4FM4B

Wild type fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
b'MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPAKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title The Fe-type nitrile hydratase from Comamonas testosteroni Ni1 does not require an activator accessory protein for expression in Escherichia coli.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4fm4B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fm4B02
3QZ5B 3A8GB 4OB2B 2ZPGB 3QXEB 3A8MB 3A8HB 2ZPHB 3X25B 1UGPB 4OB1B 2DD5B 3VYGA 3HHTB 4Y28E 2WSCE 2PVGB 4XK8E 3A8OB 2PUKB 2AHJB 2D0QB 4ZGDB 2ZPBB 3X26B 2PVDB 2PU9B 3VYHB 1UGSB 2QDYB 2DD5A 2ZPFB 2CZ1B 4FM4B 2PVOB 2ZPIB 2WSEE 4L6V5 1PSFA 1V29B 1IREB 1UGQB 1JB0E 2DXCB 1PSEA 3LW5E 2DXCA 2ZCFB 2ZPEB 2CYZB 2CZ6B 3WVDB 3WVEB 2DXBB 2ZZDB 3X20B 3X24B 1QP2A 2ZZDA 3QZ9B 5L8RE 2CZ0B 3X28B 4OB3B 4ZGJB 3A8LB 4RKUE 4KT0E 3VYGB 1AHJB 2DPPB 2DD4B 2PUOB 2DD4A 1DJ7B 2WSFE 4OB0B 1QP3A 3QYGB 1UGRB 2DXBA 2CZ7B 2O01E 1GXIE 3QYHB 4ZGEB
chains in the Genus database with same CATH superfamily
1YWPA 1H1RB 4Z6YA 4R0KA 3I5RA 2C06A 2WJ9A 2ZPGB 1M30A 2GFUA 2K5FA 5GANf 2EGCA 2QG9B 3JCMP 2ESWA 4CFWB 1WHLA 2RI5A 4E7JA 1T0JA 1VYTA 2YUPA 2OTJA 1M90U 3M55A 1TXQA 3HHTB 3ULRB 4AFUC 4PJOA 1Y96A 4QVZA 4LDUA 1NG2A 2JJ9A 1PM3A 3M0UA 2KRNA 1SEMA 2RI2A 4HXJA 1VQ8T 2EJGA 1G3SA 1ZSGA 1FMWA 1E9HB 4XU0A 3CCLQ 4NC6A 2KXCA 2JGZB 1OOTA 2PVDB 4PFPA 5LJ5h 1N8RR 5LJ5g 4EOLB 3SHWA 1RAAB 1XNIA 4F04B 1RABB 1YJ9A 3G7ZA 3V8LA 1VQ6A 2DX1A 5J3BA 4M75F 4BI3A 4LXCA 1AT1B 4HVVA 1W98B 4HNTA 3CCQQ 1G3YA 5HBHB 1FWZA 1MNDA 2WHBB 5GMKl 3QDFA 5GAN3 1O9KB 2RPNA 2C5NB 1WZOA 1VIEA 1Q81R 1EZZB 1VYUA 1YHQQ 1MV3A 2HZYA 2HDAA 2LMJA 4JX4A 2KY9A 4LDWA 5A2QE 2E6ZA 3M59A 3HFNA 4B9XA 3CXCP 2B86A 2DL3A 2BS4A 4M7AC 3H4CA 4BBRM 3VS1A 2LQNA 3ZL7C 4RTYA 4ZGJB 2DFUA 4BDYA 3OMCA 5D6WA 3V8KA 4EPCA 1Q82R 4BBSM 1HK9A 1RAFB 1S72A 1G3WA 5GAN6 2HKNA 4OF1A 1QWFA 3VUBA 3G6ET 5CAIA 2W2HA 3EG9A 4R55A 1QLYA 4M78D 4IURA 2LVMA 3POMA 2UZLB 1TUGB 2CGHA 4LOCA 2RQTA 1WHJA 1AD5A 3CPFA 1UNHD 4JJCA 2ENMA 3DL1A 4LD9K 1H641 5GANd 3A8HB 4FIBA 2XD0A 2ZPHB 1GUXB 1EX4A 1K4US 2JM9A 8ATCB 1I1JA 3HRUA 3QO3A 2RA2A 1K8AU 3WXMB 2DIGA 1TG0A 2PK2A 1O9SA 5LJ3h 1LOJA 2JS0A 2PNIA 3LWIA 1QVPA 2FPEA 4AT1B 3RERA 5KYYA 2OI3A 4FL6A 4XU2A 4AKHA 2V1QA 2FRWA 2HQXA 5GMKh 2YDLA 4Q5WA 4CI0C 1KJWA 2ED0A 1YI2A 4XU3A 5HBEB 4E7IA 3VUZA 1FVVB 4PJNA 4HCKA 1RAEB 3MO8A 3REAB 5I21A 3HL8A 1B3QA 1VQPT 4PKCC 2O31A 2QDLA 2VXFA 4RTVA 1H26B 3VKHA 2CT3A 2ZPEB 1SKUB 2DMEA 1NLOC 3BY7A 1U8RA 3OYNA 1OIYB 2YWWA 1VQ7T 2DXBB 3CCVT 4E47A 1UEBA 4Z8AA 2BKZB 4BCOB 2KMTA 2LC4A 4EOPB 1VQ8A 5GAN7 4JRKA 2MCNA 1KHIA 2LJ1A 2YLCA 3LGLA 4ORZA 1GY3B 5KYWA 3GIBA 1BIBA 1YITA 2M0YA 1WFWA 5GAMf 2MI6A 4HCCA 1QKWA 4XQ3A 1BU1A 4C92B 5GMKm 4BCNB 4OMFB 2RI3A 2CZ7B 3A5ZB 4HCBA 3A8GB 3VRYA 5LJ5e 4ZTFA 1IGQA 4HT9A 4F7NB 4F17A 4PLIA 3CCRT 3HO8A 3QSUA 4ZN3A 1AISB 3GPLA 8AT1B 4BI8B 5C0MA 2MIOA 4KUDK 5CEIB 4J9CA 5GANg 1X43A 1PKTA 4MZMA 1GFCA 2KROA 3VV0A 4BY6B 4YOSA 1AD6A 2KT8A 1SRMA 2ZAEA 4M7DF 1JJ2A 1XQHA 2EQKA 4BACA 1KQSP 2QA4A 1NPRA 4IUPA 2AIRB 2P4RA 2QXFA 1OX8A 3FB9A 4F7SB 1VYVA 2RHUA 4AG2C 4QVCA 5HK3A 3CMAA 1VQOT 4F16A 2DTIA 3SD4A 2GNCA 5CR2A 4IUUA 2KAFA 3G71T 1YJNT 2P4TA 1F1BB 3TN8B 2PTKA 5FU6C 1Z9QA 4M75C 4CRIA 4I3ZB 3TCJA 4EMKB 2X9HA 1JSTB 9ATCB 3EOCB 4M7AA 3QIIA 2L5QA 1GCQA 4RCCA 3MI9B 1JOWA 1MMGA 2XKOC 2CZ6B 3NPFA 1SHGA 4CFXB 3WVDB 2VGMA 1WJRA 3DDPB 2C0TA 5KYUA 2E6NA 1R8OB 1QP2A 4ROCA 4E7ZA 2XDPA 2DBMA 4C0FA 3QZ9B 2YT6A 4M7AE 3QWXX 1JU5C 1GRIA 1TUCA 1WQ7A 3CBPA 3OYCA 2QEXA 1KC8U 3QUIA 2KGTA 1LPLA 3A98A 2KDSA 3G4SQ 2JS2A 2RHYA 5LJ3e 1R0BG 2VKNA 4PJOB 2C0IA 2IVXA 3F70A 3L2RA 2RQUA 5GAMd 2X4JA 4MZPA 1ZUUA 1JSUB 2XMFA 2HMAA 1OV3A 2DIQA 3MP1A 4IIOA 3EFOA 4XTUA 4EIKA 1VQLT 1M4ZA 2J6KA 4LUDA 3OW2S 3VS6A 1NJIU 1BU2A 5GJWB 2HCKA 2G77A 2WACA 3A1PA 2CS7A 2G3RA 4Y92A 1ZSZC 1YCYA 1Y7XA 3GBQA 4RG2A 4EOJB 1UNGD 4X9CA 4C0DB 4M77D 1VQ5T 4ROEA 2F2WA 4MMKA 4EONB 1AWWA 2NUPA 5FRMA 3OYAA 3R6OA 5KYXB 5C6SA 2E1HA 2K2VA 2R57A 1VINA 5IT9E 4AG1C 3OYYA 3VU3C 1OL2B 2DL7A 3LLRA 2VVKA 5FWBA 2QDJA 1NE8A 2RK1A 3P8DA 5CYIB 2LJ0A 1TH7A 2K79A 2DD5A 2MPXC 3CMET 1B07A 4IUQA 1FMVA 3FC3A 4E2FB 3P8BB 4LN2A 3THKA 4FYVB 2PHGA 1D0YA 5ECAA 1FMKA 2K4YA 4M78C 1T3LA 1V29B 1QWEA 2GCXA 3CEYA 5CKFA 1D09B 1JB0E 3EHRA 3NTKA 4JJBA 4MFDA 1M2OA 2OTJQ 2F2VA 2RNAA 2CYZB 3EG9B 3TSZA 2FZCB 2EWNA 3QBYA 2RQVA 1HXDA 4JRQA 3LX7A 4M77F 1AZGB 3RKXA 2LTOA 2ZZDB 4FT2A 3QWYA 2M0OA 3VKIA 2RHZA 2EW3A 3CPWP 2CZ0B 3PVQA 4FW2A 2BZ8A 2P0QA 4F7UF 1VOMA 1M1KU 3FLGA 4BE1A 4F6SB 4J9IA 4HVWA 1ABOA 4M7DG 1H1SB 1AHJB 1UGVA 1OI1A 2EIFA 5HBJB 4A4KA 2RJEA 2DD4A 2VV5A 4KRTA 2OTLA 1YJ9Q 2IPOB 2LCSA 1FYNA 1WQWA 2G6FX 1VQOA 4D8DA 5LJ5j 3N5BB 4EMGA 1H28B 1UGRB 1QCFA 2E64A 3G71A 2QASA 1VQ4T 1QVFP 1I5OB 4K11A 5CKHA 3OYMA 3DJBA 1PG5B 5CVIA 5GAMg 3CCJA 1X27A 2EQUA 3BDLA 4E7HA 3RNJA 5I22A 1K9AA 5A0LA 5LL6S 3VRZA 1K0XA 1JXMA 1WA7A 4EDUA 5I2MA 3I55Q 1OI9B 3BFMA 2YRVA 2L2PA 2IIMA 4DBRA 2AZVA 1OX9A 3UDCA 1VQ9A 1VQKQ 1K9MC 2ZPBB 4BD3A 1WPYA 3DOGB 1B34B 5AYFA 2C0OA 1YIJQ 4JJDA 1KFZA 3RDVA 3OMGA 3TSWA 1S72Q 2MK5A 1U5SA 3SWNC 4M75A 1W4SA 1K0SA 1ZUYA 3KHIA 1Q82U 2F1LA 3E9GA 3HTRA 4HVUA 2DEUA 3OW2A 4GBQA 2UZBB 1UECA 4LDXA 4IMYB 1FKMA 4PNOA 1XO2A 1GL5A 2B8AA 3L2ZA 3OYEA 4RMOA 1OZ3A 4M75E 2UZEB 1IGUA 2K3YA 1KK7A 5KYWB 3CCUQ 2QK0A 4KRCB 1YJWT 2O4XA 3M0TA 3T9NA 4BCMB 4QKUA 1BBZA 4FSXA 5CKDA 3EFSA 1VQ5A 2DILA 1IO6A 4EOKB 1NEGA 4J7FA 5LJ3j 1M3CA 1YIJT 1TTHB 4MIMA 1IHVA 1TD6A 4A4HA 2CP5A 2DPPB 1WHMA 2X4XA 2WPAB 1YI2Q 2COWA 1Q7YU 2L3QA 1W2BA 3LWHA 2KEAA 5GMKj 4J5YA 1KIKA 2CP2A 1I4K1 4GLKA 4C5EA 2CSQA 4IUVA 2V8KA 2DRKA 3ZBDA 2CUBA 1R77A 1YNZA 1ZSZA 1RAHB 1XJWB 3OSVA 2H3EB 1C0MA 4MDWA 3AHUA 1D0ZA 1JO8A 2RF0A 4BB7A 5HKCA 2K2MA 1PD1A 2JN0A 1PWTA 3J80E 2NYSA 2Z0WA 4AKGA 1Y71A 1E7PA 3C94A 5IN1A 2D0QB 3TW7A 4M77G 3M4GA 3TQ7P 2KRSA 5I2SA 5GAOl 2O2OA 2X4WA 4KRDB 1M90C 1NM7A 2CP0A 4F7UG 3CXCS 3SDZA 3OQ5A 3MP6A 4M78A 5KE3A 4HKEA 3CC7Q 2DYBA 1YITQ 2V22B 2EYYA 1KG1A 2AKLA 2RHXA 4JLIA 3CCMT 3SFMA 1M3BA 1K73U 2RMOA 5DLOA 4J8OA 5GJVB 2DO3A 4ESRA 4M78E 4BCND 5IDPB 3CC4T 4HT8A 1QVGS 5DY9A 5FW9A 3DLMA 5EG2A 3V8JA 2DXCA 4BCPB 1D1CA 4TVRA 3EIDB 2K5IA 3UA7A 6AT1B 4OR5B 2L3SA 3H41A 1G3NC 4QT7A 3CC2A 4DA4A 1SHFA 2XDDA 4A4FA 2QQ8A 3X24B 1VYWB 1OPLA 2DLPA 4JZ4A 1XTDA 2OJ2A 4M77C 4E7KA 1N5ZA 2BUDA 1NLPC 4C8QB 2WFYB 2QA4Q 3GNFB 1M27C 3E2UA 2WIHB 1HJDA 1WXTA 1AVZC 4A4GA 3TNHB 3CMAQ 4BXXX 2DZCA 2R58A 5KE2A 2JXBA 1TFBA 2FYKA 2ATCB 3JV3A 3QYHB 5HQ0B 2X3XD 1OYXA 4NS5A 3CCLT 4C92F 4HL4A 1H27B 1AWOA 3A8MB 1G3TA 3JCMX 4F7LB 1M8VA 2I40B 3JCMf 3JCMc 3KXTA 3URGA 3EGDA 2DD5B 4FYYB 3QYEA 3META 1PRLC 3NFCA 1YJWA 4Y91A 4C8QG 3CCQT 1B7TA 1M2VB 2COZA 2F5KA 3SWNA 1K9MR 2R5AA 3IQLA 3HPWA 3ER0A 5L2WB 5J39A 3NTHA 1J3TA 4ELLA 1BI0A 2QEXQ 2DA9A 1WIEA 1K8AC 2LQ8A 3CCEQ 1YHQT 1WHGA 2QQSA 3HB9A 1WGSA 4CFUD 1BCOA 4N0AC 4OVAA 4Y72B 2WIPB 3FDRA 3DKMA 3MHXA 2IW9B 1GCPA 2ROLA 5IHNA 1JQQA 3ASKA 5IXFA 2CDTA 2R7GA 4L6V5 3M58A 3BLQB 1OKWB 4O5VA 2F2XA 1QCOA 1H3ZA 1ZHIA 2DVJA 1K1ZA 3TW6A 3F5XB 1UE9A 4QQGA 2EYQA 3UA6A 3WVEB 3MPUB 3JCMb 4J83A 3M0SA 4HCZA 5GAOm 3QG1A 3C95A 3CXCA 2J6FA 1FXXA 2EGAA 4IKFA 3QDRB 4J9GA 3L2WA 1TSFA 3CCSA 4KH1B 4ANJA 3TEEA 3I9QA 4D8KA 4OGRB 3E19A 2YXYA 4KBMB 1Z9ZA 4HLQA 1JKWA 2X3WD 5I5ZB 2WSFE 4RUGA 2EUFA 1QCNA 2IVWA 3LH5A 1QVGA 1D3UB 2JOYA 1Q86U 5IXBA 4PJOF 4ELYC 2QI2A 1JRIA 2CKKA 3CCMA 1NEBA 1JJ2P 3HKSA 3TNWB 4M7DD 2V8JA 2QQRA 4AFQC 1D3BA 4OB1B 3JCMd 5FU6B 5CQYA 4EC8B 1G8XA 2BZYA 4XAXB 1BIAA 2EAYA 1MMNA 4EOOB 1RADB 2A28A 2WSCE 4MMLA 4PK4A 2NUTA 1KHCA 4FYWB 4KULA 4E7LA 4BCKB 2PUKB 2JZ2A 3UF4A 5CO7A 1ZUKA 2MOXA 2NWMA 1M90R 2D1XA 4ELJA 3BE3A 1KD1U 2KNBB 3EH2A 4NSTB 1M5Q1 2LQKA 2DYIA 3M9QA 1WLPB 3ZFJA 3VYHB 2L3PA 4JJNK 2OTLQ 1Y0MA 4LDVA 4OMLA 2FZGB 2EYWA 3GF5A 2WMBB 1D1BA 2E3HA 2YUQA 4XTZA 3RIRA 2NUZA 5GANh 1ZX6A 1VQNQ 1IRXA 3OYLA 4X1VA 3R6NA 2KI7A 1N9SA 2CSIA 3RGFB 2YSQA 2K3XA 4LUEA 3CCLA 3CCJQ 2OX7A 2QFZA 3QJYA 4M6VA 4PFOA 4C92G 3OS2A 3OYDA 1OKVB 2E10A 4IIMA 3E9FA 2HQHA 2FVUA 4J9HA 1PRMC 2QGFB 1X6BA 4M77A 5LQFB 2MWPA 1QMCA 1V76A 2M9UA 3PVLA 2X51A 3MEAA 4FT4A 1G83A 2CCIB 3G6EA 3QHRB 4F7UA 1JXOA 4F70B 3HRTA 2BS3A 1VQ9Q 2P0PA 2BE7D 3OS5A 1UDLA 3PE0A 3TREA 3JB9H 4AI6A 2LZ6B 3QJ6A 4M77E 4RTZA 3MIAB 2UZDB 5IDNB 3PO3S 5FLXE 1PKSA 2LNVA 1YHQA 5GAN2 4F7UE 5D6YA 2JT4A 1M3AA 4JUVA 4BCHB 1LJOA 4BI4A 1ZP2A 3RESA 3CD6Q 1GXIE 5KCOA 2W96A 2L0AA 3HFOA 1KC8C 1X2QA 3CBOA 2DETA 3U23A 1W70A 2EVRA 2X4YA 2DEQA 3M57A 4M78B 3SB2A 3VS5A 1H1QB 1OGUB 4CXAB 3V7SA 2KK4A 2O88A 1Y96B 4Y28E 3ZEHA 2E3IA 2LCLA 2W9ZA 2XK0A 2JM8A 1V1CA 3JCMh 4Z02A 1HSQA 3JCMg 5IF1B 2LX7A 3OY9A 3I56Q 4N0AA 1VQPA 1K8AR 5GMKe 2JVVA 2RHIA 2C4GB 3V7RA 2XU8A 4A54A 4EOQB 1K76A 1NJIC 3MJXA 3OYFA 3OYKA 5A0GA 1AZEA 1D1AA 1SF9A 1FINB 4QSHA 4EOMB 4KGZB 1VQMQ 3TU4K 2VXEA 1UGSB 3G33B 2DVEA 4BY6C 2CZ1B 2R5MA 2PJQA 4J6WA 1IB8A 3EGUA 1VQ7A 4OMMA 4JX6A 3CCVA 2DJZA 4PJOG 3M54A 1IREB 2D8JA 4HNUA 2W0ZA 3G4ST 1RL2A 1PSEA 4C0GA 5IHKA 2DL8A 3OSSC 4NOYA 1QVFS 1MMAA 5HVYB 4L59A 3ME9A 3P8HA 4EMKC 4J6YA 4J7IA 4FW1A 3O5ZA 2VYTA 4L5GA 1YCSB 2A08A 4C5HA 2FPDA 2E4HA 3MY1B 1FX7A 4MZTA 3EGDB 3CCRA 4OMNA 4EORB 3BHVB 1NYFA 3JCMJ 3FRNA 2MAMA 3EH1A 1M1FA 1SG5A 1GBRA 1WNLA 2C5OB 2JTFA 4PJJA 4BE2A 1M1KC 2HBPA 2FO0A 2PK9B 2A7YA 3JSCA 4LDYA 2LDMA 1U06A 5GANe 1VIFA 1QLBA 3CC2Q 2FPFA 1VQ6Q 2D8HA 1N6AA 3OW2P 1N8RU 4O6JA 3VJPA 3H8ZA 5KYYB 3UPUA 1IZ6A 3BG9A 3MCAB 2DERA 4JZ3A 1YJNA 2L3RA 4OP0A 2RQWA 1I5LA 1P5EB 5GAMh 4J9EA 2OTJT 4RODA 4C0DC 2M51A 3RUXA 2A36A 2ZGWA 4C8QD 2KYMA 3PMIA 4BCQB 1UTIA 4BCJB 1Q81U 1YBYA 4N4GA 1QMZB 3HZJA 1WI7A 2H8HA 4AFZC 4DEXA 1BB9A 4P5NA 3TNIB 7AT1B 4MFEA 2EGEA 4JDSA 3J7AF 2RJDA 4F6WB 4ATOA 3UWNA 2VGNA 1UG1A 1YJ9T 2DNUA 2M02A 3SEMA 4M7DC 1Q82C 4DQ2A 1W2BP 1YP5A 1MNEA 4CFVB 2ECZA 4XU1A 3PTAA 3AT1B 4AMCA 2I53A 3PGGA 2VWFA 2X35A 1HD3A 1QQJA 5EFQB 2ABLA 1D3BB 2C6TB 3X28B 4XTWA 4UN0A 1N9RA 1K9MU 1VQLA 4V2SA 2VC8A 1ZA2B 2PUOB 2A3LA 2PMIB 3JCMe 4C8QF 2UUEB 5M9OA 2HAXA 2PQWA 2K7AA 3I55T 5FROA 2HSPA 1PNJA 1BI2A 1WHKA 1KC8R 1VOLA 2G9XB 2KMGA 2F69A 1VQKT 2VASA 2EFIA 4RTUA 5GAOn 1UGPB 1S72T 2QQ9A 3G4SA 1U1TA 1Q7YC 3PIPA 1WYXA 4ZNXA 1AWJA 1KQ1A 3L42A 3VYGA 1W1FA 3LH0A 4XTYA 5BNJB 2LP5A 1URCB 1CSKA 1C9BA 5FU7C 4JRIA 1VA7A 2CCHB 5GAOp 3CMEA 1UHFA 2V26A 1NJIR 4BCFB 4ZGDB 2CP7A 1H25B 5KH6A 4E6RA 3B57A 4MDXA 3CCSQ 3QYBA 2M1HA 1RUWA 3LQ5B 1YWOA 1ZLMA 1YFNA 4DOWA 3CCUT 5GAOr 2RH2A 3QWLA 3OYIA 5CKEA 1D0XA 2PU9B 3Q1JA 4Z88A 2JTEA 2CH4A 2RB6A 1R0CB 1F5QB 4JS4A 4PJMA 4YTLA 5GAN8 4DEYA 3MY5B 3FJ5A 2CT4A 2XI9A 4DBQA 1OULA 2DMOA 2ZPIB 2EYZA 3H0IA 5A0DA 2LT4A 2RM4A 3EGXA 1VQ8Q 1ABQA 4ZTJA 4FX3B 2QQAA 2GQIA 2FHDA 4EMKA 4LNPA 1C6VX 4M7AB 1ZA1B 3LW5E 2K57A 2JMCA 1YI2T 4OGCA 2KBTA 4UC4A 2NLUA 3KUFA 3UT1A 1BI3A 4BDZA 1UB4A 5KYUB 1K73C 2J06A 1ZQ1A 4FCYA 3NMZC 2E65A 3EFRA 1HYOA 5LJ3d 1BCMA 3BHUB 4C92D 1VQ4A 3PFSA 2X1NB 3OBYA 4YOZA 2BKDN 3MEVA 1WXBA 2BTTA 2EKHA 1UHCA 4JS5A 4PJLA 1I0CA 3VS0A 1Q95G 1CKAA 2Y4XA 4X9DA 3PMTA 1NPPA 2J6OA 1QP3A 4M7AG 1M1KR 3EFOB 5GAMe 1TOVA 3GTMS 5D6XA 4HNVA 2C5XB 4OB2B 2KSSA 5GANj 4EMHA 4PJOE 4E7SA 3PIOA 2AKKA 2KR6A 3CC7T 2DF6A 3L2VA 1YITT 2DZ9A 2EKOA 5HK0A 4EC9B 2HKQB 2BIVA 3KFVA 1NBEB 3L2QA 4J9BA 1H8KA 1U3OA 2XG8D 2EQJA 3G6EQ 2NUPB 4GLMA 1G5VA 2YHTA 1UNLD 2XHCA 5KYXA 2V1RA 3JB9D 5EC7A 3EG3A 4B9WA 2DM1A 2D0NA 3OS0A 2YLBA 2ZPFB 4VUBA 3QPHA 3QKJA 4RTWA 2FZKB 4AKIA 2YRDA 3I55A 2E12A 2PVOB 1GCQC 4M7DA 2DTHA 1VQKA 1I07A 1I81A 1ZBJA 3BW1A 2H3JA 3BG3A 1PCXA 4KUIA 2QA4T 2IN3A 4IUTA 2EBPA 1X6GA 4OMPA 3S3MA 1YIJA 1WDXA 3CMAT 2VB6A 2RJCA 4JPBW 4QQ6A 4M7DE 2CUDA 2MMPA 1JJ2S 3HRSA 1RAIB 4AFSC 1QVGP 1X69A 4JX5A 5J26A 4F7JB 3LGFA 4RCBA 3RMQA 4PJOD 4FYXB 2XDBA 2ZZDA 3EHQA 1VQPQ 4NL2A 5L8RE 4C0ZA 3JB9F 4ELZC 3CCUA 2DD4B 4RTXA 1ENWA 2GFAA 1EIFA 2SEMA 3REBB 4II1A 3VS7A 3D7SB 4KGXB 5LJ3g 1VQ7Q 4C8QC 3O0GD 4WTOB 3CCVQ 2L8DA 2E5KA 1X6OA 3DTOA 4HA8A 3E1SA 3M03A 3JRZA 2QEXT 3O8VA 3G1JA 3CCET 1MUZA 1Q7YR 1RI0A 2W99A 2YUOA 4C5IA 2JUFA 4BCIB 3BLRB 1MMDA 3CQTA 1Q86C 3RKYA 5CIUA 4M78F 3EG0A 1KXUA 4PLLA 4WCIA 3EAEA 1KQSS 2E41A 2LQWA 1E6HA 1RLPC 2K5LA 3H0FA 2KQWA 3MKDA 2JW4A 1ZBXA 2KVQG 3DB3A 1B34A 2KYBA 2IW6B 3VS4A 3CCRQ 4RTTA 4M75B 3CC4A 2F5TX 4ZN1A 5GAOq 2HEQA 4EOIB 3C0CA 3L2UA 2K9GA 1T3SA 1BYMA 2RO0A 3GNGA 1WHHA 2KRMA 3MEUA 3JCMV 1UUEA 5FRNA 2ED1A 2WSEE 2DTOA 1KD1C 4G6LB 3M0RA 2W9FA 4II5B 1JEGA 3M5AA 1LNXA 3CC7A 1K73R 2P84A 2O4XB 5LMKB 2CP3A 1VQOQ 2MWOA 2FG0A 4JRPA 3HSBA 5IHYA 1GH6B 3X20B 4M75G 4Z89A 3M0QA 1H92A 3G71Q 2HD0A 4C5GA 1YJNQ 1WX6A 1KQ2A 5CKBA 3HP9A 5CK9A 5IHIA 5FGKB 4ME7A 3DLLA 4RG8A 3VYGB 5DM7R 3OB9A 2OAUA 1DJ7B 2GGRA 2DXUA 3VS2A 5GAMj 1X2KA 1PD0A 2A0FB 2IG0A 2L89A 3M56A 3CBMA 4FSSA 4JLGA 1UJ0A 2QAZA 3JB9I 4F6UB 3QHWB 2O01E 2Y4YA 4M4ZA 3VKGA 4ZGEB 3PNWC 1ZSZB 4BCQD 3H6ZA 3CCQA 4CC7A 1LVKA 3QXEB 3BLHB 3MP8A 2OTLT 2GF7A 1KSWA 2RD1A 2EPDA 1ARKA 3VS3A 1VUBA 1VQNT 3M53A 2HNIA 4YC3B 4EOSB 4XK8E 4BE0A 4FU6A 3OYBA 5GAN5 2AHJB 4PFZA 3EGXB 1M8MA 3NGPA 4CC4B 5L23A 4KGVB 2EJFA 3CCJT 3JB9J 1UFFA 1OEBA 2Y90A 4PL6A 3FIFA 5KCHA 1OL1B 1Y57A 2XICA 3JB9G 2DE0X 1VQLQ 2WMAB 4OMOA 3I5SA 4C92C 3NDQA 3RR6A 4QVDA 1U1SA 2D6FA 1Y07A 4QW2A 2RQRA 3V7CA 3BHTB 2W10A 3GP8A 1VQ9T 1VQ5Q 2JNGA 5DLQE 3JAME 2J7IA 4CFUB 3OA6A 4BCMD 2VUBA 2LJ3A 3CCEA 2DXCB 2BE9B 3OBWA 4LE9A 1KQSA 5GAN4 4NL3A 1WJQA 2K3BA 2AZSA 3CPWS 5EJCA 3CD6T 4CC3A 3CMEQ 5GMKi 4M78G 4QQDA 1S1NA 3EJ1B 2XIDA 4F14A 3H9NA 1M9SA 3INZA 3M4YA 4C8QA 1O9KA 2CJMB 4B6MA 4DOVA 1OZ2A 2DJQA 2B9RA 2CH4W 5KYNA 4OMQA 2RN8A 5I11A 3I56T 3NHNA 1SPKA 4C8QE 1MHNA 2O9VA 2MYSA 2A37A 1AEYA 3QZ5B 5ICPB 3DDQB 1C1AA 1RACB 2MF2A 1VQMT 2C5VB 1Q86R 1AOJA 1GFDA 1A0NB 2QTVA 2DL4A 3J81E 4X34A 2YUNA 2FRYA 2QQBA 4M7AD 2F2CA 2HBWA 1QW1A 4M7DB 5LJ5f 3SWNB 1M1GA 1M2VA 2ROTA 1W2BS 4DBHA 4XTVA 1QKXA 2GTJA 2EJ9A 2OAWA 5D7UA 5FWCA 1VQ4Q 2QYZA 2LRQA 1T0HA 4PJOC 2DL5A 3EG1A 4DBFA 1GUXA 2DXTA 1W6XA 2SRCA 1TWBA 1N8RC 2LW4A 2EQIA 3RMSA 2QGSA 1UJYA 1E7OA 3KBGA 1OQKA 1LCKA 4CC2A 5IH2A 1KD1R 4FM4B 3GOXA 3M0PA 5HNBB 1SSHA 3QHSA 1G2BA 2COYA 2EYXA 2CP6A 1NZ9A 1PSFA 4J9DA 2EQMA 3HBLA 1RLQC 2FEIA 2P0KA 2DBKA 4TTHA 3S3NA 3RKWA 1ACMB 2ZCFB 2KT1A 5HY6A 1Q81C 1IXDA 2E70A 1YN8A 4M7AF 2YRCA 2HQEA 2IW8B 1JBMA 2KE9A 2RK2A 1VQNA 2AT1B 4A63B 1BI1A 2DRMA 1MGQA 1WJSA 2D9TA 5FU7B 2K6DA 5ACBA 1MV0B 2M16A 3JCMQ 2DKGA 3A8LB 1PHTA 4RKUE 4XTXA 5CCAA 2E5QA 4KH0B 3JCMW 3NTIA 2LT1A 3CC2T 2QF7A 1VQ6T 2BZXA 3K7AM 3DB4A 4D6WA 2BPMB 1SSFA 4OB0B 2LNHB 1H3HA 1TS9A 3TVTA 4BUGA 1YJWQ 1CKBA 1P92A 2I0NA 4WF2A 2DXBA 4OGEA 2LCCA 3BDUA 3BG5A 2BS2A 3PT9A 5DQWA 1PC0A 3CPWA 5LJ3f 1XOVA 3UATA 3X25B 3MEWA 3OS1A 2CREA 2FL7A 4CFNB 4BY1X 2O9SA 2NUTB 2PVGB 1BKBA 5LJ5d 1OIUB 3A8OB 5IAYA 3CD6A 4C92A 4CRLB 1GBQA 1RAGB 1TU0B 1OU8A 3OYGA 5DQVA 5AT1B 1QVFA 3X26B 2QGGA 3L1AA 1OU9A 3EG2A 2HL5C 2LX9A 4C92E 4CFMB 2QDYB 4N4IA 4R56A 1H4LD 2RJFA 2GBQA 3S3OA 1I8FA 3I56A 2GQVA 1AWXA 1O75A 4BCGB 1EFNA 1X75C 2KR3A 1X01A 1UGQB 3GLXA 1VQMA 1E6GA 1N4MA 2I2LA 4M77B 4A4EA 2WXVB 1TUDA 3FEOA 3LYIA 2PZ1A 3H0HA 2J05A 2GTOA 2DK3A 5CQXA 1IHWA 4F7UB 1N27A 2HL3A 3CCMQ 1NYGA 3I35A 2FB7A 4GY5A 1WXUA 2JMAA 3RBBB 2V8IA 3C12A 4OB3B 3S6WA 3FJPA 2JTMA 3OYHA 3OYJA 3CC4Q 4BY7X 1RI9A 4J9FA 4KT0E 2WEVB 4A53A 4N4HA 4J6XA 2DAQA 2HSEB 1H1PB 4LD6A 4M75D 1PKDB 3C4SA 3QYGB 1BK2A 1OPKA 1H24B 4YOOA 2QTXA 3CCST 1SRLA 2KXDA 5HCKA 2AK5A
chains in the Genus database with same CATH topology
4Z6YA 4HA8A 3E1SA 2C06A 2WJ9A 3JRZA 5CKHA 3OYMA 2ZPGB 3HFOA 3O8VA 2GFUA 3CBOA 2QEXT 2K5FA 1KC8C 5GANf 3CCET 3JCMP 5CVIA 5GAMg 1RI0A 3CCJA 2X4YA 2DEQA 3M57A 2EQUA 4M78B 3BDLA 2RI5A 4E7HA 4E7JA 3SB2A 4C5IA 2OTJA 5A0LA 1M90U 2JUFA 3V7SA 2KK4A 3M55A 1Y96B 5LL6S 3HHTB 4Y28E 1Q86C 3RKYA 3ZEHA 5CIUA 1Y96A 4M78F 4QVZA 2LCLA 4PJOA 4PLLA 4LDUA 2XK0A 4EDUA 5I2MA 3EAEA 3JCMh 1KQSS 4Z02A 2E41A 3JCMg 3BFMA 2YRVA 2RI2A 1VQ8T 3OY9A 2EJGA 4N0AA 1VQPA 5GMKe 2JVVA 2RHIA 3UDCA 1VQ9A 1G3SA 3V7RA 2XU8A 4A54A 1NJIC 1K9MC 2ZPBB 2K5LA 1WPYA 2KQWA 4NC6A 4XU0A 4BD3A 5A0GA 3OYFA 3OYKA 1B34B 5AYFA 1ZBXA 4QSHA 2PVDB 2KVQG 3DB3A 1B34A 5LJ5h 3OMGA 3CC4A 4M75B 5LJ5g 2F5TX 1XNIA 4ZN1A 3SWNC 4M75A 5GAOq 3TU4K 1W4SA 2VXEA 1UGSB 3G7ZA 1YJ9A 2DVEA 3V8LA 2CZ1B 3KHIA 4BY6C 1Q82U 2R5MA 3E9GA 5J3BA 1VQ6A 4J6WA 3L2UA 4M75F 4BI3A 1BYMA 2RO0A 3GNGA 3OW2A 3MEUA 1VQ7A 3JCMV 4JX6A 3CCVA 5FRNA 4LDXA 1FKMA 4HNTA 2DJZA 2WSEE 2B8AA 2DTOA 3L2ZA 4PNOA 4PJOG 4RMOA 1OZ3A 1G3YA 3OYEA 1FWZA 1KD1C 3M54A 4M75E 2K3YA 5GMKl 1IREB 5GAN3 4HNUA 3G4ST 1RL2A 1PSEA 1VIEA 4C0GA 4NOYA 3M5AA 3OSSC 1LNXA 3CC7A 1QVFS 1YJWT 2O4XB 4JX4A 2KY9A 4L59A 2O4XA 4LDWA 3ME9A 3T9NA 5A2QE 2E6ZA 3M59A 3HFNA 3P8HA 4B9XA 2MWOA 4EMKC 4JRPA 3HSBA 4FSXA 5CKDA 3EFSA 3X20B 4J6YA 4J7IA 2BS4A 1VQ5A 4M75G 2VYTA 4M7AC 3H4CA 2HD0A 4L5GA 4C5GA 4BBRM 4J7FA 5LJ3j 1YIJT 4C5HA 1KQ2A 5CKBA 3HP9A 5CK9A 1FX7A 4MIMA 4ZGJB 4MZTA 4ME7A 4BDYA 3DLLA 3OMCA 4RG8A 4A4HA 5D6WA 3V8KA 4EPCA 3VYGB 2DPPB 4BBSM 5DM7R 1HK9A 3CCRA 1S72A 3OB9A 2OAUA 1G3WA 2X4XA 5GAN6 1DJ7B 2DXUA 3JCMJ 1Q7YU 3FRNA 2MAMA 4OF1A 5GAMj 1W2BA 3LWHA 3G6ET 5CAIA 5GMKj 4J5YA 2L89A 2IG0A 3M56A 4M78D 4R55A 4IURA 3CBMA 1M1FA 2LVMA 1I4K1 2CGHA 4GLKA 4LOCA 4JLGA 4C5EA 3JB9I 4IUVA 2O01E 2Y4YA 3VKGA 2V8KA 1WNLA 4ZGEB 3CPFA 3PNWC 2JTFA 3ZBDA 4BE2A 3H6ZA 3CCQA 1M1KC 3DL1A 3QXEB 4LD9K 1H641 5GANd 2HBPA 3OSVA 3A8HB 3MP8A 4FIBA 2ZPHB 2XD0A 3JSCA 2A7YA 4MDWA 3AHUA 2OTLT 4LDYA 3HRUA 3QO3A 2RA2A 2LDMA 2GF7A 4BB7A 5GANe 2RD1A 5HKCA 1K8AU 1VIFA 3WXMB 2DIGA 2JN0A 1QLBA 3J80E 1N6AA 1VUBA 1O9SA 5LJ3h 1LOJA 2HNIA 3M53A 1N8RU 1VQNT 4O6JA 4XK8E 3VJPA 3H8ZA 3LWIA 4AKGA 4FU6A 3OYBA 1IZ6A 3BG9A 1Y71A 1QVPA 1E7PA 2AHJB 3C94A 3MCAB 5IN1A 5GAN5 2D0QB 3RERA 3TW7A 4M77G 4FL6A 2EJFA 4XU2A 3CCJT 3M4GA 1YJNA 4AKHA 2L3RA 4OP0A 3JB9J 2Y90A 4PL6A 5I2SA 5GAOl 3FIFA 5KCHA 2HQXA 5GAMh 1I5LA 2X4WA 3UPUA 2OTJT 5GMKh 2XICA 3JB9G 1M90C 4F7UG 4C0DC 3CXCS 3SDZA 4C92C 3RUXA 3OQ5A 3MP6A 4M78A 4Q5WA 4HKEA 4CI0C 5KE3A 4QVDA 2ZGWA 4C8QD 1YI2A 4XU3A 1U1SA 3PMIA 4E7IA 2D6FA 3VUZA 1KG1A 1Q81U 1Y07A 2RHXA 4JLIA 4QW2A 3MO8A 3V7CA 1YBYA 4N4GA 3SFMA 5I21A 3CCMT 3HL8A 3HZJA 1VQPT 1K73U 3GP8A 5DLOA 1VQ9T 2JNGA 4J8OA 4PKCC 2DO3A 5DLQE 4P5NA 3JAME 2VXFA 3OA6A 4M78E 3VKHA 3CC4T 4HT8A 4MFEA 2VUBA 4JDSA 5DY9A 2RJDA 1QVGS 3CCEA 3J7AF 3DLMA 2DXCB 5EG2A 3UWNA 4ATOA 3OBWA 2VGNA 3V8JA 2DXCA 3G71A 1KQSA 1YJ9T 2ZPEB 5GAN4 4NL3A 4M7DC 4TVRA 1Q82C 1WJQA 4DQ2A 2K5IA 3BY7A 1U8RA 3OYNA 3CPWS 3CC2A 5EJCA 1VQ7T 2DXBB 4DA4A 4XU1A 3PTAA 3CCVT 3CD6T 4E47A 2XDDA 4A4FA 2QQ8A 3X24B 4M78G 3PGGA 5GMKi 4QQDA 1UEBA 2X35A 1XTDA 2XIDA 4M77C 2KMTA 2LC4A 1D3BB 4E7KA 1VQ8A 2BUDA 5GAN7 4JRKA 3X28B 4XTWA 1M9SA 3INZA 1N9RA 4C8QB 1KHIA 3LGLA 2YLCA 3GNFB 3M4YA 1K9MU 4C8QA 1VQLA 4V2SA 2VC8A 2PUOB 4A4GA 3GIBA 4DOVA 2A3LA 1OZ2A 1BIBA 4C8QF 2DZCA 2R58A 3JCMe 1YITA 5M9OA 5KE2A 5GAMf 2MI6A 2HAXA 4HCCA 2PQWA 4XQ3A 3I55T 5FROA 4C92B 2FYKA 5GMKm 4OMFB 2RI3A 1BI2A 3I56T 2CZ7B 3QYHB 2KMGA 2F69A 1VQKT 4C8QE 1MHNA 1OYXA 3A5ZB 4NS5A 3QZ5B 4HCBA 3A8GB 2EFIA 5LJ5e 4C92F 3CCLT 4ZTFA 4HL4A 4HT9A 3A8MB 1G3TA 5GAOn 3JCMX 4PLIA 2MF2A 3CCRT 1VQMT 1UGPB 1M8VA 1S72T 2QQ9A 3JCMf 3JCMc 3KXTA 3HO8A 3URGA 3G4SA 3QSUA 1U1TA 1Q7YC 4ZN3A 3PIPA 2DD5B 1KQ1A 3L42A 3VYGA 3GPLA 3QYEA 4BI8B 5C0MA 3LH0A 3META 4XTYA 4X34A 3J81E 3NFCA 4KUDK 4M7AD 2QQBA 1YJWA 5FU7C 4Y91A 4C8QG 5GANg 4JRIA 1QW1A 4M7DB 5LJ5f 4MZMA 3SWNB 5GAOp 3CMEA 3CCQT 1M1GA 2F5KA 3SWNA 2R5AA 4ZGDB 5KH6A 3VV0A 4BY6B 1W2BS 3HPWA 4XTVA 3ER0A 2EJ9A 5J39A 4MDXA 4M7DF 3QYBA 2M1HA 3NTHA 2LRQA 1JJ2A 1XQHA 2EQKA 4DOWA 5GAOr 4PJOC 3CCUT 1BI0A 4BACA 2RH2A 1K8AC 3QWLA 2LQ8A 2QA4A 1NPRA 3OYIA 1YHQT 4IUPA 5CKEA 2QQSA 3HB9A 2QXFA 2PU9B 1WGSA 3FB9A 3Q1JA 2DXTA 2RHUA 4QVCA 5HK3A 2RB6A 4N0AC 4OVAA 3CMAA 4JS4A 1VQOT 4YTLA 3FDRA 1N8RC 3DKMA 2DTIA 3RMSA 3MHXA 3SD4A 3KBGA 5CR2A 5GAN8 4IUUA 2KAFA 3ASKA 2XI9A 3G71T 1YJNT 4FM4B 2P4TA 3GOXA 2ZPIB 5A0DA 3QHSA 5FU6C 4L6V5 2LT4A 2RM4A 4M75C 3M58A 4CRIA 1NZ9A 1PSFA 3TCJA 4EMKB 2EQMA 4ZTJA 3HBLA 2QQAA 4O5VA 2FHDA 2P0KA 4EMKA 4M7AB 3S3NA 3LW5E 3RKWA 2K57A 4M7AA 3QIIA 2ZCFB 1YI2T 4OGCA 2L5QA 4RCCA 4UC4A 2NLUA 3KUFA 5HY6A 1BI3A 3UT1A 1Q81C 1H3ZA 1ZHIA 4BDZA 2E70A 1UB4A 2XKOC 3TW6A 2CZ6B 4M7AF 2HQEA 4QQGA 2EYQA 1JBMA 3WVDB 3WVEB 2RK2A 2VGMA 1WJRA 4J83A 3JCMb 1K73C 1ZQ1A 4HCZA 5GAOm 1KC8U 3QG1A 1VQNA 2E6NA 3C95A 1R8OB 1BI1A 1QP2A 2E65A 1MGQA 2XDPA 3EFRA 1WJSA 3CXCA 1FXXA 2D9TA 3QZ9B 4C0FA 4IKFA 3QDRB 5FU7B 4M7AE 5LJ3d 3L2WA 4C92D 3CCSA 1WQ7A 3PFSA 1VQ4A 3CBPA 3TEEA 3OYCA 3OBYA 2QEXA 2M16A 3QUIA 3JCMQ 2DKGA 3E19A 3A8LB 4KBMB 4RKUE 2BKDN 4XTXA 2KDSA 5CCAA 2E5QA 4HLQA 3MEVA 3JCMW 2RHYA 3NTIA 5LJ3e 2LT1A 3CC2T 2QF7A 1VQ6T 4JS5A 2WSFE 4PJOB 3F70A 3L2RA 3DB4A 5GAMd 2X4JA 4D6WA 1SSFA 4OB0B 4MZPA 2IVWA 4BUGA 2Y4XA 4X9DA 3PMTA 1QVGA 1NPPA 2JOYA 1QP3A 1P92A 1Q86U 4M7AG 2DIQA 4PJOF 4BE0A 4WF2A 3MP1A 2DXBA 4ELYC 4OGEA 2LCCA 2QI2A 1JRIA 2CKKA 3BDUA 5GAMe 3BG5A 5D6XA 3CCMA 4HNVA 4XTUA 2BS2A 4OB2B 3PT9A 2KSSA 5GANj 3HKSA 3CPWA 5LJ3f 4M7DD 2V8JA 4EMHA 1VQLT 1M4ZA 1XOVA 3X25B 1D3BA 2QQRA 3PIOA 4OB1B 3MEWA 3OW2S 3JCMd 4PJOE 5FU6B 1NJIU 2KR6A 5CQYA 3CC7T 3OS1A 2G77A 2DZ9A 3L2VA 2WACA 1YITT 2FL7A 2CS7A 2EKOA 2G3RA 4XAXB 5HK0A 1BIAA 2EAYA 1YCYA 2WSCE 2PVGB 1Y7XA 4MMLA 2BIVA 4RG2A 3L2QA 1BKBA 4X9CA 4C0DB 4M77D 1VQ5T 1KHCA 2XG8D 2EQJA 4KULA 3A8OB 5IAYA 5LJ5d 4MMKA 1G5VA 4E7LA 2PUKB 2YHTA 3CD6A 4C92A 2JZ2A 5FRMA 3OYAA 3R6OA 5C6SA 2XHCA 2E1HA 2K2VA 5CO7A 2R57A 3OYGA 5IT9E 3JB9D 1QVFA 4ELJA 3OYYA 1KD1U 3X26B 4B9WA 3VU3C 3L1AA 1M5Q1 2LQKA 3LLRA 2QDJA 1NE8A 2RK1A 3P8DA 2LX9A 3OS0A 3M9QA 3ZFJA 3VYHB 4JJNK 1TH7A 4C92E 2YLBA 2QDYB 4LDVA 2DD5A 4N4IA 4R56A 2ZPFB 4VUBA 3QPHA 3CMET 3GF5A 4IUQA 3QKJA 4XTZA 3RIRA 2RJFA 5GANh 3FC3A 3P8BB 4AKIA 3I55A 3S3OA 1I8FA 2E12A 2PVOB 3OYLA 4M7DA 2DTHA 3I56A 2K4YA 4M78C 2GQVA 1O75A 1VQKA 1I81A 1N9SA 3BW1A 3BG3A 2H3JA 4KUIA 2QA4T 1V29B 2K3XA 4IUTA 2GCXA 3CEYA 1X75C 3CCLA 3S3MA 1X01A 5CKFA 1UGQB 3GLXA 1JB0E 1YIJA 3NTKA 2QFZA 4MFDA 4M6VA 3QJYA 4C92G 3OS2A 1VQMA 3OYDA 2E10A 3CMAT 2I2LA 3E9FA 4M77B 4A4EA 2FVUA 2RJCA 3FEOA 3LYIA 4M77A 2CYZB 4QQ6A 4M7DE 2MMPA 1JJ2S 3HRSA 2MWPA 2EWNA 2M9UA 4JX5A 3QBYA 1HXDA 4JRQA 2DK3A 3MEAA 3LX7A 4FT4A 4M77F 5CQXA 5J26A 3RKXA 4F7UB 1N27A 3LGFA 2LTOA 2ZZDB 3G6EA 4FT2A 4RCBA 3RMQA 4F7UA 4PJOD 2M0OA 2XDBA 2ZZDA 3HRTA 3VKIA 2RHZA 2BS3A 2FB7A 4GY5A 4NL2A 5L8RE 2CZ0B 4C0ZA 2P0PA 3JB9F 3OS5A 2P0QA 2V8IA 3C12A 3TREA 4AI6A 3QJ6A 4M77E 4F7UF 3JB9H 4OB3B 3S6WA 3FJPA 3FLGA 1M1KU 4BE1A 2JTMA 4ELZC 3OYHA 3OYJA 3CCUA 4KT0E 4M7DG 1AHJB 4A53A 5FLXE 2DD4B 1OI1A 2EIFA 2LNVA 4N4HA 1YHQA 4A4KA 5GAN2 4J6XA 2RJEA 2DD4A 2GFAA 1EIFA 2VV5A 4F7UE 2OTLA 5D6YA 2DAQA 1WQWA 4II1A 4JUVA 1LJOA 5LJ3g 4M75D 3N5BB 4LD6A 4EMGA 4BI4A 5LJ5j 1VQOA 3C4SA 3QYGB 1UGRB 3RESA 4C8QC 1GXIE 2QTXA 2E64A 3VUBA 2L8DA 5KCOA 1X6OA 3CCST 1VQ4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ5 B;  3A8G B;  4OB2 B;  2ZPG B;  3QXE B;  3A8M B;  3A8H B;  2ZPH B;  3X25 B;  1UGP B;  4OB1 B;  2DD5 B;  3VYG A;  3HHT B;  4Y28 E;  2WSC E;  2PVG B;  4XK8 E;  3A8O B;  2PUK B;  2AHJ B;  2D0Q B;  4ZGD B;  2ZPB B;  3X26 B;  2PVD B;  2PU9 B;  3VYH B;  1UGS B;  2QDY B;  2DD5 A;  2ZPF B;  2CZ1 B;  4FM4 B;  2PVO B;  2ZPI B;  2WSE E;  4L6V 5;  1PSF A;  1V29 B;  1IRE B;  1UGQ B;  1JB0 E;  2DXC B;  1PSE A;  3LW5 E;  2DXC A;  2ZCF B;  2ZPE B;  2CYZ B;  2CZ6 B;  3WVD B;  3WVE B;  2DXB B;  2ZZD B;  3X20 B;  3X24 B;  1QP2 A;  2ZZD A;  3QZ9 B;  5L8R E;  2CZ0 B;  3X28 B;  4OB3 B;  4ZGJ B;  3A8L B;  4RKU E;  4KT0 E;  3VYG B;  1AHJ B;  2DPP B;  2DD4 B;  2PUO B;  2DD4 A;  1DJ7 B;  2WSF E;  4OB0 B;  1QP3 A;  3QYG B;  1UGR B;  2DXB A;  2CZ7 B;  2O01 E;  1GXI E;  3QYH B;  4ZGE B; 
#chains in the Genus database with same CATH topology
 1YWP A;  1H1R B;  4Z6Y A;  4R0K A;  3I5R A;  2C06 A;  2WJ9 A;  2ZPG B;  1M30 A;  2GFU A;  2K5F A;  5GAN f;  2EGC A;  2QG9 B;  3JCM P;  2ESW A;  4CFW B;  1WHL A;  2RI5 A;  4E7J A;  1T0J A;  1VYT A;  2YUP A;  2OTJ A;  1M90 U;  3M55 A;  1TXQ A;  3HHT B;  3ULR B;  4AFU C;  4PJO A;  1Y96 A;  4QVZ A;  4LDU A;  1NG2 A;  2JJ9 A;  1PM3 A;  3M0U A;  2KRN A;  1SEM A;  2RI2 A;  4HXJ A;  1VQ8 T;  2EJG A;  1G3S A;  1ZSG A;  1FMW A;  1E9H B;  4XU0 A;  3CCL Q;  4NC6 A;  2KXC A;  2JGZ B;  1OOT A;  2PVD B;  4PFP A;  5LJ5 h;  1N8R R;  5LJ5 g;  4EOL B;  3SHW A;  1RAA B;  1XNI A;  4F04 B;  1RAB B;  1YJ9 A;  3G7Z A;  3V8L A;  1VQ6 A;  2DX1 A;  5J3B A;  4M75 F;  4BI3 A;  4LXC A;  1AT1 B;  4HVV A;  1W98 B;  4HNT A;  3CCQ Q;  1G3Y A;  5HBH B;  1FWZ A;  1MND A;  2WHB B;  5GMK l;  3QDF A;  5GAN 3;  1O9K B;  2RPN A;  2C5N B;  1WZO A;  1VIE A;  1Q81 R;  1EZZ B;  1VYU A;  1YHQ Q;  1MV3 A;  2HZY A;  2HDA A;  2LMJ A;  4JX4 A;  2KY9 A;  4LDW A;  5A2Q E;  2E6Z A;  3M59 A;  3HFN A;  4B9X A;  3CXC P;  2B86 A;  2DL3 A;  2BS4 A;  4M7A C;  3H4C A;  4BBR M;  3VS1 A;  2LQN A;  3ZL7 C;  4RTY A;  4ZGJ B;  2DFU A;  4BDY A;  3OMC A;  5D6W A;  3V8K A;  4EPC A;  1Q82 R;  4BBS M;  1HK9 A;  1RAF B;  1S72 A;  1G3W A;  5GAN 6;  2HKN A;  4OF1 A;  1QWF A;  3VUB A;  3G6E T;  5CAI A;  2W2H A;  3EG9 A;  4R55 A;  1QLY A;  4M78 D;  4IUR A;  2LVM A;  3POM A;  2UZL B;  1TUG B;  2CGH A;  4LOC A;  2RQT A;  1WHJ A;  1AD5 A;  3CPF A;  1UNH D;  4JJC A;  2ENM A;  3DL1 A;  4LD9 K;  1H64 1;  5GAN d;  3A8H B;  4FIB A;  2XD0 A;  2ZPH B;  1GUX B;  1EX4 A;  1K4U S;  2JM9 A;  8ATC B;  1I1J A;  3HRU A;  3QO3 A;  2RA2 A;  1K8A U;  3WXM B;  2DIG A;  1TG0 A;  2PK2 A;  1O9S A;  5LJ3 h;  1LOJ A;  2JS0 A;  2PNI A;  3LWI A;  1QVP A;  2FPE A;  4AT1 B;  3RER A;  5KYY A;  2OI3 A;  4FL6 A;  4XU2 A;  4AKH A;  2V1Q A;  2FRW A;  2HQX A;  5GMK h;  2YDL A;  4Q5W A;  4CI0 C;  1KJW A;  2ED0 A;  1YI2 A;  4XU3 A;  5HBE B;  4E7I A;  3VUZ A;  1FVV B;  4PJN A;  4HCK A;  1RAE B;  3MO8 A;  3REA B;  5I21 A;  3HL8 A;  1B3Q A;  1VQP T;  4PKC C;  2O31 A;  2QDL A;  2VXF A;  4RTV A;  1H26 B;  3VKH A;  2CT3 A;  2ZPE B;  1SKU B;  2DME A;  1NLO C;  3BY7 A;  1U8R A;  3OYN A;  1OIY B;  2YWW A;  1VQ7 T;  2DXB B;  3CCV T;  4E47 A;  1UEB A;  4Z8A A;  2BKZ B;  4BCO B;  2KMT A;  2LC4 A;  4EOP B;  1VQ8 A;  5GAN 7;  4JRK A;  2MCN A;  1KHI A;  2LJ1 A;  2YLC A;  3LGL A;  4ORZ A;  1GY3 B;  5KYW A;  3GIB A;  1BIB A;  1YIT A;  2M0Y A;  1WFW A;  5GAM f;  2MI6 A;  4HCC A;  1QKW A;  4XQ3 A;  1BU1 A;  4C92 B;  5GMK m;  4BCN B;  4OMF B;  2RI3 A;  2CZ7 B;  3A5Z B;  4HCB A;  3A8G B;  3VRY A;  5LJ5 e;  4ZTF A;  1IGQ A;  4HT9 A;  4F7N B;  4F17 A;  4PLI A;  3CCR T;  3HO8 A;  3QSU A;  4ZN3 A;  1AIS B;  3GPL A;  8AT1 B;  4BI8 B;  5C0M A;  2MIO A;  4KUD K;  5CEI B;  4J9C A;  5GAN g;  1X43 A;  1PKT A;  4MZM A;  1GFC A;  2KRO A;  3VV0 A;  4BY6 B;  4YOS A;  1AD6 A;  2KT8 A;  1SRM A;  2ZAE A;  4M7D F;  1JJ2 A;  1XQH A;  2EQK A;  4BAC A;  1KQS P;  2QA4 A;  1NPR A;  4IUP A;  2AIR B;  2P4R A;  2QXF A;  1OX8 A;  3FB9 A;  4F7S B;  1VYV A;  2RHU A;  4AG2 C;  4QVC A;  5HK3 A;  3CMA A;  1VQO T;  4F16 A;  2DTI A;  3SD4 A;  2GNC A;  5CR2 A;  4IUU A;  2KAF A;  3G71 T;  1YJN T;  2P4T A;  1F1B B;  3TN8 B;  2PTK A;  5FU6 C;  1Z9Q A;  4M75 C;  4CRI A;  4I3Z B;  3TCJ A;  4EMK B;  2X9H A;  1JST B;  9ATC B;  3EOC B;  4M7A A;  3QII A;  2L5Q A;  1GCQ A;  4RCC A;  3MI9 B;  1JOW A;  1MMG A;  2XKO C;  2CZ6 B;  3NPF A;  1SHG A;  4CFX B;  3WVD B;  2VGM A;  1WJR A;  3DDP B;  2C0T A;  5KYU A;  2E6N A;  1R8O B;  1QP2 A;  4ROC A;  4E7Z A;  2XDP A;  2DBM A;  4C0F A;  3QZ9 B;  2YT6 A;  4M7A E;  3QWX X;  1JU5 C;  1GRI A;  1TUC A;  1WQ7 A;  3CBP A;  3OYC A;  2QEX A;  1KC8 U;  3QUI A;  2KGT A;  1LPL A;  3A98 A;  2KDS A;  3G4S Q;  2JS2 A;  2RHY A;  5LJ3 e;  1R0B G;  2VKN A;  4PJO B;  2C0I A;  2IVX A;  3F70 A;  3L2R A;  2RQU A;  5GAM d;  2X4J A;  4MZP A;  1ZUU A;  1JSU B;  2XMF A;  2HMA A;  1OV3 A;  2DIQ A;  3MP1 A;  4IIO A;  3EFO A;  4XTU A;  4EIK A;  1VQL T;  1M4Z A;  2J6K A;  4LUD A;  3OW2 S;  3VS6 A;  1NJI U;  1BU2 A;  5GJW B;  2HCK A;  2G77 A;  2WAC A;  3A1P A;  2CS7 A;  2G3R A;  4Y92 A;  1ZSZ C;  1YCY A;  1Y7X A;  3GBQ A;  4RG2 A;  4EOJ B;  1UNG D;  4X9C A;  4C0D B;  4M77 D;  1VQ5 T;  4ROE A;  2F2W A;  4MMK A;  4EON B;  1AWW A;  2NUP A;  5FRM A;  3OYA A;  3R6O A;  5KYX B;  5C6S A;  2E1H A;  2K2V A;  2R57 A;  1VIN A;  5IT9 E;  4AG1 C;  3OYY A;  3VU3 C;  1OL2 B;  2DL7 A;  3LLR A;  2VVK A;  5FWB A;  2QDJ A;  1NE8 A;  2RK1 A;  3P8D A;  5CYI B;  2LJ0 A;  1TH7 A;  2K79 A;  2DD5 A;  2MPX C;  3CME T;  1B07 A;  4IUQ A;  1FMV A;  3FC3 A;  4E2F B;  3P8B B;  4LN2 A;  3THK A;  4FYV B;  2PHG A;  1D0Y A;  5ECA A;  1FMK A;  2K4Y A;  4M78 C;  1T3L A;  1V29 B;  1QWE A;  2GCX A;  3CEY A;  5CKF A;  1D09 B;  1JB0 E;  3EHR A;  3NTK A;  4JJB A;  4MFD A;  1M2O A;  2OTJ Q;  2F2V A;  2RNA A;  2CYZ B;  3EG9 B;  3TSZ A;  2FZC B;  2EWN A;  3QBY A;  2RQV A;  1HXD A;  4JRQ A;  3LX7 A;  4M77 F;  1AZG B;  3RKX A;  2LTO A;  2ZZD B;  4FT2 A;  3QWY A;  2M0O A;  3VKI A;  2RHZ A;  2EW3 A;  3CPW P;  2CZ0 B;  3PVQ A;  4FW2 A;  2BZ8 A;  2P0Q A;  4F7U F;  1VOM A;  1M1K U;  3FLG A;  4BE1 A;  4F6S B;  4J9I A;  4HVW A;  1ABO A;  4M7D G;  1H1S B;  1AHJ B;  1UGV A;  1OI1 A;  2EIF A;  5HBJ B;  4A4K A;  2RJE A;  2DD4 A;  2VV5 A;  4KRT A;  2OTL A;  1YJ9 Q;  2IPO B;  2LCS A;  1FYN A;  1WQW A;  2G6F X;  1VQO A;  4D8D A;  5LJ5 j;  3N5B B;  4EMG A;  1H28 B;  1UGR B;  1QCF A;  2E64 A;  3G71 A;  2QAS A;  1VQ4 T;  1QVF P;  1I5O B;  4K11 A;  5CKH A;  3OYM A;  3DJB A;  1PG5 B;  5CVI A;  5GAM g;  3CCJ A;  1X27 A;  2EQU A;  3BDL A;  4E7H A;  3RNJ A;  5I22 A;  1K9A A;  5A0L A;  5LL6 S;  3VRZ A;  1K0X A;  1JXM A;  1WA7 A;  4EDU A;  5I2M A;  3I55 Q;  1OI9 B;  3BFM A;  2YRV A;  2L2P A;  2IIM A;  4DBR A;  2AZV A;  1OX9 A;  3UDC A;  1VQ9 A;  1VQK Q;  1K9M C;  2ZPB B;  4BD3 A;  1WPY A;  3DOG B;  1B34 B;  5AYF A;  2C0O A;  1YIJ Q;  4JJD A;  1KFZ A;  3RDV A;  3OMG A;  3TSW A;  1S72 Q;  2MK5 A;  1U5S A;  3SWN C;  4M75 A;  1W4S A;  1K0S A;  1ZUY A;  3KHI A;  1Q82 U;  2F1L A;  3E9G A;  3HTR A;  4HVU A;  2DEU A;  3OW2 A;  4GBQ A;  2UZB B;  1UEC A;  4LDX A;  4IMY B;  1FKM A;  4PNO A;  1XO2 A;  1GL5 A;  2B8A A;  3L2Z A;  3OYE A;  4RMO A;  1OZ3 A;  4M75 E;  2UZE B;  1IGU A;  2K3Y A;  1KK7 A;  5KYW B;  3CCU Q;  2QK0 A;  4KRC B;  1YJW T;  2O4X A;  3M0T A;  3T9N A;  4BCM B;  4QKU A;  1BBZ A;  4FSX A;  5CKD A;  3EFS A;  1VQ5 A;  2DIL A;  1IO6 A;  4EOK B;  1NEG A;  4J7F A;  5LJ3 j;  1M3C A;  1YIJ T;  1TTH B;  4MIM A;  1IHV A;  1TD6 A;  4A4H A;  2CP5 A;  2DPP B;  1WHM A;  2X4X A;  2WPA B;  1YI2 Q;  2COW A;  1Q7Y U;  2L3Q A;  1W2B A;  3LWH A;  2KEA A;  5GMK j;  4J5Y A;  1KIK A;  2CP2 A;  1I4K 1;  4GLK A;  4C5E A;  2CSQ A;  4IUV A;  2V8K A;  2DRK A;  3ZBD A;  2CUB A;  1R77 A;  1YNZ A;  1ZSZ A;  1RAH B;  1XJW B;  3OSV A;  2H3E B;  1C0M A;  4MDW A;  3AHU A;  1D0Z A;  1JO8 A;  2RF0 A;  4BB7 A;  5HKC A;  2K2M A;  1PD1 A;  2JN0 A;  1PWT A;  3J80 E;  2NYS A;  2Z0W A;  4AKG A;  1Y71 A;  1E7P A;  3C94 A;  5IN1 A;  2D0Q B;  3TW7 A;  4M77 G;  3M4G A;  3TQ7 P;  2KRS A;  5I2S A;  5GAO l;  2O2O A;  2X4W A;  4KRD B;  1M90 C;  1NM7 A;  2CP0 A;  4F7U G;  3CXC S;  3SDZ A;  3OQ5 A;  3MP6 A;  4M78 A;  5KE3 A;  4HKE A;  3CC7 Q;  2DYB A;  1YIT Q;  2V22 B;  2EYY A;  1KG1 A;  2AKL A;  2RHX A;  4JLI A;  3CCM T;  3SFM A;  1M3B A;  1K73 U;  2RMO A;  5DLO A;  4J8O A;  5GJV B;  2DO3 A;  4ESR A;  4M78 E;  4BCN D;  5IDP B;  3CC4 T;  4HT8 A;  1QVG S;  5DY9 A;  5FW9 A;  3DLM A;  5EG2 A;  3V8J A;  2DXC A;  4BCP B;  1D1C A;  4TVR A;  3EID B;  2K5I A;  3UA7 A;  6AT1 B;  4OR5 B;  2L3S A;  3H41 A;  1G3N C;  4QT7 A;  3CC2 A;  4DA4 A;  1SHF A;  2XDD A;  4A4F A;  2QQ8 A;  3X24 B;  1VYW B;  1OPL A;  2DLP A;  4JZ4 A;  1XTD A;  2OJ2 A;  4M77 C;  4E7K A;  1N5Z A;  2BUD A;  1NLP C;  4C8Q B;  2WFY B;  2QA4 Q;  3GNF B;  1M27 C;  3E2U A;  2WIH B;  1HJD A;  1WXT A;  1AVZ C;  4A4G A;  3TNH B;  3CMA Q;  4BXX X;  2DZC A;  2R58 A;  5KE2 A;  2JXB A;  1TFB A;  2FYK A;  2ATC B;  3JV3 A;  3QYH B;  5HQ0 B;  2X3X D;  1OYX A;  4NS5 A;  3CCL T;  4C92 F;  4HL4 A;  1H27 B;  1AWO A;  3A8M B;  1G3T A;  3JCM X;  4F7L B;  1M8V A;  2I40 B;  3JCM f;  3JCM c;  3KXT A;  3URG A;  3EGD A;  2DD5 B;  4FYY B;  3QYE A;  3MET A;  1PRL C;  3NFC A;  1YJW A;  4Y91 A;  4C8Q G;  3CCQ T;  1B7T A;  1M2V B;  2COZ A;  2F5K A;  3SWN A;  1K9M R;  2R5A A;  3IQL A;  3HPW A;  3ER0 A;  5L2W B;  5J39 A;  3NTH A;  1J3T A;  4ELL A;  1BI0 A;  2QEX Q;  2DA9 A;  1WIE A;  1K8A C;  2LQ8 A;  3CCE Q;  1YHQ T;  1WHG A;  2QQS A;  3HB9 A;  1WGS A;  4CFU D;  1BCO A;  4N0A C;  4OVA A;  4Y72 B;  2WIP B;  3FDR A;  3DKM A;  3MHX A;  2IW9 B;  1GCP A;  2ROL A;  5IHN A;  1JQQ A;  3ASK A;  5IXF A;  2CDT A;  2R7G A;  4L6V 5;  3M58 A;  3BLQ B;  1OKW B;  4O5V A;  2F2X A;  1QCO A;  1H3Z A;  1ZHI A;  2DVJ A;  1K1Z A;  3TW6 A;  3F5X B;  1UE9 A;  4QQG A;  2EYQ A;  3UA6 A;  3WVE B;  3MPU B;  3JCM b;  4J83 A;  3M0S A;  4HCZ A;  5GAO m;  3QG1 A;  3C95 A;  3CXC A;  2J6F A;  1FXX A;  2EGA A;  4IKF A;  3QDR B;  4J9G A;  3L2W A;  1TSF A;  3CCS A;  4KH1 B;  4ANJ A;  3TEE A;  3I9Q A;  4D8K A;  4OGR B;  3E19 A;  2YXY A;  4KBM B;  1Z9Z A;  4HLQ A;  1JKW A;  2X3W D;  5I5Z B;  2WSF E;  4RUG A;  2EUF A;  1QCN A;  2IVW A;  3LH5 A;  1QVG A;  1D3U B;  2JOY A;  1Q86 U;  5IXB A;  4PJO F;  4ELY C;  2QI2 A;  1JRI A;  2CKK A;  3CCM A;  1NEB A;  1JJ2 P;  3HKS A;  3TNW B;  4M7D D;  2V8J A;  2QQR A;  4AFQ C;  1D3B A;  4OB1 B;  3JCM d;  5FU6 B;  5CQY A;  4EC8 B;  1G8X A;  2BZY A;  4XAX B;  1BIA A;  2EAY A;  1MMN A;  4EOO B;  1RAD B;  2A28 A;  2WSC E;  4MML A;  4PK4 A;  2NUT A;  1KHC A;  4FYW B;  4KUL A;  4E7L A;  4BCK B;  2PUK B;  2JZ2 A;  3UF4 A;  5CO7 A;  1ZUK A;  2MOX A;  2NWM A;  1M90 R;  2D1X A;  4ELJ A;  3BE3 A;  1KD1 U;  2KNB B;  3EH2 A;  4NST B;  1M5Q 1;  2LQK A;  2DYI A;  3M9Q A;  1WLP B;  3ZFJ A;  3VYH B;  2L3P A;  4JJN K;  2OTL Q;  1Y0M A;  4LDV A;  4OML A;  2FZG B;  2EYW A;  3GF5 A;  2WMB B;  1D1B A;  2E3H A;  2YUQ A;  4XTZ A;  3RIR A;  2NUZ A;  5GAN h;  1ZX6 A;  1VQN Q;  1IRX A;  3OYL A;  4X1V A;  3R6N A;  2KI7 A;  1N9S A;  2CSI A;  3RGF B;  2YSQ A;  2K3X A;  4LUE A;  3CCL A;  3CCJ Q;  2OX7 A;  2QFZ A;  3QJY A;  4M6V A;  4PFO A;  4C92 G;  3OS2 A;  3OYD A;  1OKV B;  2E10 A;  4IIM A;  3E9F A;  2HQH A;  2FVU A;  4J9H A;  1PRM C;  2QGF B;  1X6B A;  4M77 A;  5LQF B;  2MWP A;  1QMC A;  1V76 A;  2M9U A;  3PVL A;  2X51 A;  3MEA A;  4FT4 A;  1G83 A;  2CCI B;  3G6E A;  3QHR B;  4F7U A;  1JXO A;  4F70 B;  3HRT A;  2BS3 A;  1VQ9 Q;  2P0P A;  2BE7 D;  3OS5 A;  1UDL A;  3PE0 A;  3TRE A;  3JB9 H;  4AI6 A;  2LZ6 B;  3QJ6 A;  4M77 E;  4RTZ A;  3MIA B;  2UZD B;  5IDN B;  3PO3 S;  5FLX E;  1PKS A;  2LNV A;  1YHQ A;  5GAN 2;  4F7U E;  5D6Y A;  2JT4 A;  1M3A A;  4JUV A;  4BCH B;  1LJO A;  4BI4 A;  1ZP2 A;  3RES A;  3CD6 Q;  1GXI E;  5KCO A;  2W96 A;  2L0A A;  3HFO A;  1KC8 C;  1X2Q A;  3CBO A;  2DET A;  3U23 A;  1W70 A;  2EVR A;  2X4Y A;  2DEQ A;  3M57 A;  4M78 B;  3SB2 A;  3VS5 A;  1H1Q B;  1OGU B;  4CXA B;  3V7S A;  2KK4 A;  2O88 A;  1Y96 B;  4Y28 E;  3ZEH A;  2E3I A;  2LCL A;  2W9Z A;  2XK0 A;  2JM8 A;  1V1C A;  3JCM h;  4Z02 A;  1HSQ A;  3JCM g;  5IF1 B;  2LX7 A;  3OY9 A;  3I56 Q;  4N0A A;  1VQP A;  1K8A R;  5GMK e;  2JVV A;  2RHI A;  2C4G B;  3V7R A;  2XU8 A;  4A54 A;  4EOQ B;  1K76 A;  1NJI C;  3MJX A;  3OYF A;  3OYK A;  5A0G A;  1AZE A;  1D1A A;  1SF9 A;  1FIN B;  4QSH A;  4EOM B;  4KGZ B;  1VQM Q;  3TU4 K;  2VXE A;  1UGS B;  3G33 B;  2DVE A;  4BY6 C;  2CZ1 B;  2R5M A;  2PJQ A;  4J6W A;  1IB8 A;  3EGU A;  1VQ7 A;  4OMM A;  4JX6 A;  3CCV A;  2DJZ A;  4PJO G;  3M54 A;  1IRE B;  2D8J A;  4HNU A;  2W0Z A;  3G4S T;  1RL2 A;  1PSE A;  4C0G A;  5IHK A;  2DL8 A;  3OSS C;  4NOY A;  1QVF S;  1MMA A;  5HVY B;  4L59 A;  3ME9 A;  3P8H A;  4EMK C;  4J6Y A;  4J7I A;  4FW1 A;  3O5Z A;  2VYT A;  4L5G A;  1YCS B;  2A08 A;  4C5H A;  2FPD A;  2E4H A;  3MY1 B;  1FX7 A;  4MZT A;  3EGD B;  3CCR A;  4OMN A;  4EOR B;  3BHV B;  1NYF A;  3JCM J;  3FRN A;  2MAM A;  3EH1 A;  1M1F A;  1SG5 A;  1GBR A;  1WNL A;  2C5O B;  2JTF A;  4PJJ A;  4BE2 A;  1M1K C;  2HBP A;  2FO0 A;  2PK9 B;  2A7Y A;  3JSC A;  4LDY A;  2LDM A;  1U06 A;  5GAN e;  1VIF A;  1QLB A;  3CC2 Q;  2FPF A;  1VQ6 Q;  2D8H A;  1N6A A;  3OW2 P;  1N8R U;  4O6J A;  3VJP A;  3H8Z A;  5KYY B;  3UPU A;  1IZ6 A;  3BG9 A;  3MCA B;  2DER A;  4JZ3 A;  1YJN A;  2L3R A;  4OP0 A;  2RQW A;  1I5L A;  1P5E B;  5GAM h;  4J9E A;  2OTJ T;  4ROD A;  4C0D C;  2M51 A;  3RUX A;  2A36 A;  2ZGW A;  4C8Q D;  2KYM A;  3PMI A;  4BCQ B;  1UTI A;  4BCJ B;  1Q81 U;  1YBY A;  4N4G A;  1QMZ B;  3HZJ A;  1WI7 A;  2H8H A;  4AFZ C;  4DEX A;  1BB9 A;  4P5N A;  3TNI B;  7AT1 B;  4MFE A;  2EGE A;  4JDS A;  3J7A F;  2RJD A;  4F6W B;  4ATO A;  3UWN A;  2VGN A;  1UG1 A;  1YJ9 T;  2DNU A;  2M02 A;  3SEM A;  4M7D C;  1Q82 C;  4DQ2 A;  1W2B P;  1YP5 A;  1MNE A;  4CFV B;  2ECZ A;  4XU1 A;  3PTA A;  3AT1 B;  4AMC A;  2I53 A;  3PGG A;  2VWF A;  2X35 A;  1HD3 A;  1QQJ A;  5EFQ B;  2ABL A;  1D3B B;  2C6T B;  3X28 B;  4XTW A;  4UN0 A;  1N9R A;  1K9M U;  1VQL A;  4V2S A;  2VC8 A;  1ZA2 B;  2PUO B;  2A3L A;  2PMI B;  3JCM e;  4C8Q F;  2UUE B;  5M9O A;  2HAX A;  2PQW A;  2K7A A;  3I55 T;  5FRO A;  2HSP A;  1PNJ A;  1BI2 A;  1WHK A;  1KC8 R;  1VOL A;  2G9X B;  2KMG A;  2F69 A;  1VQK T;  2VAS A;  2EFI A;  4RTU A;  5GAO n;  1UGP B;  1S72 T;  2QQ9 A;  3G4S A;  1U1T A;  1Q7Y C;  3PIP A;  1WYX A;  4ZNX A;  1AWJ A;  1KQ1 A;  3L42 A;  3VYG A;  1W1F A;  3LH0 A;  4XTY A;  5BNJ B;  2LP5 A;  1URC B;  1CSK A;  1C9B A;  5FU7 C;  4JRI A;  1VA7 A;  2CCH B;  5GAO p;  3CME A;  1UHF A;  2V26 A;  1NJI R;  4BCF B;  4ZGD B;  2CP7 A;  1H25 B;  5KH6 A;  4E6R A;  3B57 A;  4MDX A;  3CCS Q;  3QYB A;  2M1H A;  1RUW A;  3LQ5 B;  1YWO A;  1ZLM A;  1YFN A;  4DOW A;  3CCU T;  5GAO r;  2RH2 A;  3QWL A;  3OYI A;  5CKE A;  1D0X A;  2PU9 B;  3Q1J A;  4Z88 A;  2JTE A;  2CH4 A;  2RB6 A;  1R0C B;  1F5Q B;  4JS4 A;  4PJM A;  4YTL A;  5GAN 8;  4DEY A;  3MY5 B;  3FJ5 A;  2CT4 A;  2XI9 A;  4DBQ A;  1OUL A;  2DMO A;  2ZPI B;  2EYZ A;  3H0I A;  5A0D A;  2LT4 A;  2RM4 A;  3EGX A;  1VQ8 Q;  1ABQ A;  4ZTJ A;  4FX3 B;  2QQA A;  2GQI A;  2FHD A;  4EMK A;  4LNP A;  1C6V X;  4M7A B;  1ZA1 B;  3LW5 E;  2K57 A;  2JMC A;  1YI2 T;  4OGC A;  2KBT A;  4UC4 A;  2NLU A;  3KUF A;  3UT1 A;  1BI3 A;  4BDZ A;  1UB4 A;  5KYU B;  1K73 C;  2J06 A;  1ZQ1 A;  4FCY A;  3NMZ C;  2E65 A;  3EFR A;  1HYO A;  5LJ3 d;  1BCM A;  3BHU B;  4C92 D;  1VQ4 A;  3PFS A;  2X1N B;  3OBY A;  4YOZ A;  2BKD N;  3MEV A;  1WXB A;  2BTT A;  2EKH A;  1UHC A;  4JS5 A;  4PJL A;  1I0C A;  3VS0 A;  1Q95 G;  1CKA A;  2Y4X A;  4X9D A;  3PMT A;  1NPP A;  2J6O A;  1QP3 A;  4M7A G;  1M1K R;  3EFO B;  5GAM e;  1TOV A;  3GTM S;  5D6X A;  4HNV A;  2C5X B;  4OB2 B;  2KSS A;  5GAN j;  4EMH A;  4PJO E;  4E7S A;  3PIO A;  2AKK A;  2KR6 A;  3CC7 T;  2DF6 A;  3L2V A;  1YIT T;  2DZ9 A;  2EKO A;  5HK0 A;  4EC9 B;  2HKQ B;  2BIV A;  3KFV A;  1NBE B;  3L2Q A;  4J9B A;  1H8K A;  1U3O A;  2XG8 D;  2EQJ A;  3G6E Q;  2NUP B;  4GLM A;  1G5V A;  2YHT A;  1UNL D;  2XHC A;  5KYX A;  2V1R A;  3JB9 D;  5EC7 A;  3EG3 A;  4B9W A;  2DM1 A;  2D0N A;  3OS0 A;  2YLB A;  2ZPF B;  4VUB A;  3QPH A;  3QKJ A;  4RTW A;  2FZK B;  4AKI A;  2YRD A;  3I55 A;  2E12 A;  2PVO B;  1GCQ C;  4M7D A;  2DTH A;  1VQK A;  1I07 A;  1I81 A;  1ZBJ A;  3BW1 A;  2H3J A;  3BG3 A;  1PCX A;  4KUI A;  2QA4 T;  2IN3 A;  4IUT A;  2EBP A;  1X6G A;  4OMP A;  3S3M A;  1YIJ A;  1WDX A;  3CMA T;  2VB6 A;  2RJC A;  4JPB W;  4QQ6 A;  4M7D E;  2CUD A;  2MMP A;  1JJ2 S;  3HRS A;  1RAI B;  4AFS C;  1QVG P;  1X69 A;  4JX5 A;  5J26 A;  4F7J B;  3LGF A;  4RCB A;  3RMQ A;  4PJO D;  4FYX B;  2XDB A;  2ZZD A;  3EHQ A;  1VQP Q;  4NL2 A;  5L8R E;  4C0Z A;  3JB9 F;  4ELZ C;  3CCU A;  2DD4 B;  4RTX A;  1ENW A;  2GFA A;  1EIF A;  2SEM A;  3REB B;  4II1 A;  3VS7 A;  3D7S B;  4KGX B;  5LJ3 g;  1VQ7 Q;  4C8Q C;  3O0G D;  4WTO B;  3CCV Q;  2L8D A;  2E5K A;  1X6O A;  3DTO A;  4HA8 A;  3E1S A;  3M03 A;  3JRZ A;  2QEX T;  3O8V A;  3G1J A;  3CCE T;  1MUZ A;  1Q7Y R;  1RI0 A;  2W99 A;  2YUO A;  4C5I A;  2JUF A;  4BCI B;  3BLR B;  1MMD A;  3CQT A;  1Q86 C;  3RKY A;  5CIU A;  4M78 F;  3EG0 A;  1KXU A;  4PLL A;  4WCI A;  3EAE A;  1KQS S;  2E41 A;  2LQW A;  1E6H A;  1RLP C;  2K5L A;  3H0F A;  2KQW A;  3MKD A;  2JW4 A;  1ZBX A;  2KVQ G;  3DB3 A;  1B34 A;  2KYB A;  2IW6 B;  3VS4 A;  3CCR Q;  4RTT A;  4M75 B;  3CC4 A;  2F5T X;  4ZN1 A;  5GAO q;  2HEQ A;  4EOI B;  3C0C A;  3L2U A;  2K9G A;  1T3S A;  1BYM A;  2RO0 A;  3GNG A;  1WHH A;  2KRM A;  3MEU A;  3JCM V;  1UUE A;  5FRN A;  2ED1 A;  2WSE E;  2DTO A;  1KD1 C;  4G6L B;  3M0R A;  2W9F A;  4II5 B;  1JEG A;  3M5A A;  1LNX A;  3CC7 A;  1K73 R;  2P84 A;  2O4X B;  5LMK B;  2CP3 A;  1VQO Q;  2MWO A;  2FG0 A;  4JRP A;  3HSB A;  5IHY A;  1GH6 B;  3X20 B;  4M75 G;  4Z89 A;  3M0Q A;  1H92 A;  3G71 Q;  2HD0 A;  4C5G A;  1YJN Q;  1WX6 A;  1KQ2 A;  5CKB A;  3HP9 A;  5CK9 A;  5IHI A;  5FGK B;  4ME7 A;  3DLL A;  4RG8 A;  3VYG B;  5DM7 R;  3OB9 A;  2OAU A;  1DJ7 B;  2GGR A;  2DXU A;  3VS2 A;  5GAM j;  1X2K A;  1PD0 A;  2A0F B;  2IG0 A;  2L89 A;  3M56 A;  3CBM A;  4FSS A;  4JLG A;  1UJ0 A;  2QAZ A;  3JB9 I;  4F6U B;  3QHW B;  2O01 E;  2Y4Y A;  4M4Z A;  3VKG A;  4ZGE B;  3PNW C;  1ZSZ B;  4BCQ D;  3H6Z A;  3CCQ A;  4CC7 A;  1LVK A;  3QXE B;  3BLH B;  3MP8 A;  2OTL T;  2GF7 A;  1KSW A;  2RD1 A;  2EPD A;  1ARK A;  3VS3 A;  1VUB A;  1VQN T;  3M53 A;  2HNI A;  4YC3 B;  4EOS B;  4XK8 E;  4BE0 A;  4FU6 A;  3OYB A;  5GAN 5;  2AHJ B;  4PFZ A;  3EGX B;  1M8M A;  3NGP A;  4CC4 B;  5L23 A;  4KGV B;  2EJF A;  3CCJ T;  3JB9 J;  1UFF A;  1OEB A;  2Y90 A;  4PL6 A;  3FIF A;  5KCH A;  1OL1 B;  1Y57 A;  2XIC A;  3JB9 G;  2DE0 X;  1VQL Q;  2WMA B;  4OMO A;  3I5S A;  4C92 C;  3NDQ A;  3RR6 A;  4QVD A;  1U1S A;  2D6F A;  1Y07 A;  4QW2 A;  2RQR A;  3V7C A;  3BHT B;  2W10 A;  3GP8 A;  1VQ9 T;  1VQ5 Q;  2JNG A;  5DLQ E;  3JAM E;  2J7I A;  4CFU B;  3OA6 A;  4BCM D;  2VUB A;  2LJ3 A;  3CCE A;  2DXC B;  2BE9 B;  3OBW A;  4LE9 A;  1KQS A;  5GAN 4;  4NL3 A;  1WJQ A;  2K3B A;  2AZS A;  3CPW S;  5EJC A;  3CD6 T;  4CC3 A;  3CME Q;  5GMK i;  4M78 G;  4QQD A;  1S1N A;  3EJ1 B;  2XID A;  4F14 A;  3H9N A;  1M9S A;  3INZ A;  3M4Y A;  4C8Q A;  1O9K A;  2CJM B;  4B6M A;  4DOV A;  1OZ2 A;  2DJQ A;  2B9R A;  2CH4 W;  5KYN A;  4OMQ A;  2RN8 A;  5I11 A;  3I56 T;  3NHN A;  1SPK A;  4C8Q E;  1MHN A;  2O9V A;  2MYS A;  2A37 A;  1AEY A;  3QZ5 B;  5ICP B;  3DDQ B;  1C1A A;  1RAC B;  2MF2 A;  1VQM T;  2C5V B;  1Q86 R;  1AOJ A;  1GFD A;  1A0N B;  2QTV A;  2DL4 A;  3J81 E;  4X34 A;  2YUN A;  2FRY A;  2QQB A;  4M7A D;  2F2C A;  2HBW A;  1QW1 A;  4M7D B;  5LJ5 f;  3SWN B;  1M1G A;  1M2V A;  2ROT A;  1W2B S;  4DBH A;  4XTV A;  1QKX A;  2GTJ A;  2EJ9 A;  2OAW A;  5D7U A;  5FWC A;  1VQ4 Q;  2QYZ A;  2LRQ A;  1T0H A;  4PJO C;  2DL5 A;  3EG1 A;  4DBF A;  1GUX A;  2DXT A;  1W6X A;  2SRC A;  1TWB A;  1N8R C;  2LW4 A;  2EQI A;  3RMS A;  2QGS A;  1UJY A;  1E7O A;  3KBG A;  1OQK A;  1LCK A;  4CC2 A;  5IH2 A;  1KD1 R;  4FM4 B;  3GOX A;  3M0P A;  5HNB B;  1SSH A;  3QHS A;  1G2B A;  2COY A;  2EYX A;  2CP6 A;  1NZ9 A;  1PSF A;  4J9D A;  2EQM A;  3HBL A;  1RLQ C;  2FEI A;  2P0K A;  2DBK A;  4TTH A;  3S3N A;  3RKW A;  1ACM B;  2ZCF B;  2KT1 A;  5HY6 A;  1Q81 C;  1IXD A;  2E70 A;  1YN8 A;  4M7A F;  2YRC A;  2HQE A;  2IW8 B;  1JBM A;  2KE9 A;  2RK2 A;  1VQN A;  2AT1 B;  4A63 B;  1BI1 A;  2DRM A;  1MGQ A;  1WJS A;  2D9T A;  5FU7 B;  2K6D A;  5ACB A;  1MV0 B;  2M16 A;  3JCM Q;  2DKG A;  3A8L B;  1PHT A;  4RKU E;  4XTX A;  5CCA A;  2E5Q A;  4KH0 B;  3JCM W;  3NTI A;  2LT1 A;  3CC2 T;  2QF7 A;  1VQ6 T;  2BZX A;  3K7A M;  3DB4 A;  4D6W A;  2BPM B;  1SSF A;  4OB0 B;  2LNH B;  1H3H A;  1TS9 A;  3TVT A;  4BUG A;  1YJW Q;  1CKB A;  1P92 A;  2I0N A;  4WF2 A;  2DXB A;  4OGE A;  2LCC A;  3BDU A;  3BG5 A;  2BS2 A;  3PT9 A;  5DQW A;  1PC0 A;  3CPW A;  5LJ3 f;  1XOV A;  3UAT A;  3X25 B;  3MEW A;  3OS1 A;  2CRE A;  2FL7 A;  4CFN B;  4BY1 X;  2O9S A;  2NUT B;  2PVG B;  1BKB A;  5LJ5 d;  1OIU B;  3A8O B;  5IAY A;  3CD6 A;  4C92 A;  4CRL B;  1GBQ A;  1RAG B;  1TU0 B;  1OU8 A;  3OYG A;  5DQV A;  5AT1 B;  1QVF A;  3X26 B;  2QGG A;  3L1A A;  1OU9 A;  3EG2 A;  2HL5 C;  2LX9 A;  4C92 E;  4CFM B;  2QDY B;  4N4I A;  4R56 A;  1H4L D;  2RJF A;  2GBQ A;  3S3O A;  1I8F A;  3I56 A;  2GQV A;  1AWX A;  1O75 A;  4BCG B;  1EFN A;  1X75 C;  2KR3 A;  1X01 A;  1UGQ B;  3GLX A;  1VQM A;  1E6G A;  1N4M A;  2I2L A;  4M77 B;  4A4E A;  2WXV B;  1TUD A;  3FEO A;  3LYI A;  2PZ1 A;  3H0H A;  2J05 A;  2GTO A;  2DK3 A;  5CQX A;  1IHW A;  4F7U B;  1N27 A;  2HL3 A;  3CCM Q;  1NYG A;  3I35 A;  2FB7 A;  4GY5 A;  1WXU A;  2JMA A;  3RBB B;  2V8I A;  3C12 A;  4OB3 B;  3S6W A;  3FJP A;  2JTM A;  3OYH A;  3OYJ A;  3CC4 Q;  4BY7 X;  1RI9 A;  4J9F A;  4KT0 E;  2WEV B;  4A53 A;  4N4H A;  4J6X A;  2DAQ A;  2HSE B;  1H1P B;  4LD6 A;  4M75 D;  1PKD B;  3C4S A;  3QYG B;  1BK2 A;  1OPK A;  1H24 B;  4YOO A;  2QTX A;  3CCS T;  1SRL A;  2KXD A;  5HCK A;  2AK5 A; 
#chains in the Genus database with same CATH homology
 4Z6Y A;  4HA8 A;  3E1S A;  2C06 A;  2WJ9 A;  3JRZ A;  5CKH A;  3OYM A;  2ZPG B;  3HFO A;  3O8V A;  2GFU A;  3CBO A;  2QEX T;  2K5F A;  1KC8 C;  5GAN f;  3CCE T;  3JCM P;  5CVI A;  5GAM g;  1RI0 A;  3CCJ A;  2X4Y A;  2DEQ A;  3M57 A;  2EQU A;  4M78 B;  3BDL A;  2RI5 A;  4E7H A;  4E7J A;  3SB2 A;  4C5I A;  2OTJ A;  5A0L A;  1M90 U;  2JUF A;  3V7S A;  2KK4 A;  3M55 A;  1Y96 B;  5LL6 S;  3HHT B;  4Y28 E;  1Q86 C;  3RKY A;  3ZEH A;  5CIU A;  1Y96 A;  4M78 F;  4QVZ A;  2LCL A;  4PJO A;  4PLL A;  4LDU A;  2XK0 A;  4EDU A;  5I2M A;  3EAE A;  3JCM h;  1KQS S;  4Z02 A;  2E41 A;  3JCM g;  3BFM A;  2YRV A;  2RI2 A;  1VQ8 T;  3OY9 A;  2EJG A;  4N0A A;  1VQP A;  5GMK e;  2JVV A;  2RHI A;  3UDC A;  1VQ9 A;  1G3S A;  3V7R A;  2XU8 A;  4A54 A;  1NJI C;  1K9M C;  2ZPB B;  2K5L A;  1WPY A;  2KQW A;  4NC6 A;  4XU0 A;  4BD3 A;  5A0G A;  3OYF A;  3OYK A;  1B34 B;  5AYF A;  1ZBX A;  4QSH A;  2PVD B;  2KVQ G;  3DB3 A;  1B34 A;  5LJ5 h;  3OMG A;  3CC4 A;  4M75 B;  5LJ5 g;  2F5T X;  1XNI A;  4ZN1 A;  3SWN C;  4M75 A;  5GAO q;  3TU4 K;  1W4S A;  2VXE A;  1UGS B;  3G7Z A;  1YJ9 A;  2DVE A;  3V8L A;  2CZ1 B;  3KHI A;  4BY6 C;  1Q82 U;  2R5M A;  3E9G A;  5J3B A;  1VQ6 A;  4J6W A;  3L2U A;  4M75 F;  4BI3 A;  1BYM A;  2RO0 A;  3GNG A;  3OW2 A;  3MEU A;  1VQ7 A;  3JCM V;  4JX6 A;  3CCV A;  5FRN A;  4LDX A;  1FKM A;  4HNT A;  2DJZ A;  2WSE E;  2B8A A;  2DTO A;  3L2Z A;  4PNO A;  4PJO G;  4RMO A;  1OZ3 A;  1G3Y A;  3OYE A;  1FWZ A;  1KD1 C;  3M54 A;  4M75 E;  2K3Y A;  5GMK l;  1IRE B;  5GAN 3;  4HNU A;  3G4S T;  1RL2 A;  1PSE A;  1VIE A;  4C0G A;  4NOY A;  3M5A A;  3OSS C;  1LNX A;  3CC7 A;  1QVF S;  1YJW T;  2O4X B;  4JX4 A;  2KY9 A;  4L59 A;  2O4X A;  4LDW A;  3ME9 A;  3T9N A;  5A2Q E;  2E6Z A;  3M59 A;  3HFN A;  3P8H A;  4B9X A;  2MWO A;  4EMK C;  4JRP A;  3HSB A;  4FSX A;  5CKD A;  3EFS A;  3X20 B;  4J6Y A;  4J7I A;  2BS4 A;  1VQ5 A;  4M75 G;  2VYT A;  4M7A C;  3H4C A;  2HD0 A;  4L5G A;  4C5G A;  4BBR M;  4J7F A;  5LJ3 j;  1YIJ T;  4C5H A;  1KQ2 A;  5CKB A;  3HP9 A;  5CK9 A;  1FX7 A;  4MIM A;  4ZGJ B;  4MZT A;  4ME7 A;  4BDY A;  3DLL A;  3OMC A;  4RG8 A;  4A4H A;  5D6W A;  3V8K A;  4EPC A;  3VYG B;  2DPP B;  4BBS M;  5DM7 R;  1HK9 A;  3CCR A;  1S72 A;  3OB9 A;  2OAU A;  1G3W A;  2X4X A;  5GAN 6;  1DJ7 B;  2DXU A;  3JCM J;  1Q7Y U;  3FRN A;  2MAM A;  4OF1 A;  5GAM j;  1W2B A;  3LWH A;  3G6E T;  5CAI A;  5GMK j;  4J5Y A;  2L89 A;  2IG0 A;  3M56 A;  4M78 D;  4R55 A;  4IUR A;  3CBM A;  1M1F A;  2LVM A;  1I4K 1;  2CGH A;  4GLK A;  4LOC A;  4JLG A;  4C5E A;  3JB9 I;  4IUV A;  2O01 E;  2Y4Y A;  3VKG A;  2V8K A;  1WNL A;  4ZGE B;  3CPF A;  3PNW C;  2JTF A;  3ZBD A;  4BE2 A;  3H6Z A;  3CCQ A;  1M1K C;  3DL1 A;  3QXE B;  4LD9 K;  1H64 1;  5GAN d;  2HBP A;  3OSV A;  3A8H B;  3MP8 A;  4FIB A;  2ZPH B;  2XD0 A;  3JSC A;  2A7Y A;  4MDW A;  3AHU A;  2OTL T;  4LDY A;  3HRU A;  3QO3 A;  2RA2 A;  2LDM A;  2GF7 A;  4BB7 A;  5GAN e;  2RD1 A;  5HKC A;  1K8A U;  1VIF A;  3WXM B;  2DIG A;  2JN0 A;  1QLB A;  3J80 E;  1N6A A;  1VUB A;  1O9S A;  5LJ3 h;  1LOJ A;  2HNI A;  3M53 A;  1N8R U;  1VQN T;  4O6J A;  4XK8 E;  3VJP A;  3H8Z A;  3LWI A;  4AKG A;  4FU6 A;  3OYB A;  1IZ6 A;  3BG9 A;  1Y71 A;  1QVP A;  1E7P A;  2AHJ B;  3C94 A;  3MCA B;  5IN1 A;  5GAN 5;  2D0Q B;  3RER A;  3TW7 A;  4M77 G;  4FL6 A;  2EJF A;  4XU2 A;  3CCJ T;  3M4G A;  1YJN A;  4AKH A;  2L3R A;  4OP0 A;  3JB9 J;  2Y90 A;  4PL6 A;  5I2S A;  5GAO l;  3FIF A;  5KCH A;  2HQX A;  5GAM h;  1I5L A;  2X4W A;  3UPU A;  2OTJ T;  5GMK h;  2XIC A;  3JB9 G;  1M90 C;  4F7U G;  4C0D C;  3CXC S;  3SDZ A;  4C92 C;  3RUX A;  3OQ5 A;  3MP6 A;  4M78 A;  4Q5W A;  4HKE A;  4CI0 C;  5KE3 A;  4QVD A;  2ZGW A;  4C8Q D;  1YI2 A;  4XU3 A;  1U1S A;  3PMI A;  4E7I A;  2D6F A;  3VUZ A;  1KG1 A;  1Q81 U;  1Y07 A;  2RHX A;  4JLI A;  4QW2 A;  3MO8 A;  3V7C A;  1YBY A;  4N4G A;  3SFM A;  5I21 A;  3CCM T;  3HL8 A;  3HZJ A;  1VQP T;  1K73 U;  3GP8 A;  5DLO A;  1VQ9 T;  2JNG A;  4J8O A;  4PKC C;  2DO3 A;  5DLQ E;  4P5N A;  3JAM E;  2VXF A;  3OA6 A;  4M78 E;  3VKH A;  3CC4 T;  4HT8 A;  4MFE A;  2VUB A;  4JDS A;  5DY9 A;  2RJD A;  1QVG S;  3CCE A;  3J7A F;  3DLM A;  2DXC B;  5EG2 A;  3UWN A;  4ATO A;  3OBW A;  2VGN A;  3V8J A;  2DXC A;  3G71 A;  1KQS A;  1YJ9 T;  2ZPE B;  5GAN 4;  4NL3 A;  4M7D C;  4TVR A;  1Q82 C;  1WJQ A;  4DQ2 A;  2K5I A;  3BY7 A;  1U8R A;  3OYN A;  3CPW S;  3CC2 A;  5EJC A;  1VQ7 T;  2DXB B;  4DA4 A;  4XU1 A;  3PTA A;  3CCV T;  3CD6 T;  4E47 A;  2XDD A;  4A4F A;  2QQ8 A;  3X24 B;  4M78 G;  3PGG A;  5GMK i;  4QQD A;  1UEB A;  2X35 A;  1XTD A;  2XID A;  4M77 C;  2KMT A;  2LC4 A;  1D3B B;  4E7K A;  1VQ8 A;  2BUD A;  5GAN 7;  4JRK A;  3X28 B;  4XTW A;  1M9S A;  3INZ A;  1N9R A;  4C8Q B;  1KHI A;  3LGL A;  2YLC A;  3GNF B;  3M4Y A;  1K9M U;  4C8Q A;  1VQL A;  4V2S A;  2VC8 A;  2PUO B;  4A4G A;  3GIB A;  4DOV A;  2A3L A;  1OZ2 A;  1BIB A;  4C8Q F;  2DZC A;  2R58 A;  3JCM e;  1YIT A;  5M9O A;  5KE2 A;  5GAM f;  2MI6 A;  2HAX A;  4HCC A;  2PQW A;  4XQ3 A;  3I55 T;  5FRO A;  4C92 B;  2FYK A;  5GMK m;  4OMF B;  2RI3 A;  1BI2 A;  3I56 T;  2CZ7 B;  3QYH B;  2KMG A;  2F69 A;  1VQK T;  4C8Q E;  1MHN A;  1OYX A;  3A5Z B;  4NS5 A;  3QZ5 B;  4HCB A;  3A8G B;  2EFI A;  5LJ5 e;  4C92 F;  3CCL T;  4ZTF A;  4HL4 A;  4HT9 A;  3A8M B;  1G3T A;  5GAO n;  3JCM X;  4PLI A;  2MF2 A;  3CCR T;  1VQM T;  1UGP B;  1M8V A;  1S72 T;  2QQ9 A;  3JCM f;  3JCM c;  3KXT A;  3HO8 A;  3URG A;  3G4S A;  3QSU A;  1U1T A;  1Q7Y C;  4ZN3 A;  3PIP A;  2DD5 B;  1KQ1 A;  3L42 A;  3VYG A;  3GPL A;  3QYE A;  4BI8 B;  5C0M A;  3LH0 A;  3MET A;  4XTY A;  4X34 A;  3J81 E;  3NFC A;  4KUD K;  4M7A D;  2QQB A;  1YJW A;  5FU7 C;  4Y91 A;  4C8Q G;  5GAN g;  4JRI A;  1QW1 A;  4M7D B;  5LJ5 f;  4MZM A;  3SWN B;  5GAO p;  3CME A;  3CCQ T;  1M1G A;  2F5K A;  3SWN A;  2R5A A;  4ZGD B;  5KH6 A;  3VV0 A;  4BY6 B;  1W2B S;  3HPW A;  4XTV A;  3ER0 A;  2EJ9 A;  5J39 A;  4MDX A;  4M7D F;  3QYB A;  2M1H A;  3NTH A;  2LRQ A;  1JJ2 A;  1XQH A;  2EQK A;  4DOW A;  5GAO r;  4PJO C;  3CCU T;  1BI0 A;  4BAC A;  2RH2 A;  1K8A C;  3QWL A;  2LQ8 A;  2QA4 A;  1NPR A;  3OYI A;  1YHQ T;  4IUP A;  5CKE A;  2QQS A;  3HB9 A;  2QXF A;  2PU9 B;  1WGS A;  3FB9 A;  3Q1J A;  2DXT A;  2RHU A;  4QVC A;  5HK3 A;  2RB6 A;  4N0A C;  4OVA A;  3CMA A;  4JS4 A;  1VQO T;  4YTL A;  3FDR A;  1N8R C;  3DKM A;  2DTI A;  3RMS A;  3MHX A;  3SD4 A;  3KBG A;  5CR2 A;  5GAN 8;  4IUU A;  2KAF A;  3ASK A;  2XI9 A;  3G71 T;  1YJN T;  4FM4 B;  2P4T A;  3GOX A;  2ZPI B;  5A0D A;  3QHS A;  5FU6 C;  4L6V 5;  2LT4 A;  2RM4 A;  4M75 C;  3M58 A;  4CRI A;  1NZ9 A;  1PSF A;  3TCJ A;  4EMK B;  2EQM A;  4ZTJ A;  3HBL A;  2QQA A;  4O5V A;  2FHD A;  2P0K A;  4EMK A;  4M7A B;  3S3N A;  3LW5 E;  3RKW A;  2K57 A;  4M7A A;  3QII A;  2ZCF B;  1YI2 T;  4OGC A;  2L5Q A;  4RCC A;  4UC4 A;  2NLU A;  3KUF A;  5HY6 A;  1BI3 A;  3UT1 A;  1Q81 C;  1H3Z A;  1ZHI A;  4BDZ A;  2E70 A;  1UB4 A;  2XKO C;  3TW6 A;  2CZ6 B;  4M7A F;  2HQE A;  4QQG A;  2EYQ A;  1JBM A;  3WVD B;  3WVE B;  2RK2 A;  2VGM A;  1WJR A;  4J83 A;  3JCM b;  1K73 C;  1ZQ1 A;  4HCZ A;  5GAO m;  1KC8 U;  3QG1 A;  1VQN A;  2E6N A;  3C95 A;  1R8O B;  1BI1 A;  1QP2 A;  2E65 A;  1MGQ A;  2XDP A;  3EFR A;  1WJS A;  3CXC A;  1FXX A;  2D9T A;  3QZ9 B;  4C0F A;  4IKF A;  3QDR B;  5FU7 B;  4M7A E;  5LJ3 d;  3L2W A;  4C92 D;  3CCS A;  1WQ7 A;  3PFS A;  1VQ4 A;  3CBP A;  3TEE A;  3OYC A;  3OBY A;  2QEX A;  2M16 A;  3QUI A;  3JCM Q;  2DKG A;  3E19 A;  3A8L B;  4KBM B;  4RKU E;  2BKD N;  4XTX A;  2KDS A;  5CCA A;  2E5Q A;  4HLQ A;  3MEV A;  3JCM W;  2RHY A;  3NTI A;  5LJ3 e;  2LT1 A;  3CC2 T;  2QF7 A;  1VQ6 T;  4JS5 A;  2WSF E;  4PJO B;  3F70 A;  3L2R A;  3DB4 A;  5GAM d;  2X4J A;  4D6W A;  1SSF A;  4OB0 B;  4MZP A;  2IVW A;  4BUG A;  2Y4X A;  4X9D A;  3PMT A;  1QVG A;  1NPP A;  2JOY A;  1QP3 A;  1P92 A;  1Q86 U;  4M7A G;  2DIQ A;  4PJO F;  4BE0 A;  4WF2 A;  3MP1 A;  2DXB A;  4ELY C;  4OGE A;  2LCC A;  2QI2 A;  1JRI A;  2CKK A;  3BDU A;  5GAM e;  3BG5 A;  5D6X A;  3CCM A;  4HNV A;  4XTU A;  2BS2 A;  4OB2 B;  3PT9 A;  2KSS A;  5GAN j;  3HKS A;  3CPW A;  5LJ3 f;  4M7D D;  2V8J A;  4EMH A;  1VQL T;  1M4Z A;  1XOV A;  3X25 B;  1D3B A;  2QQR A;  3PIO A;  4OB1 B;  3MEW A;  3OW2 S;  3JCM d;  4PJO E;  5FU6 B;  1NJI U;  2KR6 A;  5CQY A;  3CC7 T;  3OS1 A;  2G77 A;  2DZ9 A;  3L2V A;  2WAC A;  1YIT T;  2FL7 A;  2CS7 A;  2EKO A;  2G3R A;  4XAX B;  5HK0 A;  1BIA A;  2EAY A;  1YCY A;  2WSC E;  2PVG B;  1Y7X A;  4MML A;  2BIV A;  4RG2 A;  3L2Q A;  1BKB A;  4X9C A;  4C0D B;  4M77 D;  1VQ5 T;  1KHC A;  2XG8 D;  2EQJ A;  4KUL A;  3A8O B;  5IAY A;  5LJ5 d;  4MMK A;  1G5V A;  4E7L A;  2PUK B;  2YHT A;  3CD6 A;  4C92 A;  2JZ2 A;  5FRM A;  3OYA A;  3R6O A;  5C6S A;  2XHC A;  2E1H A;  2K2V A;  5CO7 A;  2R57 A;  3OYG A;  5IT9 E;  3JB9 D;  1QVF A;  4ELJ A;  3OYY A;  1KD1 U;  3X26 B;  4B9W A;  3VU3 C;  3L1A A;  1M5Q 1;  2LQK A;  3LLR A;  2QDJ A;  1NE8 A;  2RK1 A;  3P8D A;  2LX9 A;  3OS0 A;  3M9Q A;  3ZFJ A;  3VYH B;  4JJN K;  1TH7 A;  4C92 E;  2YLB A;  2QDY B;  4LDV A;  2DD5 A;  4N4I A;  4R56 A;  2ZPF B;  4VUB A;  3QPH A;  3CME T;  3GF5 A;  4IUQ A;  3QKJ A;  4XTZ A;  3RIR A;  2RJF A;  5GAN h;  3FC3 A;  3P8B B;  4AKI A;  3I55 A;  3S3O A;  1I8F A;  2E12 A;  2PVO B;  3OYL A;  4M7D A;  2DTH A;  3I56 A;  2K4Y A;  4M78 C;  2GQV A;  1O75 A;  1VQK A;  1I81 A;  1N9S A;  3BW1 A;  3BG3 A;  2H3J A;  4KUI A;  2QA4 T;  1V29 B;  2K3X A;  4IUT A;  2GCX A;  3CEY A;  1X75 C;  3CCL A;  3S3M A;  1X01 A;  5CKF A;  1UGQ B;  3GLX A;  1JB0 E;  1YIJ A;  3NTK A;  2QFZ A;  4MFD A;  4M6V A;  3QJY A;  4C92 G;  3OS2 A;  1VQM A;  3OYD A;  2E10 A;  3CMA T;  2I2L A;  3E9F A;  4M77 B;  4A4E A;  2FVU A;  2RJC A;  3FEO A;  3LYI A;  4M77 A;  2CYZ B;  4QQ6 A;  4M7D E;  2MMP A;  1JJ2 S;  3HRS A;  2MWP A;  2EWN A;  2M9U A;  4JX5 A;  3QBY A;  1HXD A;  4JRQ A;  2DK3 A;  3MEA A;  3LX7 A;  4FT4 A;  4M77 F;  5CQX A;  5J26 A;  3RKX A;  4F7U B;  1N27 A;  3LGF A;  2LTO A;  2ZZD B;  3G6E A;  4FT2 A;  4RCB A;  3RMQ A;  4F7U A;  4PJO D;  2M0O A;  2XDB A;  2ZZD A;  3HRT A;  3VKI A;  2RHZ A;  2BS3 A;  2FB7 A;  4GY5 A;  4NL2 A;  5L8R E;  2CZ0 B;  4C0Z A;  2P0P A;  3JB9 F;  3OS5 A;  2P0Q A;  2V8I A;  3C12 A;  3TRE A;  4AI6 A;  3QJ6 A;  4M77 E;  4F7U F;  3JB9 H;  4OB3 B;  3S6W A;  3FJP A;  3FLG A;  1M1K U;  4BE1 A;  2JTM A;  4ELZ C;  3OYH A;  3OYJ A;  3CCU A;  4KT0 E;  4M7D G;  1AHJ B;  4A53 A;  5FLX E;  2DD4 B;  1OI1 A;  2EIF A;  2LNV A;  4N4H A;  1YHQ A;  4A4K A;  5GAN 2;  4J6X A;  2RJE A;  2DD4 A;  2GFA A;  1EIF A;  2VV5 A;  4F7U E;  2OTL A;  5D6Y A;  2DAQ A;  1WQW A;  4II1 A;  4JUV A;  1LJO A;  5LJ3 g;  4M75 D;  3N5B B;  4LD6 A;  4EMG A;  4BI4 A;  5LJ5 j;  1VQO A;  3C4S A;  3QYG B;  1UGR B;  3RES A;  4C8Q C;  1GXI E;  2QTX A;  2E64 A;  3VUB A;  2L8D A;  5KCO A;  1X6O A;  3CCS T;  1VQ4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...