3EJ1B

Cdk2/cyclina complexed with a pyrazolopyridazine inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Synthesis and evaluation of pyrazolo[1,5-b]pyridazines as selective cyclin dependent kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 92
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ej1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ej1B02
3EOCB 1QMZB 1OKWB 4ELJA 4RODA 2QDJA 4OGRB 4EOSB 1O9KA 4EOJB 4EORB 1G3NC 4BCNB 4FX3B 2I53A 2WPAB 5LQFB 3DDQB 1E9HB 2CJMB 1H28B 2BKZB 5IDNB 4BCPB 2X1NB 4IMYB 4ROEA 3K7AM 4UN0A 5EFQB 4EOPB 5HQ0B 2WIPB 1UNHD 4NSTB 3BHTB 2G9XB 1H1RB 2PK2A 5I5ZB 1GUXA 2WHBB 4BCHB 4YOZA 4EOKB 4F70B 3MY1B 2PHGA 5HNBB 2PK9B 3BLHB 3M03A 2I40B 2WIHB 1JKWA 2UZLB 4EOIB 4F7SB 1H1SB 1JOWA 1TFBA 4BCMD 1H27B 1N4MA 1F5QB 2F2CA 2UZBB 5ICPB 3DDPB 2BPMB 4CFNB 3TNWB 4F7LB 5BNJB 2W99A 2PMIB 1OL2B 1P5EB 4EOMB 4EONB 5L2WB 3MI9B 5CYIB 1OKVB 1BU2A 3G33B 1FINB 1JSTB 4BCGB 1OL1B 2IW6B 1H24B 3MIAB 4CXAB 4EOOB 5LMKB 4EOQB 1D3UB 4BCND 4TTHA 4BCQB 4F7NB 2C5OB 4ROCA 2C6TB 2UZDB 3BLRB 1H25B 4CFUB 1GUXB 4G6LB 4I3ZB 2B9RA 3MY5B 4BCIB 2C5NB 1OI9B 3RGFB 1AISB 4BCJB 1H1PB 1GY3B 2UUEB 2UZEB 2WMBB 2WEVB 4EOLB 4CFMB 2WMAB 1W98B 1OIYB 3EJ1B 4EC8B 1O9KB 1VYWB 5FGKB 2C5XB 4CRLB 2WXVB 1H26B 4F7JB 1H4LD 1C9BA 1AD6A 3QHWB 1URCB 1VOLA 1ZP2A 4BCOB 4F6UB 3TN8B 5HVYB 5ACBA 3DOGB 3QHRB 3TNIB 1JSUB 3EIDB 1GH6B 2CCHB 4BCMB 1UNLD 4F6SB 3LQ5B 2EUFA 4CFVB 1VINA 3BHUB 4OR5B 1UNGD 4BCFB 4KRDB 1PKDB 1OGUB 2IW8B 4Y72B 2IW9B 5IDPB 2W9FA 4II5B 2C5VB 2W96A 1H1QB 5HBEB 3BHVB 3POMA 4KRCB 4F6WB 2V22B 4EC9B 3H4CA 2CCIB 5CEIB 2W9ZA 4YOSA 4YOOA 5IF1B 4BCKB 2WFYB 5HBHB 4YC3B 1KXUA 1OIUB 2C4GB 3BLQB 4CFXB 5HBJB 3O0GD 4BCQD 4ELLA 2W2HA 2JGZB 4CFWB 1FVVB 1XO2A 2R7GA 3F5XB 2IVXA 3TNHB 4CFUD
chains in the Genus database with same CATH superfamily
3VYHB 4ZGDB 5EJCA 4EOJB 2WPAB 1E9HB 2BKZB 3QXEB 4NSTB 2G9XB 2PK2A 2CZ1B 1GUXA 2WHBB 4EOKB 2WIHB 1JKWA 2UZLB 1H1SB 1JOWA 1TFBA 1H27B 4BY1X 3X20B 5BNJB 4EOMB 5L2WB 1FINB 3A8GB 4CXAB 3MIAB 1H24B 1D3UB 5LMKB 4EOQB 4F7NB 4BCQB 2D0QB 1AHJB 1H25B 4CFUB 2B9RA 3MY5B 1E7PA 3A8LB 2WJ9A 2UUEB 2WMBB 4EOLB 3EJ1B 1O9KB 1VYWB 2BS2A 1H26B 3BG9A 4F7JB 1H4LD 1C9BA 1URCB 4BCOB 5HVYB 1JSUB 1GH6B 2CCHB 3BG5A 4LOCA 4F6SB 3LQ5B 2DMEA 1VINA 1UNGD 1OGUB 2DD4B 5IDPB 4II5B 2IN3A 2DXBB 2V22B 4ZGJB 4YOSA 4BCQD 4ELLA 2W2HA 2PJQA 4MFDA 4BXXX 1UGPB 3TNHB 4CFUD 3QZ9B 2ZCFB 1OKWB 4OB2B 1O9KA 2DPPB 1G3NC 3QWLA 4FX3B 4BBSM 2CZ7B 4BCPB 2X1NB 4AKIA 4AKGA 4BY7X 5EFQB 4EOPB 2WIPB 1H1RB 3X28B 2QQ8A 5I5ZB 4YOZA 4F70B 4Z6YA 5HNBB 3BLHB 2I40B 4EOIB 3WVDB 1UGRB 3X25B 1UGSB 2BPMB 4CFNB 3PO3S 4HLQA 1BU2A 3G33B 4MIMA 4EOOB 2IW6B 3A8HB 3BLRB 4QSHA 4BCIB 3RGFB 1AISB 3KHIA 3VKHA 1GY3B 4CFMB 1FKMA 2WMAB 1OIYB 5FGKB 1ENWA 4HNTA 2QDYB 3DOGB 3TNIB 3EIDB 4OR5B 4BCFB 4AKHA 1PKDB 2ZZDB 2IW8B 2W9FA 4FM4B 3BHVB 4KRCB 4EC9B 5CEIB 4BCKB 3B57A 2WFYB 1KXUA 1OIUB 4NC6A 3O0GD 3X26B 2JGZB 1XO2A 5IHYA 3GTMS 2CZ0B 3EOCB 3QYBA 4HNVA 4ELJA 1UGQB 2QDJA 4EOSB 4EORB 3QZ5B 2I53A 5LQFB 3DDQB 2CJMB 1H28B 5IDNB 2QF7A 3VKGA 4HL4A 1UNHD 3BHTB 4HNUA 3HZJA 4BCHB 3MY1B 2PHGA 4F7SB 1N4MA 1F5QB 2F2CA 3DDPB 3TNWB 4F7LB 2PMIB 2ZPHB 3TW6A 1JSTB 4BCGB 1OL1B 4BCND 4TTHA 2DXCB 2C5OB 4ROCA 1GUXB 4I3ZB 4BBRM 1OI9B 1H1PB 1W98B 4EC8B 3X24B 2C5XB 2WXVB 3HB9A 1VOLA 1ZP2A 1V29B 5ACBA 3TW7A 2ZPGB 4BCMB 4ZGEB 4KRDB 3VYGB 2IW9B 2C5VB 2W96A 3POMA 4AI6A 4F6WB 2W9ZA 4JX4A 3HHTB 4YOOA 5DQVA 5HBHB 2BS3A 4YC3B 5DQWA 2C4GB 3BLQB 1IREB 4CFXB 1FVVB 3F5XB 2IVXA 3DTOA 4OB3B 1QMZB 3DL1A 4RODA 4OGRB 2KMGA 4BCNB 2LW4A 4JX5A 4IMYB 4ROEA 3K7AM 4UN0A 2BS4A 5HQ0B 2ZPFB 2PK9B 3M03A 2CZ6B 2CYZB 3A8MB 4BCMD 2UZBB 5ICPB 2W99A 3BG3A 1OL2B 1P5EB 4JX6A 4EONB 3MI9B 4M6VA 5CYIB 1OKVB 4OB0B 2C6TB 2G77A 2UZDB 4G6LB 3A8OB 2C5NB 4MFEA 4BCJB 2AHJB 2UZEB 2WEVB 4CRLB 1AD6A 4OB1B 3QHWB 3QYGB 1QLBA 3QYEA 2KR6A 3TN8B 4F6UB 3QHRB 2ZPEB 1UNLD 2EUFA 4CFVB 3BHUB 4Y72B 2ZPBB 2QFZA 1H1QB 5HBEB 3QYHB 3NDQA 3HBLA 3H4CA 2CCIB 3WVEB 1TD6A 3DJBA 5IF1B 3HO8A 2ZPIB 5HBJB 4CFWB 2QGSA 2R7GA 2DD5B
chains in the Genus database with same CATH topology
3EOCB 1QMZB 1OKWB 4ELJA 4RODA 2QDJA 4OGRB 4EOSB 1O9KA 4EOJB 4EORB 1G3NC 4BCNB 4FX3B 2I53A 2WPAB 5LQFB 3DDQB 1E9HB 2CJMB 1H28B 2BKZB 5IDNB 4BCPB 2X1NB 4IMYB 4ROEA 3K7AM 4UN0A 5EFQB 4EOPB 5HQ0B 2WIPB 1UNHD 4NSTB 3BHTB 2G9XB 1H1RB 2PK2A 5I5ZB 1GUXA 2WHBB 4BCHB 4YOZA 4EOKB 4F70B 3MY1B 2PHGA 5HNBB 2PK9B 3BLHB 3M03A 2I40B 2WIHB 1JKWA 2UZLB 4EOIB 4F7SB 1H1SB 1JOWA 1TFBA 4BCMD 1H27B 1N4MA 1F5QB 2F2CA 2UZBB 5ICPB 3DDPB 2BPMB 4CFNB 3TNWB 4F7LB 5BNJB 2W99A 2PMIB 1OL2B 1P5EB 4EOMB 4EONB 5L2WB 3MI9B 5CYIB 1OKVB 1BU2A 3G33B 1FINB 1JSTB 4BCGB 1OL1B 2IW6B 1H24B 3MIAB 4CXAB 4EOOB 5LMKB 4EOQB 1D3UB 4BCND 4TTHA 4BCQB 4F7NB 2C5OB 4ROCA 2C6TB 2UZDB 3BLRB 1H25B 4CFUB 1GUXB 4G6LB 4I3ZB 2B9RA 3MY5B 4BCIB 2C5NB 1OI9B 3RGFB 1AISB 4BCJB 1H1PB 1GY3B 2UUEB 2UZEB 2WMBB 2WEVB 4EOLB 4CFMB 2WMAB 1W98B 1OIYB 3EJ1B 4EC8B 1O9KB 1VYWB 5FGKB 2C5XB 4CRLB 2WXVB 1H26B 4F7JB 1H4LD 1C9BA 1AD6A 3QHWB 1URCB 1VOLA 1ZP2A 4BCOB 4F6UB 3TN8B 5HVYB 5ACBA 3DOGB 3QHRB 3TNIB 1JSUB 3EIDB 1GH6B 2CCHB 4BCMB 1UNLD 4F6SB 3LQ5B 2EUFA 4CFVB 1VINA 3BHUB 4OR5B 1UNGD 4BCFB 4KRDB 1PKDB 1OGUB 2IW8B 4Y72B 2IW9B 5IDPB 2W9FA 4II5B 2C5VB 2W96A 1H1QB 5HBEB 3BHVB 3POMA 4KRCB 4F6WB 2V22B 4EC9B 3H4CA 2CCIB 5CEIB 2W9ZA 4YOSA 4YOOA 5IF1B 4BCKB 2WFYB 5HBHB 4YC3B 1KXUA 1OIUB 2C4GB 3BLQB 4CFXB 5HBJB 3O0GD 4BCQD 4ELLA 2W2HA 2JGZB 4CFWB 1FVVB 1XO2A 2R7GA 3F5XB 2IVXA 3TNHB 4CFUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EOC B;  1QMZ B;  1OKW B;  4ELJ A;  4ROD A;  2QDJ A;  4OGR B;  4EOS B;  1O9K A;  4EOJ B;  4EOR B;  1G3N C;  4BCN B;  4FX3 B;  2I53 A;  2WPA B;  5LQF B;  3DDQ B;  1E9H B;  2CJM B;  1H28 B;  2BKZ B;  5IDN B;  4BCP B;  2X1N B;  4IMY B;  4ROE A;  3K7A M;  4UN0 A;  5EFQ B;  4EOP B;  5HQ0 B;  2WIP B;  1UNH D;  4NST B;  3BHT B;  2G9X B;  1H1R B;  2PK2 A;  5I5Z B;  1GUX A;  2WHB B;  4BCH B;  4YOZ A;  4EOK B;  4F70 B;  3MY1 B;  2PHG A;  5HNB B;  2PK9 B;  3BLH B;  3M03 A;  2I40 B;  2WIH B;  1JKW A;  2UZL B;  4EOI B;  4F7S B;  1H1S B;  1JOW A;  1TFB A;  4BCM D;  1H27 B;  1N4M A;  1F5Q B;  2F2C A;  2UZB B;  5ICP B;  3DDP B;  2BPM B;  4CFN B;  3TNW B;  4F7L B;  5BNJ B;  2W99 A;  2PMI B;  1OL2 B;  1P5E B;  4EOM B;  4EON B;  5L2W B;  3MI9 B;  5CYI B;  1OKV B;  1BU2 A;  3G33 B;  1FIN B;  1JST B;  4BCG B;  1OL1 B;  2IW6 B;  1H24 B;  3MIA B;  4CXA B;  4EOO B;  5LMK B;  4EOQ B;  1D3U B;  4BCN D;  4TTH A;  4BCQ B;  4F7N B;  2C5O B;  4ROC A;  2C6T B;  2UZD B;  3BLR B;  1H25 B;  4CFU B;  1GUX B;  4G6L B;  4I3Z B;  2B9R A;  3MY5 B;  4BCI B;  2C5N B;  1OI9 B;  3RGF B;  1AIS B;  4BCJ B;  1H1P B;  1GY3 B;  2UUE B;  2UZE B;  2WMB B;  2WEV B;  4EOL B;  4CFM B;  2WMA B;  1W98 B;  1OIY B;  3EJ1 B;  4EC8 B;  1O9K B;  1VYW B;  5FGK B;  2C5X B;  4CRL B;  2WXV B;  1H26 B;  4F7J B;  1H4L D;  1C9B A;  1AD6 A;  3QHW B;  1URC B;  1VOL A;  1ZP2 A;  4BCO B;  4F6U B;  3TN8 B;  5HVY B;  5ACB A;  3DOG B;  3QHR B;  3TNI B;  1JSU B;  3EID B;  1GH6 B;  2CCH B;  4BCM B;  1UNL D;  4F6S B;  3LQ5 B;  2EUF A;  4CFV B;  1VIN A;  3BHU B;  4OR5 B;  1UNG D;  4BCF B;  4KRD B;  1PKD B;  1OGU B;  2IW8 B;  4Y72 B;  2IW9 B;  5IDP B;  2W9F A;  4II5 B;  2C5V B;  2W96 A;  1H1Q B;  5HBE B;  3BHV B;  3POM A;  4KRC B;  4F6W B;  2V22 B;  4EC9 B;  3H4C A;  2CCI B;  5CEI B;  2W9Z A;  4YOS A;  4YOO A;  5IF1 B;  4BCK B;  2WFY B;  5HBH B;  4YC3 B;  1KXU A;  1OIU B;  2C4G B;  3BLQ B;  4CFX B;  5HBJ B;  3O0G D;  4BCQ D;  4ELL A;  2W2H A;  2JGZ B;  4CFW B;  1FVV B;  1XO2 A;  2R7G A;  3F5X B;  2IVX A;  3TNH B;  4CFU D; 
#chains in the Genus database with same CATH topology
 3VYH B;  4ZGD B;  5EJC A;  4EOJ B;  2WPA B;  1E9H B;  2BKZ B;  3QXE B;  4NST B;  2G9X B;  2PK2 A;  2CZ1 B;  1GUX A;  2WHB B;  4EOK B;  2WIH B;  1JKW A;  2UZL B;  1H1S B;  1JOW A;  1TFB A;  1H27 B;  4BY1 X;  3X20 B;  5BNJ B;  4EOM B;  5L2W B;  1FIN B;  3A8G B;  4CXA B;  3MIA B;  1H24 B;  1D3U B;  5LMK B;  4EOQ B;  4F7N B;  4BCQ B;  2D0Q B;  1AHJ B;  1H25 B;  4CFU B;  2B9R A;  3MY5 B;  1E7P A;  3A8L B;  2WJ9 A;  2UUE B;  2WMB B;  4EOL B;  3EJ1 B;  1O9K B;  1VYW B;  2BS2 A;  1H26 B;  3BG9 A;  4F7J B;  1H4L D;  1C9B A;  1URC B;  4BCO B;  5HVY B;  1JSU B;  1GH6 B;  2CCH B;  3BG5 A;  4LOC A;  4F6S B;  3LQ5 B;  2DME A;  1VIN A;  1UNG D;  1OGU B;  2DD4 B;  5IDP B;  4II5 B;  2IN3 A;  2DXB B;  2V22 B;  4ZGJ B;  4YOS A;  4BCQ D;  4ELL A;  2W2H A;  2PJQ A;  4MFD A;  4BXX X;  1UGP B;  3TNH B;  4CFU D;  3QZ9 B;  2ZCF B;  1OKW B;  4OB2 B;  1O9K A;  2DPP B;  1G3N C;  3QWL A;  4FX3 B;  4BBS M;  2CZ7 B;  4BCP B;  2X1N B;  4AKI A;  4AKG A;  4BY7 X;  5EFQ B;  4EOP B;  2WIP B;  1H1R B;  3X28 B;  2QQ8 A;  5I5Z B;  4YOZ A;  4F70 B;  4Z6Y A;  5HNB B;  3BLH B;  2I40 B;  4EOI B;  3WVD B;  1UGR B;  3X25 B;  1UGS B;  2BPM B;  4CFN B;  3PO3 S;  4HLQ A;  1BU2 A;  3G33 B;  4MIM A;  4EOO B;  2IW6 B;  3A8H B;  3BLR B;  4QSH A;  4BCI B;  3RGF B;  1AIS B;  3KHI A;  3VKH A;  1GY3 B;  4CFM B;  1FKM A;  2WMA B;  1OIY B;  5FGK B;  1ENW A;  4HNT A;  2QDY B;  3DOG B;  3TNI B;  3EID B;  4OR5 B;  4BCF B;  4AKH A;  1PKD B;  2ZZD B;  2IW8 B;  2W9F A;  4FM4 B;  3BHV B;  4KRC B;  4EC9 B;  5CEI B;  4BCK B;  3B57 A;  2WFY B;  1KXU A;  1OIU B;  4NC6 A;  3O0G D;  3X26 B;  2JGZ B;  1XO2 A;  5IHY A;  3GTM S;  2CZ0 B;  3EOC B;  3QYB A;  4HNV A;  4ELJ A;  1UGQ B;  2QDJ A;  4EOS B;  4EOR B;  3QZ5 B;  2I53 A;  5LQF B;  3DDQ B;  2CJM B;  1H28 B;  5IDN B;  2QF7 A;  3VKG A;  4HL4 A;  1UNH D;  3BHT B;  4HNU A;  3HZJ A;  4BCH B;  3MY1 B;  2PHG A;  4F7S B;  1N4M A;  1F5Q B;  2F2C A;  3DDP B;  3TNW B;  4F7L B;  2PMI B;  2ZPH B;  3TW6 A;  1JST B;  4BCG B;  1OL1 B;  4BCN D;  4TTH A;  2DXC B;  2C5O B;  4ROC A;  1GUX B;  4I3Z B;  4BBR M;  1OI9 B;  1H1P B;  1W98 B;  4EC8 B;  3X24 B;  2C5X B;  2WXV B;  3HB9 A;  1VOL A;  1ZP2 A;  1V29 B;  5ACB A;  3TW7 A;  2ZPG B;  4BCM B;  4ZGE B;  4KRD B;  3VYG B;  2IW9 B;  2C5V B;  2W96 A;  3POM A;  4AI6 A;  4F6W B;  2W9Z A;  4JX4 A;  3HHT B;  4YOO A;  5DQV A;  5HBH B;  2BS3 A;  4YC3 B;  5DQW A;  2C4G B;  3BLQ B;  1IRE B;  4CFX B;  1FVV B;  3F5X B;  2IVX A;  3DTO A;  4OB3 B;  1QMZ B;  3DL1 A;  4ROD A;  4OGR B;  2KMG A;  4BCN B;  2LW4 A;  4JX5 A;  4IMY B;  4ROE A;  3K7A M;  4UN0 A;  2BS4 A;  5HQ0 B;  2ZPF B;  2PK9 B;  3M03 A;  2CZ6 B;  2CYZ B;  3A8M B;  4BCM D;  2UZB B;  5ICP B;  2W99 A;  3BG3 A;  1OL2 B;  1P5E B;  4JX6 A;  4EON B;  3MI9 B;  4M6V A;  5CYI B;  1OKV B;  4OB0 B;  2C6T B;  2G77 A;  2UZD B;  4G6L B;  3A8O B;  2C5N B;  4MFE A;  4BCJ B;  2AHJ B;  2UZE B;  2WEV B;  4CRL B;  1AD6 A;  4OB1 B;  3QHW B;  3QYG B;  1QLB A;  3QYE A;  2KR6 A;  3TN8 B;  4F6U B;  3QHR B;  2ZPE B;  1UNL D;  2EUF A;  4CFV B;  3BHU B;  4Y72 B;  2ZPB B;  2QFZ A;  1H1Q B;  5HBE B;  3QYH B;  3NDQ A;  3HBL A;  3H4C A;  2CCI B;  3WVE B;  1TD6 A;  3DJB A;  5IF1 B;  3HO8 A;  2ZPI B;  5HBJ B;  4CFW B;  2QGS A;  2R7G A;  2DD5 B; 
#chains in the Genus database with same CATH homology
 3EOC B;  1QMZ B;  1OKW B;  4ELJ A;  4ROD A;  2QDJ A;  4OGR B;  4EOS B;  1O9K A;  4EOJ B;  4EOR B;  1G3N C;  4BCN B;  4FX3 B;  2I53 A;  2WPA B;  5LQF B;  3DDQ B;  1E9H B;  2CJM B;  1H28 B;  2BKZ B;  5IDN B;  4BCP B;  2X1N B;  4IMY B;  4ROE A;  3K7A M;  4UN0 A;  5EFQ B;  4EOP B;  5HQ0 B;  2WIP B;  1UNH D;  4NST B;  3BHT B;  2G9X B;  1H1R B;  2PK2 A;  5I5Z B;  1GUX A;  2WHB B;  4BCH B;  4YOZ A;  4EOK B;  4F70 B;  3MY1 B;  2PHG A;  5HNB B;  2PK9 B;  3BLH B;  3M03 A;  2I40 B;  2WIH B;  1JKW A;  2UZL B;  4EOI B;  4F7S B;  1H1S B;  1JOW A;  1TFB A;  4BCM D;  1H27 B;  1N4M A;  1F5Q B;  2F2C A;  2UZB B;  5ICP B;  3DDP B;  2BPM B;  4CFN B;  3TNW B;  4F7L B;  5BNJ B;  2W99 A;  2PMI B;  1OL2 B;  1P5E B;  4EOM B;  4EON B;  5L2W B;  3MI9 B;  5CYI B;  1OKV B;  1BU2 A;  3G33 B;  1FIN B;  1JST B;  4BCG B;  1OL1 B;  2IW6 B;  1H24 B;  3MIA B;  4CXA B;  4EOO B;  5LMK B;  4EOQ B;  1D3U B;  4BCN D;  4TTH A;  4BCQ B;  4F7N B;  2C5O B;  4ROC A;  2C6T B;  2UZD B;  3BLR B;  1H25 B;  4CFU B;  1GUX B;  4G6L B;  4I3Z B;  2B9R A;  3MY5 B;  4BCI B;  2C5N B;  1OI9 B;  3RGF B;  1AIS B;  4BCJ B;  1H1P B;  1GY3 B;  2UUE B;  2UZE B;  2WMB B;  2WEV B;  4EOL B;  4CFM B;  2WMA B;  1W98 B;  1OIY B;  3EJ1 B;  4EC8 B;  1O9K B;  1VYW B;  5FGK B;  2C5X B;  4CRL B;  2WXV B;  1H26 B;  4F7J B;  1H4L D;  1C9B A;  1AD6 A;  3QHW B;  1URC B;  1VOL A;  1ZP2 A;  4BCO B;  4F6U B;  3TN8 B;  5HVY B;  5ACB A;  3DOG B;  3QHR B;  3TNI B;  1JSU B;  3EID B;  1GH6 B;  2CCH B;  4BCM B;  1UNL D;  4F6S B;  3LQ5 B;  2EUF A;  4CFV B;  1VIN A;  3BHU B;  4OR5 B;  1UNG D;  4BCF B;  4KRD B;  1PKD B;  1OGU B;  2IW8 B;  4Y72 B;  2IW9 B;  5IDP B;  2W9F A;  4II5 B;  2C5V B;  2W96 A;  1H1Q B;  5HBE B;  3BHV B;  3POM A;  4KRC B;  4F6W B;  2V22 B;  4EC9 B;  3H4C A;  2CCI B;  5CEI B;  2W9Z A;  4YOS A;  4YOO A;  5IF1 B;  4BCK B;  2WFY B;  5HBH B;  4YC3 B;  1KXU A;  1OIU B;  2C4G B;  3BLQ B;  4CFX B;  5HBJ B;  3O0G D;  4BCQ D;  4ELL A;  2W2H A;  2JGZ B;  4CFW B;  1FVV B;  1XO2 A;  2R7G A;  3F5X B;  2IVX A;  3TNH B;  4CFU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...