2ZPIB

Complex of fe-type nitrile hydratase with tert-butylisonitrile, photo-activated for 440min at 293k
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpiB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpiB02
2ZCFB 2DXCB 1AHJB 3LW5E 2CZ7B 4RKUE 4KT0E 2ZPHB 3X26B 1PSFA 1JB0E 5L8RE 2O01E 2DXBB 2DXBA 2PU9B 1UGSB 3WVEB 3VYHB 2WSCE 2PUKB 1V29B 2DD5A 2ZPEB 2ZPFB 3WVDB 2WSFE 2DXCA 1UGQB 4XK8E 3A8LB 3QYGB 2DPPB 2ZZDB 2ZZDA 2CZ6B 2ZPIB 4OB0B 3QZ9B 1UGRB 4OB1B 3VYGB 3X20B 3A8GB 3HHTB 3X24B 1IREB 3QXEB 1PSEA 2PVOB 4OB3B 4ZGJB 3QZ5B 3QYHB 2ZPBB 2CZ1B 3A8MB 2DD4B 2QDYB 2D0QB 2DD4A 3A8OB 2CZ0B 4L6V5 4ZGEB 3VYGA 2ZPGB 3X28B 2AHJB 2PVDB 2CYZB 1GXIE 3A8HB 1QP3A 4Y28E 4ZGDB 1DJ7B 2PVGB 4FM4B 2DD5B 4OB2B 3X25B 2PUOB 1UGPB 2WSEE 1QP2A
chains in the Genus database with same CATH superfamily
1D0XA 1NEBA 3SWNA 4ROCA 1VQ7Q 2LNVA 4BCGB 1F5QB 2WIPB 2AKLA 3X26B 2XICA 1OPLA 3EAEA 4AMCA 1G83A 5EC7A 2DF6A 3CC2T 4ZNXA 3EH1A 4HXJA 1YJ9A 4LE9A 1JEGA 4L59A 2OTJT 3BW1A 3CCRA 3RNJA 5IHKA 2GTOA 2PQWA 3CMAQ 3V8LA 4Y92A 4LDWA 1M1KC 5LJ3j 1VQ6Q 2MK5A 3MP8A 4A53A 2HBWA 1YJNQ 1VQ9T 1B34B 4YOSA 4RCCA 3I55A 1AOJA 3C0CA 2M02A 2F1LA 2LNHB 4BCQD 4EOLB 1VQLQ 1PSEA 1D1AA 2BE9B 1K1ZA 4QSHA 2DXTA 1OL1B 1Y96B 2HL5C 1M30A 2FZKB 4C0FA 3OY9A 2KDSA 4M75D 5GAN2 1K9AA 2EYZA 3VKIA 2RJEA 3GPLA 1MMGA 1SEMA 3QJ6A 1JO8A 2OTLA 3EFSA 4M78C 2HMAA 3M5AA 5GAMe 2DL5A 2B8AA 4M7AD 1QMZB 2UZEB 4EOSB 4DQ2A 1KQSP 4M75A 3UA6A 1M90R 5D6XA 3CC4Q 1BIAA 4MMLA 2W9ZA 1BIBA 4OMOA 4EOJB 2V8JA 1ZA2B 5LJ3g 5EJCA 1QVGS 3A5ZB 4M7AA 1K0SA 2YRDA 4PFOA 2YUPA 4FL6A 1W2BA 1YNZA 4TVRA 5GMKh 4XAXB 3GNGA 1PWTA 3RR6A 1KQ2A 3JB9J 3X25B 1KQ1A 4RMOA 1QP2A 3E9GA 2M1HA 4BBRM 1UECA 2QQSA 1RLPC 4A4KA 3CCUA 4FYYB 4X9DA 2CDTA 3LLRA 3V7SA 1MHNA 3I5SA 4JLGA 3NPFA 2JXBA 2CUBA 1Q82R 3CD6Q 1UGSB 5IXFA 5DQVA 4D8DA 1XTDA 3MY5B 1CKAA 5GANj 1WQWA 1VQ5A 4OMFB 1WJRA 2NUZA 5A0GA 3E1SA 3T9NA 1VQPA 4M75F 1WXTA 1UGQB 2F2CA 2RHZA 3MPUB 2G6FX 1MUZA 3G4SA 5AYFA 3MCAB 4EMKC 2IVXA 3I56Q 8AT1B 1Q81R 3CEYA 3QHRB 4F04B 2FPEA 1KD1U 4R55A 3OW2P 1D1BA 4M7AF 1IZ6A 2LZ6B 2LX7A 4XU3A 3RKXA 1NJIU 2QA4T 1C1AA 1NM7A 2C0IA 3BY7A 4PJOG 1KHCA 3HKSA 3JV3A 2LDMA 4JJDA 1MNEA 3REBB 5CYIB 5CR2A 3RDVA 2FPDA 3GBQA 1YHQA 3G1JA 5KYUB 2HBPA 2BKDN 4KULA 4HT9A 2L8DA 3H9NA 5CEIB 4FT2A 2E41A 3QYHB 4OMLA 2WEVB 4KRTA 2OI3A 4RTUA 1K8AR 5HCKA 3BDUA 4XTYA 1VQOA 1AZEA 3EGXB 1N6AA 4ROEA 4C92B 4GBQA 2MF2A 2XIDA 3M9QA 5C6SA 4CFMB 3URGA 2C5XB 3TEEA 4BCJB 2DA9A 5BNJB 2H8HA 5IT9E 5GANg 4BCPB 3DOGB 2CP5A 1JU5C 2EUFA 2DVJA 3V7CA 3G71T 2HL3A 3EG9B 2RJFA 3PFSA 2XMFA 4JRKA 4FW2A 1KFZA 1QKWA 4RTYA 2LW4A 4X1VA 3OYAA 3KXTA 2QTXA 4FM4B 1JOWA 3OSVA 1H1SB 4CFVB 4CXAB 1X6GA 2ZCFB 4BCMD 5HY6A 2GNCA 4KUDK 5LJ5j 3CCEA 1PD1A 1W4SA 2DL8A 4PJMA 1H24B 1SRMA 2O2OA 2PU9B 1YBYA 3JAME 3PE0A 1FVVB 4HNTA 1YJ9T 2CKKA 2DD5A 3CCRT 3GP8A 5KYYB 1Q86C 3VU3C 4ZTJA 4M7DB 1GL5A 3BG5A 2A0FB 2YLBA 4KGXB 4XK8E 1BB9A 3DLMA 2RO0A 4C8QG 5CK9A 4JUVA 2DFUA 5GMKi 2DPPB 4JX6A 1IGUA 1H8KA 4MZPA 4A4EA 1BU2A 2KGTA 1NYFA 2IW6B 5HK3A 3JCMf 2IIMA 4JLIA 3MEUA 1FYNA 2KMGA 4JDSA 1IREB 3HL8A 3JCMe 4J9BA 1ZQ1A 5CVIA 5KE3A 2YUQA 4OB3B 2VKNA 2E6ZA 4C92D 2DRMA 2PMIB 3ZBDA 4BE2A 2WPAB 3JSCA 2WFYB 2CZ1B 4M75C 2DD4B 3HZJA 2QQRA 2YUNA 4BY6C 2OTLT 3KFVA 2OX7A 3TNWB 1QVGA 5LJ5g 1WLPB 4M7AC 5HBEB 2XI9A 1P92A 1JJ2A 1SHGA 4RUGA 1SKUB 2KXDA 3CXCS 3QWXX 3EG2A 2OAUA 4OGCA 4XTWA 3RKYA 4KBMB 4ZGDB 2DJZA 1DJ7B 4RTWA 1WA7A 2PVGB 4F7UB 5AT1B 5GANh 3QDFA 3QG1A 1E7OA 3EIDB 3LGLA 4KRDB 4C5GA 4XTXA 4J6WA 4P5NA 2RQRA 3HO8A 2ABLA 4MDXA 3H8ZA 2GCXA 2HKNA 1E9HB 2FVUA 2Y4YA 4RCBA 2CREA 5IHIA 1OZ3A 1VYWB 2MIOA 2O01E 1H28B 2V8KA 4PJJA 3WVEB 5DM7R 4C92F 5LJ3d 3BLRB 2ZPEB 3TN8B 2QK0A 1VQ5T 1AT1B 1BI2A 1EZZB 5KYYA 4BDYA 3OYDA 4HCBA 2F2XA 2SEMA 2X51A 4FSXA 1VQPT 3H0IA 1M3BA 3G4ST 2DL4A 2CZ6B 2D6FA 2C0TA 2P4RA 3CPWP 4EC8B 3K7AM 1R0BG 3BG3A 1S72T 3BLQB 1ZUUA 4LXCA 3EGDA 3CCLA 2PK2A 1YN8A 4BE1A 3FDRA 1WXBA 2QQ9A 3HHTB 1GRIA 3CCST 1X2QA 3M0RA 4LN2A 4BI3A 1G8XA 1M2VB 1IHVA 2P84A 2YXYA 2KXCA 4IIOA 3QZ5B 4LDYA 2EQMA 1UB4A 2JT4A 4J7IA 3OSSC 5FU7C 2M0OA 2YSQA 1TUCA 2DD4A 2VYTA 1VQMA 1Q7YC 3OYJA 3I5RA 4LUDA 1VQOT 3CCMT 2CP7A 3AHUA 4IUTA 5GAOq 1M90U 5CQXA 3X28B 4PLLA 2VWFA 4XTUA 1UJYA 2DO3A 4XU1A 3EFRA 3CCJQ 1GH6B 3H0HA 3FB9A 2GFAA 1XJWB 1T0HA 2Y4XA 2F5KA 3MP1A 4LD6A 3TSZA 4JS4A 1RL2A 2K4YA 1AEYA 4MFEA 4FYVB 2VASA 4DBFA 2QEXA 5GMKe 3FIFA 2MI6A 5KYXA 2QG9B 4F16A 4PJOE 3KBGA 2XDDA 3ZFJA 4EONB 1PG5B 4HVVA 2HDAA 1Q82U 3MKDA 1VQ4Q 3RIRA 2BZ8A 2EWNA 2E64A 4BB7A 5GANd 3BLHB 4NOYA 3CCET 2EAYA 2DMOA 1VYVA 2MMPA 2RH2A 1TS9A 1VQ7A 1XO2A 3VYHB 2BE7D 2PUKB 3VKHA 3NDQA 1YWOA 2ZPFB 4Z6YA 1Q81U 4JX5A 2O88A 1QVFA 1JXOA 1OI1A 1VOLA 3M0UA 1PD0A 1OYXA 2F2WA 1UEBA 4N4HA 1W2BP 3FJ5A 3CMAA 2QASA 3QZ9B 4C92G 1VQ6A 1PNJA 2QAZA 3CCVT 5D7UA 1BK2A 4JRQA 2EQJA 2V1QA 4Z89A 1YJNA 2KSSA 2X4XA 4M6VA 1K8AU 1SSFA 2E3HA 3R6NA 2WHBB 3S3NA 1I5OB 1VQLA 1BCMA 1M8MA 4KH1B 1UG1A 3CXCA 3FJPA 3M58A 1GUXB 2BIVA 4YOOA 3G6EA 4ORZA 1OI9B 2QQAA 1Y71A 1WHMA 2KVQG 2KR6A 2PNIA 3CC2Q 4JPBW 1W98B 2RB6A 2AHJB 4FSSA 3JCMX 2DK3A 2KR3A 1ZHIA 2E1HA 4C0DB 1NLOC 2OTJQ 2L3PA 3A1PA 5I2SA 4C8QE 4J9IA 2C06A 2A7YA 2GGRA 2LVMA 1MV3A 3SB2A 4PJOD 4C8QB 2W0ZA 2XHCA 4J9DA 2MAMA 3JCMc 1Q86R 2E5KA 1NBEB 2J6OA 2BPMB 4OMPA 2QI2A 1VQ9Q 4M7DG 5HNBB 1H641 4OB2B 4F6SB 2EGEA 2JW4A 3MHXA 5LJ3e 1UGPB 3JB9H 3H4CA 1AHJB 1Y07A 1VQNA 2RA2A 1N8RC 3OYFA 4C0ZA 5FU6B 2M0YA 4PJOA 1IXDA 2XK0A 2E70A 1BI0A 4FT4A 1W1FA 2LJ3A 3S6WA 1HXDA 2EKOA 1K0XA 4CRLB 4FCYA 2AT1B 3IQLA 2KYBA 4IUQA 1BCOA 1YIJT 4J83A 1V29B 2BS4A 1OPKA 2DXCA 4GY5A 3NHNA 2GF7A 3P8BB 3A8LB 2ZZDB 2UUEB 3L1AA 5HKCA 2D1XA 2WIHB 2WMBB 3M59A 3CC7T 1B3QA 4BY7X 2RHYA 3L2RA 2LP5A 3CQTA 5FRMA 2AZSA 4J6XA 4BXXX 5FWBA 3OBYA 5CQYA 2FRWA 2EJFA 3QXEB 5KH6A 2IW8B 3J80E 1OIYB 3BDLA 2LQNA 1WIEA 1TTHB 2UZDB 4PJOF 3J81E 1XOVA 1QLYA 2K9GA 1MV0B 2DVEA 4F6UB 1UE9A 4F7UG 1KSWA 1VQMT 1OZ2A 2EGCA 1CKBA 1KG1A 1GUXA 4J9CA 3DB4A 3VS3A 3KHIA 4V2SA 4J7FA 4C8QD 1NLPC 4E7JA 2O9VA 3UF4A 4EIKA 2P0KA 2EQIA 2L0AA 1WHJA 4L5GA 4GLMA 3L2QA 3A8HB 2BS3A 3UA7A 4C8QA 2EQUA 5IN1A 2KYMA 5GAMf 4PLIA 5GANe 3TQ7P 3M56A 3VS1A 2CH4W 2NUPB 2RI2A 3G33B 2RHXA 1K9MC 5I5ZB 3LW5E 3BFMA 2QA4Q 3JCMP 4A4FA 5KYWA 3SDZA 1W6XA 3O0GD 3OS5A 4CRIA 4X9CA 1PSFA 1QVGP 5FROA 2JN0A 3OYGA 5L23A 2V22B 1Z9QA 1JJ2P 1I07A 4BCIB 4OGRB 4N0AC 3DDQB 2RHUA 4NS5A 4ELLA 4QT7A 2RQUA 1D09B 1VA7A 1ZBXA 1Q7YR 2VGNA 1RUWA 2ZZDA 1GY3B 4WCIA 1OIUB 1FMVA 4C8QF 4IUPA 1ZUYA 4A63B 2JTFA 3OYEA 2YWWA 3Q1JA 2HQXA 3G71Q 4BD3A 3SD4A 1U5SA 1AWXA 3TNHB 4N4IA 1ARKA 1KD1C 4J6YA 3EG3A 2GQVA 1OU8A 2RPNA 1ZUKA 2F2VA 1B34A 4FYWB 2A28A 4L6V5 2PJQA 1LPLA 2NUTB 3CMEA 2LT4A 2JS2A 3RMQA 3G6ET 3VKGA 1X01A 4QVDA 1Y96A 2P0PA 1YJ9Q 1VQKA 5HBJB 2F69A 1OOTA 2QGFB 3E2UA 5LJ5e 2DAQA 4CI0C 4CFUB 2JTMA 2JVVA 1IHWA 1ENWA 1K4US 4XTZA 4PJOC 1GFDA 3KUFA 4KRCB 2DNUA 1VIFA 3OW2S 1VYTA 1UGVA 2CCHB 4C92E 3S3MA 1M9SA 3MY1B 1AWWA 2FYKA 2DXUA 5I11A 4HCKA 1YI2A 2WJ9A 3OYLA 1UUEA 8ATCB 5GAN5 1VQNT 4HL4A 1H4LD 5DLOA 4RKUE 5GMKl 2AIRB 1ABOA 1GBRA 3EHQA 2IW9B 1ACMB 3HFNA 3SWNC 5GAOm 1ZBJA 3CCQT 3OYIA 3MI9B 1MMNA 1PHTA 3MP6A 1OV3A 3M4GA 2YT6A 1HD3A 2YUOA 2EQKA 2QDJA 4XQ3A 2OTLQ 2FPFA 2E6NA 1YCSB 1YITA 3EJ1B 3HBLA 4J9FA 1C0MA 4NL2A 3FLGA 1GCQA 1NYGA 2CS7A 4ELJA 3NFCA 1TFBA 3X20B 1IRXA 4RTTA 2DIGA 4LNPA 4E6RA 3HPWA 1OX8A 3X24B 1H26B 1T3SA 2RI5A 5CAIA 4A54A 4AFZC 2PVOB 4M7DE 1WFWA 2DETA 2BKZB 4BUGA 3M55A 4QW2A 4XTVA 5GAOl 1PRMC 4DBRA 2LX9A 1JQQA 3H6ZA 4AG2C 1I5LA 5CKBA 2YDLA 4C0DC 4J8OA 3H0FA 4BCFB 2L5QA 3OYNA 4CFUD 3I55T 2LRQA 1HYOA 2O31A 1QVFP 2W2HA 4C8QC 1IGQA 4LDXA 3HRUA 3UT1A 1TSFA 3P8DA 3SEMA 5CKHA 5KYUA 4R56A 1Q86U 1G5VA 2BS2A 1VQ5Q 1M2OA 2UZBB 4EOKB 1SRLA 1VQPQ 1OQKA 1ZLMA 2FB7A 3C95A 3G4SQ 1YJWA 2J6FA 2L3QA 2CJMB 3EGXA 1YCYA 2PZ1A 1WQ7A 1S72Q 3VS4A 4C92A 5GAN7 1UFFA 2V26A 4DEXA 2GBQA 2YLCA 3CCSQ 3CXCP 2E5QA 3M54A 1FINB 3VS5A 3LGFA 2LQWA 1G3WA 1TUDA 1ZP2A 4II1A 2JNGA 2E10A 1RAGB 1SPKA 3DLLA 2K2MA 3EG9A 4CC3A 5CIUA 2DBMA 2AK5A 1JSUB 4PNOA 2DXBB 5CO7A 4F7UE 3HRTA 2LQKA 1M1KR 4OR5B 3DJBA 1K73C 1QCNA 3CPFA 1Q95G 2DL3A 1WI7A 2EGAA 4R0KA 3NTHA 1VQ8A 1VQOQ 1WJQA 2LJ1A 3CCMQ 4J5YA 4E7ZA 4EC9B 2QDLA 4BCNB 2E65A 1C9BA 4M7DD 3CCUT 1U3OA 2K3YA 2ED0A 2AKKA 1G3SA 4BI8B 2SRCA 2WMAB 3VYGB 2EJGA 2Z0WA 4UN0A 2LT1A 1VUBA 3ME9A 4AKGA 4MZTA 2HSEB 2MCNA 2VVKA 5GAMh 2KT1A 2ZAEA 3WXMB 2KY9A 2A08A 1BYMA 4M7DA 2LJ0A 3PVQA 4GLKA 3OYMA 1FWZA 2LC4A 1VOMA 4AFUC 2VC8A 5GAN8 4JZ3A 3CBMA 1BI3A 1TWBA 2MWOA 5IDPB 2H3EB 4ZGEB 1R77A 1K9MR 2K2VA 3CMET 2WXVB 4RODA 5I2MA 2VUBA 3CCEQ 3BHVB 3TCJA 3NGPA 1H25B 5FLXE 2CP3A 2KROA 3EHRA 4RG8A 1P5EB 5J39A 1YHQT 1AD5A 1VQKT 4IKFA 3EOCB 1G3TA 2CCIB 1QWFA 5EG2A 2X4YA 4OGEA 1N9SA 2KE9A 1BU1A 1URCB 2QQ8A 2DMEA 1WYXA 5A2QE 1UHFA 4HNUA 2B9RA 5J3BA 4EORB 2ESWA 1HK9A 1KC8C 2X4JA 4CC4B 1ZX6A 3CCVQ 3M57A 4M7DF 3QYBA 1YI2T 3O8VA 4KGZB 4KH0B 4Y91A 3J7AF 1LCKA 2IVWA 1IO6A 3L2UA 3JCMg 5J26A 4BCND 1JB0E 2CGHA 2J7IA 2DXBA 1I4K1 1GCQC 4ZN3A 1ABQA 4F7UA 2HQHA 1T3LA 1Q7YU 3DL1A 3OS1A 1Q82C 1S1NA 2JTEA 4EMKB 1H3HA 1VINA 3EFOB 5IHNA 4QKUA 4X34A 1QW1A 2QYZA 4QVCA 1M27C 3OYYA 3HTRA 1YITT 3VS0A 1WHHA 2IN3A 3META 4A4GA 1SSHA 3A8GB 2PHGA 1R0CB 2FZGB 4A4HA 1WPYA 1V1CA 4ZGJB 1XQHA 1K76A 3V7RA 4BACA 2ED1A 2AZVA 4BCOB 3M4YA 2CP0A 3PIPA 2K7AA 2RM4A 3POMA 4OF1A 1BI1A 2EW3A 1JSTB 3PTAA 4AKIA 3A98A 2XKOC 2RJDA 5GAMd 1M4ZA 4F7UF 3JCMJ 5HK0A 5KCOA 2HD0A 3NMZC 1M2VA 1N4MA 2KEAA 3UWNA 4DEYA 1QVPA 2CT3A 3BHUB 2BUDA 3UDCA 1YIJQ 1AD6A 4C92C 3QUIA 2NLUA 5IH2A 2EYWA 1W2BS 4M77G 1X75C 2EIFA 5FRNA 4YOZA 4AI6A 1PC0A 3ULRB 4BBSM 1YJWT 2LCCA 1TH7A 2YRCA 4YTLA 2COWA 3CC7Q 4JS5A 4CC2A 1AZGB 4DBQA 4JJNK 2DL7A 2BTTA 5HQ0B 2W10A 1RAEB 4JRPA 3P8HA 4QVZA 2X35A 3MEVA 2CP2A 1WZOA 2A37A 1I8FA 2DX1A 2QA4A 5ECAA 4JZ4A 5LJ3f 5GAOp 3LX7A 2CH4A 1D1CA 1UDLA 3CC4A 2C6TB 2DRKA 4JJBA 3JCMh 3VRZA 2XD0A 1QCOA 4EMKA 1E6HA 2DEUA 1VQ8T 4MZMA 3EFOA 1H92A 1OKVB 2UZLB 4DOWA 3MEAA 1U1TA 3QBYA 4M7DC 3OBWA 2E3IA 1UHCA 2QTVA 3OA6A 4KUIA 3I35A 4FX3B 1WHKA 1N5ZA 1E6GA 4EMGA 3QO3A 3INZA 3QWYA 2ECZA 2JOYA 4IURA 2C0OA 4M75B 3HFOA 3CD6A 3A8MB 2V8IA 4BY6B 4C5EA 3GLXA 2D0QB 2JGZB 4F14A 4ELZC 4PFPA 2RF0A 4M7AB 2D0NA 3VUZA 2DERA 2LTOA 4NL3A 3CCLT 3NTIA 4UC4A 1GCPA 1U1SA 3I56A 5IHYA 2CUDA 1ZSZB 4F6WB 1PRLC 4TTHA 1EIFA 3HB9A 1QCFA 4EOPB 3RGFB 2PVDB 1O9KB 1I0CA 1RAHB 5HBHB 1QWEA 3SFMA 4ANJA 4F7SB 1K73R 1X6BA 4C0GA 3G7ZA 4EOMB 3CBOA 1WHGA 2P4TA 2Y90A 3D7SB 3LYIA 4KGVB 4O6JA 1T0JA 2DBKA 1GFCA 1H1RB 2QFZA 3I9QA 2DE0X 2K57A 1WNLA 3E9FA 4DA4A 1LOJA 2PUOB 3RBBB 2V1RA 1WJSA 2CYZB 2WSEE 2QQBA 3MO8A 2RQTA 1FKMA 7AT1B 2W99A 2RQVA 4HNVA 3QDRB 4KT0E 1RLQC 1M1KU 1UTIA 5GANf 2RI3A 1VYUA 3GNFB 2VB6A 2KBTA 3OYCA 3LQ5B 2DZ9A 2YRVA 1WHLA 3C12A 5DY9A 3DKMA 2JM8A 2VV5A 5HVYB 2COZA 2QEXT 3OMCA 3ZEHA 4OP0A 4QQDA 5IXBA 2L89A 2GTJA 4J9GA 1SF9A 1X2KA 3B57A 3G6EQ 4M78G 4HVUA 3L2WA 4I3ZB 4FIBA 2L3SA 2X9HA 2RN8A 2RNAA 3PO3S 4N4GA 3JB9I 2DILA 3EG0A 3JCMd 5LMKB 1FMKA 2OAWA 4LDUA 4E2FB 2KRSA 1VQ7T 4D8KA 5ACBA 1O9SA 1O75A 2COYA 4C5HA 1HJDA 1NZ9A 1RI0A 5FU7B 1JRIA 1PKDB 1RABB 1Z9ZA 1NPRA 2X3XD 3THKA 3PMIA 2HQEA 4IIMA 4MFDA 2EKHA 2KAFA 1KQSS 3V8JA 1K9MU 3RKWA 5LQFB 2DYIA 2DTOA 2DM1A 2HEQA 1U8RA 4E7IA 2BZYA 3JB9G 1KC8R 2RHIA 1VQNQ 2IG0A 2CZ0B 3CMAT 3QJYA 2M16A 2I53A 1VQ6T 5IF1B 1JJ2S 3CCQQ 4PFZA 1ZSZA 4MMKA 3V8KA 2EVRA 3VS2A 2LMJA 2L3RA 1YJNT 4PJNA 1C6VX 1NE8A 1O9KA 4Z02A 1M1GA 3VS6A 1X69A 2C5VB 2X1NB 1KK7A 2A3LA 2JMCA 4EMHA 4JJCA 4Y28E 4EOQB 2VGMA 2VXEA 5IDNB 1NJIC 1VQLT 1J3TA 2LCLA 3C4SA 3JCMb 5GMKm 3M0QA 4BCMB 1Y0MA 3F5XB 2DD5B 4EOIB 2CSQA 2H3JA 4MDWA 1QMCA 5GJWB 1QLBA 4XU2A 5GAMj 2J05A 5LJ5f 1KJWA 2RK2A 2B86A 2CZ7B 4Q5WA 1D3UB 2EJ9A 5CKDA 4VUBA 3CCRQ 3M0SA 1S72A 2XDBA 5A0LA 1H1PB 2KMTA 4IUUA 2MPXC 2D8HA 4CFXB 3CCSA 1Y7XA 1D0YA 1PKTA 4ZTFA 3RESA 2RMOA 2WSCE 3MJXA 2DJQA 3CC4T 1WXUA 2X3WD 3I55Q 3ZL7C 2NUPA 1NEGA 1KHIA 2RD1A 4E7HA 3PMTA 5CKEA 1M3AA 1LVKA 4OMMA 1MNDA 2GFUA 3OS2A 2K5LA 2P0QA 4MIMA 3CCMA 4M77E 4HCCA 5I22A 4F7NB 1XNIA 5EFQB 3TNIB 5GAOn 4EDUA 4M77B 1TD6A 3PNWC 2FEIA 1X6OA 2JZ2A 3M53A 3PGGA 1TG0A 2EYQA 3CD6T 1OGUB 3VS7A 2QGGA 2KT8A 4RTXA 1B07A 2QDYB 5GAMg 2K3XA 2K5IA 2LQ8A 2KI7A 2KRMA 4AFSC 1M3CA 3DDPB 1WGSA 3I56T 2R57A 5LJ3h 3CBPA 1VIEA 1H3ZA 1ZA1B 1QKXA 3QYEA 1NPPA 1HSQA 2HZYA 4JRIA 1E7PA 2NYSA 4LD9K 1UNHD 4BI4A 5GAN6 1TOVA 3LH0A 1NG2A 5DQWA 1M1FA 2FRYA 4PK4A 3ASKA 1OL2B 2HAXA 2ENMA 2FL7A 2NUTA 3QPHA 3CCUQ 1N8RR 2RJCA 4IMYB 2K3BA 2FO0A 1F1BB 3LH5A 1MMAA 3OB9A 3OMGA 3DTOA 4ZN1A 3TSWA 5IAYA 2ZGWA 4JX4A 1PM3A 2C4GB 2I40B 1JBMA 1RAFB 2C5NB 1QQJA 3EGDB 3CCVA 5ICPB 5L8RE 5FU6C 3M03A 2O4XB 1EX4A 3CCJA 2DKGA 4IUVA 4C5IA 5KYNA 3TVTA 1QVFS 2I0NA 4M75G 1N9RA 3O5ZA 1GBQA 1KIKA 2WSFE 1KXUA 4J9HA 1TXQA 4M77D 2R5AA 3CMEQ 4PL6A 1FX7A 3OYHA 4HVWA 3M0PA 2ZPIB 4M7AG 1SG5A 4BCHB 4M4ZA 5DLQE 4FYXB 1KQSA 2HNIA 1YHQQ 1VQKQ 5D6WA 2D8JA 1LNXA 1ZSGA 1WX6A 4K11A 4E7SA 4M77A 2YHTA 1OKWB 1VQ4A 3TW6A 2CP6A 3GF5A 2FG0A 3OYBA 5A0DA 2X4WA 2MOXA 1UNLD 4E47A 4LUEA 2NWMA 1MGQA 1UNGD 1ZSZC 3E19A 3VV0A 1YFNA 4G6LB 2FHDA 2CSIA 3OQ5A 5FGKB 1YI2Q 3C94A 2R5MA 5L2WB 2FZCB 2D9TA 2EYYA 1Y57A 5KYXB 5GAOr 2W9FA 1K73U 4J9EA 5KCHA 3LWIA 4NC6A 1IB8A 4F7JB 2XU8A 4HT8A 3EH2A 2GQIA 4M78E 5FW9A 3OYKA 4M78B 4FU6A 1YIJA 1AWJA 1YITQ 1LJOA 4M77F 2K5FA 2XG8D 3R6OA 3OW2A 3PIOA 3LWHA 2R58A 1D3BB 1OU9A 3SHWA 3BE3A 2KNBB 2MWPA 4PKCC 3CC7A 1N27A 2LCSA 4FW1A 3REAB 2EPDA 4BDZA 3CPWS 1M90C 2HSPA 3UATA 3CC2A 1D0ZA 2O4XA 2KRNA 3FC3A 2VXFA 1X43A 4BE0A 4QQGA 2OTJA 5GAN3 2E4HA 3L2ZA 4YC3B 2DYBA 1CSKA 2XDPA 3HP9A 5CKFA 2G77A 4DBHA 1A0NB 4O5VA 2M9UA 1VQ9A 3L42A 1FXXA 5GJVB 4OB0B 2RQWA 4QQ6A 1AWOA 3NTKA 3MIAB 1M5Q1 3TU4K 1RADB 4Y72B 1U06A 3RMSA 5M9OA 3JCMW 1KD1R 2EFIA 3FRNA 3EG1A 1R8OB 1PKSA 1OX9A 1BKBA 1B7TA 2M51A 2PTKA 3H41A 5LL6S 3JCMQ 1RAAB 3ER0A 1YJWQ 4ELYC 1NJIR 4F7LB 4DOVA 1KC8U 2PK9B 4LOCA 4OMQA 3HSBA 5LJ5h 1PCXA 2BZXA 3A8OB 2DIQA 4OVAA 4ESRA 2C5OB 3F70A 3VYGA 2QF7A 2JMAA 1MMDA 1TUGB 4M78D 1Q81C 2ZPGB 1FMWA 3TW7A 4E7LA 3QWLA 1JXMA 1SHFA 2W96A 2DEQA 4PJOB 4AKHA 2DTHA 4WTOB 2ROTA 3MEWA 1AISB 4PJLA 4EOOB 5GAN4 1VQ8Q 1QP3A 4M78A 2F5TX 1G3NC 1YWPA 4RG2A 2EYXA 4NSTB 4D6WA 2KK4A 2JS0A 2MYSA 3DB3A 2E12A 1K8AC 3VUBA 4E7KA 1D3BA 2DXCB 5FWCA 2DLPA 3SWNB 3JB9D 3QHSA 4II5B 3VJPA 3PVLA 2JM9A 2ZPHB 2QXFA 3HRSA 4F17A 3EGUA 3PT9A 4HCZA 2O9SA 1G2BA 3VRYA 2JJ9A 4N0AA 4XU0A 4F70B 4RTZA 3CCJT 2G9XB 2JUFA 1V76A 5GMKj 2QGSA 2K79A 1H1QB 3L2VA 3WVDB 3TREA 3CCLQ 4RTVA 4M77C 2EBPA 3QSUA 3QYGB 3RERA 2K6DA 4M78F 1BBZA 3GTMS 1H27B 2G3RA 4EPCA 3OS0A 5I21A 4AFQC 3JCMV 4AT1B 2L2PA 1UGRB 4OB1B 2DZCA 4B6MA 4ME7A 2A36A 2J06A 1AVZC 1I81A 3BG9A 3AT1B 4CC7A 3QKJA 5CCAA 1VQ4T 4WF2A 4B9WA 1G3YA 2RK1A 3S3OA 1VQMQ 4BY1X 3FEOA 4HLQA 1M8VA 4AG1C 2IPOB 4Z8AA 4CFWB 2ZPBB 2WACA 9ATCB 1I1JA 4LDVA 4HKEA 3GIBA 3BHTB 1RACB 1WDXA 1X27A 2J6KA 2HCKA 4BCQB 2R7GA 2DTIA 2CT4A 3U23A 1UJ0A 4Z88A 3JB9F 6AT1B 1OULA 3GOXA 3M0TA 1RI9A 4CFNB 2OJ2A 4M75E 4BCKB 3RUXA 2I2LA 5LJ5d 1JKWA 2QEXQ 5KYWB 1W70A 1EFNA 3N5BB 2ROLA 3G71A 1YP5A 1GXIE 3CCQA 1RAIB 2HKQB 2KQWA 3QHWB 1TU0B 1N8RU 4M7AE 1OEBA 4HA8A 2ATCB 3JRZA 4B9XA 3CPWA 3UPUA 4ATOA 5D6YA 5KE2A 4OMNA 5C0MA 3QIIA
chains in the Genus database with same CATH topology
5GAMj 4PJOE 3SWNA 2YLCA 5LJ5f 3KBGA 2E5QA 3M54A 2RK2A 2XDDA 3ZFJA 2CZ7B 2LNVA 3LGFA 1G3WA 4Q5WA 1Q82U 4II1A 3RIRA 2EJ9A 2JNGA 4VUBA 5CKDA 2E10A 3X26B 2XICA 1S72A 2XDBA 5A0LA 3DLLA 2EWNA 2E64A 2KMTA 4BB7A 5CIUA 3EAEA 5GANd 4IUUA 4NOYA 4PNOA 5CO7A 2DXBB 3CC2T 2EAYA 2MMPA 3CCET 2RH2A 4F7UE 3CCSA 1Y7XA 1VQ7A 3HRTA 2LQKA 3VYHB 1K73C 1YJ9A 3CPFA 4ZTFA 3RESA 2WSCE 4L59A 2OTJT 2PUKB 3VKHA 3BW1A 3CCRA 3NTHA 2PQWA 3CC4T 2ZPFB 1VQ8A 3V8LA 4Z6YA 4LDWA 1M1KC 1Q81U 1WJQA 5LJ3j 4JX5A 1QVFA 4J5YA 1OI1A 1KHIA 2RD1A 1OYXA 3MP8A 1UEBA 2E65A 4A53A 4E7HA 4M7DD 3PMTA 4N4HA 5CKEA 3CCUT 1VQ9T 1B34B 2K3YA 3CMAA 4RCCA 1G3SA 3I55A 2GFUA 3QZ9B 4BI8B 3OS2A 3VYGB 2EJGA 4C92G 2K5LA 2P0QA 4MIMA 2LT1A 3CCMA 3CCVT 1VQ6A 4M77E 1VUBA 3ME9A 4HCCA 4AKGA 4MZTA 4JRQA 1XNIA 2EQJA 5GAOn 4EDUA 4M77B 3PNWC 1YJNA 1PSEA 2KSSA 5GAMh 2X4XA 4M6VA 3WXMB 4QSHA 1X6OA 2DXTA 2JZ2A 1Y96B 2KY9A 1BYMA 1K8AU 4M7DA 3M53A 1SSFA 3PGGA 2EYQA 3CD6T 4GLKA 4C0FA 1FWZA 3OYMA 2LC4A 3S3NA 3OY9A 2KDSA 2VC8A 5GAN8 1VQLA 4M75D 5GAN2 3CBMA 2QDYB 5GAMg 1BI3A 3CXCA 3FJPA 3VKIA 3M58A 2MWOA 2RJEA 2K3XA 3GPLA 3QJ6A 4ZGEB 2BIVA 2OTLA 2K2VA 3EFSA 2K5IA 3G6EA 2LQ8A 4M78C 3CMET 2QQAA 1Y71A 5I2MA 2VUBA 2KVQG 3M5AA 5GAMe 1WGSA 2KR6A 2B8AA 3I56T 4M7AD 2R57A 5LJ3h 3TCJA 3CBPA 2RB6A 1VIEA 2AHJB 3JCMX 1H3ZA 2DK3A 5FLXE 4DQ2A 3QYEA 1ZHIA 2E1HA 4M75A 4C0DB 1NPPA 4RG8A 4JRIA 1E7PA 5J39A 1YHQT 1VQKT 4IKFA 1G3TA 5D6XA 5I2SA 1BIAA 4MMLA 4LD9K 1KQ2A 4C8QE 5EG2A 4BI4A 2X4YA 5GAN6 2C06A 1BIBA 1N9SA 2A7YA 4OGEA 2LVMA 2QQ8A 3LH0A 3SB2A 4C8QB 4PJOD 1M1FA 2V8JA 5LJ3g 5EJCA 2XHCA 3ASKA 2MAMA 5A2QE 3JCMc 4HNUA 3A5ZB 1QVGS 4M7AA 2HAXA 5J3BA 2FL7A 4FL6A 3QPHA 2QI2A 1W2BA 4TVRA 5GMKh 1H641 2RJCA 4OB2B 1HK9A 3GNGA 4XAXB 1KC8C 3JB9J 3X25B 1KQ1A 2X4JA 3MHXA 5LJ3e 1UGPB 4RMOA 1QP2A 3E9GA 3OB9A 3OMGA 3M57A 3JB9H 4M7DF 3H4CA 1AHJB 3QYBA 1Y07A 2M1HA 4ZN1A 4BBRM 2RA2A 3O8VA 2ZGWA 5IAYA 4Y91A 1YI2T 1N8RC 3J7AF 2IVWA 4JX4A 4C0ZA 5FU6B 3OYFA 4PJOA 2XK0A 2E70A 3L2UA 2QQSA 4A4KA 3CCUA 1BI0A 4X9DA 1JBMA 4FT4A 3JCMg 5J26A 3LLRA 3V7SA 1MHNA 1JB0E 1HXDA 2CGHA 2EKOA 5FU6C 4JLGA 5L8RE 3S6WA 3CCVA 2DXBA 2O4XB 1I4K1 1UGSB 4ZN3A 3CCJA 2DKGA 1XTDA 4IUVA 4C5IA 1YIJT 4IUQA 4F7UA 5GANj 1QVFS 4J83A 1Q7YU 4M75G 1V29B 3DL1A 1WQWA 1N9RA 3OS1A 1Q82C 1VQ5A 2BS4A 4EMKB 4OMFB 1WJRA 5A0GA 3E1SA 2WSFE 3T9NA 1VQPA 4M75F 2DXCA 4GY5A 1UGQB 2R5AA 2RHZA 4M77D 1FX7A 4PL6A 1QW1A 4X34A 3G4SA 5AYFA 2GF7A 3MCAB 3A8LB 3P8BB 4QVCA 3OYHA 2ZZDB 3OYYA 4EMKC 1YITT 3L1AA 2ZPIB 5HKCA 4M7AG 3CEYA 1KD1U 3M59A 3META 5DLQE 1KQSA 4R55A 3CC7T 3L2RA 2RHYA 4A4GA 2HNIA 4M7AF 3A8GB 1IZ6A 5D6WA 5FRMA 1LNXA 4J6XA 4XU3A 3OBYA 5CQYA 3RKXA 1NJIU 2EJFA 2QA4T 4M77A 2YHTA 4A4HA 1WPYA 3QXEB 3TW6A 3BY7A 5KH6A 1VQ4A 3J80E 3GF5A 4PJOG 3BDLA 3OYBA 5A0DA 1KHCA 2X4WA 3HKSA 4ZGJB 2LDMA 1XQHA 4E47A 5CR2A 1YHQA 4PJOF 2HBPA 3V7RA 4BACA 2BKDN 1MGQA 4KULA 2L8DA 4HT9A 3M4YA 3J81E 4FT2A 1XOVA 2E41A 3QYHB 3E19A 3VV0A 2DVEA 3PIPA 2FHDA 2RM4A 3OQ5A 4OF1A 1BI1A 4F7UG 3BDUA 3PTAA 1VQMT 1OZ2A 1KG1A 4XTYA 4AKIA 3C94A 1VQOA 2XKOC 2R5MA 3DB4A 2RJDA 3KHIA 1M4ZA 5GAMd 4V2SA 4J7FA 2D9TA 4F7UF 3JCMJ 1N6AA 4C8QD 5HK0A 4C92B 5KCOA 4E7JA 5GAOr 2HD0A 2P0KA 2MF2A 2XIDA 3M9QA 1K73U 5C6SA 3UWNA 5KCHA 1QVPA 3URGA 3LWIA 3TEEA 4NC6A 2BUDA 3UDCA 4C92C 2XU8A 3QUIA 2NLUA 4HT8A 5IT9E 4L5GA 5GANg 4M78E 3L2QA 3A8HB 3G71T 3V7CA 3OYKA 4M78B 2BS3A 2RJFA 4C8QA 3PFSA 2EQUA 1W2BS 4JRKA 4M77G 1X75C 2EIFA 5FRNA 4AI6A 5IN1A 4FU6A 1YIJA 5GAMf 4PLIA 4BBSM 5GANe 3OYAA 1LJOA 3KXTA 1YJWT 2LCCA 2QTXA 3M56A 1TH7A 4FM4B 4M77F 4YTLA 2K5FA 2XG8D 3R6OA 3OSVA 3OW2A 4JS5A 3PIOA 3LWHA 2RI2A 2R58A 2ZCFB 1D3BB 2RHXA 1K9MC 3LW5E 5HY6A 4JJNK 3BFMA 3JCMP 4A4FA 3SDZA 2MWPA 4PKCC 4KUDK 3CC7A 1N27A 5LJ5j 4JRPA 3OS5A 3P8HA 4CRIA 4QVZA 4X9CA 1PSFA 3CCEA 4BDZA 2X35A 1W4SA 5FROA 3CPWS 2JN0A 3MEVA 1M90C 3CC2A 1I8FA 3OYGA 2O4XA 2PU9B 1YBYA 3JAME 3FC3A 2VXFA 2QA4A 5LJ3f 5GAOp 4BE0A 4HNTA 4QQGA 3LX7A 2OTJA 5GAN3 1YJ9T 3CC4A 2CKKA 3JCMh 2DD5A 4N0AC 3CCRT 2XD0A 4EMKA 3L2ZA 2RHUA 4NS5A 3GP8A 1Q86C 1VQ8T 3VU3C 4ZTJA 4M7DB 3BG5A 3HP9A 2XDPA 4MZMA 5CKFA 2G77A 2YLBA 4XK8E 1ZBXA 2RO0A 2VGNA 3DLMA 4JUVA 4C8QG 5CK9A 5GMKi 2DPPB 4JX6A 2ZZDA 4O5VA 4DOWA 2M9UA 3MEAA 1U1TA 4MZPA 4A4EA 1VQ9A 3QBYA 4M7DC 3OBWA 4C8QF 3L42A 1FXXA 4IUPA 4OB0B 4QQ6A 3OA6A 4KUIA 2JTFA 3NTKA 5HK3A 1M5Q1 3JCMf 4JLIA 3Q1JA 3OYEA 3MEUA 3TU4K 2KMGA 3RMSA 4JDSA 5M9OA 2HQXA 3JCMW 4BD3A 1IREB 2EFIA 3HL8A 3FRNA 3SD4A 3JCMe 1R8OB 1ZQ1A 5CVIA 4EMGA 3QO3A 3INZA 1BKBA 2JOYA 5KE3A 4OB3B 4IURA 5LL6S 2E6ZA 4N4IA 4M75B 3ER0A 3HFOA 4C92D 4ELYC 3JCMQ 1KD1C 4J6YA 3ZBDA 4DOVA 1KC8U 3CD6A 4LOCA 4BE2A 3JSCA 2GQVA 3HSBA 2CZ1B 3A8MB 2V8IA 4BY6B 5LJ5h 4C5EA 3GLXA 4M75C 2DD4B 2D0QB 3A8OB 1B34A 4ELZC 2DIQA 3HZJA 4OVAA 2QQRA 4L6V5 3F70A 4M7AB 3VUZA 3VYGA 2LTOA 2QF7A 4BY6C 4NL3A 3CMEA 3CCLT 3NTIA 2LT4A 4UC4A 2OTLT 4M78D 3RMQA 3G6ET 1Q81C 3VKGA 2ZPGB 3TW7A 1U1SA 3I56A 5LJ5g 1QVGA 4E7LA 4M7AC 3QWLA 1EIFA 2XI9A 3HB9A 1X01A 4QVDA 2PVDB 1P92A 1Y96A 1JJ2A 2DEQA 2P0PA 4PJOB 1VQKA 4AKHA 2DTHA 2F69A 3SFMA 5LJ5e 3CXCS 2DAQA 3MEWA 4CI0C 2JTMA 4C0GA 3G7ZA 5GAN4 2JVVA 2OAUA 1QP3A 3CBOA 4OGCA 4XTZA 2P4TA 2Y90A 4M78A 4XTWA 3RKYA 4PJOC 3KUFA 4KBMB 3LYIA 4ZGDB 2F5TX 1VIFA 2DJZA 4RG2A 3OW2S 1DJ7B 4O6JA 4D6WA 2KK4A 4C92E 3S3MA 2QFZA 2PVGB 4F7UB 5GANh 4M7DG 1M9SA 3DB3A 2E12A 3QG1A 2K57A 1K8AC 1WNLA 3E9FA 4DA4A 1LOJA 2PUOB 2FYKA 3VUBA 2DXUA 1WJSA 4E7KA 2CYZB 2WSEE 2QQBA 3LGLA 3MO8A 2WJ9A 1D3BA 2DXCB 3SWNB 4C5GA 3OYLA 3JB9D 1YI2A 1FKMA 4J6WA 3QHSA 4XTXA 4P5NA 5GAN5 1VQNT 3VJPA 4HL4A 3HO8A 5DLOA 4HNVA 3QDRB 4KT0E 4RKUE 5GMKl 2ZPHB 2QXFA 4MDXA 3HRSA 1M1KU 3H8ZA 2GCXA 5GAOm 3HFNA 3SWNC 2FVUA 2Y4YA 4RCBA 3PT9A 4HCZA 5GANf 1OZ3A 3CCQT 2RI3A 3GNFB 3OYIA 4N0AA 2O01E 2V8KA 4XU0A 3OYCA 3MP6A 4M7DE 2DZ9A 3WVEB 2YRVA 3C12A 5DM7R 5DY9A 3CCJT 3DKMA 3M4GA 4C92F 2VV5A 2JUFA 5LJ3d 2QEXT 3OMCA 3ZEHA 5GMKj 4OP0A 4QQDA 2L89A 3L2VA 2ZPEB 3WVDB 1VQ5T 3TREA 2EQKA 1BI2A 4BDYA 4HCBA 2QDJA 4XQ3A 3OYDA 4M77C 4FSXA 1VQPT 2E6NA 4M78G 3QSUA 3L2WA 1YITA 3G4ST 3QYGB 3HBLA 4FIBA 4NL2A 2CZ6B 3FLGA 2D6FA 3RERA 4M78F 2CS7A 2G3RA 4ELJA 4EPCA 3BG3A 3OS0A 5I21A 1S72T 3NFCA 4N4GA 3JCMV 3JB9I 1UGRB 4OB1B 3X20B 2DZCA 3CCLA 4ME7A 4BE1A 3FDRA 3JCMd 2DIGA 3HHTB 1I81A 2QQ9A 4LDUA 3BG9A 3HPWA 3CCST 3X24B 4BI3A 1VQ7T 5CAIA 2RI5A 5CCAA 3QKJA 1O9SA 4A54A 1O75A 4C5HA 1VQ4T 4WF2A 2PVOB 1G3YA 2RK1A 1NZ9A 4B9WA 1RI0A 5FU7B 1JRIA 3S3OA 4BUGA 3M55A 4QW2A 3FEOA 1NPRA 4HLQA 4XTVA 3PMIA 2HQEA 5GAOl 3QZ5B 4MFDA 1M8VA 2LX9A 2KAFA 2EQMA 4LDYA 1UB4A 1KQSS 4J7IA 2ZPBB 3V8JA 1K9MU 2WACA 3OSSC 5FU7C 3RKWA 3H6ZA 2DTOA 2M0OA 4HKEA 4LDVA 1U8RA 5CKBA 1I5LA 3GIBA 4C0DC 2DD4A 4E7IA 2VYTA 1VQMA 4J8OA 3JB9G 2RHIA 2DTIA 2IG0A 2CZ0B 1Q7YC 3CMAT 2L5QA 3OYJA 3QJYA 3OYNA 3I55T 2LRQA 2M16A 1VQOT 1VQ6T 3JB9F 3CCMT 3AHUA 4C8QC 4IUTA 5GAOq 1M90U 3GOXA 1JJ2S 4LDXA 5CQXA 3HRUA 3X28B 4PLLA 3V8KA 4MMKA 3UT1A 4XTUA 4M75E 3P8DA 2L3RA 5CKHA 2DO3A 3RUXA 1YJNT 4XU1A 1VQNA 1NE8A 2I2LA 3EFRA 5LJ5d 4Z02A 1M1GA 3N5BB 4R56A 1Q86U 1G5VA 3G71A 2BS2A 2A3LA 3FB9A 2GFAA 1GXIE 3CCQA 4EMHA 4Y28E 2KQWA 2Y4XA 2F5KA 2VGMA 2VXEA 3MP1A 4LD6A 1N8RU 1NJIC 1VQLT 4M7AE 2LCLA 1RL2A 2K4YA 4JS4A 3C4SA 2FB7A 4MFEA 3C95A 5GMKm 3JCMb 1YJWA 4HA8A 2QEXA 3JRZA 4B9XA 5GMKe 1YCYA 3CPWA 3UPUA 3FIFA 4ATOA 5D6YA 2MI6A 2DD5B 1WQ7A 2H3JA 4MDWA 4C92A 5KE2A 5GAN7 1QLBA 5C0MA 4XU2A 3QIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  2DXC B;  1AHJ B;  3LW5 E;  2CZ7 B;  4RKU E;  4KT0 E;  2ZPH B;  3X26 B;  1PSF A;  1JB0 E;  5L8R E;  2O01 E;  2DXB B;  2DXB A;  2PU9 B;  1UGS B;  3WVE B;  3VYH B;  2WSC E;  2PUK B;  1V29 B;  2DD5 A;  2ZPE B;  2ZPF B;  3WVD B;  2WSF E;  2DXC A;  1UGQ B;  4XK8 E;  3A8L B;  3QYG B;  2DPP B;  2ZZD B;  2ZZD A;  2CZ6 B;  2ZPI B;  4OB0 B;  3QZ9 B;  1UGR B;  4OB1 B;  3VYG B;  3X20 B;  3A8G B;  3HHT B;  3X24 B;  1IRE B;  3QXE B;  1PSE A;  2PVO B;  4OB3 B;  4ZGJ B;  3QZ5 B;  3QYH B;  2ZPB B;  2CZ1 B;  3A8M B;  2DD4 B;  2QDY B;  2D0Q B;  2DD4 A;  3A8O B;  2CZ0 B;  4L6V 5;  4ZGE B;  3VYG A;  2ZPG B;  3X28 B;  2AHJ B;  2PVD B;  2CYZ B;  1GXI E;  3A8H B;  1QP3 A;  4Y28 E;  4ZGD B;  1DJ7 B;  2PVG B;  4FM4 B;  2DD5 B;  4OB2 B;  3X25 B;  2PUO B;  1UGP B;  2WSE E;  1QP2 A; 
#chains in the Genus database with same CATH topology
 1D0X A;  1NEB A;  3SWN A;  4ROC A;  1VQ7 Q;  2LNV A;  4BCG B;  1F5Q B;  2WIP B;  2AKL A;  3X26 B;  2XIC A;  1OPL A;  3EAE A;  4AMC A;  1G83 A;  5EC7 A;  2DF6 A;  3CC2 T;  4ZNX A;  3EH1 A;  4HXJ A;  1YJ9 A;  4LE9 A;  1JEG A;  4L59 A;  2OTJ T;  3BW1 A;  3CCR A;  3RNJ A;  5IHK A;  2GTO A;  2PQW A;  3CMA Q;  3V8L A;  4Y92 A;  4LDW A;  1M1K C;  5LJ3 j;  1VQ6 Q;  2MK5 A;  3MP8 A;  4A53 A;  2HBW A;  1YJN Q;  1VQ9 T;  1B34 B;  4YOS A;  4RCC A;  3I55 A;  1AOJ A;  3C0C A;  2M02 A;  2F1L A;  2LNH B;  4BCQ D;  4EOL B;  1VQL Q;  1PSE A;  1D1A A;  2BE9 B;  1K1Z A;  4QSH A;  2DXT A;  1OL1 B;  1Y96 B;  2HL5 C;  1M30 A;  2FZK B;  4C0F A;  3OY9 A;  2KDS A;  4M75 D;  5GAN 2;  1K9A A;  2EYZ A;  3VKI A;  2RJE A;  3GPL A;  1MMG A;  1SEM A;  3QJ6 A;  1JO8 A;  2OTL A;  3EFS A;  4M78 C;  2HMA A;  3M5A A;  5GAM e;  2DL5 A;  2B8A A;  4M7A D;  1QMZ B;  2UZE B;  4EOS B;  4DQ2 A;  1KQS P;  4M75 A;  3UA6 A;  1M90 R;  5D6X A;  3CC4 Q;  1BIA A;  4MML A;  2W9Z A;  1BIB A;  4OMO A;  4EOJ B;  2V8J A;  1ZA2 B;  5LJ3 g;  5EJC A;  1QVG S;  3A5Z B;  4M7A A;  1K0S A;  2YRD A;  4PFO A;  2YUP A;  4FL6 A;  1W2B A;  1YNZ A;  4TVR A;  5GMK h;  4XAX B;  3GNG A;  1PWT A;  3RR6 A;  1KQ2 A;  3JB9 J;  3X25 B;  1KQ1 A;  4RMO A;  1QP2 A;  3E9G A;  2M1H A;  4BBR M;  1UEC A;  2QQS A;  1RLP C;  4A4K A;  3CCU A;  4FYY B;  4X9D A;  2CDT A;  3LLR A;  3V7S A;  1MHN A;  3I5S A;  4JLG A;  3NPF A;  2JXB A;  2CUB A;  1Q82 R;  3CD6 Q;  1UGS B;  5IXF A;  5DQV A;  4D8D A;  1XTD A;  3MY5 B;  1CKA A;  5GAN j;  1WQW A;  1VQ5 A;  4OMF B;  1WJR A;  2NUZ A;  5A0G A;  3E1S A;  3T9N A;  1VQP A;  4M75 F;  1WXT A;  1UGQ B;  2F2C A;  2RHZ A;  3MPU B;  2G6F X;  1MUZ A;  3G4S A;  5AYF A;  3MCA B;  4EMK C;  2IVX A;  3I56 Q;  8AT1 B;  1Q81 R;  3CEY A;  3QHR B;  4F04 B;  2FPE A;  1KD1 U;  4R55 A;  3OW2 P;  1D1B A;  4M7A F;  1IZ6 A;  2LZ6 B;  2LX7 A;  4XU3 A;  3RKX A;  1NJI U;  2QA4 T;  1C1A A;  1NM7 A;  2C0I A;  3BY7 A;  4PJO G;  1KHC A;  3HKS A;  3JV3 A;  2LDM A;  4JJD A;  1MNE A;  3REB B;  5CYI B;  5CR2 A;  3RDV A;  2FPD A;  3GBQ A;  1YHQ A;  3G1J A;  5KYU B;  2HBP A;  2BKD N;  4KUL A;  4HT9 A;  2L8D A;  3H9N A;  5CEI B;  4FT2 A;  2E41 A;  3QYH B;  4OML A;  2WEV B;  4KRT A;  2OI3 A;  4RTU A;  1K8A R;  5HCK A;  3BDU A;  4XTY A;  1VQO A;  1AZE A;  3EGX B;  1N6A A;  4ROE A;  4C92 B;  4GBQ A;  2MF2 A;  2XID A;  3M9Q A;  5C6S A;  4CFM B;  3URG A;  2C5X B;  3TEE A;  4BCJ B;  2DA9 A;  5BNJ B;  2H8H A;  5IT9 E;  5GAN g;  4BCP B;  3DOG B;  2CP5 A;  1JU5 C;  2EUF A;  2DVJ A;  3V7C A;  3G71 T;  2HL3 A;  3EG9 B;  2RJF A;  3PFS A;  2XMF A;  4JRK A;  4FW2 A;  1KFZ A;  1QKW A;  4RTY A;  2LW4 A;  4X1V A;  3OYA A;  3KXT A;  2QTX A;  4FM4 B;  1JOW A;  3OSV A;  1H1S B;  4CFV B;  4CXA B;  1X6G A;  2ZCF B;  4BCM D;  5HY6 A;  2GNC A;  4KUD K;  5LJ5 j;  3CCE A;  1PD1 A;  1W4S A;  2DL8 A;  4PJM A;  1H24 B;  1SRM A;  2O2O A;  2PU9 B;  1YBY A;  3JAM E;  3PE0 A;  1FVV B;  4HNT A;  1YJ9 T;  2CKK A;  2DD5 A;  3CCR T;  3GP8 A;  5KYY B;  1Q86 C;  3VU3 C;  4ZTJ A;  4M7D B;  1GL5 A;  3BG5 A;  2A0F B;  2YLB A;  4KGX B;  4XK8 E;  1BB9 A;  3DLM A;  2RO0 A;  4C8Q G;  5CK9 A;  4JUV A;  2DFU A;  5GMK i;  2DPP B;  4JX6 A;  1IGU A;  1H8K A;  4MZP A;  4A4E A;  1BU2 A;  2KGT A;  1NYF A;  2IW6 B;  5HK3 A;  3JCM f;  2IIM A;  4JLI A;  3MEU A;  1FYN A;  2KMG A;  4JDS A;  1IRE B;  3HL8 A;  3JCM e;  4J9B A;  1ZQ1 A;  5CVI A;  5KE3 A;  2YUQ A;  4OB3 B;  2VKN A;  2E6Z A;  4C92 D;  2DRM A;  2PMI B;  3ZBD A;  4BE2 A;  2WPA B;  3JSC A;  2WFY B;  2CZ1 B;  4M75 C;  2DD4 B;  3HZJ A;  2QQR A;  2YUN A;  4BY6 C;  2OTL T;  3KFV A;  2OX7 A;  3TNW B;  1QVG A;  5LJ5 g;  1WLP B;  4M7A C;  5HBE B;  2XI9 A;  1P92 A;  1JJ2 A;  1SHG A;  4RUG A;  1SKU B;  2KXD A;  3CXC S;  3QWX X;  3EG2 A;  2OAU A;  4OGC A;  4XTW A;  3RKY A;  4KBM B;  4ZGD B;  2DJZ A;  1DJ7 B;  4RTW A;  1WA7 A;  2PVG B;  4F7U B;  5AT1 B;  5GAN h;  3QDF A;  3QG1 A;  1E7O A;  3EID B;  3LGL A;  4KRD B;  4C5G A;  4XTX A;  4J6W A;  4P5N A;  2RQR A;  3HO8 A;  2ABL A;  4MDX A;  3H8Z A;  2GCX A;  2HKN A;  1E9H B;  2FVU A;  2Y4Y A;  4RCB A;  2CRE A;  5IHI A;  1OZ3 A;  1VYW B;  2MIO A;  2O01 E;  1H28 B;  2V8K A;  4PJJ A;  3WVE B;  5DM7 R;  4C92 F;  5LJ3 d;  3BLR B;  2ZPE B;  3TN8 B;  2QK0 A;  1VQ5 T;  1AT1 B;  1BI2 A;  1EZZ B;  5KYY A;  4BDY A;  3OYD A;  4HCB A;  2F2X A;  2SEM A;  2X51 A;  4FSX A;  1VQP T;  3H0I A;  1M3B A;  3G4S T;  2DL4 A;  2CZ6 B;  2D6F A;  2C0T A;  2P4R A;  3CPW P;  4EC8 B;  3K7A M;  1R0B G;  3BG3 A;  1S72 T;  3BLQ B;  1ZUU A;  4LXC A;  3EGD A;  3CCL A;  2PK2 A;  1YN8 A;  4BE1 A;  3FDR A;  1WXB A;  2QQ9 A;  3HHT B;  1GRI A;  3CCS T;  1X2Q A;  3M0R A;  4LN2 A;  4BI3 A;  1G8X A;  1M2V B;  1IHV A;  2P84 A;  2YXY A;  2KXC A;  4IIO A;  3QZ5 B;  4LDY A;  2EQM A;  1UB4 A;  2JT4 A;  4J7I A;  3OSS C;  5FU7 C;  2M0O A;  2YSQ A;  1TUC A;  2DD4 A;  2VYT A;  1VQM A;  1Q7Y C;  3OYJ A;  3I5R A;  4LUD A;  1VQO T;  3CCM T;  2CP7 A;  3AHU A;  4IUT A;  5GAO q;  1M90 U;  5CQX A;  3X28 B;  4PLL A;  2VWF A;  4XTU A;  1UJY A;  2DO3 A;  4XU1 A;  3EFR A;  3CCJ Q;  1GH6 B;  3H0H A;  3FB9 A;  2GFA A;  1XJW B;  1T0H A;  2Y4X A;  2F5K A;  3MP1 A;  4LD6 A;  3TSZ A;  4JS4 A;  1RL2 A;  2K4Y A;  1AEY A;  4MFE A;  4FYV B;  2VAS A;  4DBF A;  2QEX A;  5GMK e;  3FIF A;  2MI6 A;  5KYX A;  2QG9 B;  4F16 A;  4PJO E;  3KBG A;  2XDD A;  3ZFJ A;  4EON B;  1PG5 B;  4HVV A;  2HDA A;  1Q82 U;  3MKD A;  1VQ4 Q;  3RIR A;  2BZ8 A;  2EWN A;  2E64 A;  4BB7 A;  5GAN d;  3BLH B;  4NOY A;  3CCE T;  2EAY A;  2DMO A;  1VYV A;  2MMP A;  2RH2 A;  1TS9 A;  1VQ7 A;  1XO2 A;  3VYH B;  2BE7 D;  2PUK B;  3VKH A;  3NDQ A;  1YWO A;  2ZPF B;  4Z6Y A;  1Q81 U;  4JX5 A;  2O88 A;  1QVF A;  1JXO A;  1OI1 A;  1VOL A;  3M0U A;  1PD0 A;  1OYX A;  2F2W A;  1UEB A;  4N4H A;  1W2B P;  3FJ5 A;  3CMA A;  2QAS A;  3QZ9 B;  4C92 G;  1VQ6 A;  1PNJ A;  2QAZ A;  3CCV T;  5D7U A;  1BK2 A;  4JRQ A;  2EQJ A;  2V1Q A;  4Z89 A;  1YJN A;  2KSS A;  2X4X A;  4M6V A;  1K8A U;  1SSF A;  2E3H A;  3R6N A;  2WHB B;  3S3N A;  1I5O B;  1VQL A;  1BCM A;  1M8M A;  4KH1 B;  1UG1 A;  3CXC A;  3FJP A;  3M58 A;  1GUX B;  2BIV A;  4YOO A;  3G6E A;  4ORZ A;  1OI9 B;  2QQA A;  1Y71 A;  1WHM A;  2KVQ G;  2KR6 A;  2PNI A;  3CC2 Q;  4JPB W;  1W98 B;  2RB6 A;  2AHJ B;  4FSS A;  3JCM X;  2DK3 A;  2KR3 A;  1ZHI A;  2E1H A;  4C0D B;  1NLO C;  2OTJ Q;  2L3P A;  3A1P A;  5I2S A;  4C8Q E;  4J9I A;  2C06 A;  2A7Y A;  2GGR A;  2LVM A;  1MV3 A;  3SB2 A;  4PJO D;  4C8Q B;  2W0Z A;  2XHC A;  4J9D A;  2MAM A;  3JCM c;  1Q86 R;  2E5K A;  1NBE B;  2J6O A;  2BPM B;  4OMP A;  2QI2 A;  1VQ9 Q;  4M7D G;  5HNB B;  1H64 1;  4OB2 B;  4F6S B;  2EGE A;  2JW4 A;  3MHX A;  5LJ3 e;  1UGP B;  3JB9 H;  3H4C A;  1AHJ B;  1Y07 A;  1VQN A;  2RA2 A;  1N8R C;  3OYF A;  4C0Z A;  5FU6 B;  2M0Y A;  4PJO A;  1IXD A;  2XK0 A;  2E70 A;  1BI0 A;  4FT4 A;  1W1F A;  2LJ3 A;  3S6W A;  1HXD A;  2EKO A;  1K0X A;  4CRL B;  4FCY A;  2AT1 B;  3IQL A;  2KYB A;  4IUQ A;  1BCO A;  1YIJ T;  4J83 A;  1V29 B;  2BS4 A;  1OPK A;  2DXC A;  4GY5 A;  3NHN A;  2GF7 A;  3P8B B;  3A8L B;  2ZZD B;  2UUE B;  3L1A A;  5HKC A;  2D1X A;  2WIH B;  2WMB B;  3M59 A;  3CC7 T;  1B3Q A;  4BY7 X;  2RHY A;  3L2R A;  2LP5 A;  3CQT A;  5FRM A;  2AZS A;  4J6X A;  4BXX X;  5FWB A;  3OBY A;  5CQY A;  2FRW A;  2EJF A;  3QXE B;  5KH6 A;  2IW8 B;  3J80 E;  1OIY B;  3BDL A;  2LQN A;  1WIE A;  1TTH B;  2UZD B;  4PJO F;  3J81 E;  1XOV A;  1QLY A;  2K9G A;  1MV0 B;  2DVE A;  4F6U B;  1UE9 A;  4F7U G;  1KSW A;  1VQM T;  1OZ2 A;  2EGC A;  1CKB A;  1KG1 A;  1GUX A;  4J9C A;  3DB4 A;  3VS3 A;  3KHI A;  4V2S A;  4J7F A;  4C8Q D;  1NLP C;  4E7J A;  2O9V A;  3UF4 A;  4EIK A;  2P0K A;  2EQI A;  2L0A A;  1WHJ A;  4L5G A;  4GLM A;  3L2Q A;  3A8H B;  2BS3 A;  3UA7 A;  4C8Q A;  2EQU A;  5IN1 A;  2KYM A;  5GAM f;  4PLI A;  5GAN e;  3TQ7 P;  3M56 A;  3VS1 A;  2CH4 W;  2NUP B;  2RI2 A;  3G33 B;  2RHX A;  1K9M C;  5I5Z B;  3LW5 E;  3BFM A;  2QA4 Q;  3JCM P;  4A4F A;  5KYW A;  3SDZ A;  1W6X A;  3O0G D;  3OS5 A;  4CRI A;  4X9C A;  1PSF A;  1QVG P;  5FRO A;  2JN0 A;  3OYG A;  5L23 A;  2V22 B;  1Z9Q A;  1JJ2 P;  1I07 A;  4BCI B;  4OGR B;  4N0A C;  3DDQ B;  2RHU A;  4NS5 A;  4ELL A;  4QT7 A;  2RQU A;  1D09 B;  1VA7 A;  1ZBX A;  1Q7Y R;  2VGN A;  1RUW A;  2ZZD A;  1GY3 B;  4WCI A;  1OIU B;  1FMV A;  4C8Q F;  4IUP A;  1ZUY A;  4A63 B;  2JTF A;  3OYE A;  2YWW A;  3Q1J A;  2HQX A;  3G71 Q;  4BD3 A;  3SD4 A;  1U5S A;  1AWX A;  3TNH B;  4N4I A;  1ARK A;  1KD1 C;  4J6Y A;  3EG3 A;  2GQV A;  1OU8 A;  2RPN A;  1ZUK A;  2F2V A;  1B34 A;  4FYW B;  2A28 A;  4L6V 5;  2PJQ A;  1LPL A;  2NUT B;  3CME A;  2LT4 A;  2JS2 A;  3RMQ A;  3G6E T;  3VKG A;  1X01 A;  4QVD A;  1Y96 A;  2P0P A;  1YJ9 Q;  1VQK A;  5HBJ B;  2F69 A;  1OOT A;  2QGF B;  3E2U A;  5LJ5 e;  2DAQ A;  4CI0 C;  4CFU B;  2JTM A;  2JVV A;  1IHW A;  1ENW A;  1K4U S;  4XTZ A;  4PJO C;  1GFD A;  3KUF A;  4KRC B;  2DNU A;  1VIF A;  3OW2 S;  1VYT A;  1UGV A;  2CCH B;  4C92 E;  3S3M A;  1M9S A;  3MY1 B;  1AWW A;  2FYK A;  2DXU A;  5I11 A;  4HCK A;  1YI2 A;  2WJ9 A;  3OYL A;  1UUE A;  8ATC B;  5GAN 5;  1VQN T;  4HL4 A;  1H4L D;  5DLO A;  4RKU E;  5GMK l;  2AIR B;  1ABO A;  1GBR A;  3EHQ A;  2IW9 B;  1ACM B;  3HFN A;  3SWN C;  5GAO m;  1ZBJ A;  3CCQ T;  3OYI A;  3MI9 B;  1MMN A;  1PHT A;  3MP6 A;  1OV3 A;  3M4G A;  2YT6 A;  1HD3 A;  2YUO A;  2EQK A;  2QDJ A;  4XQ3 A;  2OTL Q;  2FPF A;  2E6N A;  1YCS B;  1YIT A;  3EJ1 B;  3HBL A;  4J9F A;  1C0M A;  4NL2 A;  3FLG A;  1GCQ A;  1NYG A;  2CS7 A;  4ELJ A;  3NFC A;  1TFB A;  3X20 B;  1IRX A;  4RTT A;  2DIG A;  4LNP A;  4E6R A;  3HPW A;  1OX8 A;  3X24 B;  1H26 B;  1T3S A;  2RI5 A;  5CAI A;  4A54 A;  4AFZ C;  2PVO B;  4M7D E;  1WFW A;  2DET A;  2BKZ B;  4BUG A;  3M55 A;  4QW2 A;  4XTV A;  5GAO l;  1PRM C;  4DBR A;  2LX9 A;  1JQQ A;  3H6Z A;  4AG2 C;  1I5L A;  5CKB A;  2YDL A;  4C0D C;  4J8O A;  3H0F A;  4BCF B;  2L5Q A;  3OYN A;  4CFU D;  3I55 T;  2LRQ A;  1HYO A;  2O31 A;  1QVF P;  2W2H A;  4C8Q C;  1IGQ A;  4LDX A;  3HRU A;  3UT1 A;  1TSF A;  3P8D A;  3SEM A;  5CKH A;  5KYU A;  4R56 A;  1Q86 U;  1G5V A;  2BS2 A;  1VQ5 Q;  1M2O A;  2UZB B;  4EOK B;  1SRL A;  1VQP Q;  1OQK A;  1ZLM A;  2FB7 A;  3C95 A;  3G4S Q;  1YJW A;  2J6F A;  2L3Q A;  2CJM B;  3EGX A;  1YCY A;  2PZ1 A;  1WQ7 A;  1S72 Q;  3VS4 A;  4C92 A;  5GAN 7;  1UFF A;  2V26 A;  4DEX A;  2GBQ A;  2YLC A;  3CCS Q;  3CXC P;  2E5Q A;  3M54 A;  1FIN B;  3VS5 A;  3LGF A;  2LQW A;  1G3W A;  1TUD A;  1ZP2 A;  4II1 A;  2JNG A;  2E10 A;  1RAG B;  1SPK A;  3DLL A;  2K2M A;  3EG9 A;  4CC3 A;  5CIU A;  2DBM A;  2AK5 A;  1JSU B;  4PNO A;  2DXB B;  5CO7 A;  4F7U E;  3HRT A;  2LQK A;  1M1K R;  4OR5 B;  3DJB A;  1K73 C;  1QCN A;  3CPF A;  1Q95 G;  2DL3 A;  1WI7 A;  2EGA A;  4R0K A;  3NTH A;  1VQ8 A;  1VQO Q;  1WJQ A;  2LJ1 A;  3CCM Q;  4J5Y A;  4E7Z A;  4EC9 B;  2QDL A;  4BCN B;  2E65 A;  1C9B A;  4M7D D;  3CCU T;  1U3O A;  2K3Y A;  2ED0 A;  2AKK A;  1G3S A;  4BI8 B;  2SRC A;  2WMA B;  3VYG B;  2EJG A;  2Z0W A;  4UN0 A;  2LT1 A;  1VUB A;  3ME9 A;  4AKG A;  4MZT A;  2HSE B;  2MCN A;  2VVK A;  5GAM h;  2KT1 A;  2ZAE A;  3WXM B;  2KY9 A;  2A08 A;  1BYM A;  4M7D A;  2LJ0 A;  3PVQ A;  4GLK A;  3OYM A;  1FWZ A;  2LC4 A;  1VOM A;  4AFU C;  2VC8 A;  5GAN 8;  4JZ3 A;  3CBM A;  1BI3 A;  1TWB A;  2MWO A;  5IDP B;  2H3E B;  4ZGE B;  1R77 A;  1K9M R;  2K2V A;  3CME T;  2WXV B;  4ROD A;  5I2M A;  2VUB A;  3CCE Q;  3BHV B;  3TCJ A;  3NGP A;  1H25 B;  5FLX E;  2CP3 A;  2KRO A;  3EHR A;  4RG8 A;  1P5E B;  5J39 A;  1YHQ T;  1AD5 A;  1VQK T;  4IKF A;  3EOC B;  1G3T A;  2CCI B;  1QWF A;  5EG2 A;  2X4Y A;  4OGE A;  1N9S A;  2KE9 A;  1BU1 A;  1URC B;  2QQ8 A;  2DME A;  1WYX A;  5A2Q E;  1UHF A;  4HNU A;  2B9R A;  5J3B A;  4EOR B;  2ESW A;  1HK9 A;  1KC8 C;  2X4J A;  4CC4 B;  1ZX6 A;  3CCV Q;  3M57 A;  4M7D F;  3QYB A;  1YI2 T;  3O8V A;  4KGZ B;  4KH0 B;  4Y91 A;  3J7A F;  1LCK A;  2IVW A;  1IO6 A;  3L2U A;  3JCM g;  5J26 A;  4BCN D;  1JB0 E;  2CGH A;  2J7I A;  2DXB A;  1I4K 1;  1GCQ C;  4ZN3 A;  1ABQ A;  4F7U A;  2HQH A;  1T3L A;  1Q7Y U;  3DL1 A;  3OS1 A;  1Q82 C;  1S1N A;  2JTE A;  4EMK B;  1H3H A;  1VIN A;  3EFO B;  5IHN A;  4QKU A;  4X34 A;  1QW1 A;  2QYZ A;  4QVC A;  1M27 C;  3OYY A;  3HTR A;  1YIT T;  3VS0 A;  1WHH A;  2IN3 A;  3MET A;  4A4G A;  1SSH A;  3A8G B;  2PHG A;  1R0C B;  2FZG B;  4A4H A;  1WPY A;  1V1C A;  4ZGJ B;  1XQH A;  1K76 A;  3V7R A;  4BAC A;  2ED1 A;  2AZV A;  4BCO B;  3M4Y A;  2CP0 A;  3PIP A;  2K7A A;  2RM4 A;  3POM A;  4OF1 A;  1BI1 A;  2EW3 A;  1JST B;  3PTA A;  4AKI A;  3A98 A;  2XKO C;  2RJD A;  5GAM d;  1M4Z A;  4F7U F;  3JCM J;  5HK0 A;  5KCO A;  2HD0 A;  3NMZ C;  1M2V A;  1N4M A;  2KEA A;  3UWN A;  4DEY A;  1QVP A;  2CT3 A;  3BHU B;  2BUD A;  3UDC A;  1YIJ Q;  1AD6 A;  4C92 C;  3QUI A;  2NLU A;  5IH2 A;  2EYW A;  1W2B S;  4M77 G;  1X75 C;  2EIF A;  5FRN A;  4YOZ A;  4AI6 A;  1PC0 A;  3ULR B;  4BBS M;  1YJW T;  2LCC A;  1TH7 A;  2YRC A;  4YTL A;  2COW A;  3CC7 Q;  4JS5 A;  4CC2 A;  1AZG B;  4DBQ A;  4JJN K;  2DL7 A;  2BTT A;  5HQ0 B;  2W10 A;  1RAE B;  4JRP A;  3P8H A;  4QVZ A;  2X35 A;  3MEV A;  2CP2 A;  1WZO A;  2A37 A;  1I8F A;  2DX1 A;  2QA4 A;  5ECA A;  4JZ4 A;  5LJ3 f;  5GAO p;  3LX7 A;  2CH4 A;  1D1C A;  1UDL A;  3CC4 A;  2C6T B;  2DRK A;  4JJB A;  3JCM h;  3VRZ A;  2XD0 A;  1QCO A;  4EMK A;  1E6H A;  2DEU A;  1VQ8 T;  4MZM A;  3EFO A;  1H92 A;  1OKV B;  2UZL B;  4DOW A;  3MEA A;  1U1T A;  3QBY A;  4M7D C;  3OBW A;  2E3I A;  1UHC A;  2QTV A;  3OA6 A;  4KUI A;  3I35 A;  4FX3 B;  1WHK A;  1N5Z A;  1E6G A;  4EMG A;  3QO3 A;  3INZ A;  3QWY A;  2ECZ A;  2JOY A;  4IUR A;  2C0O A;  4M75 B;  3HFO A;  3CD6 A;  3A8M B;  2V8I A;  4BY6 B;  4C5E A;  3GLX A;  2D0Q B;  2JGZ B;  4F14 A;  4ELZ C;  4PFP A;  2RF0 A;  4M7A B;  2D0N A;  3VUZ A;  2DER A;  2LTO A;  4NL3 A;  3CCL T;  3NTI A;  4UC4 A;  1GCP A;  1U1S A;  3I56 A;  5IHY A;  2CUD A;  1ZSZ B;  4F6W B;  1PRL C;  4TTH A;  1EIF A;  3HB9 A;  1QCF A;  4EOP B;  3RGF B;  2PVD B;  1O9K B;  1I0C A;  1RAH B;  5HBH B;  1QWE A;  3SFM A;  4ANJ A;  4F7S B;  1K73 R;  1X6B A;  4C0G A;  3G7Z A;  4EOM B;  3CBO A;  1WHG A;  2P4T A;  2Y90 A;  3D7S B;  3LYI A;  4KGV B;  4O6J A;  1T0J A;  2DBK A;  1GFC A;  1H1R B;  2QFZ A;  3I9Q A;  2DE0 X;  2K57 A;  1WNL A;  3E9F A;  4DA4 A;  1LOJ A;  2PUO B;  3RBB B;  2V1R A;  1WJS A;  2CYZ B;  2WSE E;  2QQB A;  3MO8 A;  2RQT A;  1FKM A;  7AT1 B;  2W99 A;  2RQV A;  4HNV A;  3QDR B;  4KT0 E;  1RLQ C;  1M1K U;  1UTI A;  5GAN f;  2RI3 A;  1VYU A;  3GNF B;  2VB6 A;  2KBT A;  3OYC A;  3LQ5 B;  2DZ9 A;  2YRV A;  1WHL A;  3C12 A;  5DY9 A;  3DKM A;  2JM8 A;  2VV5 A;  5HVY B;  2COZ A;  2QEX T;  3OMC A;  3ZEH A;  4OP0 A;  4QQD A;  5IXB A;  2L89 A;  2GTJ A;  4J9G A;  1SF9 A;  1X2K A;  3B57 A;  3G6E Q;  4M78 G;  4HVU A;  3L2W A;  4I3Z B;  4FIB A;  2L3S A;  2X9H A;  2RN8 A;  2RNA A;  3PO3 S;  4N4G A;  3JB9 I;  2DIL A;  3EG0 A;  3JCM d;  5LMK B;  1FMK A;  2OAW A;  4LDU A;  4E2F B;  2KRS A;  1VQ7 T;  4D8K A;  5ACB A;  1O9S A;  1O75 A;  2COY A;  4C5H A;  1HJD A;  1NZ9 A;  1RI0 A;  5FU7 B;  1JRI A;  1PKD B;  1RAB B;  1Z9Z A;  1NPR A;  2X3X D;  3THK A;  3PMI A;  2HQE A;  4IIM A;  4MFD A;  2EKH A;  2KAF A;  1KQS S;  3V8J A;  1K9M U;  3RKW A;  5LQF B;  2DYI A;  2DTO A;  2DM1 A;  2HEQ A;  1U8R A;  4E7I A;  2BZY A;  3JB9 G;  1KC8 R;  2RHI A;  1VQN Q;  2IG0 A;  2CZ0 B;  3CMA T;  3QJY A;  2M16 A;  2I53 A;  1VQ6 T;  5IF1 B;  1JJ2 S;  3CCQ Q;  4PFZ A;  1ZSZ A;  4MMK A;  3V8K A;  2EVR A;  3VS2 A;  2LMJ A;  2L3R A;  1YJN T;  4PJN A;  1C6V X;  1NE8 A;  1O9K A;  4Z02 A;  1M1G A;  3VS6 A;  1X69 A;  2C5V B;  2X1N B;  1KK7 A;  2A3L A;  2JMC A;  4EMH A;  4JJC A;  4Y28 E;  4EOQ B;  2VGM A;  2VXE A;  5IDN B;  1NJI C;  1VQL T;  1J3T A;  2LCL A;  3C4S A;  3JCM b;  5GMK m;  3M0Q A;  4BCM B;  1Y0M A;  3F5X B;  2DD5 B;  4EOI B;  2CSQ A;  2H3J A;  4MDW A;  1QMC A;  5GJW B;  1QLB A;  4XU2 A;  5GAM j;  2J05 A;  5LJ5 f;  1KJW A;  2RK2 A;  2B86 A;  2CZ7 B;  4Q5W A;  1D3U B;  2EJ9 A;  5CKD A;  4VUB A;  3CCR Q;  3M0S A;  1S72 A;  2XDB A;  5A0L A;  1H1P B;  2KMT A;  4IUU A;  2MPX C;  2D8H A;  4CFX B;  3CCS A;  1Y7X A;  1D0Y A;  1PKT A;  4ZTF A;  3RES A;  2RMO A;  2WSC E;  3MJX A;  2DJQ A;  3CC4 T;  1WXU A;  2X3W D;  3I55 Q;  3ZL7 C;  2NUP A;  1NEG A;  1KHI A;  2RD1 A;  4E7H A;  3PMT A;  5CKE A;  1M3A A;  1LVK A;  4OMM A;  1MND A;  2GFU A;  3OS2 A;  2K5L A;  2P0Q A;  4MIM A;  3CCM A;  4M77 E;  4HCC A;  5I22 A;  4F7N B;  1XNI A;  5EFQ B;  3TNI B;  5GAO n;  4EDU A;  4M77 B;  1TD6 A;  3PNW C;  2FEI A;  1X6O A;  2JZ2 A;  3M53 A;  3PGG A;  1TG0 A;  2EYQ A;  3CD6 T;  1OGU B;  3VS7 A;  2QGG A;  2KT8 A;  4RTX A;  1B07 A;  2QDY B;  5GAM g;  2K3X A;  2K5I A;  2LQ8 A;  2KI7 A;  2KRM A;  4AFS C;  1M3C A;  3DDP B;  1WGS A;  3I56 T;  2R57 A;  5LJ3 h;  3CBP A;  1VIE A;  1H3Z A;  1ZA1 B;  1QKX A;  3QYE A;  1NPP A;  1HSQ A;  2HZY A;  4JRI A;  1E7P A;  2NYS A;  4LD9 K;  1UNH D;  4BI4 A;  5GAN 6;  1TOV A;  3LH0 A;  1NG2 A;  5DQW A;  1M1F A;  2FRY A;  4PK4 A;  3ASK A;  1OL2 B;  2HAX A;  2ENM A;  2FL7 A;  2NUT A;  3QPH A;  3CCU Q;  1N8R R;  2RJC A;  4IMY B;  2K3B A;  2FO0 A;  1F1B B;  3LH5 A;  1MMA A;  3OB9 A;  3OMG A;  3DTO A;  4ZN1 A;  3TSW A;  5IAY A;  2ZGW A;  4JX4 A;  1PM3 A;  2C4G B;  2I40 B;  1JBM A;  1RAF B;  2C5N B;  1QQJ A;  3EGD B;  3CCV A;  5ICP B;  5L8R E;  5FU6 C;  3M03 A;  2O4X B;  1EX4 A;  3CCJ A;  2DKG A;  4IUV A;  4C5I A;  5KYN A;  3TVT A;  1QVF S;  2I0N A;  4M75 G;  1N9R A;  3O5Z A;  1GBQ A;  1KIK A;  2WSF E;  1KXU A;  4J9H A;  1TXQ A;  4M77 D;  2R5A A;  3CME Q;  4PL6 A;  1FX7 A;  3OYH A;  4HVW A;  3M0P A;  2ZPI B;  4M7A G;  1SG5 A;  4BCH B;  4M4Z A;  5DLQ E;  4FYX B;  1KQS A;  2HNI A;  1YHQ Q;  1VQK Q;  5D6W A;  2D8J A;  1LNX A;  1ZSG A;  1WX6 A;  4K11 A;  4E7S A;  4M77 A;  2YHT A;  1OKW B;  1VQ4 A;  3TW6 A;  2CP6 A;  3GF5 A;  2FG0 A;  3OYB A;  5A0D A;  2X4W A;  2MOX A;  1UNL D;  4E47 A;  4LUE A;  2NWM A;  1MGQ A;  1UNG D;  1ZSZ C;  3E19 A;  3VV0 A;  1YFN A;  4G6L B;  2FHD A;  2CSI A;  3OQ5 A;  5FGK B;  1YI2 Q;  3C94 A;  2R5M A;  5L2W B;  2FZC B;  2D9T A;  2EYY A;  1Y57 A;  5KYX B;  5GAO r;  2W9F A;  1K73 U;  4J9E A;  5KCH A;  3LWI A;  4NC6 A;  1IB8 A;  4F7J B;  2XU8 A;  4HT8 A;  3EH2 A;  2GQI A;  4M78 E;  5FW9 A;  3OYK A;  4M78 B;  4FU6 A;  1YIJ A;  1AWJ A;  1YIT Q;  1LJO A;  4M77 F;  2K5F A;  2XG8 D;  3R6O A;  3OW2 A;  3PIO A;  3LWH A;  2R58 A;  1D3B B;  1OU9 A;  3SHW A;  3BE3 A;  2KNB B;  2MWP A;  4PKC C;  3CC7 A;  1N27 A;  2LCS A;  4FW1 A;  3REA B;  2EPD A;  4BDZ A;  3CPW S;  1M90 C;  2HSP A;  3UAT A;  3CC2 A;  1D0Z A;  2O4X A;  2KRN A;  3FC3 A;  2VXF A;  1X43 A;  4BE0 A;  4QQG A;  2OTJ A;  5GAN 3;  2E4H A;  3L2Z A;  4YC3 B;  2DYB A;  1CSK A;  2XDP A;  3HP9 A;  5CKF A;  2G77 A;  4DBH A;  1A0N B;  4O5V A;  2M9U A;  1VQ9 A;  3L42 A;  1FXX A;  5GJV B;  4OB0 B;  2RQW A;  4QQ6 A;  1AWO A;  3NTK A;  3MIA B;  1M5Q 1;  3TU4 K;  1RAD B;  4Y72 B;  1U06 A;  3RMS A;  5M9O A;  3JCM W;  1KD1 R;  2EFI A;  3FRN A;  3EG1 A;  1R8O B;  1PKS A;  1OX9 A;  1BKB A;  1B7T A;  2M51 A;  2PTK A;  3H41 A;  5LL6 S;  3JCM Q;  1RAA B;  3ER0 A;  1YJW Q;  4ELY C;  1NJI R;  4F7L B;  4DOV A;  1KC8 U;  2PK9 B;  4LOC A;  4OMQ A;  3HSB A;  5LJ5 h;  1PCX A;  2BZX A;  3A8O B;  2DIQ A;  4OVA A;  4ESR A;  2C5O B;  3F70 A;  3VYG A;  2QF7 A;  2JMA A;  1MMD A;  1TUG B;  4M78 D;  1Q81 C;  2ZPG B;  1FMW A;  3TW7 A;  4E7L A;  3QWL A;  1JXM A;  1SHF A;  2W96 A;  2DEQ A;  4PJO B;  4AKH A;  2DTH A;  4WTO B;  2ROT A;  3MEW A;  1AIS B;  4PJL A;  4EOO B;  5GAN 4;  1VQ8 Q;  1QP3 A;  4M78 A;  2F5T X;  1G3N C;  1YWP A;  4RG2 A;  2EYX A;  4NST B;  4D6W A;  2KK4 A;  2JS0 A;  2MYS A;  3DB3 A;  2E12 A;  1K8A C;  3VUB A;  4E7K A;  1D3B A;  2DXC B;  5FWC A;  2DLP A;  3SWN B;  3JB9 D;  3QHS A;  4II5 B;  3VJP A;  3PVL A;  2JM9 A;  2ZPH B;  2QXF A;  3HRS A;  4F17 A;  3EGU A;  3PT9 A;  4HCZ A;  2O9S A;  1G2B A;  3VRY A;  2JJ9 A;  4N0A A;  4XU0 A;  4F70 B;  4RTZ A;  3CCJ T;  2G9X B;  2JUF A;  1V76 A;  5GMK j;  2QGS A;  2K79 A;  1H1Q B;  3L2V A;  3WVD B;  3TRE A;  3CCL Q;  4RTV A;  4M77 C;  2EBP A;  3QSU A;  3QYG B;  3RER A;  2K6D A;  4M78 F;  1BBZ A;  3GTM S;  1H27 B;  2G3R A;  4EPC A;  3OS0 A;  5I21 A;  4AFQ C;  3JCM V;  4AT1 B;  2L2P A;  1UGR B;  4OB1 B;  2DZC A;  4B6M A;  4ME7 A;  2A36 A;  2J06 A;  1AVZ C;  1I81 A;  3BG9 A;  3AT1 B;  4CC7 A;  3QKJ A;  5CCA A;  1VQ4 T;  4WF2 A;  4B9W A;  1G3Y A;  2RK1 A;  3S3O A;  1VQM Q;  4BY1 X;  3FEO A;  4HLQ A;  1M8V A;  4AG1 C;  2IPO B;  4Z8A A;  4CFW B;  2ZPB B;  2WAC A;  9ATC B;  1I1J A;  4LDV A;  4HKE A;  3GIB A;  3BHT B;  1RAC B;  1WDX A;  1X27 A;  2J6K A;  2HCK A;  4BCQ B;  2R7G A;  2DTI A;  2CT4 A;  3U23 A;  1UJ0 A;  4Z88 A;  3JB9 F;  6AT1 B;  1OUL A;  3GOX A;  3M0T A;  1RI9 A;  4CFN B;  2OJ2 A;  4M75 E;  4BCK B;  3RUX A;  2I2L A;  5LJ5 d;  1JKW A;  2QEX Q;  5KYW B;  1W70 A;  1EFN A;  3N5B B;  2ROL A;  3G71 A;  1YP5 A;  1GXI E;  3CCQ A;  1RAI B;  2HKQ B;  2KQW A;  3QHW B;  1TU0 B;  1N8R U;  4M7A E;  1OEB A;  4HA8 A;  2ATC B;  3JRZ A;  4B9X A;  3CPW A;  3UPU A;  4ATO A;  5D6Y A;  5KE2 A;  4OMN A;  5C0M A;  3QII A; 
#chains in the Genus database with same CATH homology
 5GAM j;  4PJO E;  3SWN A;  2YLC A;  5LJ5 f;  3KBG A;  2E5Q A;  3M54 A;  2RK2 A;  2XDD A;  3ZFJ A;  2CZ7 B;  2LNV A;  3LGF A;  1G3W A;  4Q5W A;  1Q82 U;  4II1 A;  3RIR A;  2EJ9 A;  2JNG A;  4VUB A;  5CKD A;  2E10 A;  3X26 B;  2XIC A;  1S72 A;  2XDB A;  5A0L A;  3DLL A;  2EWN A;  2E64 A;  2KMT A;  4BB7 A;  5CIU A;  3EAE A;  5GAN d;  4IUU A;  4NOY A;  4PNO A;  5CO7 A;  2DXB B;  3CC2 T;  2EAY A;  2MMP A;  3CCE T;  2RH2 A;  4F7U E;  3CCS A;  1Y7X A;  1VQ7 A;  3HRT A;  2LQK A;  3VYH B;  1K73 C;  1YJ9 A;  3CPF A;  4ZTF A;  3RES A;  2WSC E;  4L59 A;  2OTJ T;  2PUK B;  3VKH A;  3BW1 A;  3CCR A;  3NTH A;  2PQW A;  3CC4 T;  2ZPF B;  1VQ8 A;  3V8L A;  4Z6Y A;  4LDW A;  1M1K C;  1Q81 U;  1WJQ A;  5LJ3 j;  4JX5 A;  1QVF A;  4J5Y A;  1OI1 A;  1KHI A;  2RD1 A;  1OYX A;  3MP8 A;  1UEB A;  2E65 A;  4A53 A;  4E7H A;  4M7D D;  3PMT A;  4N4H A;  5CKE A;  3CCU T;  1VQ9 T;  1B34 B;  2K3Y A;  3CMA A;  4RCC A;  1G3S A;  3I55 A;  2GFU A;  3QZ9 B;  4BI8 B;  3OS2 A;  3VYG B;  2EJG A;  4C92 G;  2K5L A;  2P0Q A;  4MIM A;  2LT1 A;  3CCM A;  3CCV T;  1VQ6 A;  4M77 E;  1VUB A;  3ME9 A;  4HCC A;  4AKG A;  4MZT A;  4JRQ A;  1XNI A;  2EQJ A;  5GAO n;  4EDU A;  4M77 B;  3PNW C;  1YJN A;  1PSE A;  2KSS A;  5GAM h;  2X4X A;  4M6V A;  3WXM B;  4QSH A;  1X6O A;  2DXT A;  2JZ2 A;  1Y96 B;  2KY9 A;  1BYM A;  1K8A U;  4M7D A;  3M53 A;  1SSF A;  3PGG A;  2EYQ A;  3CD6 T;  4GLK A;  4C0F A;  1FWZ A;  3OYM A;  2LC4 A;  3S3N A;  3OY9 A;  2KDS A;  2VC8 A;  5GAN 8;  1VQL A;  4M75 D;  5GAN 2;  3CBM A;  2QDY B;  5GAM g;  1BI3 A;  3CXC A;  3FJP A;  3VKI A;  3M58 A;  2MWO A;  2RJE A;  2K3X A;  3GPL A;  3QJ6 A;  4ZGE B;  2BIV A;  2OTL A;  2K2V A;  3EFS A;  2K5I A;  3G6E A;  2LQ8 A;  4M78 C;  3CME T;  2QQA A;  1Y71 A;  5I2M A;  2VUB A;  2KVQ G;  3M5A A;  5GAM e;  1WGS A;  2KR6 A;  2B8A A;  3I56 T;  4M7A D;  2R57 A;  5LJ3 h;  3TCJ A;  3CBP A;  2RB6 A;  1VIE A;  2AHJ B;  3JCM X;  1H3Z A;  2DK3 A;  5FLX E;  4DQ2 A;  3QYE A;  1ZHI A;  2E1H A;  4M75 A;  4C0D B;  1NPP A;  4RG8 A;  4JRI A;  1E7P A;  5J39 A;  1YHQ T;  1VQK T;  4IKF A;  1G3T A;  5D6X A;  5I2S A;  1BIA A;  4MML A;  4LD9 K;  1KQ2 A;  4C8Q E;  5EG2 A;  4BI4 A;  2X4Y A;  5GAN 6;  2C06 A;  1BIB A;  1N9S A;  2A7Y A;  4OGE A;  2LVM A;  2QQ8 A;  3LH0 A;  3SB2 A;  4C8Q B;  4PJO D;  1M1F A;  2V8J A;  5LJ3 g;  5EJC A;  2XHC A;  3ASK A;  2MAM A;  5A2Q E;  3JCM c;  4HNU A;  3A5Z B;  1QVG S;  4M7A A;  2HAX A;  5J3B A;  2FL7 A;  4FL6 A;  3QPH A;  2QI2 A;  1W2B A;  4TVR A;  5GMK h;  1H64 1;  2RJC A;  4OB2 B;  1HK9 A;  3GNG A;  4XAX B;  1KC8 C;  3JB9 J;  3X25 B;  1KQ1 A;  2X4J A;  3MHX A;  5LJ3 e;  1UGP B;  4RMO A;  1QP2 A;  3E9G A;  3OB9 A;  3OMG A;  3M57 A;  3JB9 H;  4M7D F;  3H4C A;  1AHJ B;  3QYB A;  1Y07 A;  2M1H A;  4ZN1 A;  4BBR M;  2RA2 A;  3O8V A;  2ZGW A;  5IAY A;  4Y91 A;  1YI2 T;  1N8R C;  3J7A F;  2IVW A;  4JX4 A;  4C0Z A;  5FU6 B;  3OYF A;  4PJO A;  2XK0 A;  2E70 A;  3L2U A;  2QQS A;  4A4K A;  3CCU A;  1BI0 A;  4X9D A;  1JBM A;  4FT4 A;  3JCM g;  5J26 A;  3LLR A;  3V7S A;  1MHN A;  1JB0 E;  1HXD A;  2CGH A;  2EKO A;  5FU6 C;  4JLG A;  5L8R E;  3S6W A;  3CCV A;  2DXB A;  2O4X B;  1I4K 1;  1UGS B;  4ZN3 A;  3CCJ A;  2DKG A;  1XTD A;  4IUV A;  4C5I A;  1YIJ T;  4IUQ A;  4F7U A;  5GAN j;  1QVF S;  4J83 A;  1Q7Y U;  4M75 G;  1V29 B;  3DL1 A;  1WQW A;  1N9R A;  3OS1 A;  1Q82 C;  1VQ5 A;  2BS4 A;  4EMK B;  4OMF B;  1WJR A;  5A0G A;  3E1S A;  2WSF E;  3T9N A;  1VQP A;  4M75 F;  2DXC A;  4GY5 A;  1UGQ B;  2R5A A;  2RHZ A;  4M77 D;  1FX7 A;  4PL6 A;  1QW1 A;  4X34 A;  3G4S A;  5AYF A;  2GF7 A;  3MCA B;  3A8L B;  3P8B B;  4QVC A;  3OYH A;  2ZZD B;  3OYY A;  4EMK C;  1YIT T;  3L1A A;  2ZPI B;  5HKC A;  4M7A G;  3CEY A;  1KD1 U;  3M59 A;  3MET A;  5DLQ E;  1KQS A;  4R55 A;  3CC7 T;  3L2R A;  2RHY A;  4A4G A;  2HNI A;  4M7A F;  3A8G B;  1IZ6 A;  5D6W A;  5FRM A;  1LNX A;  4J6X A;  4XU3 A;  3OBY A;  5CQY A;  3RKX A;  1NJI U;  2EJF A;  2QA4 T;  4M77 A;  2YHT A;  4A4H A;  1WPY A;  3QXE B;  3TW6 A;  3BY7 A;  5KH6 A;  1VQ4 A;  3J80 E;  3GF5 A;  4PJO G;  3BDL A;  3OYB A;  5A0D A;  1KHC A;  2X4W A;  3HKS A;  4ZGJ B;  2LDM A;  1XQH A;  4E47 A;  5CR2 A;  1YHQ A;  4PJO F;  2HBP A;  3V7R A;  4BAC A;  2BKD N;  1MGQ A;  4KUL A;  2L8D A;  4HT9 A;  3M4Y A;  3J81 E;  4FT2 A;  1XOV A;  2E41 A;  3QYH B;  3E19 A;  3VV0 A;  2DVE A;  3PIP A;  2FHD A;  2RM4 A;  3OQ5 A;  4OF1 A;  1BI1 A;  4F7U G;  3BDU A;  3PTA A;  1VQM T;  1OZ2 A;  1KG1 A;  4XTY A;  4AKI A;  3C94 A;  1VQO A;  2XKO C;  2R5M A;  3DB4 A;  2RJD A;  3KHI A;  1M4Z A;  5GAM d;  4V2S A;  4J7F A;  2D9T A;  4F7U F;  3JCM J;  1N6A A;  4C8Q D;  5HK0 A;  4C92 B;  5KCO A;  4E7J A;  5GAO r;  2HD0 A;  2P0K A;  2MF2 A;  2XID A;  3M9Q A;  1K73 U;  5C6S A;  3UWN A;  5KCH A;  1QVP A;  3URG A;  3LWI A;  3TEE A;  4NC6 A;  2BUD A;  3UDC A;  4C92 C;  2XU8 A;  3QUI A;  2NLU A;  4HT8 A;  5IT9 E;  4L5G A;  5GAN g;  4M78 E;  3L2Q A;  3A8H B;  3G71 T;  3V7C A;  3OYK A;  4M78 B;  2BS3 A;  2RJF A;  4C8Q A;  3PFS A;  2EQU A;  1W2B S;  4JRK A;  4M77 G;  1X75 C;  2EIF A;  5FRN A;  4AI6 A;  5IN1 A;  4FU6 A;  1YIJ A;  5GAM f;  4PLI A;  4BBS M;  5GAN e;  3OYA A;  1LJO A;  3KXT A;  1YJW T;  2LCC A;  2QTX A;  3M56 A;  1TH7 A;  4FM4 B;  4M77 F;  4YTL A;  2K5F A;  2XG8 D;  3R6O A;  3OSV A;  3OW2 A;  4JS5 A;  3PIO A;  3LWH A;  2RI2 A;  2R58 A;  2ZCF B;  1D3B B;  2RHX A;  1K9M C;  3LW5 E;  5HY6 A;  4JJN K;  3BFM A;  3JCM P;  4A4F A;  3SDZ A;  2MWP A;  4PKC C;  4KUD K;  3CC7 A;  1N27 A;  5LJ5 j;  4JRP A;  3OS5 A;  3P8H A;  4CRI A;  4QVZ A;  4X9C A;  1PSF A;  3CCE A;  4BDZ A;  2X35 A;  1W4S A;  5FRO A;  3CPW S;  2JN0 A;  3MEV A;  1M90 C;  3CC2 A;  1I8F A;  3OYG A;  2O4X A;  2PU9 B;  1YBY A;  3JAM E;  3FC3 A;  2VXF A;  2QA4 A;  5LJ3 f;  5GAO p;  4BE0 A;  4HNT A;  4QQG A;  3LX7 A;  2OTJ A;  5GAN 3;  1YJ9 T;  3CC4 A;  2CKK A;  3JCM h;  2DD5 A;  4N0A C;  3CCR T;  2XD0 A;  4EMK A;  3L2Z A;  2RHU A;  4NS5 A;  3GP8 A;  1Q86 C;  1VQ8 T;  3VU3 C;  4ZTJ A;  4M7D B;  3BG5 A;  3HP9 A;  2XDP A;  4MZM A;  5CKF A;  2G77 A;  2YLB A;  4XK8 E;  1ZBX A;  2RO0 A;  2VGN A;  3DLM A;  4JUV A;  4C8Q G;  5CK9 A;  5GMK i;  2DPP B;  4JX6 A;  2ZZD A;  4O5V A;  4DOW A;  2M9U A;  3MEA A;  1U1T A;  4MZP A;  4A4E A;  1VQ9 A;  3QBY A;  4M7D C;  3OBW A;  4C8Q F;  3L42 A;  1FXX A;  4IUP A;  4OB0 B;  4QQ6 A;  3OA6 A;  4KUI A;  2JTF A;  3NTK A;  5HK3 A;  1M5Q 1;  3JCM f;  4JLI A;  3Q1J A;  3OYE A;  3MEU A;  3TU4 K;  2KMG A;  3RMS A;  4JDS A;  5M9O A;  2HQX A;  3JCM W;  4BD3 A;  1IRE B;  2EFI A;  3HL8 A;  3FRN A;  3SD4 A;  3JCM e;  1R8O B;  1ZQ1 A;  5CVI A;  4EMG A;  3QO3 A;  3INZ A;  1BKB A;  2JOY A;  5KE3 A;  4OB3 B;  4IUR A;  5LL6 S;  2E6Z A;  4N4I A;  4M75 B;  3ER0 A;  3HFO A;  4C92 D;  4ELY C;  3JCM Q;  1KD1 C;  4J6Y A;  3ZBD A;  4DOV A;  1KC8 U;  3CD6 A;  4LOC A;  4BE2 A;  3JSC A;  2GQV A;  3HSB A;  2CZ1 B;  3A8M B;  2V8I A;  4BY6 B;  5LJ5 h;  4C5E A;  3GLX A;  4M75 C;  2DD4 B;  2D0Q B;  3A8O B;  1B34 A;  4ELZ C;  2DIQ A;  3HZJ A;  4OVA A;  2QQR A;  4L6V 5;  3F70 A;  4M7A B;  3VUZ A;  3VYG A;  2LTO A;  2QF7 A;  4BY6 C;  4NL3 A;  3CME A;  3CCL T;  3NTI A;  2LT4 A;  4UC4 A;  2OTL T;  4M78 D;  3RMQ A;  3G6E T;  1Q81 C;  3VKG A;  2ZPG B;  3TW7 A;  1U1S A;  3I56 A;  5LJ5 g;  1QVG A;  4E7L A;  4M7A C;  3QWL A;  1EIF A;  2XI9 A;  3HB9 A;  1X01 A;  4QVD A;  2PVD B;  1P92 A;  1Y96 A;  1JJ2 A;  2DEQ A;  2P0P A;  4PJO B;  1VQK A;  4AKH A;  2DTH A;  2F69 A;  3SFM A;  5LJ5 e;  3CXC S;  2DAQ A;  3MEW A;  4CI0 C;  2JTM A;  4C0G A;  3G7Z A;  5GAN 4;  2JVV A;  2OAU A;  1QP3 A;  3CBO A;  4OGC A;  4XTZ A;  2P4T A;  2Y90 A;  4M78 A;  4XTW A;  3RKY A;  4PJO C;  3KUF A;  4KBM B;  3LYI A;  4ZGD B;  2F5T X;  1VIF A;  2DJZ A;  4RG2 A;  3OW2 S;  1DJ7 B;  4O6J A;  4D6W A;  2KK4 A;  4C92 E;  3S3M A;  2QFZ A;  2PVG B;  4F7U B;  5GAN h;  4M7D G;  1M9S A;  3DB3 A;  2E12 A;  3QG1 A;  2K57 A;  1K8A C;  1WNL A;  3E9F A;  4DA4 A;  1LOJ A;  2PUO B;  2FYK A;  3VUB A;  2DXU A;  1WJS A;  4E7K A;  2CYZ B;  2WSE E;  2QQB A;  3LGL A;  3MO8 A;  2WJ9 A;  1D3B A;  2DXC B;  3SWN B;  4C5G A;  3OYL A;  3JB9 D;  1YI2 A;  1FKM A;  4J6W A;  3QHS A;  4XTX A;  4P5N A;  5GAN 5;  1VQN T;  3VJP A;  4HL4 A;  3HO8 A;  5DLO A;  4HNV A;  3QDR B;  4KT0 E;  4RKU E;  5GMK l;  2ZPH B;  2QXF A;  4MDX A;  3HRS A;  1M1K U;  3H8Z A;  2GCX A;  5GAO m;  3HFN A;  3SWN C;  2FVU A;  2Y4Y A;  4RCB A;  3PT9 A;  4HCZ A;  5GAN f;  1OZ3 A;  3CCQ T;  2RI3 A;  3GNF B;  3OYI A;  4N0A A;  2O01 E;  2V8K A;  4XU0 A;  3OYC A;  3MP6 A;  4M7D E;  2DZ9 A;  3WVE B;  2YRV A;  3C12 A;  5DM7 R;  5DY9 A;  3CCJ T;  3DKM A;  3M4G A;  4C92 F;  2VV5 A;  2JUF A;  5LJ3 d;  2QEX T;  3OMC A;  3ZEH A;  5GMK j;  4OP0 A;  4QQD A;  2L89 A;  3L2V A;  2ZPE B;  3WVD B;  1VQ5 T;  3TRE A;  2EQK A;  1BI2 A;  4BDY A;  4HCB A;  2QDJ A;  4XQ3 A;  3OYD A;  4M77 C;  4FSX A;  1VQP T;  2E6N A;  4M78 G;  3QSU A;  3L2W A;  1YIT A;  3G4S T;  3QYG B;  3HBL A;  4FIB A;  4NL2 A;  2CZ6 B;  3FLG A;  2D6F A;  3RER A;  4M78 F;  2CS7 A;  2G3R A;  4ELJ A;  4EPC A;  3BG3 A;  3OS0 A;  5I21 A;  1S72 T;  3NFC A;  4N4G A;  3JCM V;  3JB9 I;  1UGR B;  4OB1 B;  3X20 B;  2DZC A;  3CCL A;  4ME7 A;  4BE1 A;  3FDR A;  3JCM d;  2DIG A;  3HHT B;  1I81 A;  2QQ9 A;  4LDU A;  3BG9 A;  3HPW A;  3CCS T;  3X24 B;  4BI3 A;  1VQ7 T;  5CAI A;  2RI5 A;  5CCA A;  3QKJ A;  1O9S A;  4A54 A;  1O75 A;  4C5H A;  1VQ4 T;  4WF2 A;  2PVO B;  1G3Y A;  2RK1 A;  1NZ9 A;  4B9W A;  1RI0 A;  5FU7 B;  1JRI A;  3S3O A;  4BUG A;  3M55 A;  4QW2 A;  3FEO A;  1NPR A;  4HLQ A;  4XTV A;  3PMI A;  2HQE A;  5GAO l;  3QZ5 B;  4MFD A;  1M8V A;  2LX9 A;  2KAF A;  2EQM A;  4LDY A;  1UB4 A;  1KQS S;  4J7I A;  2ZPB B;  3V8J A;  1K9M U;  2WAC A;  3OSS C;  5FU7 C;  3RKW A;  3H6Z A;  2DTO A;  2M0O A;  4HKE A;  4LDV A;  1U8R A;  5CKB A;  1I5L A;  3GIB A;  4C0D C;  2DD4 A;  4E7I A;  2VYT A;  1VQM A;  4J8O A;  3JB9 G;  2RHI A;  2DTI A;  2IG0 A;  2CZ0 B;  1Q7Y C;  3CMA T;  2L5Q A;  3OYJ A;  3QJY A;  3OYN A;  3I55 T;  2LRQ A;  2M16 A;  1VQO T;  1VQ6 T;  3JB9 F;  3CCM T;  3AHU A;  4C8Q C;  4IUT A;  5GAO q;  1M90 U;  3GOX A;  1JJ2 S;  4LDX A;  5CQX A;  3HRU A;  3X28 B;  4PLL A;  3V8K A;  4MMK A;  3UT1 A;  4XTU A;  4M75 E;  3P8D A;  2L3R A;  5CKH A;  2DO3 A;  3RUX A;  1YJN T;  4XU1 A;  1VQN A;  1NE8 A;  2I2L A;  3EFR A;  5LJ5 d;  4Z02 A;  1M1G A;  3N5B B;  4R56 A;  1Q86 U;  1G5V A;  3G71 A;  2BS2 A;  2A3L A;  3FB9 A;  2GFA A;  1GXI E;  3CCQ A;  4EMH A;  4Y28 E;  2KQW A;  2Y4X A;  2F5K A;  2VGM A;  2VXE A;  3MP1 A;  4LD6 A;  1N8R U;  1NJI C;  1VQL T;  4M7A E;  2LCL A;  1RL2 A;  2K4Y A;  4JS4 A;  3C4S A;  2FB7 A;  4MFE A;  3C95 A;  5GMK m;  3JCM b;  1YJW A;  4HA8 A;  2QEX A;  3JRZ A;  4B9X A;  5GMK e;  1YCY A;  3CPW A;  3UPU A;  3FIF A;  4ATO A;  5D6Y A;  2MI6 A;  2DD5 B;  1WQ7 A;  2H3J A;  4MDW A;  4C92 A;  5KE2 A;  5GAN 7;  1QLB A;  5C0M A;  4XU2 A;  3QII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...