4FM4B

Wild type fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPAKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title The Fe-type nitrile hydratase from Comamonas testosteroni Ni1 does not require an activator accessory protein for expression in Escherichia coli.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4fm4B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fm4B02
2WSFE 4RKUE 3X25B 2CZ0B 1QP3A 1IREB 2ZPGB 2ZZDB 3QZ5B 4ZGJB 3X26B 2QDYB 2WSEE 4OB2B 2PVOB 3WVEB 3X20B 3A8OB 3X24B 2ZZDA 4FM4B 3A8HB 2ZPEB 2CZ6B 2DPPB 3WVDB 1UGPB 1UGSB 3QYGB 2PUKB 1JB0E 2DXCA 2O01E 1UGQB 4ZGDB 3VYHB 2CZ7B 3HHTB 4ZGEB 2DXBB 2DD5B 3A8MB 2ZCFB 3A8GB 1V29B 2PU9B 5L8RE 2DXCB 1GXIE 1AHJB 1UGRB 3X28B 4KT0E 2DXBA 2DD5A 2ZPHB 1QP2A 3VYGB 2ZPIB 1PSFA 1PSEA 4OB0B 4OB1B 3QYHB 3A8LB 3QXEB 2PUOB 3VYGA 2PVDB 2D0QB 2CZ1B 4OB3B 2AHJB 2DD4B 1DJ7B 2PVGB 4L6V5 3QZ9B 2ZPFB 2WSCE 2ZPBB 4Y28E 2CYZB 2DD4A 3LW5E 4XK8E
chains in the Genus database with same CATH superfamily
4YOZA 2ECZA 1Q86C 4J5YA 4PKCC 4RTUA 5GAMg 4QVCA 2LDMA 4HKEA 3I5RA 4JUVA 1YITA 4UC4A 3SWNC 4Z89A 4FX3B 1H3HA 1BI3A 4ELLA 2XK0A 2ZZDB 4QVZA 2GCXA 1M1FA 4ZNXA 3OW2A 1G83A 1T0HA 4ROCA 2VASA 1OULA 4LE9A 4M7AE 1VQ6Q 2FG0A 3CBOA 4M78F 4WCIA 5A0DA 3THKA 2CP7A 2PMIB 2CT4A 4F6WB 3FJ5A 3NTHA 4BCIB 3BLHB 2V1QA 2A36A 2KXDA 3E2UA 1VQ5A 3NPFA 5GAOl 1RAIB 3DDPB 4J9IA 2HBPA 2K7AA 1X2QA 1M1GA 2GTJA 3DLLA 2F1LA 1S72A 2BUDA 2XHCA 1FWZA 1IRXA 2C0TA 2QEXT 3QYEA 1PRMC 4AKHA 3GF5A 4PJOF 4JZ4A 3HFOA 2O4XA 2Y90A 3V7SA 1JO8A 4L5GA 3DB3A 1TFBA 3BG9A 5CO7A 4BY6B 1IXDA 2P0KA 2RO0A 4KBMB 4M77F 1ZSGA 4CC7A 5CKFA 1N9RA 1QQJA 1I1JA 5KCOA 5J39A 4C8QD 1W98B 1EZZB 1OI1A 4C8QG 2R5MA 2JMAA 2BKZB 3I56Q 4C92F 3VU3C 3M59A 4OB3B 3JAME 1LNXA 3G4SQ 3CC4Q 3G71Q 1WNLA 2DBMA 2JMCA 3TNHB 2F2VA 4XTZA 2XKOC 2LNHB 4J83A 2RJFA 3ZL7C 2P4RA 3I55T 4AKGA 1RAFB 1UTIA 1Q82U 2IW6B 1NEGA 2CZ0B 1HSQA 3MY1B 4IKFA 1M9SA 1T3LA 1XOVA 4J9GA 3DKMA 4ANJA 1IREB 4XU1A 3RGFB 2AZSA 2C6TB 1QWFA 3OBWA 1TWBA 5HK3A 5CQXA 1Q86R 2C0OA 2X1NB 1UB4A 3OYGA 1ZSZA 2AT1B 3RMQA 4KUIA 3WVEB 3CBPA 5HBJB 1K9AA 1UGVA 3A8OB 2JTMA 3GNFB 2W96A 2RI5A 1YI2Q 1H24B 4MFDA 3BLQB 4FSSA 2BZXA 5GAOm 2YWWA 4RG8A 5CKEA 2MIOA 3POMA 2DRMA 5LJ3g 5IHNA 2C06A 1OX9A 1KIKA 3RKXA 2BPMB 1SRLA 4HA8A 2KI7A 3VYHB 4M7AD 1JBMA 3QKJA 4M7AG 3BY7A 2ZCFB 1VUBA 5KCHA 2HQXA 4JJBA 2PU9B 8AT1B 5GAN2 2CGHA 3CPWP 2RQUA 4FW1A 3RMSA 3X28B 1GUXA 2PHGA 1WA7A 2LQNA 3CCQA 2HSEB 2CJMB 5FU6C 5KE3A 3G4ST 2C5NB 1M5Q1 1QCNA 1G3SA 2WIPB 3JCMQ 4EOOB 3VYGB 5GAOr 3JCMh 5LJ3j 4QKUA 3LH5A 3H0FA 1VQ4Q 2BTTA 2C4GB 4M75E 4F14A 5D6WA 1M3BA 3CCLQ 1TU0B 2YHTA 2XMFA 3M0SA 2JGZB 2PVDB 4C8QA 1NYFA 4JDSA 1GCPA 4OGEA 1ZUUA 1H1RB 2K3BA 5FLXE 4X1VA 2CT3A 2HKNA 3TCJA 1RAGB 1G8XA 2W0ZA 2GQVA 4HCKA 1K9MU 2VUBA 1YI2T 1D1BA 1W1FA 4RTYA 2NWMA 2RQWA 2D0NA 1KQSP 5LJ3d 5J3BA 1KQ1A 3PE0A 1OKVB 4AG2C 3R6OA 3OYAA 2BKDN 3EGXB 3TREA 2DVEA 1JU5C 2M0YA 3GTMS 1R0CB 1BBZA 1G5VA 3H8ZA 3L42A 4AFQC 3OB9A 4LDWA 2KAFA 2PVOB 5GAOn 1KJWA 2DIGA 2OAWA 2G9XB 2JTFA 2ABLA 2MI6A 3SFMA 3E1SA 4J7IA 5EG2A 2RHYA 1WHKA 4CFUD 2LX9A 1YFNA 5KYUA 3VRYA 4KRDB 1EFNA 4YOSA 3FLGA 3VUBA 1H25B 2BS4A 3PMIA 1JEGA 1UGQB 1RACB 5A2QE 2J6FA 1VQ4T 4DBFA 4M7AA 4FT2A 3CCLT 3NDQA 2YLBA 1YIJQ 3OW2S 2WEVB 2MCNA 3CQTA 4J9DA 2BS3A 2KNBB 2JZ2A 1IO6A 4EOJB 1RABB 2CUDA 3DB4A 2KBTA 3OYDA 4KT0E 2VV5A 1VINA 3RKYA 1SSFA 5LJ5h 1ZBXA 4JJDA 1K1ZA 1RLPC 2W99A 4EMKC 4AFUC 1N9SA 1ZQ1A 3CCJQ 2FHDA 3LGLA 3QYBA 2QQAA 1FX7A 4D6WA 2HQHA 3SDZA 4QT7A 1VQKQ 2PTKA 3HSBA 2LP5A 1PG5B 1PKSA 2BZYA 1K4US 2HL5C 4GY5A 5GANe 1VQPQ 1D0YA 1CKAA 2EVRA 2R58A 4OR5B 2KROA 5KYNA 1PD1A 2HCKA 3JCMe 2A7YA 1QMZB 3J81E 2V22B 2COZA 2OTLQ 1I0CA 2X3XD 3BHVB 2EFIA 2CP0A 3JSCA 5C0MA 2HMAA 2D9TA 5ICPB 2DETA 4BCNB 5GAN6 4B9XA 3MKDA 2DD4A 3RBBB 2LJ3A 2XDDA 2FPEA 1AZGB 4K11A 1I5LA 4LUDA 3CCUT 1MV3A 4KGXB 1W2BP 1JSUB 2QYZA 3CCST 1NM7A 2LCLA 2KEAA 4BI3A 5LJ3f 4BBRM 1Y0MA 1D3BB 2X4JA 5GMKl 2QK0A 5GAN5 1JJ2A 3CMAA 3AHUA 2R5AA 5DQVA 2DL7A 1KD1U 4EMKB 3OSSC 1TUGB 2LTOA 1XO2A 2ZPEB 1OOTA 2QGFB 4JX6A 3OYIA 2G3RA 2CZ6B 4OMQA 2E70A 4E7LA 5L2WB 1Y96B 3I35A 2PQWA 2RI2A 4WTOB 4HLQA 3ULRB 2ZGWA 1KHIA 1MGQA 3KUFA 2EYXA 2W9ZA 4XTUA 4DBQA 4HNUA 1BU1A 1UUEA 3M58A 2O9SA 2YUPA 1VQKT 4BCMB 1HXDA 5IDPB 2M0OA 1X27A 1M3AA 1P92A 4EC8B 3V7RA 1WHGA 2KYMA 2GFAA 3VUZA 2YUQA 3P8HA 3G6EQ 2WMAB 4BCQB 2DD5A 1WJRA 2L3SA 1ZLMA 1YJWA 2JUFA 1WXUA 4IUUA 2L8DA 4F7UB 4HXJA 2CUBA 5FGKB 4J9BA 1OX8A 4BBSM 2BS2A 3LQ5B 3HZJA 4OB1B 3V7CA 3JCMb 3QJ6A 4F7SB 1Z9QA 3VKGA 1YJ9A 2RB6A 1HD3A 1PKDB 5IN1A 1RLQC 3HB9A 3C94A 1H1SB 2F5KA 1B7TA 2QXFA 2ROTA 2AHJB 1QVGA 1WXBA 4RTVA 4PFPA 2KT8A 4E6RA 4LDXA 3JCMP 5D6YA 1TUDA 2V8JA 1VQ7T 1VYUA 3QWXX 4TTHA 4LD9K 4HCBA 1PHTA 3OYHA 1NJIU 3PO3S 4RG2A 2VXFA 1AWXA 3SHWA 3T9NA 4M75A 5HBEB 2M9UA 3O8VA 1G3YA 2L2PA 1WHHA 3OYFA 4F7UG 1QLBA 1TSFA 2RD1A 5D7UA 1WLPB 4YC3B 3LYIA 3JCMc 2PNIA 3GLXA 4A4KA 1AWWA 1BK2A 5IDNB 1P5EB 3OYLA 1M4ZA 3X26B 2V26A 5I5ZB 4IUQA 5ECAA 4IIMA 1QCFA 3CXCA 1PCXA 1QW1A 1K73U 4C5EA 2DM1A 5HK0A 2MOXA 2IN3A 3GPLA 2PK2A 2A0FB 1U1TA 4JS4A 2DAQA 4M4ZA 1GL5A 2KRSA 5L23A 2E4HA 2KSSA 4QSHA 1X01A 2B8AA 2EJFA 2K4YA 4M77B 4DEYA 2QGGA 3JB9J 4M7DE 1O9KB 1O75A 1OV3A 3VS3A 1VQ8Q 1VQLT 3CBMA 3VV0A 2RHZA 3HHTB 4ATOA 2LQKA 2O4XB 2JN0A 4CC4B 2OTJT 2QGSA 2P4TA 2XI9A 1Q86U 2L0AA 1V29B 2WHBB 3CC7T 4CRLB 3DLMA 1H4LD 2QDJA 2ZAEA 1GCQA 3QWLA 2A08A 2K3YA 3CMEQ 3LH0A 1VQMT 1Z9ZA 2P0QA 4X9CA 1PKTA 4HT8A 1TOVA 3EFSA 1X43A 4XU0A 4MFEA 5GJVB 4G6LB 2RNAA 1H27B 2IVXA 4FW2A 2YUOA 3V8LA 3TSWA 2UZBB 3M0TA 1PSFA 4QQGA 2VWFA 4PK4A 7AT1B 1OKWB 1K76A 2RA2A 5GAOp 4MMKA 2K2MA 1AEYA 2HEQA 2KMGA 3TSZA 4AFZC 4HVUA 2FRYA 3ZBDA 1M90C 1KXUA 2UZDB 2VGNA 4RTTA 4EDUA 3MP1A 3L2RA 3CCVA 2DEUA 1VQNA 3RERA 4PL6A 1XJWB 2QDLA 5GANg 1OU8A 3M0RA 3OYYA 4IUPA 1YHQA 3Q1JA 3QPHA 3CCMA 4C0DC 1X6GA 4CFWB 3VS1A 1YITQ 1U5SA 4DBHA 4HCZA 2A28A 4RKUE 3M9QA 2IG0A 4OMPA 2H3JA 1ZSZB 1QP3A 2KRNA 3RR6A 2F69A 5CKHA 2DEQA 1VQ8T 3EH2A 3QHSA 2GGRA 5I21A 2EUFA 1M8VA 2IW9B 4J9CA 2EQMA 5GANj 1IHWA 1VQ5Q 3X24B 3QDFA 1YBYA 1F5QB 2E64A 4XAXB 3CMET 3REBB 4F7UF 1S72Q 2OAUA 3EGDB 2RF0A 4AMCA 3NGPA 3HTRA 5CVIA 2DKGA 3L1AA 2KXCA 2E65A 1VQOT 1GUXB 2HBWA 2JS0A 1PNJA 2O9VA 3MHXA 3H4CA 1SEMA 2VKNA 2PJQA 1JJ2S 4YTLA 3JCMX 2JNGA 1BI2A 4C0DB 3VJPA 2I0NA 5GANd 4HL4A 4RODA 2W2HA 2F5TX 2R57A 4C8QB 4J9HA 2CP6A 1VQ9T 3JCMd 4EOQB 2X35A 4RCBA 1YITT 4PLIA 4M7AC 2KGTA 1U3OA 2J06A 2W10A 2KY9A 3SB2A 3QJYA 4KRCB 4DBRA 3TQ7P 1D09B 4C5GA 3EG9A 3F5XB 2PVGB 4N4GA 1N8RC 1RAAB 1OGUB 4OGRB 3CCEA 3TEEA 1KC8C 3SWNB 3CD6T 2L3RA 1VYVA 4TVRA 1VQ5T 4CC3A 3UA7A 2YUNA 4ELYC 1M90R 4QW2A 3V8KA 3FDRA 2LW4A 3EG2A 3I55A 1KSWA 3TU4K 2HKQB 1GBRA 2F2CA 3MPUB 5KYUB 4JRKA 1VQ6T 2FZCB 1QVGS 1MMGA 1VYTA 1XTDA 3MCAB 5AYFA 4BACA 1C6VX 5LJ5j 3A8HB 2D6FA 1U8RA 2AIRB 4XQ3A 2DXUA 1NBEB 2MAMA 5FWBA 4M7AB 3EFRA 4J6YA 2DL3A 1QMCA 4OMOA 3EFOA 1KK7A 2EJ9A 2DL8A 4C0FA 4CRIA 2X4WA 5C6SA 1G2BA 3DDQB 3CPFA 1AOJA 2NYSA 3A8MB 4R56A 3MY5B 3CCQQ 1FMWA 2UZLB 3PMTA 2O31A 3CXCS 3WXMB 4LD6A 1RUWA 2QI2A 3M4YA 1QCOA 2X3WD 4RMOA 2XG8D 4EOKB 1LPLA 1D3UB 5LL6S 4M7DA 5LJ5d 3S3NA 1LVKA 1G3WA 1W70A 4E2FB 1RADB 1E7PA 2RMOA 3DTOA 1X6OA 8ATCB 5GANf 3RNJA 1TD6A 2FRWA 2EAYA 4IUTA 4NC6A 2WXVB 1WZOA 3I56T 3JCMf 3HP9A 1MV0B 1VOMA 2EYZA 1W6XA 1ZBJA 2D8HA 2DD4B 3CC4T 3G71T 2A37A 2DZ9A 2E12A 3CC2Q 2JT4A 2MF2A 1UNGD 1FKMA 1FINB 2QAZA 3OQ5A 2DTHA 2YSQA 4Z6YA 4DEXA 5KYYA 2DFUA 1ZHIA 4GLKA 2HL3A 2CSIA 1EX4A 4EOSB 4XK8E 4LN2A 2EGAA 1N8RR 3PIPA 1NLPC 3FJPA 1X75C 2A3LA 1JXOA 1KC8R 1AISB 4FYXB 3HFNA 3NTKA 3QZ5B 4JPBW 2QDYB 2AK5A 3GBQA 2B86A 5DLQE 4BCGB 1Y07A 2CKKA 5AT1B 1C0MA 2RJDA 3X20B 4CFUB 3CC2A 4RUGA 2MK5A 1Q82C 4M75C 1ZP2A 3BHUB 2YXYA 2X51A 2X4YA 2C5XB 3G1JA 3PNWC 4C8QF 1UGSB 4Y72B 3OW2P 5IXFA 1UDLA 2CZ7B 5GAMh 1ZA1B 3MO8A 2COYA 1I8FA 2RJCA 3OS5A 1H641 5FU6B 5DM7R 3QSUA 2DD5B 2MPXC 1RL2A 4N4IA 2LJ1A 2WMBB 1M2VB 2DTIA 3UA6A 5KYWB 4J6WA 1F1BB 2VC8A 4MIMA 3CCRA 1OZ2A 1QP2A 1BI1A 3EGUA 2CREA 3BG5A 4E7HA 2C5VB 2JM8A 4KGZB 3M5AA 5HBHB 2ESWA 3E19A 4E7ZA 5LJ5f 4II1A 1BIAA 4E7SA 4NL3A 4FYVB 1GFCA 1NYGA 3GIBA 2WPAB 1AD6A 2D0QB 1BIBA 3LX7A 1GCQC 2D8JA 3L2QA 2NUTB 1BCMA 4M75B 2FB7A 4JZ3A 2ZPFB 5BNJB 2RHIA 1NEBA 2CYZB 1MMNA 4EPCA 4M7AF 1U06A 2ROLA 1CKBA 1QVFA 1JKWA 2M02A 3I5SA 2HSPA 4A4FA 3OA6A 4EC9B 1H26B 4PNOA 1N5ZA 4FCYA 3C4SA 3LLRA 5GAN7 4XTWA 2IW8B 1I4K1 3EG0A 3CMAQ 3CCUA 4BCKB 1MNEA 1K9MC 2WFYB 2WSEE 2QQSA 3H6ZA 3EG1A 4LNPA 1MMAA 1E7OA 4LUEA 3CCSA 1EIFA 4M75D 4M75G 2XD0A 5KE2A 2EYQA 1WIEA 2WJ9A 2CSQA 1IGUA 3NHNA 4LDUA 5GMKh 4J9FA 2LX7A 2HD0A 5IHIA 1WQ7A 2DJQA 4R55A 3QHRB 4M78E 1FVVB 4BD3A 1KFZA 2LRQA 4GLMA 3HKSA 2ED0A 2EQKA 4LDYA 1QWEA 3L2WA 1YIJT 4NSTB 3EHRA 1PC0A 1YJWQ 4ORZA 2DXCB 1GXIE 3TW7A 1Q7YC 1UGRB 2KR6A 1I07A 1VA7A 2DXBA 2ZPHB 5GAMe 3H0HA 4Q5WA 3PFSA 2YRCA 9ATCB 3CCJT 1K8AC 4YOOA 2JM9A 4KUDK 1YJ9Q 4C5IA 4M78C 4EOIB 3QYHB 2PUOB 4ME7A 4PJOE 4BCOB 5LJ3h 4IIOA 3PGGA 2HDAA 1VQPT 2QA4A 3A1PA 1Q81C 2SRCA 4IURA 5I22A 4L6V5 2DO3A 1E6HA 2OTLT 5D6XA 1MHNA 4D8KA 4CFVB 3S6WA 2MWPA 3MP8A 4NL2A 3EJ1B 3EH1A 4LOCA 1OIYB 4C92E 2WSFE 1VQ7A 2RK1A 3J80E 5GAN3 3KHIA 1OYXA 3QG1A 2EYWA 4EONB 4NOYA 2JJ9A 4F16A 4PJOC 2PK9B 5LJ5e 4KULA 4FSXA 3E9FA 2I53A 1Y57A 2RQVA 3EAEA 4OB2B 2KR3A 4QQDA 1WYXA 2EKHA 1OU9A 4XU2A 5A0LA 4JLIA 1JXMA 2J7IA 3FC3A 2GF7A 2GBQA 2I2LA 1GH6B 1OL2B 4Z8AA 3WVDB 2DK3A 2WACA 1K9MR 3ZFJA 4X34A 1UGPB 1QLYA 2XIDA 1X2KA 5GJWB 1WDXA 4OMLA 1M90U 3JB9D 2EBPA 3JB9G 2EWNA 5GMKm 3FB9A 1OIUB 1W4SA 3JV3A 1TS9A 3VS4A 1VQLA 1H8KA 1KD1C 4ROEA 5KYXA 4M75F 1RI9A 4BE2A 2OTJA 3G6ET 3IQLA 1XQHA 5EC7A 1YN8A 3EOCB 1NLOC 3OY9A 4BCJB 4M78D 1VQMA 2DILA 1Q7YR 1YJNA 2DA9A 4M78G 3QIIA 1PSEA 4ZN3A 2GTOA 5CR2A 3EG9B 2DYBA 3DL1A 4CI0C 5LQFB 1UNHD 1TUCA 3VS6A 4F7JB 2DERA 3CCVQ 2MWOA 1K8AR 1UE9A 1VQNQ 2LCSA 1UNLD 3MI9B 2YRDA 2CZ1B 1AVZC 1HK9A 1YHQQ 4JX5A 2IPOB 2K5LA 2O2OA 4M7DC 4QVDA 3M54A 3CCMQ 3GNGA 4FYWB 1SG5A 2FL7A 4N4HA 1Q81R 5CEIB 2ATCB 4Y28E 1H92A 2HAXA 1YCYA 1BB9A 2CP2A 4PJOD 3GOXA 2DVJA 3OSVA 4PJOG 3BHTB 3HRTA 5DY9A 1NZ9A 4F17A 5J26A 5HCKA 5HKCA 4BI4A 1SKUB 2E3IA 4BCFB 1SF9A 3P8DA 4MZMA 6AT1B 1N4MA 1ZUYA 3ME9A 3B57A 1ENWA 1JSTB 2W9FA 4EORB 2DMEA 2DL5A 4CFMB 1TXQA 1NJIC 4CFXB 3EFOB 1JRIA 1WJSA 3JCMg 3UWNA 4C92D 2KQWA 5EJCA 3TNIB 4C92G 4I3ZB 2FVUA 2UUEB 4II5B 2EGCA 3CPWA 3QYGB 1JQQA 2RJEA 2LQ8A 1PWTA 1QVFS 2FYKA 2BE9B 3KBGA 1JJ2P 1K73C 2PZ1A 3FIFA 2LJ0A 3HBLA 4JS5A 4Z88A 4M7DB 4HNTA 2JW4A 5GAN8 2QQBA 5A0GA 4XTYA 1WX6A 1WPYA 1VIFA 4HCCA 2MYSA 3M4GA 3R6NA 2VXEA 1KD1R 1H1QB 2J05A 2F2XA 2V8IA 5ACBA 2KMTA 3H41A 3JB9F 3URGA 2LQWA 1JOWA 5FRMA 2ZPIB 1Y71A 2CP5A 2CCHB 4M78A 1SRMA 1QVPA 2DL4A 3QXEB 1UG1A 2DF6A 3MEAA 2QASA 1VQ9A 4BY6C 3F70A 4DOVA 2JXBA 4BE0A 5I2MA 2K9GA 5KYYB 2QEXA 1KQSA 3KFVA 3CCEQ 1NG2A 4M7DD 1M27C 4M7DG 1VYWB 3UT1A 2Y4YA 1Q95G 2DMOA 2RQRA 4A4GA 5CCAA 3DJBA 3NMZC 2DE0X 3VS5A 3PVQA 2ENMA 3G33B 2QG9B 4A53A 3OYMA 3I55Q 4JJNK 1BCOA 3M0UA 3CD6A 4E7IA 4PJOA 2B9RA 1QVGP 3OYNA 4Y92A 3PIOA 5GAMj 1M1KC 1RI0A 4BCPB 2I40B 5IAYA 3VS2A 4EOMB 1WXTA 1R8OB 2VVKA 4CC2A 1V1CA 2JTEA 4ZN1A 4M77A 5FW9A 1O9KA 4FU6A 5LJ5g 1GFDA 1UEBA 3EG3A 5I11A 3QDRB 1OPKA 1BI0A 2E6NA 2FO0A 4HNVA 1ABOA 4MZPA 2FZKB 2KRMA 1VQ6A 3QO3A 4C92A 2YT6A 4OGCA 3QBYA 2O88A 1LCKA 1S72T 4PFOA 1ZX6A 3RIRA 4AFSC 1NJIR 3ZEHA 3CXCP 1JB0E 1R77A 1K0XA 2EYYA 3LGFA 4LDVA 4ZGEB 2YDLA 5GAMd 4B6MA 3L2ZA 3UPUA 1J3TA 4BCHB 2P84A 4XTVA 3BLRB 4JRIA 2LMJA 4EMHA 2RHXA 1SHFA 2EKOA 3D7SB 3RDVA 1K73R 4AKIA 3C95A 3CCET 1XNIA 4E47A 2CCIB 1YCSB 4BDZA 3TW6A 1HJDA 2H3EB 4JJCA 3G7ZA 3GP8A 5DLOA 3V8JA 2AKLA 2GNCA 2C5OB 2EJGA 2L3QA 3QWYA 2J6OA 4IUVA 3SEMA 5HVYB 3MEUA 4RCCA 4D8DA 3HPWA 4AG1C 1UJYA 2KDSA 2E5KA 2C0IA 3I56A 3QZ9B 3JCMJ 3A98A 2YRVA 1W2BA 2ZPBB 3G4SA 3CC4A 3G71A 2RHUA 1B34A 5GMKj 4F6UB 2RM4A 4WF2A 1A0NB 4KRTA 4RTZA 1PRLC 2KT1A 4PJLA 1RAHB 3OYKA 2L89A 4OVAA 1SSHA 2EGEA 3VS7A 2G77A 1H28B 2ED1A 2NUPA 1QKWA 2E6ZA 4M7DF 3C0CA 2VYTA 4BE1A 1PD0A 2LT4A 3O0GD 2EQUA 5EFQB 3S3OA 4KH0B 1URCB 5FROA 1ACMB 3EGDA 1M1KR 5CQYA 2KVQG 1D0XA 2X4XA 3L2UA 1OEBA 2ZZDA 1WHMA 3H9NA 1X6BA 3VKIA 2KYBA 2NUZA 4Y91A 2M1HA 4ZTJA 4XTXA 2RN8A 3K7AM 3VRZA 1YI2A 5GANh 1FMKA 4OMMA 2PUKB 2RQTA 1SPKA 2O01E 4J6XA 4J8OA 4MDWA 4ZGDB 1OZ3A 1S1NA 2LVMA 2QQRA 2D1XA 5IH2A 2DXBB 3CCQT 4FL6A 2J6KA 4V2SA 2E1HA 2VB6A 1O9SA 2L3PA 2F2WA 3CCRQ 3A5ZB 3RKWA 3KXTA 1AHJB 4EMGA 1CSKA 5IHKA 1GBQA 5GAMf 3META 1B3QA 4XU3A 3JRZA 4BI8B 3REAB 4OMFB 1KQ2A 2JVVA 4BXXX 2DJZA 4N0AA 1IGQA 1TH7A 4E7KA 2RH2A 5CAIA 3CPWS 3OS0A 3AT1B 1ZA2B 1VQ4A 1UFFA 3MIAB 3SWNA 4M6VA 4HT9A 3CCLA 1UHCA 3H0IA 1UHFA 4RTWA 1U1SA 1TG0A 3S3MA 2Y4XA 3LWIA 3CC2T 3OYJA 1KG1A 1M30A 1BYMA 2WSCE 2SEMA 3ER0A 2XICA 5CYIB 4UN0A 1N27A 2DIQA 3INZA 2Z0WA 3JCMW 3DOGB 2QF7A 1Q7YU 1YP5A 2GQIA 3OYEA 3CCUQ 2EIFA 5HY6A 4C5HA 4F7LB 1SHGA 2UZEB 4C0GA 3CCSQ 2X9HA 5IF1B 4F04B 1K8AU 5DQWA 4JX4A 1KQSS 3N5BB 2DZCA 2OI3A 4OF1A 2DLPA 3M03A 3CCRT 1FYNA 2OX7A 3P8BB 5FWCA 1MMDA 4NS5A 2K3XA 2DPPB 4CXAB 3HRUA 1G3NC 1NPPA 1LJOA 2EQIA 1Q81U 3RUXA 4A4EA 1KHCA 2QFZA 2HZYA 4FIBA 4MZTA 4RTXA 2DTOA 5KYXB 3NFCA 1VOLA 1WHLA 1H3ZA 5IT9E 1OPLA 2QQ9A 4GBQA 1WI7A 2XDPA 3A8GB 3LWHA 1UJ0A 1C9BA 4F7UE 1AD5A 5GAOq 3FRNA 1C1AA 2AZVA 4EOLB 3BE3A 3OMGA 5CKDA 1T0JA 1D1AA 1OL1B 1YIJA 5CKBA 3EIDB 3CEYA 4DQ2A 4BY7X 4VUBA 2JOYA 1Q82R 4PJMA 4AI6A 3M0PA 4AT1B 2DYIA 4BDYA 2CP3A 2QA4Q 1BU2A 4DOWA 4PJNA 3CCJA 4JRQA 4BY1X 3VYGA 4C0ZA 1ARKA 4PLLA 3UF4A 2QQ8A 3UATA 1WHJA 2LZ6B 1VQKA 3HO8A 4OMNA 1DJ7B 1MUZA 1VQPA 3OYCA 4EOPB 1I81A 1VQ7Q 5LMKB 2RK2A 4O6JA 4MMLA 2OTLA 2V1RA 2M51A 3X25B 4A54A 4BCND 3VKHA 4ESRA 3HL8A 4LXCA 4A4HA 3E9GA 1PM3A 1D1CA 2V8KA 4P5NA 1Y7XA 2ZPGB 3CMAT 4ZGJB 1N6AA 4HVVA 2XU8A 3BDUA 4PFZA 4M77E 1BKBA 3PVLA 4L59A 2DX1A 1OQKA 4JLGA 5CIUA 3J7AF 4QQ6A 3OBYA 3EGXA 5HQ0B 2IVWA 4ZTFA 2K5IA 1W2BS 4X9DA 3SD4A 2HNIA 3OS1A 1YNZA 1TTHB 1X69A 1NPRA 1V76A 2EW3A 5M9OA 3M56A 3M0QA 1AWOA 2FPDA 4BB7A 5GAN4 1M2VA 2EQJA 5KYWA 1WFWA 1FMVA 2NLUA 2COWA 1M8MA 1K0SA 1UECA 1VQLQ 2WIHB 1E9HB 2JS2A 3MEVA 4R0KA 2K79A 4M77C 2K57A 2QA4T 3PT9A 2KK4A 3NTIA 2OTJQ 4PJJA 1YJWT 5L8RE 1GY3B 3CC7Q 4Z02A 2FEIA 3JB9H 2E10A 4FT4A 5KH6A 4BCMD 2BZ8A 3O5ZA 4C92C 1G3TA 3RESA 4M78B 1VQMQ 5I2SA 3FEOA 2LT1A 1YJNQ 3QUIA 3G6EA 4BCQD 4F6SB 2CS7A 2KE9A 4ELJA 1YJ9T 2NUTA 4OB0B 1MNDA 1M3CA 4CFNB 1I5OB 4KGVB 1T3SA 1H1PB 3PTAA 1R0BG 2L5QA 2MMPA 5GMKe 2G6FX 3ASKA 4J9EA 3MP6A 3CC7A 1E6GA 3TVTA 1ABQA 2BIVA 1B07A 1WJQA 4PJOB 4IMYB 1LOJA 1GRIA 4F70B 2K2VA 1NE8A 2H8HA 3EHQA 2XDBA 3JB9I 4A63B 2IIMA 1IB8A 4FYYB 4JRPA 3BFMA 1ZUKA 2K6DA 3UDCA 4B9WA 1AT1B 4O5VA 1HYOA 2P0PA 2EPDA 2RI3A 2OJ2A 2K5FA 4C92B 2E41A 1ZSZC 2LNVA 2CH4A 4HVWA 2E3HA 1RAEB 4BUGA 1YWPA 1QVFP 4DA4A 1QKXA 5LJ3e 4FM4B 5HNBB 2FPFA 1M2OA 2AKKA 2DXTA 1D3BA 2E5QA 1VIEA 5FU7C 2DBKA 3M55A 1YJNT 2M16A 4EMKA 3BW1A 4F7NB 2BE7D 2DRKA 2QTXA 2DXCA 2HQEA 4M77D 3OYBA 4M77G 1VQOQ 1Y96A 2R7GA 1VQ8A 3M53A 2CH4W 1YWOA 4C8QE 2CDTA 3TN8B 3I9QA 3BDLA 3HRSA 3L2VA 3U23A 2DNUA 3M57A 5FRNA 1M1KU 1FXXA 3JCMV 4EIKA 1IZ6A 2YLCA 3MEWA 1N8RU 4J7FA 3C12A 3CMEA 1AWJA 1WQWA 4ELZC 3TNWB 1KC8U 1VQ9Q 1AZEA 3OMCA 2LCCA 3OS2A 3MJXA 3A8LB 2QEXQ 2GFUA 2FZGB 1WGSA 3CCVT 1OI9B 1VQOA 4C8QC 5IHYA 4F7UA 1VQNT 5IXBA 1D0ZA 3QHWB 4MDXA 1B34B 5CK9A 4E7JA 2VGMA 4OP0A 1YHQT 3CCMT 4KH1B 4N0AC 1IHVA 2QTVA 5FU7B 5GMKi 2RPNA 3CD6Q 2LC4A 3BG3A 2NUPB 3LW5E 3VS0A
chains in the Genus database with same CATH topology
1QVFA 3T9NA 1Q86C 4M75A 4J5YA 4PKCC 2M9UA 5GAMg 3O8VA 1G3YA 4A4FA 4QVCA 3OYKA 2LDMA 3OYFA 4HKEA 4F7UG 4JUVA 3OA6A 1QLBA 2L89A 4OVAA 4UC4A 4PNOA 1YITA 3QSUA 2RD1A 3SWNC 3C4SA 1BI3A 2G77A 3LYIA 3JCMc 3GLXA 4A4KA 3LLRA 5GAN7 2XK0A 4XTWA 2E6ZA 1I4K1 2ZZDB 4QVZA 3OYLA 1M4ZA 2GCXA 3X26B 1M1FA 4M7DF 4IUQA 2VYTA 3CCUA 3OW2A 4BE1A 3CXCA 2LT4A 1QW1A 2EQUA 1K9MC 2WSEE 4C5EA 1K73U 4M7AE 2QQSA 3S3OA 3H6ZA 5HK0A 3GPLA 5FROA 4JS4A 3CCSA 1U1TA 1EIFA 3CBOA 2DAQA 4M78F 5CQYA 5A0DA 4M75D 2KVQG 2X4XA 3L2UA 2ZZDA 4M75G 3VKIA 2XD0A 5KE2A 2EYQA 4Y91A 2WJ9A 2M1HA 3NTHA 4XTXA 4ZTJA 2KSSA 4QSHA 1X01A 2B8AA 2EJFA 2K4YA 4M77B 5GANh 5GAOl 1YI2A 1VQ5A 4LDUA 5GMKh 3JB9J 4M7DE 2PUKB 2HBPA 1O75A 2HD0A 1M1GA 3DLLA 1WQ7A 4R55A 2O01E 3CBMA 4J6XA 2BUDA 4J8OA 1S72A 1VQLT 4MDWA 4ZGDB 4M78E 3VV0A 1OZ3A 2QQRA 2LVMA 2RHZA 4BD3A 2XHCA 2LRQA 1FWZA 2D6FA 3HHTB 4ATOA 2LQKA 2O4XB 3HKSA 2DXBB 2JN0A 2EQKA 2OTJT 2P4TA 4LDYA 4FL6A 3QYEA 2XI9A 3L2WA 4AKHA 2E1HA 2QEXT 3GF5A 3CCQT 1O9SA 1YIJT 1Q86U 4V2SA 1V29B 3A5ZB 3CC7T 3DLMA 2DXCB 3RKWA 3KXTA 3TW7A 2QDJA 1GXIE 1Q7YC 1AHJB 4EMGA 1UGRB 2KR6A 4PJOF 5GAMf 3QWLA 3HFOA 2O4XA 2Y90A 2K3YA 3META 2DXBA 3LH0A 3V7SA 1VQMT 4XU3A 2P0QA 4X9CA 2ZPHB 4HT8A 3JRZA 4BI8B 4L5GA 4OMFB 3EFSA 1KQ2A 3DB3A 4XU0A 4MFEA 2JVVA 5GAMe 2DJZA 4N0AA 4Q5WA 3BG9A 3PFSA 5CO7A 4BY6B 3CCJT 1K8AC 2P0KA 1TH7A 2RO0A 2RH2A 4E7KA 5CAIA 4KBMB 4M77F 3V8LA 4KUDK 3CPWS 1PSFA 4C5IA 5CKFA 1N9RA 4M78C 5KCOA 3QYHB 4QQGA 3OS0A 5J39A 4C8QD 2PUOB 2RA2A 4ME7A 5GAOp 4MMKA 4PJOE 5LJ3h 1OI1A 2KMGA 3PGGA 4C8QG 1VQ4A 2R5MA 1VQPT 2QA4A 4C92F 3SWNA 3VU3C 1Q81C 3M59A 4M6VA 4HT9A 3CCLA 4OB3B 4IURA 3JAME 1U1SA 1LNXA 3ZBDA 1M90C 3L2RA 2Y4XA 2VGNA 4L6V5 4EDUA 3MP1A 1WNLA 3OYJA 3LWIA 3CCVA 2DO3A 3CC2T 4PL6A 2OTLT 1VQNA 3RERA 1KG1A 1BYMA 5D6XA 1MHNA 5GANg 2WSCE 3S6WA 2MWPA 1Q81U 3MP8A 3OYYA 4NL2A 4XTZA 2XKOC 4IUPA 4J83A 1YHQA 2RJFA 3ER0A 3Q1JA 3QPHA 3CCMA 4C0DC 2XICA 4LOCA 2DIQA 1N27A 4C92E 2WSFE 4AKGA 3INZA 4HCZA 4RKUE 3M9QA 2IG0A 2RK1A 3J80E 5GAN3 3JCMW 1Q82U 1VQ7A 3KHIA 2CZ0B 1OYXA 2QF7A 4IKFA 2H3JA 1M9SA 1Q7YU 1XOVA 3DKMA 3QG1A 4NOYA 3OYEA 4PJOC 1QP3A 1IREB 4XU1A 5LJ5e 2EIFA 5HY6A 4KULA 2F69A 4FSXA 3OBWA 5CKHA 5HK3A 4C5HA 2DEQA 5CQXA 1VQ8T 3E9FA 4C0GA 3QHSA 1K8AU 3EAEA 1UB4A 3OYGA 5I21A 4JX4A 4OB2B 1M8VA 3RMQA 4KUIA 4QQDA 3WVEB 3CBPA 1KQSS 3N5BB 2DZCA 4OF1A 3A8OB 2EQMA 5GANj 4XU2A 2JTMA 3GNFB 5A0LA 4JLIA 2RI5A 3X24B 3CCRT 3P8BB 3FC3A 2GF7A 2I2LA 4MFDA 4NS5A 1YBYA 2K3XA 2DPPB 3WVDB 2DK3A 2E64A 2WACA 3HRUA 3ZFJA 1NPPA 1LJOA 4XAXB 5GAOm 4X34A 1UGPB 4RG8A 3RUXA 5CKEA 4A4EA 4F7UF 3CMET 2XIDA 1KHCA 2OAUA 2QFZA 4FIBA 4MZTA 5LJ3g 1M90U 2C06A 5CVIA 2DTOA 3JB9D 3RKXA 3NFCA 2DKGA 3L1AA 3JB9G 4HA8A 5IT9E 3VYHB 2EWNA 4M7AD 1H3ZA 1JBMA 2E65A 3QKJA 5GMKm 3FB9A 1VQOT 2QQ9A 1W4SA 4M7AG 3BY7A 1VQLA 2ZCFB 1KD1C 2XDPA 3MHXA 1VUBA 5KCHA 3A8GB 3H4CA 2HQXA 2PU9B 5GAN2 4M75F 4F7UE 3LWHA 5GAOq 3FRNA 4BE2A 2CGHA 3RMSA 3OMGA 5CKDA 3X28B 4YTLA 3JCMX 3I55T 3CCQA 1JJ2S 3G6ET 2OTJA 2JNGA 1YIJA 5FU6C 5KE3A 1BI2A 3G4ST 4C0DB 5CKBA 1M5Q1 3VJPA 1XQHA 1G3SA 3CEYA 5GANd 4HL4A 4DQ2A 3JCMQ 4VUBA 3VYGB 2JOYA 3OY9A 5GAOr 2F5TX 3JCMh 4AI6A 2R57A 4C8QB 4M78D 5LJ3j 1VQMA 1VQ9T 3JCMd 4BDYA 1YJNA 4M78G 2X35A 3QIIA 4RCBA 4M75E 1PSEA 1YITT 4ZN3A 4PLIA 4M7AC 4DOWA 5CR2A 5D6WA 3CCJA 3DL1A 4JRQA 4CI0C 3S3MA 3VYGA 2KY9A 2YHTA 4C0ZA 4PLLA 3QJYA 3SB2A 2PVDB 4C8QA 2QQ8A 2MWOA 1VQKA 4JDSA 4OGEA 2CZ1B 3HO8A 4C5GA 1HK9A 1DJ7B 5FLXE 2PVGB 1VQPA 4N4GA 3OYCA 1N8RC 4JX5A 2K5LA 3TCJA 4M7DC 4QVDA 3M54A 3GNGA 2GQVA 1I81A 1K9MU 3CCEA 3TEEA 1KC8C 2FL7A 4N4HA 3SWNB 2RK2A 4O6JA 2VUBA 4Y28E 2L3RA 3CD6T 4MMLA 4TVRA 1YI2T 1VQ5T 2OTLA 2HAXA 1YCYA 4ELYC 4PJOD 3GOXA 3X25B 4QW2A 4A54A 3OSVA 4PJOG 3V8KA 3FDRA 3HRTA 3VKHA 5DY9A 3HL8A 5J3BA 5LJ3d 1KQ1A 1NZ9A 4A4HA 3E9GA 5J26A 5HKCA 3I55A 4BI4A 3R6OA 3OYAA 2BKDN 2V8KA 3P8DA 2DVEA 3TREA 4P5NA 1Y7XA 4MZMA 3TU4K 2ZPGB 3CMAT 4ZGJB 1N6AA 2XU8A 3BDUA 1G5VA 4M77E 3H8ZA 3L42A 3ME9A 4ZTFA 1BKBA 3OB9A 4LDWA 2KAFA 4L59A 2PVOB 5GAOn 4JRKA 2DIGA 4JLGA 1VQ6T 2JTFA 5CIUA 1QVGS 3J7AF 2MI6A 4QQ6A 3OBYA 1NJIC 1XTDA 2IVWA 3MCAB 5AYFA 3SFMA 3E1SA 4BACA 2K5IA 1JRIA 3A8HB 1WJSA 3JCMg 3UWNA 4C92D 5LJ5j 4X9DA 2KQWA 4XQ3A 3SD4A 4J7IA 1U8RA 5EJCA 5EG2A 2RHYA 4C92G 2HNIA 2DXUA 2FVUA 2LX9A 4WF2A 3OS1A 1NPRA 2MAMA 5M9OA 3CPWA 3FLGA 3M56A 3QYGB 3EFRA 4M7AB 3VUBA 4J6YA 4BB7A 2RJEA 2BS4A 2LQ8A 3PMIA 2EQJA 5GAN4 1QVFS 2EJ9A 2NLUA 2FYKA 3KBGA 1UGQB 4C0FA 1K73C 5A2QE 1VQ4T 3MEVA 4CRIA 2X4WA 2K57A 4M77C 3FIFA 2QA4T 5C6SA 3PT9A 4M7AA 4FT2A 2KK4A 3CPFA 3NTIA 3A8MB 3HBLA 3CCLT 4R56A 2YLBA 4JS5A 4M7DB 4HNTA 3OW2S 3PMTA 3CXCS 1YJWT 3WXMB 4LD6A 5L8RE 2BS3A 2QQBA 5GAN8 4Z02A 5A0GA 3JB9H 2JZ2A 2E10A 4RG2A 2QI2A 3DB4A 3M4YA 4FT4A 5KH6A 4C92C 3OYDA 4KT0E 1G3TA 4XTYA 1WPYA 2VV5A 3RESA 4M78B 1VIFA 4RMOA 2XG8D 3RKYA 1SSFA 5LJ5h 5I2SA 1ZBXA 3M4GA 3FEOA 2LT1A 2VXEA 4HCCA 5LL6S 4M7DA 3QUIA 4EMKC 5LJ5d 2V8IA 3S3NA 3G6EA 1G3WA 1N9SA 2KMTA 1ZQ1A 2FHDA 3JB9F 1E7PA 3LGLA 3QYBA 3URGA 2CS7A 2QQAA 4ELJA 5FRMA 2ZPIB 1Y71A 1YJ9T 4M78A 1FX7A 1X6OA 4D6WA 5GANf 3SDZA 4OB0B 1QVPA 3QXEB 3HSBA 2EAYA 4IUTA 3MEAA 1VQ9A 4NC6A 4BY6C 3PTAA 3F70A 2MMPA 2L5QA 4GY5A 5GANe 4DOVA 3I56T 3JCMf 4BE0A 5GMKe 3HP9A 5I2MA 3ASKA 2R58A 2QEXA 1KQSA 3MP6A 4M7DD 2DD4B 3CC4T 3G71T 3JCMe 3CC7A 2A7YA 2DZ9A 4M7DG 2E12A 3J81E 3UT1A 2Y4YA 2EFIA 2MF2A 1FKMA 2BIVA 3JSCA 3OQ5A 5C0MA 2DTHA 1WJQA 4PJOB 4Z6YA 1LOJA 4A4GA 2D9TA 5CCAA 1ZHIA 4GLKA 4B9XA 5GAN6 2DD4A 2K2VA 1NE8A 4XK8E 2XDDA 4A53A 3OYMA 4JJNK 3PIPA 3FJPA 1X75C 3CD6A 1I5LA 4E7IA 4PJOA 2XDBA 3JB9I 2A3LA 3OYNA 3PIOA 3CCUT 5GAMj 1M1KC 1RI0A 4JRPA 3BFMA 5IAYA 3UDCA 4B9WA 4O5VA 3CCST 3HFNA 3NTKA 3QZ5B 1R8OB 2P0PA 2LCLA 2RI3A 4ZN1A 2QDYB 4BI3A 5DLQE 5LJ3f 4BBRM 2K5FA 4C92B 4M77A 2E41A 1Y07A 2LNVA 1D3BB 2X4JA 5GMKl 4BUGA 2CKKA 5GAN5 2RJDA 4FU6A 5LJ5g 1JJ2A 3X20B 1UEBA 3CMAA 3AHUA 3QDRB 4DA4A 3CC2A 2R5AA 1BI0A 5LJ3e 2E6NA 1KD1U 4FM4B 3OSSC 4EMKB 2LTOA 1Q82C 4HNVA 2ZPEB 4JX6A 4MZPA 2G3RA 4M75C 2CZ6B 3OYIA 1VQ6A 3QO3A 4C92A 4OGCA 3QBYA 4C8QF 2DXTA 2X4YA 1D3BA 3PNWC 2E5QA 1S72T 2E70A 4E7LA 1VIEA 1UGSB 3RIRA 1Y96B 5FU7C 3M55A 2PQWA 1YJNT 2M16A 3ZEHA 2RI2A 1JB0E 3BW1A 4EMKA 4HLQA 2QTXA 2DXCA 2HQEA 2ZGWA 4M77D 3OYBA 1KHIA 1MGQA 3KUFA 4M77G 2CZ7B 3LGFA 4XTUA 5GAMh 3MO8A 4HNUA 1I8FA 1Y96A 2RJCA 4ZGEB 1H641 3OS5A 4LDVA 5FU6B 5DM7R 3M58A 5GAMd 1VQ8A 2DD5B 3L2ZA 1RL2A 1HXDA 2M0OA 3M53A 1VQKT 3UPUA 4N4IA 4XTVA 4C8QE 4JRIA 4EMHA 2DTIA 1P92A 2RHXA 2EKOA 4J6WA 3BDLA 3HRSA 3V7RA 3L2VA 3VUZA 2GFAA 3M57A 5FRNA 4AKIA 1M1KU 3P8HA 1FXXA 3C95A 3JCMV 1IZ6A 2VC8A 3CCET 4MIMA 1XNIA 3CCRA 2DD5A 1WJRA 4E47A 2YLCA 1YJWA 2JUFA 1OZ2A 4BDZA 3MEWA 1QP2A 1BI1A 1N8RU 4J7FA 3C12A 3TW6A 4IUUA 3CMEA 2L8DA 3G7ZA 3GP8A 5DLOA 3BG5A 3V8JA 1WQWA 4F7UB 4ELZC 4E7HA 1KC8U 3M5AA 4BBSM 3OMCA 2BS2A 2EJGA 2LCCA 3HZJA 3OS2A 4OB1B 3E19A 3V7CA 3JCMb 3QJ6A 4IUVA 1W2BS 3A8LB 5LJ5f 2GFUA 4II1A 1BIAA 3MEUA 1WGSA 4NL3A 3CCVT 3VKGA 1VQOA 1YJ9A 2RB6A 4RCCA 4C8QC 5IN1A 4F7UA 1VQNT 3GIBA 3HB9A 3HPWA 3C94A 2D0QB 1BIBA 2F5KA 2KDSA 1B34B 3LX7A 4MDXA 2QXFA 3L2QA 2AHJB 1QVGA 5CK9A 4E7JA 2VGMA 4OP0A 3I56A 1YHQT 3QZ9B 3JCMJ 4M75B 3CCMT 2YRVA 2FB7A 1W2BA 2ZPFB 4LDXA 4N0AC 3JCMP 5D6YA 2V8JA 2ZPBB 1VQ7T 3G4SA 5FU7B 5GMKi 3CC4A 4LD9K 3G71A 2RHIA 2RHUA 1B34A 4HCBA 2LC4A 2CYZB 4EPCA 3OYHA 4M7AF 5GMKj 3BG3A 1NJIU 2RM4A 3LW5E 2VXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF E;  4RKU E;  3X25 B;  2CZ0 B;  1QP3 A;  1IRE B;  2ZPG B;  2ZZD B;  3QZ5 B;  4ZGJ B;  3X26 B;  2QDY B;  2WSE E;  4OB2 B;  2PVO B;  3WVE B;  3X20 B;  3A8O B;  3X24 B;  2ZZD A;  4FM4 B;  3A8H B;  2ZPE B;  2CZ6 B;  2DPP B;  3WVD B;  1UGP B;  1UGS B;  3QYG B;  2PUK B;  1JB0 E;  2DXC A;  2O01 E;  1UGQ B;  4ZGD B;  3VYH B;  2CZ7 B;  3HHT B;  4ZGE B;  2DXB B;  2DD5 B;  3A8M B;  2ZCF B;  3A8G B;  1V29 B;  2PU9 B;  5L8R E;  2DXC B;  1GXI E;  1AHJ B;  1UGR B;  3X28 B;  4KT0 E;  2DXB A;  2DD5 A;  2ZPH B;  1QP2 A;  3VYG B;  2ZPI B;  1PSF A;  1PSE A;  4OB0 B;  4OB1 B;  3QYH B;  3A8L B;  3QXE B;  2PUO B;  3VYG A;  2PVD B;  2D0Q B;  2CZ1 B;  4OB3 B;  2AHJ B;  2DD4 B;  1DJ7 B;  2PVG B;  4L6V 5;  3QZ9 B;  2ZPF B;  2WSC E;  2ZPB B;  4Y28 E;  2CYZ B;  2DD4 A;  3LW5 E;  4XK8 E; 
#chains in the Genus database with same CATH topology
 4YOZ A;  2ECZ A;  1Q86 C;  4J5Y A;  4PKC C;  4RTU A;  5GAM g;  4QVC A;  2LDM A;  4HKE A;  3I5R A;  4JUV A;  1YIT A;  4UC4 A;  3SWN C;  4Z89 A;  4FX3 B;  1H3H A;  1BI3 A;  4ELL A;  2XK0 A;  2ZZD B;  4QVZ A;  2GCX A;  1M1F A;  4ZNX A;  3OW2 A;  1G83 A;  1T0H A;  4ROC A;  2VAS A;  1OUL A;  4LE9 A;  4M7A E;  1VQ6 Q;  2FG0 A;  3CBO A;  4M78 F;  4WCI A;  5A0D A;  3THK A;  2CP7 A;  2PMI B;  2CT4 A;  4F6W B;  3FJ5 A;  3NTH A;  4BCI B;  3BLH B;  2V1Q A;  2A36 A;  2KXD A;  3E2U A;  1VQ5 A;  3NPF A;  5GAO l;  1RAI B;  3DDP B;  4J9I A;  2HBP A;  2K7A A;  1X2Q A;  1M1G A;  2GTJ A;  3DLL A;  2F1L A;  1S72 A;  2BUD A;  2XHC A;  1FWZ A;  1IRX A;  2C0T A;  2QEX T;  3QYE A;  1PRM C;  4AKH A;  3GF5 A;  4PJO F;  4JZ4 A;  3HFO A;  2O4X A;  2Y90 A;  3V7S A;  1JO8 A;  4L5G A;  3DB3 A;  1TFB A;  3BG9 A;  5CO7 A;  4BY6 B;  1IXD A;  2P0K A;  2RO0 A;  4KBM B;  4M77 F;  1ZSG A;  4CC7 A;  5CKF A;  1N9R A;  1QQJ A;  1I1J A;  5KCO A;  5J39 A;  4C8Q D;  1W98 B;  1EZZ B;  1OI1 A;  4C8Q G;  2R5M A;  2JMA A;  2BKZ B;  3I56 Q;  4C92 F;  3VU3 C;  3M59 A;  4OB3 B;  3JAM E;  1LNX A;  3G4S Q;  3CC4 Q;  3G71 Q;  1WNL A;  2DBM A;  2JMC A;  3TNH B;  2F2V A;  4XTZ A;  2XKO C;  2LNH B;  4J83 A;  2RJF A;  3ZL7 C;  2P4R A;  3I55 T;  4AKG A;  1RAF B;  1UTI A;  1Q82 U;  2IW6 B;  1NEG A;  2CZ0 B;  1HSQ A;  3MY1 B;  4IKF A;  1M9S A;  1T3L A;  1XOV A;  4J9G A;  3DKM A;  4ANJ A;  1IRE B;  4XU1 A;  3RGF B;  2AZS A;  2C6T B;  1QWF A;  3OBW A;  1TWB A;  5HK3 A;  5CQX A;  1Q86 R;  2C0O A;  2X1N B;  1UB4 A;  3OYG A;  1ZSZ A;  2AT1 B;  3RMQ A;  4KUI A;  3WVE B;  3CBP A;  5HBJ B;  1K9A A;  1UGV A;  3A8O B;  2JTM A;  3GNF B;  2W96 A;  2RI5 A;  1YI2 Q;  1H24 B;  4MFD A;  3BLQ B;  4FSS A;  2BZX A;  5GAO m;  2YWW A;  4RG8 A;  5CKE A;  2MIO A;  3POM A;  2DRM A;  5LJ3 g;  5IHN A;  2C06 A;  1OX9 A;  1KIK A;  3RKX A;  2BPM B;  1SRL A;  4HA8 A;  2KI7 A;  3VYH B;  4M7A D;  1JBM A;  3QKJ A;  4M7A G;  3BY7 A;  2ZCF B;  1VUB A;  5KCH A;  2HQX A;  4JJB A;  2PU9 B;  8AT1 B;  5GAN 2;  2CGH A;  3CPW P;  2RQU A;  4FW1 A;  3RMS A;  3X28 B;  1GUX A;  2PHG A;  1WA7 A;  2LQN A;  3CCQ A;  2HSE B;  2CJM B;  5FU6 C;  5KE3 A;  3G4S T;  2C5N B;  1M5Q 1;  1QCN A;  1G3S A;  2WIP B;  3JCM Q;  4EOO B;  3VYG B;  5GAO r;  3JCM h;  5LJ3 j;  4QKU A;  3LH5 A;  3H0F A;  1VQ4 Q;  2BTT A;  2C4G B;  4M75 E;  4F14 A;  5D6W A;  1M3B A;  3CCL Q;  1TU0 B;  2YHT A;  2XMF A;  3M0S A;  2JGZ B;  2PVD B;  4C8Q A;  1NYF A;  4JDS A;  1GCP A;  4OGE A;  1ZUU A;  1H1R B;  2K3B A;  5FLX E;  4X1V A;  2CT3 A;  2HKN A;  3TCJ A;  1RAG B;  1G8X A;  2W0Z A;  2GQV A;  4HCK A;  1K9M U;  2VUB A;  1YI2 T;  1D1B A;  1W1F A;  4RTY A;  2NWM A;  2RQW A;  2D0N A;  1KQS P;  5LJ3 d;  5J3B A;  1KQ1 A;  3PE0 A;  1OKV B;  4AG2 C;  3R6O A;  3OYA A;  2BKD N;  3EGX B;  3TRE A;  2DVE A;  1JU5 C;  2M0Y A;  3GTM S;  1R0C B;  1BBZ A;  1G5V A;  3H8Z A;  3L42 A;  4AFQ C;  3OB9 A;  4LDW A;  2KAF A;  2PVO B;  5GAO n;  1KJW A;  2DIG A;  2OAW A;  2G9X B;  2JTF A;  2ABL A;  2MI6 A;  3SFM A;  3E1S A;  4J7I A;  5EG2 A;  2RHY A;  1WHK A;  4CFU D;  2LX9 A;  1YFN A;  5KYU A;  3VRY A;  4KRD B;  1EFN A;  4YOS A;  3FLG A;  3VUB A;  1H25 B;  2BS4 A;  3PMI A;  1JEG A;  1UGQ B;  1RAC B;  5A2Q E;  2J6F A;  1VQ4 T;  4DBF A;  4M7A A;  4FT2 A;  3CCL T;  3NDQ A;  2YLB A;  1YIJ Q;  3OW2 S;  2WEV B;  2MCN A;  3CQT A;  4J9D A;  2BS3 A;  2KNB B;  2JZ2 A;  1IO6 A;  4EOJ B;  1RAB B;  2CUD A;  3DB4 A;  2KBT A;  3OYD A;  4KT0 E;  2VV5 A;  1VIN A;  3RKY A;  1SSF A;  5LJ5 h;  1ZBX A;  4JJD A;  1K1Z A;  1RLP C;  2W99 A;  4EMK C;  4AFU C;  1N9S A;  1ZQ1 A;  3CCJ Q;  2FHD A;  3LGL A;  3QYB A;  2QQA A;  1FX7 A;  4D6W A;  2HQH A;  3SDZ A;  4QT7 A;  1VQK Q;  2PTK A;  3HSB A;  2LP5 A;  1PG5 B;  1PKS A;  2BZY A;  1K4U S;  2HL5 C;  4GY5 A;  5GAN e;  1VQP Q;  1D0Y A;  1CKA A;  2EVR A;  2R58 A;  4OR5 B;  2KRO A;  5KYN A;  1PD1 A;  2HCK A;  3JCM e;  2A7Y A;  1QMZ B;  3J81 E;  2V22 B;  2COZ A;  2OTL Q;  1I0C A;  2X3X D;  3BHV B;  2EFI A;  2CP0 A;  3JSC A;  5C0M A;  2HMA A;  2D9T A;  5ICP B;  2DET A;  4BCN B;  5GAN 6;  4B9X A;  3MKD A;  2DD4 A;  3RBB B;  2LJ3 A;  2XDD A;  2FPE A;  1AZG B;  4K11 A;  1I5L A;  4LUD A;  3CCU T;  1MV3 A;  4KGX B;  1W2B P;  1JSU B;  2QYZ A;  3CCS T;  1NM7 A;  2LCL A;  2KEA A;  4BI3 A;  5LJ3 f;  4BBR M;  1Y0M A;  1D3B B;  2X4J A;  5GMK l;  2QK0 A;  5GAN 5;  1JJ2 A;  3CMA A;  3AHU A;  2R5A A;  5DQV A;  2DL7 A;  1KD1 U;  4EMK B;  3OSS C;  1TUG B;  2LTO A;  1XO2 A;  2ZPE B;  1OOT A;  2QGF B;  4JX6 A;  3OYI A;  2G3R A;  2CZ6 B;  4OMQ A;  2E70 A;  4E7L A;  5L2W B;  1Y96 B;  3I35 A;  2PQW A;  2RI2 A;  4WTO B;  4HLQ A;  3ULR B;  2ZGW A;  1KHI A;  1MGQ A;  3KUF A;  2EYX A;  2W9Z A;  4XTU A;  4DBQ A;  4HNU A;  1BU1 A;  1UUE A;  3M58 A;  2O9S A;  2YUP A;  1VQK T;  4BCM B;  1HXD A;  5IDP B;  2M0O A;  1X27 A;  1M3A A;  1P92 A;  4EC8 B;  3V7R A;  1WHG A;  2KYM A;  2GFA A;  3VUZ A;  2YUQ A;  3P8H A;  3G6E Q;  2WMA B;  4BCQ B;  2DD5 A;  1WJR A;  2L3S A;  1ZLM A;  1YJW A;  2JUF A;  1WXU A;  4IUU A;  2L8D A;  4F7U B;  4HXJ A;  2CUB A;  5FGK B;  4J9B A;  1OX8 A;  4BBS M;  2BS2 A;  3LQ5 B;  3HZJ A;  4OB1 B;  3V7C A;  3JCM b;  3QJ6 A;  4F7S B;  1Z9Q A;  3VKG A;  1YJ9 A;  2RB6 A;  1HD3 A;  1PKD B;  5IN1 A;  1RLQ C;  3HB9 A;  3C94 A;  1H1S B;  2F5K A;  1B7T A;  2QXF A;  2ROT A;  2AHJ B;  1QVG A;  1WXB A;  4RTV A;  4PFP A;  2KT8 A;  4E6R A;  4LDX A;  3JCM P;  5D6Y A;  1TUD A;  2V8J A;  1VQ7 T;  1VYU A;  3QWX X;  4TTH A;  4LD9 K;  4HCB A;  1PHT A;  3OYH A;  1NJI U;  3PO3 S;  4RG2 A;  2VXF A;  1AWX A;  3SHW A;  3T9N A;  4M75 A;  5HBE B;  2M9U A;  3O8V A;  1G3Y A;  2L2P A;  1WHH A;  3OYF A;  4F7U G;  1QLB A;  1TSF A;  2RD1 A;  5D7U A;  1WLP B;  4YC3 B;  3LYI A;  3JCM c;  2PNI A;  3GLX A;  4A4K A;  1AWW A;  1BK2 A;  5IDN B;  1P5E B;  3OYL A;  1M4Z A;  3X26 B;  2V26 A;  5I5Z B;  4IUQ A;  5ECA A;  4IIM A;  1QCF A;  3CXC A;  1PCX A;  1QW1 A;  1K73 U;  4C5E A;  2DM1 A;  5HK0 A;  2MOX A;  2IN3 A;  3GPL A;  2PK2 A;  2A0F B;  1U1T A;  4JS4 A;  2DAQ A;  4M4Z A;  1GL5 A;  2KRS A;  5L23 A;  2E4H A;  2KSS A;  4QSH A;  1X01 A;  2B8A A;  2EJF A;  2K4Y A;  4M77 B;  4DEY A;  2QGG A;  3JB9 J;  4M7D E;  1O9K B;  1O75 A;  1OV3 A;  3VS3 A;  1VQ8 Q;  1VQL T;  3CBM A;  3VV0 A;  2RHZ A;  3HHT B;  4ATO A;  2LQK A;  2O4X B;  2JN0 A;  4CC4 B;  2OTJ T;  2QGS A;  2P4T A;  2XI9 A;  1Q86 U;  2L0A A;  1V29 B;  2WHB B;  3CC7 T;  4CRL B;  3DLM A;  1H4L D;  2QDJ A;  2ZAE A;  1GCQ A;  3QWL A;  2A08 A;  2K3Y A;  3CME Q;  3LH0 A;  1VQM T;  1Z9Z A;  2P0Q A;  4X9C A;  1PKT A;  4HT8 A;  1TOV A;  3EFS A;  1X43 A;  4XU0 A;  4MFE A;  5GJV B;  4G6L B;  2RNA A;  1H27 B;  2IVX A;  4FW2 A;  2YUO A;  3V8L A;  3TSW A;  2UZB B;  3M0T A;  1PSF A;  4QQG A;  2VWF A;  4PK4 A;  7AT1 B;  1OKW B;  1K76 A;  2RA2 A;  5GAO p;  4MMK A;  2K2M A;  1AEY A;  2HEQ A;  2KMG A;  3TSZ A;  4AFZ C;  4HVU A;  2FRY A;  3ZBD A;  1M90 C;  1KXU A;  2UZD B;  2VGN A;  4RTT A;  4EDU A;  3MP1 A;  3L2R A;  3CCV A;  2DEU A;  1VQN A;  3RER A;  4PL6 A;  1XJW B;  2QDL A;  5GAN g;  1OU8 A;  3M0R A;  3OYY A;  4IUP A;  1YHQ A;  3Q1J A;  3QPH A;  3CCM A;  4C0D C;  1X6G A;  4CFW B;  3VS1 A;  1YIT Q;  1U5S A;  4DBH A;  4HCZ A;  2A28 A;  4RKU E;  3M9Q A;  2IG0 A;  4OMP A;  2H3J A;  1ZSZ B;  1QP3 A;  2KRN A;  3RR6 A;  2F69 A;  5CKH A;  2DEQ A;  1VQ8 T;  3EH2 A;  3QHS A;  2GGR A;  5I21 A;  2EUF A;  1M8V A;  2IW9 B;  4J9C A;  2EQM A;  5GAN j;  1IHW A;  1VQ5 Q;  3X24 B;  3QDF A;  1YBY A;  1F5Q B;  2E64 A;  4XAX B;  3CME T;  3REB B;  4F7U F;  1S72 Q;  2OAU A;  3EGD B;  2RF0 A;  4AMC A;  3NGP A;  3HTR A;  5CVI A;  2DKG A;  3L1A A;  2KXC A;  2E65 A;  1VQO T;  1GUX B;  2HBW A;  2JS0 A;  1PNJ A;  2O9V A;  3MHX A;  3H4C A;  1SEM A;  2VKN A;  2PJQ A;  1JJ2 S;  4YTL A;  3JCM X;  2JNG A;  1BI2 A;  4C0D B;  3VJP A;  2I0N A;  5GAN d;  4HL4 A;  4ROD A;  2W2H A;  2F5T X;  2R57 A;  4C8Q B;  4J9H A;  2CP6 A;  1VQ9 T;  3JCM d;  4EOQ B;  2X35 A;  4RCB A;  1YIT T;  4PLI A;  4M7A C;  2KGT A;  1U3O A;  2J06 A;  2W10 A;  2KY9 A;  3SB2 A;  3QJY A;  4KRC B;  4DBR A;  3TQ7 P;  1D09 B;  4C5G A;  3EG9 A;  3F5X B;  2PVG B;  4N4G A;  1N8R C;  1RAA B;  1OGU B;  4OGR B;  3CCE A;  3TEE A;  1KC8 C;  3SWN B;  3CD6 T;  2L3R A;  1VYV A;  4TVR A;  1VQ5 T;  4CC3 A;  3UA7 A;  2YUN A;  4ELY C;  1M90 R;  4QW2 A;  3V8K A;  3FDR A;  2LW4 A;  3EG2 A;  3I55 A;  1KSW A;  3TU4 K;  2HKQ B;  1GBR A;  2F2C A;  3MPU B;  5KYU B;  4JRK A;  1VQ6 T;  2FZC B;  1QVG S;  1MMG A;  1VYT A;  1XTD A;  3MCA B;  5AYF A;  4BAC A;  1C6V X;  5LJ5 j;  3A8H B;  2D6F A;  1U8R A;  2AIR B;  4XQ3 A;  2DXU A;  1NBE B;  2MAM A;  5FWB A;  4M7A B;  3EFR A;  4J6Y A;  2DL3 A;  1QMC A;  4OMO A;  3EFO A;  1KK7 A;  2EJ9 A;  2DL8 A;  4C0F A;  4CRI A;  2X4W A;  5C6S A;  1G2B A;  3DDQ B;  3CPF A;  1AOJ A;  2NYS A;  3A8M B;  4R56 A;  3MY5 B;  3CCQ Q;  1FMW A;  2UZL B;  3PMT A;  2O31 A;  3CXC S;  3WXM B;  4LD6 A;  1RUW A;  2QI2 A;  3M4Y A;  1QCO A;  2X3W D;  4RMO A;  2XG8 D;  4EOK B;  1LPL A;  1D3U B;  5LL6 S;  4M7D A;  5LJ5 d;  3S3N A;  1LVK A;  1G3W A;  1W70 A;  4E2F B;  1RAD B;  1E7P A;  2RMO A;  3DTO A;  1X6O A;  8ATC B;  5GAN f;  3RNJ A;  1TD6 A;  2FRW A;  2EAY A;  4IUT A;  4NC6 A;  2WXV B;  1WZO A;  3I56 T;  3JCM f;  3HP9 A;  1MV0 B;  1VOM A;  2EYZ A;  1W6X A;  1ZBJ A;  2D8H A;  2DD4 B;  3CC4 T;  3G71 T;  2A37 A;  2DZ9 A;  2E12 A;  3CC2 Q;  2JT4 A;  2MF2 A;  1UNG D;  1FKM A;  1FIN B;  2QAZ A;  3OQ5 A;  2DTH A;  2YSQ A;  4Z6Y A;  4DEX A;  5KYY A;  2DFU A;  1ZHI A;  4GLK A;  2HL3 A;  2CSI A;  1EX4 A;  4EOS B;  4XK8 E;  4LN2 A;  2EGA A;  1N8R R;  3PIP A;  1NLP C;  3FJP A;  1X75 C;  2A3L A;  1JXO A;  1KC8 R;  1AIS B;  4FYX B;  3HFN A;  3NTK A;  3QZ5 B;  4JPB W;  2QDY B;  2AK5 A;  3GBQ A;  2B86 A;  5DLQ E;  4BCG B;  1Y07 A;  2CKK A;  5AT1 B;  1C0M A;  2RJD A;  3X20 B;  4CFU B;  3CC2 A;  4RUG A;  2MK5 A;  1Q82 C;  4M75 C;  1ZP2 A;  3BHU B;  2YXY A;  2X51 A;  2X4Y A;  2C5X B;  3G1J A;  3PNW C;  4C8Q F;  1UGS B;  4Y72 B;  3OW2 P;  5IXF A;  1UDL A;  2CZ7 B;  5GAM h;  1ZA1 B;  3MO8 A;  2COY A;  1I8F A;  2RJC A;  3OS5 A;  1H64 1;  5FU6 B;  5DM7 R;  3QSU A;  2DD5 B;  2MPX C;  1RL2 A;  4N4I A;  2LJ1 A;  2WMB B;  1M2V B;  2DTI A;  3UA6 A;  5KYW B;  4J6W A;  1F1B B;  2VC8 A;  4MIM A;  3CCR A;  1OZ2 A;  1QP2 A;  1BI1 A;  3EGU A;  2CRE A;  3BG5 A;  4E7H A;  2C5V B;  2JM8 A;  4KGZ B;  3M5A A;  5HBH B;  2ESW A;  3E19 A;  4E7Z A;  5LJ5 f;  4II1 A;  1BIA A;  4E7S A;  4NL3 A;  4FYV B;  1GFC A;  1NYG A;  3GIB A;  2WPA B;  1AD6 A;  2D0Q B;  1BIB A;  3LX7 A;  1GCQ C;  2D8J A;  3L2Q A;  2NUT B;  1BCM A;  4M75 B;  2FB7 A;  4JZ3 A;  2ZPF B;  5BNJ B;  2RHI A;  1NEB A;  2CYZ B;  1MMN A;  4EPC A;  4M7A F;  1U06 A;  2ROL A;  1CKB A;  1QVF A;  1JKW A;  2M02 A;  3I5S A;  2HSP A;  4A4F A;  3OA6 A;  4EC9 B;  1H26 B;  4PNO A;  1N5Z A;  4FCY A;  3C4S A;  3LLR A;  5GAN 7;  4XTW A;  2IW8 B;  1I4K 1;  3EG0 A;  3CMA Q;  3CCU A;  4BCK B;  1MNE A;  1K9M C;  2WFY B;  2WSE E;  2QQS A;  3H6Z A;  3EG1 A;  4LNP A;  1MMA A;  1E7O A;  4LUE A;  3CCS A;  1EIF A;  4M75 D;  4M75 G;  2XD0 A;  5KE2 A;  2EYQ A;  1WIE A;  2WJ9 A;  2CSQ A;  1IGU A;  3NHN A;  4LDU A;  5GMK h;  4J9F A;  2LX7 A;  2HD0 A;  5IHI A;  1WQ7 A;  2DJQ A;  4R55 A;  3QHR B;  4M78 E;  1FVV B;  4BD3 A;  1KFZ A;  2LRQ A;  4GLM A;  3HKS A;  2ED0 A;  2EQK A;  4LDY A;  1QWE A;  3L2W A;  1YIJ T;  4NST B;  3EHR A;  1PC0 A;  1YJW Q;  4ORZ A;  2DXC B;  1GXI E;  3TW7 A;  1Q7Y C;  1UGR B;  2KR6 A;  1I07 A;  1VA7 A;  2DXB A;  2ZPH B;  5GAM e;  3H0H A;  4Q5W A;  3PFS A;  2YRC A;  9ATC B;  3CCJ T;  1K8A C;  4YOO A;  2JM9 A;  4KUD K;  1YJ9 Q;  4C5I A;  4M78 C;  4EOI B;  3QYH B;  2PUO B;  4ME7 A;  4PJO E;  4BCO B;  5LJ3 h;  4IIO A;  3PGG A;  2HDA A;  1VQP T;  2QA4 A;  3A1P A;  1Q81 C;  2SRC A;  4IUR A;  5I22 A;  4L6V 5;  2DO3 A;  1E6H A;  2OTL T;  5D6X A;  1MHN A;  4D8K A;  4CFV B;  3S6W A;  2MWP A;  3MP8 A;  4NL2 A;  3EJ1 B;  3EH1 A;  4LOC A;  1OIY B;  4C92 E;  2WSF E;  1VQ7 A;  2RK1 A;  3J80 E;  5GAN 3;  3KHI A;  1OYX A;  3QG1 A;  2EYW A;  4EON B;  4NOY A;  2JJ9 A;  4F16 A;  4PJO C;  2PK9 B;  5LJ5 e;  4KUL A;  4FSX A;  3E9F A;  2I53 A;  1Y57 A;  2RQV A;  3EAE A;  4OB2 B;  2KR3 A;  4QQD A;  1WYX A;  2EKH A;  1OU9 A;  4XU2 A;  5A0L A;  4JLI A;  1JXM A;  2J7I A;  3FC3 A;  2GF7 A;  2GBQ A;  2I2L A;  1GH6 B;  1OL2 B;  4Z8A A;  3WVD B;  2DK3 A;  2WAC A;  1K9M R;  3ZFJ A;  4X34 A;  1UGP B;  1QLY A;  2XID A;  1X2K A;  5GJW B;  1WDX A;  4OML A;  1M90 U;  3JB9 D;  2EBP A;  3JB9 G;  2EWN A;  5GMK m;  3FB9 A;  1OIU B;  1W4S A;  3JV3 A;  1TS9 A;  3VS4 A;  1VQL A;  1H8K A;  1KD1 C;  4ROE A;  5KYX A;  4M75 F;  1RI9 A;  4BE2 A;  2OTJ A;  3G6E T;  3IQL A;  1XQH A;  5EC7 A;  1YN8 A;  3EOC B;  1NLO C;  3OY9 A;  4BCJ B;  4M78 D;  1VQM A;  2DIL A;  1Q7Y R;  1YJN A;  2DA9 A;  4M78 G;  3QII A;  1PSE A;  4ZN3 A;  2GTO A;  5CR2 A;  3EG9 B;  2DYB A;  3DL1 A;  4CI0 C;  5LQF B;  1UNH D;  1TUC A;  3VS6 A;  4F7J B;  2DER A;  3CCV Q;  2MWO A;  1K8A R;  1UE9 A;  1VQN Q;  2LCS A;  1UNL D;  3MI9 B;  2YRD A;  2CZ1 B;  1AVZ C;  1HK9 A;  1YHQ Q;  4JX5 A;  2IPO B;  2K5L A;  2O2O A;  4M7D C;  4QVD A;  3M54 A;  3CCM Q;  3GNG A;  4FYW B;  1SG5 A;  2FL7 A;  4N4H A;  1Q81 R;  5CEI B;  2ATC B;  4Y28 E;  1H92 A;  2HAX A;  1YCY A;  1BB9 A;  2CP2 A;  4PJO D;  3GOX A;  2DVJ A;  3OSV A;  4PJO G;  3BHT B;  3HRT A;  5DY9 A;  1NZ9 A;  4F17 A;  5J26 A;  5HCK A;  5HKC A;  4BI4 A;  1SKU B;  2E3I A;  4BCF B;  1SF9 A;  3P8D A;  4MZM A;  6AT1 B;  1N4M A;  1ZUY A;  3ME9 A;  3B57 A;  1ENW A;  1JST B;  2W9F A;  4EOR B;  2DME A;  2DL5 A;  4CFM B;  1TXQ A;  1NJI C;  4CFX B;  3EFO B;  1JRI A;  1WJS A;  3JCM g;  3UWN A;  4C92 D;  2KQW A;  5EJC A;  3TNI B;  4C92 G;  4I3Z B;  2FVU A;  2UUE B;  4II5 B;  2EGC A;  3CPW A;  3QYG B;  1JQQ A;  2RJE A;  2LQ8 A;  1PWT A;  1QVF S;  2FYK A;  2BE9 B;  3KBG A;  1JJ2 P;  1K73 C;  2PZ1 A;  3FIF A;  2LJ0 A;  3HBL A;  4JS5 A;  4Z88 A;  4M7D B;  4HNT A;  2JW4 A;  5GAN 8;  2QQB A;  5A0G A;  4XTY A;  1WX6 A;  1WPY A;  1VIF A;  4HCC A;  2MYS A;  3M4G A;  3R6N A;  2VXE A;  1KD1 R;  1H1Q B;  2J05 A;  2F2X A;  2V8I A;  5ACB A;  2KMT A;  3H41 A;  3JB9 F;  3URG A;  2LQW A;  1JOW A;  5FRM A;  2ZPI B;  1Y71 A;  2CP5 A;  2CCH B;  4M78 A;  1SRM A;  1QVP A;  2DL4 A;  3QXE B;  1UG1 A;  2DF6 A;  3MEA A;  2QAS A;  1VQ9 A;  4BY6 C;  3F70 A;  4DOV A;  2JXB A;  4BE0 A;  5I2M A;  2K9G A;  5KYY B;  2QEX A;  1KQS A;  3KFV A;  3CCE Q;  1NG2 A;  4M7D D;  1M27 C;  4M7D G;  1VYW B;  3UT1 A;  2Y4Y A;  1Q95 G;  2DMO A;  2RQR A;  4A4G A;  5CCA A;  3DJB A;  3NMZ C;  2DE0 X;  3VS5 A;  3PVQ A;  2ENM A;  3G33 B;  2QG9 B;  4A53 A;  3OYM A;  3I55 Q;  4JJN K;  1BCO A;  3M0U A;  3CD6 A;  4E7I A;  4PJO A;  2B9R A;  1QVG P;  3OYN A;  4Y92 A;  3PIO A;  5GAM j;  1M1K C;  1RI0 A;  4BCP B;  2I40 B;  5IAY A;  3VS2 A;  4EOM B;  1WXT A;  1R8O B;  2VVK A;  4CC2 A;  1V1C A;  2JTE A;  4ZN1 A;  4M77 A;  5FW9 A;  1O9K A;  4FU6 A;  5LJ5 g;  1GFD A;  1UEB A;  3EG3 A;  5I11 A;  3QDR B;  1OPK A;  1BI0 A;  2E6N A;  2FO0 A;  4HNV A;  1ABO A;  4MZP A;  2FZK B;  2KRM A;  1VQ6 A;  3QO3 A;  4C92 A;  2YT6 A;  4OGC A;  3QBY A;  2O88 A;  1LCK A;  1S72 T;  4PFO A;  1ZX6 A;  3RIR A;  4AFS C;  1NJI R;  3ZEH A;  3CXC P;  1JB0 E;  1R77 A;  1K0X A;  2EYY A;  3LGF A;  4LDV A;  4ZGE B;  2YDL A;  5GAM d;  4B6M A;  3L2Z A;  3UPU A;  1J3T A;  4BCH B;  2P84 A;  4XTV A;  3BLR B;  4JRI A;  2LMJ A;  4EMH A;  2RHX A;  1SHF A;  2EKO A;  3D7S B;  3RDV A;  1K73 R;  4AKI A;  3C95 A;  3CCE T;  1XNI A;  4E47 A;  2CCI B;  1YCS B;  4BDZ A;  3TW6 A;  1HJD A;  2H3E B;  4JJC A;  3G7Z A;  3GP8 A;  5DLO A;  3V8J A;  2AKL A;  2GNC A;  2C5O B;  2EJG A;  2L3Q A;  3QWY A;  2J6O A;  4IUV A;  3SEM A;  5HVY B;  3MEU A;  4RCC A;  4D8D A;  3HPW A;  4AG1 C;  1UJY A;  2KDS A;  2E5K A;  2C0I A;  3I56 A;  3QZ9 B;  3JCM J;  3A98 A;  2YRV A;  1W2B A;  2ZPB B;  3G4S A;  3CC4 A;  3G71 A;  2RHU A;  1B34 A;  5GMK j;  4F6U B;  2RM4 A;  4WF2 A;  1A0N B;  4KRT A;  4RTZ A;  1PRL C;  2KT1 A;  4PJL A;  1RAH B;  3OYK A;  2L89 A;  4OVA A;  1SSH A;  2EGE A;  3VS7 A;  2G77 A;  1H28 B;  2ED1 A;  2NUP A;  1QKW A;  2E6Z A;  4M7D F;  3C0C A;  2VYT A;  4BE1 A;  1PD0 A;  2LT4 A;  3O0G D;  2EQU A;  5EFQ B;  3S3O A;  4KH0 B;  1URC B;  5FRO A;  1ACM B;  3EGD A;  1M1K R;  5CQY A;  2KVQ G;  1D0X A;  2X4X A;  3L2U A;  1OEB A;  2ZZD A;  1WHM A;  3H9N A;  1X6B A;  3VKI A;  2KYB A;  2NUZ A;  4Y91 A;  2M1H A;  4ZTJ A;  4XTX A;  2RN8 A;  3K7A M;  3VRZ A;  1YI2 A;  5GAN h;  1FMK A;  4OMM A;  2PUK B;  2RQT A;  1SPK A;  2O01 E;  4J6X A;  4J8O A;  4MDW A;  4ZGD B;  1OZ3 A;  1S1N A;  2LVM A;  2QQR A;  2D1X A;  5IH2 A;  2DXB B;  3CCQ T;  4FL6 A;  2J6K A;  4V2S A;  2E1H A;  2VB6 A;  1O9S A;  2L3P A;  2F2W A;  3CCR Q;  3A5Z B;  3RKW A;  3KXT A;  1AHJ B;  4EMG A;  1CSK A;  5IHK A;  1GBQ A;  5GAM f;  3MET A;  1B3Q A;  4XU3 A;  3JRZ A;  4BI8 B;  3REA B;  4OMF B;  1KQ2 A;  2JVV A;  4BXX X;  2DJZ A;  4N0A A;  1IGQ A;  1TH7 A;  4E7K A;  2RH2 A;  5CAI A;  3CPW S;  3OS0 A;  3AT1 B;  1ZA2 B;  1VQ4 A;  1UFF A;  3MIA B;  3SWN A;  4M6V A;  4HT9 A;  3CCL A;  1UHC A;  3H0I A;  1UHF A;  4RTW A;  1U1S A;  1TG0 A;  3S3M A;  2Y4X A;  3LWI A;  3CC2 T;  3OYJ A;  1KG1 A;  1M30 A;  1BYM A;  2WSC E;  2SEM A;  3ER0 A;  2XIC A;  5CYI B;  4UN0 A;  1N27 A;  2DIQ A;  3INZ A;  2Z0W A;  3JCM W;  3DOG B;  2QF7 A;  1Q7Y U;  1YP5 A;  2GQI A;  3OYE A;  3CCU Q;  2EIF A;  5HY6 A;  4C5H A;  4F7L B;  1SHG A;  2UZE B;  4C0G A;  3CCS Q;  2X9H A;  5IF1 B;  4F04 B;  1K8A U;  5DQW A;  4JX4 A;  1KQS S;  3N5B B;  2DZC A;  2OI3 A;  4OF1 A;  2DLP A;  3M03 A;  3CCR T;  1FYN A;  2OX7 A;  3P8B B;  5FWC A;  1MMD A;  4NS5 A;  2K3X A;  2DPP B;  4CXA B;  3HRU A;  1G3N C;  1NPP A;  1LJO A;  2EQI A;  1Q81 U;  3RUX A;  4A4E A;  1KHC A;  2QFZ A;  2HZY A;  4FIB A;  4MZT A;  4RTX A;  2DTO A;  5KYX B;  3NFC A;  1VOL A;  1WHL A;  1H3Z A;  5IT9 E;  1OPL A;  2QQ9 A;  4GBQ A;  1WI7 A;  2XDP A;  3A8G B;  3LWH A;  1UJ0 A;  1C9B A;  4F7U E;  1AD5 A;  5GAO q;  3FRN A;  1C1A A;  2AZV A;  4EOL B;  3BE3 A;  3OMG A;  5CKD A;  1T0J A;  1D1A A;  1OL1 B;  1YIJ A;  5CKB A;  3EID B;  3CEY A;  4DQ2 A;  4BY7 X;  4VUB A;  2JOY A;  1Q82 R;  4PJM A;  4AI6 A;  3M0P A;  4AT1 B;  2DYI A;  4BDY A;  2CP3 A;  2QA4 Q;  1BU2 A;  4DOW A;  4PJN A;  3CCJ A;  4JRQ A;  4BY1 X;  3VYG A;  4C0Z A;  1ARK A;  4PLL A;  3UF4 A;  2QQ8 A;  3UAT A;  1WHJ A;  2LZ6 B;  1VQK A;  3HO8 A;  4OMN A;  1DJ7 B;  1MUZ A;  1VQP A;  3OYC A;  4EOP B;  1I81 A;  1VQ7 Q;  5LMK B;  2RK2 A;  4O6J A;  4MML A;  2OTL A;  2V1R A;  2M51 A;  3X25 B;  4A54 A;  4BCN D;  3VKH A;  4ESR A;  3HL8 A;  4LXC A;  4A4H A;  3E9G A;  1PM3 A;  1D1C A;  2V8K A;  4P5N A;  1Y7X A;  2ZPG B;  3CMA T;  4ZGJ B;  1N6A A;  4HVV A;  2XU8 A;  3BDU A;  4PFZ A;  4M77 E;  1BKB A;  3PVL A;  4L59 A;  2DX1 A;  1OQK A;  4JLG A;  5CIU A;  3J7A F;  4QQ6 A;  3OBY A;  3EGX A;  5HQ0 B;  2IVW A;  4ZTF A;  2K5I A;  1W2B S;  4X9D A;  3SD4 A;  2HNI A;  3OS1 A;  1YNZ A;  1TTH B;  1X69 A;  1NPR A;  1V76 A;  2EW3 A;  5M9O A;  3M56 A;  3M0Q A;  1AWO A;  2FPD A;  4BB7 A;  5GAN 4;  1M2V A;  2EQJ A;  5KYW A;  1WFW A;  1FMV A;  2NLU A;  2COW A;  1M8M A;  1K0S A;  1UEC A;  1VQL Q;  2WIH B;  1E9H B;  2JS2 A;  3MEV A;  4R0K A;  2K79 A;  4M77 C;  2K57 A;  2QA4 T;  3PT9 A;  2KK4 A;  3NTI A;  2OTJ Q;  4PJJ A;  1YJW T;  5L8R E;  1GY3 B;  3CC7 Q;  4Z02 A;  2FEI A;  3JB9 H;  2E10 A;  4FT4 A;  5KH6 A;  4BCM D;  2BZ8 A;  3O5Z A;  4C92 C;  1G3T A;  3RES A;  4M78 B;  1VQM Q;  5I2S A;  3FEO A;  2LT1 A;  1YJN Q;  3QUI A;  3G6E A;  4BCQ D;  4F6S B;  2CS7 A;  2KE9 A;  4ELJ A;  1YJ9 T;  2NUT A;  4OB0 B;  1MND A;  1M3C A;  4CFN B;  1I5O B;  4KGV B;  1T3S A;  1H1P B;  3PTA A;  1R0B G;  2L5Q A;  2MMP A;  5GMK e;  2G6F X;  3ASK A;  4J9E A;  3MP6 A;  3CC7 A;  1E6G A;  3TVT A;  1ABQ A;  2BIV A;  1B07 A;  1WJQ A;  4PJO B;  4IMY B;  1LOJ A;  1GRI A;  4F70 B;  2K2V A;  1NE8 A;  2H8H A;  3EHQ A;  2XDB A;  3JB9 I;  4A63 B;  2IIM A;  1IB8 A;  4FYY B;  4JRP A;  3BFM A;  1ZUK A;  2K6D A;  3UDC A;  4B9W A;  1AT1 B;  4O5V A;  1HYO A;  2P0P A;  2EPD A;  2RI3 A;  2OJ2 A;  2K5F A;  4C92 B;  2E41 A;  1ZSZ C;  2LNV A;  2CH4 A;  4HVW A;  2E3H A;  1RAE B;  4BUG A;  1YWP A;  1QVF P;  4DA4 A;  1QKX A;  5LJ3 e;  4FM4 B;  5HNB B;  2FPF A;  1M2O A;  2AKK A;  2DXT A;  1D3B A;  2E5Q A;  1VIE A;  5FU7 C;  2DBK A;  3M55 A;  1YJN T;  2M16 A;  4EMK A;  3BW1 A;  4F7N B;  2BE7 D;  2DRK A;  2QTX A;  2DXC A;  2HQE A;  4M77 D;  3OYB A;  4M77 G;  1VQO Q;  1Y96 A;  2R7G A;  1VQ8 A;  3M53 A;  2CH4 W;  1YWO A;  4C8Q E;  2CDT A;  3TN8 B;  3I9Q A;  3BDL A;  3HRS A;  3L2V A;  3U23 A;  2DNU A;  3M57 A;  5FRN A;  1M1K U;  1FXX A;  3JCM V;  4EIK A;  1IZ6 A;  2YLC A;  3MEW A;  1N8R U;  4J7F A;  3C12 A;  3CME A;  1AWJ A;  1WQW A;  4ELZ C;  3TNW B;  1KC8 U;  1VQ9 Q;  1AZE A;  3OMC A;  2LCC A;  3OS2 A;  3MJX A;  3A8L B;  2QEX Q;  2GFU A;  2FZG B;  1WGS A;  3CCV T;  1OI9 B;  1VQO A;  4C8Q C;  5IHY A;  4F7U A;  1VQN T;  5IXB A;  1D0Z A;  3QHW B;  4MDX A;  1B34 B;  5CK9 A;  4E7J A;  2VGM A;  4OP0 A;  1YHQ T;  3CCM T;  4KH1 B;  4N0A C;  1IHV A;  2QTV A;  5FU7 B;  5GMK i;  2RPN A;  3CD6 Q;  2LC4 A;  3BG3 A;  2NUP B;  3LW5 E;  3VS0 A; 
#chains in the Genus database with same CATH homology
 1QVF A;  3T9N A;  1Q86 C;  4M75 A;  4J5Y A;  4PKC C;  2M9U A;  5GAM g;  3O8V A;  1G3Y A;  4A4F A;  4QVC A;  3OYK A;  2LDM A;  3OYF A;  4HKE A;  4F7U G;  4JUV A;  3OA6 A;  1QLB A;  2L89 A;  4OVA A;  4UC4 A;  4PNO A;  1YIT A;  3QSU A;  2RD1 A;  3SWN C;  3C4S A;  1BI3 A;  2G77 A;  3LYI A;  3JCM c;  3GLX A;  4A4K A;  3LLR A;  5GAN 7;  2XK0 A;  4XTW A;  2E6Z A;  1I4K 1;  2ZZD B;  4QVZ A;  3OYL A;  1M4Z A;  2GCX A;  3X26 B;  1M1F A;  4M7D F;  4IUQ A;  2VYT A;  3CCU A;  3OW2 A;  4BE1 A;  3CXC A;  2LT4 A;  1QW1 A;  2EQU A;  1K9M C;  2WSE E;  4C5E A;  1K73 U;  4M7A E;  2QQS A;  3S3O A;  3H6Z A;  5HK0 A;  3GPL A;  5FRO A;  4JS4 A;  3CCS A;  1U1T A;  1EIF A;  3CBO A;  2DAQ A;  4M78 F;  5CQY A;  5A0D A;  4M75 D;  2KVQ G;  2X4X A;  3L2U A;  2ZZD A;  4M75 G;  3VKI A;  2XD0 A;  5KE2 A;  2EYQ A;  4Y91 A;  2WJ9 A;  2M1H A;  3NTH A;  4XTX A;  4ZTJ A;  2KSS A;  4QSH A;  1X01 A;  2B8A A;  2EJF A;  2K4Y A;  4M77 B;  5GAN h;  5GAO l;  1YI2 A;  1VQ5 A;  4LDU A;  5GMK h;  3JB9 J;  4M7D E;  2PUK B;  2HBP A;  1O75 A;  2HD0 A;  1M1G A;  3DLL A;  1WQ7 A;  4R55 A;  2O01 E;  3CBM A;  4J6X A;  2BUD A;  4J8O A;  1S72 A;  1VQL T;  4MDW A;  4ZGD B;  4M78 E;  3VV0 A;  1OZ3 A;  2QQR A;  2LVM A;  2RHZ A;  4BD3 A;  2XHC A;  2LRQ A;  1FWZ A;  2D6F A;  3HHT B;  4ATO A;  2LQK A;  2O4X B;  3HKS A;  2DXB B;  2JN0 A;  2EQK A;  2OTJ T;  2P4T A;  4LDY A;  4FL6 A;  3QYE A;  2XI9 A;  3L2W A;  4AKH A;  2E1H A;  2QEX T;  3GF5 A;  3CCQ T;  1O9S A;  1YIJ T;  1Q86 U;  4V2S A;  1V29 B;  3A5Z B;  3CC7 T;  3DLM A;  2DXC B;  3RKW A;  3KXT A;  3TW7 A;  2QDJ A;  1GXI E;  1Q7Y C;  1AHJ B;  4EMG A;  1UGR B;  2KR6 A;  4PJO F;  5GAM f;  3QWL A;  3HFO A;  2O4X A;  2Y90 A;  2K3Y A;  3MET A;  2DXB A;  3LH0 A;  3V7S A;  1VQM T;  4XU3 A;  2P0Q A;  4X9C A;  2ZPH B;  4HT8 A;  3JRZ A;  4BI8 B;  4L5G A;  4OMF B;  3EFS A;  1KQ2 A;  3DB3 A;  4XU0 A;  4MFE A;  2JVV A;  5GAM e;  2DJZ A;  4N0A A;  4Q5W A;  3BG9 A;  3PFS A;  5CO7 A;  4BY6 B;  3CCJ T;  1K8A C;  2P0K A;  1TH7 A;  2RO0 A;  2RH2 A;  4E7K A;  5CAI A;  4KBM B;  4M77 F;  3V8L A;  4KUD K;  3CPW S;  1PSF A;  4C5I A;  5CKF A;  1N9R A;  4M78 C;  5KCO A;  3QYH B;  4QQG A;  3OS0 A;  5J39 A;  4C8Q D;  2PUO B;  2RA2 A;  4ME7 A;  5GAO p;  4MMK A;  4PJO E;  5LJ3 h;  1OI1 A;  2KMG A;  3PGG A;  4C8Q G;  1VQ4 A;  2R5M A;  1VQP T;  2QA4 A;  4C92 F;  3SWN A;  3VU3 C;  1Q81 C;  3M59 A;  4M6V A;  4HT9 A;  3CCL A;  4OB3 B;  4IUR A;  3JAM E;  1U1S A;  1LNX A;  3ZBD A;  1M90 C;  3L2R A;  2Y4X A;  2VGN A;  4L6V 5;  4EDU A;  3MP1 A;  1WNL A;  3OYJ A;  3LWI A;  3CCV A;  2DO3 A;  3CC2 T;  4PL6 A;  2OTL T;  1VQN A;  3RER A;  1KG1 A;  1BYM A;  5D6X A;  1MHN A;  5GAN g;  2WSC E;  3S6W A;  2MWP A;  1Q81 U;  3MP8 A;  3OYY A;  4NL2 A;  4XTZ A;  2XKO C;  4IUP A;  4J83 A;  1YHQ A;  2RJF A;  3ER0 A;  3Q1J A;  3QPH A;  3CCM A;  4C0D C;  2XIC A;  4LOC A;  2DIQ A;  1N27 A;  4C92 E;  2WSF E;  4AKG A;  3INZ A;  4HCZ A;  4RKU E;  3M9Q A;  2IG0 A;  2RK1 A;  3J80 E;  5GAN 3;  3JCM W;  1Q82 U;  1VQ7 A;  3KHI A;  2CZ0 B;  1OYX A;  2QF7 A;  4IKF A;  2H3J A;  1M9S A;  1Q7Y U;  1XOV A;  3DKM A;  3QG1 A;  4NOY A;  3OYE A;  4PJO C;  1QP3 A;  1IRE B;  4XU1 A;  5LJ5 e;  2EIF A;  5HY6 A;  4KUL A;  2F69 A;  4FSX A;  3OBW A;  5CKH A;  5HK3 A;  4C5H A;  2DEQ A;  5CQX A;  1VQ8 T;  3E9F A;  4C0G A;  3QHS A;  1K8A U;  3EAE A;  1UB4 A;  3OYG A;  5I21 A;  4JX4 A;  4OB2 B;  1M8V A;  3RMQ A;  4KUI A;  4QQD A;  3WVE B;  3CBP A;  1KQS S;  3N5B B;  2DZC A;  4OF1 A;  3A8O B;  2EQM A;  5GAN j;  4XU2 A;  2JTM A;  3GNF B;  5A0L A;  4JLI A;  2RI5 A;  3X24 B;  3CCR T;  3P8B B;  3FC3 A;  2GF7 A;  2I2L A;  4MFD A;  4NS5 A;  1YBY A;  2K3X A;  2DPP B;  3WVD B;  2DK3 A;  2E64 A;  2WAC A;  3HRU A;  3ZFJ A;  1NPP A;  1LJO A;  4XAX B;  5GAO m;  4X34 A;  1UGP B;  4RG8 A;  3RUX A;  5CKE A;  4A4E A;  4F7U F;  3CME T;  2XID A;  1KHC A;  2OAU A;  2QFZ A;  4FIB A;  4MZT A;  5LJ3 g;  1M90 U;  2C06 A;  5CVI A;  2DTO A;  3JB9 D;  3RKX A;  3NFC A;  2DKG A;  3L1A A;  3JB9 G;  4HA8 A;  5IT9 E;  3VYH B;  2EWN A;  4M7A D;  1H3Z A;  1JBM A;  2E65 A;  3QKJ A;  5GMK m;  3FB9 A;  1VQO T;  2QQ9 A;  1W4S A;  4M7A G;  3BY7 A;  1VQL A;  2ZCF B;  1KD1 C;  2XDP A;  3MHX A;  1VUB A;  5KCH A;  3A8G B;  3H4C A;  2HQX A;  2PU9 B;  5GAN 2;  4M75 F;  4F7U E;  3LWH A;  5GAO q;  3FRN A;  4BE2 A;  2CGH A;  3RMS A;  3OMG A;  5CKD A;  3X28 B;  4YTL A;  3JCM X;  3I55 T;  3CCQ A;  1JJ2 S;  3G6E T;  2OTJ A;  2JNG A;  1YIJ A;  5FU6 C;  5KE3 A;  1BI2 A;  3G4S T;  4C0D B;  5CKB A;  1M5Q 1;  3VJP A;  1XQH A;  1G3S A;  3CEY A;  5GAN d;  4HL4 A;  4DQ2 A;  3JCM Q;  4VUB A;  3VYG B;  2JOY A;  3OY9 A;  5GAO r;  2F5T X;  3JCM h;  4AI6 A;  2R57 A;  4C8Q B;  4M78 D;  5LJ3 j;  1VQM A;  1VQ9 T;  3JCM d;  4BDY A;  1YJN A;  4M78 G;  2X35 A;  3QII A;  4RCB A;  4M75 E;  1PSE A;  1YIT T;  4ZN3 A;  4PLI A;  4M7A C;  4DOW A;  5CR2 A;  5D6W A;  3CCJ A;  3DL1 A;  4JRQ A;  4CI0 C;  3S3M A;  3VYG A;  2KY9 A;  2YHT A;  4C0Z A;  4PLL A;  3QJY A;  3SB2 A;  2PVD B;  4C8Q A;  2QQ8 A;  2MWO A;  1VQK A;  4JDS A;  4OGE A;  2CZ1 B;  3HO8 A;  4C5G A;  1HK9 A;  1DJ7 B;  5FLX E;  2PVG B;  1VQP A;  4N4G A;  3OYC A;  1N8R C;  4JX5 A;  2K5L A;  3TCJ A;  4M7D C;  4QVD A;  3M54 A;  3GNG A;  2GQV A;  1I81 A;  1K9M U;  3CCE A;  3TEE A;  1KC8 C;  2FL7 A;  4N4H A;  3SWN B;  2RK2 A;  4O6J A;  2VUB A;  4Y28 E;  2L3R A;  3CD6 T;  4MML A;  4TVR A;  1YI2 T;  1VQ5 T;  2OTL A;  2HAX A;  1YCY A;  4ELY C;  4PJO D;  3GOX A;  3X25 B;  4QW2 A;  4A54 A;  3OSV A;  4PJO G;  3V8K A;  3FDR A;  3HRT A;  3VKH A;  5DY9 A;  3HL8 A;  5J3B A;  5LJ3 d;  1KQ1 A;  1NZ9 A;  4A4H A;  3E9G A;  5J26 A;  5HKC A;  3I55 A;  4BI4 A;  3R6O A;  3OYA A;  2BKD N;  2V8K A;  3P8D A;  2DVE A;  3TRE A;  4P5N A;  1Y7X A;  4MZM A;  3TU4 K;  2ZPG B;  3CMA T;  4ZGJ B;  1N6A A;  2XU8 A;  3BDU A;  1G5V A;  4M77 E;  3H8Z A;  3L42 A;  3ME9 A;  4ZTF A;  1BKB A;  3OB9 A;  4LDW A;  2KAF A;  4L59 A;  2PVO B;  5GAO n;  4JRK A;  2DIG A;  4JLG A;  1VQ6 T;  2JTF A;  5CIU A;  1QVG S;  3J7A F;  2MI6 A;  4QQ6 A;  3OBY A;  1NJI C;  1XTD A;  2IVW A;  3MCA B;  5AYF A;  3SFM A;  3E1S A;  4BAC A;  2K5I A;  1JRI A;  3A8H B;  1WJS A;  3JCM g;  3UWN A;  4C92 D;  5LJ5 j;  4X9D A;  2KQW A;  4XQ3 A;  3SD4 A;  4J7I A;  1U8R A;  5EJC A;  5EG2 A;  2RHY A;  4C92 G;  2HNI A;  2DXU A;  2FVU A;  2LX9 A;  4WF2 A;  3OS1 A;  1NPR A;  2MAM A;  5M9O A;  3CPW A;  3FLG A;  3M56 A;  3QYG B;  3EFR A;  4M7A B;  3VUB A;  4J6Y A;  4BB7 A;  2RJE A;  2BS4 A;  2LQ8 A;  3PMI A;  2EQJ A;  5GAN 4;  1QVF S;  2EJ9 A;  2NLU A;  2FYK A;  3KBG A;  1UGQ B;  4C0F A;  1K73 C;  5A2Q E;  1VQ4 T;  3MEV A;  4CRI A;  2X4W A;  2K57 A;  4M77 C;  3FIF A;  2QA4 T;  5C6S A;  3PT9 A;  4M7A A;  4FT2 A;  2KK4 A;  3CPF A;  3NTI A;  3A8M B;  3HBL A;  3CCL T;  4R56 A;  2YLB A;  4JS5 A;  4M7D B;  4HNT A;  3OW2 S;  3PMT A;  3CXC S;  1YJW T;  3WXM B;  4LD6 A;  5L8R E;  2BS3 A;  2QQB A;  5GAN 8;  4Z02 A;  5A0G A;  3JB9 H;  2JZ2 A;  2E10 A;  4RG2 A;  2QI2 A;  3DB4 A;  3M4Y A;  4FT4 A;  5KH6 A;  4C92 C;  3OYD A;  4KT0 E;  1G3T A;  4XTY A;  1WPY A;  2VV5 A;  3RES A;  4M78 B;  1VIF A;  4RMO A;  2XG8 D;  3RKY A;  1SSF A;  5LJ5 h;  5I2S A;  1ZBX A;  3M4G A;  3FEO A;  2LT1 A;  2VXE A;  4HCC A;  5LL6 S;  4M7D A;  3QUI A;  4EMK C;  5LJ5 d;  2V8I A;  3S3N A;  3G6E A;  1G3W A;  1N9S A;  2KMT A;  1ZQ1 A;  2FHD A;  3JB9 F;  1E7P A;  3LGL A;  3QYB A;  3URG A;  2CS7 A;  2QQA A;  4ELJ A;  5FRM A;  2ZPI B;  1Y71 A;  1YJ9 T;  4M78 A;  1FX7 A;  1X6O A;  4D6W A;  5GAN f;  3SDZ A;  4OB0 B;  1QVP A;  3QXE B;  3HSB A;  2EAY A;  4IUT A;  3MEA A;  1VQ9 A;  4NC6 A;  4BY6 C;  3PTA A;  3F70 A;  2MMP A;  2L5Q A;  4GY5 A;  5GAN e;  4DOV A;  3I56 T;  3JCM f;  4BE0 A;  5GMK e;  3HP9 A;  5I2M A;  3ASK A;  2R58 A;  2QEX A;  1KQS A;  3MP6 A;  4M7D D;  2DD4 B;  3CC4 T;  3G71 T;  3JCM e;  3CC7 A;  2A7Y A;  2DZ9 A;  4M7D G;  2E12 A;  3J81 E;  3UT1 A;  2Y4Y A;  2EFI A;  2MF2 A;  1FKM A;  2BIV A;  3JSC A;  3OQ5 A;  5C0M A;  2DTH A;  1WJQ A;  4PJO B;  4Z6Y A;  1LOJ A;  4A4G A;  2D9T A;  5CCA A;  1ZHI A;  4GLK A;  4B9X A;  5GAN 6;  2DD4 A;  2K2V A;  1NE8 A;  4XK8 E;  2XDD A;  4A53 A;  3OYM A;  4JJN K;  3PIP A;  3FJP A;  1X75 C;  3CD6 A;  1I5L A;  4E7I A;  4PJO A;  2XDB A;  3JB9 I;  2A3L A;  3OYN A;  3PIO A;  3CCU T;  5GAM j;  1M1K C;  1RI0 A;  4JRP A;  3BFM A;  5IAY A;  3UDC A;  4B9W A;  4O5V A;  3CCS T;  3HFN A;  3NTK A;  3QZ5 B;  1R8O B;  2P0P A;  2LCL A;  2RI3 A;  4ZN1 A;  2QDY B;  4BI3 A;  5DLQ E;  5LJ3 f;  4BBR M;  2K5F A;  4C92 B;  4M77 A;  2E41 A;  1Y07 A;  2LNV A;  1D3B B;  2X4J A;  5GMK l;  4BUG A;  2CKK A;  5GAN 5;  2RJD A;  4FU6 A;  5LJ5 g;  1JJ2 A;  3X20 B;  1UEB A;  3CMA A;  3AHU A;  3QDR B;  4DA4 A;  3CC2 A;  2R5A A;  1BI0 A;  5LJ3 e;  2E6N A;  1KD1 U;  4FM4 B;  3OSS C;  4EMK B;  2LTO A;  1Q82 C;  4HNV A;  2ZPE B;  4JX6 A;  4MZP A;  2G3R A;  4M75 C;  2CZ6 B;  3OYI A;  1VQ6 A;  3QO3 A;  4C92 A;  4OGC A;  3QBY A;  4C8Q F;  2DXT A;  2X4Y A;  1D3B A;  3PNW C;  2E5Q A;  1S72 T;  2E70 A;  4E7L A;  1VIE A;  1UGS B;  3RIR A;  1Y96 B;  5FU7 C;  3M55 A;  2PQW A;  1YJN T;  2M16 A;  3ZEH A;  2RI2 A;  1JB0 E;  3BW1 A;  4EMK A;  4HLQ A;  2QTX A;  2DXC A;  2HQE A;  2ZGW A;  4M77 D;  3OYB A;  1KHI A;  1MGQ A;  3KUF A;  4M77 G;  2CZ7 B;  3LGF A;  4XTU A;  5GAM h;  3MO8 A;  4HNU A;  1I8F A;  1Y96 A;  2RJC A;  4ZGE B;  1H64 1;  3OS5 A;  4LDV A;  5FU6 B;  5DM7 R;  3M58 A;  5GAM d;  1VQ8 A;  2DD5 B;  3L2Z A;  1RL2 A;  1HXD A;  2M0O A;  3M53 A;  1VQK T;  3UPU A;  4N4I A;  4XTV A;  4C8Q E;  4JRI A;  4EMH A;  2DTI A;  1P92 A;  2RHX A;  2EKO A;  4J6W A;  3BDL A;  3HRS A;  3V7R A;  3L2V A;  3VUZ A;  2GFA A;  3M57 A;  5FRN A;  4AKI A;  1M1K U;  3P8H A;  1FXX A;  3C95 A;  3JCM V;  1IZ6 A;  2VC8 A;  3CCE T;  4MIM A;  1XNI A;  3CCR A;  2DD5 A;  1WJR A;  4E47 A;  2YLC A;  1YJW A;  2JUF A;  1OZ2 A;  4BDZ A;  3MEW A;  1QP2 A;  1BI1 A;  1N8R U;  4J7F A;  3C12 A;  3TW6 A;  4IUU A;  3CME A;  2L8D A;  3G7Z A;  3GP8 A;  5DLO A;  3BG5 A;  3V8J A;  1WQW A;  4F7U B;  4ELZ C;  4E7H A;  1KC8 U;  3M5A A;  4BBS M;  3OMC A;  2BS2 A;  2EJG A;  2LCC A;  3HZJ A;  3OS2 A;  4OB1 B;  3E19 A;  3V7C A;  3JCM b;  3QJ6 A;  4IUV A;  1W2B S;  3A8L B;  5LJ5 f;  2GFU A;  4II1 A;  1BIA A;  3MEU A;  1WGS A;  4NL3 A;  3CCV T;  3VKG A;  1VQO A;  1YJ9 A;  2RB6 A;  4RCC A;  4C8Q C;  5IN1 A;  4F7U A;  1VQN T;  3GIB A;  3HB9 A;  3HPW A;  3C94 A;  2D0Q B;  1BIB A;  2F5K A;  2KDS A;  1B34 B;  3LX7 A;  4MDX A;  2QXF A;  3L2Q A;  2AHJ B;  1QVG A;  5CK9 A;  4E7J A;  2VGM A;  4OP0 A;  3I56 A;  1YHQ T;  3QZ9 B;  3JCM J;  4M75 B;  3CCM T;  2YRV A;  2FB7 A;  1W2B A;  2ZPF B;  4LDX A;  4N0A C;  3JCM P;  5D6Y A;  2V8J A;  2ZPB B;  1VQ7 T;  3G4S A;  5FU7 B;  5GMK i;  3CC4 A;  4LD9 K;  3G71 A;  2RHI A;  2RHU A;  1B34 A;  4HCB A;  2LC4 A;  2CYZ B;  4EPC A;  3OYH A;  4M7A F;  5GMK j;  3BG3 A;  1NJI U;  2RM4 A;  3LW5 E;  2VXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...