3EJ1B

Cdk2/cyclina complexed with a pyrazolopyridazine inhibitor
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords Cell division protein kinase 2
publication title Synthesis and evaluation of pyrazolo[1,5-b]pyridazines as selective cyclin dependent kinase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ej1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3ej1B02
1GUXA 5HQ0B 3TNHB 1XO2A 1H27B 4BCOB 1VYWB 4F7LB 2C5OB 4BCFB 1JOWA 2X1NB 1UNHD 3BLQB 4BCNB 1P5EB 2V22B 1JSTB 2WIHB 3G33B 4ROCA 4CFNB 3QHWB 1OKVB 3EJ1B 3POMA 3TNWB 4BCMD 4BCQD 2C4GB 2C5VB 3M03A 4EOSB 2BPMB 1OIUB 2PMIB 1JSUB 5FGKB 5HVYB 1VOLA 4YC3B 1OKWB 3RGFB 5IF1B 3TN8B 2WMAB 3DOGB 2CJMB 3F5XB 2IW9B 2C5NB 4G6LB 4I3ZB 4CFXB 1AISB 4BCKB 4CFMB 3MI9B 3QHRB 1FVVB 3DDQB 4UN0A 2UZLB 2W96A 1N4MA 1G3NC 4F7SB 4CXAB 1UNLD 2PHGA 1F5QB 4EOOB 1PKDB 4IMYB 1W98B 4EOIB 1QMZB 4BCHB 2IW8B 4ROEA 3O0GD 2I40B 4YOZA 4EOPB 1H24B 3DDPB 3TNIB 5BNJB 1KXUA 2PK9B 3MY1B 4YOOA 1OGUB 2W99A 1D3UB 3EIDB 2UZBB 1O9KB 5ICPB 3BHVB 1GH6B 1H1QB 2WIPB 2CCHB 1OL1B 4EONB 4F6WB 2IW6B 5I5ZB 2F2CA 1GY3B 4Y72B 1TFBA 1O9KA 4CFWB 4CRLB 2WFYB 2QDJA 4RODA 3MIAB 3K7AM 2I53A 5L2WB 2WXVB 4KRDB 2BKZB 2WPAB 2IVXA 4OR5B 4TTHA 5HBJB 1C9BA 3MY5B 3BLRB 4CFUB 1H1RB 1H1PB 1H4LD 1H26B 5LQFB 2CCIB 2WMBB 3H4CA 2EUFA 4BCJB 1OIYB 2B9RA 2UUEB 4BCPB 3BHTB 4NSTB 4F6UB 2C5XB 1URCB 1FINB 4F7JB 1OI9B 2WEVB 4F70B 5HNBB 4EOKB 4YOSA 5IDNB 4BCIB 2UZDB 4EOLB 4BCGB 2C6TB 4KRCB 4F6SB 5HBHB 4EORB 2PK2A 4CFUD 4EC8B 4ELLA 2W2HA 3BHUB 1OL2B 1AD6A 4EC9B 3EOCB 1JKWA 4ELJA 4CFVB 2W9ZA 3LQ5B 5EFQB 1H1SB 4II5B 3BLHB 4OGRB 1ZP2A 2G9XB 4EOMB 4FX3B 4BCMB 2JGZB 4BCQB 2UZEB 4EOJB 5CEIB 1GUXB 5IDPB 4F7NB 1UNGD 1E9HB 2WHBB 5CYIB 5ACBA 1H28B 5HBEB 2R7GA 1BU2A 1H25B 1VINA 4BCND 5LMKB 4EOQB 2W9FA
chains in the Genus database with same CATH superfamily
3QYBA 5HQ0B 1H27B 4LOCA 2V22B 1UGRB 4BBSM 2C4GB 2DD5B 3M03A 2QQ8A 2PMIB 2ZZDB 2WMAB 2C5NB 2W96A 4F7SB 2QF7A 4CXAB 3QZ5B 4EOOB 4MFEA 1PKDB 4IMYB 4ROEA 2I40B 4EOPB 1KXUA 2BS3A 4JX6A 1OGUB 5ICPB 1E7PA 3BHVB 2WIPB 2ZPEB 3VKGA 2CCHB 1OL1B 5I5ZB 4ZGJB 2DPPB 1O9KA 4RODA 3MIAB 5L2WB 4KRDB 1C9BA 2IVXA 5HBJB 4HNVA 4HLQA 4CFUB 1H26B 4ZGEB 4BBRM 3H4CA 2DXCB 1OIYB 2B9RA 4BCPB 1OI9B 4F70B 1TD6A 5HNBB 5IDNB 2UZDB 2CZ0B 4F6SB 2DD4B 3EOCB 4HL4A 2D0QB 5IDPB 2CZ6B 5DQWA 5HBEB 4OB3B 4EOQB 2W9FA 3TNHB 3VYHB 1XO2A 1VYWB 2C5OB 3HO8A 2QFZA 3G33B 1JSTB 2CZ1B 3QYEA 4BXXX 3WVEB 1VOLA 5FGKB 1OKWB 5IF1B 3TN8B 4NC6A 2IW9B 1V29B 3DTOA 3MI9B 3DDQB 2IN3A 2UZLB 4QSHA 1N4MA 2ZPIB 1UNLD 1F5QB 4EOIB 1W98B 1QMZB 4BCHB 2IW8B 3X26B 4YOZA 2LW4A 4OB1B 2PK9B 3DL1A 3EIDB 2UZBB 1GH6B 1H1QB 4EONB 2F2CA 4Y72B 2PJQA 4CFWB 2WFYB 3HBLA 3K7AM 3TW6A 2WPAB 4TTHA 3A8HB 3BLRB 2CZ7B 4Z6YA 4AI6A 3QXEB 1IREB 4BCJB 5IHYA 1URCB 4F7JB 4BY7X 2QDYB 4BCGB 3HB9A 2PK2A 4EC8B 3WVDB 3A8LB 4ELJA 4CFVB 2W9ZA 1H1SB 3DJBA 4FX3B 1UGPB 2JGZB 2G77A 3HZJA 4F7NB 5CYIB 1H28B 2R7GA 1VINA 1H25B 3QYHB 1GUXA 4JX5A 4BCOB 4F7LB 2DXBB 1JOWA 2X1NB 2ZPHB 3B57A 2KR6A 4BCNB 3QWLA 2WIHB 4CFNB 3EJ1B 4BY1X 4BCMD 3X28B 3VYGB 2C5VB 2BPMB 1OIUB 1JSUB 4YC3B 2CJMB 3F5XB 1FKMA 4G6LB 4CFXB 4OB0B 2ZPBB 4CFMB 3QHRB 1FVVB 3X25B 2WJ9A 4AKIA 3X20B 1H24B 3DDPB 3TNIB 3MY1B 4YOOA 5EJCA 1O9KB 3X24B 1UGSB 2CYZB 3QYGB 1GY3B 3NDQA 4CRLB 2QDJA 2I53A 3A8OB 3MY5B 1H4LD 1H1PB 3BG9A 4AKHA 2WMBB 2UUEB 4F6UB 1AHJB 2WEVB 4EOKB 4YOSA 4BCIB 2C6TB 2ZPGB 4KRCB 5HBHB 4EORB 2W2HA 2KMGA 4EC9B 5EFQB 4II5B 3BLHB 4OGRB 1ZP2A 3BG3A 4BCMB 4AKGA 2UZEB 4EOJB 5CEIB 3TW7A 1UNGD 1E9HB 1BU2A 5LMKB 4FM4B 4M6VA 4ZGDB 4BCFB 2BS4A 3HHTB 1UNHD 3BLQB 1P5EB 4ROCA 3A8MB 3QHWB 1OKVB 3POMA 3TNWB 4BCQD 3A8GB 2BS2A 5HVYB 4EOSB 3RGFB 3KHIA 3PO3S 3DOGB 4I3ZB 1AISB 4BCKB 4UN0A 1G3NC 2DMEA 2PHGA 4MFDA 4MIMA 3O0GD 5BNJB 1UGQB 2ZCFB 2W99A 1D3UB 4F6WB 2IW6B 1TFBA 1QLBA 5DQVA 2WXVB 2BKZB 4OR5B 3VKHA 1H1RB 2ZPFB 3QZ9B 5LQFB 2CCIB 2EUFA 3BHTB 4NSTB 2C5XB 1FINB 4EOLB 4CFUD 4ELLA 3BHUB 1OL2B 1AD6A 2QGSA 1JKWA 2AHJB 3LQ5B 4OB2B 2G9XB 4EOMB 4HNUA 4HNTA 4BCQB 1GUXB 4JX4A 5ACBA 2WHBB 1ENWA 3BG5A 3GTMS 4BCND
chains in the Genus database with same CATH topology
1GUXA 5HQ0B 3TNHB 1XO2A 1H27B 4BCOB 1VYWB 4F7LB 2C5OB 4BCFB 1JOWA 2X1NB 1UNHD 3BLQB 4BCNB 1P5EB 2V22B 1JSTB 2WIHB 3G33B 4ROCA 4CFNB 3QHWB 1OKVB 3EJ1B 3POMA 3TNWB 4BCMD 4BCQD 2C4GB 2C5VB 3M03A 4EOSB 2BPMB 1OIUB 2PMIB 1JSUB 5FGKB 5HVYB 1VOLA 4YC3B 1OKWB 3RGFB 5IF1B 3TN8B 2WMAB 3DOGB 2CJMB 3F5XB 2IW9B 2C5NB 4G6LB 4I3ZB 4CFXB 1AISB 4BCKB 4CFMB 3MI9B 3QHRB 1FVVB 3DDQB 4UN0A 2UZLB 2W96A 1N4MA 1G3NC 4F7SB 4CXAB 1UNLD 2PHGA 1F5QB 4EOOB 1PKDB 4IMYB 1W98B 4EOIB 1QMZB 4BCHB 2IW8B 4ROEA 3O0GD 2I40B 4YOZA 4EOPB 1H24B 3DDPB 3TNIB 5BNJB 1KXUA 2PK9B 3MY1B 4YOOA 1OGUB 2W99A 1D3UB 3EIDB 2UZBB 1O9KB 5ICPB 3BHVB 1GH6B 1H1QB 2WIPB 2CCHB 1OL1B 4EONB 4F6WB 2IW6B 5I5ZB 2F2CA 1GY3B 4Y72B 1TFBA 1O9KA 4CFWB 4CRLB 2WFYB 2QDJA 4RODA 3MIAB 3K7AM 2I53A 5L2WB 2WXVB 4KRDB 2BKZB 2WPAB 2IVXA 4OR5B 4TTHA 5HBJB 1C9BA 3MY5B 3BLRB 4CFUB 1H1RB 1H1PB 1H4LD 1H26B 5LQFB 2CCIB 2WMBB 3H4CA 2EUFA 4BCJB 1OIYB 2B9RA 2UUEB 4BCPB 3BHTB 4NSTB 4F6UB 2C5XB 1URCB 1FINB 4F7JB 1OI9B 2WEVB 4F70B 5HNBB 4EOKB 4YOSA 5IDNB 4BCIB 2UZDB 4EOLB 4BCGB 2C6TB 4KRCB 4F6SB 5HBHB 4EORB 2PK2A 4CFUD 4EC8B 4ELLA 2W2HA 3BHUB 1OL2B 1AD6A 4EC9B 3EOCB 1JKWA 4ELJA 4CFVB 2W9ZA 3LQ5B 5EFQB 1H1SB 4II5B 3BLHB 4OGRB 1ZP2A 2G9XB 4EOMB 4FX3B 4BCMB 2JGZB 4BCQB 2UZEB 4EOJB 5CEIB 1GUXB 5IDPB 4F7NB 1UNGD 1E9HB 2WHBB 5CYIB 5ACBA 1H28B 5HBEB 2R7GA 1BU2A 1H25B 1VINA 4BCND 5LMKB 4EOQB 2W9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUX A;  5HQ0 B;  3TNH B;  1XO2 A;  1H27 B;  4BCO B;  1VYW B;  4F7L B;  2C5O B;  4BCF B;  1JOW A;  2X1N B;  1UNH D;  3BLQ B;  4BCN B;  1P5E B;  2V22 B;  1JST B;  2WIH B;  3G33 B;  4ROC A;  4CFN B;  3QHW B;  1OKV B;  3EJ1 B;  3POM A;  3TNW B;  4BCM D;  4BCQ D;  2C4G B;  2C5V B;  3M03 A;  4EOS B;  2BPM B;  1OIU B;  2PMI B;  1JSU B;  5FGK B;  5HVY B;  1VOL A;  4YC3 B;  1OKW B;  3RGF B;  5IF1 B;  3TN8 B;  2WMA B;  3DOG B;  2CJM B;  3F5X B;  2IW9 B;  2C5N B;  4G6L B;  4I3Z B;  4CFX B;  1AIS B;  4BCK B;  4CFM B;  3MI9 B;  3QHR B;  1FVV B;  3DDQ B;  4UN0 A;  2UZL B;  2W96 A;  1N4M A;  1G3N C;  4F7S B;  4CXA B;  1UNL D;  2PHG A;  1F5Q B;  4EOO B;  1PKD B;  4IMY B;  1W98 B;  4EOI B;  1QMZ B;  4BCH B;  2IW8 B;  4ROE A;  3O0G D;  2I40 B;  4YOZ A;  4EOP B;  1H24 B;  3DDP B;  3TNI B;  5BNJ B;  1KXU A;  2PK9 B;  3MY1 B;  4YOO A;  1OGU B;  2W99 A;  1D3U B;  3EID B;  2UZB B;  1O9K B;  5ICP B;  3BHV B;  1GH6 B;  1H1Q B;  2WIP B;  2CCH B;  1OL1 B;  4EON B;  4F6W B;  2IW6 B;  5I5Z B;  2F2C A;  1GY3 B;  4Y72 B;  1TFB A;  1O9K A;  4CFW B;  4CRL B;  2WFY B;  2QDJ A;  4ROD A;  3MIA B;  3K7A M;  2I53 A;  5L2W B;  2WXV B;  4KRD B;  2BKZ B;  2WPA B;  2IVX A;  4OR5 B;  4TTH A;  5HBJ B;  1C9B A;  3MY5 B;  3BLR B;  4CFU B;  1H1R B;  1H1P B;  1H4L D;  1H26 B;  5LQF B;  2CCI B;  2WMB B;  3H4C A;  2EUF A;  4BCJ B;  1OIY B;  2B9R A;  2UUE B;  4BCP B;  3BHT B;  4NST B;  4F6U B;  2C5X B;  1URC B;  1FIN B;  4F7J B;  1OI9 B;  2WEV B;  4F70 B;  5HNB B;  4EOK B;  4YOS A;  5IDN B;  4BCI B;  2UZD B;  4EOL B;  4BCG B;  2C6T B;  4KRC B;  4F6S B;  5HBH B;  4EOR B;  2PK2 A;  4CFU D;  4EC8 B;  4ELL A;  2W2H A;  3BHU B;  1OL2 B;  1AD6 A;  4EC9 B;  3EOC B;  1JKW A;  4ELJ A;  4CFV B;  2W9Z A;  3LQ5 B;  5EFQ B;  1H1S B;  4II5 B;  3BLH B;  4OGR B;  1ZP2 A;  2G9X B;  4EOM B;  4FX3 B;  4BCM B;  2JGZ B;  4BCQ B;  2UZE B;  4EOJ B;  5CEI B;  1GUX B;  5IDP B;  4F7N B;  1UNG D;  1E9H B;  2WHB B;  5CYI B;  5ACB A;  1H28 B;  5HBE B;  2R7G A;  1BU2 A;  1H25 B;  1VIN A;  4BCN D;  5LMK B;  4EOQ B;  2W9F A; 
#chains in the Genus database with same CATH topology
 3QYB A;  5HQ0 B;  1H27 B;  4LOC A;  2V22 B;  1UGR B;  4BBS M;  2C4G B;  2DD5 B;  3M03 A;  2QQ8 A;  2PMI B;  2ZZD B;  2WMA B;  2C5N B;  2W96 A;  4F7S B;  2QF7 A;  4CXA B;  3QZ5 B;  4EOO B;  4MFE A;  1PKD B;  4IMY B;  4ROE A;  2I40 B;  4EOP B;  1KXU A;  2BS3 A;  4JX6 A;  1OGU B;  5ICP B;  1E7P A;  3BHV B;  2WIP B;  2ZPE B;  3VKG A;  2CCH B;  1OL1 B;  5I5Z B;  4ZGJ B;  2DPP B;  1O9K A;  4ROD A;  3MIA B;  5L2W B;  4KRD B;  1C9B A;  2IVX A;  5HBJ B;  4HNV A;  4HLQ A;  4CFU B;  1H26 B;  4ZGE B;  4BBR M;  3H4C A;  2DXC B;  1OIY B;  2B9R A;  4BCP B;  1OI9 B;  4F70 B;  1TD6 A;  5HNB B;  5IDN B;  2UZD B;  2CZ0 B;  4F6S B;  2DD4 B;  3EOC B;  4HL4 A;  2D0Q B;  5IDP B;  2CZ6 B;  5DQW A;  5HBE B;  4OB3 B;  4EOQ B;  2W9F A;  3TNH B;  3VYH B;  1XO2 A;  1VYW B;  2C5O B;  3HO8 A;  2QFZ A;  3G33 B;  1JST B;  2CZ1 B;  3QYE A;  4BXX X;  3WVE B;  1VOL A;  5FGK B;  1OKW B;  5IF1 B;  3TN8 B;  4NC6 A;  2IW9 B;  1V29 B;  3DTO A;  3MI9 B;  3DDQ B;  2IN3 A;  2UZL B;  4QSH A;  1N4M A;  2ZPI B;  1UNL D;  1F5Q B;  4EOI B;  1W98 B;  1QMZ B;  4BCH B;  2IW8 B;  3X26 B;  4YOZ A;  2LW4 A;  4OB1 B;  2PK9 B;  3DL1 A;  3EID B;  2UZB B;  1GH6 B;  1H1Q B;  4EON B;  2F2C A;  4Y72 B;  2PJQ A;  4CFW B;  2WFY B;  3HBL A;  3K7A M;  3TW6 A;  2WPA B;  4TTH A;  3A8H B;  3BLR B;  2CZ7 B;  4Z6Y A;  4AI6 A;  3QXE B;  1IRE B;  4BCJ B;  5IHY A;  1URC B;  4F7J B;  4BY7 X;  2QDY B;  4BCG B;  3HB9 A;  2PK2 A;  4EC8 B;  3WVD B;  3A8L B;  4ELJ A;  4CFV B;  2W9Z A;  1H1S B;  3DJB A;  4FX3 B;  1UGP B;  2JGZ B;  2G77 A;  3HZJ A;  4F7N B;  5CYI B;  1H28 B;  2R7G A;  1VIN A;  1H25 B;  3QYH B;  1GUX A;  4JX5 A;  4BCO B;  4F7L B;  2DXB B;  1JOW A;  2X1N B;  2ZPH B;  3B57 A;  2KR6 A;  4BCN B;  3QWL A;  2WIH B;  4CFN B;  3EJ1 B;  4BY1 X;  4BCM D;  3X28 B;  3VYG B;  2C5V B;  2BPM B;  1OIU B;  1JSU B;  4YC3 B;  2CJM B;  3F5X B;  1FKM A;  4G6L B;  4CFX B;  4OB0 B;  2ZPB B;  4CFM B;  3QHR B;  1FVV B;  3X25 B;  2WJ9 A;  4AKI A;  3X20 B;  1H24 B;  3DDP B;  3TNI B;  3MY1 B;  4YOO A;  5EJC A;  1O9K B;  3X24 B;  1UGS B;  2CYZ B;  3QYG B;  1GY3 B;  3NDQ A;  4CRL B;  2QDJ A;  2I53 A;  3A8O B;  3MY5 B;  1H4L D;  1H1P B;  3BG9 A;  4AKH A;  2WMB B;  2UUE B;  4F6U B;  1AHJ B;  2WEV B;  4EOK B;  4YOS A;  4BCI B;  2C6T B;  2ZPG B;  4KRC B;  5HBH B;  4EOR B;  2W2H A;  2KMG A;  4EC9 B;  5EFQ B;  4II5 B;  3BLH B;  4OGR B;  1ZP2 A;  3BG3 A;  4BCM B;  4AKG A;  2UZE B;  4EOJ B;  5CEI B;  3TW7 A;  1UNG D;  1E9H B;  1BU2 A;  5LMK B;  4FM4 B;  4M6V A;  4ZGD B;  4BCF B;  2BS4 A;  3HHT B;  1UNH D;  3BLQ B;  1P5E B;  4ROC A;  3A8M B;  3QHW B;  1OKV B;  3POM A;  3TNW B;  4BCQ D;  3A8G B;  2BS2 A;  5HVY B;  4EOS B;  3RGF B;  3KHI A;  3PO3 S;  3DOG B;  4I3Z B;  1AIS B;  4BCK B;  4UN0 A;  1G3N C;  2DME A;  2PHG A;  4MFD A;  4MIM A;  3O0G D;  5BNJ B;  1UGQ B;  2ZCF B;  2W99 A;  1D3U B;  4F6W B;  2IW6 B;  1TFB A;  1QLB A;  5DQV A;  2WXV B;  2BKZ B;  4OR5 B;  3VKH A;  1H1R B;  2ZPF B;  3QZ9 B;  5LQF B;  2CCI B;  2EUF A;  3BHT B;  4NST B;  2C5X B;  1FIN B;  4EOL B;  4CFU D;  4ELL A;  3BHU B;  1OL2 B;  1AD6 A;  2QGS A;  1JKW A;  2AHJ B;  3LQ5 B;  4OB2 B;  2G9X B;  4EOM B;  4HNU A;  4HNT A;  4BCQ B;  1GUX B;  4JX4 A;  5ACB A;  2WHB B;  1ENW A;  3BG5 A;  3GTM S;  4BCN D; 
#chains in the Genus database with same CATH homology
 1GUX A;  5HQ0 B;  3TNH B;  1XO2 A;  1H27 B;  4BCO B;  1VYW B;  4F7L B;  2C5O B;  4BCF B;  1JOW A;  2X1N B;  1UNH D;  3BLQ B;  4BCN B;  1P5E B;  2V22 B;  1JST B;  2WIH B;  3G33 B;  4ROC A;  4CFN B;  3QHW B;  1OKV B;  3EJ1 B;  3POM A;  3TNW B;  4BCM D;  4BCQ D;  2C4G B;  2C5V B;  3M03 A;  4EOS B;  2BPM B;  1OIU B;  2PMI B;  1JSU B;  5FGK B;  5HVY B;  1VOL A;  4YC3 B;  1OKW B;  3RGF B;  5IF1 B;  3TN8 B;  2WMA B;  3DOG B;  2CJM B;  3F5X B;  2IW9 B;  2C5N B;  4G6L B;  4I3Z B;  4CFX B;  1AIS B;  4BCK B;  4CFM B;  3MI9 B;  3QHR B;  1FVV B;  3DDQ B;  4UN0 A;  2UZL B;  2W96 A;  1N4M A;  1G3N C;  4F7S B;  4CXA B;  1UNL D;  2PHG A;  1F5Q B;  4EOO B;  1PKD B;  4IMY B;  1W98 B;  4EOI B;  1QMZ B;  4BCH B;  2IW8 B;  4ROE A;  3O0G D;  2I40 B;  4YOZ A;  4EOP B;  1H24 B;  3DDP B;  3TNI B;  5BNJ B;  1KXU A;  2PK9 B;  3MY1 B;  4YOO A;  1OGU B;  2W99 A;  1D3U B;  3EID B;  2UZB B;  1O9K B;  5ICP B;  3BHV B;  1GH6 B;  1H1Q B;  2WIP B;  2CCH B;  1OL1 B;  4EON B;  4F6W B;  2IW6 B;  5I5Z B;  2F2C A;  1GY3 B;  4Y72 B;  1TFB A;  1O9K A;  4CFW B;  4CRL B;  2WFY B;  2QDJ A;  4ROD A;  3MIA B;  3K7A M;  2I53 A;  5L2W B;  2WXV B;  4KRD B;  2BKZ B;  2WPA B;  2IVX A;  4OR5 B;  4TTH A;  5HBJ B;  1C9B A;  3MY5 B;  3BLR B;  4CFU B;  1H1R B;  1H1P B;  1H4L D;  1H26 B;  5LQF B;  2CCI B;  2WMB B;  3H4C A;  2EUF A;  4BCJ B;  1OIY B;  2B9R A;  2UUE B;  4BCP B;  3BHT B;  4NST B;  4F6U B;  2C5X B;  1URC B;  1FIN B;  4F7J B;  1OI9 B;  2WEV B;  4F70 B;  5HNB B;  4EOK B;  4YOS A;  5IDN B;  4BCI B;  2UZD B;  4EOL B;  4BCG B;  2C6T B;  4KRC B;  4F6S B;  5HBH B;  4EOR B;  2PK2 A;  4CFU D;  4EC8 B;  4ELL A;  2W2H A;  3BHU B;  1OL2 B;  1AD6 A;  4EC9 B;  3EOC B;  1JKW A;  4ELJ A;  4CFV B;  2W9Z A;  3LQ5 B;  5EFQ B;  1H1S B;  4II5 B;  3BLH B;  4OGR B;  1ZP2 A;  2G9X B;  4EOM B;  4FX3 B;  4BCM B;  2JGZ B;  4BCQ B;  2UZE B;  4EOJ B;  5CEI B;  1GUX B;  5IDP B;  4F7N B;  1UNG D;  1E9H B;  2WHB B;  5CYI B;  5ACB A;  1H28 B;  5HBE B;  2R7G A;  1BU2 A;  1H25 B;  1VIN A;  4BCN D;  5LMK B;  4EOQ B;  2W9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...