2ZPIB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpiB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpiB02
3X20B 4RKUE 2ZPIB 3QXEB 2PU9B 4FM4B 1GXIE 3X26B 3A8MB 2ZPEB 4OB0B 1UGQB 3HHTB 4ZGEB 1PSFA 1PSEA 2DD4B 1AHJB 2CZ7B 1JB0E 3VYHB 5L8RE 3A8GB 1QP2A 3QZ9B 3X28B 3A8OB 3QZ5B 1UGPB 2DD5A 2CYZB 4ZGJB 4ZGDB 3LW5E 3A8HB 2ZPGB 1V29B 2PUKB 2PUOB 2CZ1B 4L6V5 4OB1B 2ZPFB 2CZ0B 4XK8E 2ZPBB 2WSCE 3WVDB 2PVDB 1UGSB 1IREB 2ZZDB 1UGRB 2DPPB 2DD5B 4OB2B 2O01E 3VYGB 2PVOB 2DXCA 2DXBA 4Y28E 2DXCB 2WSFE 2DXBB 3QYHB 4KT0E 1DJ7B 3WVEB 2CZ6B 2PVGB 2ZCFB 2WSEE 2D0QB 1QP3A 3A8LB 2AHJB 2ZPHB 4OB3B 2ZZDA 3X24B 2QDYB 2DD4A 3X25B 3VYGA 3QYGB
chains in the Genus database with same CATH superfamily
1AZEA 3OYLA 5I22A 2F5TX 2KROA 3G4SA 2KR3A 1LCKA 1NJIU 3OYDA 4FM4B 1VQMT 3V8KA 2RHYA 1IHVA 4OGCA 2MAMA 3EH1A 2GQVA 2AZSA 4DBHA 2K2VA 3L2UA 1NE8A 3CPFA 2LNVA 3FJ5A 4Z02A 1H1QB 1O75A 4AMCA 1D0XA 2AKKA 1Z9QA 2DVJA 4JS5A 5GAN2 1FX7A 2LT4A 3OYAA 2JW4A 3EG2A 1JXOA 3FLGA 1G3NC 3HRSA 2HD0A 3LH5A 2E5QA 3VS4A 2DD5A 1V76A 2E4HA 4M7AB 5GAMe 5IHYA 2K6DA 4LDUA 2SEMA 3FEOA 4BUGA 2PUOB 1S72A 3DJBA 1NJIC 4M7DA 3ZBDA 2OTLT 1M1KC 2PVDB 5EG2A 3WXMB 4QVZA 4PJOE 2FPFA 5HK3A 4BDZA 4OVAA 1N8RC 1VQ7T 3VUBA 4AFSC 2EVRA 1H1SB 1EX4A 3OSVA 5LL6S 1X2QA 2QG9B 1BCMA 2X4YA 2DXBB 1K0XA 5EJCA 4FYXB 5CYIB 3EFOB 1YNZA 2AIRB 4J6WA 3EFSA 2KEAA 3RIRA 3PTAA 4XTZA 5HK0A 1AWWA 3OYFA 5DY9A 3CD6Q 1YJNA 1NYGA 4E7SA 3H9NA 5LJ5h 3PVLA 5D7UA 4KBMB 4GY5A 4MZMA 1E9HB 4M78F 4BD3A 5FLXE 3L2WA 2BZYA 3KXTA 4JZ4A 1QVFS 2HSEB 2X3XD 2RA2A 1VA7A 2E65A 3EG9A 5KYXA 1G83A 3J81E 2C4GB 1ACMB 2V1QA 2XMFA 2DILA 4A4FA 1H25B 2NUTB 2KT8A 2RN8A 3M53A 5GANg 2OI3A 3OMCA 1VQPA 1OYXA 3A5ZB 2V8IA 4F7UA 2DRKA 2MIOA 2KR6A 4M7DE 4M75E 2EQKA 2ROLA 4X34A 3BFMA 1K0SA 1KHCA 2V1RA 3TNIB 3VKIA 2K2MA 2HSPA 1JJ2A 3CCMQ 2UZDB 3HTRA 2GQIA 4JJNK 5CKBA 2BE9B 4ZGJB 1TUDA 1YCSB 3G6EQ 1UTIA 2JJ9A 1M90R 3MKDA 1GY3B 4FU6A 5IF1B 4PJOC 2CT3A 3MI9B 2G6FX 4BCPB 5CIUA 2M0YA 2B8AA 3C95A 2O88A 4CFVB 2CUBA 3CCJT 5LMKB 3M0TA 4EORB 2EFIA 3DOGB 2YHTA 2K3YA 4RUGA 4NL3A 1O9SA 1VYUA 1YCYA 2BIVA 3REBB 2JTFA 2A3LA 3QBYA 4B9XA 4OB2B 1NM7A 5GMKi 3CC4A 3SD4A 4BY7X 3E9GA 2RQTA 3G6ET 2FRWA 4MDXA 1QVGA 4C0ZA 1WX6A 5ACBA 3JB9F 4CC4B 2QEXQ 1ZSGA 3JRZA 3P8HA 2YRDA 5I21A 2NWMA 1PKTA 2MK5A 2D0QB 4OR5B 5GAN7 3OYBA 4BCOB 2M02A 1GCQA 1VQ6Q 1AVZC 2BS4A 1NLOC 8AT1B 4F7NB 2QA4T 1YITA 1OGUB 5GANh 5GANd 5I2SA 4BY1X 4F14A 4M77G 3VS0A 5HKCA 1WNLA 2OJ2A 4C8QC 2DERA 2RNAA 3BW1A 3H4CA 4EC9B 4XQ3A 4HCKA 4FSXA 1OPLA 4OP0A 4F70B 4J9IA 3HHTB 1KK7A 2WHBB 1RAAB 4QT7A 1AHJB 2DX1A 3I5RA 4IMYB 1Q81C 1OL2B 3T9NA 1M2VA 4J9GA 4RTWA 1QKWA 1VQ6T 4PL6A 1A0NB 2JN0A 2CP5A 4C0DB 1JEGA 1VQ4Q 3LGFA 3X28B 1XQHA 2DETA 1S72T 2YUOA 3CC2T 4RCCA 2C0OA 2JTMA 1UGPB 1ZQ1A 2JOYA 2E64A 2CYZB 3MEAA 3M58A 2XKOC 4CC7A 1YJWT 3S3MA 2YT6A 3C4SA 3PNWC 2C5XB 3HZJA 2GFUA 1UB4A 3EGXA 3QUIA 2ZGWA 1TOVA 1YFNA 2J7IA 2KYBA 4EOLB 1M3BA 4M78B 3HKSA 1CKBA 1Q86U 4PJNA 4FCYA 2ZPBB 4II5B 4TTHA 3UT1A 3EGDA 1C0MA 2QEXA 4CFUB 1UDLA 4C8QD 3GNGA 4Z8AA 4F7UE 4JLIA 2ZZDB 2A08A 1UGRB 4X1VA 2KRNA 2O31A 4AG2C 3CPWP 3FC3A 1HYOA 1RAHB 2M1HA 3BG5A 4EOJB 2DIQA 3C12A 4EOKB 2X51A 2KT1A 4M7DB 2XK0A 2DXCB 1PG5B 4J9DA 4JJDA 3VRZA 2LQKA 5GAOm 3M5AA 1AEYA 3OS2A 5IH2A 2KMTA 3Q1JA 2BZXA 4ZN3A 3PIOA 3L1AA 1WGSA 3PE0A 1OX9A 2LJ1A 2ZCFB 1ENWA 2QK0A 1ZP2A 2EGAA 4FW2A 8ATCB 3C0CA 4BCIB 3A8LB 1GH6B 1M3AA 4M78G 1VQNA 4OMLA 2CP3A 1JOWA 4ROEA 2QGGA 3M0RA 2O4XB 2JT4A 3CCMA 1U1SA 1OULA 1X69A 3QKJA 4MFEA 3JV3A 4M78C 1K73C 2D8JA 2F1LA 5FWCA 2ZPIB 2VGMA 2PU9B 3SFMA 2K4YA 5LJ5d 4M77F 3OW2S 2QQAA 3JCMW 1G5VA 5CEIB 4RCBA 1TU0B 1QVFP 1MUZA 2CZ7B 2EQJA 3CCQQ 3CCQT 3C94A 3CCLT 1R0BG 2FVUA 4YOSA 2HNIA 2IVXA 1QP2A 1KFZA 3EGDB 3CC7T 3SB2A 5HCKA 2LT1A 1JO8A 2WACA 3L2RA 3E9FA 3URGA 2GFAA 3CPWS 4DOVA 5IN1A 3AHUA 2ESWA 3R6OA 2DLPA 1Q81U 1WHHA 1OZ2A 2P0PA 1BI3A 2VYTA 2DE0X 3A8HB 2M51A 4HCZA 3CCEQ 2KMGA 1SHFA 1R77A 1V29B 1HK9A 3POMA 1XTDA 3RKYA 5KYYA 3JCMJ 2R5MA 2OTLA 4AKIA 5M9OA 2XG8D 2JMCA 5GAN4 3UATA 3VKHA 2PZ1A 4JRIA 2H3EB 1Y7XA 3D7SB 1IREB 1MMDA 1D3UB 1UNHD 1B34B 1WHMA 3TSWA 4Z89A 1QQJA 2RD1A 2JZ2A 3OYGA 4C5GA 2PVOB 3BLRB 4KRCB 4E7LA 1WIEA 3BG3A 2KGTA 4DBRA 3G71Q 1G3TA 1TTHB 1VQ5T 1H4LD 2F5KA 1DJ7B 1AZGB 4TVRA 1K9MR 1E7OA 4LUDA 1QW1A 2RJDA 1QWEA 2P0QA 3V7SA 3QPHA 1AWOA 4BCQB 4JUVA 2CP6A 1J3TA 1GBQA 4V2SA 2HCKA 3CMAA 5LJ3f 3GLXA 1NYFA 3JCMQ 3MJXA 2YXYA 3META 2HEQA 2DIGA 1MMNA 2K3BA 2YUNA 1PHTA 4J7IA 4Y72B 3JB9I 3GTMS 4X9CA 2EWNA 3GPLA 2PHGA 3A8MB 2R57A 4D6WA 3LWIA 4EMKA 4EOMB 3JCMV 1H26B 4N4HA 1KD1C 3P8DA 2MWPA 2I40B 3BG9A 1UHCA 3NMZC 4Q5WA 1WHGA 5D6XA 2DNUA 3V7CA 1W2BA 4BCFB 1LPLA 1N5ZA 1NEBA 1LOJA 4VUBA 2DEUA 3ZFJA 2MI6A 4CRLB 1Z9ZA 1PD0A 2C0TA 2V22B 5D6YA 1GBRA 2E5KA 3CCVA 1N9SA 4MIMA 3U23A 1E6GA 1NZ9A 4M7DF 4QQDA 1PKDB 1X43A 2YSQA 3RDVA 1WHJA 3CCMT 2PK9B 3LYIA 1VQ9T 2H3JA 2RQVA 2W10A 2MF2A 1PD1A 4BCMB 4EOIB 3HBLA 1Q86C 2CGHA 2CZ0B 2DEQA 3RNJA 1IHWA 1TWBA 4EIKA 4M77E 1M1FA 5CVIA 1AT1B 2DAQA 3EHQA 3CCVT 3HSBA 1WXBA 3OYJA 1CSKA 1RLQC 2MMPA 3QHSA 4YC3B 3H0HA 4NS5A 2VC8A 2BS2A 3THKA 5HBEB 3FRNA 3PMIA 1X01A 5CCAA 3LH0A 4JRPA 4JX5A 2KVQG 4P5NA 1M4ZA 1P92A 2XU8A 2WSFE 1H3HA 4XU3A 1PNJA 4BCJB 1U1TA 3CCLQ 3J80E 4MMLA 1YIJQ 5GAOn 2M9UA 3OYKA 2KK4A 1JQQA 1T0HA 2PJQA 5KYUA 4GLMA 4C5IA 1TG0A 2WFYB 2HQXA 5GAN6 1D3BA 2HDAA 3QYEA 2DD4A 3X25B 4EOQB 3EFOA 3VYGA 1H28B 2JGZB 2J6OA 1VQOA 3CMAT 5HY6A 1M1KU 3CMAQ 1GFDA 3JCMe 2F2VA 2X35A 3VS6A 2HZYA 4F6SB 2L5QA 3V7RA 5LQFB 1QLBA 2RI2A 2QFZA 4EOPB 1OU9A 2XHCA 1VQLA 2F69A 4ELLA 4ROCA 2EYZA 4KRTA 4B9WA 2ZPEB 1PSFA 1TUCA 2KXDA 2FZGB 5L8RE 4WF2A 5KYUB 5FU6B 4XTUA 7AT1B 4PLIA 3V8JA 3TVTA 5BNJB 1Q81R 3QDFA 4AKHA 1VUBA 2EAYA 4Y92A 2C5VB 4M75G 3MP8A 2I53A 2LW4A 3K7AM 3QZ5B 5GAMj 2PTKA 1IGUA 2W9ZA 4EMHA 1QVGP 4MDWA 2JXBA 2LZ6B 5CKDA 4Z88A 5KH6A 1NJIR 1M9SA 4Y91A 2DXTA 3VUZA 3OYIA 2OTLQ 5CR2A 4BCNB 1PKSA 1ZLMA 3M56A 5J3BA 1YITT 1GCPA 4QVCA 3QJ6A 4RTTA 2A36A 3G33B 1TH7A 1BU2A 1Y07A 1VQ7Q 2EYQA 2YRCA 3RKXA 3CMEA 1FMVA 2LP5A 4QVDA 2DKGA 4PJOB 3PMTA 3QHWB 2E6ZA 4JRQA 1H92A 5CQXA 4RTXA 1AOJA 1W4SA 2GTJA 2COZA 1KC8U 2AK5A 5CKHA 3OSSC 1YJWQ 1KQSA 1YI2Q 1O9KA 2IW6B 4A4EA 5IXFA 1QP3A 1H1PB 2QQ8A 1K73R 2A28A 3TQ7P 2SRCA 2EQMA 4M77D 5LJ5e 4BE2A 1YHQQ 2DJZA 2KE9A 5IAYA 1YJ9T 3CCSA 2F2XA 4PJOG 4HT8A 3RGFB 2OTJQ 3CQTA 3E19A 4QQ6A 1D1AA 1Y96B 3I56A 1VQNT 1VQNQ 3I55Q 2HL5C 3O0GD 2IVWA 3EIDB 2KRMA 3GP8A 2C5NB 2FEIA 5LJ3j 2D1XA 4F7UG 2EPDA 2WEVB 1JB0E 1VIFA 1C9BA 1AISB 1B7TA 3QO3A 1UNGD 3HL8A 3TREA 2DTIA 1VQPT 4G6LB 2YLCA 4M75A 4BI4A 3EH2A 5GAOr 3MEUA 3MY1B 3QHRB 1ZUUA 3TU4K 1H27B 4E47A 3MP6A 3I35A 3DDQB 1ZBXA 1OKVB 4BBRM 1BB9A 4GLKA 2RQRA 3CCSQ 2QEXT 1YJ9A 3LW5E 1YHQA 4M4ZA 2MCNA 1UG1A 4X9DA 2PUKB 2BPMB 1IZ6A 1I8FA 2CZ1B 2WIPB 1H24B 1WXUA 1VQ8T 4JZ3A 3JCMX 4XK8E 5FWBA 1YI2A 1YJWA 2CH4W 3HB9A 1BI0A 3UF4A 4MFDA 1ZSZC 3KHIA 2DFUA 1TSFA 1WHKA 3DB3A 4JPBW 3CXCS 2DD5B 4KGXB 2X4WA 2YUPA 2DXCA 4M7DG 2MPXC 3DLMA 2NUPB 2RB6A 2J05A 1UNLD 1F5QB 3LWHA 2RQUA 2K5FA 3SDZA 1OQKA 2DL7A 2KBTA 3CMET 1YP5A 3WVEB 2ECZA 1VQ7A 2P0KA 3M0QA 4BCHB 1N6AA 2EQIA 2PVGB 4JDSA 1OI1A 2I0NA 2K57A 3UPUA 1GUXB 3CC2Q 3X24B 1FMWA 2RF0A 2F2WA 2VB6A 3NDQA 2D9TA 2BKZB 5LJ5j 4M77A 2I2LA 3MEVA 5I2MA 3M0PA 1YITQ 5ICPB 3M9QA 3HO8A 3ME9A 3QXEB 4ATOA 1G2BA 2RJFA 2VV5A 1SPKA 4J5YA 2LC4A 2ATCB 3X26B 1W1FA 5HVYB 4XU2A 2LCCA 5CKFA 2IG0A 5GMKh 1AWJA 2BE7D 2LQ8A 2RHXA 3VV0A 1WI7A 1N4MA 3G1JA 3H41A 3V8LA 3O5ZA 3DDPB 4HVWA 1RAFB 4F16A 3L2ZA 1SHGA 5GJWB 1VQLQ 2RJEA 3A1PA 3CD6T 2EGCA 4OMMA 4A4GA 1T3SA 1H641 1UECA 9ATCB 1K8AR 1G3WA 4C8QF 2GTOA 3NTKA 2RK1A 2CJMB 3TNWB 1WLPB 3GIBA 3BHUB 1VQOQ 3BDLA 4J8OA 3SEMA 2QTXA 1OX8A 4ZGDB 4EOOB 1M90C 4BDYA 1HSQA 4LDXA 5GAN8 2D6FA 5DM7R 2LJ0A 5EC7A 2DJQA 3UA6A 3EAEA 4IUTA 3UA7A 5GAN5 3WVDB 1SSFA 4M7DC 4E7IA 3ZL7C 2OTJT 4KGVB 2IIMA 3FIFA 1OOTA 4LN2A 1OPKA 2O01E 1IXDA 4XTVA 4BB7A 3EJ1B 4R0KA 3QWXX 3CXCA 2YLBA 3H6ZA 4Y28E 1PM3A 1URCB 2QYZA 2L89A 5GMKl 4MZTA 4M7AC 1B3QA 1R8OB 4DQ2A 5FRNA 2B86A 4PJMA 4LDWA 3RERA 3PT9A 5DLQE 3OYNA 3I56T 4EC8B 4ZTFA 1D09B 3BHVB 1U3OA 1K73U 3EG9B 4M7AG 3VKGA 1Q82C 1KJWA 4PJOF 5CO7A 4FYWB 1MNDA 4MZPA 4M7DD 3CCUQ 1RL2A 4PJJA 1XNIA 3MPUB 2X4XA 3CCVQ 2WPAB 4C8QA 2KSSA 5GANj 2IPOB 2JTEA 4M75B 2CP0A 3EHRA 4RTVA 2LX9A 2GF7A 3BLQB 1K8AC 1YJNQ 1ZUKA 2UZBB 1Q7YR 1I07A 3OW2P 2O2OA 2M0OA 1MMGA 2LQNA 2OAUA 2RI3A 3GBQA 3L2VA 1MMAA 4BY6B 4LE9A 4OF1A 2ABLA 2XIDA 5C0MA 4OMNA 2EW3A 1RACB 2YWWA 4JRKA 2G9XB 1M30A 1FVVB 3S6WA 5KE2A 5GAOq 1I81A 2D0NA 1VQKQ 2LRQA 1I4K1 1BYMA 3M0UA 2DBMA 4EOSB 3M0SA 2ZPGB 4PJOD 1S1NA 5GMKj 1S72Q 1OIYB 1KHIA 2JUFA 1M2VB 1AD5A 1JSUB 3JCMh 4O5VA 4BE1A 3R6NA 2DYIA 2WSCE 4M75F 3QWLA 1VQKA 3MCAB 3P8BB 1UEBA 2DK3A 4EONB 4BCND 2MOXA 3DKMA 3VS3A 1X6BA 2CS7A 2BTTA 4NC6A 3QSUA 2KYMA 1QCNA 2K5IA 4FSSA 4BCKB 4PFZA 1N8RU 1M1GA 1ARKA 4ELJA 3HRUA 1WJQA 3TW6A 1AWXA 2PMIB 2WJ9A 1M8MA 4E7KA 4JX4A 1I5LA 3OY9A 4M75C 4RG2A 1I5OB 3BE3A 3DL1A 2GCXA 4EPCA 1W6XA 1VQMA 3JCMb 2NUPA 4BE0A 4OGRB 1UJYA 5CKEA 1ABQA 1BI1A 4WTOB 2QDYB 4J6YA 3CCEA 3G4SQ 5KYYB 1JU5C 4IKFA 5FU6C 3TSZA 4HKEA 2P4TA 3SWNC 3OMGA 2L2PA 3VS5A 4JJBA 3CCUA 4D8KA 3VRYA 1OKWB 1WYXA 1JJ2S 3ASKA 3SWNA 5LJ3g 5A0LA 1TD6A 1OU8A 1M2OA 2E1HA 5GAOl 4K11A 4CFNB 4HNTA 3I55T 2FRYA 3CCQA 3RUXA 2HBPA 2W2HA 2DBKA 2QF7A 3RMSA 4ZNXA 4CFMB 2DZCA 4BI3A 2DA9A 2XI9A 3KUFA 2QDLA 2PQWA 4ANJA 3A8OB 3OYHA 1OIUB 2CH4A 5KYNA 3JB9G 3FDRA 2W99A 1QCFA 2EBPA 1JJ2P 1VQ9A 2JVVA 4AFZC 4F7UB 4OMQA 4BY6C 3NTIA 2HKNA 1PCXA 2L8DA 1ZBJA 5GANe 1SEMA 2A7YA 4A54A 2IW9B 3VS7A 2GBQA 4OB1B 1YWPA 2KI7A 4J9FA 3TNHB 3AT1B 4F6WB 2EKOA 2NUTA 2RI5A 1MHNA 4M7AF 1X75C 2NYSA 3CC7Q 1Y57A 4E7ZA 4A4HA 5A0DA 4IUPA 1RAGB 3DLLA 2E70A 1F1BB 3OS1A 1CKAA 4NL2A 1Y0MA 3OYMA 2MWOA 3M57A 2LDMA 3EGUA 3OYCA 2CP7A 4AKGA 2PNIA 3MP1A 3BHTB 2VXFA 4RTYA 2ZPHB 1MV0B 2ZZDA 2XDBA 3TEEA 2WIHB 4DA4A 2QI2A 1SG5A 2COYA 2QAZA 4CC2A 3LGLA 3OBYA 1VQ5Q 1M5Q1 2AZVA 1ZHIA 4LXCA 5L23A 4RKUE 3TW7A 1PRLC 2J6KA 3FJPA 1M3CA 3CC2A 4HXJA 5AT1B 2PK2A 1JKWA 1K9MC 4O6JA 4AT1B 2VXEA 1W2BP 2AKLA 4II1A 1WA7A 1VQ4A 5CK9A 4N4IA 1AD6A 4BCQD 3SWNB 3CCRA 4LNPA 4C8QG 2QGFB 2LNHB 4C92C 4EMKB 4LD6A 3FB9A 1VQKT 3LLRA 4ELYC 1TUGB 2VVKA 2X3WD 2ED0A 1YBYA 1FXXA 4FX3B 4FYVB 2IW8B 1QCOA 2K5LA 1VIEA 4C92E 1RUWA 2EQUA 4M7AA 1WHLA 2GGRA 1M27C 3JB9H 4AFQC 4A53A 3VS1A 4AG1C 2CT4A 2QA4A 2VKNA 4BXXX 2FPDA 2XDPA 4CXAB 4BI8B 1PC0A 4M78D 2RQWA 2EJGA 4C0GA 1QLYA 1RI0A 1SF9A 2DL4A 4ZN1A 3PIPA 2LVMA 1YJ9Q 3HFOA 3JB9D 2EYWA 2HMAA 3RR6A 1UJ0A 2HKQB 4CI0C 3BDUA 2IN3A 1QVPA 2QQRA 1LNXA 5CQYA 3CC4T 4HNVA 3OBWA 2L3QA 1YI2T 3BLHB 5C6SA 1KG1A 4EMGA 4J83A 2HQHA 1MGQA 1X6OA 2HQEA 3M4GA 1OZ3A 2O4XA 1QKXA 1FYNA 4IIOA 1UUEA 1YHQT 2KDSA 2AHJB 4LOCA 3RBBB 3I55A 3I56Q 2XD0A 6AT1B 1VOMA 4JJCA 2YDLA 4CRIA 1VQ9Q 4QW2A 3QYGB 2OTJA 2QDJA 2XDDA 1O9KB 5EFQB 3CCUT 2DMOA 4XU0A 2L3SA 4C92A 3I5SA 4N0AA 2UUEB 2WMBB 3CCET 1EZZB 3DB4A 5LJ3d 2O9SA 4QKUA 3REAB 2KQWA 2AT1B 2LQWA 1MV3A 2JM9A 4KRDB 2K9GA 2CCIB 2R58A 3QZ9B 1BCOA 2W9FA 2BUDA 1KQSP 2BS3A 1YIJT 5FROA 2DYBA 2MYSA 1GCQC 2VUBA 4QSHA 4B6MA 1BIAA 4M7AD 1WJSA 2O9VA 1UGVA 2JS0A 1H8KA 3CMEQ 1SRLA 4KH0B 3JB9J 1NEGA 1X6GA 1N27A 1WQWA 1ZSZA 2LX7A 1PWTA 3OS5A 2EYXA 2A0FB 1VQMQ 3CD6A 1W70A 1JRIA 2V8JA 2B9RA 4KUDK 1UGSB 2R5AA 1H1RB 4XU1A 5IT9E 3O8VA 3CPWA 1G3YA 4QQGA 1B07A 3NPFA 4YTLA 4C92D 2ED1A 2J6FA 5FW9A 3VU3C 4F17A 5DQWA 2DXBA 4R55A 1K4US 2LMJA 4JLGA 1D0ZA 3L2QA 3CBOA 4OMOA 3G71T 1K1ZA 3JCMg 4PJOA 2FZCB 4C92F 4EDUA 5FRMA 5J39A 2DL5A 3EFRA 2ROTA 3M55A 3CBPA 5LJ3h 1WDXA 4M78E 5FU7B 3MHXA 1D1CA 2E10A 3H0FA 2KRSA 3H0IA 4ME7A 1Q95G 1C6VX 1SSHA 4YOZA 5GAMd 4NSTB 5FGKB 4CFXB 4PFOA 4Z6YA 1SKUB 2JNGA 2C5OB 4N0AC 1KIKA 4C0DC 1BK2A 2FHDA 5A0GA 4UC4A 2QGSA 2EKHA 4XTWA 4OMFB 2RHUA 5A2QE 4FYYB 2VASA 1GXIE 4HA8A 4PK4A 2HL3A 4OB0B 1UGQB 2CDTA 4HVVA 1YIJA 3RMQA 2UZLB 2DM1A 2DVEA 1OL1B 4PKCC 5DLOA 1QMCA 4FL6A 4A63B 3GNFB 1VQ8A 5GJVB 1NBEB 2V8KA 1MNEA 4C5EA 1V1CA 3CCJA 4F6UB 3OQ5A 1Y71A 1KD1U 2X9HA 4N4GA 1Q86R 1H3ZA 1RAIB 3KFVA 4ZTJA 3LQ5B 2WXVB 4F7JB 2C0IA 4C8QE 4M75D 3F5XB 2DO3A 1X27A 3JCMd 1HD3A 1GL5A 1K9MU 2DZ9A 3I9QA 1PRMC 1C1AA 3CBMA 2F2CA 2DTOA 4IUQA 1Y96A 2RO0A 3CCST 2ZAEA 4PNOA 2K79A 4UN0A 1KSWA 2EJFA 3JCMP 5GAMg 1IB8A 3CCJQ 1KC8R 4ORZA 5IDNB 1K8AU 3JCMf 2LJ3A 1VINA 2C06A 2Y4XA 1VQ8Q 4R56A 1KD1R 4F7LB 2FO0A 1NG2A 1NPRA 5LJ5f 1QWFA 1ABOA 1W98B 3QYHB 4KT0E 4J6XA 4LD9K 4RG8A 4IIMA 5ECAA 1UHFA 3JCMc 5GMKm 1XOVA 1EIFA 3RESA 1JSTB 4RTUA 2HBWA 4E6RA 2J06A 3KBGA 2COWA 2C6TB 1TS9A 3MEWA 1VOLA 2CSQA 1XO2A 4DEYA 1M8VA 2EIFA 2CSIA 3X20B 1YJNT 3PGGA 2YRVA 4GBQA 2WMAB 4HLQA 4M78A 1FINB 1KQ1A 1RABB 2DF6A 2RMOA 4J9HA 4RODA 4NOYA 1QVGS 2FYKA 3E1SA 3EGXB 3BY7A 2Y90A 3HP9A 2E41A 1PSEA 2DD4B 3E2UA 2M16A 2FL7A 2JMAA 1ZA2B 1IO6A 3QDRB 4HNUA 3A8GB 4L5GA 3G71A 2CP2A 5HNBB 4KUIA 3QG1A 4C0FA 4XTXA 4LDVA 1UFFA 3CCRT 3JSCA 1VYTA 1WFWA 3TN8B 3M03A 5KYWB 1VQ4T 1RLPC 1X2KA 2NUZA 2W0ZA 3OW2A 3NGPA 1ZSZB 1UE9A 2RPNA 4E7JA 2YUQA 1E7PA 5AYFA 3GOXA 2QXFA 3EOCB 1WJRA 2EGEA 1OV3A 3HPWA 1EFNA 4CFWB 3UDCA 4HCCA 4M77B 3DTOA 2FPEA 4DBQA 4A4KA 1GUXA 1I0CA 4DBFA 4JS4A 1G8XA 3PFSA 3EG1A 1OEBA 3VS2A 1QMZB 3EG3A 4LDYA 5LJ5g 3VYGB 5KCHA 4RTZA 2K7AA 4XAXB 4F7SB 1M90U 5I11A 4IUUA 3EG0A 1VYWB 4HT9A 1BI2A 2OAWA 3CXCP 3M4YA 2ENMA 4FT2A 4KGZB 5GANf 3G4ST 2L3PA 3MO8A 2CREA 1P5EB 2QQ9A 2E12A 3HFNA 3ER0A 4AI6A 1LJOA 5KYWA 5IHNA 4OB3B 1TXQA 1D0YA 2RHZA 2KNBB 4PJLA 1BIBA 1JXMA 2NLUA 3TCJA 4EMKC 2CUDA 2K3XA 3L42A 5IDPB 1WPYA 1ZUYA 3SHWA 2P4RA 2A37A 1Q82R 2GNCA 1D1BA 1BU1A 1KQSS 4ELZC 3G7ZA 1ZA1B 2Z0WA 4L59A 4JX6A 2BKDN 4IUVA 1LVKA 1N9RA 2HAXA 4BCGB 4MMKA 5DQVA 2X4JA 4BBSM 2E6NA 4M77C 1D3BB 3VJPA 5GAMf 5L2WB 1WXTA 1T0JA 5LJ3e 3F70A 2G3RA 5FU7C 3NHNA 2LCLA 5GMKe 2EUFA 4ESRA 3UWNA 2FB7A 1RI9A 3IQLA 2L3RA 1TFBA 4C92G 4E7HA 2FG0A 2BZ8A 1KQ2A 1E6HA 3QWYA 2CKKA 1RAEB 4L6V5 2X1NB 4IURA 4OGEA 1T3LA 2VWFA 3M59A 4D8DA 2DL8A 1BKBA 2QA4Q 4PLLA 5KYXB 5IHKA 4M6VA 4HL4A 4DOWA 3ULRB 1YN8A 1GFCA 3OS0A 2DPPB 2KY9A 3J7AF 2OX7A 2QQBA 4BCMD 1JBMA 3JAME 3QIIA 1Q82U 1ZX6A 2E3HA 4M7AE 5HBJB 2RK2A 1N8RR 3RKWA 1XJWB 3M54A 5IXBA 3CCRQ 3LX7A 2QQSA 1K9AA 1U5SA 1IRXA 1M1KR 1K76A 3ZEHA 2VGNA 2DRMA 2LCSA 4YOOA 2W96A 2P84A 2L0AA 4F7UF 1VQLT 4J9EA 1KXUA 2KXCA 1VYVA 2H8HA 1VQ5A 2DL3A 4C92B 5IHIA 2G77A 5D6WA 1VQ6A 1VQOT 1B34A 4OMPA 1W2BS 4XTYA 1WQ7A 1R0CB 1WZOA 1SRMA 5J26A 4ZGEB 2QTVA 4J7FA 4LUEA 3VYHB 3PVQA 2FZKB 4HCBA 5I5ZB 4E2FB 1BBZA 3CEYA 2UZEB 3GF5A 1GRIA 1NLPC 1FMKA 2RJCA 3S3OA 1Q7YC 3CC4Q 3MY5B 5GAOp 4CC3A 3CC7A 4BACA 5HBHB 2V26A 3S3NA 5GAN3 2QASA 4PFPA 2DXUA 2EJ9A 2DMEA 4F04B 5GAMh 2D8HA 1I1JA 3OYYA 3NFCA 1HJDA 5HQ0B 4J9CA 2EYYA 1U8RA 1QVFA 1Q7YU 3QJYA 4FW1A 1U06A 2ZPFB 2CCHB 1HXDA 3G6EA 2KAFA 2LTOA 4CFUD 4C8QB 3A98A 4WCIA 3OA6A 3CCLA 4HVUA 1NPPA 2DTHA 2E3IA 3B57A 4KULA 3INZA 3QYBA 1G3SA 4KH1B 1FWZA 3PO3S 4I3ZB 4FT4A 1OI9B 4AFUC 1RADB 1YWOA 1IGQA 3MIAB 5CAIA 1VQPQ 2R7GA 2JS2A 4FIBA 4C5HA 1KC8C 2RM4A 5KE3A 2CZ6B 2JM8A 4J9BA 4DEXA 2WSEE 3OYEA 2RHIA 3HRTA 2Y4YA 2RH2A 3N5BB 3H8ZA 3NTHA 2XICA 1FKMA 5KCOA 4RMOA 3OB9A
chains in the Genus database with same CATH topology
2FHDA 5A0GA 3GLXA 4UC4A 3JCMQ 3OYLA 4C8QA 2F5TX 3META 2KSSA 3G4SA 2DIGA 4XTWA 4OMFB 5GANj 2RHUA 5A2QE 4M75B 1NJIU 3OYDA 4FM4B 4J7IA 2LX9A 3JB9I 4X9CA 1VQMT 2EWNA 2GF7A 2RHYA 3V8KA 3GPLA 1K8AC 1GXIE 4OGCA 3A8MB 2MAMA 2R57A 4HA8A 4D6WA 2GQVA 4OB0B 1UGQB 3LWIA 4EMKA 2M0OA 1YIJA 2K2VA 3RMQA 3L2UA 1NE8A 2OAUA 2LNVA 3CPFA 2DVEA 4Z02A 3JCMV 4N4HA 2RI3A 3P8DA 1O75A 2MWPA 1KD1C 4JS5A 4PKCC 3BG9A 4Q5WA 5DLOA 5GAN2 1FX7A 5D6XA 3L2VA 2LT4A 3OYAA 3V7CA 4FL6A 1W2BA 3GNFB 4BY6B 4OF1A 1VQ8A 2V8KA 2XIDA 1LOJA 4VUBA 3ZFJA 2MI6A 3FLGA 5C0MA 3HRSA 2HD0A 4C5EA 3CCJA 2E5QA 3OQ5A 4JRKA 1Y71A 2DD5A 5D6YA 3CCVA 1N9SA 4MIMA 4M7AB 3S6WA 5KE2A 5GAOq 1KD1U 1I81A 1NZ9A 4N4GA 5GAMe 1H3ZA 4LDUA 5KCOA 4ZTJA 2LRQA 1I4K1 4M7DF 4QQDA 1BYMA 4C8QE 4M75D 2DO3A 3JCMd 2ZPGB 3FEOA 3CCMT 4PJOD 5GMKj 3LYIA 1K9MU 4BUGA 1VQ9T 2DZ9A 2H3JA 2PUOB 2MF2A 1KHIA 2JUFA 3CBMA 1S72A 1NJIC 4M7DA 3HBLA 3JCMh 4O5VA 2CGHA 2CZ0B 2DEQA 2DTOA 4IUQA 3ZBDA 4BE1A 1Q86C 2OTLT 2WSCE 4M75F 3QWLA 2PVDB 5EG2A 1M1KC 3WXMB 4M77E 1M1FA 5CVIA 1VQKA 2DAQA 3MCAB 4QVZA 1Y96A 2RO0A 3P8BB 3CCST 3CCVT 4PNOA 1UEBA 2DK3A 3HSBA 4PJOE 3DKMA 3OYJA 2CS7A 2EJFA 2MMPA 3QHSA 5HK3A 4NS5A 5GAMg 2VC8A 2BS2A 3JCMP 4BDZA 4OVAA 1N8RC 1K8AU 3VUBA 1VQ7T 3FRNA 4NC6A 3PMIA 1X01A 3JCMf 5CCAA 2C06A 3QSUA 3LH0A 2Y4XA 4JRPA 4JX5A 2K5IA 2KVQG 3OSVA 5LL6S 4R56A 4P5NA 1N8RU 1M4ZA 1M1GA 1P92A 4ELJA 1NPRA 2X4YA 3HRUA 2WSFE 2DXBB 2XU8A 1WJQA 3TW6A 5LJ5f 5EJCA 4XU3A 2WJ9A 1U1TA 3QYHB 4E7KA 4KT0E 4JX4A 4J6XA 1I5LA 3J80E 4J6WA 4RG8A 4LD9K 3EFSA 3OY9A 4MMLA 5GMKm 4M75C 3JCMc 3RIRA 4RG2A 1XOVA 3PTAA 4XTZA 5HK0A 1EIFA 5GAOn 3OYFA 3RESA 5DY9A 2M9UA 3OYKA 2KK4A 3DL1A 1YJNA 2GCXA 4EPCA 1VQMA 3JCMb 4BE0A 3KBGA 5CKEA 5LJ5h 1BI1A 4C5IA 2QDYB 4J6YA 3CCEA 2HQXA 4KBMB 4GY5A 1D3BA 4MZMA 4M78F 3QYEA 5GAN6 2DD4A 3MEWA 4IKFA 5FU6C 3X25B 3VYGA 4BD3A 5FLXE 3L2WA 3KXTA 1M8VA 2EIFA 1VQOA 1QVFS 3CMAT 4HKEA 5HY6A 1M1KU 2P4TA 3X20B 2RA2A 3SWNC 3JCMe 1YJNT 2X35A 2E65A 3OMGA 3PGGA 2YRVA 3CCUA 2L5QA 3V7RA 4M78A 4HLQA 1QLBA 1KQ1A 1JJ2S 3J81E 1QVGS 2RI2A 2QFZA 3ASKA 4NOYA 2FYKA 3SWNA 5A0LA 5LJ3g 3E1SA 2XHCA 2E1HA 1VQLA 2F69A 2Y90A 3BY7A 4B9WA 4A4FA 2ZPEB 5GAOl 3HP9A 1PSFA 2E41A 4HNTA 1PSEA 3I55T 2DD4B 3M53A 2M16A 2FL7A 3CCQA 3RUXA 5L8RE 5GANg 4WF2A 3QDRB 4HNUA 3A8GB 2HBPA 4L5GA 4XTUA 5FU6B 3G71A 4PLIA 2QF7A 3OMCA 3RMSA 1OYXA 3V8JA 1VQPA 4KUIA 3A5ZB 3QG1A 4C0FA 2V8IA 4F7UA 2DZCA 4BI3A 2XI9A 4XTXA 4AKHA 1VUBA 2EAYA 3KUFA 2KR6A 2PQWA 4M7DE 4M75E 2EQKA 4X34A 3A8OB 4LDVA 3OYHA 3BFMA 4M75G 3CCRT 3MP8A 1KHCA 3JSCA 3JB9G 3VKIA 3QZ5B 5GAMj 3FDRA 3OW2A 1VQ4T 1JJ2A 4JJNK 4EMHA 5CKBA 4MDWA 1VQ9A 2JVVA 4F7UB 4E7JA 5CKDA 5KH6A 4BY6C 4ZGJB 1M9SA 4Y91A 2DXTA 1E7PA 3NTIA 5AYFA 3GOXA 2L8DA 2QXFA 5GANe 3VUZA 3OYIA 4FU6A 5CR2A 1WJRA 4PJOC 3M56A 2A7YA 5J3BA 4A54A 3HPWA 1YITT 4OB1B 3UDCA 4QVCA 4HCCA 3QJ6A 5CIUA 4M77B 2B8AA 3C95A 1TH7A 3CCJT 4A4KA 1Y07A 2EKOA 2EYQA 4JS4A 3RKXA 3CMEA 2RI5A 2YHTA 1MHNA 2EFIA 4NL3A 2K3YA 3PFSA 4QVDA 1O9SA 4M7AF 1YCYA 2BIVA 2DKGA 4PJOB 1X75C 3PMTA 2JTFA 2A3LA 3QBYA 4LDYA 4B9XA 4OB2B 5LJ5g 4A4HA 3VYGB 5A0DA 5GMKi 4IUPA 3SD4A 2E6ZA 4XAXB 5KCHA 4JRQA 3CC4A 3E9GA 3DLLA 2E70A 1M90U 3G6ET 5CQXA 4MDXA 1QVGA 3OS1A 1W4SA 4IUUA 4C0ZA 4NL2A 4HT9A 3JB9F 1KC8U 1BI2A 3OYMA 5CKHA 3OSSC 2MWOA 3M57A 1KQSA 3M4YA 2LDMA 3JRZA 3OYCA 4FT2A 3P8HA 5GANf 3G4ST 4AKGA 5I21A 3MP1A 4A4EA 3MO8A 2D0QB 2QQ9A 5GAN7 2VXFA 1QP3A 2E12A 2QQ8A 3HFNA 2ZPHB 4AI6A 1LJOA 3ER0A 3OYBA 4OB3B 2ZZDA 2EQMA 4M77D 2XDBA 2RHZA 3TEEA 5LJ5e 4DA4A 4BE2A 1BIBA 2NLUA 2BS4A 2QI2A 2DJZA 3TCJA 4EMKC 5IAYA 2QA4T 1YJ9T 1YITA 3CCSA 2K3XA 3LGLA 3OBYA 4PJOG 3L42A 1WPYA 4HT8A 5GANh 1M5Q1 1ZHIA 5I2SA 5GANd 3E19A 4M77G 3TW7A 4QQ6A 4RKUE 5HKCA 1WNLA 4C8QC 1Y96B 3FJPA 3I56A 1VQNT 3BW1A 3CC2A 3H4CA 4XQ3A 1KQSS 2IVWA 1K9MC 4O6JA 4ELZC 4FSXA 2VXEA 3G7ZA 4OP0A 1VQ4A 4II1A 3GP8A 3HHTB 5CK9A 4N4IA 5LJ3j 4L59A 4F7UG 1AHJB 4JX6A 3SWNB 4C8QG 3CCRA 1JB0E 2BKDN 1Q81C 4EMKB 4IUVA 1N9RA 1VIFA 3T9NA 4C92C 4LD6A 3FB9A 1VQKT 2HAXA 3LLRA 4MMKA 3QO3A 3HL8A 3TREA 4ELYC 1VQ6T 4PL6A 2DTIA 2JN0A 1YBYA 4C0DB 1VQPT 1FXXA 3LGFA 2YLCA 4M75A 4BI4A 2X4JA 3X28B 1XQHA 4BBSM 2E6NA 2K5LA 1D3BB 4M77C 3VJPA 5GAMf 1S72T 5GAOr 3MEUA 1VIEA 4RCCA 4C92E 3CC2T 5LJ3e 3F70A 2EQUA 2G3RA 5FU7C 3TU4K 4M7AA 2JTMA 1UGPB 3MP6A 4E47A 1ZQ1A 2LCLA 2JOYA 2E64A 2CYZB 3MEAA 5GMKe 1ZBXA 4BBRM 4GLKA 3JB9H 4A53A 3M58A 2XKOC 2QEXT 1YJWT 3S3MA 3UWNA 3C4SA 2FB7A 2QA4A 1YJ9A 3LW5E 3PNWC 3HZJA 2L3RA 1YHQA 2GFUA 4C92G 1UB4A 3QUIA 4E7HA 1YIJT 2XDPA 2ZGWA 1KQ2A 4X9DA 2CKKA 1IZ6A 2PUKB 1I8FA 4BI8B 2CZ1B 4L6V5 4M78D 2EJGA 4M78B 4C0GA 4IURA 3HKSA 4OGEA 1VQ8T 3JCMX 1Q86U 3M59A 1RI0A 4XK8E 2ZPBB 1BKBA 4ZN1A 3UT1A 2LVMA 3PIPA 4PLLA 2QEXA 3HFOA 3JB9D 1YI2A 1YJWA 4C8QD 3HB9A 4M6VA 1BI0A 4HL4A 3GNGA 4F7UE 4DOWA 4JLIA 2ZZDB 1UGRB 4MFDA 3BDUA 4CI0C 3KHIA 3OS0A 3FC3A 2DPPB 3DB3A 1QVPA 2KY9A 3CXCS 2QQRA 2DD5B 2M1HA 3J7AF 1LNXA 2QQBA 2X4WA 1JBMA 3BG5A 2DIQA 2DXCA 3QIIA 5CQYA 3C12A 3JAME 3CC4T 1Q82U 4M7DG 3DLMA 4HNVA 3OBWA 1YI2T 4M7DB 4M7AE 2XK0A 2RB6A 5C6SA 1KG1A 2DXCB 4EMGA 4J83A 1MGQA 5GAOm 2RK2A 2LQKA 1X6OA 3M5AA 2HQEA 3RKWA 2K5FA 3OS2A 3LWHA 3SDZA 2KMTA 3M4GA 3Q1JA 4ZN3A 3PIOA 3CMET 1VQ7A 3WVEB 3L1AA 3M54A 2P0KA 1OZ3A 2O4XA 1WGSA 3LX7A 1N6AA 2PVGB 1YHQT 2ZCFB 2QQSA 4JDSA 1OI1A 2K57A 3UPUA 3A8LB 2AHJB 2KDSA 4LOCA 3ZEHA 2VGNA 3I55A 4M78G 1VQNA 3X24B 2XD0A 4F7UF 2D9TA 4CRIA 1VQLT 5LJ5j 2O4XB 4QW2A 3QYGB 4M77A 2OTJA 2I2LA 2QDJA 1VQ5A 3MEVA 2XDDA 3CCMA 1U1SA 5I2MA 3QKJA 4MFEA 3M9QA 4M78C 3CCUT 4C92B 3HO8A 1K73C 3ME9A 2ZPIB 3QXEB 4XU0A 2G77A 2VGMA 2PU9B 5D6WA 1VQ6A 4ATOA 3SFMA 1VQOT 1B34A 2K4YA 4C92A 4M77F 2RJFA 5LJ5d 2VV5A 3OW2S 4N0AA 2QQAA 4J5YA 3JCMW 1W2BS 2LC4A 4XTYA 3X26B 1WQ7A 1G5VA 4RCBA 3CCET 5J26A 4XU2A 4ZGEB 2LCCA 3DB4A 5CKFA 2IG0A 4J7FA 5LJ3d 5GMKh 2CZ7B 2EQJA 2KQWA 2LQ8A 3VYHB 2RHXA 3VV0A 3CCQT 3C94A 3CCLT 4HCBA 2FVUA 2HNIA 1QP2A 3V8LA 3CEYA 3CC7T 3SB2A 2R58A 3QZ9B 3GF5A 3L2ZA 2LT1A 2WACA 3L2RA 2RJEA 3E9FA 3URGA 3CD6T 2RJCA 4A4GA 1H641 3S3OA 1Q7YC 2GFAA 2BUDA 5GAOp 2BS3A 1G3WA 4C8QF 3CPWS 3CC7A 4BACA 5FROA 4DOVA 3NTKA 2RK1A 5IN1A 3AHUA 2VUBA 4QSHA 3R6OA 1BIAA 3S3NA 3GIBA 5GAN3 1Q81U 4M7AD 3BDLA 1WJSA 4J8OA 1OZ2A 2P0PA 2DXUA 1BI3A 2QTXA 2EJ9A 5GAMh 2VYTA 4ZGDB 3A8HB 3JB9J 3OYYA 4HCZA 3NFCA 2KMGA 1N27A 1WQWA 1M90C 1U8RA 1QVFA 1V29B 1HK9A 1Q7YU 1XTDA 4BDYA 3OS5A 3QJYA 3RKYA 4LDXA 5GAN8 2D6FA 3JCMJ 2R5MA 5DM7R 3CD6A 2ZPFB 2OTLA 4AKIA 1JRIA 5M9OA 1HXDA 2V8JA 2XG8D 3EAEA 4IUTA 5GAN5 3WVDB 4KUDK 5GAN4 3G6EA 1SSFA 2KAFA 4M7DC 1UGSB 3VKHA 2LTOA 2R5AA 4JRIA 4C8QB 4E7IA 2OTJT 4XU1A 3OA6A 5IT9E 3CCLA 1NPPA 1Y7XA 2DTHA 1IREB 3O8VA 3CPWA 3FIFA 1B34B 1G3YA 4QQGA 4KULA 2RD1A 3INZA 3QYBA 4YTLA 4C92D 2JZ2A 2O01E 4C5GA 4XTVA 4BB7A 3OYGA 1G3SA 2PVOB 3VU3C 3CXCA 2YLBA 3H6ZA 1FWZA 2DXBA 4R55A 4FT4A 4Y28E 4E7LA 3BG3A 2L89A 4JLGA 5GMKl 4MZTA 5CAIA 3L2QA 3CBOA 4M7AC 3G71T 1R8OB 4DQ2A 3JCMg 4FIBA 1G3TA 4C5HA 1KC8C 2RM4A 5FRNA 5KE3A 1VQ5T 4PJOA 2F5KA 4C92F 1DJ7B 4EDUA 4LDWA 5FRMA 5J39A 3RERA 2CZ6B 3PT9A 3M55A 3EFRA 5DLQE 4TVRA 3OYNA 3I56T 4ZTFA 3CBPA 5LJ3h 1QW1A 2RJDA 4M78E 2WSEE 3OYEA 2RHIA 5FU7B 1K73U 3MHXA 2P0QA 2E10A 3V7SA 4M7AG 3VKGA 1Q82C 3QPHA 4ME7A 4PJOF 3HRTA 5CO7A 2Y4YA 2RH2A 3N5BB 3H8ZA 3NTHA 4MZPA 2XICA 4M7DD 1RL2A 4JUVA 1XNIA 5GAMd 4V2SA 4Z6YA 2JNGA 3CMAA 1FKMA 2X4XA 5LJ3f 4N0AC 4RMOA 4C0DC 3OB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X20 B;  4RKU E;  2ZPI B;  3QXE B;  2PU9 B;  4FM4 B;  1GXI E;  3X26 B;  3A8M B;  2ZPE B;  4OB0 B;  1UGQ B;  3HHT B;  4ZGE B;  1PSF A;  1PSE A;  2DD4 B;  1AHJ B;  2CZ7 B;  1JB0 E;  3VYH B;  5L8R E;  3A8G B;  1QP2 A;  3QZ9 B;  3X28 B;  3A8O B;  3QZ5 B;  1UGP B;  2DD5 A;  2CYZ B;  4ZGJ B;  4ZGD B;  3LW5 E;  3A8H B;  2ZPG B;  1V29 B;  2PUK B;  2PUO B;  2CZ1 B;  4L6V 5;  4OB1 B;  2ZPF B;  2CZ0 B;  4XK8 E;  2ZPB B;  2WSC E;  3WVD B;  2PVD B;  1UGS B;  1IRE B;  2ZZD B;  1UGR B;  2DPP B;  2DD5 B;  4OB2 B;  2O01 E;  3VYG B;  2PVO B;  2DXC A;  2DXB A;  4Y28 E;  2DXC B;  2WSF E;  2DXB B;  3QYH B;  4KT0 E;  1DJ7 B;  3WVE B;  2CZ6 B;  2PVG B;  2ZCF B;  2WSE E;  2D0Q B;  1QP3 A;  3A8L B;  2AHJ B;  2ZPH B;  4OB3 B;  2ZZD A;  3X24 B;  2QDY B;  2DD4 A;  3X25 B;  3VYG A;  3QYG B; 
#chains in the Genus database with same CATH topology
 1AZE A;  3OYL A;  5I22 A;  2F5T X;  2KRO A;  3G4S A;  2KR3 A;  1LCK A;  1NJI U;  3OYD A;  4FM4 B;  1VQM T;  3V8K A;  2RHY A;  1IHV A;  4OGC A;  2MAM A;  3EH1 A;  2GQV A;  2AZS A;  4DBH A;  2K2V A;  3L2U A;  1NE8 A;  3CPF A;  2LNV A;  3FJ5 A;  4Z02 A;  1H1Q B;  1O75 A;  4AMC A;  1D0X A;  2AKK A;  1Z9Q A;  2DVJ A;  4JS5 A;  5GAN 2;  1FX7 A;  2LT4 A;  3OYA A;  2JW4 A;  3EG2 A;  1JXO A;  3FLG A;  1G3N C;  3HRS A;  2HD0 A;  3LH5 A;  2E5Q A;  3VS4 A;  2DD5 A;  1V76 A;  2E4H A;  4M7A B;  5GAM e;  5IHY A;  2K6D A;  4LDU A;  2SEM A;  3FEO A;  4BUG A;  2PUO B;  1S72 A;  3DJB A;  1NJI C;  4M7D A;  3ZBD A;  2OTL T;  1M1K C;  2PVD B;  5EG2 A;  3WXM B;  4QVZ A;  4PJO E;  2FPF A;  5HK3 A;  4BDZ A;  4OVA A;  1N8R C;  1VQ7 T;  3VUB A;  4AFS C;  2EVR A;  1H1S B;  1EX4 A;  3OSV A;  5LL6 S;  1X2Q A;  2QG9 B;  1BCM A;  2X4Y A;  2DXB B;  1K0X A;  5EJC A;  4FYX B;  5CYI B;  3EFO B;  1YNZ A;  2AIR B;  4J6W A;  3EFS A;  2KEA A;  3RIR A;  3PTA A;  4XTZ A;  5HK0 A;  1AWW A;  3OYF A;  5DY9 A;  3CD6 Q;  1YJN A;  1NYG A;  4E7S A;  3H9N A;  5LJ5 h;  3PVL A;  5D7U A;  4KBM B;  4GY5 A;  4MZM A;  1E9H B;  4M78 F;  4BD3 A;  5FLX E;  3L2W A;  2BZY A;  3KXT A;  4JZ4 A;  1QVF S;  2HSE B;  2X3X D;  2RA2 A;  1VA7 A;  2E65 A;  3EG9 A;  5KYX A;  1G83 A;  3J81 E;  2C4G B;  1ACM B;  2V1Q A;  2XMF A;  2DIL A;  4A4F A;  1H25 B;  2NUT B;  2KT8 A;  2RN8 A;  3M53 A;  5GAN g;  2OI3 A;  3OMC A;  1VQP A;  1OYX A;  3A5Z B;  2V8I A;  4F7U A;  2DRK A;  2MIO A;  2KR6 A;  4M7D E;  4M75 E;  2EQK A;  2ROL A;  4X34 A;  3BFM A;  1K0S A;  1KHC A;  2V1R A;  3TNI B;  3VKI A;  2K2M A;  2HSP A;  1JJ2 A;  3CCM Q;  2UZD B;  3HTR A;  2GQI A;  4JJN K;  5CKB A;  2BE9 B;  4ZGJ B;  1TUD A;  1YCS B;  3G6E Q;  1UTI A;  2JJ9 A;  1M90 R;  3MKD A;  1GY3 B;  4FU6 A;  5IF1 B;  4PJO C;  2CT3 A;  3MI9 B;  2G6F X;  4BCP B;  5CIU A;  2M0Y A;  2B8A A;  3C95 A;  2O88 A;  4CFV B;  2CUB A;  3CCJ T;  5LMK B;  3M0T A;  4EOR B;  2EFI A;  3DOG B;  2YHT A;  2K3Y A;  4RUG A;  4NL3 A;  1O9S A;  1VYU A;  1YCY A;  2BIV A;  3REB B;  2JTF A;  2A3L A;  3QBY A;  4B9X A;  4OB2 B;  1NM7 A;  5GMK i;  3CC4 A;  3SD4 A;  4BY7 X;  3E9G A;  2RQT A;  3G6E T;  2FRW A;  4MDX A;  1QVG A;  4C0Z A;  1WX6 A;  5ACB A;  3JB9 F;  4CC4 B;  2QEX Q;  1ZSG A;  3JRZ A;  3P8H A;  2YRD A;  5I21 A;  2NWM A;  1PKT A;  2MK5 A;  2D0Q B;  4OR5 B;  5GAN 7;  3OYB A;  4BCO B;  2M02 A;  1GCQ A;  1VQ6 Q;  1AVZ C;  2BS4 A;  1NLO C;  8AT1 B;  4F7N B;  2QA4 T;  1YIT A;  1OGU B;  5GAN h;  5GAN d;  5I2S A;  4BY1 X;  4F14 A;  4M77 G;  3VS0 A;  5HKC A;  1WNL A;  2OJ2 A;  4C8Q C;  2DER A;  2RNA A;  3BW1 A;  3H4C A;  4EC9 B;  4XQ3 A;  4HCK A;  4FSX A;  1OPL A;  4OP0 A;  4F70 B;  4J9I A;  3HHT B;  1KK7 A;  2WHB B;  1RAA B;  4QT7 A;  1AHJ B;  2DX1 A;  3I5R A;  4IMY B;  1Q81 C;  1OL2 B;  3T9N A;  1M2V A;  4J9G A;  4RTW A;  1QKW A;  1VQ6 T;  4PL6 A;  1A0N B;  2JN0 A;  2CP5 A;  4C0D B;  1JEG A;  1VQ4 Q;  3LGF A;  3X28 B;  1XQH A;  2DET A;  1S72 T;  2YUO A;  3CC2 T;  4RCC A;  2C0O A;  2JTM A;  1UGP B;  1ZQ1 A;  2JOY A;  2E64 A;  2CYZ B;  3MEA A;  3M58 A;  2XKO C;  4CC7 A;  1YJW T;  3S3M A;  2YT6 A;  3C4S A;  3PNW C;  2C5X B;  3HZJ A;  2GFU A;  1UB4 A;  3EGX A;  3QUI A;  2ZGW A;  1TOV A;  1YFN A;  2J7I A;  2KYB A;  4EOL B;  1M3B A;  4M78 B;  3HKS A;  1CKB A;  1Q86 U;  4PJN A;  4FCY A;  2ZPB B;  4II5 B;  4TTH A;  3UT1 A;  3EGD A;  1C0M A;  2QEX A;  4CFU B;  1UDL A;  4C8Q D;  3GNG A;  4Z8A A;  4F7U E;  4JLI A;  2ZZD B;  2A08 A;  1UGR B;  4X1V A;  2KRN A;  2O31 A;  4AG2 C;  3CPW P;  3FC3 A;  1HYO A;  1RAH B;  2M1H A;  3BG5 A;  4EOJ B;  2DIQ A;  3C12 A;  4EOK B;  2X51 A;  2KT1 A;  4M7D B;  2XK0 A;  2DXC B;  1PG5 B;  4J9D A;  4JJD A;  3VRZ A;  2LQK A;  5GAO m;  3M5A A;  1AEY A;  3OS2 A;  5IH2 A;  2KMT A;  3Q1J A;  2BZX A;  4ZN3 A;  3PIO A;  3L1A A;  1WGS A;  3PE0 A;  1OX9 A;  2LJ1 A;  2ZCF B;  1ENW A;  2QK0 A;  1ZP2 A;  2EGA A;  4FW2 A;  8ATC B;  3C0C A;  4BCI B;  3A8L B;  1GH6 B;  1M3A A;  4M78 G;  1VQN A;  4OML A;  2CP3 A;  1JOW A;  4ROE A;  2QGG A;  3M0R A;  2O4X B;  2JT4 A;  3CCM A;  1U1S A;  1OUL A;  1X69 A;  3QKJ A;  4MFE A;  3JV3 A;  4M78 C;  1K73 C;  2D8J A;  2F1L A;  5FWC A;  2ZPI B;  2VGM A;  2PU9 B;  3SFM A;  2K4Y A;  5LJ5 d;  4M77 F;  3OW2 S;  2QQA A;  3JCM W;  1G5V A;  5CEI B;  4RCB A;  1TU0 B;  1QVF P;  1MUZ A;  2CZ7 B;  2EQJ A;  3CCQ Q;  3CCQ T;  3C94 A;  3CCL T;  1R0B G;  2FVU A;  4YOS A;  2HNI A;  2IVX A;  1QP2 A;  1KFZ A;  3EGD B;  3CC7 T;  3SB2 A;  5HCK A;  2LT1 A;  1JO8 A;  2WAC A;  3L2R A;  3E9F A;  3URG A;  2GFA A;  3CPW S;  4DOV A;  5IN1 A;  3AHU A;  2ESW A;  3R6O A;  2DLP A;  1Q81 U;  1WHH A;  1OZ2 A;  2P0P A;  1BI3 A;  2VYT A;  2DE0 X;  3A8H B;  2M51 A;  4HCZ A;  3CCE Q;  2KMG A;  1SHF A;  1R77 A;  1V29 B;  1HK9 A;  3POM A;  1XTD A;  3RKY A;  5KYY A;  3JCM J;  2R5M A;  2OTL A;  4AKI A;  5M9O A;  2XG8 D;  2JMC A;  5GAN 4;  3UAT A;  3VKH A;  2PZ1 A;  4JRI A;  2H3E B;  1Y7X A;  3D7S B;  1IRE B;  1MMD A;  1D3U B;  1UNH D;  1B34 B;  1WHM A;  3TSW A;  4Z89 A;  1QQJ A;  2RD1 A;  2JZ2 A;  3OYG A;  4C5G A;  2PVO B;  3BLR B;  4KRC B;  4E7L A;  1WIE A;  3BG3 A;  2KGT A;  4DBR A;  3G71 Q;  1G3T A;  1TTH B;  1VQ5 T;  1H4L D;  2F5K A;  1DJ7 B;  1AZG B;  4TVR A;  1K9M R;  1E7O A;  4LUD A;  1QW1 A;  2RJD A;  1QWE A;  2P0Q A;  3V7S A;  3QPH A;  1AWO A;  4BCQ B;  4JUV A;  2CP6 A;  1J3T A;  1GBQ A;  4V2S A;  2HCK A;  3CMA A;  5LJ3 f;  3GLX A;  1NYF A;  3JCM Q;  3MJX A;  2YXY A;  3MET A;  2HEQ A;  2DIG A;  1MMN A;  2K3B A;  2YUN A;  1PHT A;  4J7I A;  4Y72 B;  3JB9 I;  3GTM S;  4X9C A;  2EWN A;  3GPL A;  2PHG A;  3A8M B;  2R57 A;  4D6W A;  3LWI A;  4EMK A;  4EOM B;  3JCM V;  1H26 B;  4N4H A;  1KD1 C;  3P8D A;  2MWP A;  2I40 B;  3BG9 A;  1UHC A;  3NMZ C;  4Q5W A;  1WHG A;  5D6X A;  2DNU A;  3V7C A;  1W2B A;  4BCF B;  1LPL A;  1N5Z A;  1NEB A;  1LOJ A;  4VUB A;  2DEU A;  3ZFJ A;  2MI6 A;  4CRL B;  1Z9Z A;  1PD0 A;  2C0T A;  2V22 B;  5D6Y A;  1GBR A;  2E5K A;  3CCV A;  1N9S A;  4MIM A;  3U23 A;  1E6G A;  1NZ9 A;  4M7D F;  4QQD A;  1PKD B;  1X43 A;  2YSQ A;  3RDV A;  1WHJ A;  3CCM T;  2PK9 B;  3LYI A;  1VQ9 T;  2H3J A;  2RQV A;  2W10 A;  2MF2 A;  1PD1 A;  4BCM B;  4EOI B;  3HBL A;  1Q86 C;  2CGH A;  2CZ0 B;  2DEQ A;  3RNJ A;  1IHW A;  1TWB A;  4EIK A;  4M77 E;  1M1F A;  5CVI A;  1AT1 B;  2DAQ A;  3EHQ A;  3CCV T;  3HSB A;  1WXB A;  3OYJ A;  1CSK A;  1RLQ C;  2MMP A;  3QHS A;  4YC3 B;  3H0H A;  4NS5 A;  2VC8 A;  2BS2 A;  3THK A;  5HBE B;  3FRN A;  3PMI A;  1X01 A;  5CCA A;  3LH0 A;  4JRP A;  4JX5 A;  2KVQ G;  4P5N A;  1M4Z A;  1P92 A;  2XU8 A;  2WSF E;  1H3H A;  4XU3 A;  1PNJ A;  4BCJ B;  1U1T A;  3CCL Q;  3J80 E;  4MML A;  1YIJ Q;  5GAO n;  2M9U A;  3OYK A;  2KK4 A;  1JQQ A;  1T0H A;  2PJQ A;  5KYU A;  4GLM A;  4C5I A;  1TG0 A;  2WFY B;  2HQX A;  5GAN 6;  1D3B A;  2HDA A;  3QYE A;  2DD4 A;  3X25 B;  4EOQ B;  3EFO A;  3VYG A;  1H28 B;  2JGZ B;  2J6O A;  1VQO A;  3CMA T;  5HY6 A;  1M1K U;  3CMA Q;  1GFD A;  3JCM e;  2F2V A;  2X35 A;  3VS6 A;  2HZY A;  4F6S B;  2L5Q A;  3V7R A;  5LQF B;  1QLB A;  2RI2 A;  2QFZ A;  4EOP B;  1OU9 A;  2XHC A;  1VQL A;  2F69 A;  4ELL A;  4ROC A;  2EYZ A;  4KRT A;  4B9W A;  2ZPE B;  1PSF A;  1TUC A;  2KXD A;  2FZG B;  5L8R E;  4WF2 A;  5KYU B;  5FU6 B;  4XTU A;  7AT1 B;  4PLI A;  3V8J A;  3TVT A;  5BNJ B;  1Q81 R;  3QDF A;  4AKH A;  1VUB A;  2EAY A;  4Y92 A;  2C5V B;  4M75 G;  3MP8 A;  2I53 A;  2LW4 A;  3K7A M;  3QZ5 B;  5GAM j;  2PTK A;  1IGU A;  2W9Z A;  4EMH A;  1QVG P;  4MDW A;  2JXB A;  2LZ6 B;  5CKD A;  4Z88 A;  5KH6 A;  1NJI R;  1M9S A;  4Y91 A;  2DXT A;  3VUZ A;  3OYI A;  2OTL Q;  5CR2 A;  4BCN B;  1PKS A;  1ZLM A;  3M56 A;  5J3B A;  1YIT T;  1GCP A;  4QVC A;  3QJ6 A;  4RTT A;  2A36 A;  3G33 B;  1TH7 A;  1BU2 A;  1Y07 A;  1VQ7 Q;  2EYQ A;  2YRC A;  3RKX A;  3CME A;  1FMV A;  2LP5 A;  4QVD A;  2DKG A;  4PJO B;  3PMT A;  3QHW B;  2E6Z A;  4JRQ A;  1H92 A;  5CQX A;  4RTX A;  1AOJ A;  1W4S A;  2GTJ A;  2COZ A;  1KC8 U;  2AK5 A;  5CKH A;  3OSS C;  1YJW Q;  1KQS A;  1YI2 Q;  1O9K A;  2IW6 B;  4A4E A;  5IXF A;  1QP3 A;  1H1P B;  2QQ8 A;  1K73 R;  2A28 A;  3TQ7 P;  2SRC A;  2EQM A;  4M77 D;  5LJ5 e;  4BE2 A;  1YHQ Q;  2DJZ A;  2KE9 A;  5IAY A;  1YJ9 T;  3CCS A;  2F2X A;  4PJO G;  4HT8 A;  3RGF B;  2OTJ Q;  3CQT A;  3E19 A;  4QQ6 A;  1D1A A;  1Y96 B;  3I56 A;  1VQN T;  1VQN Q;  3I55 Q;  2HL5 C;  3O0G D;  2IVW A;  3EID B;  2KRM A;  3GP8 A;  2C5N B;  2FEI A;  5LJ3 j;  2D1X A;  4F7U G;  2EPD A;  2WEV B;  1JB0 E;  1VIF A;  1C9B A;  1AIS B;  1B7T A;  3QO3 A;  1UNG D;  3HL8 A;  3TRE A;  2DTI A;  1VQP T;  4G6L B;  2YLC A;  4M75 A;  4BI4 A;  3EH2 A;  5GAO r;  3MEU A;  3MY1 B;  3QHR B;  1ZUU A;  3TU4 K;  1H27 B;  4E47 A;  3MP6 A;  3I35 A;  3DDQ B;  1ZBX A;  1OKV B;  4BBR M;  1BB9 A;  4GLK A;  2RQR A;  3CCS Q;  2QEX T;  1YJ9 A;  3LW5 E;  1YHQ A;  4M4Z A;  2MCN A;  1UG1 A;  4X9D A;  2PUK B;  2BPM B;  1IZ6 A;  1I8F A;  2CZ1 B;  2WIP B;  1H24 B;  1WXU A;  1VQ8 T;  4JZ3 A;  3JCM X;  4XK8 E;  5FWB A;  1YI2 A;  1YJW A;  2CH4 W;  3HB9 A;  1BI0 A;  3UF4 A;  4MFD A;  1ZSZ C;  3KHI A;  2DFU A;  1TSF A;  1WHK A;  3DB3 A;  4JPB W;  3CXC S;  2DD5 B;  4KGX B;  2X4W A;  2YUP A;  2DXC A;  4M7D G;  2MPX C;  3DLM A;  2NUP B;  2RB6 A;  2J05 A;  1UNL D;  1F5Q B;  3LWH A;  2RQU A;  2K5F A;  3SDZ A;  1OQK A;  2DL7 A;  2KBT A;  3CME T;  1YP5 A;  3WVE B;  2ECZ A;  1VQ7 A;  2P0K A;  3M0Q A;  4BCH B;  1N6A A;  2EQI A;  2PVG B;  4JDS A;  1OI1 A;  2I0N A;  2K57 A;  3UPU A;  1GUX B;  3CC2 Q;  3X24 B;  1FMW A;  2RF0 A;  2F2W A;  2VB6 A;  3NDQ A;  2D9T A;  2BKZ B;  5LJ5 j;  4M77 A;  2I2L A;  3MEV A;  5I2M A;  3M0P A;  1YIT Q;  5ICP B;  3M9Q A;  3HO8 A;  3ME9 A;  3QXE B;  4ATO A;  1G2B A;  2RJF A;  2VV5 A;  1SPK A;  4J5Y A;  2LC4 A;  2ATC B;  3X26 B;  1W1F A;  5HVY B;  4XU2 A;  2LCC A;  5CKF A;  2IG0 A;  5GMK h;  1AWJ A;  2BE7 D;  2LQ8 A;  2RHX A;  3VV0 A;  1WI7 A;  1N4M A;  3G1J A;  3H41 A;  3V8L A;  3O5Z A;  3DDP B;  4HVW A;  1RAF B;  4F16 A;  3L2Z A;  1SHG A;  5GJW B;  1VQL Q;  2RJE A;  3A1P A;  3CD6 T;  2EGC A;  4OMM A;  4A4G A;  1T3S A;  1H64 1;  1UEC A;  9ATC B;  1K8A R;  1G3W A;  4C8Q F;  2GTO A;  3NTK A;  2RK1 A;  2CJM B;  3TNW B;  1WLP B;  3GIB A;  3BHU B;  1VQO Q;  3BDL A;  4J8O A;  3SEM A;  2QTX A;  1OX8 A;  4ZGD B;  4EOO B;  1M90 C;  4BDY A;  1HSQ A;  4LDX A;  5GAN 8;  2D6F A;  5DM7 R;  2LJ0 A;  5EC7 A;  2DJQ A;  3UA6 A;  3EAE A;  4IUT A;  3UA7 A;  5GAN 5;  3WVD B;  1SSF A;  4M7D C;  4E7I A;  3ZL7 C;  2OTJ T;  4KGV B;  2IIM A;  3FIF A;  1OOT A;  4LN2 A;  1OPK A;  2O01 E;  1IXD A;  4XTV A;  4BB7 A;  3EJ1 B;  4R0K A;  3QWX X;  3CXC A;  2YLB A;  3H6Z A;  4Y28 E;  1PM3 A;  1URC B;  2QYZ A;  2L89 A;  5GMK l;  4MZT A;  4M7A C;  1B3Q A;  1R8O B;  4DQ2 A;  5FRN A;  2B86 A;  4PJM A;  4LDW A;  3RER A;  3PT9 A;  5DLQ E;  3OYN A;  3I56 T;  4EC8 B;  4ZTF A;  1D09 B;  3BHV B;  1U3O A;  1K73 U;  3EG9 B;  4M7A G;  3VKG A;  1Q82 C;  1KJW A;  4PJO F;  5CO7 A;  4FYW B;  1MND A;  4MZP A;  4M7D D;  3CCU Q;  1RL2 A;  4PJJ A;  1XNI A;  3MPU B;  2X4X A;  3CCV Q;  2WPA B;  4C8Q A;  2KSS A;  5GAN j;  2IPO B;  2JTE A;  4M75 B;  2CP0 A;  3EHR A;  4RTV A;  2LX9 A;  2GF7 A;  3BLQ B;  1K8A C;  1YJN Q;  1ZUK A;  2UZB B;  1Q7Y R;  1I07 A;  3OW2 P;  2O2O A;  2M0O A;  1MMG A;  2LQN A;  2OAU A;  2RI3 A;  3GBQ A;  3L2V A;  1MMA A;  4BY6 B;  4LE9 A;  4OF1 A;  2ABL A;  2XID A;  5C0M A;  4OMN A;  2EW3 A;  1RAC B;  2YWW A;  4JRK A;  2G9X B;  1M30 A;  1FVV B;  3S6W A;  5KE2 A;  5GAO q;  1I81 A;  2D0N A;  1VQK Q;  2LRQ A;  1I4K 1;  1BYM A;  3M0U A;  2DBM A;  4EOS B;  3M0S A;  2ZPG B;  4PJO D;  1S1N A;  5GMK j;  1S72 Q;  1OIY B;  1KHI A;  2JUF A;  1M2V B;  1AD5 A;  1JSU B;  3JCM h;  4O5V A;  4BE1 A;  3R6N A;  2DYI A;  2WSC E;  4M75 F;  3QWL A;  1VQK A;  3MCA B;  3P8B B;  1UEB A;  2DK3 A;  4EON B;  4BCN D;  2MOX A;  3DKM A;  3VS3 A;  1X6B A;  2CS7 A;  2BTT A;  4NC6 A;  3QSU A;  2KYM A;  1QCN A;  2K5I A;  4FSS A;  4BCK B;  4PFZ A;  1N8R U;  1M1G A;  1ARK A;  4ELJ A;  3HRU A;  1WJQ A;  3TW6 A;  1AWX A;  2PMI B;  2WJ9 A;  1M8M A;  4E7K A;  4JX4 A;  1I5L A;  3OY9 A;  4M75 C;  4RG2 A;  1I5O B;  3BE3 A;  3DL1 A;  2GCX A;  4EPC A;  1W6X A;  1VQM A;  3JCM b;  2NUP A;  4BE0 A;  4OGR B;  1UJY A;  5CKE A;  1ABQ A;  1BI1 A;  4WTO B;  2QDY B;  4J6Y A;  3CCE A;  3G4S Q;  5KYY B;  1JU5 C;  4IKF A;  5FU6 C;  3TSZ A;  4HKE A;  2P4T A;  3SWN C;  3OMG A;  2L2P A;  3VS5 A;  4JJB A;  3CCU A;  4D8K A;  3VRY A;  1OKW B;  1WYX A;  1JJ2 S;  3ASK A;  3SWN A;  5LJ3 g;  5A0L A;  1TD6 A;  1OU8 A;  1M2O A;  2E1H A;  5GAO l;  4K11 A;  4CFN B;  4HNT A;  3I55 T;  2FRY A;  3CCQ A;  3RUX A;  2HBP A;  2W2H A;  2DBK A;  2QF7 A;  3RMS A;  4ZNX A;  4CFM B;  2DZC A;  4BI3 A;  2DA9 A;  2XI9 A;  3KUF A;  2QDL A;  2PQW A;  4ANJ A;  3A8O B;  3OYH A;  1OIU B;  2CH4 A;  5KYN A;  3JB9 G;  3FDR A;  2W99 A;  1QCF A;  2EBP A;  1JJ2 P;  1VQ9 A;  2JVV A;  4AFZ C;  4F7U B;  4OMQ A;  4BY6 C;  3NTI A;  2HKN A;  1PCX A;  2L8D A;  1ZBJ A;  5GAN e;  1SEM A;  2A7Y A;  4A54 A;  2IW9 B;  3VS7 A;  2GBQ A;  4OB1 B;  1YWP A;  2KI7 A;  4J9F A;  3TNH B;  3AT1 B;  4F6W B;  2EKO A;  2NUT A;  2RI5 A;  1MHN A;  4M7A F;  1X75 C;  2NYS A;  3CC7 Q;  1Y57 A;  4E7Z A;  4A4H A;  5A0D A;  4IUP A;  1RAG B;  3DLL A;  2E70 A;  1F1B B;  3OS1 A;  1CKA A;  4NL2 A;  1Y0M A;  3OYM A;  2MWO A;  3M57 A;  2LDM A;  3EGU A;  3OYC A;  2CP7 A;  4AKG A;  2PNI A;  3MP1 A;  3BHT B;  2VXF A;  4RTY A;  2ZPH B;  1MV0 B;  2ZZD A;  2XDB A;  3TEE A;  2WIH B;  4DA4 A;  2QI2 A;  1SG5 A;  2COY A;  2QAZ A;  4CC2 A;  3LGL A;  3OBY A;  1VQ5 Q;  1M5Q 1;  2AZV A;  1ZHI A;  4LXC A;  5L23 A;  4RKU E;  3TW7 A;  1PRL C;  2J6K A;  3FJP A;  1M3C A;  3CC2 A;  4HXJ A;  5AT1 B;  2PK2 A;  1JKW A;  1K9M C;  4O6J A;  4AT1 B;  2VXE A;  1W2B P;  2AKL A;  4II1 A;  1WA7 A;  1VQ4 A;  5CK9 A;  4N4I A;  1AD6 A;  4BCQ D;  3SWN B;  3CCR A;  4LNP A;  4C8Q G;  2QGF B;  2LNH B;  4C92 C;  4EMK B;  4LD6 A;  3FB9 A;  1VQK T;  3LLR A;  4ELY C;  1TUG B;  2VVK A;  2X3W D;  2ED0 A;  1YBY A;  1FXX A;  4FX3 B;  4FYV B;  2IW8 B;  1QCO A;  2K5L A;  1VIE A;  4C92 E;  1RUW A;  2EQU A;  4M7A A;  1WHL A;  2GGR A;  1M27 C;  3JB9 H;  4AFQ C;  4A53 A;  3VS1 A;  4AG1 C;  2CT4 A;  2QA4 A;  2VKN A;  4BXX X;  2FPD A;  2XDP A;  4CXA B;  4BI8 B;  1PC0 A;  4M78 D;  2RQW A;  2EJG A;  4C0G A;  1QLY A;  1RI0 A;  1SF9 A;  2DL4 A;  4ZN1 A;  3PIP A;  2LVM A;  1YJ9 Q;  3HFO A;  3JB9 D;  2EYW A;  2HMA A;  3RR6 A;  1UJ0 A;  2HKQ B;  4CI0 C;  3BDU A;  2IN3 A;  1QVP A;  2QQR A;  1LNX A;  5CQY A;  3CC4 T;  4HNV A;  3OBW A;  2L3Q A;  1YI2 T;  3BLH B;  5C6S A;  1KG1 A;  4EMG A;  4J83 A;  2HQH A;  1MGQ A;  1X6O A;  2HQE A;  3M4G A;  1OZ3 A;  2O4X A;  1QKX A;  1FYN A;  4IIO A;  1UUE A;  1YHQ T;  2KDS A;  2AHJ B;  4LOC A;  3RBB B;  3I55 A;  3I56 Q;  2XD0 A;  6AT1 B;  1VOM A;  4JJC A;  2YDL A;  4CRI A;  1VQ9 Q;  4QW2 A;  3QYG B;  2OTJ A;  2QDJ A;  2XDD A;  1O9K B;  5EFQ B;  3CCU T;  2DMO A;  4XU0 A;  2L3S A;  4C92 A;  3I5S A;  4N0A A;  2UUE B;  2WMB B;  3CCE T;  1EZZ B;  3DB4 A;  5LJ3 d;  2O9S A;  4QKU A;  3REA B;  2KQW A;  2AT1 B;  2LQW A;  1MV3 A;  2JM9 A;  4KRD B;  2K9G A;  2CCI B;  2R58 A;  3QZ9 B;  1BCO A;  2W9F A;  2BUD A;  1KQS P;  2BS3 A;  1YIJ T;  5FRO A;  2DYB A;  2MYS A;  1GCQ C;  2VUB A;  4QSH A;  4B6M A;  1BIA A;  4M7A D;  1WJS A;  2O9V A;  1UGV A;  2JS0 A;  1H8K A;  3CME Q;  1SRL A;  4KH0 B;  3JB9 J;  1NEG A;  1X6G A;  1N27 A;  1WQW A;  1ZSZ A;  2LX7 A;  1PWT A;  3OS5 A;  2EYX A;  2A0F B;  1VQM Q;  3CD6 A;  1W70 A;  1JRI A;  2V8J A;  2B9R A;  4KUD K;  1UGS B;  2R5A A;  1H1R B;  4XU1 A;  5IT9 E;  3O8V A;  3CPW A;  1G3Y A;  4QQG A;  1B07 A;  3NPF A;  4YTL A;  4C92 D;  2ED1 A;  2J6F A;  5FW9 A;  3VU3 C;  4F17 A;  5DQW A;  2DXB A;  4R55 A;  1K4U S;  2LMJ A;  4JLG A;  1D0Z A;  3L2Q A;  3CBO A;  4OMO A;  3G71 T;  1K1Z A;  3JCM g;  4PJO A;  2FZC B;  4C92 F;  4EDU A;  5FRM A;  5J39 A;  2DL5 A;  3EFR A;  2ROT A;  3M55 A;  3CBP A;  5LJ3 h;  1WDX A;  4M78 E;  5FU7 B;  3MHX A;  1D1C A;  2E10 A;  3H0F A;  2KRS A;  3H0I A;  4ME7 A;  1Q95 G;  1C6V X;  1SSH A;  4YOZ A;  5GAM d;  4NST B;  5FGK B;  4CFX B;  4PFO A;  4Z6Y A;  1SKU B;  2JNG A;  2C5O B;  4N0A C;  1KIK A;  4C0D C;  1BK2 A;  2FHD A;  5A0G A;  4UC4 A;  2QGS A;  2EKH A;  4XTW A;  4OMF B;  2RHU A;  5A2Q E;  4FYY B;  2VAS A;  1GXI E;  4HA8 A;  4PK4 A;  2HL3 A;  4OB0 B;  1UGQ B;  2CDT A;  4HVV A;  1YIJ A;  3RMQ A;  2UZL B;  2DM1 A;  2DVE A;  1OL1 B;  4PKC C;  5DLO A;  1QMC A;  4FL6 A;  4A63 B;  3GNF B;  1VQ8 A;  5GJV B;  1NBE B;  2V8K A;  1MNE A;  4C5E A;  1V1C A;  3CCJ A;  4F6U B;  3OQ5 A;  1Y71 A;  1KD1 U;  2X9H A;  4N4G A;  1Q86 R;  1H3Z A;  1RAI B;  3KFV A;  4ZTJ A;  3LQ5 B;  2WXV B;  4F7J B;  2C0I A;  4C8Q E;  4M75 D;  3F5X B;  2DO3 A;  1X27 A;  3JCM d;  1HD3 A;  1GL5 A;  1K9M U;  2DZ9 A;  3I9Q A;  1PRM C;  1C1A A;  3CBM A;  2F2C A;  2DTO A;  4IUQ A;  1Y96 A;  2RO0 A;  3CCS T;  2ZAE A;  4PNO A;  2K79 A;  4UN0 A;  1KSW A;  2EJF A;  3JCM P;  5GAM g;  1IB8 A;  3CCJ Q;  1KC8 R;  4ORZ A;  5IDN B;  1K8A U;  3JCM f;  2LJ3 A;  1VIN A;  2C06 A;  2Y4X A;  1VQ8 Q;  4R56 A;  1KD1 R;  4F7L B;  2FO0 A;  1NG2 A;  1NPR A;  5LJ5 f;  1QWF A;  1ABO A;  1W98 B;  3QYH B;  4KT0 E;  4J6X A;  4LD9 K;  4RG8 A;  4IIM A;  5ECA A;  1UHF A;  3JCM c;  5GMK m;  1XOV A;  1EIF A;  3RES A;  1JST B;  4RTU A;  2HBW A;  4E6R A;  2J06 A;  3KBG A;  2COW A;  2C6T B;  1TS9 A;  3MEW A;  1VOL A;  2CSQ A;  1XO2 A;  4DEY A;  1M8V A;  2EIF A;  2CSI A;  3X20 B;  1YJN T;  3PGG A;  2YRV A;  4GBQ A;  2WMA B;  4HLQ A;  4M78 A;  1FIN B;  1KQ1 A;  1RAB B;  2DF6 A;  2RMO A;  4J9H A;  4ROD A;  4NOY A;  1QVG S;  2FYK A;  3E1S A;  3EGX B;  3BY7 A;  2Y90 A;  3HP9 A;  2E41 A;  1PSE A;  2DD4 B;  3E2U A;  2M16 A;  2FL7 A;  2JMA A;  1ZA2 B;  1IO6 A;  3QDR B;  4HNU A;  3A8G B;  4L5G A;  3G71 A;  2CP2 A;  5HNB B;  4KUI A;  3QG1 A;  4C0F A;  4XTX A;  4LDV A;  1UFF A;  3CCR T;  3JSC A;  1VYT A;  1WFW A;  3TN8 B;  3M03 A;  5KYW B;  1VQ4 T;  1RLP C;  1X2K A;  2NUZ A;  2W0Z A;  3OW2 A;  3NGP A;  1ZSZ B;  1UE9 A;  2RPN A;  4E7J A;  2YUQ A;  1E7P A;  5AYF A;  3GOX A;  2QXF A;  3EOC B;  1WJR A;  2EGE A;  1OV3 A;  3HPW A;  1EFN A;  4CFW B;  3UDC A;  4HCC A;  4M77 B;  3DTO A;  2FPE A;  4DBQ A;  4A4K A;  1GUX A;  1I0C A;  4DBF A;  4JS4 A;  1G8X A;  3PFS A;  3EG1 A;  1OEB A;  3VS2 A;  1QMZ B;  3EG3 A;  4LDY A;  5LJ5 g;  3VYG B;  5KCH A;  4RTZ A;  2K7A A;  4XAX B;  4F7S B;  1M90 U;  5I11 A;  4IUU A;  3EG0 A;  1VYW B;  4HT9 A;  1BI2 A;  2OAW A;  3CXC P;  3M4Y A;  2ENM A;  4FT2 A;  4KGZ B;  5GAN f;  3G4S T;  2L3P A;  3MO8 A;  2CRE A;  1P5E B;  2QQ9 A;  2E12 A;  3HFN A;  3ER0 A;  4AI6 A;  1LJO A;  5KYW A;  5IHN A;  4OB3 B;  1TXQ A;  1D0Y A;  2RHZ A;  2KNB B;  4PJL A;  1BIB A;  1JXM A;  2NLU A;  3TCJ A;  4EMK C;  2CUD A;  2K3X A;  3L42 A;  5IDP B;  1WPY A;  1ZUY A;  3SHW A;  2P4R A;  2A37 A;  1Q82 R;  2GNC A;  1D1B A;  1BU1 A;  1KQS S;  4ELZ C;  3G7Z A;  1ZA1 B;  2Z0W A;  4L59 A;  4JX6 A;  2BKD N;  4IUV A;  1LVK A;  1N9R A;  2HAX A;  4BCG B;  4MMK A;  5DQV A;  2X4J A;  4BBS M;  2E6N A;  4M77 C;  1D3B B;  3VJP A;  5GAM f;  5L2W B;  1WXT A;  1T0J A;  5LJ3 e;  3F70 A;  2G3R A;  5FU7 C;  3NHN A;  2LCL A;  5GMK e;  2EUF A;  4ESR A;  3UWN A;  2FB7 A;  1RI9 A;  3IQL A;  2L3R A;  1TFB A;  4C92 G;  4E7H A;  2FG0 A;  2BZ8 A;  1KQ2 A;  1E6H A;  3QWY A;  2CKK A;  1RAE B;  4L6V 5;  2X1N B;  4IUR A;  4OGE A;  1T3L A;  2VWF A;  3M59 A;  4D8D A;  2DL8 A;  1BKB A;  2QA4 Q;  4PLL A;  5KYX B;  5IHK A;  4M6V A;  4HL4 A;  4DOW A;  3ULR B;  1YN8 A;  1GFC A;  3OS0 A;  2DPP B;  2KY9 A;  3J7A F;  2OX7 A;  2QQB A;  4BCM D;  1JBM A;  3JAM E;  3QII A;  1Q82 U;  1ZX6 A;  2E3H A;  4M7A E;  5HBJ B;  2RK2 A;  1N8R R;  3RKW A;  1XJW B;  3M54 A;  5IXB A;  3CCR Q;  3LX7 A;  2QQS A;  1K9A A;  1U5S A;  1IRX A;  1M1K R;  1K76 A;  3ZEH A;  2VGN A;  2DRM A;  2LCS A;  4YOO A;  2W96 A;  2P84 A;  2L0A A;  4F7U F;  1VQL T;  4J9E A;  1KXU A;  2KXC A;  1VYV A;  2H8H A;  1VQ5 A;  2DL3 A;  4C92 B;  5IHI A;  2G77 A;  5D6W A;  1VQ6 A;  1VQO T;  1B34 A;  4OMP A;  1W2B S;  4XTY A;  1WQ7 A;  1R0C B;  1WZO A;  1SRM A;  5J26 A;  4ZGE B;  2QTV A;  4J7F A;  4LUE A;  3VYH B;  3PVQ A;  2FZK B;  4HCB A;  5I5Z B;  4E2F B;  1BBZ A;  3CEY A;  2UZE B;  3GF5 A;  1GRI A;  1NLP C;  1FMK A;  2RJC A;  3S3O A;  1Q7Y C;  3CC4 Q;  3MY5 B;  5GAO p;  4CC3 A;  3CC7 A;  4BAC A;  5HBH B;  2V26 A;  3S3N A;  5GAN 3;  2QAS A;  4PFP A;  2DXU A;  2EJ9 A;  2DME A;  4F04 B;  5GAM h;  2D8H A;  1I1J A;  3OYY A;  3NFC A;  1HJD A;  5HQ0 B;  4J9C A;  2EYY A;  1U8R A;  1QVF A;  1Q7Y U;  3QJY A;  4FW1 A;  1U06 A;  2ZPF B;  2CCH B;  1HXD A;  3G6E A;  2KAF A;  2LTO A;  4CFU D;  4C8Q B;  3A98 A;  4WCI A;  3OA6 A;  3CCL A;  4HVU A;  1NPP A;  2DTH A;  2E3I A;  3B57 A;  4KUL A;  3INZ A;  3QYB A;  1G3S A;  4KH1 B;  1FWZ A;  3PO3 S;  4I3Z B;  4FT4 A;  1OI9 B;  4AFU C;  1RAD B;  1YWO A;  1IGQ A;  3MIA B;  5CAI A;  1VQP Q;  2R7G A;  2JS2 A;  4FIB A;  4C5H A;  1KC8 C;  2RM4 A;  5KE3 A;  2CZ6 B;  2JM8 A;  4J9B A;  4DEX A;  2WSE E;  3OYE A;  2RHI A;  3HRT A;  2Y4Y A;  2RH2 A;  3N5B B;  3H8Z A;  3NTH A;  2XIC A;  1FKM A;  5KCO A;  4RMO A;  3OB9 A; 
#chains in the Genus database with same CATH homology
 2FHD A;  5A0G A;  3GLX A;  4UC4 A;  3JCM Q;  3OYL A;  4C8Q A;  2F5T X;  3MET A;  2KSS A;  3G4S A;  2DIG A;  4XTW A;  4OMF B;  5GAN j;  2RHU A;  5A2Q E;  4M75 B;  1NJI U;  3OYD A;  4FM4 B;  4J7I A;  2LX9 A;  3JB9 I;  4X9C A;  1VQM T;  2EWN A;  2GF7 A;  2RHY A;  3V8K A;  3GPL A;  1K8A C;  1GXI E;  4OGC A;  3A8M B;  2MAM A;  2R57 A;  4HA8 A;  4D6W A;  2GQV A;  4OB0 B;  1UGQ B;  3LWI A;  4EMK A;  2M0O A;  1YIJ A;  2K2V A;  3RMQ A;  3L2U A;  1NE8 A;  2OAU A;  2LNV A;  3CPF A;  2DVE A;  4Z02 A;  3JCM V;  4N4H A;  2RI3 A;  3P8D A;  1O75 A;  2MWP A;  1KD1 C;  4JS5 A;  4PKC C;  3BG9 A;  4Q5W A;  5DLO A;  5GAN 2;  1FX7 A;  5D6X A;  3L2V A;  2LT4 A;  3OYA A;  3V7C A;  4FL6 A;  1W2B A;  3GNF B;  4BY6 B;  4OF1 A;  1VQ8 A;  2V8K A;  2XID A;  1LOJ A;  4VUB A;  3ZFJ A;  2MI6 A;  3FLG A;  5C0M A;  3HRS A;  2HD0 A;  4C5E A;  3CCJ A;  2E5Q A;  3OQ5 A;  4JRK A;  1Y71 A;  2DD5 A;  5D6Y A;  3CCV A;  1N9S A;  4MIM A;  4M7A B;  3S6W A;  5KE2 A;  5GAO q;  1KD1 U;  1I81 A;  1NZ9 A;  4N4G A;  5GAM e;  1H3Z A;  4LDU A;  5KCO A;  4ZTJ A;  2LRQ A;  1I4K 1;  4M7D F;  4QQD A;  1BYM A;  4C8Q E;  4M75 D;  2DO3 A;  3JCM d;  2ZPG B;  3FEO A;  3CCM T;  4PJO D;  5GMK j;  3LYI A;  1K9M U;  4BUG A;  1VQ9 T;  2DZ9 A;  2H3J A;  2PUO B;  2MF2 A;  1KHI A;  2JUF A;  3CBM A;  1S72 A;  1NJI C;  4M7D A;  3HBL A;  3JCM h;  4O5V A;  2CGH A;  2CZ0 B;  2DEQ A;  2DTO A;  4IUQ A;  3ZBD A;  4BE1 A;  1Q86 C;  2OTL T;  2WSC E;  4M75 F;  3QWL A;  2PVD B;  5EG2 A;  1M1K C;  3WXM B;  4M77 E;  1M1F A;  5CVI A;  1VQK A;  2DAQ A;  3MCA B;  4QVZ A;  1Y96 A;  2RO0 A;  3P8B B;  3CCS T;  3CCV T;  4PNO A;  1UEB A;  2DK3 A;  3HSB A;  4PJO E;  3DKM A;  3OYJ A;  2CS7 A;  2EJF A;  2MMP A;  3QHS A;  5HK3 A;  4NS5 A;  5GAM g;  2VC8 A;  2BS2 A;  3JCM P;  4BDZ A;  4OVA A;  1N8R C;  1K8A U;  3VUB A;  1VQ7 T;  3FRN A;  4NC6 A;  3PMI A;  1X01 A;  3JCM f;  5CCA A;  2C06 A;  3QSU A;  3LH0 A;  2Y4X A;  4JRP A;  4JX5 A;  2K5I A;  2KVQ G;  3OSV A;  5LL6 S;  4R56 A;  4P5N A;  1N8R U;  1M4Z A;  1M1G A;  1P92 A;  4ELJ A;  1NPR A;  2X4Y A;  3HRU A;  2WSF E;  2DXB B;  2XU8 A;  1WJQ A;  3TW6 A;  5LJ5 f;  5EJC A;  4XU3 A;  2WJ9 A;  1U1T A;  3QYH B;  4E7K A;  4KT0 E;  4JX4 A;  4J6X A;  1I5L A;  3J80 E;  4J6W A;  4RG8 A;  4LD9 K;  3EFS A;  3OY9 A;  4MML A;  5GMK m;  4M75 C;  3JCM c;  3RIR A;  4RG2 A;  1XOV A;  3PTA A;  4XTZ A;  5HK0 A;  1EIF A;  5GAO n;  3OYF A;  3RES A;  5DY9 A;  2M9U A;  3OYK A;  2KK4 A;  3DL1 A;  1YJN A;  2GCX A;  4EPC A;  1VQM A;  3JCM b;  4BE0 A;  3KBG A;  5CKE A;  5LJ5 h;  1BI1 A;  4C5I A;  2QDY B;  4J6Y A;  3CCE A;  2HQX A;  4KBM B;  4GY5 A;  1D3B A;  4MZM A;  4M78 F;  3QYE A;  5GAN 6;  2DD4 A;  3MEW A;  4IKF A;  5FU6 C;  3X25 B;  3VYG A;  4BD3 A;  5FLX E;  3L2W A;  3KXT A;  1M8V A;  2EIF A;  1VQO A;  1QVF S;  3CMA T;  4HKE A;  5HY6 A;  1M1K U;  2P4T A;  3X20 B;  2RA2 A;  3SWN C;  3JCM e;  1YJN T;  2X35 A;  2E65 A;  3OMG A;  3PGG A;  2YRV A;  3CCU A;  2L5Q A;  3V7R A;  4M78 A;  4HLQ A;  1QLB A;  1KQ1 A;  1JJ2 S;  3J81 E;  1QVG S;  2RI2 A;  2QFZ A;  3ASK A;  4NOY A;  2FYK A;  3SWN A;  5A0L A;  5LJ3 g;  3E1S A;  2XHC A;  2E1H A;  1VQL A;  2F69 A;  2Y90 A;  3BY7 A;  4B9W A;  4A4F A;  2ZPE B;  5GAO l;  3HP9 A;  1PSF A;  2E41 A;  4HNT A;  1PSE A;  3I55 T;  2DD4 B;  3M53 A;  2M16 A;  2FL7 A;  3CCQ A;  3RUX A;  5L8R E;  5GAN g;  4WF2 A;  3QDR B;  4HNU A;  3A8G B;  2HBP A;  4L5G A;  4XTU A;  5FU6 B;  3G71 A;  4PLI A;  2QF7 A;  3OMC A;  3RMS A;  1OYX A;  3V8J A;  1VQP A;  4KUI A;  3A5Z B;  3QG1 A;  4C0F A;  2V8I A;  4F7U A;  2DZC A;  4BI3 A;  2XI9 A;  4XTX A;  4AKH A;  1VUB A;  2EAY A;  3KUF A;  2KR6 A;  2PQW A;  4M7D E;  4M75 E;  2EQK A;  4X34 A;  3A8O B;  4LDV A;  3OYH A;  3BFM A;  4M75 G;  3CCR T;  3MP8 A;  1KHC A;  3JSC A;  3JB9 G;  3VKI A;  3QZ5 B;  5GAM j;  3FDR A;  3OW2 A;  1VQ4 T;  1JJ2 A;  4JJN K;  4EMH A;  5CKB A;  4MDW A;  1VQ9 A;  2JVV A;  4F7U B;  4E7J A;  5CKD A;  5KH6 A;  4BY6 C;  4ZGJ B;  1M9S A;  4Y91 A;  2DXT A;  1E7P A;  3NTI A;  5AYF A;  3GOX A;  2L8D A;  2QXF A;  5GAN e;  3VUZ A;  3OYI A;  4FU6 A;  5CR2 A;  1WJR A;  4PJO C;  3M56 A;  2A7Y A;  5J3B A;  4A54 A;  3HPW A;  1YIT T;  4OB1 B;  3UDC A;  4QVC A;  4HCC A;  3QJ6 A;  5CIU A;  4M77 B;  2B8A A;  3C95 A;  1TH7 A;  3CCJ T;  4A4K A;  1Y07 A;  2EKO A;  2EYQ A;  4JS4 A;  3RKX A;  3CME A;  2RI5 A;  2YHT A;  1MHN A;  2EFI A;  4NL3 A;  2K3Y A;  3PFS A;  4QVD A;  1O9S A;  4M7A F;  1YCY A;  2BIV A;  2DKG A;  4PJO B;  1X75 C;  3PMT A;  2JTF A;  2A3L A;  3QBY A;  4LDY A;  4B9X A;  4OB2 B;  5LJ5 g;  4A4H A;  3VYG B;  5A0D A;  5GMK i;  4IUP A;  3SD4 A;  2E6Z A;  4XAX B;  5KCH A;  4JRQ A;  3CC4 A;  3E9G A;  3DLL A;  2E70 A;  1M90 U;  3G6E T;  5CQX A;  4MDX A;  1QVG A;  3OS1 A;  1W4S A;  4IUU A;  4C0Z A;  4NL2 A;  4HT9 A;  3JB9 F;  1KC8 U;  1BI2 A;  3OYM A;  5CKH A;  3OSS C;  2MWO A;  3M57 A;  1KQS A;  3M4Y A;  2LDM A;  3JRZ A;  3OYC A;  4FT2 A;  3P8H A;  5GAN f;  3G4S T;  4AKG A;  5I21 A;  3MP1 A;  4A4E A;  3MO8 A;  2D0Q B;  2QQ9 A;  5GAN 7;  2VXF A;  1QP3 A;  2E12 A;  2QQ8 A;  3HFN A;  2ZPH B;  4AI6 A;  1LJO A;  3ER0 A;  3OYB A;  4OB3 B;  2ZZD A;  2EQM A;  4M77 D;  2XDB A;  2RHZ A;  3TEE A;  5LJ5 e;  4DA4 A;  4BE2 A;  1BIB A;  2NLU A;  2BS4 A;  2QI2 A;  2DJZ A;  3TCJ A;  4EMK C;  5IAY A;  2QA4 T;  1YJ9 T;  1YIT A;  3CCS A;  2K3X A;  3LGL A;  3OBY A;  4PJO G;  3L42 A;  1WPY A;  4HT8 A;  5GAN h;  1M5Q 1;  1ZHI A;  5I2S A;  5GAN d;  3E19 A;  4M77 G;  3TW7 A;  4QQ6 A;  4RKU E;  5HKC A;  1WNL A;  4C8Q C;  1Y96 B;  3FJP A;  3I56 A;  1VQN T;  3BW1 A;  3CC2 A;  3H4C A;  4XQ3 A;  1KQS S;  2IVW A;  1K9M C;  4O6J A;  4ELZ C;  4FSX A;  2VXE A;  3G7Z A;  4OP0 A;  1VQ4 A;  4II1 A;  3GP8 A;  3HHT B;  5CK9 A;  4N4I A;  5LJ3 j;  4L59 A;  4F7U G;  1AHJ B;  4JX6 A;  3SWN B;  4C8Q G;  3CCR A;  1JB0 E;  2BKD N;  1Q81 C;  4EMK B;  4IUV A;  1N9R A;  1VIF A;  3T9N A;  4C92 C;  4LD6 A;  3FB9 A;  1VQK T;  2HAX A;  3LLR A;  4MMK A;  3QO3 A;  3HL8 A;  3TRE A;  4ELY C;  1VQ6 T;  4PL6 A;  2DTI A;  2JN0 A;  1YBY A;  4C0D B;  1VQP T;  1FXX A;  3LGF A;  2YLC A;  4M75 A;  4BI4 A;  2X4J A;  3X28 B;  1XQH A;  4BBS M;  2E6N A;  2K5L A;  1D3B B;  4M77 C;  3VJP A;  5GAM f;  1S72 T;  5GAO r;  3MEU A;  1VIE A;  4RCC A;  4C92 E;  3CC2 T;  5LJ3 e;  3F70 A;  2EQU A;  2G3R A;  5FU7 C;  3TU4 K;  4M7A A;  2JTM A;  1UGP B;  3MP6 A;  4E47 A;  1ZQ1 A;  2LCL A;  2JOY A;  2E64 A;  2CYZ B;  3MEA A;  5GMK e;  1ZBX A;  4BBR M;  4GLK A;  3JB9 H;  4A53 A;  3M58 A;  2XKO C;  2QEX T;  1YJW T;  3S3M A;  3UWN A;  3C4S A;  2FB7 A;  2QA4 A;  1YJ9 A;  3LW5 E;  3PNW C;  3HZJ A;  2L3R A;  1YHQ A;  2GFU A;  4C92 G;  1UB4 A;  3QUI A;  4E7H A;  1YIJ T;  2XDP A;  2ZGW A;  1KQ2 A;  4X9D A;  2CKK A;  1IZ6 A;  2PUK B;  1I8F A;  4BI8 B;  2CZ1 B;  4L6V 5;  4M78 D;  2EJG A;  4M78 B;  4C0G A;  4IUR A;  3HKS A;  4OGE A;  1VQ8 T;  3JCM X;  1Q86 U;  3M59 A;  1RI0 A;  4XK8 E;  2ZPB B;  1BKB A;  4ZN1 A;  3UT1 A;  2LVM A;  3PIP A;  4PLL A;  2QEX A;  3HFO A;  3JB9 D;  1YI2 A;  1YJW A;  4C8Q D;  3HB9 A;  4M6V A;  1BI0 A;  4HL4 A;  3GNG A;  4F7U E;  4DOW A;  4JLI A;  2ZZD B;  1UGR B;  4MFD A;  3BDU A;  4CI0 C;  3KHI A;  3OS0 A;  3FC3 A;  2DPP B;  3DB3 A;  1QVP A;  2KY9 A;  3CXC S;  2QQR A;  2DD5 B;  2M1H A;  3J7A F;  1LNX A;  2QQB A;  2X4W A;  1JBM A;  3BG5 A;  2DIQ A;  2DXC A;  3QII A;  5CQY A;  3C12 A;  3JAM E;  3CC4 T;  1Q82 U;  4M7D G;  3DLM A;  4HNV A;  3OBW A;  1YI2 T;  4M7D B;  4M7A E;  2XK0 A;  2RB6 A;  5C6S A;  1KG1 A;  2DXC B;  4EMG A;  4J83 A;  1MGQ A;  5GAO m;  2RK2 A;  2LQK A;  1X6O A;  3M5A A;  2HQE A;  3RKW A;  2K5F A;  3OS2 A;  3LWH A;  3SDZ A;  2KMT A;  3M4G A;  3Q1J A;  4ZN3 A;  3PIO A;  3CME T;  1VQ7 A;  3WVE B;  3L1A A;  3M54 A;  2P0K A;  1OZ3 A;  2O4X A;  1WGS A;  3LX7 A;  1N6A A;  2PVG B;  1YHQ T;  2ZCF B;  2QQS A;  4JDS A;  1OI1 A;  2K57 A;  3UPU A;  3A8L B;  2AHJ B;  2KDS A;  4LOC A;  3ZEH A;  2VGN A;  3I55 A;  4M78 G;  1VQN A;  3X24 B;  2XD0 A;  4F7U F;  2D9T A;  4CRI A;  1VQL T;  5LJ5 j;  2O4X B;  4QW2 A;  3QYG B;  4M77 A;  2OTJ A;  2I2L A;  2QDJ A;  1VQ5 A;  3MEV A;  2XDD A;  3CCM A;  1U1S A;  5I2M A;  3QKJ A;  4MFE A;  3M9Q A;  4M78 C;  3CCU T;  4C92 B;  3HO8 A;  1K73 C;  3ME9 A;  2ZPI B;  3QXE B;  4XU0 A;  2G77 A;  2VGM A;  2PU9 B;  5D6W A;  1VQ6 A;  4ATO A;  3SFM A;  1VQO T;  1B34 A;  2K4Y A;  4C92 A;  4M77 F;  2RJF A;  5LJ5 d;  2VV5 A;  3OW2 S;  4N0A A;  2QQA A;  4J5Y A;  3JCM W;  1W2B S;  2LC4 A;  4XTY A;  3X26 B;  1WQ7 A;  1G5V A;  4RCB A;  3CCE T;  5J26 A;  4XU2 A;  4ZGE B;  2LCC A;  3DB4 A;  5CKF A;  2IG0 A;  4J7F A;  5LJ3 d;  5GMK h;  2CZ7 B;  2EQJ A;  2KQW A;  2LQ8 A;  3VYH B;  2RHX A;  3VV0 A;  3CCQ T;  3C94 A;  3CCL T;  4HCB A;  2FVU A;  2HNI A;  1QP2 A;  3V8L A;  3CEY A;  3CC7 T;  3SB2 A;  2R58 A;  3QZ9 B;  3GF5 A;  3L2Z A;  2LT1 A;  2WAC A;  3L2R A;  2RJE A;  3E9F A;  3URG A;  3CD6 T;  2RJC A;  4A4G A;  1H64 1;  3S3O A;  1Q7Y C;  2GFA A;  2BUD A;  5GAO p;  2BS3 A;  1G3W A;  4C8Q F;  3CPW S;  3CC7 A;  4BAC A;  5FRO A;  4DOV A;  3NTK A;  2RK1 A;  5IN1 A;  3AHU A;  2VUB A;  4QSH A;  3R6O A;  1BIA A;  3S3N A;  3GIB A;  5GAN 3;  1Q81 U;  4M7A D;  3BDL A;  1WJS A;  4J8O A;  1OZ2 A;  2P0P A;  2DXU A;  1BI3 A;  2QTX A;  2EJ9 A;  5GAM h;  2VYT A;  4ZGD B;  3A8H B;  3JB9 J;  3OYY A;  4HCZ A;  3NFC A;  2KMG A;  1N27 A;  1WQW A;  1M90 C;  1U8R A;  1QVF A;  1V29 B;  1HK9 A;  1Q7Y U;  1XTD A;  4BDY A;  3OS5 A;  3QJY A;  3RKY A;  4LDX A;  5GAN 8;  2D6F A;  3JCM J;  2R5M A;  5DM7 R;  3CD6 A;  2ZPF B;  2OTL A;  4AKI A;  1JRI A;  5M9O A;  1HXD A;  2V8J A;  2XG8 D;  3EAE A;  4IUT A;  5GAN 5;  3WVD B;  4KUD K;  5GAN 4;  3G6E A;  1SSF A;  2KAF A;  4M7D C;  1UGS B;  3VKH A;  2LTO A;  2R5A A;  4JRI A;  4C8Q B;  4E7I A;  2OTJ T;  4XU1 A;  3OA6 A;  5IT9 E;  3CCL A;  1NPP A;  1Y7X A;  2DTH A;  1IRE B;  3O8V A;  3CPW A;  3FIF A;  1B34 B;  1G3Y A;  4QQG A;  4KUL A;  2RD1 A;  3INZ A;  3QYB A;  4YTL A;  4C92 D;  2JZ2 A;  2O01 E;  4C5G A;  4XTV A;  4BB7 A;  3OYG A;  1G3S A;  2PVO B;  3VU3 C;  3CXC A;  2YLB A;  3H6Z A;  1FWZ A;  2DXB A;  4R55 A;  4FT4 A;  4Y28 E;  4E7L A;  3BG3 A;  2L89 A;  4JLG A;  5GMK l;  4MZT A;  5CAI A;  3L2Q A;  3CBO A;  4M7A C;  3G71 T;  1R8O B;  4DQ2 A;  3JCM g;  4FIB A;  1G3T A;  4C5H A;  1KC8 C;  2RM4 A;  5FRN A;  5KE3 A;  1VQ5 T;  4PJO A;  2F5K A;  4C92 F;  1DJ7 B;  4EDU A;  4LDW A;  5FRM A;  5J39 A;  3RER A;  2CZ6 B;  3PT9 A;  3M55 A;  3EFR A;  5DLQ E;  4TVR A;  3OYN A;  3I56 T;  4ZTF A;  3CBP A;  5LJ3 h;  1QW1 A;  2RJD A;  4M78 E;  2WSE E;  3OYE A;  2RHI A;  5FU7 B;  1K73 U;  3MHX A;  2P0Q A;  2E10 A;  3V7S A;  4M7A G;  3VKG A;  1Q82 C;  3QPH A;  4ME7 A;  4PJO F;  3HRT A;  5CO7 A;  2Y4Y A;  2RH2 A;  3N5B B;  3H8Z A;  3NTH A;  4MZP A;  2XIC A;  4M7D D;  1RL2 A;  4JUV A;  1XNI A;  5GAM d;  4V2S A;  4Z6Y A;  2JNG A;  3CMA A;  1FKM A;  2X4X A;  5LJ3 f;  4N0A C;  4RMO A;  4C0D C;  3OB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...