2ZPIB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpiB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpiB02
4OB0B 1AHJB 1PSFA 2ZPBB 2CZ0B 3X24B 3A8OB 2PU9B 2ZCFB 2PVGB 3X20B 2CZ6B 3QYGB 4FM4B 2O01E 1UGPB 1UGSB 1V29B 3A8LB 3VYGB 4ZGDB 2DD4B 1PSEA 2AHJB 2DXCB 3WVEB 1QP3A 2CZ7B 3A8HB 5L8RE 1UGRB 2PVOB 3QXEB 1DJ7B 2ZZDA 2ZPHB 2PUKB 3X28B 2PUOB 2DXBB 2D0QB 1JB0E 4ZGEB 2DD4A 3X26B 2DD5B 4L6V5 3WVDB 1GXIE 2DPPB 2QDYB 3QZ5B 2ZPGB 3LW5E 1UGQB 2WSCE 1QP2A 4RKUE 2ZPFB 2ZPEB 4ZGJB 2DXBA 3HHTB 4XK8E 3X25B 1IREB 3VYGA 4OB2B 3QYHB 2DXCA 3VYHB 2DD5A 2ZZDB 4KT0E 4OB3B 3A8GB 2CYZB 3A8MB 2CZ1B 2PVDB 3QZ9B 4OB1B 2WSFE 2WSEE 2ZPIB 4Y28E
chains in the Genus database with same CATH superfamily
2COYA 2F2WA 1IGQA 2L3RA 4C8QE 1W2BP 1Q95G 2MK5A 4DEXA 3PO3S 4J83A 3X20B 4MDXA 4BI4A 3JCMg 4FM4B 4CRIA 1C9BA 4ROEA 4LD9K 1EZZB 4AG1C 4HXJA 1NZ9A 5C6SA 2X51A 3HTRA 1C0MA 3T9NA 4ORZA 3GNGA 1UDLA 3OYJA 2HKNA 3JCMW 3MI9B 4BDZA 2QAZA 2J6OA 5I21A 3CCEA 1QVGA 2DL5A 4HNVA 4XTWA 2PUKB 1VQKA 2DBMA 3RIRA 4XTZA 5EFQB 2EQKA 2LCLA 1ZUYA 5EC7A 3VS6A 2V1RA 3TEEA 5GANj 3V8JA 1GUXA 4HT8A 3M0UA 2FVUA 4QVDA 2GQIA 5GJVB 2VUBA 1VQ7Q 2LX9A 2DRMA 1D0ZA 5CKEA 4OP0A 3JB9G 3CXCP 3QJYA 3M53A 1M2OA 2VXFA 3UPUA 1U1SA 2ZGWA 2ZPFB 4ZGJB 4CFUD 3CCSQ 3PIPA 1WLPB 2EYYA 3V7RA 4DBFA 2XG8D 2YLCA 2XDPA 3EFOB 1PNJA 1N27A 1Y0MA 4QKUA 4M7DF 1KIKA 1Q7YC 1MMAA 1U5SA 2CP3A 5LJ5e 3BY7A 4NL3A 1WDXA 4NOYA 2A36A 1A0NB 1WFWA 3WXMB 2FZKB 3N5BB 4N4GA 3PE0A 4IKFA 2Z0WA 1CSKA 3LQ5B 2CP2A 4XU0A 3MO8A 1FMVA 4MIMA 4YOZA 1Q82R 1KG1A 4JJDA 2A37A 1WHHA 1NEBA 4C5EA 2H3EB 4M7AF 1JXOA 2CT3A 2EWNA 3J81E 3QWLA 3PIOA 2KAFA 2M1HA 2FEIA 3M0SA 5ACBA 4OMOA 1UGPB 2PK2A 1D3BA 1BKBA 3MEVA 1M3CA 1VQPQ 4Y72B 1KC8C 3TW6A 4ZGDB 2J6KA 2L3QA 4C0DC 2CGHA 3BDUA 3QWXX 1YITA 3A8HB 3H0IA 1ZBXA 2QA4A 2PVOB 2EBPA 1SG5A 2DK3A 2LZ6B 1D1BA 3TN8B 4KGVB 1AZGB 2RJDA 2RJFA 5FU6C 5FLXE 2D0QB 3LX7A 5A0LA 4HL4A 2BUDA 2CSQA 1KHCA 1QWFA 4C5IA 5KYUA 3PMIA 4VUBA 1ACMB 2COWA 4IUTA 2RPNA 2ZPGB 4BBSM 4MMLA 3FJ5A 4J9DA 4RKUE 3OYKA 2FZCB 3C94A 1IREB 2R58A 3H6ZA 2CH4A 1QVPA 1UE9A 1LPLA 1D1CA 3TSWA 3KHIA 3CC2T 4R0KA 4ANJA 1GCPA 2XHCA 5GAN6 1FKMA 2KYBA 4J9IA 1GUXB 1RUWA 5I2SA 5KYWA 3OYYA 4BCKB 4RTZA 3CCJT 2DLPA 1AD6A 3OSSC 1YIJA 1QQJA 2DJZA 2DZ9A 2P0KA 5GMKh 2NWMA 4Z02A 1PSFA 1WJRA 2DXTA 3CQTA 5EG2A 3VS1A 3QDRB 4OGRB 4M78A 1YI2T 2LJ0A 3DDQB 4E47A 1JJ2P 4M78G 3MP8A 2O88A 5GAOm 5I22A 3RGFB 1H1SB 1HD3A 3BLQB 2HQHA 1VQ8A 5CYIB 3CBOA 1VQ6A 1QVFP 5KYXA 5LMKB 3CCUT 4M78C 4F7NB 3FB9A 4JJCA 2LVMA 4PJOF 2VYTA 5CKHA 4ZTJA 2KY9A 1H26B 2VGNA 2E70A 5GAOq 1OIUB 1EIFA 5HBEB 4AKIA 1IHVA 4OMQA 1YP5A 1VQNA 4KBMB 4P5NA 1GCQA 1WI7A 2O9SA 1TD6A 1NG2A 1E6GA 6AT1B 1BI1A 2JOYA 4C0DB 4AKHA 3INZA 1H1RB 5KYYB 2C5XB 1OX8A 3TNHB 1OGUB 4OVAA 1RABB 2DPPB 2QDYB 2GBQA 4LUEA 4XQ3A 1BK2A 4YC3B 3G6EA 5GMKm 3HB9A 1BI0A 2EFIA 1D3BB 2QYZA 1GCQC 2ZPEB 2FG0A 5FU6B 1MGQA 2CUBA 1YJWQ 1B34A 2EKOA 3R6NA 3VYGA 3OW2P 3EGUA 4IIOA 1VYVA 2DXCA 4M75F 3G4SQ 2DD5A 1K8AC 2QDJA 3CCVT 3OYLA 3QHRB 5FW9A 2L3PA 4FU6A 1OKVB 3EGDA 3EG3A 3CD6T 2CSIA 3BLHB 3SWNA 1UUEA 1K73R 4CRLB 3EG0A 2JVVA 3OYAA 1VOMA 4OB1B 2YUPA 3PNWC 3UA7A 2KXCA 3GNFB 4HNTA 5LJ3d 3TQ7P 2FO0A 1JKWA 1X6GA 4HVVA 2R7GA 4DOWA 4OB0B 2V8JA 1NLOC 5GAMe 1UECA 2ZPBB 4J8OA 5M9OA 1WQWA 4EONB 1G83A 1YWPA 3CC2Q 3C95A 4JX4A 3JB9D 1RACB 1ZA2B 5HY6A 2PJQA 1RAHB 2W99A 4J9HA 2DD4B 3VV0A 1E7OA 1VQ9A 2JNGA 3C0CA 3CCJQ 3EH2A 4O6JA 1I81A 3QWYA 1WHJA 5GANf 1Q86U 1NYGA 3L2RA 2C5OB 2NUZA 1MUZA 1NM7A 3VS2A 3ZFJA 3KXTA 2XK0A 1BU2A 1YI2Q 2QEXA 3KFVA 1TTHB 4QT7A 3P8BB 4XTUA 3GPLA 3BG9A 3E2UA 1Q7YR 2HBWA 4ZGEB 1JQQA 2O4XA 1JEGA 4RTYA 2RB6A 4LUDA 2DMOA 2VVKA 3EFSA 4BI3A 3VKIA 2QTVA 4KRDB 4PJLA 1S72T 4B6MA 4CFWB 3CCUQ 4J6WA 1AWOA 1FX7A 2EYQA 3JCMc 3BG3A 2E3IA 2GNCA 2P4TA 3OSVA 2RQWA 2A08A 2JXBA 2IVXA 4MZMA 4ZN1A 3DKMA 2RHXA 1H641 2EQJA 2MI6A 3BW1A 8AT1B 3OYEA 2I0NA 3RERA 3B57A 3UDCA 5CKBA 3QBYA 3EG9A 1RL2A 5BNJB 2LC4A 3VKGA 2E6ZA 1O9KA 1VQOQ 3TNWB 5D7UA 4Q5WA 4CC2A 3OB9A 3JCMJ 1ZSZB 3QHWB 1R0BG 5LL6S 4BCFB 1UHCA 1WX6A 1VQ7A 1F1BB 1UNGD 3VS3A 4GLMA 3EAEA 3REAB 2LCCA 4IIMA 2YSQA 5D6XA 2OX7A 3I9QA 2D9TA 3JCMf 4EOLB 1X01A 3H4CA 2CP6A 3REBB 1FMKA 1PD1A 4QQDA 1P92A 3P8HA 4N0AA 5LJ3h 1I07A 5LJ5d 4J6XA 1KQ2A 2KR3A 2K6DA 2CP5A 1NBEB 3CD6Q 2F2CA 3VYGB 5GJWB 1LNXA 3HSBA 4F6WB 3CC4A 3JCMQ 2DXCB 5A0GA 3CEYA 2DETA 1WA7A 4N0AC 1JXMA 1WHMA 2NUTB 3Q1JA 4J7IA 2XI9A 4XU3A 1OPKA 1IB8A 3PMTA 1YJ9T 4JRKA 3ZL7C 3CMAA 1OU8A 2IIMA 3JCMb 2CUDA 1ABOA 1GFDA 5DLQE 1W98B 1YCYA 1M1KC 2LQKA 2FZGB 4AFSC 2I40B 1TOVA 3O0GD 1YNZA 4OGEA 3LH0A 4D8DA 2LQWA 2KT1A 3UA6A 4EC9B 1VQPA 2J6FA 1AVZC 4M78D 2KK4A 4R56A 1RADB 2Y90A 4EMGA 4JRPA 5HVYB 2EYZA 2JUFA 1NPPA 2AKKA 1VUBA 4OF1A 4BE2A 2MWPA 3CMET 2DERA 1AWXA 4ROCA 1PKDB 4RODA 4LXCA 3FC3A 3A8GB 1G8XA 2PQWA 3O8VA 2OTJT 3E9FA 2BPMB 3R6OA 4FYYB 5HK0A 2VXEA 5FU7C 1VQ4Q 2O4XB 3DLMA 3M0QA 1K0XA 3MIAB 5LJ3j 4JZ3A 1NE8A 2DXUA 2RQRA 3RDVA 2AK5A 3DL1A 3HFNA 2LDMA 2P4RA 3L2QA 3RNJA 3MCAB 4F6SB 3A1PA 4A4FA 1PD0A 2EKHA 2EQIA 3GIBA 3X24B 2AIRB 4B9XA 4FW2A 5GAN2 1HK9A 1E9HB 3QYGB 3CCLT 2ESWA 3OS2A 4D6WA 2O01E 2LMJA 4N4IA 2O9VA 5DM7R 2JS0A 2EW3A 2X4JA 2K7AA 5HQ0B 4EOPB 5LJ5h 1G3WA 2HD0A 2J05A 3OYCA 3FLGA 3OYIA 3M55A 2KE9A 3NHNA 3I5SA 2C5NB 2QI2A 4PLLA 4IURA 1JSUB 2DL4A 3JV3A 2IPOB 2KEAA 1T3SA 5CEIB 1UJYA 2JT4A 3PT9A 4JX6A 1Z9QA 2JZ2A 1KK7A 1K8AR 3O5ZA 4M77F 1K73C 1TUCA 1JU5C 3MP1A 1MMGA 1GXIE 1MV0B 1X6BA 1O9SA 3VS7A 2P0PA 2LP5A 3M0RA 4J5YA 3CCMT 4M4ZA 2HCKA 4TTHA 3S3OA 2MYSA 3VKHA 5D6WA 1VINA 3H8ZA 1RAIB 1K1ZA 4F70B 4CC3A 3DB4A 1M3AA 3HHTB 2CJMB 2EJGA 3KBGA 2WMAB 4UC4A 1YJ9Q 1O75A 3OYMA 1YWOA 2J7IA 4F7UA 5IXFA 1ZUKA 3FIFA 1JSTB 3FRNA 4F7UG 4YOOA 3VUZA 2EYWA 4F16A 3JB9H 4OB3B 3OYFA 5GAN4 3CBMA 4LDUA 5GANe 1K0SA 1PHTA 4D8KA 2JTFA 1HYOA 2RHUA 3SB2A 4M78E 1NYFA 3QZ9B 2ED0A 2OI3A 2OTLA 2JTEA 4EOQB 1AZEA 2K2MA 4BY6C 5KH6A 3CC7A 2RQUA 2ZCFB 1SHFA 2QG9B 8ATCB 2HMAA 5LJ5j 2RI5A 1N9RA 1SSFA 3CMEQ 1W70A 4XTVA 1V29B 2L5QA 2OTJQ 1NEGA 1SRMA 5FU7B 2GFUA 2CP7A 4ESRA 1B3QA 4F6UB 4BE1A 1Q81U 1G3YA 2CZ7B 1KJWA 2V1QA 2VGMA 2E12A 3CCET 1KD1U 4C92F 3CCQQ 2XDBA 4MZTA 1DJ7B 5GAMd 2GQVA 5GAN5 4LDWA 5KCHA 1X75C 3CPWS 1F5QB 2ABLA 3A5ZB 3G71A 3CCLQ 1KQSS 4C8QF 4UN0A 1R0CB 4PFPA 4AFUC 4LNPA 2BZ8A 2HQEA 2HSPA 1OQKA 1VIFA 1Y57A 2AZVA 1VIEA 2RQTA 5CVIA 2HBPA 3H9NA 4M7DA 3JCMe 2COZA 4ME7A 3ZBDA 4X9DA 2V8KA 1QP2A 1N8RU 1R8OB 2C0IA 1T0HA 4HVWA 4KGZB 2YLBA 1RI9A 4RCCA 1YJWT 2DYIA 4FYVB 4IUUA 3TREA 1OU9A 1VQMT 2RO0A 2GTOA 3G4ST 1PRMC 3GBQA 1NLPC 1WQ7A 4M7DC 2LCSA 3BHVB 1XJWB 4FW1A 3OS5A 1HSQA 3M56A 3FJPA 1JO8A 3BHTB 4G6LB 2BZYA 2DYBA 1YCSB 4IUVA 3DDPB 1C6VX 4X1VA 4N4HA 3CCMQ 4TVRA 1I8FA 2P84A 2F69A 2V22B 2EUFA 1RI0A 3LGFA 2UZDB 1N4MA 2K4YA 3RMSA 2DKGA 1H1QB 1IO6A 2LQ8A 4HVUA 3TCJA 4L5GA 2OJ2A 4X9CA 4EORB 3UATA 1I5OB 1M4ZA 3JSCA 1BIBA 4Z88A 3JCMV 2SRCA 3QYEA 2K3YA 4XU1A 1VQ5T 2LW4A 3OYHA 1M1KR 5I2MA 1YJNT 1NJIU 4F7UB 4ELJA 5CCAA 5L2WB 2IG0A 1R77A 2QA4T 2DMEA 3VRYA 1T0JA 4ELZC 2KROA 1XNIA 4O5VA 4AI6A 2EAYA 1FVVB 2W96A 4OMMA 2EJFA 4J7FA 1UNLD 1VA7A 1TUDA 3I5RA 4F04B 2BS4A 5HBHB 3BDLA 2E10A 5GAMh 3JB9J 1JB0E 2DTOA 1S1NA 2RJEA 2WJ9A 3HO8A 3SDZA 1EX4A 2PZ1A 4A4KA 1H28B 2K5IA 2X1NB 3NDQA 3CCVA 2LNHB 1K9MU 3ME9A 2KMGA 2DFUA 1WYXA 3CCEQ 1XQHA 2KQWA 1I1JA 3CD6A 3GLXA 4F7SB 2JMAA 4RTUA 4F14A 1D0YA 3VU3C 1Y96A 1E6HA 1M2VA 3G7ZA 1PRLC 4CC4B 3H0HA 4FT4A 1VQOT 3I56A 3I55A 4KT0E 3TSZA 2LJ3A 4CI0C 4WCIA 5LJ3f 2A0FB 3NTKA 4QQGA 3J7AF 1ABQA 2KT8A 4BB7A 4RG8A 4OMFB 3RMQA 1OL2B 1W4SA 3UWNA 1Y07A 1V1CA 1CKBA 2YHTA 2CCHB 3HPWA 1H24B 2CKKA 1ZX6A 5IAYA 1VQMQ 1OEBA 4WF2A 1UB4A 2PU9B 4PJMA 2R57A 5IHNA 3OYGA 2DE0X 4PJOA 2QDLA 4OR5B 4PJOG 5GMKj 3EG1A 3RKXA 4V2SA 1X27A 2RHYA 4GY5A 1MNEA 4GBQA 3VJPA 4LN2A 3JB9I 5KYUB 4F7LB 3RR6A 4PJOC 4JJNK 5GAMj 4R55A 2D6FA 1S72A 2ZZDA 2OAUA 3SWNC 1VQLA 1QMCA 7AT1B 2GCXA 2HDAA 3HL8A 4KRTA 1QVGP 3CPWA 3EHRA 5CK9A 2FPDA 1RLPC 5DLOA 3LWHA 2BKDN 2H8HA 1KQSA 2LTOA 1VQ5Q 3QKJA 1I0CA 1LJOA 4EMKA 4A4HA 1YJNQ 3H41A 9ATCB 2WEVB 1BI2A 1WJSA 4JX5A 3ER0A 4M75A 4E7JA 4X34A 3QZ5B 1I4K1 1N9SA 4M75G 4LOCA 1M8VA 2HEQA 2QA4Q 4HT9A 4DBHA 3OW2S 3D7SB 3OBYA 5KYWB 3AHUA 1KFZA 3MJXA 2DXBA 2DVJA 4KRCB 4EMKC 4JUVA 4M75C 2QFZA 2O31A 1Q82U 3SEMA 2XICA 4M78B 1Q86C 1QW1A 2FPEA 2K5FA 4BCMD 3GP8A 2RHIA 5GAOr 1VQ4T 3BLRB 4AMCA 4RG2A 2MPXC 3QUIA 4OMPA 4HCBA 2FYKA 3FDRA 2WSFE 4K11A 4RTXA 4BD3A 5LJ5f 5KYXB 2XD0A 2LT1A 2LT4A 1X69A 4A4EA 3A8OB 3VS4A 2VWFA 1XTDA 2WIHB 4E7ZA 1IXDA 2NUPA 2CZ6B 3L1AA 4M7DD 4AFZC 1FWZA 1UGSB 1VYTA 1WXTA 3OMGA 3JAME 1Y96B 1YJ9A 1M2VB 2DVEA 5J3BA 3M4YA 1PC0A 5LJ3g 2X3XD 2PNIA 2HAXA 5CKFA 1M5Q1 2QGFB 2NLUA 1UGRB 5CO7A 2XDDA 2EYXA 3SHWA 4QVCA 4KH0B 2DIGA 2J06A 4II1A 3CCSA 1BU1A 2DTIA 3QIIA 1QMZB 2AKLA 1B34B 2CP0A 2SEMA 1M90U 2VASA 4CFVB 4BCND 3X26B 2DD5B 1GFCA 4KUDK 1H3HA 3VS0A 2KRMA 4KULA 3G33B 2C6TB 1AD5A 1SKUB 4M6VA 4FSXA 5CIUA 4F7UE 3EGDB 4YTLA 3SWNB 3L42A 1FYNA 3L2WA 4C5HA 4CXAB 2OTJA 4EOSB 4JS5A 5GMKi 1U1TA 4EOJB 3HP9A 4A4GA 3OYNA 4Z89A 2C0OA 3C12A 3MKDA 4RTTA 3QDFA 1VQNQ 4J9EA 2M9UA 1M3BA 1UJ0A 1ENWA 1TG0A 2RJCA 2BKZB 4JRQA 3POMA 3OY9A 3QPHA 4RMOA 4E7HA 2KVQG 2ZZDB 1W6XA 1MMNA 2K5LA 3TVTA 2BTTA 4EPCA 3EFRA 3CCLA 1BCMA 2K3XA 2K9GA 1TWBA 2JJ9A 4QW2A 4XTYA 3URGA 3MY5B 3L2UA 1TSFA 3KUFA 1D3UB 2HKQB 4A63B 2M02A 2PMIB 3MPUB 2ZPIB 1OULA 3OS1A 5IHKA 4PJNA 2W9ZA 1M27C 1RAGB 3OS0A 2LX7A 4M75B 2IW9B 4BBRM 1GBQA 1QWEA 1X2QA 5CKDA 5HBJB 1M1FA 2GFAA 2GGRA 3NTHA 1V76A 2PVGB 5I11A 1QCNA 2LJ1A 4QQ6A 3PFSA 2P0QA 1UTIA 5CAIA 1TU0B 2YUQA 4FCYA 2HSEB 5GMKl 1Y71A 1IZ6A 2YRVA 4BCHB 3CC4T 5IT9E 1YHQT 5HNBB 2KNBB 3WVEB 2RK2A 4FYWB 3CCQT 4E7LA 5GANh 1HXDA 3BE3A 1U06A 3K7AM 2DEQA 1J3TA 4II5B 3RKYA 2HNIA 3VUBA 2ZPHB 5LJ5g 2CH4W 3CBPA 1I5LA 2R5AA 2C4GB 2CDTA 2M0OA 4PKCC 3ULRB 4M7DE 1WNLA 2B8AA 3CMAT 1PKSA 2H3JA 3THKA 2F5KA 1JRIA 3RESA 2W0ZA 2HL5C 5DY9A 4DEYA 3CCRT 4QVZA 2QK0A 3EG9B 2G9XB 2QF7A 2E64A 3M9QA 2BS2A 3V8KA 5D6YA 1FINB 2B9RA 4EDUA 2WHBB 2UZEB 1O9KB 3MEUA 2CCIB 4FYXB 3H0FA 1SPKA 2NUPB 2WSCE 2PK9B 1MV3A 2LQNA 2QQSA 3M0PA 4LE9A 1EFNA 5IN1A 4PJOD 2DZCA 2DRKA 4XK8E 4DBRA 2DA9A 2IW6B 4ZTFA 5IHIA 2D1XA 1OL1B 5J26A 2EQMA 3EG2A 1H8KA 4OB2B 3QYHB 3JB9F 2JMCA 1GY3B 2WPAB 1KQ1A 2D8HA 1OIYB 5I5ZB 1C1AA 1TUGB 3A8MB 1OPLA 2GTJA 3LYIA 5AYFA 2V8IA 4Z8AA 3M54A 2RF0A 5GAOn 3NMZC 1Z9ZA 1QKXA 1JBMA 5IDPB 3JCMh 1YFNA 2DBKA 4L59A 4ELYC 4Z6YA 4EMHA 2CZ0B 2MOXA 3F70A 3OYBA 2FB7A 1B7TA 3VS5A 1QCFA 4M75D 1WGSA 3EHQA 3SD4A 4JLGA 4BY1X 1ZBJA 5GAMf 1W2BS 3CPWP 2CT4A 2L3SA 4E2FB 1PSEA 1Y7XA 1QP3A 1Q7YU 3TU4K 1KQSP 4M77A 1VOLA 1OI9B 4NC6A 2FRWA 4M77G 2ENMA 3M59A 3HRUA 4JS4A 5C0MA 3C4SA 3QO3A 1IGUA 1BB9A 5IXBA 1QKWA 1YJWA 1IHWA 3NGPA 1VQMA 2YRDA 1H92A 4M77C 4E7SA 2MCNA 3G4SA 3LLRA 1Q86R 2WIPB 1OZ3A 2QQBA 2AT1B 3CC4Q 2A7YA 5GAN3 3MP6A 1GH6B 2KRNA 2A28A 4J9BA 1YHQQ 4HCZA 4NSTB 2KRSA 1H1PB 4WTOB 2X4YA 5A0DA 1VQKT 5IHYA 2B86A 4E7KA 1KC8U 1AWJA 3U23A 2L89A 3META 3DLLA 2EIFA 1D09B 4BE0A 4NS5A 3CMAQ 5FGKB 3CXCS 2RMOA 4LDYA 1SSHA 2V26A 3GF5A 4Y91A 5KYYA 3RBBB 3S3MA 3CCRQ 1Q81C 2BIVA 1SF9A 3CC2A 2QQAA 2YUOA 1ZSGA 4BCGB 3L2VA 1WXUA 4IUQA 1KD1C 4M7DG 3GTMS 1LCKA 2E1HA 4CC7A 4IUPA 4I3ZB 1UEBA 1X43A 1VQ5A 2EJ9A 4BCOB 4PJOE 3CCJA 2E3HA 2FL7A 2WSEE 2OTLT 4Y28E 2C06A 1YJNA 5HK3A 3MEAA 3UT1A 2RNAA 5A2QE 3CC7T 3SFMA 4KH1B 4M7AA 5IH2A 4FIBA 2YT6A 4C92A 4M7AG 4MMKA 3P8DA 2A3LA 4BCJB 1YI2A 4C92G 4C0GA 4XTXA 4MFDA 1N8RC 4MZPA 4EC8B 3MEWA 1ZLMA 4HKEA 4BUGA 4C8QA 1KSWA 4PL6A 2X4WA 4C8QG 2K2VA 4BCPB 4ZNXA 4M7AC 3MHXA 2D8JA 4CFXB 4C92C 3J80E 2DL3A 3CCUA 4M78F 3OA6A 1X6OA 5LQFB 4LDVA 1ZQ1A 2E6NA 2I2LA 4A53A 2K79A 4EIKA 3G71T 3OMCA 2XU8A 3EJ1B 1FXXA 3V7SA 4M75E 2RN8A 4C8QC 1K9AA 4BI8B 1M90R 3EIDB 4PLIA 1M8MA 2QASA 1OOTA 4B9WA 2Y4YA 1URCB 2DD4A 3BG5A 2XIDA 1YITT 1VQOA 5GAMg 2YWWA 4BY6B 1E7PA 2FRYA 3F5XB 1JOWA 2MMPA 4EOKB 2RI3A 5GAOp 2QQ8A 2RHZA 1GRIA 1G3SA 1OYXA 1XOVA 2OAWA 1KXUA 3GOXA 1AWWA 1D0XA 1P5EB 2E4HA 4MDWA 2C5VB 3LWIA 4M77B 1TFBA 3HZJA 2YRCA 1NJIC 3HFOA 5FRMA 3VYHB 3OQ5A 1M1GA 1WZOA 2JTMA 1BI3A 5DQVA 3V7CA 1ZHIA 4OMLA 2ECZA 2UUEB 4BACA 1VQKQ 1UNHD 3HRSA 4DBQA 4C0FA 2KGTA 2PHGA 3IQLA 2WMBB 4OGCA 3NTIA 2BE9B 4BCMB 4PFOA 1QLYA 5KE3A 3JCMX 5J39A 1AHJB 1AT1B 2QGSA 2X3WD 4J9GA 1FMWA 1KHIA 4NL2A 2F2VA 2KMTA 3V8LA 1SRLA 1K9MC 1PWTA 2NYSA 2QQRA 3PVQA 1WHKA 1ZSZA 3A8LB 4HNUA 1MNDA 3E9GA 1NPRA 2DL8A 2MF2A 2E5QA 1YIJT 2KSSA 4F7JB 2M16A 2DJQA 1W2BA 2EGCA 2AHJB 3RKWA 1K8AU 1GBRA 1WHGA 3JRZA 3QJ6A 1JJ2S 5ECAA 3DJBA 1ZUUA 2OTLQ 4CFNB 4M7DB 1OV3A 2CREA 4FT2A 2DEUA 1H3ZA 4AT1B 2VKNA 2BE7D 5FWCA 3CC7Q 1ARKA 1ZSZC 2VB6A 4EOOB 3QHSA 1PKTA 1N5ZA 4JZ4A 5FROA 4PK4A 4JRIA 4HLQA 2EGEA 1QVFS 2LRQA 1WHLA 1UHFA 1VQ8T 1IRXA 5FRNA 1HJDA 2RK1A 1VQ6T 1ZP2A 4M7AB 2L8DA 2DF6A 2NUTA 4C92B 2G6FX 1UGQB 1OI1A 5GMKe 3UF4A 1TH7A 1BIAA 3BHUB 1VQ4A 4BCNB 3PTAA 4XU2A 4C8QB 2EVRA 2K3BA 3G71Q 1VQNT 1MMDA 3S3NA 3X25B 4KUIA 1U3OA 3E1SA 2D0NA 4A54A 2YDLA 3I56T 5CQXA 5DQWA 3I55T 4Y92A 1TS9A 3DTOA 3CXCA 2F2XA 3VRZA 3G1JA 4DA4A 1YITQ 3G6ET 1TXQA 2ED1A 4JPBW 3TNIB 2E41A 4M77D 4PJJA 2RA2A 1VYUA 4HCKA 1G2BA 4QSHA 2DNUA 2QTXA 2UZBB 4FSSA 1X2KA 4BXXX 2DO3A 4ZN3A 2K57A 2QQ9A 2CZ1B 2WFYB 2PVDB 1WJQA 3TW7A 3E19A 2KBTA 2L0AA 2YXYA 2DL7A 2JM9A 2W2HA 1G3TA 4MFEA 2RQVA 2FPFA 4C0ZA 3S6WA 1W1FA 3M4GA 2ROTA 1UGVA 4KGXB 2M0YA 4EOIB 4C5GA 5KE2A 4CFMB 3EGXA 1GL5A 2HQXA 3QG1A 4PFZA 5CQYA 4JLIA 2WACA 4FL6A 1N6AA 5HKCA 1QVGS 2AZSA 5L8RE 1Q82C 3A98A 1VQLT 2Y4XA 4AKGA 2F1LA 5GAN7 2F5TX 3EOCB 3BFMA 1AISB 3X28B 1YN8A 2PUOB 4RTWA 2UZLB 1RAFB 2X4XA 5IDNB 2IVWA 5GANd 1SEMA 1H27B 1Q81R 1VQ9T 5HCKA 3ZEHA 4JDSA 3QYBA 2GF7A 1KD1R 3M57A 1YIJQ 1OX9A 2DAQA 3MY1B 2EGAA 2G3RA 3LW5E 2KDSA 4E6RA 3PVLA 2RH2A 4OMNA 1KC8R 2CS7A 3M58A 4BY7X 2XMFA 4M7AD 4LDXA 3PGGA 2QEXT 4BDYA 4C92D 3CPFA 3DB3A 4E7IA 2DIQA 4BCQB 1RAEB 4ELLA 4FX3B 1VQ8Q 4C8QD 1UFFA 2HZYA 2X35A 3LH5A 1LVKA 1VQ6Q 2KR6A 1PM3A 1N8RR 2I53A 5KYNA 4YOSA 5GAN8 2KXDA 2L2PA 4PJOB 3CMEA 3CCVQ 4JJBA 2E5KA 3EH1A 3FEOA 1M9SA 1BCOA 2QXFA 4RTVA 1MHNA 4PNOA 1LOJA 3HBLA 3NPFA 2YUNA 4BCIB 1PCXA 1M1KU 1UG1A 4F17A 2DTHA 1YHQA 4HA8A 5GAOl 1M90C 4AFQC 3CCQA 3DOGB 1WXBA 3I56Q 2IN3A 3I55Q 1XO2A 2C0TA 3OBWA 2JM8A 4M77E 4LD6A 2QGGA 3JCMd 3G6EQ 2KYMA 1VQ7T 2LNVA 2JS2A 4GLKA 5L23A 2JGZB 3M5AA 4AG2C 2WXVB 3ASKA 4EMKB 3QSUA 2DILA 3CCRA 4RUGA 2IW8B 2VV5A 2G77A 2ZAEA 1T3LA 1RAAB 3EFOA 1QCOA 3L2ZA 1JJ2A 2JN0A 5AT1B 3QXEB 1WPYA 5FWBA 4HCCA 2RD1A 5IF1B 2KI7A 5CR2A 2O2OA 2RM4A 3RUXA 2MWOA 1H4LD 5GANg 3CCST 1G5VA 2X9HA 2DXBB 1NJIR 2HL3A 4ATOA 1QVFA 2EPDA 2FHDA 2ATCB 1AEYA 1ZA1B 2M51A 3M03A 2XKOC 2ROLA 2DX1A 1PG5B 4L6V5 3WVDB 1SHGA 4J9FA 2E65A 4CFUB 3I35A 2W9FA 1K76A 3EGXB 4EOMB 3CCMA 1OKWB 1S72Q 3HKSA 1WIEA 1VQLQ 1D1AA 2MIOA 4DOVA 1VYWB 1B07A 1YBYA 1AOJA 5LJ3e 2W10A 5ICPB 4J6YA 1M30A 1OZ2A 4J9CA 2VC8A 3JCMP 1K9MR 2MAMA 5EJCA 1VQ9Q 3NFCA 1H25B 1CKAA 4RCBA 1BYMA 4BCQD 3OYDA 4DQ2A 2DM1A 3AT1B 2CYZB 1VQPT 1BBZA 4IMYB 4M7AE 5KCOA 1QLBA 3M0TA 3LGLA 4C92E 3OW2A 1RLQC 1U8RA 3HRTA 4XAXB 2BS3A 2EQUA 2PTKA 1K73U 2QEXQ 1K4US 2JW4A 2R5MA 2RI2A 4F7UF 2BZXA 1G3NC
chains in the Genus database with same CATH topology
5IAYA 5A2QE 1X01A 3H4CA 3CC7T 2L3RA 4WF2A 4C8QE 3SFMA 4QQDA 1P92A 4M7AA 3P8HA 1VQLT 4N0AA 4FIBA 1UB4A 2PU9B 4J83A 2R57A 3X20B 4C92A 4M7AG 4MMKA 3OYGA 3P8DA 5LJ3h 3JCMf 4BI4A 3JCMg 3QSUA 4FM4B 2A3LA 4MDXA 5LJ5d 4J6XA 1YI2A 4PJOA 4C92G 4C0GA 4XTXA 4CRIA 4PJOG 4LD9K 1KQ2A 4MFDA 5GMKj 1N8RC 4MZPA 1NZ9A 3RKXA 3MEWA 4HKEA 5C6SA 4V2SA 2RHYA 4BUGA 4C8QA 4GY5A 3VYGB 1LNXA 4PL6A 3VJPA 2X4WA 3HSBA 4C8QG 3CC4A 2K2VA 3JCMQ 2DXCB 3JB9I 3T9NA 5A0GA 3GNGA 3CEYA 3MHXA 4M7AC 3OYJA 4N0AC 3JCMW 4C92C 3J80E 4BDZA 3Q1JA 3CCUA 4J7IA 4PJOC 4M78F 5I21A 1X6OA 4LDVA 2XI9A 5GAMj 4XU3A 4R55A 3OA6A 4JJNK 1ZQ1A 2ZZDA 2E6NA 2I2LA 3CCEA 1S72A 1QVGA 4HNVA 2OAUA 3SWNC 4A53A 4XTWA 1VQLA 2PUKB 3G71T 1VQKA 3OMCA 3RIRA 2XU8A 1FXXA 4XTZA 3V7SA 2EQKA 2GCXA 3PMTA 3HL8A 2LCLA 4M75E 4C8QC 3CPWA 4BI8B 1YJ9T 4JRKA 3TEEA 5GANj 3V8JA 4PLIA 5CK9A 3CMAA 5DLOA 3LWHA 4HT8A 2BKDN 2FVUA 4B9WA 4QVDA 2Y4YA 2LTOA 1KQSA 3JCMb 2VUBA 3QKJA 1LJOA 3BG5A 2DD4A 2LX9A 2XIDA 4EMKA 5DLQE 1YITT 1YCYA 4A4HA 1VQOA 1M1KC 2LQKA 5CKEA 1BI2A 4M75A 1WJSA 4JX5A 3ER0A 4OP0A 4E7JA 4X34A 5GAMg 4BY6B 3QZ5B 3JB9G 1I4K1 1N9SA 4M75G 4LOCA 3QJYA 1M8VA 3M53A 1E7PA 4HT9A 4OGEA 3LH0A 2VXFA 2MMPA 3OW2S 3UPUA 1VQPA 3OBYA 1U1SA 2RI3A 5GAOp 2QQ8A 2RHZA 2ZGWA 2ZPFB 3AHUA 1G3SA 4M78D 2KK4A 4ZGJB 1OYXA 4R56A 2DXBA 1XOVA 4EMKC 2Y90A 4EMGA 3GOXA 3PIPA 4JRPA 3V7RA 2XG8D 4JUVA 2YLCA 4MDWA 3LWIA 4M77B 2JUFA 2XDPA 4M75C 3HZJA 2QFZA 1NJIC 1Q82U 1N27A 3HFOA 5FRMA 3VYHB 1NPPA 4M7DF 1VUBA 3OQ5A 4OF1A 4BE2A 1Q7YC 2XICA 2MWPA 5LJ5e 4M78B 3BY7A 1M1GA 4NL3A 3CMET 2JTMA 1BI3A 1Q86C 3FC3A 1QW1A 3A8GB 2K5FA 2PQWA 1ZHIA 4NOYA 3O8VA 3V7CA 3GP8A 2RHIA 3WXMB 5GAOr 2OTJT 4BACA 3E9FA 1VQ4T 3N5BB 3R6OA 4N4GA 4IKFA 4RG2A 3HRSA 3QUIA 5HK0A 4HCBA 2FYKA 2VXEA 5FU7C 3FDRA 4C0FA 2O4XB 3DLMA 3MO8A 4XU0A 2WSFE 4MIMA 4BD3A 5LJ3j 5LJ5f 1KG1A 1NE8A 2DXUA 2XD0A 2LT1A 4C5EA 4OGCA 3DL1A 3NTIA 3HFNA 5KE3A 4M7AF 2LDMA 3JCMX 5J39A 2EWNA 3L2QA 1AHJB 2LT4A 3MCAB 4A4FA 4A4EA 3J81E 3QWLA 3X24B 3GIBA 3A8OB 4B9XA 1KHIA 1XTDA 5GAN2 3PIOA 4NL2A 2KAFA 2CZ6B 1HK9A 3QYGB 3CCLT 2M1HA 2KMTA 3V8LA 3OS2A 1K9MC 3L1AA 4D6WA 2O01E 4M7DD 1UGPB 2QQRA 1FWZA 1UGSB 4N4IA 3OMGA 3JAME 1D3BA 1BKBA 1Y96B 3MEVA 5DM7R 1YJ9A 3A8LB 4HNUA 3E9GA 3DLLA 2DVEA 2X4JA 1KC8C 1NPRA 5J3BA 3TW6A 4ZGDB 2E5QA 2MF2A 3M4YA 2KSSA 5LJ3g 1YIJT 5LJ5h 1G3WA 2HD0A 2M16A 4C0DC 1W2BA 2AHJB 3RKWA 1K8AU 2CGHA 3OYCA 3BDUA 3FLGA 3JRZA 3QJ6A 3OYIA 3A8HB 1YITA 5CKFA 1JJ2S 2HAXA 1M5Q1 1ZBXA 3M55A 4M7DB 2QA4A 2NLUA 4FT2A 1H3ZA 1UGRB 5CO7A 2PVOB 2DK3A 2XDDA 4PLLA 2QI2A 4IURA 3QHSA 4QVCA 5FROA 4JRIA 4HLQA 2DIGA 2RJDA 1QVFS 3PT9A 2LRQA 4JX6A 2RJFA 4II1A 2JZ2A 5FU6C 2D0QB 2DTIA 5FLXE 3LX7A 3QIIA 5A0LA 4HL4A 2BUDA 1VQ8T 1B34B 5FRNA 1M90U 2RK1A 1VQ6T 1KHCA 4M77F 1K73C 4C5IA 3X26B 2DD5B 4M7AB 4KUDK 3PMIA 3MP1A 4KULA 4VUBA 1GXIE 2L8DA 1O9SA 4IUTA 4C92B 2ZPGB 4BBSM 2P0PA 4J5YA 1UGQB 3CCMT 4M6VA 1OI1A 4FSXA 4MMLA 5CIUA 4F7UE 5GMKe 3S3OA 3VKHA 1TH7A 1BIAA 4YTLA 3SWNB 3L42A 3L2WA 5D6WA 4RKUE 4C5HA 3H8ZA 2OTJA 4JS5A 5GMKi 1VQ4A 1U1TA 3PTAA 4XU2A 4C8QB 3HP9A 3OYKA 3DB4A 1VQNT 3C94A 4A4GA 3HHTB 3OYNA 3S3NA 3X25B 4KUIA 3C12A 3E1SA 2EJGA 1IREB 3KBGA 4UC4A 4A54A 1O75A 3OYMA 2M9UA 2R58A 3H6ZA 5CQXA 3I56T 2RJCA 4F7UA 3I55T 1QVPA 4JRQA 3FIFA 3CXCA 3FRNA 4F7UG 3KHIA 3OY9A 3CC2T 3QPHA 3VUZA 4RMOA 2KVQG 4E7HA 3JB9H 2ZZDB 4DA4A 4OB3B 3G6ET 3OYFA 2K5LA 2XHCA 2E41A 4M77D 4EPCA 5GAN6 1FKMA 3EFRA 3CBMA 5GAN4 2RA2A 4LDUA 3CCLA 5GANe 2K3XA 4QW2A 4QSHA 2QTXA 4XTYA 3URGA 2JTFA 5I2SA 2RHUA 4ZN3A 2DO3A 3OYYA 3SB2A 3KUFA 3L2UA 4M78E 2K57A 2QQ9A 2CZ1B 3CCJT 2PVDB 1WJQA 3TW7A 3E19A 3QZ9B 2ZPIB 3OSSC 3OS1A 1YIJA 2DJZA 2DZ9A 2OTLA 1G3TA 3OS0A 4MFEA 2P0KA 5GMKh 4C0ZA 4M75B 3S6WA 3M4GA 4Z02A 4BY6C 5KH6A 4BBRM 1PSFA 5CKDA 1WJRA 2DXTA 3CC7A 1M1FA 2GFAA 5EG2A 3NTHA 3QDRB 2ZCFB 2PVGB 4M78A 4C5GA 5KE2A 1YI2T 4QQ6A 3PFSA 2P0QA 5LJ5j 4E47A 2RI5A 1N9RA 4M78G 1SSFA 3MP8A 4XTVA 5GAOm 5CAIA 1V29B 2HQXA 2L5QA 3QG1A 5CQYA 5GMKl 1Y71A 1IZ6A 2YRVA 4JLIA 2GFUA 5FU7B 3CC4T 5IT9E 3CBOA 1VQ8A 1YHQT 4BE1A 2WACA 1VQ6A 3WVEB 4FL6A 1G3YA 1Q81U 2RK2A 2CZ7B 1N6AA 5HKCA 3CCQT 4E7LA 5GANh 3CCUT 1HXDA 4M78C 3FB9A 2VGMA 1QVGS 2DEQA 5L8RE 2E12A 1Q82C 1KD1U 4C92F 3CCET 3RKYA 2LVMA 2XDBA 4MZTA 2HNIA 1DJ7B 4PJOF 2VYTA 3VUBA 2ZPHB 2GQVA 2Y4XA 5LJ5g 5GAMd 3CBPA 4LDWA 5CKHA 5GAN5 4AKGA 2KY9A 2R5AA 5KCHA 1X75C 2M0OA 4PKCC 5GAN7 3CPWS 4ZTJA 2F5TX 3A5ZB 3BFMA 3G71A 3X28B 4M7DE 2E70A 2PUOB 2VGNA 5GAOq 1EIFA 1WNLA 2B8AA 2X4XA 3CMAT 2H3JA 2IVWA 4C8QF 4AKIA 5GANd 1KQSS 1VQNA 2F5KA 1JRIA 4KBMB 4P5NA 3RESA 5DY9A 1VQ9T 3CCRT 4QVZA 3ZEHA 2HQEA 1BI1A 2JOYA 2QF7A 3QYBA 1VIFA 2BS2A 2E64A 2GF7A 3M9QA 4JDSA 1VIEA 4AKHA 3INZA 3M57A 5D6YA 2DAQA 4EDUA 2G3RA 3MEUA 5CVIA 4OVAA 2HBPA 4M7DA 2DPPB 2QDYB 3LW5E 2KDSA 4XQ3A 3JCMe 4ME7A 2RH2A 4X9DA 3ZBDA 3G6EA 2V8KA 2WSCE 1QP2A 5GMKm 2CS7A 1N8RU 1R8OB 3M58A 3HB9A 1BI0A 2QQSA 4M7AD 2EFIA 2YLBA 4LDXA 1D3BB 3PGGA 4RCCA 2QEXT 1BYMA 4BDYA 1YJWT 4C92D 2ZPEB 3CPFA 5IN1A 4PJOD 4IUUA 3TREA 2DZCA 5FU6B 1MGQA 4XK8E 1VQMT 3DB3A 4E7IA 2RO0A 1B34A 2DIQA 2EKOA 3VYGA 4ZTFA 5J26A 3G4ST 2EQMA 1WQ7A 4OB2B 3QYHB 3JB9F 4M7DC 2DXCA 4C8QD 4M75F 2DD5A 2X35A 1K8AC 2QDJA 3OS5A 3CCVT 2KR6A 1KQ1A 3OYLA 3M56A 3FJPA 4FU6A 5GAN8 4PJOB 4IUVA 3CMEA 3CD6T 3SWNA 4N4HA 4TVRA 3FEOA 1I8FA 1M9SA 2F69A 3A8MB 3LYIA 1RI0A 2QXFA 3LGFA 2JVVA 5AYFA 3OYAA 1MHNA 2V8IA 4PNOA 4OB1B 1LOJA 2K4YA 3HBLA 2DKGA 3M54A 3PNWC 3RMSA 5GAOn 3GNFB 4HNTA 1JBMA 5LJ3d 3JCMh 1M1KU 1YHQA 2DTHA 2LQ8A 4HA8A 5GAOl 1M90C 4L59A 3TCJA 4DOWA 4OB0B 4ELYC 4Z6YA 2V8JA 4L5GA 5GAMe 3CCQA 2ZPBB 4EMHA 2CZ0B 4J8OA 1I5LA 5M9OA 4X9CA 3OBWA 1WQWA 3F70A 3OYBA 2FB7A 3C95A 4JX4A 4M77E 3JB9D 1M4ZA 3JSCA 1BIBA 1WGSA 4LD6A 4M75D 5HY6A 3JCMV 3JCMd 3SD4A 3QYEA 2K3YA 4XU1A 4JLGA 1VQ5T 1VQ7T 2LNVA 4GLKA 3OYHA 5I2MA 3M5AA 5GAMf 1W2BS 1YJNT 1NJIU 2DD4B 4F7UB 3ASKA 3VV0A 1PSEA 4EMKB 4ELJA 2JNGA 5CCAA 2IG0A 3CCRA 1VQ9A 1Y7XA 1QP3A 4O6JA 1Q7YU 3TU4K 1I81A 4M77A 2VV5A 2G77A 2QA4T 5GANf 4NC6A 4ELZC 1Q86U 1XNIA 4M77G 3L2ZA 4AI6A 4O5VA 1JJ2A 2JN0A 2EAYA 3QXEB 1WPYA 3L2RA 3M59A 2EJFA 3HRUA 5C0MA 2RD1A 3C4SA 4JS4A 4HCCA 2D6FA 3QO3A 5CR2A 2RM4A 3RUXA 3ZFJA 2MWOA 4J7FA 5GANg 2XK0A 3KXTA 3CCST 2QEXA 1G5VA 2DXBB 1YJWA 3P8BB 2BS4A 3BDLA 4XTUA 2E10A 5GAMh 3GPLA 3JB9J 3BG9A 1JB0E 4ATOA 2DTOA 1QVFA 1VQMA 2FHDA 2RJEA 2WJ9A 3HO8A 4ZGEB 2O4XA 4M77C 3G4SA 2RB6A 3SDZA 3LLRA 2XKOC 1OZ3A 4A4KA 2QQBA 3EFSA 4L6V5 2A7YA 3VKIA 4BI3A 3MP6A 4C0DB 5GAN3 3WVDB 2K5IA 3CCVA 2E65A 4HCZA 1S72T 1K9MU 3ME9A 2X4YA 4J6WA 2KMGA 1FX7A 5A0DA 3CCMA 2EYQA 3JCMc 1VQKT 3BG3A 1XQHA 2KQWA 3HKSA 2P4TA 3CD6A 3OSVA 3GLXA 4DOVA 4E7KA 1KC8U 4ZN1A 4MZMA 1YBYA 2L89A 3META 2EIFA 2RHXA 1H641 3DKMA 2EQJA 2MI6A 3BW1A 3VU3C 1Y96A 5LJ3e 3OYEA 4BE0A 2C06A 3G7ZA 4J6YA 4NS5A 3RERA 1OZ2A 3UDCA 3CXCS 5CKBA 3QBYA 4LDYA 4FT4A 2VC8A 3JCMP 3GF5A 1VQOT 3I56A 1RL2A 4Y91A 3I55A 2MAMA 5EJCA 3S3MA 2LC4A 3VKGA 1Q81C 2BIVA 2E6ZA 3NFCA 3CC2A 2QQAA 4KT0E 3V8KA 3CCSA 4RCBA 4CI0C 3L2VA 4Q5WA 3OYDA 4IUQA 5LJ3f 3NTKA 3OB9A 4DQ2A 4QQGA 3JCMJ 1KD1C 2CYZB 3J7AF 4M7DG 4BB7A 1VQPT 4RG8A 2E1HA 4OMFB 3RMQA 4M7AE 5LL6S 5KCOA 4IUPA 1QLBA 1W4SA 1UEBA 3LGLA 3UWNA 1VQ5A 1Y07A 4C92E 2EJ9A 3OW2A 1VQ7A 1U8RA 4PJOE 3HRTA 4XAXB 2BS3A 2EQUA 3CCJA 1K73U 2FL7A 2WSEE 2YHTA 3EAEA 2LCCA 2OTLT 4Y28E 2R5MA 2RI2A 3HPWA 4F7UF 3MEAA 3UT1A 2CKKA 5HK3A 1YJNA 5D6XA 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB0 B;  1AHJ B;  1PSF A;  2ZPB B;  2CZ0 B;  3X24 B;  3A8O B;  2PU9 B;  2ZCF B;  2PVG B;  3X20 B;  2CZ6 B;  3QYG B;  4FM4 B;  2O01 E;  1UGP B;  1UGS B;  1V29 B;  3A8L B;  3VYG B;  4ZGD B;  2DD4 B;  1PSE A;  2AHJ B;  2DXC B;  3WVE B;  1QP3 A;  2CZ7 B;  3A8H B;  5L8R E;  1UGR B;  2PVO B;  3QXE B;  1DJ7 B;  2ZZD A;  2ZPH B;  2PUK B;  3X28 B;  2PUO B;  2DXB B;  2D0Q B;  1JB0 E;  4ZGE B;  2DD4 A;  3X26 B;  2DD5 B;  4L6V 5;  3WVD B;  1GXI E;  2DPP B;  2QDY B;  3QZ5 B;  2ZPG B;  3LW5 E;  1UGQ B;  2WSC E;  1QP2 A;  4RKU E;  2ZPF B;  2ZPE B;  4ZGJ B;  2DXB A;  3HHT B;  4XK8 E;  3X25 B;  1IRE B;  3VYG A;  4OB2 B;  3QYH B;  2DXC A;  3VYH B;  2DD5 A;  2ZZD B;  4KT0 E;  4OB3 B;  3A8G B;  2CYZ B;  3A8M B;  2CZ1 B;  2PVD B;  3QZ9 B;  4OB1 B;  2WSF E;  2WSE E;  2ZPI B;  4Y28 E; 
#chains in the Genus database with same CATH topology
 2COY A;  2F2W A;  1IGQ A;  2L3R A;  4C8Q E;  1W2B P;  1Q95 G;  2MK5 A;  4DEX A;  3PO3 S;  4J83 A;  3X20 B;  4MDX A;  4BI4 A;  3JCM g;  4FM4 B;  4CRI A;  1C9B A;  4ROE A;  4LD9 K;  1EZZ B;  4AG1 C;  4HXJ A;  1NZ9 A;  5C6S A;  2X51 A;  3HTR A;  1C0M A;  3T9N A;  4ORZ A;  3GNG A;  1UDL A;  3OYJ A;  2HKN A;  3JCM W;  3MI9 B;  4BDZ A;  2QAZ A;  2J6O A;  5I21 A;  3CCE A;  1QVG A;  2DL5 A;  4HNV A;  4XTW A;  2PUK B;  1VQK A;  2DBM A;  3RIR A;  4XTZ A;  5EFQ B;  2EQK A;  2LCL A;  1ZUY A;  5EC7 A;  3VS6 A;  2V1R A;  3TEE A;  5GAN j;  3V8J A;  1GUX A;  4HT8 A;  3M0U A;  2FVU A;  4QVD A;  2GQI A;  5GJV B;  2VUB A;  1VQ7 Q;  2LX9 A;  2DRM A;  1D0Z A;  5CKE A;  4OP0 A;  3JB9 G;  3CXC P;  3QJY A;  3M53 A;  1M2O A;  2VXF A;  3UPU A;  1U1S A;  2ZGW A;  2ZPF B;  4ZGJ B;  4CFU D;  3CCS Q;  3PIP A;  1WLP B;  2EYY A;  3V7R A;  4DBF A;  2XG8 D;  2YLC A;  2XDP A;  3EFO B;  1PNJ A;  1N27 A;  1Y0M A;  4QKU A;  4M7D F;  1KIK A;  1Q7Y C;  1MMA A;  1U5S A;  2CP3 A;  5LJ5 e;  3BY7 A;  4NL3 A;  1WDX A;  4NOY A;  2A36 A;  1A0N B;  1WFW A;  3WXM B;  2FZK B;  3N5B B;  4N4G A;  3PE0 A;  4IKF A;  2Z0W A;  1CSK A;  3LQ5 B;  2CP2 A;  4XU0 A;  3MO8 A;  1FMV A;  4MIM A;  4YOZ A;  1Q82 R;  1KG1 A;  4JJD A;  2A37 A;  1WHH A;  1NEB A;  4C5E A;  2H3E B;  4M7A F;  1JXO A;  2CT3 A;  2EWN A;  3J81 E;  3QWL A;  3PIO A;  2KAF A;  2M1H A;  2FEI A;  3M0S A;  5ACB A;  4OMO A;  1UGP B;  2PK2 A;  1D3B A;  1BKB A;  3MEV A;  1M3C A;  1VQP Q;  4Y72 B;  1KC8 C;  3TW6 A;  4ZGD B;  2J6K A;  2L3Q A;  4C0D C;  2CGH A;  3BDU A;  3QWX X;  1YIT A;  3A8H B;  3H0I A;  1ZBX A;  2QA4 A;  2PVO B;  2EBP A;  1SG5 A;  2DK3 A;  2LZ6 B;  1D1B A;  3TN8 B;  4KGV B;  1AZG B;  2RJD A;  2RJF A;  5FU6 C;  5FLX E;  2D0Q B;  3LX7 A;  5A0L A;  4HL4 A;  2BUD A;  2CSQ A;  1KHC A;  1QWF A;  4C5I A;  5KYU A;  3PMI A;  4VUB A;  1ACM B;  2COW A;  4IUT A;  2RPN A;  2ZPG B;  4BBS M;  4MML A;  3FJ5 A;  4J9D A;  4RKU E;  3OYK A;  2FZC B;  3C94 A;  1IRE B;  2R58 A;  3H6Z A;  2CH4 A;  1QVP A;  1UE9 A;  1LPL A;  1D1C A;  3TSW A;  3KHI A;  3CC2 T;  4R0K A;  4ANJ A;  1GCP A;  2XHC A;  5GAN 6;  1FKM A;  2KYB A;  4J9I A;  1GUX B;  1RUW A;  5I2S A;  5KYW A;  3OYY A;  4BCK B;  4RTZ A;  3CCJ T;  2DLP A;  1AD6 A;  3OSS C;  1YIJ A;  1QQJ A;  2DJZ A;  2DZ9 A;  2P0K A;  5GMK h;  2NWM A;  4Z02 A;  1PSF A;  1WJR A;  2DXT A;  3CQT A;  5EG2 A;  3VS1 A;  3QDR B;  4OGR B;  4M78 A;  1YI2 T;  2LJ0 A;  3DDQ B;  4E47 A;  1JJ2 P;  4M78 G;  3MP8 A;  2O88 A;  5GAO m;  5I22 A;  3RGF B;  1H1S B;  1HD3 A;  3BLQ B;  2HQH A;  1VQ8 A;  5CYI B;  3CBO A;  1VQ6 A;  1QVF P;  5KYX A;  5LMK B;  3CCU T;  4M78 C;  4F7N B;  3FB9 A;  4JJC A;  2LVM A;  4PJO F;  2VYT A;  5CKH A;  4ZTJ A;  2KY9 A;  1H26 B;  2VGN A;  2E70 A;  5GAO q;  1OIU B;  1EIF A;  5HBE B;  4AKI A;  1IHV A;  4OMQ A;  1YP5 A;  1VQN A;  4KBM B;  4P5N A;  1GCQ A;  1WI7 A;  2O9S A;  1TD6 A;  1NG2 A;  1E6G A;  6AT1 B;  1BI1 A;  2JOY A;  4C0D B;  4AKH A;  3INZ A;  1H1R B;  5KYY B;  2C5X B;  1OX8 A;  3TNH B;  1OGU B;  4OVA A;  1RAB B;  2DPP B;  2QDY B;  2GBQ A;  4LUE A;  4XQ3 A;  1BK2 A;  4YC3 B;  3G6E A;  5GMK m;  3HB9 A;  1BI0 A;  2EFI A;  1D3B B;  2QYZ A;  1GCQ C;  2ZPE B;  2FG0 A;  5FU6 B;  1MGQ A;  2CUB A;  1YJW Q;  1B34 A;  2EKO A;  3R6N A;  3VYG A;  3OW2 P;  3EGU A;  4IIO A;  1VYV A;  2DXC A;  4M75 F;  3G4S Q;  2DD5 A;  1K8A C;  2QDJ A;  3CCV T;  3OYL A;  3QHR B;  5FW9 A;  2L3P A;  4FU6 A;  1OKV B;  3EGD A;  3EG3 A;  3CD6 T;  2CSI A;  3BLH B;  3SWN A;  1UUE A;  1K73 R;  4CRL B;  3EG0 A;  2JVV A;  3OYA A;  1VOM A;  4OB1 B;  2YUP A;  3PNW C;  3UA7 A;  2KXC A;  3GNF B;  4HNT A;  5LJ3 d;  3TQ7 P;  2FO0 A;  1JKW A;  1X6G A;  4HVV A;  2R7G A;  4DOW A;  4OB0 B;  2V8J A;  1NLO C;  5GAM e;  1UEC A;  2ZPB B;  4J8O A;  5M9O A;  1WQW A;  4EON B;  1G83 A;  1YWP A;  3CC2 Q;  3C95 A;  4JX4 A;  3JB9 D;  1RAC B;  1ZA2 B;  5HY6 A;  2PJQ A;  1RAH B;  2W99 A;  4J9H A;  2DD4 B;  3VV0 A;  1E7O A;  1VQ9 A;  2JNG A;  3C0C A;  3CCJ Q;  3EH2 A;  4O6J A;  1I81 A;  3QWY A;  1WHJ A;  5GAN f;  1Q86 U;  1NYG A;  3L2R A;  2C5O B;  2NUZ A;  1MUZ A;  1NM7 A;  3VS2 A;  3ZFJ A;  3KXT A;  2XK0 A;  1BU2 A;  1YI2 Q;  2QEX A;  3KFV A;  1TTH B;  4QT7 A;  3P8B B;  4XTU A;  3GPL A;  3BG9 A;  3E2U A;  1Q7Y R;  2HBW A;  4ZGE B;  1JQQ A;  2O4X A;  1JEG A;  4RTY A;  2RB6 A;  4LUD A;  2DMO A;  2VVK A;  3EFS A;  4BI3 A;  3VKI A;  2QTV A;  4KRD B;  4PJL A;  1S72 T;  4B6M A;  4CFW B;  3CCU Q;  4J6W A;  1AWO A;  1FX7 A;  2EYQ A;  3JCM c;  3BG3 A;  2E3I A;  2GNC A;  2P4T A;  3OSV A;  2RQW A;  2A08 A;  2JXB A;  2IVX A;  4MZM A;  4ZN1 A;  3DKM A;  2RHX A;  1H64 1;  2EQJ A;  2MI6 A;  3BW1 A;  8AT1 B;  3OYE A;  2I0N A;  3RER A;  3B57 A;  3UDC A;  5CKB A;  3QBY A;  3EG9 A;  1RL2 A;  5BNJ B;  2LC4 A;  3VKG A;  2E6Z A;  1O9K A;  1VQO Q;  3TNW B;  5D7U A;  4Q5W A;  4CC2 A;  3OB9 A;  3JCM J;  1ZSZ B;  3QHW B;  1R0B G;  5LL6 S;  4BCF B;  1UHC A;  1WX6 A;  1VQ7 A;  1F1B B;  1UNG D;  3VS3 A;  4GLM A;  3EAE A;  3REA B;  2LCC A;  4IIM A;  2YSQ A;  5D6X A;  2OX7 A;  3I9Q A;  2D9T A;  3JCM f;  4EOL B;  1X01 A;  3H4C A;  2CP6 A;  3REB B;  1FMK A;  1PD1 A;  4QQD A;  1P92 A;  3P8H A;  4N0A A;  5LJ3 h;  1I07 A;  5LJ5 d;  4J6X A;  1KQ2 A;  2KR3 A;  2K6D A;  2CP5 A;  1NBE B;  3CD6 Q;  2F2C A;  3VYG B;  5GJW B;  1LNX A;  3HSB A;  4F6W B;  3CC4 A;  3JCM Q;  2DXC B;  5A0G A;  3CEY A;  2DET A;  1WA7 A;  4N0A C;  1JXM A;  1WHM A;  2NUT B;  3Q1J A;  4J7I A;  2XI9 A;  4XU3 A;  1OPK A;  1IB8 A;  3PMT A;  1YJ9 T;  4JRK A;  3ZL7 C;  3CMA A;  1OU8 A;  2IIM A;  3JCM b;  2CUD A;  1ABO A;  1GFD A;  5DLQ E;  1W98 B;  1YCY A;  1M1K C;  2LQK A;  2FZG B;  4AFS C;  2I40 B;  1TOV A;  3O0G D;  1YNZ A;  4OGE A;  3LH0 A;  4D8D A;  2LQW A;  2KT1 A;  3UA6 A;  4EC9 B;  1VQP A;  2J6F A;  1AVZ C;  4M78 D;  2KK4 A;  4R56 A;  1RAD B;  2Y90 A;  4EMG A;  4JRP A;  5HVY B;  2EYZ A;  2JUF A;  1NPP A;  2AKK A;  1VUB A;  4OF1 A;  4BE2 A;  2MWP A;  3CME T;  2DER A;  1AWX A;  4ROC A;  1PKD B;  4ROD A;  4LXC A;  3FC3 A;  3A8G B;  1G8X A;  2PQW A;  3O8V A;  2OTJ T;  3E9F A;  2BPM B;  3R6O A;  4FYY B;  5HK0 A;  2VXE A;  5FU7 C;  1VQ4 Q;  2O4X B;  3DLM A;  3M0Q A;  1K0X A;  3MIA B;  5LJ3 j;  4JZ3 A;  1NE8 A;  2DXU A;  2RQR A;  3RDV A;  2AK5 A;  3DL1 A;  3HFN A;  2LDM A;  2P4R A;  3L2Q A;  3RNJ A;  3MCA B;  4F6S B;  3A1P A;  4A4F A;  1PD0 A;  2EKH A;  2EQI A;  3GIB A;  3X24 B;  2AIR B;  4B9X A;  4FW2 A;  5GAN 2;  1HK9 A;  1E9H B;  3QYG B;  3CCL T;  2ESW A;  3OS2 A;  4D6W A;  2O01 E;  2LMJ A;  4N4I A;  2O9V A;  5DM7 R;  2JS0 A;  2EW3 A;  2X4J A;  2K7A A;  5HQ0 B;  4EOP B;  5LJ5 h;  1G3W A;  2HD0 A;  2J05 A;  3OYC A;  3FLG A;  3OYI A;  3M55 A;  2KE9 A;  3NHN A;  3I5S A;  2C5N B;  2QI2 A;  4PLL A;  4IUR A;  1JSU B;  2DL4 A;  3JV3 A;  2IPO B;  2KEA A;  1T3S A;  5CEI B;  1UJY A;  2JT4 A;  3PT9 A;  4JX6 A;  1Z9Q A;  2JZ2 A;  1KK7 A;  1K8A R;  3O5Z A;  4M77 F;  1K73 C;  1TUC A;  1JU5 C;  3MP1 A;  1MMG A;  1GXI E;  1MV0 B;  1X6B A;  1O9S A;  3VS7 A;  2P0P A;  2LP5 A;  3M0R A;  4J5Y A;  3CCM T;  4M4Z A;  2HCK A;  4TTH A;  3S3O A;  2MYS A;  3VKH A;  5D6W A;  1VIN A;  3H8Z A;  1RAI B;  1K1Z A;  4F70 B;  4CC3 A;  3DB4 A;  1M3A A;  3HHT B;  2CJM B;  2EJG A;  3KBG A;  2WMA B;  4UC4 A;  1YJ9 Q;  1O75 A;  3OYM A;  1YWO A;  2J7I A;  4F7U A;  5IXF A;  1ZUK A;  3FIF A;  1JST B;  3FRN A;  4F7U G;  4YOO A;  3VUZ A;  2EYW A;  4F16 A;  3JB9 H;  4OB3 B;  3OYF A;  5GAN 4;  3CBM A;  4LDU A;  5GAN e;  1K0S A;  1PHT A;  4D8K A;  2JTF A;  1HYO A;  2RHU A;  3SB2 A;  4M78 E;  1NYF A;  3QZ9 B;  2ED0 A;  2OI3 A;  2OTL A;  2JTE A;  4EOQ B;  1AZE A;  2K2M A;  4BY6 C;  5KH6 A;  3CC7 A;  2RQU A;  2ZCF B;  1SHF A;  2QG9 B;  8ATC B;  2HMA A;  5LJ5 j;  2RI5 A;  1N9R A;  1SSF A;  3CME Q;  1W70 A;  4XTV A;  1V29 B;  2L5Q A;  2OTJ Q;  1NEG A;  1SRM A;  5FU7 B;  2GFU A;  2CP7 A;  4ESR A;  1B3Q A;  4F6U B;  4BE1 A;  1Q81 U;  1G3Y A;  2CZ7 B;  1KJW A;  2V1Q A;  2VGM A;  2E12 A;  3CCE T;  1KD1 U;  4C92 F;  3CCQ Q;  2XDB A;  4MZT A;  1DJ7 B;  5GAM d;  2GQV A;  5GAN 5;  4LDW A;  5KCH A;  1X75 C;  3CPW S;  1F5Q B;  2ABL A;  3A5Z B;  3G71 A;  3CCL Q;  1KQS S;  4C8Q F;  4UN0 A;  1R0C B;  4PFP A;  4AFU C;  4LNP A;  2BZ8 A;  2HQE A;  2HSP A;  1OQK A;  1VIF A;  1Y57 A;  2AZV A;  1VIE A;  2RQT A;  5CVI A;  2HBP A;  3H9N A;  4M7D A;  3JCM e;  2COZ A;  4ME7 A;  3ZBD A;  4X9D A;  2V8K A;  1QP2 A;  1N8R U;  1R8O B;  2C0I A;  1T0H A;  4HVW A;  4KGZ B;  2YLB A;  1RI9 A;  4RCC A;  1YJW T;  2DYI A;  4FYV B;  4IUU A;  3TRE A;  1OU9 A;  1VQM T;  2RO0 A;  2GTO A;  3G4S T;  1PRM C;  3GBQ A;  1NLP C;  1WQ7 A;  4M7D C;  2LCS A;  3BHV B;  1XJW B;  4FW1 A;  3OS5 A;  1HSQ A;  3M56 A;  3FJP A;  1JO8 A;  3BHT B;  4G6L B;  2BZY A;  2DYB A;  1YCS B;  4IUV A;  3DDP B;  1C6V X;  4X1V A;  4N4H A;  3CCM Q;  4TVR A;  1I8F A;  2P84 A;  2F69 A;  2V22 B;  2EUF A;  1RI0 A;  3LGF A;  2UZD B;  1N4M A;  2K4Y A;  3RMS A;  2DKG A;  1H1Q B;  1IO6 A;  2LQ8 A;  4HVU A;  3TCJ A;  4L5G A;  2OJ2 A;  4X9C A;  4EOR B;  3UAT A;  1I5O B;  1M4Z A;  3JSC A;  1BIB A;  4Z88 A;  3JCM V;  2SRC A;  3QYE A;  2K3Y A;  4XU1 A;  1VQ5 T;  2LW4 A;  3OYH A;  1M1K R;  5I2M A;  1YJN T;  1NJI U;  4F7U B;  4ELJ A;  5CCA A;  5L2W B;  2IG0 A;  1R77 A;  2QA4 T;  2DME A;  3VRY A;  1T0J A;  4ELZ C;  2KRO A;  1XNI A;  4O5V A;  4AI6 A;  2EAY A;  1FVV B;  2W96 A;  4OMM A;  2EJF A;  4J7F A;  1UNL D;  1VA7 A;  1TUD A;  3I5R A;  4F04 B;  2BS4 A;  5HBH B;  3BDL A;  2E10 A;  5GAM h;  3JB9 J;  1JB0 E;  2DTO A;  1S1N A;  2RJE A;  2WJ9 A;  3HO8 A;  3SDZ A;  1EX4 A;  2PZ1 A;  4A4K A;  1H28 B;  2K5I A;  2X1N B;  3NDQ A;  3CCV A;  2LNH B;  1K9M U;  3ME9 A;  2KMG A;  2DFU A;  1WYX A;  3CCE Q;  1XQH A;  2KQW A;  1I1J A;  3CD6 A;  3GLX A;  4F7S B;  2JMA A;  4RTU A;  4F14 A;  1D0Y A;  3VU3 C;  1Y96 A;  1E6H A;  1M2V A;  3G7Z A;  1PRL C;  4CC4 B;  3H0H A;  4FT4 A;  1VQO T;  3I56 A;  3I55 A;  4KT0 E;  3TSZ A;  2LJ3 A;  4CI0 C;  4WCI A;  5LJ3 f;  2A0F B;  3NTK A;  4QQG A;  3J7A F;  1ABQ A;  2KT8 A;  4BB7 A;  4RG8 A;  4OMF B;  3RMQ A;  1OL2 B;  1W4S A;  3UWN A;  1Y07 A;  1V1C A;  1CKB A;  2YHT A;  2CCH B;  3HPW A;  1H24 B;  2CKK A;  1ZX6 A;  5IAY A;  1VQM Q;  1OEB A;  4WF2 A;  1UB4 A;  2PU9 B;  4PJM A;  2R57 A;  5IHN A;  3OYG A;  2DE0 X;  4PJO A;  2QDL A;  4OR5 B;  4PJO G;  5GMK j;  3EG1 A;  3RKX A;  4V2S A;  1X27 A;  2RHY A;  4GY5 A;  1MNE A;  4GBQ A;  3VJP A;  4LN2 A;  3JB9 I;  5KYU B;  4F7L B;  3RR6 A;  4PJO C;  4JJN K;  5GAM j;  4R55 A;  2D6F A;  1S72 A;  2ZZD A;  2OAU A;  3SWN C;  1VQL A;  1QMC A;  7AT1 B;  2GCX A;  2HDA A;  3HL8 A;  4KRT A;  1QVG P;  3CPW A;  3EHR A;  5CK9 A;  2FPD A;  1RLP C;  5DLO A;  3LWH A;  2BKD N;  2H8H A;  1KQS A;  2LTO A;  1VQ5 Q;  3QKJ A;  1I0C A;  1LJO A;  4EMK A;  4A4H A;  1YJN Q;  3H41 A;  9ATC B;  2WEV B;  1BI2 A;  1WJS A;  4JX5 A;  3ER0 A;  4M75 A;  4E7J A;  4X34 A;  3QZ5 B;  1I4K 1;  1N9S A;  4M75 G;  4LOC A;  1M8V A;  2HEQ A;  2QA4 Q;  4HT9 A;  4DBH A;  3OW2 S;  3D7S B;  3OBY A;  5KYW B;  3AHU A;  1KFZ A;  3MJX A;  2DXB A;  2DVJ A;  4KRC B;  4EMK C;  4JUV A;  4M75 C;  2QFZ A;  2O31 A;  1Q82 U;  3SEM A;  2XIC A;  4M78 B;  1Q86 C;  1QW1 A;  2FPE A;  2K5F A;  4BCM D;  3GP8 A;  2RHI A;  5GAO r;  1VQ4 T;  3BLR B;  4AMC A;  4RG2 A;  2MPX C;  3QUI A;  4OMP A;  4HCB A;  2FYK A;  3FDR A;  2WSF E;  4K11 A;  4RTX A;  4BD3 A;  5LJ5 f;  5KYX B;  2XD0 A;  2LT1 A;  2LT4 A;  1X69 A;  4A4E A;  3A8O B;  3VS4 A;  2VWF A;  1XTD A;  2WIH B;  4E7Z A;  1IXD A;  2NUP A;  2CZ6 B;  3L1A A;  4M7D D;  4AFZ C;  1FWZ A;  1UGS B;  1VYT A;  1WXT A;  3OMG A;  3JAM E;  1Y96 B;  1YJ9 A;  1M2V B;  2DVE A;  5J3B A;  3M4Y A;  1PC0 A;  5LJ3 g;  2X3X D;  2PNI A;  2HAX A;  5CKF A;  1M5Q 1;  2QGF B;  2NLU A;  1UGR B;  5CO7 A;  2XDD A;  2EYX A;  3SHW A;  4QVC A;  4KH0 B;  2DIG A;  2J06 A;  4II1 A;  3CCS A;  1BU1 A;  2DTI A;  3QII A;  1QMZ B;  2AKL A;  1B34 B;  2CP0 A;  2SEM A;  1M90 U;  2VAS A;  4CFV B;  4BCN D;  3X26 B;  2DD5 B;  1GFC A;  4KUD K;  1H3H A;  3VS0 A;  2KRM A;  4KUL A;  3G33 B;  2C6T B;  1AD5 A;  1SKU B;  4M6V A;  4FSX A;  5CIU A;  4F7U E;  3EGD B;  4YTL A;  3SWN B;  3L42 A;  1FYN A;  3L2W A;  4C5H A;  4CXA B;  2OTJ A;  4EOS B;  4JS5 A;  5GMK i;  1U1T A;  4EOJ B;  3HP9 A;  4A4G A;  3OYN A;  4Z89 A;  2C0O A;  3C12 A;  3MKD A;  4RTT A;  3QDF A;  1VQN Q;  4J9E A;  2M9U A;  1M3B A;  1UJ0 A;  1ENW A;  1TG0 A;  2RJC A;  2BKZ B;  4JRQ A;  3POM A;  3OY9 A;  3QPH A;  4RMO A;  4E7H A;  2KVQ G;  2ZZD B;  1W6X A;  1MMN A;  2K5L A;  3TVT A;  2BTT A;  4EPC A;  3EFR A;  3CCL A;  1BCM A;  2K3X A;  2K9G A;  1TWB A;  2JJ9 A;  4QW2 A;  4XTY A;  3URG A;  3MY5 B;  3L2U A;  1TSF A;  3KUF A;  1D3U B;  2HKQ B;  4A63 B;  2M02 A;  2PMI B;  3MPU B;  2ZPI B;  1OUL A;  3OS1 A;  5IHK A;  4PJN A;  2W9Z A;  1M27 C;  1RAG B;  3OS0 A;  2LX7 A;  4M75 B;  2IW9 B;  4BBR M;  1GBQ A;  1QWE A;  1X2Q A;  5CKD A;  5HBJ B;  1M1F A;  2GFA A;  2GGR A;  3NTH A;  1V76 A;  2PVG B;  5I11 A;  1QCN A;  2LJ1 A;  4QQ6 A;  3PFS A;  2P0Q A;  1UTI A;  5CAI A;  1TU0 B;  2YUQ A;  4FCY A;  2HSE B;  5GMK l;  1Y71 A;  1IZ6 A;  2YRV A;  4BCH B;  3CC4 T;  5IT9 E;  1YHQ T;  5HNB B;  2KNB B;  3WVE B;  2RK2 A;  4FYW B;  3CCQ T;  4E7L A;  5GAN h;  1HXD A;  3BE3 A;  1U06 A;  3K7A M;  2DEQ A;  1J3T A;  4II5 B;  3RKY A;  2HNI A;  3VUB A;  2ZPH B;  5LJ5 g;  2CH4 W;  3CBP A;  1I5L A;  2R5A A;  2C4G B;  2CDT A;  2M0O A;  4PKC C;  3ULR B;  4M7D E;  1WNL A;  2B8A A;  3CMA T;  1PKS A;  2H3J A;  3THK A;  2F5K A;  1JRI A;  3RES A;  2W0Z A;  2HL5 C;  5DY9 A;  4DEY A;  3CCR T;  4QVZ A;  2QK0 A;  3EG9 B;  2G9X B;  2QF7 A;  2E64 A;  3M9Q A;  2BS2 A;  3V8K A;  5D6Y A;  1FIN B;  2B9R A;  4EDU A;  2WHB B;  2UZE B;  1O9K B;  3MEU A;  2CCI B;  4FYX B;  3H0F A;  1SPK A;  2NUP B;  2WSC E;  2PK9 B;  1MV3 A;  2LQN A;  2QQS A;  3M0P A;  4LE9 A;  1EFN A;  5IN1 A;  4PJO D;  2DZC A;  2DRK A;  4XK8 E;  4DBR A;  2DA9 A;  2IW6 B;  4ZTF A;  5IHI A;  2D1X A;  1OL1 B;  5J26 A;  2EQM A;  3EG2 A;  1H8K A;  4OB2 B;  3QYH B;  3JB9 F;  2JMC A;  1GY3 B;  2WPA B;  1KQ1 A;  2D8H A;  1OIY B;  5I5Z B;  1C1A A;  1TUG B;  3A8M B;  1OPL A;  2GTJ A;  3LYI A;  5AYF A;  2V8I A;  4Z8A A;  3M54 A;  2RF0 A;  5GAO n;  3NMZ C;  1Z9Z A;  1QKX A;  1JBM A;  5IDP B;  3JCM h;  1YFN A;  2DBK A;  4L59 A;  4ELY C;  4Z6Y A;  4EMH A;  2CZ0 B;  2MOX A;  3F70 A;  3OYB A;  2FB7 A;  1B7T A;  3VS5 A;  1QCF A;  4M75 D;  1WGS A;  3EHQ A;  3SD4 A;  4JLG A;  4BY1 X;  1ZBJ A;  5GAM f;  1W2B S;  3CPW P;  2CT4 A;  2L3S A;  4E2F B;  1PSE A;  1Y7X A;  1QP3 A;  1Q7Y U;  3TU4 K;  1KQS P;  4M77 A;  1VOL A;  1OI9 B;  4NC6 A;  2FRW A;  4M77 G;  2ENM A;  3M59 A;  3HRU A;  4JS4 A;  5C0M A;  3C4S A;  3QO3 A;  1IGU A;  1BB9 A;  5IXB A;  1QKW A;  1YJW A;  1IHW A;  3NGP A;  1VQM A;  2YRD A;  1H92 A;  4M77 C;  4E7S A;  2MCN A;  3G4S A;  3LLR A;  1Q86 R;  2WIP B;  1OZ3 A;  2QQB A;  2AT1 B;  3CC4 Q;  2A7Y A;  5GAN 3;  3MP6 A;  1GH6 B;  2KRN A;  2A28 A;  4J9B A;  1YHQ Q;  4HCZ A;  4NST B;  2KRS A;  1H1P B;  4WTO B;  2X4Y A;  5A0D A;  1VQK T;  5IHY A;  2B86 A;  4E7K A;  1KC8 U;  1AWJ A;  3U23 A;  2L89 A;  3MET A;  3DLL A;  2EIF A;  1D09 B;  4BE0 A;  4NS5 A;  3CMA Q;  5FGK B;  3CXC S;  2RMO A;  4LDY A;  1SSH A;  2V26 A;  3GF5 A;  4Y91 A;  5KYY A;  3RBB B;  3S3M A;  3CCR Q;  1Q81 C;  2BIV A;  1SF9 A;  3CC2 A;  2QQA A;  2YUO A;  1ZSG A;  4BCG B;  3L2V A;  1WXU A;  4IUQ A;  1KD1 C;  4M7D G;  3GTM S;  1LCK A;  2E1H A;  4CC7 A;  4IUP A;  4I3Z B;  1UEB A;  1X43 A;  1VQ5 A;  2EJ9 A;  4BCO B;  4PJO E;  3CCJ A;  2E3H A;  2FL7 A;  2WSE E;  2OTL T;  4Y28 E;  2C06 A;  1YJN A;  5HK3 A;  3MEA A;  3UT1 A;  2RNA A;  5A2Q E;  3CC7 T;  3SFM A;  4KH1 B;  4M7A A;  5IH2 A;  4FIB A;  2YT6 A;  4C92 A;  4M7A G;  4MMK A;  3P8D A;  2A3L A;  4BCJ B;  1YI2 A;  4C92 G;  4C0G A;  4XTX A;  4MFD A;  1N8R C;  4MZP A;  4EC8 B;  3MEW A;  1ZLM A;  4HKE A;  4BUG A;  4C8Q A;  1KSW A;  4PL6 A;  2X4W A;  4C8Q G;  2K2V A;  4BCP B;  4ZNX A;  4M7A C;  3MHX A;  2D8J A;  4CFX B;  4C92 C;  3J80 E;  2DL3 A;  3CCU A;  4M78 F;  3OA6 A;  1X6O A;  5LQF B;  4LDV A;  1ZQ1 A;  2E6N A;  2I2L A;  4A53 A;  2K79 A;  4EIK A;  3G71 T;  3OMC A;  2XU8 A;  3EJ1 B;  1FXX A;  3V7S A;  4M75 E;  2RN8 A;  4C8Q C;  1K9A A;  4BI8 B;  1M90 R;  3EID B;  4PLI A;  1M8M A;  2QAS A;  1OOT A;  4B9W A;  2Y4Y A;  1URC B;  2DD4 A;  3BG5 A;  2XID A;  1YIT T;  1VQO A;  5GAM g;  2YWW A;  4BY6 B;  1E7P A;  2FRY A;  3F5X B;  1JOW A;  2MMP A;  4EOK B;  2RI3 A;  5GAO p;  2QQ8 A;  2RHZ A;  1GRI A;  1G3S A;  1OYX A;  1XOV A;  2OAW A;  1KXU A;  3GOX A;  1AWW A;  1D0X A;  1P5E B;  2E4H A;  4MDW A;  2C5V B;  3LWI A;  4M77 B;  1TFB A;  3HZJ A;  2YRC A;  1NJI C;  3HFO A;  5FRM A;  3VYH B;  3OQ5 A;  1M1G A;  1WZO A;  2JTM A;  1BI3 A;  5DQV A;  3V7C A;  1ZHI A;  4OML A;  2ECZ A;  2UUE B;  4BAC A;  1VQK Q;  1UNH D;  3HRS A;  4DBQ A;  4C0F A;  2KGT A;  2PHG A;  3IQL A;  2WMB B;  4OGC A;  3NTI A;  2BE9 B;  4BCM B;  4PFO A;  1QLY A;  5KE3 A;  3JCM X;  5J39 A;  1AHJ B;  1AT1 B;  2QGS A;  2X3W D;  4J9G A;  1FMW A;  1KHI A;  4NL2 A;  2F2V A;  2KMT A;  3V8L A;  1SRL A;  1K9M C;  1PWT A;  2NYS A;  2QQR A;  3PVQ A;  1WHK A;  1ZSZ A;  3A8L B;  4HNU A;  1MND A;  3E9G A;  1NPR A;  2DL8 A;  2MF2 A;  2E5Q A;  1YIJ T;  2KSS A;  4F7J B;  2M16 A;  2DJQ A;  1W2B A;  2EGC A;  2AHJ B;  3RKW A;  1K8A U;  1GBR A;  1WHG A;  3JRZ A;  3QJ6 A;  1JJ2 S;  5ECA A;  3DJB A;  1ZUU A;  2OTL Q;  4CFN B;  4M7D B;  1OV3 A;  2CRE A;  4FT2 A;  2DEU A;  1H3Z A;  4AT1 B;  2VKN A;  2BE7 D;  5FWC A;  3CC7 Q;  1ARK A;  1ZSZ C;  2VB6 A;  4EOO B;  3QHS A;  1PKT A;  1N5Z A;  4JZ4 A;  5FRO A;  4PK4 A;  4JRI A;  4HLQ A;  2EGE A;  1QVF S;  2LRQ A;  1WHL A;  1UHF A;  1VQ8 T;  1IRX A;  5FRN A;  1HJD A;  2RK1 A;  1VQ6 T;  1ZP2 A;  4M7A B;  2L8D A;  2DF6 A;  2NUT A;  4C92 B;  2G6F X;  1UGQ B;  1OI1 A;  5GMK e;  3UF4 A;  1TH7 A;  1BIA A;  3BHU B;  1VQ4 A;  4BCN B;  3PTA A;  4XU2 A;  4C8Q B;  2EVR A;  2K3B A;  3G71 Q;  1VQN T;  1MMD A;  3S3N A;  3X25 B;  4KUI A;  1U3O A;  3E1S A;  2D0N A;  4A54 A;  2YDL A;  3I56 T;  5CQX A;  5DQW A;  3I55 T;  4Y92 A;  1TS9 A;  3DTO A;  3CXC A;  2F2X A;  3VRZ A;  3G1J A;  4DA4 A;  1YIT Q;  3G6E T;  1TXQ A;  2ED1 A;  4JPB W;  3TNI B;  2E41 A;  4M77 D;  4PJJ A;  2RA2 A;  1VYU A;  4HCK A;  1G2B A;  4QSH A;  2DNU A;  2QTX A;  2UZB B;  4FSS A;  1X2K A;  4BXX X;  2DO3 A;  4ZN3 A;  2K57 A;  2QQ9 A;  2CZ1 B;  2WFY B;  2PVD B;  1WJQ A;  3TW7 A;  3E19 A;  2KBT A;  2L0A A;  2YXY A;  2DL7 A;  2JM9 A;  2W2H A;  1G3T A;  4MFE A;  2RQV A;  2FPF A;  4C0Z A;  3S6W A;  1W1F A;  3M4G A;  2ROT A;  1UGV A;  4KGX B;  2M0Y A;  4EOI B;  4C5G A;  5KE2 A;  4CFM B;  3EGX A;  1GL5 A;  2HQX A;  3QG1 A;  4PFZ A;  5CQY A;  4JLI A;  2WAC A;  4FL6 A;  1N6A A;  5HKC A;  1QVG S;  2AZS A;  5L8R E;  1Q82 C;  3A98 A;  1VQL T;  2Y4X A;  4AKG A;  2F1L A;  5GAN 7;  2F5T X;  3EOC B;  3BFM A;  1AIS B;  3X28 B;  1YN8 A;  2PUO B;  4RTW A;  2UZL B;  1RAF B;  2X4X A;  5IDN B;  2IVW A;  5GAN d;  1SEM A;  1H27 B;  1Q81 R;  1VQ9 T;  5HCK A;  3ZEH A;  4JDS A;  3QYB A;  2GF7 A;  1KD1 R;  3M57 A;  1YIJ Q;  1OX9 A;  2DAQ A;  3MY1 B;  2EGA A;  2G3R A;  3LW5 E;  2KDS A;  4E6R A;  3PVL A;  2RH2 A;  4OMN A;  1KC8 R;  2CS7 A;  3M58 A;  4BY7 X;  2XMF A;  4M7A D;  4LDX A;  3PGG A;  2QEX T;  4BDY A;  4C92 D;  3CPF A;  3DB3 A;  4E7I A;  2DIQ A;  4BCQ B;  1RAE B;  4ELL A;  4FX3 B;  1VQ8 Q;  4C8Q D;  1UFF A;  2HZY A;  2X35 A;  3LH5 A;  1LVK A;  1VQ6 Q;  2KR6 A;  1PM3 A;  1N8R R;  2I53 A;  5KYN A;  4YOS A;  5GAN 8;  2KXD A;  2L2P A;  4PJO B;  3CME A;  3CCV Q;  4JJB A;  2E5K A;  3EH1 A;  3FEO A;  1M9S A;  1BCO A;  2QXF A;  4RTV A;  1MHN A;  4PNO A;  1LOJ A;  3HBL A;  3NPF A;  2YUN A;  4BCI B;  1PCX A;  1M1K U;  1UG1 A;  4F17 A;  2DTH A;  1YHQ A;  4HA8 A;  5GAO l;  1M90 C;  4AFQ C;  3CCQ A;  3DOG B;  1WXB A;  3I56 Q;  2IN3 A;  3I55 Q;  1XO2 A;  2C0T A;  3OBW A;  2JM8 A;  4M77 E;  4LD6 A;  2QGG A;  3JCM d;  3G6E Q;  2KYM A;  1VQ7 T;  2LNV A;  2JS2 A;  4GLK A;  5L23 A;  2JGZ B;  3M5A A;  4AG2 C;  2WXV B;  3ASK A;  4EMK B;  3QSU A;  2DIL A;  3CCR A;  4RUG A;  2IW8 B;  2VV5 A;  2G77 A;  2ZAE A;  1T3L A;  1RAA B;  3EFO A;  1QCO A;  3L2Z A;  1JJ2 A;  2JN0 A;  5AT1 B;  3QXE B;  1WPY A;  5FWB A;  4HCC A;  2RD1 A;  5IF1 B;  2KI7 A;  5CR2 A;  2O2O A;  2RM4 A;  3RUX A;  2MWO A;  1H4L D;  5GAN g;  3CCS T;  1G5V A;  2X9H A;  2DXB B;  1NJI R;  2HL3 A;  4ATO A;  1QVF A;  2EPD A;  2FHD A;  2ATC B;  1AEY A;  1ZA1 B;  2M51 A;  3M03 A;  2XKO C;  2ROL A;  2DX1 A;  1PG5 B;  4L6V 5;  3WVD B;  1SHG A;  4J9F A;  2E65 A;  4CFU B;  3I35 A;  2W9F A;  1K76 A;  3EGX B;  4EOM B;  3CCM A;  1OKW B;  1S72 Q;  3HKS A;  1WIE A;  1VQL Q;  1D1A A;  2MIO A;  4DOV A;  1VYW B;  1B07 A;  1YBY A;  1AOJ A;  5LJ3 e;  2W10 A;  5ICP B;  4J6Y A;  1M30 A;  1OZ2 A;  4J9C A;  2VC8 A;  3JCM P;  1K9M R;  2MAM A;  5EJC A;  1VQ9 Q;  3NFC A;  1H25 B;  1CKA A;  4RCB A;  1BYM A;  4BCQ D;  3OYD A;  4DQ2 A;  2DM1 A;  3AT1 B;  2CYZ B;  1VQP T;  1BBZ A;  4IMY B;  4M7A E;  5KCO A;  1QLB A;  3M0T A;  3LGL A;  4C92 E;  3OW2 A;  1RLQ C;  1U8R A;  3HRT A;  4XAX B;  2BS3 A;  2EQU A;  2PTK A;  1K73 U;  2QEX Q;  1K4U S;  2JW4 A;  2R5M A;  2RI2 A;  4F7U F;  2BZX A;  1G3N C; 
#chains in the Genus database with same CATH homology
 5IAY A;  5A2Q E;  1X01 A;  3H4C A;  3CC7 T;  2L3R A;  4WF2 A;  4C8Q E;  3SFM A;  4QQD A;  1P92 A;  4M7A A;  3P8H A;  1VQL T;  4N0A A;  4FIB A;  1UB4 A;  2PU9 B;  4J83 A;  2R57 A;  3X20 B;  4C92 A;  4M7A G;  4MMK A;  3OYG A;  3P8D A;  5LJ3 h;  3JCM f;  4BI4 A;  3JCM g;  3QSU A;  4FM4 B;  2A3L A;  4MDX A;  5LJ5 d;  4J6X A;  1YI2 A;  4PJO A;  4C92 G;  4C0G A;  4XTX A;  4CRI A;  4PJO G;  4LD9 K;  1KQ2 A;  4MFD A;  5GMK j;  1N8R C;  4MZP A;  1NZ9 A;  3RKX A;  3MEW A;  4HKE A;  5C6S A;  4V2S A;  2RHY A;  4BUG A;  4C8Q A;  4GY5 A;  3VYG B;  1LNX A;  4PL6 A;  3VJP A;  2X4W A;  3HSB A;  4C8Q G;  3CC4 A;  2K2V A;  3JCM Q;  2DXC B;  3JB9 I;  3T9N A;  5A0G A;  3GNG A;  3CEY A;  3MHX A;  4M7A C;  3OYJ A;  4N0A C;  3JCM W;  4C92 C;  3J80 E;  4BDZ A;  3Q1J A;  3CCU A;  4J7I A;  4PJO C;  4M78 F;  5I21 A;  1X6O A;  4LDV A;  2XI9 A;  5GAM j;  4XU3 A;  4R55 A;  3OA6 A;  4JJN K;  1ZQ1 A;  2ZZD A;  2E6N A;  2I2L A;  3CCE A;  1S72 A;  1QVG A;  4HNV A;  2OAU A;  3SWN C;  4A53 A;  4XTW A;  1VQL A;  2PUK B;  3G71 T;  1VQK A;  3OMC A;  3RIR A;  2XU8 A;  1FXX A;  4XTZ A;  3V7S A;  2EQK A;  2GCX A;  3PMT A;  3HL8 A;  2LCL A;  4M75 E;  4C8Q C;  3CPW A;  4BI8 B;  1YJ9 T;  4JRK A;  3TEE A;  5GAN j;  3V8J A;  4PLI A;  5CK9 A;  3CMA A;  5DLO A;  3LWH A;  4HT8 A;  2BKD N;  2FVU A;  4B9W A;  4QVD A;  2Y4Y A;  2LTO A;  1KQS A;  3JCM b;  2VUB A;  3QKJ A;  1LJO A;  3BG5 A;  2DD4 A;  2LX9 A;  2XID A;  4EMK A;  5DLQ E;  1YIT T;  1YCY A;  4A4H A;  1VQO A;  1M1K C;  2LQK A;  5CKE A;  1BI2 A;  4M75 A;  1WJS A;  4JX5 A;  3ER0 A;  4OP0 A;  4E7J A;  4X34 A;  5GAM g;  4BY6 B;  3QZ5 B;  3JB9 G;  1I4K 1;  1N9S A;  4M75 G;  4LOC A;  3QJY A;  1M8V A;  3M53 A;  1E7P A;  4HT9 A;  4OGE A;  3LH0 A;  2VXF A;  2MMP A;  3OW2 S;  3UPU A;  1VQP A;  3OBY A;  1U1S A;  2RI3 A;  5GAO p;  2QQ8 A;  2RHZ A;  2ZGW A;  2ZPF B;  3AHU A;  1G3S A;  4M78 D;  2KK4 A;  4ZGJ B;  1OYX A;  4R56 A;  2DXB A;  1XOV A;  4EMK C;  2Y90 A;  4EMG A;  3GOX A;  3PIP A;  4JRP A;  3V7R A;  2XG8 D;  4JUV A;  2YLC A;  4MDW A;  3LWI A;  4M77 B;  2JUF A;  2XDP A;  4M75 C;  3HZJ A;  2QFZ A;  1NJI C;  1Q82 U;  1N27 A;  3HFO A;  5FRM A;  3VYH B;  1NPP A;  4M7D F;  1VUB A;  3OQ5 A;  4OF1 A;  4BE2 A;  1Q7Y C;  2XIC A;  2MWP A;  5LJ5 e;  4M78 B;  3BY7 A;  1M1G A;  4NL3 A;  3CME T;  2JTM A;  1BI3 A;  1Q86 C;  3FC3 A;  1QW1 A;  3A8G B;  2K5F A;  2PQW A;  1ZHI A;  4NOY A;  3O8V A;  3V7C A;  3GP8 A;  2RHI A;  3WXM B;  5GAO r;  2OTJ T;  4BAC A;  3E9F A;  1VQ4 T;  3N5B B;  3R6O A;  4N4G A;  4IKF A;  4RG2 A;  3HRS A;  3QUI A;  5HK0 A;  4HCB A;  2FYK A;  2VXE A;  5FU7 C;  3FDR A;  4C0F A;  2O4X B;  3DLM A;  3MO8 A;  4XU0 A;  2WSF E;  4MIM A;  4BD3 A;  5LJ3 j;  5LJ5 f;  1KG1 A;  1NE8 A;  2DXU A;  2XD0 A;  2LT1 A;  4C5E A;  4OGC A;  3DL1 A;  3NTI A;  3HFN A;  5KE3 A;  4M7A F;  2LDM A;  3JCM X;  5J39 A;  2EWN A;  3L2Q A;  1AHJ B;  2LT4 A;  3MCA B;  4A4F A;  4A4E A;  3J81 E;  3QWL A;  3X24 B;  3GIB A;  3A8O B;  4B9X A;  1KHI A;  1XTD A;  5GAN 2;  3PIO A;  4NL2 A;  2KAF A;  2CZ6 B;  1HK9 A;  3QYG B;  3CCL T;  2M1H A;  2KMT A;  3V8L A;  3OS2 A;  1K9M C;  3L1A A;  4D6W A;  2O01 E;  4M7D D;  1UGP B;  2QQR A;  1FWZ A;  1UGS B;  4N4I A;  3OMG A;  3JAM E;  1D3B A;  1BKB A;  1Y96 B;  3MEV A;  5DM7 R;  1YJ9 A;  3A8L B;  4HNU A;  3E9G A;  3DLL A;  2DVE A;  2X4J A;  1KC8 C;  1NPR A;  5J3B A;  3TW6 A;  4ZGD B;  2E5Q A;  2MF2 A;  3M4Y A;  2KSS A;  5LJ3 g;  1YIJ T;  5LJ5 h;  1G3W A;  2HD0 A;  2M16 A;  4C0D C;  1W2B A;  2AHJ B;  3RKW A;  1K8A U;  2CGH A;  3OYC A;  3BDU A;  3FLG A;  3JRZ A;  3QJ6 A;  3OYI A;  3A8H B;  1YIT A;  5CKF A;  1JJ2 S;  2HAX A;  1M5Q 1;  1ZBX A;  3M55 A;  4M7D B;  2QA4 A;  2NLU A;  4FT2 A;  1H3Z A;  1UGR B;  5CO7 A;  2PVO B;  2DK3 A;  2XDD A;  4PLL A;  2QI2 A;  4IUR A;  3QHS A;  4QVC A;  5FRO A;  4JRI A;  4HLQ A;  2DIG A;  2RJD A;  1QVF S;  3PT9 A;  2LRQ A;  4JX6 A;  2RJF A;  4II1 A;  2JZ2 A;  5FU6 C;  2D0Q B;  2DTI A;  5FLX E;  3LX7 A;  3QII A;  5A0L A;  4HL4 A;  2BUD A;  1VQ8 T;  1B34 B;  5FRN A;  1M90 U;  2RK1 A;  1VQ6 T;  1KHC A;  4M77 F;  1K73 C;  4C5I A;  3X26 B;  2DD5 B;  4M7A B;  4KUD K;  3PMI A;  3MP1 A;  4KUL A;  4VUB A;  1GXI E;  2L8D A;  1O9S A;  4IUT A;  4C92 B;  2ZPG B;  4BBS M;  2P0P A;  4J5Y A;  1UGQ B;  3CCM T;  4M6V A;  1OI1 A;  4FSX A;  4MML A;  5CIU A;  4F7U E;  5GMK e;  3S3O A;  3VKH A;  1TH7 A;  1BIA A;  4YTL A;  3SWN B;  3L42 A;  3L2W A;  5D6W A;  4RKU E;  4C5H A;  3H8Z A;  2OTJ A;  4JS5 A;  5GMK i;  1VQ4 A;  1U1T A;  3PTA A;  4XU2 A;  4C8Q B;  3HP9 A;  3OYK A;  3DB4 A;  1VQN T;  3C94 A;  4A4G A;  3HHT B;  3OYN A;  3S3N A;  3X25 B;  4KUI A;  3C12 A;  3E1S A;  2EJG A;  1IRE B;  3KBG A;  4UC4 A;  4A54 A;  1O75 A;  3OYM A;  2M9U A;  2R58 A;  3H6Z A;  5CQX A;  3I56 T;  2RJC A;  4F7U A;  3I55 T;  1QVP A;  4JRQ A;  3FIF A;  3CXC A;  3FRN A;  4F7U G;  3KHI A;  3OY9 A;  3CC2 T;  3QPH A;  3VUZ A;  4RMO A;  2KVQ G;  4E7H A;  3JB9 H;  2ZZD B;  4DA4 A;  4OB3 B;  3G6E T;  3OYF A;  2K5L A;  2XHC A;  2E41 A;  4M77 D;  4EPC A;  5GAN 6;  1FKM A;  3EFR A;  3CBM A;  5GAN 4;  2RA2 A;  4LDU A;  3CCL A;  5GAN e;  2K3X A;  4QW2 A;  4QSH A;  2QTX A;  4XTY A;  3URG A;  2JTF A;  5I2S A;  2RHU A;  4ZN3 A;  2DO3 A;  3OYY A;  3SB2 A;  3KUF A;  3L2U A;  4M78 E;  2K57 A;  2QQ9 A;  2CZ1 B;  3CCJ T;  2PVD B;  1WJQ A;  3TW7 A;  3E19 A;  3QZ9 B;  2ZPI B;  3OSS C;  3OS1 A;  1YIJ A;  2DJZ A;  2DZ9 A;  2OTL A;  1G3T A;  3OS0 A;  4MFE A;  2P0K A;  5GMK h;  4C0Z A;  4M75 B;  3S6W A;  3M4G A;  4Z02 A;  4BY6 C;  5KH6 A;  4BBR M;  1PSF A;  5CKD A;  1WJR A;  2DXT A;  3CC7 A;  1M1F A;  2GFA A;  5EG2 A;  3NTH A;  3QDR B;  2ZCF B;  2PVG B;  4M78 A;  4C5G A;  5KE2 A;  1YI2 T;  4QQ6 A;  3PFS A;  2P0Q A;  5LJ5 j;  4E47 A;  2RI5 A;  1N9R A;  4M78 G;  1SSF A;  3MP8 A;  4XTV A;  5GAO m;  5CAI A;  1V29 B;  2HQX A;  2L5Q A;  3QG1 A;  5CQY A;  5GMK l;  1Y71 A;  1IZ6 A;  2YRV A;  4JLI A;  2GFU A;  5FU7 B;  3CC4 T;  5IT9 E;  3CBO A;  1VQ8 A;  1YHQ T;  4BE1 A;  2WAC A;  1VQ6 A;  3WVE B;  4FL6 A;  1G3Y A;  1Q81 U;  2RK2 A;  2CZ7 B;  1N6A A;  5HKC A;  3CCQ T;  4E7L A;  5GAN h;  3CCU T;  1HXD A;  4M78 C;  3FB9 A;  2VGM A;  1QVG S;  2DEQ A;  5L8R E;  2E12 A;  1Q82 C;  1KD1 U;  4C92 F;  3CCE T;  3RKY A;  2LVM A;  2XDB A;  4MZT A;  2HNI A;  1DJ7 B;  4PJO F;  2VYT A;  3VUB A;  2ZPH B;  2GQV A;  2Y4X A;  5LJ5 g;  5GAM d;  3CBP A;  4LDW A;  5CKH A;  5GAN 5;  4AKG A;  2KY9 A;  2R5A A;  5KCH A;  1X75 C;  2M0O A;  4PKC C;  5GAN 7;  3CPW S;  4ZTJ A;  2F5T X;  3A5Z B;  3BFM A;  3G71 A;  3X28 B;  4M7D E;  2E70 A;  2PUO B;  2VGN A;  5GAO q;  1EIF A;  1WNL A;  2B8A A;  2X4X A;  3CMA T;  2H3J A;  2IVW A;  4C8Q F;  4AKI A;  5GAN d;  1KQS S;  1VQN A;  2F5K A;  1JRI A;  4KBM B;  4P5N A;  3RES A;  5DY9 A;  1VQ9 T;  3CCR T;  4QVZ A;  3ZEH A;  2HQE A;  1BI1 A;  2JOY A;  2QF7 A;  3QYB A;  1VIF A;  2BS2 A;  2E64 A;  2GF7 A;  3M9Q A;  4JDS A;  1VIE A;  4AKH A;  3INZ A;  3M57 A;  5D6Y A;  2DAQ A;  4EDU A;  2G3R A;  3MEU A;  5CVI A;  4OVA A;  2HBP A;  4M7D A;  2DPP B;  2QDY B;  3LW5 E;  2KDS A;  4XQ3 A;  3JCM e;  4ME7 A;  2RH2 A;  4X9D A;  3ZBD A;  3G6E A;  2V8K A;  2WSC E;  1QP2 A;  5GMK m;  2CS7 A;  1N8R U;  1R8O B;  3M58 A;  3HB9 A;  1BI0 A;  2QQS A;  4M7A D;  2EFI A;  2YLB A;  4LDX A;  1D3B B;  3PGG A;  4RCC A;  2QEX T;  1BYM A;  4BDY A;  1YJW T;  4C92 D;  2ZPE B;  3CPF A;  5IN1 A;  4PJO D;  4IUU A;  3TRE A;  2DZC A;  5FU6 B;  1MGQ A;  4XK8 E;  1VQM T;  3DB3 A;  4E7I A;  2RO0 A;  1B34 A;  2DIQ A;  2EKO A;  3VYG A;  4ZTF A;  5J26 A;  3G4S T;  2EQM A;  1WQ7 A;  4OB2 B;  3QYH B;  3JB9 F;  4M7D C;  2DXC A;  4C8Q D;  4M75 F;  2DD5 A;  2X35 A;  1K8A C;  2QDJ A;  3OS5 A;  3CCV T;  2KR6 A;  1KQ1 A;  3OYL A;  3M56 A;  3FJP A;  4FU6 A;  5GAN 8;  4PJO B;  4IUV A;  3CME A;  3CD6 T;  3SWN A;  4N4H A;  4TVR A;  3FEO A;  1I8F A;  1M9S A;  2F69 A;  3A8M B;  3LYI A;  1RI0 A;  2QXF A;  3LGF A;  2JVV A;  5AYF A;  3OYA A;  1MHN A;  2V8I A;  4PNO A;  4OB1 B;  1LOJ A;  2K4Y A;  3HBL A;  2DKG A;  3M54 A;  3PNW C;  3RMS A;  5GAO n;  3GNF B;  4HNT A;  1JBM A;  5LJ3 d;  3JCM h;  1M1K U;  1YHQ A;  2DTH A;  2LQ8 A;  4HA8 A;  5GAO l;  1M90 C;  4L59 A;  3TCJ A;  4DOW A;  4OB0 B;  4ELY C;  4Z6Y A;  2V8J A;  4L5G A;  5GAM e;  3CCQ A;  2ZPB B;  4EMH A;  2CZ0 B;  4J8O A;  1I5L A;  5M9O A;  4X9C A;  3OBW A;  1WQW A;  3F70 A;  3OYB A;  2FB7 A;  3C95 A;  4JX4 A;  4M77 E;  3JB9 D;  1M4Z A;  3JSC A;  1BIB A;  1WGS A;  4LD6 A;  4M75 D;  5HY6 A;  3JCM V;  3JCM d;  3SD4 A;  3QYE A;  2K3Y A;  4XU1 A;  4JLG A;  1VQ5 T;  1VQ7 T;  2LNV A;  4GLK A;  3OYH A;  5I2M A;  3M5A A;  5GAM f;  1W2B S;  1YJN T;  1NJI U;  2DD4 B;  4F7U B;  3ASK A;  3VV0 A;  1PSE A;  4EMK B;  4ELJ A;  2JNG A;  5CCA A;  2IG0 A;  3CCR A;  1VQ9 A;  1Y7X A;  1QP3 A;  4O6J A;  1Q7Y U;  3TU4 K;  1I81 A;  4M77 A;  2VV5 A;  2G77 A;  2QA4 T;  5GAN f;  4NC6 A;  4ELZ C;  1Q86 U;  1XNI A;  4M77 G;  3L2Z A;  4AI6 A;  4O5V A;  1JJ2 A;  2JN0 A;  2EAY A;  3QXE B;  1WPY A;  3L2R A;  3M59 A;  2EJF A;  3HRU A;  5C0M A;  2RD1 A;  3C4S A;  4JS4 A;  4HCC A;  2D6F A;  3QO3 A;  5CR2 A;  2RM4 A;  3RUX A;  3ZFJ A;  2MWO A;  4J7F A;  5GAN g;  2XK0 A;  3KXT A;  3CCS T;  2QEX A;  1G5V A;  2DXB B;  1YJW A;  3P8B B;  2BS4 A;  3BDL A;  4XTU A;  2E10 A;  5GAM h;  3GPL A;  3JB9 J;  3BG9 A;  1JB0 E;  4ATO A;  2DTO A;  1QVF A;  1VQM A;  2FHD A;  2RJE A;  2WJ9 A;  3HO8 A;  4ZGE B;  2O4X A;  4M77 C;  3G4S A;  2RB6 A;  3SDZ A;  3LLR A;  2XKO C;  1OZ3 A;  4A4K A;  2QQB A;  3EFS A;  4L6V 5;  2A7Y A;  3VKI A;  4BI3 A;  3MP6 A;  4C0D B;  5GAN 3;  3WVD B;  2K5I A;  3CCV A;  2E65 A;  4HCZ A;  1S72 T;  1K9M U;  3ME9 A;  2X4Y A;  4J6W A;  2KMG A;  1FX7 A;  5A0D A;  3CCM A;  2EYQ A;  3JCM c;  1VQK T;  3BG3 A;  1XQH A;  2KQW A;  3HKS A;  2P4T A;  3CD6 A;  3OSV A;  3GLX A;  4DOV A;  4E7K A;  1KC8 U;  4ZN1 A;  4MZM A;  1YBY A;  2L89 A;  3MET A;  2EIF A;  2RHX A;  1H64 1;  3DKM A;  2EQJ A;  2MI6 A;  3BW1 A;  3VU3 C;  1Y96 A;  5LJ3 e;  3OYE A;  4BE0 A;  2C06 A;  3G7Z A;  4J6Y A;  4NS5 A;  3RER A;  1OZ2 A;  3UDC A;  3CXC S;  5CKB A;  3QBY A;  4LDY A;  4FT4 A;  2VC8 A;  3JCM P;  3GF5 A;  1VQO T;  3I56 A;  1RL2 A;  4Y91 A;  3I55 A;  2MAM A;  5EJC A;  3S3M A;  2LC4 A;  3VKG A;  1Q81 C;  2BIV A;  2E6Z A;  3NFC A;  3CC2 A;  2QQA A;  4KT0 E;  3V8K A;  3CCS A;  4RCB A;  4CI0 C;  3L2V A;  4Q5W A;  3OYD A;  4IUQ A;  5LJ3 f;  3NTK A;  3OB9 A;  4DQ2 A;  4QQG A;  3JCM J;  1KD1 C;  2CYZ B;  3J7A F;  4M7D G;  4BB7 A;  1VQP T;  4RG8 A;  2E1H A;  4OMF B;  3RMQ A;  4M7A E;  5LL6 S;  5KCO A;  4IUP A;  1QLB A;  1W4S A;  1UEB A;  3LGL A;  3UWN A;  1VQ5 A;  1Y07 A;  4C92 E;  2EJ9 A;  3OW2 A;  1VQ7 A;  1U8R A;  4PJO E;  3HRT A;  4XAX B;  2BS3 A;  2EQU A;  3CCJ A;  1K73 U;  2FL7 A;  2WSE E;  2YHT A;  3EAE A;  2LCC A;  2OTL T;  4Y28 E;  2R5M A;  2RI2 A;  3HPW A;  4F7U F;  3MEA A;  3UT1 A;  2CKK A;  5HK3 A;  1YJN A;  5D6X A;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...