4FM4B

Wild type fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPAKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title The Fe-type nitrile hydratase from Comamonas testosteroni Ni1 does not require an activator accessory protein for expression in Escherichia coli.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4fm4B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fm4B02
2CZ1B 1UGRB 3WVEB 1PSFA 1UGSB 3QZ9B 3X24B 3LW5E 2PUKB 3X26B 4OB1B 3X28B 1QP2A 3A8OB 2DXCA 4OB3B 4L6V5 1PSEA 2PVOB 4OB2B 1UGPB 2CZ0B 3VYGB 2ZPGB 2PUOB 3A8MB 3A8HB 4RKUE 4ZGEB 3VYHB 2CZ7B 1JB0E 3VYGA 4Y28E 1V29B 2ZCFB 2WSFE 3QYHB 3QXEB 2DD4B 2ZPHB 4OB0B 1AHJB 4FM4B 4XK8E 2ZPBB 2DD4A 2ZZDB 2ZPFB 1UGQB 2AHJB 1QP3A 1GXIE 3A8GB 2PVDB 2ZZDA 2PU9B 3HHTB 2ZPEB 3QYGB 3QZ5B 3X25B 2D0QB 2PVGB 2WSEE 3A8LB 2DD5B 2DXBB 2DXCB 3WVDB 4KT0E 2CYZB 2DPPB 2DD5A 2DXBA 3X20B 2O01E 4ZGDB 2WSCE 2QDYB 5L8RE 4ZGJB 1IREB 2ZPIB 1DJ7B 2CZ6B
chains in the Genus database with same CATH superfamily
3JB9H 2JT4A 4KRCB 2DA9A 2EQIA 3WVEB 2E6ZA 2RI3A 2M0YA 4WCIA 1OIYB 2EW3A 5J26A 1KD1R 1KQSA 4FYXB 3HSBA 4C8QE 1BCMA 2L8DA 5GAOr 3H0FA 2MMPA 1D1BA 2IW6B 5FWBA 4FYWB 3CC7Q 1G2BA 4PJJA 3G4SQ 1XNIA 3EHRA 3CC4T 2X9HA 2XIDA 3A8OB 4BCOB 4QVDA 1O9SA 2LQKA 2WIPB 2QTVA 4AFZC 3LWIA 1VQNT 4QQGA 5GMKj 4GLKA 4AKHA 3MIAB 2BZXA 3VYHB 4HCKA 1WQWA 2YXYA 1VINA 3QJYA 2JVVA 3C94A 1QCOA 1QVFS 2WSFE 2WJ9A 3BDUA 3INZA 3H0HA 3PIOA 2YDLA 3UT1A 1WJRA 5I5ZB 1TG0A 2E5QA 5LJ3g 1AWOA 4LOCA 2DXTA 1WHHA 1VQ4T 4J9FA 4F7SB 4IKFA 4CXAB 2BUDA 4C92D 2KDSA 3THKA 3A8GB 1AD6A 4YOSA 4N0AA 2MPXC 2JJ9A 1O9KB 5IDPB 4C92F 2Y4XA 3CCQQ 1X2QA 4JRKA 2YRCA 1KXUA 4BACA 1D0YA 3QZ5B 3JCMd 1PC0A 4PFOA 5CIUA 3MPUB 3VUBA 5IXFA 4X9CA 4ATOA 4CFUB 4Y72B 3DB3A 3CPWS 1H25B 4LD6A 1IXDA 1WGSA 1UNLD 2PJQA 2CYZB 1OU9A 2PQWA 3IQLA 1B3QA 2UZBB 1TD6A 2DD5A 4JLGA 5IN1A 4C92C 3M0RA 4ZGJB 2JOYA 1E9HB 4M77E 2ED1A 1O9KA 5GANh 1QKXA 3EOCB 1VQLT 3GNGA 1FINB 4F17A 1GCQA 3TVTA 4LUDA 4KULA 2GFAA 1PSFA 4M78B 2CP0A 1GCPA 2AIRB 4RCCA 1BU2A 2BKZB 4J9BA 1MMGA 1YI2A 4B6MA 1WNLA 4F6WB 5ICPB 2V8IA 1H3ZA 3EG2A 3EG9B 4HA8A 3VYGB 2YLBA 4R55A 4JJDA 1W70A 4DBFA 2QI2A 2JNGA 4C0ZA 2V8KA 3SB2A 4M7DG 2FZCB 4IUTA 4BE1A 1X6GA 1OV3A 4IURA 1IZ6A 1G3SA 2KXDA 1M4ZA 1RAAB 5LJ3j 4M78A 3CCLA 3VS2A 2X4WA 4A53A 1J3TA 3REAB 2EVRA 3JB9I 4M7DD 4GBQA 2QGSA 2XICA 2NUPA 3A98A 3DL1A 3SD4A 3OYEA 1NJIU 3CCET 5CKDA 3CCMA 3ZEHA 1QP3A 4NSTB 3EGDA 1M90U 5GMKl 2PVDB 4A54A 4M7DF 3UA6A 2EYQA 4EOQB 2HMAA 1H1RB 1W98B 3FJ5A 3RGFB 4PFZA 5GMKi 1P92A 3OSSC 1YIJA 5AYFA 2CT4A 3SDZA 2MK5A 5IH2A 3O5ZA 1NBEB 2JMAA 1VQMT 2FO0A 2OTLT 3PIPA 3RMQA 4M7DC 1G3WA 3HO8A 2MAMA 4LUEA 5GAN6 3C0CA 1GUXB 2O01E 5IHIA 3CC2T 4YC3B 1ZUKA 5GAN7 2ABLA 2W10A 2J06A 2MWOA 2P0QA 4BCND 2D9TA 2PZ1A 1U06A 2RH2A 1YBYA 1VQKT 2EKHA 1MV0B 2J7IA 5GAOn 3QIIA 3TSWA 1NJIC 3VUZA 4C0GA 1JXMA 1MNDA 3V7CA 2VC8A 1M90C 4OF1A 4RODA 4XTXA 1VQ9A 5IT9E 4NC6A 2RA2A 1I0CA 3DJBA 4ZNXA 1VQ5T 2VGMA 2C0IA 1W1FA 3E19A 4OB2B 1VYTA 1I8FA 2KR3A 8AT1B 4X9DA 2PUOB 4AG1C 4MZMA 2KXCA 2IPOB 1S72Q 3CPFA 4FL6A 4BI3A 4C8QD 1YJ9A 2BE7D 4AFSC 2QTXA 2KT8A 3RESA 1FMKA 2YLCA 1AHJB 3EGUA 1N8RR 3EH2A 5KYWA 4C8QF 2WPAB 4F7UB 5C0MA 5GANf 1W2BA 3GIBA 2PK9B 3RKWA 1WYXA 1G8XA 3V8JA 4CRLB 4LNPA 2EQKA 4JDSA 3P8HA 4ZTJA 1U5SA 1IRXA 4Q5WA 3J81E 1KQSS 4EPCA 2KY9A 2F2WA 2OTJQ 4WF2A 2IN3A 5HBHB 1YNZA 5GMKh 2JTFA 5IHKA 4I3ZB 2AZVA 4UC4A 2K5IA 2LT1A 4C8QC 2R57A 2DE0X 2ZGWA 1TU0B 2DVEA 2RK2A 2DVJA 2IVXA 4PK4A 2HSPA 1RUWA 2EJGA 1HJDA 4F7UA 3MKDA 2WEVB 5DQVA 3KXTA 2L89A 2QEXT 2DXBB 4EOOB 2FZGB 1UG1A 4G6LB 5CCAA 4TVRA 1H28B 3CQTA 1M9SA 2W9FA 3I56Q 3JB9J 2WSCE 3JCMP 2SEMA 2D8JA 1M8MA 3HFNA 2CP3A 3QDRB 4YOOA 3UATA 1QVPA 2DTHA 1VQPA 3M0TA 4OVAA 2Y4YA 1KC8U 1Q82R 1Q86U 1E6HA 3PE0A 2F69A 2P4RA 4CFMB 4E7HA 3V8KA 3O8VA 4M77D 2W9ZA 1NLOC 4MDXA 3FC3A 2M0OA 2ESWA 3MY1B 1LNXA 1Y57A 2DKGA 2RJCA 1G5VA 3UPUA 3NTHA 4EOKB 4ME7A 2G9XB 1VYWB 4N4IA 2WXVB 3KHIA 4M77F 1C6VX 2JXBA 1PKDB 3CCUQ 1H1PB 3OYHA 3M56A 3RR6A 1WIEA 1K9MU 2NWMA 4OB0B 1B34B 4BDZA 2DYIA 3VKIA 3CMAQ 3LGFA 1TS9A 4PJMA 1E7PA 3OA6A 2B9RA 1UGVA 1VQNA 3EAEA 2ZZDB 1O75A 4CFVB 4HCCA 1PD1A 3E2UA 2V1RA 1JO8A 4M77C 3SWNB 3TW7A 2BS4A 3BY7A 1KC8C 1Q86C 1WXBA 3JCMX 1MUZA 4CC4B 2XD0A 1AZEA 3LYIA 3BE3A 5ECAA 1NPRA 1SPKA 2FRYA 2J6FA 2X3XD 3JCMb 3CCVQ 4GLMA 4XAXB 1ABOA 3H8ZA 1AOJA 1VQ4A 1B34A 1VQOQ 2X4YA 3CC7T 1UFFA 1FMVA 1D1CA 5LJ3h 3OQ5A 2A7YA 2E5KA 2EYXA 1R77A 1RAEB 5DQWA 1AEYA 4MMKA 2LQWA 1I1JA 2CP7A 5L23A 3SWNA 1K9MC 1D09B 3EG3A 1F5QB 5HKCA 4M78E 1PD0A 2KRNA 2VXEA 1ZSZC 2H3JA 5AT1B 2DZCA 4XU2A 1LJOA 3U23A 5KYYB 2NUTB 2D6FA 4OB1B 3OYAA 2NUZA 5M9OA 1IB8A 3GLXA 3OB9A 1TOVA 1NEGA 2ZAEA 2YHTA 5A0GA 4MDWA 2D0NA 2LMJA 2C0OA 3CCQT 4EOSB 2H8HA 2X4JA 2HDAA 1JB0E 2JZ2A 3META 2RHYA 3QYHB 1YP5A 5KYYA 1VA7A 2K3XA 2DIQA 4M75B 1KJWA 3NTIA 2E10A 2EAYA 1GFCA 3VS1A 2NUTA 2QASA 4NOYA 5KYUA 2DD4A 2O9SA 5A0LA 2DK3A 1OEBA 1X69A 2DNUA 2LRQA 1YCYA 1UGQB 2FPFA 1G3YA 2IG0A 2K5LA 1RI0A 4AKGA 3M55A 2LNHB 3PVLA 3A5ZB 4RTVA 4EMKB 1WLPB 2DL3A 5IXBA 1BBZA 1RABB 3BHUB 3GTMS 4D6WA 1QLYA 1AWXA 1VQ6Q 3FRNA 4M75A 4PJNA 1KQ1A 2VV5A 3CCEA 1WHJA 2QYZA 1VQ8Q 4F6UB 2DZ9A 1JSTB 2BTTA 1BI0A 1Q81U 1QQJA 4BD3A 3EJ1B 5D6WA 3OS1A 2PMIB 4HKEA 3O0GD 1RI9A 1W4SA 3NPFA 4FYYB 4EMKA 2EQMA 4B9XA 4F04B 3JB9D 2CCIB 3QJ6A 2W96A 4IUPA 3F5XB 1M3BA 3HRSA 4OGCA 2K79A 2OJ2A 3I55Q 3CMEQ 3LQ5B 1AISB 1QVGP 3QWLA 1Q7YR 1CSKA 2VWFA 3C95A 1VQMA 3QKJA 2DXUA 1JU5C 4KBMB 3JB9F 1OZ3A 4FIBA 3DB4A 2J6KA 5EC7A 2DJQA 2M9UA 1SEMA 2RHIA 3OYLA 1IO6A 5KH6A 3CC2A 2E3IA 4QVCA 4VUBA 1K73U 3MI9B 3M0PA 3UA7A 1VQ7Q 3FB9A 1PSEA 5HY6A 4JX5A 4AI6A 4OMQA 1VQKA 1JBMA 5LJ3e 3G1JA 2QG9B 3A8HB 4RKUE 2JMCA 3BG3A 5LJ3f 2CZ7B 2YRDA 4F7UE 3GNFB 1Q81C 1C0MA 3EFRA 5HVYB 1E7OA 4A4EA 4FM4B 2MWPA 3OMGA 1GFDA 1VQ5A 2KRMA 2JUFA 4OMOA 3POMA 5GAOm 2HAXA 5GAN3 2XMFA 1WHLA 4XTUA 4AKIA 1F1BB 1MHNA 2EPDA 3QUIA 3DDQB 1TWBA 2CSQA 3QHSA 1QMCA 4QKUA 4DEXA 4BCHB 3G71Q 1MGQA 2MYSA 3NTKA 3FIFA 5GAMg 2G77A 2XG8D 5HNBB 2QQAA 2RQRA 4MIMA 5D6XA 1K73C 2YSQA 5LJ5g 3H0IA 3CD6Q 1B7TA 2O88A 4N0AC 5CQXA 2VASA 2W0ZA 2HNIA 1TTHB 1RL2A 1WZOA 3A8LB 2DD5B 1VYVA 4JRPA 4CFUD 3OS5A 4V2SA 4X34A 2QFZA 2UZLB 3PNWC 3UDCA 4BY6B 5I21A 2E1HA 1OU8A 3PMTA 3BDLA 5BNJB 3NGPA 4GY5A 2YUNA 1S72T 1Z9QA 4PNOA 4XTYA 3FJPA 1OI1A 3VS0A 1K1ZA 2CSIA 3CXCP 3Q1JA 3F70A 4M78G 2K4YA 2W2HA 1EIFA 1K8AR 3VS5A 1HK9A 4QQDA 2QEXA 1RAGB 1OYXA 2C4GB 2CGHA 3X28B 1WDXA 3OS2A 4CFWB 2RJDA 4M7AB 4M78D 1UDLA 1K0SA 1YCSB 5HK3A 2FPDA 4II5B 4F16A 1UGPB 3J7AF 2OTJT 1YHQQ 2HZYA 2RHXA 2VYTA 4M78F 1LPLA 2KE9A 2O2OA 4HCBA 3LH0A 4FSXA 3V7RA 1X6BA 3FLGA 1GH6B 1H24B 2NUPB 3I35A 3MEUA 1R0BG 3I5RA 1UHFA 1M2VB 5CYIB 1N6AA 3OMCA 3M58A 3QDFA 2OAUA 4RTWA 3EGDB 4M7AA 2I40B 1H1QB 2DO3A 2YUPA 4QVZA 3I56T 1XTDA 1PHTA 5HK0A 5A2QE 4M78C 2X1NB 5HQ0B 1N8RU 1KHIA 4F7JB 2LX7A 4JPBW 4XTWA 4R0KA 1G3TA 3G6EQ 1PKSA 4XU0A 5FROA 1P5EB 1YWPA 3SHWA 5LJ5j 3TNWB 4MZPA 4BBSM 2WACA 3ZBDA 3TW6A 3M03A 3DLMA 2ROTA 2L3PA 2DL8A 4RUGA 3QHRB 4BB7A 1MMDA 2JS2A 3JCMg 1M2VA 2LZ6B 2DIGA 4BCJB 3MO8A 4JUVA 4Z88A 3QYEA 1UJ0A 2DMOA 4HCZA 3RIRA 2CJMB 2LTOA 2C5VB 3HRTA 2BZYA 2MI6A 2QDYB 2FG0A 1N9SA 4JRIA 3GOXA 3MEVA 3OYMA 4HT9A 2K7AA 3OW2P 2CZ6B 2LW4A 4LN2A 4PFPA 3DKMA 1RAIB 3CC7A 3G4SA 2RHZA 4LD9K 1UGSB 3MCAB 3X24B 1ZHIA 3X26B 3OBYA 1N8RC 2QF7A 1OZ2A 1LCKA 1YJWQ 3OY9A 1YITQ 1MNEA 5EJCA 1VOMA 4XU3A 3TU4K 1WX6A 2IVWA 4F6SB 3CCRQ 2VKNA 2K2MA 4OB3B 3V8LA 4L6V5 3NHNA 4IUUA 1FX7A 3JCMW 1Q82U 3CC4Q 3S3NA 4XTZA 3OYJA 1QVGA 3CCJQ 2ZPGB 4M75E 1K4US 2RHUA 2EYWA 2K6DA 4EMHA 5ACBA 2M02A 2QXFA 5FW9A 2QA4Q 3CCVT 4DOVA 3KFVA 4HVUA 5KYWB 4Y28E 1V29B 4A4GA 2HBPA 3JCMc 2E64A 3RERA 3AT1B 3M0SA 4F7UG 1VQOT 2X35A 1FVVB 5FRNA 4QQ6A 1YN8A 3URGA 3MEAA 5GANd 1A0NB 3CCQA 2RI2A 4HVWA 4EIKA 3OYYA 1SSHA 5IAYA 2O9VA 3VU3C 3HHTB 2LX9A 2RJEA 2IIMA 5LMKB 4F7UF 4LDYA 2I53A 3TEEA 1ABQA 1WQ7A 3MEWA 2RF0A 3E9GA 3HP9A 4J83A 3QG1A 1SG5A 3FEOA 2LDMA 1Q82C 3NFCA 2RJFA 3EIDB 2L5QA 4EMGA 2LJ1A 1RAHB 2ED0A 3VS4A 2V8JA 4IIMA 4QSHA 1T0HA 3WVDB 2X51A 3JCMJ 3M4GA 4D8DA 3V7SA 2RD1A 4JJNK 3M9QA 5IF1B 3S3MA 1G83A 1JQQA 1T0JA 8ATCB 3L2RA 1QWEA 3MY5B 2AZSA 2CP5A 2D1XA 4J6XA 4ELYC 2CREA 2DAQA 4JZ3A 2J6OA 2P0KA 4FCYA 1N4MA 1URCB 4AG2C 3ASKA 1VQLQ 1G3NC 2HD0A 5GAN5 4QW2A 4ELZC 3H41A 3BFMA 1YJNQ 1UB4A 1M90R 3DDPB 4CC3A 1ENWA 3CXCA 1OL2B 1LVKA 2E65A 3S3OA 2EUFA 1NM7A 3NDQA 5FU7B 3EG0A 5IHNA 1EFNA 1ZSGA 1RLQC 1H1SB 1AWWA 2FB7A 5CQYA 3BG5A 3K7AM 3ZL7C 5GANg 1VQ6T 3M59A 4JJBA 1JJ2P 4AFUC 1D3UB 4DBRA 2F2XA 2DTIA 1WHKA 2A28A 4AT1B 4F7LB 3REBB 1VQ8T 3M5AA 2DEUA 2EWNA 4BE0A 3OYGA 4ROCA 4FX3B 4RTYA 1H8KA 2DJZA 3CCSQ 5FU7C 2BZ8A 2LC4A 4D8KA 1H26B 3DOGB 1ZA2B 1GXIE 2P4TA 2XK0A 3JRZA 1OX8A 2O4XA 1MV3A 3LGLA 3SFMA 5DM7R 2C5OB 4C5HA 4RCBA 2K9GA 4J5YA 1Z9ZA 3I55T 3CMET 2LQ8A 4NL2A 4J9HA 3M4YA 1PRMC 1AD5A 1NPPA 4NL3A 2W99A 3M53A 4XQ3A 2B86A 4EONB 3JCMV 1UJYA 4LDUA 1BI3A 3EG1A 2HCKA 2J05A 1NEBA 2DL5A 1YWOA 4RG2A 4OGEA 3HTRA 2MIOA 1N9RA 4Z02A 3CBOA 1VQ7T 5FLXE 4KT0E 5GAN8 1XQHA 2NLUA 2E4HA 5FU6B 3L42A 2R5MA 4ZN3A 1KFZA 2OTLQ 1FWZA 2BE9B 4HLQA 4J9CA 2L0AA 2QDJA 4J6WA 3VRZA 1ZBXA 1PM3A 1WFWA 5CK9A 4BXXX 2GCXA 4BCGB 4PJOA 4M7AE 4P5NA 3G4ST 3SWNC 3JV3A 4JJCA 5LJ5h 2LCSA 1OX9A 1WXUA 4J8OA 2CS7A 2X3WD 1OULA 1ZA1B 2COWA 2L3RA 3OW2A 1S72A 1Y71A 3D7SB 1BK2A 4HL4A 4OMMA 4J7FA 4A4KA 4KUIA 2CZ0B 1D3BB 3PO3S 3OYIA 2FEIA 2CP6A 3A8MB 4BCIB 1JEGA 4CRIA 1M5Q1 2RN8A 4M75G 1EZZB 3CD6T 5FWCA 1JOWA 5KYUB 2DD4B 2UZEB 3H4CA 3EGXB 1M1KR 4BCQB 2K5FA 1X2KA 3OYNA 2HEQA 5CAIA 4OR5B 4M75D 1KD1U 3JAME 2RQTA 4ESRA 2OTJA 2E70A 5I22A 2I0NA 4BUGA 4IUVA 3R6OA 1D3BA 4XTVA 2KBTA 4M75F 3BLHB 4Z89A 3KUFA 5DY9A 1RAFB 1KC8R 2XDBA 2HL3A 1V76A 2D0QB 4C5EA 2KK4A 2GQVA 4KRTA 2IW8B 3QHWB 3RKYA 3I5SA 4AFQC 1YFNA 3EGXA 2V26A 3I56A 1M1GA 1QVGS 2H3EB 2CUDA 2COZA 2HQHA 2ECZA 4KGXB 1V1CA 2KSSA 4M75C 4JLIA 3OYBA 1ZX6A 3MP6A 1YHQT 1TSFA 5CR2A 3B57A 2F2CA 1DJ7B 2ATCB 2MOXA 4OMLA 1SKUB 4K11A 4IMYB 4CC2A 1KD1C 3L2VA 5HBJB 1T3SA 1B07A 4MZTA 2RMOA 2FYKA 4OP0A 2C5XB 4FT2A 4EMKC 1C9BA 1QCFA 2KI7A 1TFBA 1UHCA 5FGKB 1JXOA 3JCMh 1NLPC 4BY1X 5CEIB 2K57A 1K8AU 2E3HA 2KR6A 2EGEA 3SEMA 2RI5A 3KBGA 3RMSA 2YRVA 3CCUA 2P0PA 1Q95G 2M1HA 2VGNA 3L2QA 4FYVB 1YI2Q 3G6ET 4RTXA 1D0ZA 4L59A 4MFDA 2FZKB 1BIAA 1QKWA 3CMAA 2OAWA 2LT4A 1NZ9A 2GNCA 2AT1B 2DBMA 3A1PA 5LJ3d 4PLLA 5KYXB 4J9EA 3QBYA 2KAFA 1TH7A 2HL5C 3ZFJA 2V1QA 4FU6A 5GAMe 3HZJA 2ZPFB 2JS0A 3CCLQ 4EOIB 5LJ5e 3CCVA 2FPEA 5LJ5f 1JJ2A 2C06A 2C6TB 2CH4A 3CCMQ 2QQBA 1AT1B 4Y92A 1VQOA 1RADB 3OYDA 3QYGB 4FW2A 5I2MA 2EBPA 1K8AC 1XJWB 4KH1B 1XO2A 5KYXA 1K76A 4BDYA 2CUBA 2QDLA 3CXCS 3WXMB 1YJWT 3EH1A 1YITT 2EYYA 3VS3A 2DRMA 4E7ZA 1M30A 2JGZB 3ULRB 3TCJA 3QWXX 3LX7A 3CCRT 1YIJQ 4ELLA 4YTLA 3PVQA 4KH0B 1RLPC 2G6FX 1R8OB 5HCKA 4XU1A 3CCJT 3PTAA 1TXQA 1GY3B 3CEYA 2XHCA 1U1SA 4M6VA 1M3AA 3OYKA 2ZPIB 2QA4T 2KT1A 1T3LA 3JSCA 4CFNB 2DLPA 2KNBB 1W2BP 5GJWB 2K3YA 4M4ZA 2CZ1B 1VUBA 5I2SA 2R7GA 2YWWA 3QZ9B 1UE9A 4KRDB 2HKNA 5CO7A 4EOLB 5EFQB 3RUXA 2KMGA 2CCHB 4M7AG 4C92G 1WPYA 1QLBA 3HKSA 1QP2A 2DM1A 2XKOC 3BLQB 1OL1B 1JSUB 3LLRA 1X43A 1D0XA 1VIFA 4BI8B 1WHMA 1VQ9Q 4M7AD 2G3RA 2KROA 2RQWA 1ZP2A 2JW4A 1K9AA 2DFUA 4ANJA 4DOWA 1M27C 1VYUA 2DX1A 4E7LA 1K0XA 2EIFA 4M7AF 4BY6C 2ZPHB 1PRLC 3EFSA 5CVIA 1I07A 1Q81R 4FSSA 2COYA 4C92B 1GCQC 1YJ9Q 2BIVA 1NYFA 2DETA 1IGQA 4DBHA 1LOJA 1WJQA 3C4SA 3BHVB 5GAOl 2E12A 4ZTFA 4OMNA 1OPKA 4L5GA 1BCOA 1H641 2A08A 2LJ0A 5I11A 4PJOE 5GMKm 1VQ6A 1TUGB 2PU9B 4JX4A 3JCMe 2A36A 1QVFP 2WFYB 2BPMB 4Z6YA 1WXTA 4J9DA 2RO0A 3TNIB 4HVVA 3JCMf 3UWNA 1VQ8A 4FW1A 4M7AC 2GTOA 3GPLA 2RQUA 4A4HA 3OW2S 5KE3A 4JS5A 3H6ZA 3HL8A 1D1AA 2HSEB 2BS2A 1WI7A 2LNVA 1K73R 4C92A 1OGUB 2WMAB 1I4K1 1YJNT 1CKBA 4E2FB 5GAMj 2QQ8A 1QWFA 2YT6A 3I55A 3CMEA 3ME9A 1U8RA 3VJPA 2DILA 4LE9A 4RTTA 2ENMA 3G33B 4E7SA 1KK7A 4ZN1A 2B8AA 3TSZA 1UGRB 2EQUA 3PMIA 4C0FA 3VKHA 5L2WB 3OBWA 3CPWP 1VIEA 3N5BB 1U1TA 2PUKB 5KYNA 4J9GA 1VQ7A 3QWYA 3S6WA 1IGUA 3CCST 1VQPQ 4UN0A 2WHBB 3BW1A 1M3CA 5IDNB 1S1NA 4BBRM 3M0QA 4ROEA 2E41A 2DERA 4DEYA 3CCUT 4BE2A 4F7NB 2F5KA 5KCHA 2BKDN 4RTZA 1UEBA 3EG9A 3VS6A 3VKGA 3CMAT 3VYGA 4EC8B 3HPWA 5LL6S 1MMNA 4M7DB 2LQNA 5D7UA 1FMWA 1PKTA 1ZQ1A 1M1FA 1BIBA 2VB6A 1FYNA 3G71A 2JTMA 1OIUB 2R58A 1I5LA 4E7IA 1VQNQ 3CD6A 3FDRA 2UZDB 3G7ZA 2XDDA 1CKAA 2KEAA 1FXXA 2EJFA 2KRSA 4RMOA 2A37A 4TTHA 2YUOA 4C5GA 2D8HA 2CH4W 3J80E 2EGCA 1OQKA 4MFEA 2KGTA 2EJ9A 2PVGB 1C1AA 4M7DA 3TNHB 3L1AA 5CKEA 2LP5A 2A0FB 3HFOA 1SHGA 2C0TA 4QT7A 5DLOA 3HB9A 1OI9B 1VQ4Q 1QW1A 2RPNA 2DF6A 4F70B 4BCNB 3P8DA 2QAZA 5A0DA 4YOZA 3X20B 4C8QG 4PL6A 1Y0MA 2JN0A 1IREB 2MF2A 2V22B 1GUXA 3NMZC 2DL7A 2HQEA 2QK0A 2F5TX 2BS3A 2PK2A 3LW5E 1JJ2S 2QQ9A 2EQJA 1KIKA 2ROLA 1XOVA 1YHQA 5GANe 3GP8A 2DYBA 3LH5A 4HNVA 1VOLA 1HSQA 2M51A 4C8QB 2PTKA 2PVOB 3MHXA 1UNHD 2OX7A 4LDWA 4EORB 4BCPB 3L2WA 3LWHA 1H27B 1GBRA 4A4FA 4PKCC 1Y96B 1NG2A 5KCOA 3BLRB 2ZCFB 4BY7X 5GAOq 5C6SA 1NJIR 2XI9A 3EFOB 2L3SA 2DEQA 1WHGA 4EC9B 1SSFA 2I2LA 5GAN4 3TN8B 4CC7A 4EDUA 3BHTB 3ER0A 3HRUA 1H4LD 3OSVA 3G6EA 4E47A 2OI3A 2O4XB 6AT1B 4OGRB 3C12A 4C8QA 1M1KU 3M0UA 2DMEA 1IHVA 4AMCA 4KGZB 1GL5A 2WIHB 1UECA 2RNAA 1IHWA 4FT4A 2GTJA 1UNGD 1Y96A 2L2PA 1HYOA 1PCXA 4CI0C 4PJOG 4JX6A 3X25B 3GBQA 3EFOA 2KQWA 5HBEB 4BCMD 3DLLA 4HNTA 4M77G 2GGRA 1PWTA 4PJOD 2HBWA 1EX4A 2KMTA 2PHGA 5D6YA 1QVFA 1QMZB 1KQSP 3CCEQ 2DPPB 4O5VA 3MJXA 3RBBB 1YI2T 2DXBA 2RB6A 4BCMB 2KVQG 4O6JA 4PJOF 2VXFA 1KQ2A 1UUEA 4C5IA 5GAN2 5FRMA 4PJOB 4MMLA 1YJWA 1YITA 1X01A 1H3HA 4KGVB 1JRIA 3MP8A 2LCLA 4M77B 4E6RA 3CCRA 2UUEB 1M1KC 2K2VA 1SF9A 1I5OB 1W6XA 1MMAA 2FVUA 3P8BB 2NYSA 5GAOp 3CC4A 3QYBA 3VRYA 3CCJA 1TUCA 3CCLT 2CKKA 1VQMQ 2VVKA 2P84A 4PJOC 2E6NA 2QA4A 3RKXA 5KE2A 1M8VA 2WMBB 5GAMh 3H9NA 3JCMQ 3CC2Q 3CPWA 5DLQE 3CCMT 2LJ3A 3EHQA 3R6NA 4ZGEB 5J3BA 4C92E 3T9NA 3E9FA 3L2ZA 4C0DB 3RDVA 2CT3A 4ORZA 2F2VA 1ZBJA 1VQKQ 3QXEB 1M2OA 2MCNA 2CDTA 5FU6C 3CBPA 2M16A 4M77A 2KYBA 1FKMA 1ZLMA 2EFIA 1Q7YU 4JRQA 1YIJT 1ZSZB 4E7KA 1SRMA 3G71T 4E7JA 5CKHA 2AHJB 4BCQD 4F14A 4Z8AA 1Y07A 1N5ZA 5GANj 4HNUA 1VQ5Q 3OYFA 1UTIA 4C0DC 2ZZDA 2GFUA 4PJLA 2FRWA 2AKKA 4DA4A 4JZ4A 4LDVA 3AHUA 3RNJA 2KYMA 1Y7XA 3BG9A 4Y91A 1HD3A 4IUQA 4BI4A 4EOMB 2WSEE 1OPLA 1BYMA 4EOJB 2GF7A 1ZUYA 2JM8A 1ZSZA 1N27A 2DXCB 1U3OA 2AKLA 5GMKe 2IW9B 1VQ9T 1BI2A 2SRCA 2VUBA 1ACMB 4ZGDB 2FL7A 4DQ2A 1Q86R 5CKFA 1VQLA 1TUDA 1Q7YC 2QGFB 2QGGA 3UF4A 5LQFB 2DBKA 4BCFB 4HXJA 4II1A 2JM9A 3QPHA 3DTOA 2A3LA 1YJNA 1ARKA 3OS0A 2AK5A 1YJ9T 2EYZA 2HKQB 3CBMA 1NYGA 3VV0A 1JKWA 1NE8A 4N4HA 1X6OA 3QO3A 4NS5A 4PLIA 1HXDA 2EGAA 3HBLA 3MP1A 3L2UA 2QEXQ 2DXCA 3TREA 1RACB 2QQRA 1K9MR 4M7DE 2O31A 3PGGA 2JTEA 1I81A 2F1LA 4B9WA 4R56A 9ATCB 4EOPB 1GRIA 1OKWB 2GQIA 1AVZC 1WA7A 3QSUA 1X75C 4LDXA 3CCSA 7AT1B 1KG1A 4J6YA 2QQSA 3PT9A 2YUQA 4XK8E 4DBQA 2L3QA 1E6GA 2ZPBB 1GBQA 4OMFB 1KSWA 4LXCA 2RQVA 1H92A 2RK1A 2XDPA 2PNIA 4KUDK 4WTOB 1AZGB 4ELJA 2FHDA 3JB9G 1OKVB 4CFXB 2DL4A 4JS4A 5GAMd 2RM4A 1SRLA 3M57A 4N4GA 2C5NB 3I9QA 1BKBA 5J39A 5LJ5d 5EG2A 2CP2A 1PNJA 4HT8A 4BCKB 1OOTA 2ZPEB 3VS7A 1WJSA 5GJVB 1R0CB 2XU8A 1BI1A 4J9IA 4X1VA 2R5AA 4J7IA 4RTUA 2HQXA 1X27A 1W2BS 3TQ7P 1QCNA 1KHCA 2Y90A 5GAMf 4OMPA 2DRKA 2LVMA 3GF5A 1VQPT 3PFSA 2OTLA 2Z0WA 3E1SA 4A63B 2EKOA 1BB9A 4RG8A 1PG5B 3M54A 1ZUUA 2GBQA 2DTOA 3OYCA 5CKBA 5L8RE 4IIOA 5IHYA 1SHFA 1BU1A 2LCCA 2K3BA 1AWJA 2X4XA
chains in the Genus database with same CATH topology
2DZCA 4XU2A 4ZN1A 3JB9H 1LJOA 2B8AA 1UGRB 2EQUA 3PMIA 4C0FA 3VKHA 3WVEB 2E6ZA 2RI3A 3OBWA 1VIEA 3N5BB 1U1TA 2PUKB 3ASKA 5J26A 2HD0A 1KQSA 1VQ7A 5GAN5 3HSBA 4C8QE 2L8DA 5GAOr 2D6FA 4OB1B 2MMPA 4QW2A 3OYAA 4ELZC 1XNIA 3CC4T 3BFMA 3S6WA 3CCST 1UB4A 2XIDA 5M9OA 3A8OB 3BW1A 4BBRM 4QVDA 1O9SA 2LQKA 3GLXA 3OB9A 2E41A 3CXCA 2E65A 3LWIA 3S3OA 3CCUT 2YHTA 1VQNT 4BE2A 4QQGA 4MDWA 2F5KA 5A0GA 5KCHA 4GLKA 4AKHA 5GMKj 5FU7B 2BKDN 3CCQT 2FB7A 3VYHB 1UEBA 5CQYA 3VKGA 1WQWA 2X4JA 3BG5A 1JB0E 2JZ2A 3VYGA 5GANg 3META 3M59A 2JVVA 3C94A 3HPWA 2RHYA 3QJYA 5LL6S 2WSFE 3QYHB 2WJ9A 1QVFS 4M7DB 2DTIA 2K3XA 2DIQA 3BDUA 3INZA 4M75B 3PIOA 3UT1A 3NTIA 1VQ8T 1WJRA 2E10A 2EAYA 2E5QA 3M5AA 1ZQ1A 5LJ3g 4NOYA 4LOCA 1M1FA 2DD4A 2DXTA 2EWNA 1BIBA 4BE0A 3OYGA 3G71A 1VQ4T 5A0LA 2DK3A 2DJZA 4IKFA 1YCYA 1UGQB 2BUDA 2IG0A 1G3YA 2JTMA 2LRQA 2K5LA 2LC4A 5FU7C 2KDSA 4C92D 1RI0A 1GXIE 4AKGA 2P4TA 2XK0A 3JRZA 2R58A 3A8GB 3M55A 3A5ZB 4EMKB 2O4XA 4N0AA 1I5LA 3CMAT 4E7IA 3LGLA 3FDRA 3SFMA 3CD6A 3G7ZA 5DM7R 2XDDA 4C5HA 4RCBA 4J5YA 3I55T 3CMET 4C92F 1FXXA 2EJFA 2Y4XA 4RMOA 4D6WA 2LQ8A 4NL2A 3M4YA 4C5GA 4JRKA 1NPPA 4NL3A 3J80E 3M53A 3QZ5B 4BACA 3FRNA 4MFEA 4XQ3A 2EJ9A 2PVGB 3JCMd 4M7DA 3JCMV 4M75A 5CIUA 1KQ1A 3L1AA 2VV5A 4LDUA 4X9CA 1BI3A 5CKEA 3VUBA 3CCEA 4ATOA 3DB3A 3HFOA 4RG2A 4OGEA 2DZ9A 3CPWS 5DLOA 1N9RA 3HB9A 1BI0A 4LD6A 4Z02A 1Q81U 4BD3A 1QW1A 3CBOA 5D6WA 3OS1A 1VQ7T 5FLXE 4HKEA 1WGSA 4KT0E 5GAN8 2CYZB 1XQHA 2NLUA 3P8DA 2PQWA 2DD5A 4JLGA 5IN1A 5A0DA 1W4SA 3L42A 5FU6B 3X20B 2R5MA 4C8QG 4PL6A 4ZN3A 1YI2T 4C92C 4EMKA 1VQMA 2EQMA 4ZGJB 1FWZA 2JOYA 2JN0A 4B9XA 1IREB 4HLQA 3QJ6A 4M77E 2QDJA 4J6WA 5GANh 1ZBXA 2MF2A 5CK9A 2GCXA 4IUPA 1VQLT 3GNGA 3HRSA 4OGCA 2HQEA 4KULA 4PJOA 2GFAA 3QWLA 2F5TX 4M7AE 3C95A 2BS3A 1PSFA 3QKJA 2DXUA 4KBMB 4M78B 4P5NA 3SWNC 5LJ5h 1OZ3A 3LW5E 3JB9F 4FIBA 4RCCA 3DB4A 1JJ2S 2QQ9A 4J8OA 2CS7A 2EQJA 2M9UA 2RHIA 1YI2A 3OYLA 1XOVA 5KH6A 3CC2A 1WNLA 4QVCA 1YHQA 5GANe 4VUBA 2L3RA 3GP8A 1K73U 3OW2A 2V8IA 1S72A 4HNVA 1Y71A 1H3ZA 4C8QB 3FB9A 1PSEA 5HY6A 4JX5A 4AI6A 4HL4A 2PVOB 3MHXA 4J7FA 4LDWA 4HA8A 4KUIA 4A4KA 2CZ0B 3L2WA 1VQKA 1D3BB 3LWHA 3VYGB 2YLBA 1JBMA 5LJ3e 4R55A 3OYIA 3A8MB 4A4FA 3A8HB 4PKCC 4RKUE 1Y96B 2QI2A 3BG3A 4CRIA 5LJ3f 2JNGA 4C0ZA 2CZ7B 2V8KA 3SB2A 5KCOA 4M7DG 1M5Q1 4F7UE 4IUTA 3GNFB 4BE1A 4M75G 2ZCFB 1Q81C 4IURA 5GAOq 1IZ6A 1G3SA 3EFRA 5C6SA 3CD6T 2XI9A 1M4ZA 2DEQA 2DD4B 5LJ3j 1SSFA 3H4CA 4M78A 4A4EA 3CCLA 2I2LA 5GAN4 4FM4B 2MWPA 3OMGA 2X4WA 4A53A 2K5FA 1VQ5A 3OYNA 5CAIA 4EDUA 3JB9I 3ER0A 3HRUA 4M7DD 2JUFA 3OSVA 2XICA 4M75D 5GAOm 1KD1U 3DL1A 3JAME 3G6EA 4E47A 2HAXA 5GAN3 2O4XB 3SD4A 3OYEA 4XTUA 1NJIU 5CKDA 3CCET 2OTJA 2E70A 3CCMA 4AKIA 1MHNA 3C12A 3QUIA 4BUGA 3ZEHA 1QP3A 4C8QA 1M1KU 1M90U 3QHSA 2PVDB 4A54A 5GMKl 4IUVA 3R6OA 4M7DF 1D3BA 1MGQA 3NTKA 4M75F 4XTVA 2EYQA 4FT4A 3FIFA 1Y96A 5GAMg 2G77A 2XG8D 4CI0C 2QQAA 4PJOG 3KUFA 5DY9A 2XDBA 4MIMA 5D6XA 1K73C 5GMKi 4JX6A 3X25B 2D0QB 1P92A 2KK4A 2GQVA 3OSSC 4C5EA 5AYFA 2KQWA 3RKYA 5LJ5g 1YIJA 4N0AC 3SDZA 5CQXA 3DLLA 4HNTA 4M77G 2HNIA 3I56A 1M1GA 1QVGS 4PJOD 1RL2A 3A8LB 2KMTA 2DD5B 1VQMT 5D6YA 2OTLT 1QVFA 3PIPA 4JRPA 3RMQA 4M7DC 2KSSA 3OS5A 1G3WA 3HO8A 4V2SA 4X34A 2DPPB 2MAMA 4M75C 4O5VA 4JLIA 2QFZA 5GAN6 3UDCA 3PNWC 2DXBA 4BY6B 2RB6A 5I21A 2E1HA 2KVQG 2O01E 4O6JA 3OYBA 3PMTA 4PJOF 3MP6A 3CC2T 1YHQT 3BDLA 2VXFA 1KQ2A 4GY5A 5CR2A 4C5IA 5GAN2 4PNOA 5GAN7 1S72T 5FRMA 4PJOB 1DJ7B 4XTYA 2MWOA 2P0QA 3FJPA 2D9TA 1OI1A 4MMLA 1YJWA 2RH2A 1YBYA 1YITA 1KD1C 3Q1JA 1X01A 3L2VA 3F70A 5GAOn 4M78G 1VQKT 2K4YA 1EIFA 3QIIA 1NJIC 4MZTA 3VUZA 1JRIA 3MP8A 1HK9A 2LCLA 4QQDA 4C0GA 2QEXA 4M77B 2FYKA 4OP0A 3CCRA 4FT2A 4EMKC 1M1KC 1OYXA 2K2VA 2VC8A 3V7CA 1M90C 4OF1A 3CC4A 2FVUA 3P8BB 5GAOp 2CGHA 4XTXA 3X28B 3JCMh 4NC6A 5IT9E 3QYBA 3OS2A 1VQ9A 2RJDA 4M7AB 3CCJA 4M78D 2RA2A 3CCLT 2CKKA 2K57A 1K8AU 2KR6A 4PJOC 2RI5A 2E6NA 1VQ5T 3KBGA 3RMSA 5HK3A 2QA4A 2VGMA 2YRVA 3CCUA 2P0PA 3RKXA 5KE2A 3E19A 2M1HA 2VGNA 3L2QA 4OB2B 1UGPB 1M8VA 3G6ET 1I8FA 5GAMh 3J7AF 3JCMQ 2OTJT 4X9DA 5DLQE 2PUOB 4L59A 4MFDA 4M78F 2RHXA 2VYTA 4MZMA 3CPWA 3CCMT 4ZGEB 1BIAA 3CPFA 5J3BA 4FL6A 4BI3A 4C8QD 4C92E 3T9NA 3CMAA 1YJ9A 4HCBA 2LT4A 3E9FA 3LH0A 3L2ZA 4FSXA 4C0DB 1NZ9A 2QTXA 3V7RA 3RESA 3QXEB 5LJ3d 2YLCA 4PLLA 3FLGA 5FU6C 3CBPA 2M16A 4M77A 1AHJB 2KAFA 3QBYA 1TH7A 3MEUA 3ZFJA 1FKMA 4C8QF 2EFIA 4FU6A 4F7UB 4JRQA 1Q7YU 1N6AA 3OMCA 5C0MA 3M58A 1YIJT 5GAMe 2OAUA 5GANf 1W2BA 4E7KA 4M7AA 3GIBA 3G71T 3HZJA 4E7JA 4QVZA 2ZPFB 2DO3A 3RKWA 5CKHA 2AHJB 1XTDA 3I56T 5LJ5e 1Y07A 3V8JA 5HK0A 5A2QE 4HNUA 4M78C 5GANj 1N8RU 3CCVA 1KHIA 2EQKA 4JDSA 3OYFA 4XTWA 3P8HA 4C0DC 2ZZDA 5LJ5f 4ZTJA 1JJ2A 4Q5WA 3J81E 1KQSS 1G3TA 2C06A 2GFUA 4EPCA 2KY9A 4XU0A 4WF2A 5FROA 2QQBA 4DA4A 5LJ5j 4LDVA 1VQOA 4MZPA 3ZBDA 4BBSM 2JTFA 2WACA 3QYGB 5GMKh 3TW6A 3OYDA 3AHUA 5I2MA 4UC4A 1K8AC 1Y7XA 2K5IA 2LT1A 4C8QC 2R57A 3DLMA 4BDYA 3BG9A 2ZGWA 4Y91A 4IUQA 3CXCS 2DVEA 2RK2A 3WXMB 4BB7A 4BI4A 1YJWT 1YITT 2WSEE 1BYMA 3JCMg 2EJGA 4F7UA 3TCJA 3KXTA 2DIGA 2L89A 2GF7A 2QEXT 3MO8A 2DXBB 3LX7A 3CCRT 4YTLA 5CCAA 4JUVA 4TVRA 1N27A 2DXCB 3QYEA 3JB9D 1M9SA 4HCZA 1R8OB 3RIRA 2LTOA 3HRTA 4XU1A 5GMKe 3JB9J 1VQ9T 1BI2A 2VUBA 3CCJT 3PTAA 4ZGDB 2MI6A 2WSCE 2QDYB 3CEYA 3JCMP 2XHCA 2FL7A 1U1SA 4M6VA 1N9SA 4JRIA 3OYKA 4DQ2A 3GOXA 3MEVA 3OYMA 2ZPIB 5CKFA 2QA4T 1VQLA 4HT9A 1Q7YC 3JSCA 3HFNA 2CZ6B 3QDRB 1VQ6T 2K3YA 3DKMA 4II1A 2CZ1B 1VUBA 3QPHA 3CC7A 5I2SA 1QVPA 3G4SA 2A3LA 2RHZA 2DTHA 1YJNA 3G4ST 4LD9K 1VQPA 4OVAA 1UGSB 3QZ9B 3X24B 1ZHIA 3MCAB 3OS0A 3X26B 2Y4YA 1YJ9T 3OBYA 5CO7A 1N8RC 2QF7A 3CBMA 1KC8U 1OZ2A 1Q86U 3VV0A 2F69A 3RUXA 2KMGA 1NE8A 4N4HA 3OY9A 4M7AG 5EJCA 4C92G 1WPYA 1X6OA 3QO3A 4NS5A 4XU3A 1QLBA 3HKSA 4E7HA 4PLIA 3V8KA 1QP2A 1HXDA 2XKOC 3O8VA 4M77D 3HBLA 3TU4K 3MP1A 3L2UA 2IVWA 4MDXA 3FC3A 2M0OA 2DXCA 4OB3B 3V8LA 1LNXA 2DKGA 4L6V5 2RJCA 3LLRA 1G5VA 3TREA 3UPUA 4IUUA 3NTHA 1FX7A 3JCMW 1Q82U 2QQRA 3S3NA 1VIFA 4ME7A 4XTZA 4BI8B 3OYJA 4M7AD 4M7DE 1QVGA 2G3RA 4N4IA 2ZPGB 4M75E 3KHIA 3PGGA 2RHUA 4M77F 1I81A 4B9WA 4R56A 4EMHA 2QXFA 4DOWA 3CCVT 4DOVA 4Y28E 1V29B 3OYHA 3M56A 4A4GA 2HBPA 3JCMc 4E7LA 2E64A 2EIFA 4M7AF 3RERA 4BY6C 1K9MU 2ZPHB 1X75C 4OB0B 3EFSA 1B34B 3CCSA 4BDZA 5CVIA 4LDXA 4F7UG 1KG1A 1VQOT 4J6YA 2QQSA 2X35A 3PT9A 4C92B 3VKIA 5FRNA 2BIVA 4XK8E 3LGFA 2ZPBB 4OMFB 1LOJA 1E7PA 3OA6A 1WJQA 3C4SA 5GAOl 4QQ6A 1VQNA 2E12A 2RK1A 3URGA 3EAEA 4L5GA 2XDPA 4ZTFA 4KUDK 2ZZDB 1O75A 4HCCA 3MEAA 1H641 2FHDA 4ELJA 5GANd 3JB9G 3CCQA 2RI2A 4M77C 4JS4A 3SWNB 5GAMd 2RM4A 4PJOE 5GMKm 3OYYA 1VQ6A 3TW7A 2BS4A 3M57A 3BY7A 2PU9B 4JX4A 4N4GA 3JCMe 5IAYA 1KC8C 1Q86C 3JCMX 3VU3C 3HHTB 2LX9A 4Z6YA 1BKBA 2RJEA 5EG2A 5J39A 3JCMf 2RO0A 5LJ5d 3UWNA 1VQ8A 4HT8A 2XD0A 3LYIA 4M7AC 3GPLA 4F7UF 2ZPEB 1NPRA 4LDYA 3TEEA 1WJSA 3JCMb 3MEWA 1WQ7A 2XU8A 4XAXB 1BI1A 3E9GA 4A4HA 3OW2S 3H8ZA 2R5AA 4J7IA 5KE3A 4JS5A 1VQ4A 3HP9A 4J83A 3H6ZA 2HQXA 3HL8A 3QG1A 1W2BS 3FEOA 1B34A 2LDMA 2BS2A 1KHCA 2Y90A 1Q82C 2LNVA 3NFCA 4C92A 5GAMf 2X4YA 3CC7T 2RJFA 2LVMA 1I4K1 3GF5A 2L5QA 5LJ3h 4EMGA 1YJNT 1VQPT 3OQ5A 3PFSA 2A7YA 2OTLA 2V8JA 3E1SA 2EKOA 4QSHA 4RG8A 3WVDB 5GAMj 3JCMJ 2QQ8A 3M54A 3M4GA 3V7SA 4MMKA 2RD1A 4JJNK 3M9QA 3I55A 3CMEA 3S3MA 3ME9A 1U8RA 3SWNA 2DTOA 3OYCA 1K9MC 5CKBA 3VJPA 3L2RA 5L8RE 3QSUA 5HKCA 4M78E 4J6XA 4ELYC 2LCCA 2DAQA 2VXEA 2H3JA 2X4XA 2P0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CZ1 B;  1UGR B;  3WVE B;  1PSF A;  1UGS B;  3QZ9 B;  3X24 B;  3LW5 E;  2PUK B;  3X26 B;  4OB1 B;  3X28 B;  1QP2 A;  3A8O B;  2DXC A;  4OB3 B;  4L6V 5;  1PSE A;  2PVO B;  4OB2 B;  1UGP B;  2CZ0 B;  3VYG B;  2ZPG B;  2PUO B;  3A8M B;  3A8H B;  4RKU E;  4ZGE B;  3VYH B;  2CZ7 B;  1JB0 E;  3VYG A;  4Y28 E;  1V29 B;  2ZCF B;  2WSF E;  3QYH B;  3QXE B;  2DD4 B;  2ZPH B;  4OB0 B;  1AHJ B;  4FM4 B;  4XK8 E;  2ZPB B;  2DD4 A;  2ZZD B;  2ZPF B;  1UGQ B;  2AHJ B;  1QP3 A;  1GXI E;  3A8G B;  2PVD B;  2ZZD A;  2PU9 B;  3HHT B;  2ZPE B;  3QYG B;  3QZ5 B;  3X25 B;  2D0Q B;  2PVG B;  2WSE E;  3A8L B;  2DD5 B;  2DXB B;  2DXC B;  3WVD B;  4KT0 E;  2CYZ B;  2DPP B;  2DD5 A;  2DXB A;  3X20 B;  2O01 E;  4ZGD B;  2WSC E;  2QDY B;  5L8R E;  4ZGJ B;  1IRE B;  2ZPI B;  1DJ7 B;  2CZ6 B; 
#chains in the Genus database with same CATH topology
 3JB9 H;  2JT4 A;  4KRC B;  2DA9 A;  2EQI A;  3WVE B;  2E6Z A;  2RI3 A;  2M0Y A;  4WCI A;  1OIY B;  2EW3 A;  5J26 A;  1KD1 R;  1KQS A;  4FYX B;  3HSB A;  4C8Q E;  1BCM A;  2L8D A;  5GAO r;  3H0F A;  2MMP A;  1D1B A;  2IW6 B;  5FWB A;  4FYW B;  3CC7 Q;  1G2B A;  4PJJ A;  3G4S Q;  1XNI A;  3EHR A;  3CC4 T;  2X9H A;  2XID A;  3A8O B;  4BCO B;  4QVD A;  1O9S A;  2LQK A;  2WIP B;  2QTV A;  4AFZ C;  3LWI A;  1VQN T;  4QQG A;  5GMK j;  4GLK A;  4AKH A;  3MIA B;  2BZX A;  3VYH B;  4HCK A;  1WQW A;  2YXY A;  1VIN A;  3QJY A;  2JVV A;  3C94 A;  1QCO A;  1QVF S;  2WSF E;  2WJ9 A;  3BDU A;  3INZ A;  3H0H A;  3PIO A;  2YDL A;  3UT1 A;  1WJR A;  5I5Z B;  1TG0 A;  2E5Q A;  5LJ3 g;  1AWO A;  4LOC A;  2DXT A;  1WHH A;  1VQ4 T;  4J9F A;  4F7S B;  4IKF A;  4CXA B;  2BUD A;  4C92 D;  2KDS A;  3THK A;  3A8G B;  1AD6 A;  4YOS A;  4N0A A;  2MPX C;  2JJ9 A;  1O9K B;  5IDP B;  4C92 F;  2Y4X A;  3CCQ Q;  1X2Q A;  4JRK A;  2YRC A;  1KXU A;  4BAC A;  1D0Y A;  3QZ5 B;  3JCM d;  1PC0 A;  4PFO A;  5CIU A;  3MPU B;  3VUB A;  5IXF A;  4X9C A;  4ATO A;  4CFU B;  4Y72 B;  3DB3 A;  3CPW S;  1H25 B;  4LD6 A;  1IXD A;  1WGS A;  1UNL D;  2PJQ A;  2CYZ B;  1OU9 A;  2PQW A;  3IQL A;  1B3Q A;  2UZB B;  1TD6 A;  2DD5 A;  4JLG A;  5IN1 A;  4C92 C;  3M0R A;  4ZGJ B;  2JOY A;  1E9H B;  4M77 E;  2ED1 A;  1O9K A;  5GAN h;  1QKX A;  3EOC B;  1VQL T;  3GNG A;  1FIN B;  4F17 A;  1GCQ A;  3TVT A;  4LUD A;  4KUL A;  2GFA A;  1PSF A;  4M78 B;  2CP0 A;  1GCP A;  2AIR B;  4RCC A;  1BU2 A;  2BKZ B;  4J9B A;  1MMG A;  1YI2 A;  4B6M A;  1WNL A;  4F6W B;  5ICP B;  2V8I A;  1H3Z A;  3EG2 A;  3EG9 B;  4HA8 A;  3VYG B;  2YLB A;  4R55 A;  4JJD A;  1W70 A;  4DBF A;  2QI2 A;  2JNG A;  4C0Z A;  2V8K A;  3SB2 A;  4M7D G;  2FZC B;  4IUT A;  4BE1 A;  1X6G A;  1OV3 A;  4IUR A;  1IZ6 A;  1G3S A;  2KXD A;  1M4Z A;  1RAA B;  5LJ3 j;  4M78 A;  3CCL A;  3VS2 A;  2X4W A;  4A53 A;  1J3T A;  3REA B;  2EVR A;  3JB9 I;  4M7D D;  4GBQ A;  2QGS A;  2XIC A;  2NUP A;  3A98 A;  3DL1 A;  3SD4 A;  3OYE A;  1NJI U;  3CCE T;  5CKD A;  3CCM A;  3ZEH A;  1QP3 A;  4NST B;  3EGD A;  1M90 U;  5GMK l;  2PVD B;  4A54 A;  4M7D F;  3UA6 A;  2EYQ A;  4EOQ B;  2HMA A;  1H1R B;  1W98 B;  3FJ5 A;  3RGF B;  4PFZ A;  5GMK i;  1P92 A;  3OSS C;  1YIJ A;  5AYF A;  2CT4 A;  3SDZ A;  2MK5 A;  5IH2 A;  3O5Z A;  1NBE B;  2JMA A;  1VQM T;  2FO0 A;  2OTL T;  3PIP A;  3RMQ A;  4M7D C;  1G3W A;  3HO8 A;  2MAM A;  4LUE A;  5GAN 6;  3C0C A;  1GUX B;  2O01 E;  5IHI A;  3CC2 T;  4YC3 B;  1ZUK A;  5GAN 7;  2ABL A;  2W10 A;  2J06 A;  2MWO A;  2P0Q A;  4BCN D;  2D9T A;  2PZ1 A;  1U06 A;  2RH2 A;  1YBY A;  1VQK T;  2EKH A;  1MV0 B;  2J7I A;  5GAO n;  3QII A;  3TSW A;  1NJI C;  3VUZ A;  4C0G A;  1JXM A;  1MND A;  3V7C A;  2VC8 A;  1M90 C;  4OF1 A;  4ROD A;  4XTX A;  1VQ9 A;  5IT9 E;  4NC6 A;  2RA2 A;  1I0C A;  3DJB A;  4ZNX A;  1VQ5 T;  2VGM A;  2C0I A;  1W1F A;  3E19 A;  4OB2 B;  1VYT A;  1I8F A;  2KR3 A;  8AT1 B;  4X9D A;  2PUO B;  4AG1 C;  4MZM A;  2KXC A;  2IPO B;  1S72 Q;  3CPF A;  4FL6 A;  4BI3 A;  4C8Q D;  1YJ9 A;  2BE7 D;  4AFS C;  2QTX A;  2KT8 A;  3RES A;  1FMK A;  2YLC A;  1AHJ B;  3EGU A;  1N8R R;  3EH2 A;  5KYW A;  4C8Q F;  2WPA B;  4F7U B;  5C0M A;  5GAN f;  1W2B A;  3GIB A;  2PK9 B;  3RKW A;  1WYX A;  1G8X A;  3V8J A;  4CRL B;  4LNP A;  2EQK A;  4JDS A;  3P8H A;  4ZTJ A;  1U5S A;  1IRX A;  4Q5W A;  3J81 E;  1KQS S;  4EPC A;  2KY9 A;  2F2W A;  2OTJ Q;  4WF2 A;  2IN3 A;  5HBH B;  1YNZ A;  5GMK h;  2JTF A;  5IHK A;  4I3Z B;  2AZV A;  4UC4 A;  2K5I A;  2LT1 A;  4C8Q C;  2R57 A;  2DE0 X;  2ZGW A;  1TU0 B;  2DVE A;  2RK2 A;  2DVJ A;  2IVX A;  4PK4 A;  2HSP A;  1RUW A;  2EJG A;  1HJD A;  4F7U A;  3MKD A;  2WEV B;  5DQV A;  3KXT A;  2L89 A;  2QEX T;  2DXB B;  4EOO B;  2FZG B;  1UG1 A;  4G6L B;  5CCA A;  4TVR A;  1H28 B;  3CQT A;  1M9S A;  2W9F A;  3I56 Q;  3JB9 J;  2WSC E;  3JCM P;  2SEM A;  2D8J A;  1M8M A;  3HFN A;  2CP3 A;  3QDR B;  4YOO A;  3UAT A;  1QVP A;  2DTH A;  1VQP A;  3M0T A;  4OVA A;  2Y4Y A;  1KC8 U;  1Q82 R;  1Q86 U;  1E6H A;  3PE0 A;  2F69 A;  2P4R A;  4CFM B;  4E7H A;  3V8K A;  3O8V A;  4M77 D;  2W9Z A;  1NLO C;  4MDX A;  3FC3 A;  2M0O A;  2ESW A;  3MY1 B;  1LNX A;  1Y57 A;  2DKG A;  2RJC A;  1G5V A;  3UPU A;  3NTH A;  4EOK B;  4ME7 A;  2G9X B;  1VYW B;  4N4I A;  2WXV B;  3KHI A;  4M77 F;  1C6V X;  2JXB A;  1PKD B;  3CCU Q;  1H1P B;  3OYH A;  3M56 A;  3RR6 A;  1WIE A;  1K9M U;  2NWM A;  4OB0 B;  1B34 B;  4BDZ A;  2DYI A;  3VKI A;  3CMA Q;  3LGF A;  1TS9 A;  4PJM A;  1E7P A;  3OA6 A;  2B9R A;  1UGV A;  1VQN A;  3EAE A;  2ZZD B;  1O75 A;  4CFV B;  4HCC A;  1PD1 A;  3E2U A;  2V1R A;  1JO8 A;  4M77 C;  3SWN B;  3TW7 A;  2BS4 A;  3BY7 A;  1KC8 C;  1Q86 C;  1WXB A;  3JCM X;  1MUZ A;  4CC4 B;  2XD0 A;  1AZE A;  3LYI A;  3BE3 A;  5ECA A;  1NPR A;  1SPK A;  2FRY A;  2J6F A;  2X3X D;  3JCM b;  3CCV Q;  4GLM A;  4XAX B;  1ABO A;  3H8Z A;  1AOJ A;  1VQ4 A;  1B34 A;  1VQO Q;  2X4Y A;  3CC7 T;  1UFF A;  1FMV A;  1D1C A;  5LJ3 h;  3OQ5 A;  2A7Y A;  2E5K A;  2EYX A;  1R77 A;  1RAE B;  5DQW A;  1AEY A;  4MMK A;  2LQW A;  1I1J A;  2CP7 A;  5L23 A;  3SWN A;  1K9M C;  1D09 B;  3EG3 A;  1F5Q B;  5HKC A;  4M78 E;  1PD0 A;  2KRN A;  2VXE A;  1ZSZ C;  2H3J A;  5AT1 B;  2DZC A;  4XU2 A;  1LJO A;  3U23 A;  5KYY B;  2NUT B;  2D6F A;  4OB1 B;  3OYA A;  2NUZ A;  5M9O A;  1IB8 A;  3GLX A;  3OB9 A;  1TOV A;  1NEG A;  2ZAE A;  2YHT A;  5A0G A;  4MDW A;  2D0N A;  2LMJ A;  2C0O A;  3CCQ T;  4EOS B;  2H8H A;  2X4J A;  2HDA A;  1JB0 E;  2JZ2 A;  3MET A;  2RHY A;  3QYH B;  1YP5 A;  5KYY A;  1VA7 A;  2K3X A;  2DIQ A;  4M75 B;  1KJW A;  3NTI A;  2E10 A;  2EAY A;  1GFC A;  3VS1 A;  2NUT A;  2QAS A;  4NOY A;  5KYU A;  2DD4 A;  2O9S A;  5A0L A;  2DK3 A;  1OEB A;  1X69 A;  2DNU A;  2LRQ A;  1YCY A;  1UGQ B;  2FPF A;  1G3Y A;  2IG0 A;  2K5L A;  1RI0 A;  4AKG A;  3M55 A;  2LNH B;  3PVL A;  3A5Z B;  4RTV A;  4EMK B;  1WLP B;  2DL3 A;  5IXB A;  1BBZ A;  1RAB B;  3BHU B;  3GTM S;  4D6W A;  1QLY A;  1AWX A;  1VQ6 Q;  3FRN A;  4M75 A;  4PJN A;  1KQ1 A;  2VV5 A;  3CCE A;  1WHJ A;  2QYZ A;  1VQ8 Q;  4F6U B;  2DZ9 A;  1JST B;  2BTT A;  1BI0 A;  1Q81 U;  1QQJ A;  4BD3 A;  3EJ1 B;  5D6W A;  3OS1 A;  2PMI B;  4HKE A;  3O0G D;  1RI9 A;  1W4S A;  3NPF A;  4FYY B;  4EMK A;  2EQM A;  4B9X A;  4F04 B;  3JB9 D;  2CCI B;  3QJ6 A;  2W96 A;  4IUP A;  3F5X B;  1M3B A;  3HRS A;  4OGC A;  2K79 A;  2OJ2 A;  3I55 Q;  3CME Q;  3LQ5 B;  1AIS B;  1QVG P;  3QWL A;  1Q7Y R;  1CSK A;  2VWF A;  3C95 A;  1VQM A;  3QKJ A;  2DXU A;  1JU5 C;  4KBM B;  3JB9 F;  1OZ3 A;  4FIB A;  3DB4 A;  2J6K A;  5EC7 A;  2DJQ A;  2M9U A;  1SEM A;  2RHI A;  3OYL A;  1IO6 A;  5KH6 A;  3CC2 A;  2E3I A;  4QVC A;  4VUB A;  1K73 U;  3MI9 B;  3M0P A;  3UA7 A;  1VQ7 Q;  3FB9 A;  1PSE A;  5HY6 A;  4JX5 A;  4AI6 A;  4OMQ A;  1VQK A;  1JBM A;  5LJ3 e;  3G1J A;  2QG9 B;  3A8H B;  4RKU E;  2JMC A;  3BG3 A;  5LJ3 f;  2CZ7 B;  2YRD A;  4F7U E;  3GNF B;  1Q81 C;  1C0M A;  3EFR A;  5HVY B;  1E7O A;  4A4E A;  4FM4 B;  2MWP A;  3OMG A;  1GFD A;  1VQ5 A;  2KRM A;  2JUF A;  4OMO A;  3POM A;  5GAO m;  2HAX A;  5GAN 3;  2XMF A;  1WHL A;  4XTU A;  4AKI A;  1F1B B;  1MHN A;  2EPD A;  3QUI A;  3DDQ B;  1TWB A;  2CSQ A;  3QHS A;  1QMC A;  4QKU A;  4DEX A;  4BCH B;  3G71 Q;  1MGQ A;  2MYS A;  3NTK A;  3FIF A;  5GAM g;  2G77 A;  2XG8 D;  5HNB B;  2QQA A;  2RQR A;  4MIM A;  5D6X A;  1K73 C;  2YSQ A;  5LJ5 g;  3H0I A;  3CD6 Q;  1B7T A;  2O88 A;  4N0A C;  5CQX A;  2VAS A;  2W0Z A;  2HNI A;  1TTH B;  1RL2 A;  1WZO A;  3A8L B;  2DD5 B;  1VYV A;  4JRP A;  4CFU D;  3OS5 A;  4V2S A;  4X34 A;  2QFZ A;  2UZL B;  3PNW C;  3UDC A;  4BY6 B;  5I21 A;  2E1H A;  1OU8 A;  3PMT A;  3BDL A;  5BNJ B;  3NGP A;  4GY5 A;  2YUN A;  1S72 T;  1Z9Q A;  4PNO A;  4XTY A;  3FJP A;  1OI1 A;  3VS0 A;  1K1Z A;  2CSI A;  3CXC P;  3Q1J A;  3F70 A;  4M78 G;  2K4Y A;  2W2H A;  1EIF A;  1K8A R;  3VS5 A;  1HK9 A;  4QQD A;  2QEX A;  1RAG B;  1OYX A;  2C4G B;  2CGH A;  3X28 B;  1WDX A;  3OS2 A;  4CFW B;  2RJD A;  4M7A B;  4M78 D;  1UDL A;  1K0S A;  1YCS B;  5HK3 A;  2FPD A;  4II5 B;  4F16 A;  1UGP B;  3J7A F;  2OTJ T;  1YHQ Q;  2HZY A;  2RHX A;  2VYT A;  4M78 F;  1LPL A;  2KE9 A;  2O2O A;  4HCB A;  3LH0 A;  4FSX A;  3V7R A;  1X6B A;  3FLG A;  1GH6 B;  1H24 B;  2NUP B;  3I35 A;  3MEU A;  1R0B G;  3I5R A;  1UHF A;  1M2V B;  5CYI B;  1N6A A;  3OMC A;  3M58 A;  3QDF A;  2OAU A;  4RTW A;  3EGD B;  4M7A A;  2I40 B;  1H1Q B;  2DO3 A;  2YUP A;  4QVZ A;  3I56 T;  1XTD A;  1PHT A;  5HK0 A;  5A2Q E;  4M78 C;  2X1N B;  5HQ0 B;  1N8R U;  1KHI A;  4F7J B;  2LX7 A;  4JPB W;  4XTW A;  4R0K A;  1G3T A;  3G6E Q;  1PKS A;  4XU0 A;  5FRO A;  1P5E B;  1YWP A;  3SHW A;  5LJ5 j;  3TNW B;  4MZP A;  4BBS M;  2WAC A;  3ZBD A;  3TW6 A;  3M03 A;  3DLM A;  2ROT A;  2L3P A;  2DL8 A;  4RUG A;  3QHR B;  4BB7 A;  1MMD A;  2JS2 A;  3JCM g;  1M2V A;  2LZ6 B;  2DIG A;  4BCJ B;  3MO8 A;  4JUV A;  4Z88 A;  3QYE A;  1UJ0 A;  2DMO A;  4HCZ A;  3RIR A;  2CJM B;  2LTO A;  2C5V B;  3HRT A;  2BZY A;  2MI6 A;  2QDY B;  2FG0 A;  1N9S A;  4JRI A;  3GOX A;  3MEV A;  3OYM A;  4HT9 A;  2K7A A;  3OW2 P;  2CZ6 B;  2LW4 A;  4LN2 A;  4PFP A;  3DKM A;  1RAI B;  3CC7 A;  3G4S A;  2RHZ A;  4LD9 K;  1UGS B;  3MCA B;  3X24 B;  1ZHI A;  3X26 B;  3OBY A;  1N8R C;  2QF7 A;  1OZ2 A;  1LCK A;  1YJW Q;  3OY9 A;  1YIT Q;  1MNE A;  5EJC A;  1VOM A;  4XU3 A;  3TU4 K;  1WX6 A;  2IVW A;  4F6S B;  3CCR Q;  2VKN A;  2K2M A;  4OB3 B;  3V8L A;  4L6V 5;  3NHN A;  4IUU A;  1FX7 A;  3JCM W;  1Q82 U;  3CC4 Q;  3S3N A;  4XTZ A;  3OYJ A;  1QVG A;  3CCJ Q;  2ZPG B;  4M75 E;  1K4U S;  2RHU A;  2EYW A;  2K6D A;  4EMH A;  5ACB A;  2M02 A;  2QXF A;  5FW9 A;  2QA4 Q;  3CCV T;  4DOV A;  3KFV A;  4HVU A;  5KYW B;  4Y28 E;  1V29 B;  4A4G A;  2HBP A;  3JCM c;  2E64 A;  3RER A;  3AT1 B;  3M0S A;  4F7U G;  1VQO T;  2X35 A;  1FVV B;  5FRN A;  4QQ6 A;  1YN8 A;  3URG A;  3MEA A;  5GAN d;  1A0N B;  3CCQ A;  2RI2 A;  4HVW A;  4EIK A;  3OYY A;  1SSH A;  5IAY A;  2O9V A;  3VU3 C;  3HHT B;  2LX9 A;  2RJE A;  2IIM A;  5LMK B;  4F7U F;  4LDY A;  2I53 A;  3TEE A;  1ABQ A;  1WQ7 A;  3MEW A;  2RF0 A;  3E9G A;  3HP9 A;  4J83 A;  3QG1 A;  1SG5 A;  3FEO A;  2LDM A;  1Q82 C;  3NFC A;  2RJF A;  3EID B;  2L5Q A;  4EMG A;  2LJ1 A;  1RAH B;  2ED0 A;  3VS4 A;  2V8J A;  4IIM A;  4QSH A;  1T0H A;  3WVD B;  2X51 A;  3JCM J;  3M4G A;  4D8D A;  3V7S A;  2RD1 A;  4JJN K;  3M9Q A;  5IF1 B;  3S3M A;  1G83 A;  1JQQ A;  1T0J A;  8ATC B;  3L2R A;  1QWE A;  3MY5 B;  2AZS A;  2CP5 A;  2D1X A;  4J6X A;  4ELY C;  2CRE A;  2DAQ A;  4JZ3 A;  2J6O A;  2P0K A;  4FCY A;  1N4M A;  1URC B;  4AG2 C;  3ASK A;  1VQL Q;  1G3N C;  2HD0 A;  5GAN 5;  4QW2 A;  4ELZ C;  3H41 A;  3BFM A;  1YJN Q;  1UB4 A;  1M90 R;  3DDP B;  4CC3 A;  1ENW A;  3CXC A;  1OL2 B;  1LVK A;  2E65 A;  3S3O A;  2EUF A;  1NM7 A;  3NDQ A;  5FU7 B;  3EG0 A;  5IHN A;  1EFN A;  1ZSG A;  1RLQ C;  1H1S B;  1AWW A;  2FB7 A;  5CQY A;  3BG5 A;  3K7A M;  3ZL7 C;  5GAN g;  1VQ6 T;  3M59 A;  4JJB A;  1JJ2 P;  4AFU C;  1D3U B;  4DBR A;  2F2X A;  2DTI A;  1WHK A;  2A28 A;  4AT1 B;  4F7L B;  3REB B;  1VQ8 T;  3M5A A;  2DEU A;  2EWN A;  4BE0 A;  3OYG A;  4ROC A;  4FX3 B;  4RTY A;  1H8K A;  2DJZ A;  3CCS Q;  5FU7 C;  2BZ8 A;  2LC4 A;  4D8K A;  1H26 B;  3DOG B;  1ZA2 B;  1GXI E;  2P4T A;  2XK0 A;  3JRZ A;  1OX8 A;  2O4X A;  1MV3 A;  3LGL A;  3SFM A;  5DM7 R;  2C5O B;  4C5H A;  4RCB A;  2K9G A;  4J5Y A;  1Z9Z A;  3I55 T;  3CME T;  2LQ8 A;  4NL2 A;  4J9H A;  3M4Y A;  1PRM C;  1AD5 A;  1NPP A;  4NL3 A;  2W99 A;  3M53 A;  4XQ3 A;  2B86 A;  4EON B;  3JCM V;  1UJY A;  4LDU A;  1BI3 A;  3EG1 A;  2HCK A;  2J05 A;  1NEB A;  2DL5 A;  1YWO A;  4RG2 A;  4OGE A;  3HTR A;  2MIO A;  1N9R A;  4Z02 A;  3CBO A;  1VQ7 T;  5FLX E;  4KT0 E;  5GAN 8;  1XQH A;  2NLU A;  2E4H A;  5FU6 B;  3L42 A;  2R5M A;  4ZN3 A;  1KFZ A;  2OTL Q;  1FWZ A;  2BE9 B;  4HLQ A;  4J9C A;  2L0A A;  2QDJ A;  4J6W A;  3VRZ A;  1ZBX A;  1PM3 A;  1WFW A;  5CK9 A;  4BXX X;  2GCX A;  4BCG B;  4PJO A;  4M7A E;  4P5N A;  3G4S T;  3SWN C;  3JV3 A;  4JJC A;  5LJ5 h;  2LCS A;  1OX9 A;  1WXU A;  4J8O A;  2CS7 A;  2X3W D;  1OUL A;  1ZA1 B;  2COW A;  2L3R A;  3OW2 A;  1S72 A;  1Y71 A;  3D7S B;  1BK2 A;  4HL4 A;  4OMM A;  4J7F A;  4A4K A;  4KUI A;  2CZ0 B;  1D3B B;  3PO3 S;  3OYI A;  2FEI A;  2CP6 A;  3A8M B;  4BCI B;  1JEG A;  4CRI A;  1M5Q 1;  2RN8 A;  4M75 G;  1EZZ B;  3CD6 T;  5FWC A;  1JOW A;  5KYU B;  2DD4 B;  2UZE B;  3H4C A;  3EGX B;  1M1K R;  4BCQ B;  2K5F A;  1X2K A;  3OYN A;  2HEQ A;  5CAI A;  4OR5 B;  4M75 D;  1KD1 U;  3JAM E;  2RQT A;  4ESR A;  2OTJ A;  2E70 A;  5I22 A;  2I0N A;  4BUG A;  4IUV A;  3R6O A;  1D3B A;  4XTV A;  2KBT A;  4M75 F;  3BLH B;  4Z89 A;  3KUF A;  5DY9 A;  1RAF B;  1KC8 R;  2XDB A;  2HL3 A;  1V76 A;  2D0Q B;  4C5E A;  2KK4 A;  2GQV A;  4KRT A;  2IW8 B;  3QHW B;  3RKY A;  3I5S A;  4AFQ C;  1YFN A;  3EGX A;  2V26 A;  3I56 A;  1M1G A;  1QVG S;  2H3E B;  2CUD A;  2COZ A;  2HQH A;  2ECZ A;  4KGX B;  1V1C A;  2KSS A;  4M75 C;  4JLI A;  3OYB A;  1ZX6 A;  3MP6 A;  1YHQ T;  1TSF A;  5CR2 A;  3B57 A;  2F2C A;  1DJ7 B;  2ATC B;  2MOX A;  4OML A;  1SKU B;  4K11 A;  4IMY B;  4CC2 A;  1KD1 C;  3L2V A;  5HBJ B;  1T3S A;  1B07 A;  4MZT A;  2RMO A;  2FYK A;  4OP0 A;  2C5X B;  4FT2 A;  4EMK C;  1C9B A;  1QCF A;  2KI7 A;  1TFB A;  1UHC A;  5FGK B;  1JXO A;  3JCM h;  1NLP C;  4BY1 X;  5CEI B;  2K57 A;  1K8A U;  2E3H A;  2KR6 A;  2EGE A;  3SEM A;  2RI5 A;  3KBG A;  3RMS A;  2YRV A;  3CCU A;  2P0P A;  1Q95 G;  2M1H A;  2VGN A;  3L2Q A;  4FYV B;  1YI2 Q;  3G6E T;  4RTX A;  1D0Z A;  4L59 A;  4MFD A;  2FZK B;  1BIA A;  1QKW A;  3CMA A;  2OAW A;  2LT4 A;  1NZ9 A;  2GNC A;  2AT1 B;  2DBM A;  3A1P A;  5LJ3 d;  4PLL A;  5KYX B;  4J9E A;  3QBY A;  2KAF A;  1TH7 A;  2HL5 C;  3ZFJ A;  2V1Q A;  4FU6 A;  5GAM e;  3HZJ A;  2ZPF B;  2JS0 A;  3CCL Q;  4EOI B;  5LJ5 e;  3CCV A;  2FPE A;  5LJ5 f;  1JJ2 A;  2C06 A;  2C6T B;  2CH4 A;  3CCM Q;  2QQB A;  1AT1 B;  4Y92 A;  1VQO A;  1RAD B;  3OYD A;  3QYG B;  4FW2 A;  5I2M A;  2EBP A;  1K8A C;  1XJW B;  4KH1 B;  1XO2 A;  5KYX A;  1K76 A;  4BDY A;  2CUB A;  2QDL A;  3CXC S;  3WXM B;  1YJW T;  3EH1 A;  1YIT T;  2EYY A;  3VS3 A;  2DRM A;  4E7Z A;  1M30 A;  2JGZ B;  3ULR B;  3TCJ A;  3QWX X;  3LX7 A;  3CCR T;  1YIJ Q;  4ELL A;  4YTL A;  3PVQ A;  4KH0 B;  1RLP C;  2G6F X;  1R8O B;  5HCK A;  4XU1 A;  3CCJ T;  3PTA A;  1TXQ A;  1GY3 B;  3CEY A;  2XHC A;  1U1S A;  4M6V A;  1M3A A;  3OYK A;  2ZPI B;  2QA4 T;  2KT1 A;  1T3L A;  3JSC A;  4CFN B;  2DLP A;  2KNB B;  1W2B P;  5GJW B;  2K3Y A;  4M4Z A;  2CZ1 B;  1VUB A;  5I2S A;  2R7G A;  2YWW A;  3QZ9 B;  1UE9 A;  4KRD B;  2HKN A;  5CO7 A;  4EOL B;  5EFQ B;  3RUX A;  2KMG A;  2CCH B;  4M7A G;  4C92 G;  1WPY A;  1QLB A;  3HKS A;  1QP2 A;  2DM1 A;  2XKO C;  3BLQ B;  1OL1 B;  1JSU B;  3LLR A;  1X43 A;  1D0X A;  1VIF A;  4BI8 B;  1WHM A;  1VQ9 Q;  4M7A D;  2G3R A;  2KRO A;  2RQW A;  1ZP2 A;  2JW4 A;  1K9A A;  2DFU A;  4ANJ A;  4DOW A;  1M27 C;  1VYU A;  2DX1 A;  4E7L A;  1K0X A;  2EIF A;  4M7A F;  4BY6 C;  2ZPH B;  1PRL C;  3EFS A;  5CVI A;  1I07 A;  1Q81 R;  4FSS A;  2COY A;  4C92 B;  1GCQ C;  1YJ9 Q;  2BIV A;  1NYF A;  2DET A;  1IGQ A;  4DBH A;  1LOJ A;  1WJQ A;  3C4S A;  3BHV B;  5GAO l;  2E12 A;  4ZTF A;  4OMN A;  1OPK A;  4L5G A;  1BCO A;  1H64 1;  2A08 A;  2LJ0 A;  5I11 A;  4PJO E;  5GMK m;  1VQ6 A;  1TUG B;  2PU9 B;  4JX4 A;  3JCM e;  2A36 A;  1QVF P;  2WFY B;  2BPM B;  4Z6Y A;  1WXT A;  4J9D A;  2RO0 A;  3TNI B;  4HVV A;  3JCM f;  3UWN A;  1VQ8 A;  4FW1 A;  4M7A C;  2GTO A;  3GPL A;  2RQU A;  4A4H A;  3OW2 S;  5KE3 A;  4JS5 A;  3H6Z A;  3HL8 A;  1D1A A;  2HSE B;  2BS2 A;  1WI7 A;  2LNV A;  1K73 R;  4C92 A;  1OGU B;  2WMA B;  1I4K 1;  1YJN T;  1CKB A;  4E2F B;  5GAM j;  2QQ8 A;  1QWF A;  2YT6 A;  3I55 A;  3CME A;  3ME9 A;  1U8R A;  3VJP A;  2DIL A;  4LE9 A;  4RTT A;  2ENM A;  3G33 B;  4E7S A;  1KK7 A;  4ZN1 A;  2B8A A;  3TSZ A;  1UGR B;  2EQU A;  3PMI A;  4C0F A;  3VKH A;  5L2W B;  3OBW A;  3CPW P;  1VIE A;  3N5B B;  1U1T A;  2PUK B;  5KYN A;  4J9G A;  1VQ7 A;  3QWY A;  3S6W A;  1IGU A;  3CCS T;  1VQP Q;  4UN0 A;  2WHB B;  3BW1 A;  1M3C A;  5IDN B;  1S1N A;  4BBR M;  3M0Q A;  4ROE A;  2E41 A;  2DER A;  4DEY A;  3CCU T;  4BE2 A;  4F7N B;  2F5K A;  5KCH A;  2BKD N;  4RTZ A;  1UEB A;  3EG9 A;  3VS6 A;  3VKG A;  3CMA T;  3VYG A;  4EC8 B;  3HPW A;  5LL6 S;  1MMN A;  4M7D B;  2LQN A;  5D7U A;  1FMW A;  1PKT A;  1ZQ1 A;  1M1F A;  1BIB A;  2VB6 A;  1FYN A;  3G71 A;  2JTM A;  1OIU B;  2R58 A;  1I5L A;  4E7I A;  1VQN Q;  3CD6 A;  3FDR A;  2UZD B;  3G7Z A;  2XDD A;  1CKA A;  2KEA A;  1FXX A;  2EJF A;  2KRS A;  4RMO A;  2A37 A;  4TTH A;  2YUO A;  4C5G A;  2D8H A;  2CH4 W;  3J80 E;  2EGC A;  1OQK A;  4MFE A;  2KGT A;  2EJ9 A;  2PVG B;  1C1A A;  4M7D A;  3TNH B;  3L1A A;  5CKE A;  2LP5 A;  2A0F B;  3HFO A;  1SHG A;  2C0T A;  4QT7 A;  5DLO A;  3HB9 A;  1OI9 B;  1VQ4 Q;  1QW1 A;  2RPN A;  2DF6 A;  4F70 B;  4BCN B;  3P8D A;  2QAZ A;  5A0D A;  4YOZ A;  3X20 B;  4C8Q G;  4PL6 A;  1Y0M A;  2JN0 A;  1IRE B;  2MF2 A;  2V22 B;  1GUX A;  3NMZ C;  2DL7 A;  2HQE A;  2QK0 A;  2F5T X;  2BS3 A;  2PK2 A;  3LW5 E;  1JJ2 S;  2QQ9 A;  2EQJ A;  1KIK A;  2ROL A;  1XOV A;  1YHQ A;  5GAN e;  3GP8 A;  2DYB A;  3LH5 A;  4HNV A;  1VOL A;  1HSQ A;  2M51 A;  4C8Q B;  2PTK A;  2PVO B;  3MHX A;  1UNH D;  2OX7 A;  4LDW A;  4EOR B;  4BCP B;  3L2W A;  3LWH A;  1H27 B;  1GBR A;  4A4F A;  4PKC C;  1Y96 B;  1NG2 A;  5KCO A;  3BLR B;  2ZCF B;  4BY7 X;  5GAO q;  5C6S A;  1NJI R;  2XI9 A;  3EFO B;  2L3S A;  2DEQ A;  1WHG A;  4EC9 B;  1SSF A;  2I2L A;  5GAN 4;  3TN8 B;  4CC7 A;  4EDU A;  3BHT B;  3ER0 A;  3HRU A;  1H4L D;  3OSV A;  3G6E A;  4E47 A;  2OI3 A;  2O4X B;  6AT1 B;  4OGR B;  3C12 A;  4C8Q A;  1M1K U;  3M0U A;  2DME A;  1IHV A;  4AMC A;  4KGZ B;  1GL5 A;  2WIH B;  1UEC A;  2RNA A;  1IHW A;  4FT4 A;  2GTJ A;  1UNG D;  1Y96 A;  2L2P A;  1HYO A;  1PCX A;  4CI0 C;  4PJO G;  4JX6 A;  3X25 B;  3GBQ A;  3EFO A;  2KQW A;  5HBE B;  4BCM D;  3DLL A;  4HNT A;  4M77 G;  2GGR A;  1PWT A;  4PJO D;  2HBW A;  1EX4 A;  2KMT A;  2PHG A;  5D6Y A;  1QVF A;  1QMZ B;  1KQS P;  3CCE Q;  2DPP B;  4O5V A;  3MJX A;  3RBB B;  1YI2 T;  2DXB A;  2RB6 A;  4BCM B;  2KVQ G;  4O6J A;  4PJO F;  2VXF A;  1KQ2 A;  1UUE A;  4C5I A;  5GAN 2;  5FRM A;  4PJO B;  4MML A;  1YJW A;  1YIT A;  1X01 A;  1H3H A;  4KGV B;  1JRI A;  3MP8 A;  2LCL A;  4M77 B;  4E6R A;  3CCR A;  2UUE B;  1M1K C;  2K2V A;  1SF9 A;  1I5O B;  1W6X A;  1MMA A;  2FVU A;  3P8B B;  2NYS A;  5GAO p;  3CC4 A;  3QYB A;  3VRY A;  3CCJ A;  1TUC A;  3CCL T;  2CKK A;  1VQM Q;  2VVK A;  2P84 A;  4PJO C;  2E6N A;  2QA4 A;  3RKX A;  5KE2 A;  1M8V A;  2WMB B;  5GAM h;  3H9N A;  3JCM Q;  3CC2 Q;  3CPW A;  5DLQ E;  3CCM T;  2LJ3 A;  3EHQ A;  3R6N A;  4ZGE B;  5J3B A;  4C92 E;  3T9N A;  3E9F A;  3L2Z A;  4C0D B;  3RDV A;  2CT3 A;  4ORZ A;  2F2V A;  1ZBJ A;  1VQK Q;  3QXE B;  1M2O A;  2MCN A;  2CDT A;  5FU6 C;  3CBP A;  2M16 A;  4M77 A;  2KYB A;  1FKM A;  1ZLM A;  2EFI A;  1Q7Y U;  4JRQ A;  1YIJ T;  1ZSZ B;  4E7K A;  1SRM A;  3G71 T;  4E7J A;  5CKH A;  2AHJ B;  4BCQ D;  4F14 A;  4Z8A A;  1Y07 A;  1N5Z A;  5GAN j;  4HNU A;  1VQ5 Q;  3OYF A;  1UTI A;  4C0D C;  2ZZD A;  2GFU A;  4PJL A;  2FRW A;  2AKK A;  4DA4 A;  4JZ4 A;  4LDV A;  3AHU A;  3RNJ A;  2KYM A;  1Y7X A;  3BG9 A;  4Y91 A;  1HD3 A;  4IUQ A;  4BI4 A;  4EOM B;  2WSE E;  1OPL A;  1BYM A;  4EOJ B;  2GF7 A;  1ZUY A;  2JM8 A;  1ZSZ A;  1N27 A;  2DXC B;  1U3O A;  2AKL A;  5GMK e;  2IW9 B;  1VQ9 T;  1BI2 A;  2SRC A;  2VUB A;  1ACM B;  4ZGD B;  2FL7 A;  4DQ2 A;  1Q86 R;  5CKF A;  1VQL A;  1TUD A;  1Q7Y C;  2QGF B;  2QGG A;  3UF4 A;  5LQF B;  2DBK A;  4BCF B;  4HXJ A;  4II1 A;  2JM9 A;  3QPH A;  3DTO A;  2A3L A;  1YJN A;  1ARK A;  3OS0 A;  2AK5 A;  1YJ9 T;  2EYZ A;  2HKQ B;  3CBM A;  1NYG A;  3VV0 A;  1JKW A;  1NE8 A;  4N4H A;  1X6O A;  3QO3 A;  4NS5 A;  4PLI A;  1HXD A;  2EGA A;  3HBL A;  3MP1 A;  3L2U A;  2QEX Q;  2DXC A;  3TRE A;  1RAC B;  2QQR A;  1K9M R;  4M7D E;  2O31 A;  3PGG A;  2JTE A;  1I81 A;  2F1L A;  4B9W A;  4R56 A;  9ATC B;  4EOP B;  1GRI A;  1OKW B;  2GQI A;  1AVZ C;  1WA7 A;  3QSU A;  1X75 C;  4LDX A;  3CCS A;  7AT1 B;  1KG1 A;  4J6Y A;  2QQS A;  3PT9 A;  2YUQ A;  4XK8 E;  4DBQ A;  2L3Q A;  1E6G A;  2ZPB B;  1GBQ A;  4OMF B;  1KSW A;  4LXC A;  2RQV A;  1H92 A;  2RK1 A;  2XDP A;  2PNI A;  4KUD K;  4WTO B;  1AZG B;  4ELJ A;  2FHD A;  3JB9 G;  1OKV B;  4CFX B;  2DL4 A;  4JS4 A;  5GAM d;  2RM4 A;  1SRL A;  3M57 A;  4N4G A;  2C5N B;  3I9Q A;  1BKB A;  5J39 A;  5LJ5 d;  5EG2 A;  2CP2 A;  1PNJ A;  4HT8 A;  4BCK B;  1OOT A;  2ZPE B;  3VS7 A;  1WJS A;  5GJV B;  1R0C B;  2XU8 A;  1BI1 A;  4J9I A;  4X1V A;  2R5A A;  4J7I A;  4RTU A;  2HQX A;  1X27 A;  1W2B S;  3TQ7 P;  1QCN A;  1KHC A;  2Y90 A;  5GAM f;  4OMP A;  2DRK A;  2LVM A;  3GF5 A;  1VQP T;  3PFS A;  2OTL A;  2Z0W A;  3E1S A;  4A63 B;  2EKO A;  1BB9 A;  4RG8 A;  1PG5 B;  3M54 A;  1ZUU A;  2GBQ A;  2DTO A;  3OYC A;  5CKB A;  5L8R E;  4IIO A;  5IHY A;  1SHF A;  1BU1 A;  2LCC A;  2K3B A;  1AWJ A;  2X4X A; 
#chains in the Genus database with same CATH homology
 2DZC A;  4XU2 A;  4ZN1 A;  3JB9 H;  1LJO A;  2B8A A;  1UGR B;  2EQU A;  3PMI A;  4C0F A;  3VKH A;  3WVE B;  2E6Z A;  2RI3 A;  3OBW A;  1VIE A;  3N5B B;  1U1T A;  2PUK B;  3ASK A;  5J26 A;  2HD0 A;  1KQS A;  1VQ7 A;  5GAN 5;  3HSB A;  4C8Q E;  2L8D A;  5GAO r;  2D6F A;  4OB1 B;  2MMP A;  4QW2 A;  3OYA A;  4ELZ C;  1XNI A;  3CC4 T;  3BFM A;  3S6W A;  3CCS T;  1UB4 A;  2XID A;  5M9O A;  3A8O B;  3BW1 A;  4BBR M;  4QVD A;  1O9S A;  2LQK A;  3GLX A;  3OB9 A;  2E41 A;  3CXC A;  2E65 A;  3LWI A;  3S3O A;  3CCU T;  2YHT A;  1VQN T;  4BE2 A;  4QQG A;  4MDW A;  2F5K A;  5A0G A;  5KCH A;  4GLK A;  4AKH A;  5GMK j;  5FU7 B;  2BKD N;  3CCQ T;  2FB7 A;  3VYH B;  1UEB A;  5CQY A;  3VKG A;  1WQW A;  2X4J A;  3BG5 A;  1JB0 E;  2JZ2 A;  3VYG A;  5GAN g;  3MET A;  3M59 A;  2JVV A;  3C94 A;  3HPW A;  2RHY A;  3QJY A;  5LL6 S;  2WSF E;  3QYH B;  2WJ9 A;  1QVF S;  4M7D B;  2DTI A;  2K3X A;  2DIQ A;  3BDU A;  3INZ A;  4M75 B;  3PIO A;  3UT1 A;  3NTI A;  1VQ8 T;  1WJR A;  2E10 A;  2EAY A;  2E5Q A;  3M5A A;  1ZQ1 A;  5LJ3 g;  4NOY A;  4LOC A;  1M1F A;  2DD4 A;  2DXT A;  2EWN A;  1BIB A;  4BE0 A;  3OYG A;  3G71 A;  1VQ4 T;  5A0L A;  2DK3 A;  2DJZ A;  4IKF A;  1YCY A;  1UGQ B;  2BUD A;  2IG0 A;  1G3Y A;  2JTM A;  2LRQ A;  2K5L A;  2LC4 A;  5FU7 C;  2KDS A;  4C92 D;  1RI0 A;  1GXI E;  4AKG A;  2P4T A;  2XK0 A;  3JRZ A;  2R58 A;  3A8G B;  3M55 A;  3A5Z B;  4EMK B;  2O4X A;  4N0A A;  1I5L A;  3CMA T;  4E7I A;  3LGL A;  3FDR A;  3SFM A;  3CD6 A;  3G7Z A;  5DM7 R;  2XDD A;  4C5H A;  4RCB A;  4J5Y A;  3I55 T;  3CME T;  4C92 F;  1FXX A;  2EJF A;  2Y4X A;  4RMO A;  4D6W A;  2LQ8 A;  4NL2 A;  3M4Y A;  4C5G A;  4JRK A;  1NPP A;  4NL3 A;  3J80 E;  3M53 A;  3QZ5 B;  4BAC A;  3FRN A;  4MFE A;  4XQ3 A;  2EJ9 A;  2PVG B;  3JCM d;  4M7D A;  3JCM V;  4M75 A;  5CIU A;  1KQ1 A;  3L1A A;  2VV5 A;  4LDU A;  4X9C A;  1BI3 A;  5CKE A;  3VUB A;  3CCE A;  4ATO A;  3DB3 A;  3HFO A;  4RG2 A;  4OGE A;  2DZ9 A;  3CPW S;  5DLO A;  1N9R A;  3HB9 A;  1BI0 A;  4LD6 A;  4Z02 A;  1Q81 U;  4BD3 A;  1QW1 A;  3CBO A;  5D6W A;  3OS1 A;  1VQ7 T;  5FLX E;  4HKE A;  1WGS A;  4KT0 E;  5GAN 8;  2CYZ B;  1XQH A;  2NLU A;  3P8D A;  2PQW A;  2DD5 A;  4JLG A;  5IN1 A;  5A0D A;  1W4S A;  3L42 A;  5FU6 B;  3X20 B;  2R5M A;  4C8Q G;  4PL6 A;  4ZN3 A;  1YI2 T;  4C92 C;  4EMK A;  1VQM A;  2EQM A;  4ZGJ B;  1FWZ A;  2JOY A;  2JN0 A;  4B9X A;  1IRE B;  4HLQ A;  3QJ6 A;  4M77 E;  2QDJ A;  4J6W A;  5GAN h;  1ZBX A;  2MF2 A;  5CK9 A;  2GCX A;  4IUP A;  1VQL T;  3GNG A;  3HRS A;  4OGC A;  2HQE A;  4KUL A;  4PJO A;  2GFA A;  3QWL A;  2F5T X;  4M7A E;  3C95 A;  2BS3 A;  1PSF A;  3QKJ A;  2DXU A;  4KBM B;  4M78 B;  4P5N A;  3SWN C;  5LJ5 h;  1OZ3 A;  3LW5 E;  3JB9 F;  4FIB A;  4RCC A;  3DB4 A;  1JJ2 S;  2QQ9 A;  4J8O A;  2CS7 A;  2EQJ A;  2M9U A;  2RHI A;  1YI2 A;  3OYL A;  1XOV A;  5KH6 A;  3CC2 A;  1WNL A;  4QVC A;  1YHQ A;  5GAN e;  4VUB A;  2L3R A;  3GP8 A;  1K73 U;  3OW2 A;  2V8I A;  1S72 A;  4HNV A;  1Y71 A;  1H3Z A;  4C8Q B;  3FB9 A;  1PSE A;  5HY6 A;  4JX5 A;  4AI6 A;  4HL4 A;  2PVO B;  3MHX A;  4J7F A;  4LDW A;  4HA8 A;  4KUI A;  4A4K A;  2CZ0 B;  3L2W A;  1VQK A;  1D3B B;  3LWH A;  3VYG B;  2YLB A;  1JBM A;  5LJ3 e;  4R55 A;  3OYI A;  3A8M B;  4A4F A;  3A8H B;  4PKC C;  4RKU E;  1Y96 B;  2QI2 A;  3BG3 A;  4CRI A;  5LJ3 f;  2JNG A;  4C0Z A;  2CZ7 B;  2V8K A;  3SB2 A;  5KCO A;  4M7D G;  1M5Q 1;  4F7U E;  4IUT A;  3GNF B;  4BE1 A;  4M75 G;  2ZCF B;  1Q81 C;  4IUR A;  5GAO q;  1IZ6 A;  1G3S A;  3EFR A;  5C6S A;  3CD6 T;  2XI9 A;  1M4Z A;  2DEQ A;  2DD4 B;  5LJ3 j;  1SSF A;  3H4C A;  4M78 A;  4A4E A;  3CCL A;  2I2L A;  5GAN 4;  4FM4 B;  2MWP A;  3OMG A;  2X4W A;  4A53 A;  2K5F A;  1VQ5 A;  3OYN A;  5CAI A;  4EDU A;  3JB9 I;  3ER0 A;  3HRU A;  4M7D D;  2JUF A;  3OSV A;  2XIC A;  4M75 D;  5GAO m;  1KD1 U;  3DL1 A;  3JAM E;  3G6E A;  4E47 A;  2HAX A;  5GAN 3;  2O4X B;  3SD4 A;  3OYE A;  4XTU A;  1NJI U;  5CKD A;  3CCE T;  2OTJ A;  2E70 A;  3CCM A;  4AKI A;  1MHN A;  3C12 A;  3QUI A;  4BUG A;  3ZEH A;  1QP3 A;  4C8Q A;  1M1K U;  1M90 U;  3QHS A;  2PVD B;  4A54 A;  5GMK l;  4IUV A;  3R6O A;  4M7D F;  1D3B A;  1MGQ A;  3NTK A;  4M75 F;  4XTV A;  2EYQ A;  4FT4 A;  3FIF A;  1Y96 A;  5GAM g;  2G77 A;  2XG8 D;  4CI0 C;  2QQA A;  4PJO G;  3KUF A;  5DY9 A;  2XDB A;  4MIM A;  5D6X A;  1K73 C;  5GMK i;  4JX6 A;  3X25 B;  2D0Q B;  1P92 A;  2KK4 A;  2GQV A;  3OSS C;  4C5E A;  5AYF A;  2KQW A;  3RKY A;  5LJ5 g;  1YIJ A;  4N0A C;  3SDZ A;  5CQX A;  3DLL A;  4HNT A;  4M77 G;  2HNI A;  3I56 A;  1M1G A;  1QVG S;  4PJO D;  1RL2 A;  3A8L B;  2KMT A;  2DD5 B;  1VQM T;  5D6Y A;  2OTL T;  1QVF A;  3PIP A;  4JRP A;  3RMQ A;  4M7D C;  2KSS A;  3OS5 A;  1G3W A;  3HO8 A;  4V2S A;  4X34 A;  2DPP B;  2MAM A;  4M75 C;  4O5V A;  4JLI A;  2QFZ A;  5GAN 6;  3UDC A;  3PNW C;  2DXB A;  4BY6 B;  2RB6 A;  5I21 A;  2E1H A;  2KVQ G;  2O01 E;  4O6J A;  3OYB A;  3PMT A;  4PJO F;  3MP6 A;  3CC2 T;  1YHQ T;  3BDL A;  2VXF A;  1KQ2 A;  4GY5 A;  5CR2 A;  4C5I A;  5GAN 2;  4PNO A;  5GAN 7;  1S72 T;  5FRM A;  4PJO B;  1DJ7 B;  4XTY A;  2MWO A;  2P0Q A;  3FJP A;  2D9T A;  1OI1 A;  4MML A;  1YJW A;  2RH2 A;  1YBY A;  1YIT A;  1KD1 C;  3Q1J A;  1X01 A;  3L2V A;  3F70 A;  5GAO n;  4M78 G;  1VQK T;  2K4Y A;  1EIF A;  3QII A;  1NJI C;  4MZT A;  3VUZ A;  1JRI A;  3MP8 A;  1HK9 A;  2LCL A;  4QQD A;  4C0G A;  2QEX A;  4M77 B;  2FYK A;  4OP0 A;  3CCR A;  4FT2 A;  4EMK C;  1M1K C;  1OYX A;  2K2V A;  2VC8 A;  3V7C A;  1M90 C;  4OF1 A;  3CC4 A;  2FVU A;  3P8B B;  5GAO p;  2CGH A;  4XTX A;  3X28 B;  3JCM h;  4NC6 A;  5IT9 E;  3QYB A;  3OS2 A;  1VQ9 A;  2RJD A;  4M7A B;  3CCJ A;  4M78 D;  2RA2 A;  3CCL T;  2CKK A;  2K57 A;  1K8A U;  2KR6 A;  4PJO C;  2RI5 A;  2E6N A;  1VQ5 T;  3KBG A;  3RMS A;  5HK3 A;  2QA4 A;  2VGM A;  2YRV A;  3CCU A;  2P0P A;  3RKX A;  5KE2 A;  3E19 A;  2M1H A;  2VGN A;  3L2Q A;  4OB2 B;  1UGP B;  1M8V A;  3G6E T;  1I8F A;  5GAM h;  3J7A F;  3JCM Q;  2OTJ T;  4X9D A;  5DLQ E;  2PUO B;  4L59 A;  4MFD A;  4M78 F;  2RHX A;  2VYT A;  4MZM A;  3CPW A;  3CCM T;  4ZGE B;  1BIA A;  3CPF A;  5J3B A;  4FL6 A;  4BI3 A;  4C8Q D;  4C92 E;  3T9N A;  3CMA A;  1YJ9 A;  4HCB A;  2LT4 A;  3E9F A;  3LH0 A;  3L2Z A;  4FSX A;  4C0D B;  1NZ9 A;  2QTX A;  3V7R A;  3RES A;  3QXE B;  5LJ3 d;  2YLC A;  4PLL A;  3FLG A;  5FU6 C;  3CBP A;  2M16 A;  4M77 A;  1AHJ B;  2KAF A;  3QBY A;  1TH7 A;  3MEU A;  3ZFJ A;  1FKM A;  4C8Q F;  2EFI A;  4FU6 A;  4F7U B;  4JRQ A;  1Q7Y U;  1N6A A;  3OMC A;  5C0M A;  3M58 A;  1YIJ T;  5GAM e;  2OAU A;  5GAN f;  1W2B A;  4E7K A;  4M7A A;  3GIB A;  3G71 T;  3HZJ A;  4E7J A;  4QVZ A;  2ZPF B;  2DO3 A;  3RKW A;  5CKH A;  2AHJ B;  1XTD A;  3I56 T;  5LJ5 e;  1Y07 A;  3V8J A;  5HK0 A;  5A2Q E;  4HNU A;  4M78 C;  5GAN j;  1N8R U;  3CCV A;  1KHI A;  2EQK A;  4JDS A;  3OYF A;  4XTW A;  3P8H A;  4C0D C;  2ZZD A;  5LJ5 f;  4ZTJ A;  1JJ2 A;  4Q5W A;  3J81 E;  1KQS S;  1G3T A;  2C06 A;  2GFU A;  4EPC A;  2KY9 A;  4XU0 A;  4WF2 A;  5FRO A;  2QQB A;  4DA4 A;  5LJ5 j;  4LDV A;  1VQO A;  4MZP A;  3ZBD A;  4BBS M;  2JTF A;  2WAC A;  3QYG B;  5GMK h;  3TW6 A;  3OYD A;  3AHU A;  5I2M A;  4UC4 A;  1K8A C;  1Y7X A;  2K5I A;  2LT1 A;  4C8Q C;  2R57 A;  3DLM A;  4BDY A;  3BG9 A;  2ZGW A;  4Y91 A;  4IUQ A;  3CXC S;  2DVE A;  2RK2 A;  3WXM B;  4BB7 A;  4BI4 A;  1YJW T;  1YIT T;  2WSE E;  1BYM A;  3JCM g;  2EJG A;  4F7U A;  3TCJ A;  3KXT A;  2DIG A;  2L89 A;  2GF7 A;  2QEX T;  3MO8 A;  2DXB B;  3LX7 A;  3CCR T;  4YTL A;  5CCA A;  4JUV A;  4TVR A;  1N27 A;  2DXC B;  3QYE A;  3JB9 D;  1M9S A;  4HCZ A;  1R8O B;  3RIR A;  2LTO A;  3HRT A;  4XU1 A;  5GMK e;  3JB9 J;  1VQ9 T;  1BI2 A;  2VUB A;  3CCJ T;  3PTA A;  4ZGD B;  2MI6 A;  2WSC E;  2QDY B;  3CEY A;  3JCM P;  2XHC A;  2FL7 A;  1U1S A;  4M6V A;  1N9S A;  4JRI A;  3OYK A;  4DQ2 A;  3GOX A;  3MEV A;  3OYM A;  2ZPI B;  5CKF A;  2QA4 T;  1VQL A;  4HT9 A;  1Q7Y C;  3JSC A;  3HFN A;  2CZ6 B;  3QDR B;  1VQ6 T;  2K3Y A;  3DKM A;  4II1 A;  2CZ1 B;  1VUB A;  3QPH A;  3CC7 A;  5I2S A;  1QVP A;  3G4S A;  2A3L A;  2RHZ A;  2DTH A;  1YJN A;  3G4S T;  4LD9 K;  1VQP A;  4OVA A;  1UGS B;  3QZ9 B;  3X24 B;  1ZHI A;  3MCA B;  3OS0 A;  3X26 B;  2Y4Y A;  1YJ9 T;  3OBY A;  5CO7 A;  1N8R C;  2QF7 A;  3CBM A;  1KC8 U;  1OZ2 A;  1Q86 U;  3VV0 A;  2F69 A;  3RUX A;  2KMG A;  1NE8 A;  4N4H A;  3OY9 A;  4M7A G;  5EJC A;  4C92 G;  1WPY A;  1X6O A;  3QO3 A;  4NS5 A;  4XU3 A;  1QLB A;  3HKS A;  4E7H A;  4PLI A;  3V8K A;  1QP2 A;  1HXD A;  2XKO C;  3O8V A;  4M77 D;  3HBL A;  3TU4 K;  3MP1 A;  3L2U A;  2IVW A;  4MDX A;  3FC3 A;  2M0O A;  2DXC A;  4OB3 B;  3V8L A;  1LNX A;  2DKG A;  4L6V 5;  2RJC A;  3LLR A;  1G5V A;  3TRE A;  3UPU A;  4IUU A;  3NTH A;  1FX7 A;  3JCM W;  1Q82 U;  2QQR A;  3S3N A;  1VIF A;  4ME7 A;  4XTZ A;  4BI8 B;  3OYJ A;  4M7A D;  4M7D E;  1QVG A;  2G3R A;  4N4I A;  2ZPG B;  4M75 E;  3KHI A;  3PGG A;  2RHU A;  4M77 F;  1I81 A;  4B9W A;  4R56 A;  4EMH A;  2QXF A;  4DOW A;  3CCV T;  4DOV A;  4Y28 E;  1V29 B;  3OYH A;  3M56 A;  4A4G A;  2HBP A;  3JCM c;  4E7L A;  2E64 A;  2EIF A;  4M7A F;  3RER A;  4BY6 C;  1K9M U;  2ZPH B;  1X75 C;  4OB0 B;  3EFS A;  1B34 B;  3CCS A;  4BDZ A;  5CVI A;  4LDX A;  4F7U G;  1KG1 A;  1VQO T;  4J6Y A;  2QQS A;  2X35 A;  3PT9 A;  4C92 B;  3VKI A;  5FRN A;  2BIV A;  4XK8 E;  3LGF A;  2ZPB B;  4OMF B;  1LOJ A;  1E7P A;  3OA6 A;  1WJQ A;  3C4S A;  5GAO l;  4QQ6 A;  1VQN A;  2E12 A;  2RK1 A;  3URG A;  3EAE A;  4L5G A;  2XDP A;  4ZTF A;  4KUD K;  2ZZD B;  1O75 A;  4HCC A;  3MEA A;  1H64 1;  2FHD A;  4ELJ A;  5GAN d;  3JB9 G;  3CCQ A;  2RI2 A;  4M77 C;  4JS4 A;  3SWN B;  5GAM d;  2RM4 A;  4PJO E;  5GMK m;  3OYY A;  1VQ6 A;  3TW7 A;  2BS4 A;  3M57 A;  3BY7 A;  2PU9 B;  4JX4 A;  4N4G A;  3JCM e;  5IAY A;  1KC8 C;  1Q86 C;  3JCM X;  3VU3 C;  3HHT B;  2LX9 A;  4Z6Y A;  1BKB A;  2RJE A;  5EG2 A;  5J39 A;  3JCM f;  2RO0 A;  5LJ5 d;  3UWN A;  1VQ8 A;  4HT8 A;  2XD0 A;  3LYI A;  4M7A C;  3GPL A;  4F7U F;  2ZPE B;  1NPR A;  4LDY A;  3TEE A;  1WJS A;  3JCM b;  3MEW A;  1WQ7 A;  2XU8 A;  4XAX B;  1BI1 A;  3E9G A;  4A4H A;  3OW2 S;  3H8Z A;  2R5A A;  4J7I A;  5KE3 A;  4JS5 A;  1VQ4 A;  3HP9 A;  4J83 A;  3H6Z A;  2HQX A;  3HL8 A;  3QG1 A;  1W2B S;  3FEO A;  1B34 A;  2LDM A;  2BS2 A;  1KHC A;  2Y90 A;  1Q82 C;  2LNV A;  3NFC A;  4C92 A;  5GAM f;  2X4Y A;  3CC7 T;  2RJF A;  2LVM A;  1I4K 1;  3GF5 A;  2L5Q A;  5LJ3 h;  4EMG A;  1YJN T;  1VQP T;  3OQ5 A;  3PFS A;  2A7Y A;  2OTL A;  2V8J A;  3E1S A;  2EKO A;  4QSH A;  4RG8 A;  3WVD B;  5GAM j;  3JCM J;  2QQ8 A;  3M54 A;  3M4G A;  3V7S A;  4MMK A;  2RD1 A;  4JJN K;  3M9Q A;  3I55 A;  3CME A;  3S3M A;  3ME9 A;  1U8R A;  3SWN A;  2DTO A;  3OYC A;  1K9M C;  5CKB A;  3VJP A;  3L2R A;  5L8R E;  3QSU A;  5HKC A;  4M78 E;  4J6X A;  4ELY C;  2LCC A;  2DAQ A;  2VXE A;  2H3J A;  2X4X A;  2P0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...