCCA 2VV5A 3NTKA 3PIOA 3H4CA 4PKCC 3OYFA 1K9MC 3BDLA 2DD4B 4FSXA 4HKEA 1ZBXA 1YI2A 5GAMd 4FU6A 2R5AA 3RESA 3G6ET 3V7RA 2Y4YA 3LYIA 5IN1A 3OYCA 1Y71A 3C12A 1VQ5A 5GMKi 1YITT 3CMEA 1M1GA 2DKGA 3JCMg 4EMKC 3VJPA 4HCBA 1XOVA 2XICA 2M9UA 1I8FA 4LOCA 4Q5WA 4BI8B 3CCRA 5GANd 2O4XA 3S3NA 2H3JA 4A53A 3OYNA 2FB7A 3ZFJA 5GAMf 3M4GA 1U1SA 2KSSA 2O4XB 2WSCE 4HCZA 2G77A 4DOWA 4EMHA 1N8RU 4PJOF 5LJ5h 4JLIA 1M1KC 2CZ6B 2LVMA 2QQ8A 2LX9A 3PIPA 4M7AF 2ZPFB 1WGSA 2DXUA 3CPWA 4KULA 1VQ8A 4LD9K 1U1TA 4XTZA 4C92E 4JRPA 2VUBA 1PSFA 2BS4A 2PUKB 4DOVA 2P4TA 3CBOA 4A54A 5LJ5j 4IUQA 4A4HA 3M55A 1EIFA 5GANf 2GCXA 3FLGA 3FIFA 4M7DD 1Q82U 2KR6A 3X28B 3BW1A 2DIQA 1VQ7T 2EQMA 3Q1JA 2XG8D 5FU7B 3JB9I 4M78D 1VQ9A 4ELJA 1YBYA 3F70A 2CYZB 4M75B 2YHTA 2RI5A 4FT4A 4J8OA 2QA4T 3CCET 3H8ZA 2WACA 4JX6A 4FIBA 3HRSA 5CK9A 4RG2A 3CCMA 4BE1A 4O6JA 2MF2A 3VYHB 2X4YA 4HL4A 4KBMB 2R5MA 1Q86U 1JB0E 4M78G 4XTVA 4XU2A 4PJOC 5GAOq 4M7AC 3CCQT 2HNIA 2K5IA 4PLIA 3OYMA 4C0ZA 3V7SA 4BD3A 3E1SA 3HFNA 1FX7A 5LJ3h 2JNGA 4NL3A 2DXCB 5FRMA 3HB9A 1KD1C 4HT9A 2B8AA 5A0LA 5CKEA 4C8QG 1VQ6T 4M78F 4OGCA 2EQJA 3VYGB 3VKIA 3JCMJ 1KC8C 3SB2A 2EAYA 5LJ3j 2FL7A 3JCMh 1QVGA 2ZPGB 2OTLA 2E65A 2DK3A 5A0DA 1H3ZA 3G4SA 3CD6A 4JLGA 3P8DA 3J81E 2KY9A 1WQWA 3CPFA 3SFMA 2GFUA 4Z02A 4F7UA 3PNWC 4ELZC 4CI0C 3OYAA 3NTHA 2WJ9A 4F7UB 2FHDA 3INZA 5IT9E 4RKUE 3CCVT 4BI3A 4M75E 3JB9H 1M4ZA 2JTMA 1QVGS 2JUFA 4A4FA 4JX5A 1Y96A 1FKMA 2G3RA 3CBMA 1BI1A 3CCLA 4NC6A 3PMTA 2QQ9A 5CO7A 3OYBA 1QLBA 3AHUA 1Q7YC 2BUDA 3GNFB 4A4GA 2RHZA 2DPPB 2EWNA 4QVZA 4A4EA 3JCMe 1AHJB 2ZPBB 3L2ZA 3I56A 2M16A 4N0AA 5KCOA 3OS0A 5I21A 2DZCA 1K8AC 3HBLA 4FM4B 2F5KA 2K57A 2ZPEB 3C94A 4MDWA 1YJWA 1WQ7A 3SWNA 5FLXE 3CCJT 2I2LA 3V8LA 1DJ7B 4IURA 2QFZA 1YHQT 2RHIA 2EJFA 3OS2A 3HPWA 4M75G 3LLRA 4ZGEB 4XTYA 5I2MA 3RERA 5DLQE 2KQWA 3KXTA 4UC4A 4C5IA 3BG5A 5GAOl 1S72T 4MMLA 3META 5GMKl 2DZ9A 3OMCA 1YJ9A 3ZEHA 4OMFB 3GF5A 5HY6A 1YJNT 3M54A 4IUPA 5A0GA 5GAMg 4JJNK 5GAN6 4C92A 1NE8A 4ZN3A 2E6NA 4FT2A 1IZ6A 3JB9D 4LDXA 3OMGA 4HNVA 2YLCA 1UGRB 4OB0B 1O75A 4LDVA 4FL6A 4XU1A 2LRQA 3OQ5A 1NPPA 5D6YA 4QVCA 5CKDA 3G6EA 3A8HB 3LW5E 4TVRA 3BG9A 1M9SA 4OB3B 1P92A 3E9FA 2LTOA 5GANg 2D0QB 2Y90A 3R6OA 1MHNA 2QEXT 3VU3C 3JB9G 4ATOA 4C0DB 4GY5A 3CCUA 2DD4A 1ZHIA 1K73C 4PJOE 3UDCA 5D6XA 2DAQA 4M7AE 4XAXB 4HLQA 2EJ9A 3NFCA 1FWZA 4XK8E 4C5EA 4E7KA 4E7IA 1KHIA 4M7DF 3M59A 4J7FA 4F7UG 3JCMc 3SD4A 2PU9B 2DJZA 4J7IA 4JS5A 3O8VA 4M77B 1Y7XA 2CKKA 5LJ5d 4V2SA 4M6VA 3HP9A 3X24B 3UWNA 4B9XA 2CS7A 1K9MU 1VQLA 3MHXA 3JB9F 3CC7A 3ZBDA 1U8RA 3FDRA 3HZJA 2VXEA 4II1A 1VQMA 2QF7A 2MWPA 3UT1A 1JBMA 3MP8A 5CVIA 1JRIA 4E47A 2VC8A 1YCYA 3CC2T 4EMGA 1OZ2A 2QA4A 1LOJA 2X4WA 5J26A 5LJ5f 4HCCA 3LH0A 2XHCA 1I4K1 1VIEA 5EJCA 1KHCA 2RI2A 3A5ZB 3G7ZA 3MEVA 4D6WA 3L2UA 5A2QE 3CXCS 1VQOA 2M0OA 3G71T 1BIBA 3WXMB 3JCMX 4ZN1A 2XU8A 4IUTA 4M7DC 2K3YA 3I55A 4N4GA 4QSHA 1M1KU 2PUOB 5FRNA 2FYKA 2IVWA 3C4SA 3T9NA 4BB7A 3WVEB 4BI4A 4M75A 5J3BA 2RK2A 4XQ3A 5KE2A 3OYHA 4GLKA 3MEUA 3OSSC 1NJIC 1VQPT 4C92D 3OY9A 4MFEA 1X6OA 4JRKA 3M5AA 1TH7A 3PT9A 1BI0A 3DLLA 1M90C 1VQ6A 5FROA 2RM4A 4M77E 3GOXA 2BS2A 4X9DA 4C5HA 5GANh 4MIMA 3CMAA 3QWLA 4JX4A 3BFMA 4C8QD 4C92G 3CC4A 3HO8A 3M4YA 4MZPA 4XU3A 2E64A 3CBPA 4BY6C 4EMKA 2DXCA 2KMGA 4OB1B 4EMKB 5GANj 3A8LB 1N6AA 1VQKT 2QDYB 3MP6A 3VYGA 3FEOA 5GAMe 2XIDA 3QJ6A 4IUVA 1VQNA 2V8IA 5DLOA 2GF7A 3M58A 4C92F 1WJQA 3M57A 2RI3A 4LDWA 3VUBA 3NTIA 5C0MA 3KHIA 2ZCFB 5CKHA 4J6WA 2F5TX 4OGEA 1KD1U 1WJRA 5EG2A 3OYJA 4PL6A 3RKYA 5GANe 1VQ9T 1QVFS 2K2VA 1KC8U 2HAXA 4BBRM 4C8QF 5FU6C 3FRNA 2PQWA 2KK4A 1N9RA 4KUDK 3L2WA 3CEYA 2RJFA 4J83A 4BE2A 1YHQA 4IUUA 3MEAA 5M9OA 3L1AA 2R58A 1QP3A 2ZGWA 2RD1A 4N4IA 5GMKh 1Q81C 3BY7A 3LGLA 3OYYA 4QQDA 1Y07A 4M78C 5CQXA 3LX7A 4PJOA 2E6ZA 2QXFA 3SDZA 4M75D 4M7AA 2R57A 3QHSA 5CKBA 2X4JA 5CCAA 4PJOB 3QPHA 1VQ4A 4M7AB 3HKSA 2GFAA 4KT0E 3M53A 4OVAA 5GMKj 1VIFA 2DTOA 2VGNA 4E7HA 4O5VA 1Q7YU 5LL6S 2IG0A 5GAN8 1YIJA 4MZTA 1XQHA 5DM7R 3A8MB 3CCSA 4AKHA 2VYTA 4MDXA 2QDJA 4WF2A 2OTJA 3QXEB 2DTHA 4C8QC 2OTLT 1G3TA 3G4ST 3L2RA 3CD6T 1VUBA 1K8AU 5IAYA 3V8KA 5L8RE 4ZGDB 2V8KA 1SSFA 1UB4A 3L2QA 2L8DA 3PFSA 3QDRB 4IKFA 2K3XA 5CR2A 2A7YA 2LT4A 3KUFA 5D6WA 2XD0A 2OAUA 4NS5A 2QEXA 5GMKe 3ASKA 2DXBB 1M5Q1 2RO0A 2QQAA 3P8BB 4R56A 1M1FA 2E41A 4XTUA 3RUXA 5GAN3 3OYLA 3J7AF 2CZ0B 4M7DE 4M75F 2RHXA 2DXTA 3HFOA 3PGGA 3QG1A 3OS5A 3OSVA 5LJ5g 5GAN7 4Y91A 1M8VA 3TW6A 5FU6B 3HRUA 4AKIA 1YITA 3C95A 5CIUA 2L89A 2RHUA 1NZ9A 4CRIA 4X9CA 3OYDA 1FXXA 4XTWA 3OBWA 5GAOp 4HA8A 3MEWA 3QBYA 4MFDA 4J6XA 1YJWT 3GP8A 4OF1A 3L2VA 1JJ2S 4M78B 2F69A 2JZ2A 4M77A 5AYFA 3RMSA 2XKOC 1UEBA 2HD0A 1G5VA 3TCJA 1I81A 4C5GA 3JCMQ 5FU7C 3S3OA 3TREA 4XU0A 1K73U 3JSCA 4M75C 4QQ6A 3ME9A 4JUVA 3KBGA 3CXCA 4BDYA 1LJOA 1VQ7A 2LCCA 1YJ9T 4Z6YA 2CZ1B 2DD5B 4AKGA 3QZ5B 2HQEA 3RIRA 3VUZA 1E7PA 4QVDA 4L5GA 3V7CA 3OW2S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC A;  3HHT B;  1UGS B;  4OB1 B;  2AHJ B;  2CZ7 B;  3A8L B;  3X25 B;  2DPP B;  2QDY B;  3VYG A;  3QYG B;  2PVD B;  4ZGJ B;  1AHJ B;  2ZPB B;  3QZ9 B;  4FM4 B;  1IRE B;  2ZPE B;  2ZCF B;  2DD5 A;  1DJ7 B;  4L6V 5;  3X20 B;  4ZGE B;  2DD4 B;  2PVO B;  4OB2 B;  3QYH B;  1QP3 A;  3WVD B;  3A8O B;  1UGR B;  4OB0 B;  4KT0 E;  2WSC E;  3A8H B;  3LW5 E;  4OB3 B;  2CZ6 B;  2O01 E;  2WSF E;  2ZPF B;  2D0Q B;  3A8M B;  3X26 B;  1PSF A;  3QXE B;  2DD4 A;  2PUK B;  5L8R E;  4ZGD B;  4XK8 E;  3X28 B;  2PU9 B;  2ZZD A;  2DXB B;  2ZZD B;  2CYZ B;  3X24 B;  1V29 B;  2CZ0 B;  3A8G B;  1QP2 A;  3VYH B;  1JB0 E;  4Y28 E;  2PVG B;  2DXC B;  1UGP B;  1GXI E;  2PUO B;  2ZPH B;  2DXB A;  3WVE B;  3VYG B;  1UGQ B;  2ZPG B;  2ZPI B;  2CZ1 B;  2DD5 B;  3QZ5 B;  1PSE A;  4RKU E;  2WSE E; 
#chains in the Genus database with same CATH topology
 4JRQ A;  3MY1 B;  2RQT A;  1VQP A;  2RJE A;  4M7A G;  3CD6 Q;  2KR3 A;  2RQU A;  3JAM E;  2MI6 A;  4BXX X;  4OMP A;  1KQS A;  4JDS A;  5GAM h;  3CCU T;  2JS2 A;  3RKW A;  2JTF A;  1YI2 T;  4M78 E;  1W98 B;  4AG2 C;  4L6V 5;  4BCN B;  1OI9 B;  2EYQ A;  2HZY A;  1UE9 A;  1N9S A;  4HVU A;  1KQS S;  2NYS A;  1Q86 R;  3QSU A;  2LC4 A;  3M0P A;  9ATC B;  3CC7 T;  2PVO B;  4OB2 B;  1BKB A;  3QYH B;  1FYN A;  1B7T A;  5DY9 A;  1YWO A;  1BYM A;  2UZD B;  4MZM A;  5HK3 A;  2BS3 A;  3A8O B;  3JCM W;  1SHG A;  1VQO T;  1AWW A;  3OYK A;  1LVK A;  1Z9Q A;  3EGD A;  1I5L A;  2L3R A;  4N0A C;  5KYY B;  2EQK A;  2KRS A;  4M77 G;  3SWN C;  1NLO C;  2DO3 A;  2HCK A;  2HKN A;  2DNU A;  1KC8 R;  3JCM P;  1K0S A;  1H4L D;  2WEV B;  3VRY A;  1R8O B;  2FZK B;  2K79 A;  1QCO A;  1BCO A;  2BE9 B;  4XTX A;  2EYZ A;  2QQS A;  2XI9 A;  2QK0 A;  5CKF A;  3BG3 A;  2EIF A;  1Y96 B;  3S3N A;  3TU4 K;  1M3B A;  2LQ8 A;  3MP1 A;  2LQW A;  1VQL Q;  2E12 A;  4J9H A;  3EFO B;  1ABQ A;  5EC7 A;  3M0T A;  5GMK m;  2E3I A;  4A4K A;  2DXB A;  1QLY A;  1TU0 B;  2MMP A;  2KEA A;  4CFN B;  2RJD A;  2JOY A;  5KCH A;  4HXJ A;  1B3Q A;  4BAC A;  1KQ2 A;  3QJY A;  2LW4 A;  5FW9 A;  2KNB B;  1PSE A;  4QT7 A;  3RMQ A;  2A36 A;  3EFS A;  3BDU A;  2LQK A;  1WXT A;  2JXB A;  2QGS A;  1BIA A;  3M0U A;  2KXC A;  3EID B;  2AHJ B;  5EFQ B;  2K7A A;  3EG0 A;  3CC2 A;  3CCS T;  4ZGJ B;  3VV0 A;  1X75 C;  4HT8 A;  2OTJ T;  1PC0 A;  1VA7 A;  4M7D G;  3OYE A;  3G71 A;  1PNJ A;  3I9Q A;  4C8Q A;  1NM7 A;  4C8Q B;  2AZV A;  3N5B B;  2W2H A;  2DD4 B;  4FSX A;  1X69 A;  3RES A;  3G6E T;  1VQ5 A;  2X9H A;  3JCM g;  1WZO A;  2M9U A;  3CCR A;  2YWW A;  1BCM A;  3OYN A;  3M4G A;  2KSS A;  4EMH A;  2HAX A;  1AVZ C;  1OOT A;  3CCL Q;  2LVM A;  4M7A F;  1YHQ Q;  2DXU A;  1OIY B;  2VUB A;  2BS4 A;  1GUX A;  2PUK B;  4GBQ A;  4A54 A;  1AWJ A;  4OMN A;  1GUX B;  1I0C A;  3I56 Q;  1TFB A;  1WHK A;  2YSQ A;  1I07 A;  2DIQ A;  2EQM A;  1NJI R;  1GFC A;  5ACB A;  2C0I A;  1VQ4 Q;  1OGU B;  3VS7 A;  4M75 B;  2YHT A;  4J8O A;  2QA4 T;  1M90 R;  5CYI B;  2EYY A;  2X4Y A;  3MI9 B;  1JB0 E;  4M78 G;  5KYU A;  5GAO q;  2K5I A;  5KYU B;  3MPU B;  4C0Z A;  3V7S A;  3EH1 A;  3HFN A;  5LJ3 h;  1TUC A;  1OIU B;  2DXC B;  2RNA A;  5FRM A;  3C0C A;  1SG5 A;  2MK5 A;  5A0L A;  3F5X B;  5I22 A;  1VYV A;  4OGC A;  1EZZ B;  3JCM J;  1KC8 C;  3BHT B;  3SB2 A;  2FL7 A;  3JCM h;  4AFQ C;  3CD6 A;  2DL5 A;  3J81 E;  2KY9 A;  3SFM A;  4Z02 A;  1TSF A;  1IGQ A;  4RKU E;  4BI3 A;  3JB9 H;  1M4Z A;  2JTM A;  2JUF A;  1RUW A;  3NPF A;  4A4F A;  4J9D A;  1BI1 A;  2W9F A;  4FCY A;  2IW6 B;  2QAZ A;  5CO7 A;  3AHU A;  1QLB A;  2HL5 C;  2NUT B;  2YXY A;  4A4G A;  1AWO A;  2RN8 A;  1VQ7 Q;  3RR6 A;  4A4E A;  3PE0 A;  2LJ3 A;  5KCO A;  2DZC A;  1K8A C;  2K57 A;  3CCE Q;  1SHF A;  2PZ1 A;  4EON B;  2ABL A;  1SF9 A;  3SEM A;  4ZGE B;  1KFZ A;  4TTH A;  3RER A;  4AFU C;  3CCQ Q;  5DLQ E;  1VYW B;  3I5S A;  4RTY A;  1OKW B;  4MML A;  3MET A;  3GF5 A;  3M54 A;  4IUP A;  2B9R A;  2W99 A;  4ZN3 A;  2F1L A;  3HTR A;  3R6N A;  2KE9 A;  4G6L B;  1P92 A;  4OB3 B;  2LTO A;  5GAN g;  1TD6 A;  2QEX T;  3MY5 B;  1LPL A;  4C0D B;  1PKS A;  2IW8 B;  3UDC A;  5D6X A;  1RAD B;  4M7D F;  3M59 A;  5L2W B;  2DJZ A;  4JS5 A;  2CKK A;  2C0T A;  4M6V A;  2QYZ A;  3HP9 A;  5KYX A;  2CS7 A;  2HDA A;  1VQL A;  3MHX A;  3JB9 F;  2D0N A;  4EC8 B;  2WHB B;  5L23 A;  1X2Q A;  4II1 A;  4PFZ A;  4E47 A;  3CC2 T;  1WHJ A;  4IIO A;  5KYW B;  4JJC A;  2XHC A;  4OGR B;  1I4K 1;  2KT1 A;  1VIE A;  5EJC A;  3G7Z A;  2LCS A;  3L2U A;  1ARK A;  3G71 T;  5IHY A;  1M27 C;  4ZN1 A;  4N4G A;  4QSH A;  1NLP C;  2IVW A;  3T9N A;  1Q82 R;  1E6G A;  4XQ3 A;  1NJI C;  3QDF A;  2DBK A;  3OY9 A;  1X6O A;  3M5A A;  1BI0 A;  1M90 C;  2K2M A;  1WHH A;  4EOI B;  2BS2 A;  1JEG A;  2MPX C;  5GAN h;  4MIM A;  4C8Q D;  2CP2 A;  3CBP A;  4EMK A;  4OB1 B;  4EMK B;  2MCN A;  1VQK T;  1UG1 A;  3MP6 A;  3VYG A;  2DFU A;  2FPE A;  3UAT A;  3QJ6 A;  1NBE B;  5DLO A;  5IHN A;  4Y92 A;  2PMI B;  4IIM A;  3VUB A;  5HBE B;  3KHI A;  2ZCF B;  5CKH A;  4J6W A;  1QVF P;  3OYJ A;  2CUB A;  5LMK B;  1KC8 U;  4JJB A;  1UTI A;  1Y57 A;  5FU6 C;  1EX4 A;  4KRD B;  2CCI B;  3B57 A;  1N9R A;  2QG9 B;  1H8K A;  3EJ1 B;  3CEY A;  2DL7 A;  1YHQ A;  3EG1 A;  2R58 A;  4AMC A;  4F7L B;  1QP3 A;  2EVR A;  2FPD A;  4F7J B;  4N4I A;  3BY7 A;  1M30 A;  4PJO A;  4EOJ B;  2E6Z A;  4M75 D;  4PJO B;  1SRM A;  3QPH A;  1VQ4 A;  5GMK j;  1VQP Q;  1VIF A;  4PJL A;  4E7H A;  4O5V A;  5LL6 S;  2WIH B;  2YT6 A;  4HCK A;  1RAA B;  4CC4 B;  3CME Q;  4C8Q C;  2C5N B;  3CD6 T;  1VUB A;  1K8A U;  4ESR A;  4ZGD B;  2V8K A;  1SSF A;  2L8D A;  1JKW A;  4PJN A;  4GLM A;  5D6W A;  1WA7 A;  5GMK e;  1M5Q 1;  2RO0 A;  1JSU B;  3HFO A;  3OSV A;  3HRU A;  1PHT A;  1FXX A;  5I5Z B;  1X43 A;  1QMC A;  4EIK A;  4YC3 B;  1JJ2 P;  3QBY A;  1YCS B;  4MFD A;  3H0I A;  3CCM Q;  2J6O A;  2CT4 A;  2F69 A;  1WHL A;  1N4M A;  3TCJ A;  1I81 A;  2O88 A;  2IW9 B;  2DRK A;  4XU0 A;  2JM9 A;  4M75 C;  1JQQ A;  1VQ7 A;  4Z6Y A;  2HQE A;  4L5G A;  3OW2 S;  1RLP C;  4F70 B;  3CCE A;  4RCB A;  2M51 A;  3QII A;  2RF0 A;  2FG0 A;  4DA4 A;  1D1A A;  2RB6 A;  4CC7 A;  3LWH A;  1X6B A;  3QYG B;  3CCQ A;  1AZE A;  1A0N B;  2D1X A;  3K7A M;  1E7O A;  3VS1 A;  1Q82 C;  4BCJ B;  4EDU A;  2DA9 A;  3TNW B;  5LJ3 d;  1YNZ A;  1G3S A;  3MCA B;  3HSB A;  1O9S A;  1WI7 A;  1VQL T;  2C06 A;  2DLP A;  1NJI U;  3CPW P;  2K5L A;  1N27 A;  2MAM A;  3GNG A;  3JCM d;  4C8Q E;  1M90 U;  1NG2 A;  4CRL B;  5LJ3 f;  3WVD B;  1PRL C;  3QKJ A;  2EJG A;  4ZTJ A;  2YUO A;  3M9Q A;  1GCQ C;  3JCM f;  5LJ5 e;  1D0Z A;  4C0G A;  5KYN A;  2O01 E;  4PLL A;  1MGQ A;  1YJ9 Q;  2KAF A;  2DET A;  1JO8 A;  3OS1 A;  2GQV A;  1OL2 B;  1KG1 A;  2RHY A;  2AKK A;  4X34 A;  1BI2 A;  1TXQ A;  1WIE A;  4P5N A;  5GAN 2;  3P8H A;  2WFY B;  3DLM A;  1KQ1 A;  4J9B A;  2QGF B;  2A28 A;  1MND A;  1M3A A;  5CAI A;  1QVG P;  3JB9 J;  4BUG A;  4Y28 E;  4L59 A;  1W4S A;  4J9I A;  2FVU A;  4ROC A;  5I2S A;  2EKH A;  3L42 A;  4NL2 A;  4MMK A;  1NPR A;  4C0D C;  1GXI E;  3CCR Q;  4J9G A;  1VQM Q;  2DTI A;  3POM A;  2RA2 A;  2QQB A;  3HRT A;  2DIG A;  2J05 A;  2VXF A;  3URG A;  1ZQ1 A;  2JN0 A;  3CCL T;  3JCM V;  3FC3 A;  2IIM A;  1GFD A;  1HK9 A;  1RI0 A;  3I55 Q;  3I56 T;  2KRO A;  4J6Y A;  1MV0 B;  1WFW A;  1VQ4 T;  1JXM A;  1PD1 A;  3G33 B;  4LUE A;  3GTM S;  2D8J A;  3PMI A;  2CSI A;  4C92 B;  3G1J A;  1FMV A;  1Z9Z A;  1IGU A;  3OYG A;  1LNX A;  4ELY C;  3CMA Q;  4RMO A;  3CC4 Q;  4AI6 A;  1X01 A;  2D6F A;  3GPL A;  2DD5 A;  4PJO D;  2BKD N;  3E9G A;  2UZE B;  3LWI A;  4E7Z A;  2VWF A;  2XDD A;  2E4H A;  4RCC A;  4PKC C;  3BDL A;  4HKE A;  3THK A;  1VQN Q;  1ZBX A;  3NMZ C;  5GJW B;  1LCK A;  1X2K A;  4II5 B;  3V7R A;  5IN1 A;  3LYI A;  2CT3 A;  1QCN A;  4CC2 A;  3CME A;  1M1G A;  4EMK C;  3VJP A;  4FX3 B;  1JU5 C;  4HCB A;  2XIC A;  4Q5W A;  2BZ8 A;  5GAN d;  1BK2 A;  2FB7 A;  3ZFJ A;  1U1S A;  4HCZ A;  4DOW A;  1M1K C;  4JPB W;  4R0K A;  2C5V B;  2CZ6 B;  2LX9 A;  3BLQ B;  3RGF B;  2ZPF B;  4KUL A;  1VQ8 A;  3UF4 A;  1PSF A;  1TG0 A;  4IUQ A;  4A4H A;  4RTZ A;  5GAN f;  2GCX A;  3FLG A;  1H1P B;  1Q82 U;  1PCX A;  1VQ7 T;  2O31 A;  3VS6 A;  5FU7 B;  1QCF A;  2G9X B;  4JZ3 A;  4FT4 A;  1QQJ A;  3CCE T;  1O9K B;  2FRY A;  2WAC A;  3CCM A;  4RG2 A;  4O6J A;  2MF2 A;  4HL4 A;  1XJW B;  5KYY A;  1U5S A;  4PJO C;  3CCQ T;  2HNI A;  4PLI A;  4BCI B;  4RTU A;  2DL4 A;  4BD3 A;  2X3W D;  2JNG A;  1ENW A;  2YUP A;  5HCK A;  4C8Q G;  3H9N A;  1VQ6 T;  2EAY A;  1YIT Q;  4FYY B;  1V1C A;  1WX6 A;  2M02 A;  3CPF A;  3TSZ A;  4F7U A;  4ELZ C;  2WJ9 A;  4F7U B;  5IT9 E;  1PRM C;  2EW3 A;  2HKQ B;  2WMB B;  1BB9 A;  2F2V A;  1Y96 A;  2L3Q A;  1AEY A;  1Q81 R;  4NC6 A;  2QQ9 A;  3EFO A;  2W96 A;  1IO6 A;  3GNF B;  2DPP B;  2RQW A;  4EOR B;  1K8A R;  2OI3 A;  4QVZ A;  1AHJ B;  3OS0 A;  4FM4 B;  4MDW A;  1WQ7 A;  2I2L A;  2RHI A;  1UDL A;  4OML A;  4DBR A;  3HPW A;  3OS2 A;  4M75 G;  4XTY A;  5I2M A;  2BZY A;  2CH4 W;  3JV3 A;  2KQW A;  4UC4 A;  4C5I A;  1TUG B;  2JGZ B;  3DDP B;  4OR5 B;  4F7N B;  1YJ9 A;  3ZEH A;  5HY6 A;  4JJN K;  2HL3 A;  1C6V X;  1IZ6 A;  1UNH D;  2YLC A;  1O75 A;  1Q95 G;  6AT1 B;  4LDV A;  1MMA A;  2LRQ A;  3OQ5 A;  5D6Y A;  4QVC A;  4IMY B;  3EOC B;  4TVR A;  1M9S A;  4OMO A;  3JB9 G;  1MHN A;  2Z0W A;  3VU3 C;  1WLP B;  4PFP A;  4ATO A;  1V76 A;  5DQW A;  2DD4 A;  3CCV Q;  1ZHI A;  1K73 C;  4PJO E;  2O2O A;  4Y72 B;  4HLQ A;  4E7K A;  1NEG A;  4EOP B;  1KHI A;  8AT1 B;  2PU9 B;  3O8V A;  1UEC A;  4M77 B;  2FO0 A;  1SRL A;  1MMD A;  4B9X A;  3UWN A;  2RMO A;  1U8R A;  3FDR A;  4LXC A;  1EFN A;  2VXE A;  1H1R B;  1VQM A;  1IXD A;  2EQI A;  2MWP A;  3MP8 A;  5CVI A;  2VC8 A;  4RUG A;  1LOJ A;  3CXC P;  5J26 A;  1N8R R;  4HCC A;  3MEV A;  1KHC A;  2DE0 X;  1PM3 A;  2M0O A;  1T0H A;  4OMQ A;  4IUT A;  3PVQ A;  3I55 A;  1M1K U;  1S72 Q;  5FRN A;  3C4S A;  4M75 A;  1D1B A;  2G6F X;  4RTX A;  3OSS C;  1VQP T;  4C92 D;  2LZ6 B;  3FJ5 A;  4MFE A;  4KRT A;  1KQS P;  3H41 A;  3PT9 A;  2RM4 A;  3LQ5 B;  3DTO A;  3A98 A;  5D7U A;  4C5H A;  3CMA A;  3BFM A;  3CC4 A;  3HO8 A;  3M4Y A;  4MZP A;  1GCP A;  2DXC A;  1FMW A;  3VS2 A;  2KMG A;  4CXA B;  3A8L B;  1N6A A;  2P84 A;  2ED0 A;  2QDY B;  2NUP B;  5GAM e;  2E5K A;  1VQN A;  2MIO A;  2DYI A;  2RI3 A;  1OPK A;  1UHC A;  4OGE A;  1QVF S;  2K2V A;  1PWT A;  4BBR M;  4C8Q F;  1PKT A;  2PQW A;  2KK4 A;  1D0X A;  2NUT A;  1QMZ B;  4BE2 A;  4IUU A;  3MEA A;  2D8H A;  5GMK h;  1Q81 C;  1WYX A;  3OYY A;  4PJM A;  1GCQ A;  3EHQ A;  3SDZ A;  2R57 A;  2GFA A;  4KT0 E;  3M53 A;  4OVA A;  2WPA B;  2DTO A;  4NST B;  1YI2 Q;  5GAN 8;  5DM7 R;  3A8M B;  2O9V A;  2VYT A;  2EGE A;  2LP5 A;  3QXE B;  1G3T A;  1UHF A;  3L2Q A;  3NDQ A;  3PFS A;  2A7Y A;  2LT4 A;  2GGR A;  2OX7 A;  3KUF A;  2XD0 A;  2OAU A;  3ASK A;  2V1Q A;  1ZX6 A;  3P8B B;  4R56 A;  1M1F A;  2E41 A;  4M75 F;  2RHX A;  5LJ5 g;  1SKU B;  5GAN 7;  1H24 B;  4Y91 A;  4AKI A;  1YIT A;  3C95 A;  2L89 A;  1F5Q B;  4OMM A;  4CRI A;  4EOO B;  4RTV A;  2ENM A;  3OBW A;  4OF1 A;  5FWB A;  3EHR A;  1JJ2 S;  4M78 B;  1OU8 A;  2WIP B;  5AYF A;  3RMS A;  2XKO C;  3TNI B;  2I53 A;  1G5V A;  4F17 A;  4C5G A;  3JCM Q;  1OX9 A;  5FU7 C;  3S3O A;  4BY7 X;  1K73 U;  3JSC A;  4QQ6 A;  3KBG A;  4BDY A;  3MKD A;  1ZUK A;  1YJ9 T;  4AKG A;  5KYW A;  4K11 A;  3V7C A;  2W0Z A;  4C0F A;  5HK0 A;  5HVY B;  4LDU A;  2VAS A;  2K4Y A;  3PTA A;  3GIB A;  2VGM A;  3QYB A;  4PJO G;  3HHT B;  2OTL Q;  2BTT A;  2P0P A;  2XK0 A;  3G4S Q;  1N8R C;  5J39 A;  2NLU A;  2LT1 A;  1GBQ A;  5C6S A;  4BE0 A;  4QW2 A;  2RJC A;  3QZ9 B;  2FPF A;  2GBQ A;  4DQ2 A;  2QTX A;  4RTT A;  3TEE A;  1VQ5 T;  2OAW A;  3TNH B;  2L2P A;  3QO3 A;  1OKV B;  5HBJ B;  2KRN A;  2EFI A;  1WPY A;  3CCR T;  1R0B G;  3EG9 A;  1RAF B;  2AIR B;  1VQM T;  1WJS A;  2RH2 A;  3CPW S;  3EG9 B;  4R55 A;  2LJ0 A;  2EGA A;  3CCV A;  1H26 B;  2V8J A;  1XO2 A;  4M77 D;  3RKX A;  4ZTF A;  3I55 T;  2JS0 A;  2HQH A;  1H1Q B;  4B9W A;  2KVQ G;  4BDZ A;  2CJM B;  1OI1 A;  3VKH A;  1WHM A;  3LGF A;  4JRI A;  2JJ9 A;  2LNV A;  3G6E Q;  2ZZD A;  2E70 A;  1OV3 A;  1QW1 A;  4KGZ B;  2C5O B;  3CMA T;  2ZZD B;  3CC4 T;  5IXB A;  1QP2 A;  3QUI A;  1GL5 A;  2XMF A;  4BCP B;  1M2O A;  4ROE A;  1S72 A;  4HNU A;  4VUB A;  5KE3 A;  4QQG A;  2IN3 A;  2VB6 A;  3FB9 A;  1H64 1;  1G3N C;  2DVE A;  1AZG B;  1H1S B;  1Q81 U;  4BY6 B;  2HBP A;  2UZB B;  1VQN T;  1WNL A;  2LMJ A;  5LJ3 e;  4LN2 A;  5IF1 B;  2PVG B;  1UGP B;  4CFV B;  1R77 A;  2YDL A;  3FJP A;  2ZPH B;  1BI3 A;  2KBT A;  1UGQ B;  2YRV A;  3DKM A;  3BE3 A;  2PHG A;  4JS4 A;  4M77 C;  2ZPI B;  1VQ8 Q;  2YRD A;  3H6Z A;  3SWN B;  1TWB A;  4BCH B;  4RTW A;  2BIV A;  1G8X A;  2E5Q A;  1U3O A;  1QVP A;  5GAN 4;  2CGH A;  3VS3 A;  3EGX A;  1W2B A;  1G2B A;  5CQY A;  1ZP2 A;  2EPD A;  1K76 A;  3EGX B;  4CC3 A;  3J80 E;  3S3M A;  2JM8 A;  4LNP A;  4M7D D;  2O9S A;  3M03 A;  4F7U E;  1D3B A;  3TW7 A;  3X25 B;  3OBY A;  1D3B B;  2J6K A;  1D1C A;  1RAC B;  1QKW A;  2QQR A;  2PVD B;  3ER0 A;  1W2B S;  3OW2 A;  2JMA A;  2GQI A;  3EH2 A;  2C5X B;  2A37 A;  1B07 A;  2SEM A;  3OA6 A;  1E6H A;  2P0Q A;  1ZUU A;  2RK1 A;  2K6D A;  4YTL A;  3JCM b;  3OB9 A;  2HEQ A;  3PIO A;  1YI2 A;  2R5A A;  2X51 A;  3OYC A;  3C12 A;  4EOM B;  5GMK i;  1YIT T;  1C1A A;  2DKG A;  1AWX A;  2F2C A;  1M1K R;  1I8F A;  4LOC A;  1GY3 B;  1AD6 A;  4BI8 B;  2O4X A;  2V22 B;  2H3J A;  4A53 A;  4J9E A;  3TVT A;  2O4X B;  2WSC E;  2G77 A;  1N8R U;  4PJO F;  1WGS A;  4JZ4 A;  2L3S A;  4CFX B;  4XTZ A;  2HSP A;  4JRP A;  3IQL A;  5LJ5 j;  2FEI A;  1TUD A;  1EIF A;  4Z8A A;  1H25 B;  2EYW A;  2KR6 A;  3X28 B;  1SEM A;  1CKA A;  3BW1 A;  3RBB B;  2XG8 D;  4M78 D;  2JT4 A;  1UGV A;  4AT1 B;  4ELJ A;  3F70 A;  1YIJ Q;  2SRC A;  2RI5 A;  4JX6 A;  4FIB A;  3HRS A;  4BE1 A;  4M4Z A;  1H27 B;  1MNE A;  2ROL A;  4KBM B;  2R5M A;  4XTV A;  4XU2 A;  2ZAE A;  2QEX Q;  3OYM A;  1YFN A;  3O0G D;  1TS9 A;  1FX7 A;  4NL3 A;  4BY1 X;  3HB9 A;  4HT9 A;  3MJX A;  3PO3 S;  1KK7 A;  2ZPG B;  1UJ0 A;  2E65 A;  2DK3 A;  5A0D A;  3UA7 A;  2OTL A;  3G4S A;  1WXB A;  1WQW A;  2GFU A;  4CI0 C;  4BCM B;  3NTH A;  3MIA B;  1JXO A;  2FHD A;  3INZ A;  3CCV T;  4M75 E;  2EBP A;  2LX7 A;  1VOL A;  3PMT A;  3GBQ A;  3OYB A;  1OPL A;  1Q7Y C;  2QGG A;  2BUD A;  2L3P A;  4Z89 A;  1AIS B;  2RPN A;  2DIL A;  3L2Z A;  5HBH B;  2HBW A;  5I21 A;  3C94 A;  4BCG B;  1K4U S;  2HMA A;  5FLX E;  1RAH B;  3V8L A;  1GH6 B;  1DJ7 B;  1YHQ T;  5CEI B;  2X3X D;  3KFV A;  1K0X A;  3KXT A;  7AT1 B;  3BG5 A;  3ULR B;  5GAO l;  1S72 T;  2KT8 A;  2DZ9 A;  3OMC A;  1BU1 A;  4OMF B;  1QKX A;  5GAM g;  1VQK Q;  2C4G B;  2WXV B;  4PJJ A;  4C92 A;  5GAN 6;  1NE8 A;  4F7S B;  4FT2 A;  4LDX A;  4HNV A;  1UGR B;  4FL6 A;  4XU1 A;  3G6E A;  1NPP A;  3A8H B;  4ZNX A;  3BG9 A;  1K73 R;  4DBF A;  2MOX A;  2D0Q B;  2Y90 A;  1VYT A;  3R6O A;  1M3C A;  1ZA1 B;  4GY5 A;  1T3S A;  2DAQ A;  4XAX B;  4ROD A;  2EJ9 A;  4XK8 E;  1W1F A;  2AKL A;  2EYX A;  4J7F A;  4F7U G;  3SD4 A;  4J7I A;  4HVW A;  2NWM A;  5LJ5 d;  4V2S A;  1JST B;  1K1Z A;  3M0Q A;  3X24 B;  4EC9 B;  4BCK B;  1VYU A;  3HZJ A;  2QF7 A;  3OW2 P;  1W6X A;  3UT1 A;  1JBM A;  2DL8 A;  5ECA A;  1YCY A;  2A0F B;  4EMG A;  3CCJ Q;  1OZ2 A;  2QA4 A;  3QHR B;  2X4W A;  4WTO B;  5LJ5 f;  3LH0 A;  2RI2 A;  3A5Z B;  3CXC S;  5A2Q E;  1CSK A;  3JCM X;  2KRM A;  1ABO A;  2K3Y A;  3E2U A;  1RI9 A;  2FYK A;  3WVE B;  1ZUY A;  2RQR A;  5KE2 A;  1IB8 A;  1YJN Q;  1OQK A;  1O9K A;  4GLK A;  1UFF A;  2JMC A;  2J06 A;  2BKZ B;  1UUE A;  4JRK A;  4QKU A;  3QWY A;  5FRO A;  1IHW A;  4JX4 A;  3DDQ B;  2ESW A;  5GJV B;  4XU3 A;  2E3H A;  2A08 A;  4BY6 C;  4BCO B;  1PG5 B;  1WHG A;  3FEO A;  4IUV A;  2DBM A;  2P4R A;  1YN8 A;  2GF7 A;  3M58 A;  2AT1 B;  2ROT A;  4C92 F;  1WJQ A;  1KXU A;  3M57 A;  5C0M A;  3EGD B;  3NTI A;  2IVX A;  4D8D A;  2F5T X;  5HQ0 B;  4PL6 A;  3RKY A;  4YOZ A;  2KYM A;  2CUD A;  3L1A A;  5M9O A;  1ZSZ A;  2RD1 A;  1MV3 A;  1ZSZ B;  3LGL A;  4QQD A;  1Y07 A;  5CQX A;  3LX7 A;  4M7A A;  5CKB A;  2K9G A;  2X4J A;  3TSW A;  4M7A B;  3HKS A;  1Q7Y U;  2VGN A;  2IG0 A;  1YIJ A;  4MZT A;  2DVJ A;  2BE7 D;  4AKH A;  5IHK A;  4MDX A;  4WF2 A;  2OTL T;  3G4S T;  3L2R A;  1KIK A;  5L8R E;  4F6U B;  2X1N B;  2QEX A;  1CKB A;  2VVK A;  2DXB B;  1KJW A;  2FZG B;  4B6M A;  2QQA A;  4Z88 A;  4XTU A;  3RUX A;  5GAN 3;  2I0N A;  3ZL7 C;  4CFU B;  1M8V A;  5FU6 B;  3EG3 A;  5CIU A;  4BCM D;  1S1N A;  2RHU A;  4PFO A;  4XTW A;  1VQ9 Q;  2DF6 A;  2NUZ A;  4HA8 A;  5GAO p;  3MEW A;  1J3T A;  5FGK B;  3L2V A;  1X6G A;  1YP5 A;  2JZ2 A;  4M77 A;  1UEB A;  1MUZ A;  4EOS B;  1QWE A;  3TRE A;  1OUL A;  1AOJ A;  1QWF A;  3ME9 A;  1K9M R;  4JUV A;  1LJO A;  2LCC A;  2CZ1 B;  3VUZ A;  3QZ5 B;  1E7P A;  3CQT A;  4J9C A;  4F7U F;  1RLQ C;  1XNI A;  4FW2 A;  5LJ3 g;  2K5F A;  4KGX B;  4HVV A;  2AZS A;  1D3U B;  3QWX X;  4OP0 A;  2CZ7 B;  3E19 A;  3BHU B;  2D9T A;  5GAO r;  5GAO n;  4ELL A;  1D0Y A;  1IRE B;  1RL2 A;  4F04 B;  2A3L A;  1VQK A;  3DB3 A;  1WXU A;  5GAM j;  1K9A A;  3UA6 A;  3M56 A;  3X20 B;  3CME T;  1X27 A;  2DJQ A;  4BBS M;  4KH1 B;  2KMT A;  4LD6 A;  2E1H A;  2P0K A;  3BHV B;  1Q86 C;  1OL1 B;  2EKO A;  1YJW Q;  2NUP A;  2CP5 A;  2LQN A;  4F16 A;  2ED1 A;  4FW1 A;  3TQ7 P;  4E7J A;  1VQ8 T;  4LDY A;  1ZA2 B;  2QI2 A;  1QVF A;  2KXD A;  4RG8 A;  4F6S B;  2DMO A;  3QHW B;  5HNB B;  2V26 A;  2J6F A;  2WSF E;  1HYO A;  3UPU A;  2CDT A;  1KD1 R;  5HKC A;  3X26 B;  4M7D A;  2HQX A;  4M7D B;  1OYX A;  2LDM A;  3CCM T;  1PKD B;  5GAN 5;  4E7L A;  3CCJ A;  2CCH B;  2FRW A;  3U23 A;  3OYI A;  3MO8 A;  2DME A;  2CP0 A;  2JVV A;  4M77 F;  2COZ A;  1V29 B;  3RNJ A;  2YLB A;  3S6W A;  3A8G B;  2L5Q A;  3D7S B;  3CCU Q;  4N4H A;  4C92 C;  4AG1 C;  3HL8 A;  4J5Y A;  1YJN A;  5IXF A;  3A1P A;  2E10 A;  1GBR A;  3QYE A;  4BCN D;  2BZX A;  1B34 A;  4DEY A;  2MYS A;  4BCF B;  1B34 B;  2XDP A;  1OZ3 A;  1PD0 A;  2Y4X A;  2M1H A;  4KUI A;  5IDN B;  3V8J A;  3CC7 Q;  3JRZ A;  4PNO A;  1G3W A;  4FYV B;  4ME7 A;  1H28 B;  5GAO m;  3M0S A;  2PTK A;  3DB4 A;  1G3Y A;  1NEB A;  1FMK A;  1XTD A;  5IDP B;  4KGV B;  4LUD A;  1VQO Q;  3EFR A;  2COW A;  4EOL B;  1JJ2 A;  1HXD A;  1NYF A;  2WSE E;  3VS4 A;  4HNT A;  2KGT A;  1P5E B;  2X35 A;  2KDS A;  5BNJ B;  3DL1 A;  1ACM B;  2X4X A;  3GLX A;  1M8M A;  2DEQ A;  1UGS B;  4M78 A;  4F14 A;  2LCL A;  2XDB A;  2WMA B;  1G83 A;  3VS5 A;  2EQU A;  1YIJ T;  4NOY A;  2IPO B;  2YUN A;  2V1R A;  1VQ6 Q;  4YOS A;  2MWO A;  3AT1 B;  3EAE A;  3VKG A;  2F2W A;  3NGP A;  1IHV A;  5KH6 A;  3REA B;  4M7A D;  4EPC A;  8ATC B;  1U06 A;  3OYF A;  1D09 B;  2VV5 A;  3NTK A;  3H4C A;  1K9M C;  1SPK A;  3H0H A;  1BBZ A;  5GAM d;  4FU6 A;  3RDV A;  2Y4Y A;  2B86 A;  1Y71 A;  1UJY A;  1E9H B;  5KYX B;  3EGU A;  1XOV A;  5LQF B;  5GAM f;  2I40 B;  1URC B;  4DBQ A;  5LJ5 h;  4JLI A;  2QQ8 A;  3BLH B;  1HSQ A;  2JW4 A;  3PIP A;  4CFU D;  3CPW A;  4LD9 K;  1U1T A;  4C92 E;  2DEU A;  4UN0 A;  1OU9 A;  1I5O B;  4DOV A;  2P4T A;  5DQV A;  2RQV A;  3CBO A;  3M55 A;  3FIF A;  2QTV A;  3Q1J A;  3JB9 I;  2DL3 A;  1YWP A;  1ZSG A;  2DRM A;  1VQ9 A;  1YBY A;  2CYZ B;  4X1V A;  4E7S A;  3H8Z A;  2PNI A;  5CK9 A;  3CCS Q;  2GTJ A;  5IHI A;  5ICP B;  1ZSZ C;  1UNL D;  3VYH B;  1IRX A;  2OTJ Q;  1Q86 U;  4M7A C;  1RAI B;  1OX8 A;  2QAS A;  5FWC A;  3E1S A;  4EOK B;  1HJD A;  1KD1 C;  2B8A A;  5CKE A;  4BCQ B;  4M78 F;  2EQJ A;  3VYG B;  3VKI A;  5LJ3 j;  1QVG A;  2FZC B;  1H3Z A;  4JLG A;  3P8D A;  5CR2 A;  3OYA A;  3PNW C;  1W70 A;  5IH2 A;  1NYG A;  2PK2 A;  1QVG S;  1Q7Y R;  4JX5 A;  1FKM A;  2G3R A;  3CBM A;  5AT1 B;  2VKN A;  1M2V A;  2DER A;  3CCL A;  1M2V B;  4PK4 A;  2RHZ A;  2UZL B;  2M0Y A;  2J7I A;  2EWN A;  1RAB B;  3JCM e;  1VOM A;  2ZPB B;  3I56 A;  3I35 A;  1AT1 B;  2M16 A;  4N0A A;  2H3E B;  2QA4 Q;  3HBL A;  4E6R A;  1UNG D;  2F5K A;  2ZPE B;  1YJW A;  3SWN A;  3CCJ T;  4IUR A;  2QFZ A;  3BLR B;  3REB B;  2GNC A;  2EJF A;  2YUQ A;  3LLR A;  2C0O A;  2PK9 B;  5GMK l;  4FSS A;  1KSW A;  5A0G A;  1YJN T;  4AFZ C;  2E6N A;  3JB9 D;  1GRI A;  1MMG A;  3OMG A;  4I3Z B;  4OB0 B;  3DOG B;  4A63 B;  5CKD A;  3LW5 E;  2CP6 A;  1VIN A;  3DJB A;  3E9F A;  1TOV A;  3CCU A;  1T3L A;  4M7A E;  2UUE B;  3NFC A;  1FWZ A;  2EUF A;  2K3B A;  4C5E A;  4E7I A;  2YRC A;  3JCM c;  4LE9 A;  2L0A A;  1Y7X A;  3M0R A;  1K9M U;  1TTH B;  3CC7 A;  3ZBD A;  3NHN A;  1MMN A;  1JOW A;  1C0M A;  4DEX A;  1JRI A;  1OEB A;  4CFW B;  4E2F B;  2QDL A;  2KYB A;  4D6W A;  1VQO A;  1BIB A;  3WXM B;  2XU8 A;  1AD5 A;  4M7D C;  4FYX B;  2COY A;  2PUO B;  4BI4 A;  4BB7 A;  1ZLM A;  1T0J A;  5J3B A;  2RK2 A;  3OYH A;  1FIN B;  3MEU A;  1HD3 A;  1TH7 A;  1H3H A;  3DLL A;  3SHW A;  1VQ6 A;  3GOX A;  3O5Z A;  4M77 E;  4X9D A;  3QWL A;  2PJQ A;  4C92 G;  4CFM B;  1BU2 A;  2C6T B;  2E64 A;  3LH5 A;  2BPM B;  2AK5 A;  5GAN j;  4D8K A;  3H0F A;  2JTE A;  4JJD A;  4EOQ B;  2XID A;  2HSE B;  2V8I A;  1SSH A;  1ZBJ A;  4LDW A;  4KH0 B;  1KD1 U;  1WJR A;  5EG2 A;  2KI7 A;  5GAN e;  1VQ9 T;  3CC2 Q;  4KRC B;  3FRN A;  2F2X A;  2CRE A;  4KUD K;  3L2W A;  2RJF A;  4J83 A;  1RAG B;  3G71 Q;  2W10 A;  2ZGW A;  2LJ1 A;  4M78 C;  2H8H A;  2QXF A;  2DX1 A;  3QHS A;  5CCA A;  4FYW B;  4YOO A;  1RAE B;  4F6W B;  3EG2 A;  1XQH A;  2DM1 A;  3TN8 B;  2LNH B;  3CCS A;  5I11 A;  1VQ5 Q;  1H92 A;  2GTO A;  2QDJ A;  2OTJ A;  2DTH A;  1WDX A;  1Y0M A;  3PVL A;  1C9B A;  1I1J A;  5IAY A;  3V8K A;  1UB4 A;  4IKF A;  3QDR B;  2K3X A;  1R0C B;  2ATC B;  2OJ2 A;  4NS5 A;  4ANJ A;  2CH4 A;  2CSQ A;  4M7D E;  4BCQ D;  3OYL A;  3J7A F;  2R7G A;  2CZ0 B;  4J9F A;  2DXT A;  3PGG A;  1FVV B;  3QG1 A;  3OS5 A;  2DYB A;  4WCI A;  3TW6 A;  3VRZ A;  1NZ9 A;  4X9C A;  3OYD A;  4DBH A;  4J6X A;  1YJW T;  3GP8 A;  1W2B P;  1F1B B;  2HD0 A;  3VS0 A;  1N5Z A;  2ECZ A;  4AFS C;  2CP3 A;  2W9Z A;  4ORZ A;  2EGC A;  3I5R A;  3CXC A;  2CP7 A;  3RIR A;  2DD5 B;  4QVD A; 
#chains in the Genus database with same CATH homology
 4F7U F;  4C0F A;  5HK0 A;  4JRQ A;  1XNI A;  5LJ3 g;  3CCE A;  4LDU A;  1VQP A;  4RCB A;  2K4Y A;  2K5F A;  3QII A;  3PTA A;  3GIB A;  2RJE A;  3QYB A;  2VGM A;  4PJO G;  3HHT B;  4M7A G;  4DA4 A;  2XK0 A;  2P0P A;  1N8R C;  4OP0 A;  2CZ7 B;  2RB6 A;  3LWH A;  5J39 A;  2NLU A;  3E19 A;  3JAM E;  3QYG B;  2MI6 A;  3CCQ A;  2LT1 A;  1KQS A;  2D9T A;  4JDS A;  5C6S A;  5GAM h;  5GAO n;  4QW2 A;  3CCU T;  4BE0 A;  5GAO r;  2RJC A;  3QZ9 B;  1IRE B;  1RL2 A;  2JTF A;  3RKW A;  1YI2 T;  4DQ2 A;  2QTX A;  4M78 E;  1Q82 C;  2A3L A;  1VQK A;  4EDU A;  3DB3 A;  3TEE A;  4L6V 5;  5LJ3 d;  5GAM j;  1G3S A;  1VQ5 T;  3MCA B;  2EYQ A;  3HSB A;  3M56 A;  1N9S A;  3QO3 A;  1KQS S;  3X20 B;  3CME T;  1O9S A;  3QSU A;  4BBS M;  2EFI A;  1VQL T;  2C06 A;  2LC4 A;  2KMT A;  4LD6 A;  3CC7 T;  2PVO B;  1NJI U;  4OB2 B;  1BKB A;  2E1H A;  3QYH B;  1WPY A;  3CCR T;  2K5L A;  1N27 A;  2MAM A;  2P0K A;  3GNG A;  3JCM d;  5DY9 A;  1VQM T;  1Q86 C;  1WJS A;  2RH2 A;  4C8Q E;  1M90 U;  3CPW S;  2EKO A;  4R55 A;  1BYM A;  5LJ3 f;  3WVD B;  3CCV A;  3QKJ A;  4MZM A;  2EJG A;  4E7J A;  5HK3 A;  1VQ8 T;  2BS3 A;  2V8J A;  2QI2 A;  4LDY A;  3A8O B;  4M77 D;  3JCM W;  1QVF A;  4RG8 A;  1VQO T;  3RKX A;  4ZTJ A;  3OYK A;  1I5L A;  3M9Q A;  3JCM f;  5LJ5 e;  4ZTF A;  2L3R A;  4C0G A;  3I55 T;  4N0A C;  2O01 E;  2WSF E;  4PLL A;  1MGQ A;  2EQK A;  4M77 G;  2KAF A;  3UPU A;  5HKC A;  3X26 B;  4M7D A;  3SWN C;  2HQX A;  2DO3 A;  3OS1 A;  2GQV A;  4M7D B;  4B9W A;  1KG1 A;  1OYX A;  2LDM A;  2RHY A;  3CCM T;  3JCM P;  2KVQ G;  4BDZ A;  5GAN 5;  4E7L A;  1OI1 A;  4X34 A;  3VKH A;  1BI2 A;  3LGF A;  4JRI A;  3CCJ A;  2LNV A;  4P5N A;  3OYI A;  2ZZD A;  3MO8 A;  2E70 A;  1QW1 A;  5GAN 2;  1R8O B;  3CMA T;  2ZZD B;  3P8H A;  2JVV A;  3DLM A;  1KQ1 A;  4M77 F;  1V29 B;  3CC4 T;  2YLB A;  3S6W A;  3A8G B;  1QP2 A;  2L5Q A;  3QUI A;  1S72 A;  4N4H A;  4HNU A;  4VUB A;  4C92 C;  5KE3 A;  5CAI A;  4QQG A;  3JB9 J;  4XTX A;  3FB9 A;  3HL8 A;  1H64 1;  2QQS A;  4Y28 E;  4J5Y A;  4BUG A;  2DVE A;  1YJN A;  2E10 A;  4L59 A;  3QYE A;  1Q81 U;  1W4S A;  2XI9 A;  4BY6 B;  2HBP A;  1VQN T;  1B34 A;  5CKF A;  3BG3 A;  2EIF A;  2FVU A;  1WNL A;  5I2S A;  1Y96 B;  3L42 A;  5LJ3 e;  1B34 B;  2XDP A;  1OZ3 A;  4NL2 A;  2Y4X A;  4MMK A;  3TU4 K;  2LQ8 A;  1NPR A;  2M1H A;  2PVG B;  3MP1 A;  2E12 A;  4KUI A;  3V8J A;  4C0D C;  1UGP B;  3JRZ A;  4PNO A;  1G3W A;  4ME7 A;  1GXI E;  5GAO m;  3FJP A;  5GMK m;  2DTI A;  2ZPH B;  4A4K A;  1BI3 A;  2DXB A;  3DB4 A;  2MMP A;  2RA2 A;  1G3Y A;  1UGQ B;  2QQB A;  2YRV A;  3DKM A;  4JS4 A;  2RJD A;  1XTD A;  3HRT A;  2ZPI B;  4M77 C;  2DIG A;  3URG A;  2VXF A;  2JOY A;  5KCH A;  1ZQ1 A;  2JN0 A;  3CCL T;  4BAC A;  1KQ2 A;  3QJY A;  3EFR A;  3H6Z A;  3SWN B;  3JCM V;  3FC3 A;  1JJ2 A;  1HXD A;  2BIV A;  1PSE A;  1HK9 A;  2E5Q A;  2WSE E;  1QVP A;  1RI0 A;  4HNT A;  3RMQ A;  5GAN 4;  2CGH A;  3EFS A;  3BDU A;  2LQK A;  2X35 A;  3I56 T;  1W2B A;  2KDS A;  3DL1 A;  1BIA A;  5CQY A;  4J6Y A;  2X4X A;  3GLX A;  1VQ4 T;  2DEQ A;  3J80 E;  1UGS B;  4M78 A;  3S3M A;  2LCL A;  4F7U E;  2XDB A;  1D3B A;  2AHJ B;  3TW7 A;  3X25 B;  2EQU A;  3OBY A;  1YIJ T;  1D3B B;  3CC2 A;  4NOY A;  3PMI A;  3CCS T;  2QQR A;  2PVD B;  4ZGJ B;  4C92 B;  3VV0 A;  3ER0 A;  3OYG A;  1X75 C;  1W2B S;  2MWO A;  1LNX A;  3OW2 A;  4HT8 A;  4M7D G;  4ELY C;  2OTJ T;  3EAE A;  4RMO A;  3OYE A;  3VKG A;  3G71 A;  4AI6 A;  1X01 A;  2D6F A;  3OA6 A;  3GPL A;  5KH6 A;  4C8Q A;  2DD5 A;  4PJO D;  2BKD N;  2P0Q A;  4M7A D;  4C8Q B;  3E9G A;  4EPC A;  3LWI A;  2RK1 A;  3N5B B;  4YTL A;  3JCM b;  2XDD A;  3OB9 A;  4RCC A;  2VV5 A;  3NTK A;  3PIO A;  3H4C A;  4PKC C;  3OYF A;  1K9M C;  3BDL A;  2DD4 B;  4FSX A;  4HKE A;  1ZBX A;  1YI2 A;  5GAM d;  4FU6 A;  2R5A A;  3RES A;  3G6E T;  3V7R A;  2Y4Y A;  3LYI A;  5IN1 A;  3OYC A;  1Y71 A;  3C12 A;  1VQ5 A;  5GMK i;  1YIT T;  3CME A;  1M1G A;  2DKG A;  3JCM g;  4EMK C;  3VJP A;  4HCB A;  1XOV A;  2XIC A;  2M9U A;  1I8F A;  4LOC A;  4Q5W A;  4BI8 B;  3CCR A;  5GAN d;  2O4X A;  3S3N A;  2H3J A;  4A53 A;  3OYN A;  2FB7 A;  3ZFJ A;  5GAM f;  3M4G A;  1U1S A;  2KSS A;  2O4X B;  2WSC E;  4HCZ A;  2G77 A;  4DOW A;  4EMH A;  1N8R U;  4PJO F;  5LJ5 h;  4JLI A;  1M1K C;  2CZ6 B;  2LVM A;  2QQ8 A;  2LX9 A;  3PIP A;  4M7A F;  2ZPF B;  1WGS A;  2DXU A;  3CPW A;  4KUL A;  1VQ8 A;  4LD9 K;  1U1T A;  4XTZ A;  4C92 E;  4JRP A;  2VUB A;  1PSF A;  2BS4 A;  2PUK B;  4DOV A;  2P4T A;  3CBO A;  4A54 A;  5LJ5 j;  4IUQ A;  4A4H A;  3M55 A;  1EIF A;  5GAN f;  2GCX A;  3FLG A;  3FIF A;  4M7D D;  1Q82 U;  2KR6 A;  3X28 B;  3BW1 A;  2DIQ A;  1VQ7 T;  2EQM A;  3Q1J A;  2XG8 D;  5FU7 B;  3JB9 I;  4M78 D;  1VQ9 A;  4ELJ A;  1YBY A;  3F70 A;  2CYZ B;  4M75 B;  2YHT A;  2RI5 A;  4FT4 A;  4J8O A;  2QA4 T;  3CCE T;  3H8Z A;  2WAC A;  4JX6 A;  4FIB A;  3HRS A;  5CK9 A;  4RG2 A;  3CCM A;  4BE1 A;  4O6J A;  2MF2 A;  3VYH B;  2X4Y A;  4HL4 A;  4KBM B;  2R5M A;  1Q86 U;  1JB0 E;  4M78 G;  4XTV A;  4XU2 A;  4PJO C;  5GAO q;  4M7A C;  3CCQ T;  2HNI A;  2K5I A;  4PLI A;  3OYM A;  4C0Z A;  3V7S A;  4BD3 A;  3E1S A;  3HFN A;  1FX7 A;  5LJ3 h;  2JNG A;  4NL3 A;  2DXC B;  5FRM A;  3HB9 A;  1KD1 C;  4HT9 A;  2B8A A;  5A0L A;  5CKE A;  4C8Q G;  1VQ6 T;  4M78 F;  4OGC A;  2EQJ A;  3VYG B;  3VKI A;  3JCM J;  1KC8 C;  3SB2 A;  2EAY A;  5LJ3 j;  2FL7 A;  3JCM h;  1QVG A;  2ZPG B;  2OTL A;  2E65 A;  2DK3 A;  5A0D A;  1H3Z A;  3G4S A;  3CD6 A;  4JLG A;  3P8D A;  3J81 E;  2KY9 A;  1WQW A;  3CPF A;  3SFM A;  2GFU A;  4Z02 A;  4F7U A;  3PNW C;  4ELZ C;  4CI0 C;  3OYA A;  3NTH A;  2WJ9 A;  4F7U B;  2FHD A;  3INZ A;  5IT9 E;  4RKU E;  3CCV T;  4BI3 A;  4M75 E;  3JB9 H;  1M4Z A;  2JTM A;  1QVG S;  2JUF A;  4A4F A;  4JX5 A;  1Y96 A;  1FKM A;  2G3R A;  3CBM A;  1BI1 A;  3CCL A;  4NC6 A;  3PMT A;  2QQ9 A;  5CO7 A;  3OYB A;  1QLB A;  3AHU A;  1Q7Y C;  2BUD A;  3GNF B;  4A4G A;  2RHZ A;  2DPP B;  2EWN A;  4QVZ A;  4A4E A;  3JCM e;  1AHJ B;  2ZPB B;  3L2Z A;  3I56 A;  2M16 A;  4N0A A;  5KCO A;  3OS0 A;  5I21 A;  2DZC A;  1K8A C;  3HBL A;  4FM4 B;  2F5K A;  2K57 A;  2ZPE B;  3C94 A;  4MDW A;  1YJW A;  1WQ7 A;  3SWN A;  5FLX E;  3CCJ T;  2I2L A;  3V8L A;  1DJ7 B;  4IUR A;  2QFZ A;  1YHQ T;  2RHI A;  2EJF A;  3OS2 A;  3HPW A;  4M75 G;  3LLR A;  4ZGE B;  4XTY A;  5I2M A;  3RER A;  5DLQ E;  2KQW A;  3KXT A;  4UC4 A;  4C5I A;  3BG5 A;  5GAO l;  1S72 T;  4MML A;  3MET A;  5GMK l;  2DZ9 A;  3OMC A;  1YJ9 A;  3ZEH A;  4OMF B;  3GF5 A;  5HY6 A;  1YJN T;  3M54 A;  4IUP A;  5A0G A;  5GAM g;  4JJN K;  5GAN 6;  4C92 A;  1NE8 A;  4ZN3 A;  2E6N A;  4FT2 A;  1IZ6 A;  3JB9 D;  4LDX A;  3OMG A;  4HNV A;  2YLC A;  1UGR B;  4OB0 B;  1O75 A;  4LDV A;  4FL6 A;  4XU1 A;  2LRQ A;  3OQ5 A;  1NPP A;  5D6Y A;  4QVC A;  5CKD A;  3G6E A;  3A8H B;  3LW5 E;  4TVR A;  3BG9 A;  1M9S A;  4OB3 B;  1P92 A;  3E9F A;  2LTO A;  5GAN g;  2D0Q B;  2Y90 A;  3R6O A;  1MHN A;  2QEX T;  3VU3 C;  3JB9 G;  4ATO A;  4C0D B;  4GY5 A;  3CCU A;  2DD4 A;  1ZHI A;  1K73 C;  4PJO E;  3UDC A;  5D6X A;  2DAQ A;  4M7A E;  4XAX B;  4HLQ A;  2EJ9 A;  3NFC A;  1FWZ A;  4XK8 E;  4C5E A;  4E7K A;  4E7I A;  1KHI A;  4M7D F;  3M59 A;  4J7F A;  4F7U G;  3JCM c;  3SD4 A;  2PU9 B;  2DJZ A;  4J7I A;  4JS5 A;  3O8V A;  4M77 B;  1Y7X A;  2CKK A;  5LJ5 d;  4V2S A;  4M6V A;  3HP9 A;  3X24 B;  3UWN A;  4B9X A;  2CS7 A;  1K9M U;  1VQL A;  3MHX A;  3JB9 F;  3CC7 A;  3ZBD A;  1U8R A;  3FDR A;  3HZJ A;  2VXE A;  4II1 A;  1VQM A;  2QF7 A;  2MWP A;  3UT1 A;  1JBM A;  3MP8 A;  5CVI A;  1JRI A;  4E47 A;  2VC8 A;  1YCY A;  3CC2 T;  4EMG A;  1OZ2 A;  2QA4 A;  1LOJ A;  2X4W A;  5J26 A;  5LJ5 f;  4HCC A;  3LH0 A;  2XHC A;  1I4K 1;  1VIE A;  5EJC A;  1KHC A;  2RI2 A;  3A5Z B;  3G7Z A;  3MEV A;  4D6W A;  3L2U A;  5A2Q E;  3CXC S;  1VQO A;  2M0O A;  3G71 T;  1BIB A;  3WXM B;  3JCM X;  4ZN1 A;  2XU8 A;  4IUT A;  4M7D C;  2K3Y A;  3I55 A;  4N4G A;  4QSH A;  1M1K U;  2PUO B;  5FRN A;  2FYK A;  2IVW A;  3C4S A;  3T9N A;  4BB7 A;  3WVE B;  4BI4 A;  4M75 A;  5J3B A;  2RK2 A;  4XQ3 A;  5KE2 A;  3OYH A;  4GLK A;  3MEU A;  3OSS C;  1NJI C;  1VQP T;  4C92 D;  3OY9 A;  4MFE A;  1X6O A;  4JRK A;  3M5A A;  1TH7 A;  3PT9 A;  1BI0 A;  3DLL A;  1M90 C;  1VQ6 A;  5FRO A;  2RM4 A;  4M77 E;  3GOX A;  2BS2 A;  4X9D A;  4C5H A;  5GAN h;  4MIM A;  3CMA A;  3QWL A;  4JX4 A;  3BFM A;  4C8Q D;  4C92 G;  3CC4 A;  3HO8 A;  3M4Y A;  4MZP A;  4XU3 A;  2E64 A;  3CBP A;  4BY6 C;  4EMK A;  2DXC A;  2KMG A;  4OB1 B;  4EMK B;  5GAN j;  3A8L B;  1N6A A;  1VQK T;  2QDY B;  3MP6 A;  3VYG A;  3FEO A;  5GAM e;  2XID A;  3QJ6 A;  4IUV A;  1VQN A;  2V8I A;  5DLO A;  2GF7 A;  3M58 A;  4C92 F;  1WJQ A;  3M57 A;  2RI3 A;  4LDW A;  3VUB A;  3NTI A;  5C0M A;  3KHI A;  2ZCF B;  5CKH A;  4J6W A;  2F5T X;  4OGE A;  1KD1 U;  1WJR A;  5EG2 A;  3OYJ A;  4PL6 A;  3RKY A;  5GAN e;  1VQ9 T;  1QVF S;  2K2V A;  1KC8 U;  2HAX A;  4BBR M;  4C8Q F;  5FU6 C;  3FRN A;  2PQW A;  2KK4 A;  1N9R A;  4KUD K;  3L2W A;  3CEY A;  2RJF A;  4J83 A;  4BE2 A;  1YHQ A;  4IUU A;  3MEA A;  5M9O A;  3L1A A;  2R58 A;  1QP3 A;  2ZGW A;  2RD1 A;  4N4I A;  5GMK h;  1Q81 C;  3BY7 A;  3LGL A;  3OYY A;  4QQD A;  1Y07 A;  4M78 C;  5CQX A;  3LX7 A;  4PJO A;  2E6Z A;  2QXF A;  3SDZ A;  4M75 D;  4M7A A;  2R57 A;  3QHS A;  5CKB A;  2X4J A;  5CCA A;  4PJO B;  3QPH A;  1VQ4 A;  4M7A B;  3HKS A;  2GFA A;  4KT0 E;  3M53 A;  4OVA A;  5GMK j;  1VIF A;  2DTO A;  2VGN A;  4E7H A;  4O5V A;  1Q7Y U;  5LL6 S;  2IG0 A;  5GAN 8;  1YIJ A;  4MZT A;  1XQH A;  5DM7 R;  3A8M B;  3CCS A;  4AKH A;  2VYT A;  4MDX A;  2QDJ A;  4WF2 A;  2OTJ A;  3QXE B;  2DTH A;  4C8Q C;  2OTL T;  1G3T A;  3G4S T;  3L2R A;  3CD6 T;  1VUB A;  1K8A U;  5IAY A;  3V8K A;  5L8R E;  4ZGD B;  2V8K A;  1SSF A;  1UB4 A;  3L2Q A;  2L8D A;  3PFS A;  3QDR B;  4IKF A;  2K3X A;  5CR2 A;  2A7Y A;  2LT4 A;  3KUF A;  5D6W A;  2XD0 A;  2OAU A;  4NS5 A;  2QEX A;  5GMK e;  3ASK A;  2DXB B;  1M5Q 1;  2RO0 A;  2QQA A;  3P8B B;  4R56 A;  1M1F A;  2E41 A;  4XTU A;  3RUX A;  5GAN 3;  3OYL A;  3J7A F;  2CZ0 B;  4M7D E;  4M75 F;  2RHX A;  2DXT A;  3HFO A;  3PGG A;  3QG1 A;  3OS5 A;  3OSV A;  5LJ5 g;  5GAN 7;  4Y91 A;  1M8V A;  3TW6 A;  5FU6 B;  3HRU A;  4AKI A;  1YIT A;  3C95 A;  5CIU A;  2L89 A;  2RHU A;  1NZ9 A;  4CRI A;  4X9C A;  3OYD A;  1FXX A;  4XTW A;  3OBW A;  5GAO p;  4HA8 A;  3MEW A;  3QBY A;  4MFD A;  4J6X A;  1YJW T;  3GP8 A;  4OF1 A;  3L2V A;  1JJ2 S;  4M78 B;  2F69 A;  2JZ2 A;  4M77 A;  5AYF A;  3RMS A;  2XKO C;  1UEB A;  2HD0 A;  1G5V A;  3TCJ A;  1I81 A;  4C5G A;  3JCM Q;  5FU7 C;  3S3O A;  3TRE A;  4XU0 A;  1K73 U;  3JSC A;  4M75 C;  4QQ6 A;  3ME9 A;  4JUV A;  3KBG A;  3CXC A;  4BDY A;  1LJO A;  1VQ7 A;  2LCC A;  1YJ9 T;  4Z6Y A;  2CZ1 B;  2DD5 B;  4AKG A;  3QZ5 B;  2HQE A;  3RIR A;  3VUZ A;  1E7P A;  4QVD A;  4L5G A;  3V7C A;  3OW2 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...