4FM4B

Wild type fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPAKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fe-type nitrile hydratase from Comamonas testosteroni Ni1 does not require an activator accessory protein for expression in Escherichia coli.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 56
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4fm4B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fm4B02
4Y28E 2DD5B 2DXCA 2PVOB 2CZ1B 3A8HB 3LW5E 2ZPHB 1PSEA 2DD5A 2WSFE 4RKUE 3QXEB 3VYHB 4OB2B 2DD4A 5L8RE 4ZGEB 3A8LB 4OB3B 2ZCFB 1QP3A 2ZPFB 3A8GB 2DXBA 3A8MB 4OB1B 2DD4B 1AHJB 1UGQB 3QYHB 3HHTB 4FM4B 3WVDB 3QZ5B 4OB0B 2DXCB 3QZ9B 2CZ6B 1GXIE 2ZZDB 2PU9B 1DJ7B 3WVEB 2O01E 1UGPB 2AHJB 3A8OB 1PSFA 4KT0E 3VYGA 2CZ0B 2PUOB 2WSCE 4ZGJB 1V29B 2ZPEB 3X26B 3X24B 2ZPBB 1JB0E 3X20B 2WSEE 2ZZDA 2ZPGB 2CZ7B 1IREB 2PVDB 2D0QB 1QP2A 4L6V5 2DXBB 4ZGDB 2PUKB 2DPPB 2PVGB 1UGRB 1UGSB 3VYGB 3X28B 2CYZB 3X25B 2QDYB 2ZPIB 4XK8E 3QYGB
chains in the Genus database with same CATH superfamily
3BDUA 3CCLQ 2MIOA 3CQTA 1VQMA 3PGGA 4GY5A 4KRCB 2OTJT 4RTXA 2LT1A 2LT4A 2XHCA 2CKKA 4BD3A 4LDWA 5CIUA 5GAOn 4AT1B 1YI2Q 1I1JA 1NEBA 4BCHB 1B34B 4D6WA 3MP1A 1MV0B 1U8RA 1E9HB 5L8RE 3CMAQ 1Y71A 4KH1B 4IIOA 3CCUQ 1HK9A 4N0AC 2QXFA 1QVFS 2EW3A 4Z6YA 4J83A 1NYFA 3BG3A 2B86A 3JCMW 1N4MA 4FYWB 3OMCA 1S72A 1VQ6Q 4AKIA 4XTWA 3V8LA 4OMNA 3JCMQ 1Q95G 1VYUA 3LH5A 2D8HA 3REAB 2J05A 1J3TA 3CC4T 1Y96B 3QZ5B 2QYZA 4F7JB 1UDLA 4NOYA 4OGEA 1YIJA 4PJLA 2HQXA 4XTXA 1PWTA 2LQNA 5DM7R 3BLRB 4CFNB 2RH2A 3EFOA 1OOTA 3MEVA 1U1SA 2RQTA 3OYEA 3JB9J 4HVUA 4JS5A 5HK3A 3CCRT 2KR6A 4VUBA 5CKHA 5KYUB 3CMAA 2JMCA 4E7SA 3QWXX 4CFWB 5DY9A 2UZBB 4IIMA 1X2QA 3PIOA 4OF1A 2GQVA 4JX4A 2V1RA 3LLRA 4LDVA 2VV5A 4JX6A 4EOMB 4C92B 3VRYA 1JXOA 5LJ3e 2NUPB 3EG3A 5HNBB 5GAOp 3HL8A 1R0CB 2LVMA 4BCJB 4XU2A 1H641 2GGRA 1SRMA 1JJ2S 1YBYA 2X9HA 4X1VA 1VQ8Q 3GOXA 4C0DB 4J7FA 2JM9A 1N9RA 3PMTA 3QHRB 3X28B 1WPYA 3L2VA 2CYZB 3QPHA 1BU1A 1N8RU 4KUIA 3JB9F 1E6GA 1HSQA 3QYEA 3CD6A 2DD5B 2DXCA 2QQ9A 4B6MA 1OU9A 2P4TA 2D8JA 1WA7A 3EH1A 4N4IA 3LYIA 2QTVA 5KYWA 1S1NA 4M4ZA 2E5QA 1YI2T 3HRSA 4QQ6A 3I55Q 2RA2A 1SF9A 1KC8R 1G3SA 4EC8B 2DZ9A 1SRLA 1NZ9A 2DL3A 2CCIB 1UNLD 1IO6A 2W10A 1GFCA 1G3TA 1HD3A 3VS4A 1R77A 2PMIB 4BCPB 2M1HA 3BFMA 1KD1C 4HVWA 4XTZA 1UECA 3CCQT 3CCET 1PCXA 3OS0A 1XQHA 1WHLA 3JSCA 5FU7C 3PO3S 2QA4A 1JSUB 3CD6Q 4E47A 3OYBA 1Q7YR 3HFNA 2K6DA 2DRMA 4FW1A 4Q5WA 2EJFA 3G4ST 2O9SA 3BHTB 1T3LA 3J81E 1Q81U 4CC4B 1H92A 4RMOA 3NTKA 3MIAB 5BNJB 1E7OA 3VU3C 4M75E 4BCNB 3M0RA 3G33B 1YJ9Q 2PUOB 3KUFA 2RM4A 4UC4A 3I35A 5LJ3d 1X2KA 1N27A 2EJGA 3SWNB 3THKA 2DM1A 4BUGA 2ZPEB 4BI8B 2BS2A 1RAAB 2V8IA 1M90R 1VQ9Q 4FT4A 2PNIA 1M3CA 2HMAA 4DEXA 3JB9G 2WMBB 4JRIA 2O88A 3BHVB 4L6V5 2DXBB 1M2OA 1D3UB 2W2HA 3CCST 2HBWA 4N4HA 3VKGA 4PJOD 2ED0A 5GAN4 1OIYB 2AZSA 1X6BA 2K3XA 3NTIA 3CMEQ 1G83A 2EQMA 3G1JA 5CAIA 3H4CA 5LJ5e 1YJWT 1QCOA 2PK9B 4G6LB 1K9AA 3RMQA 3HPWA 1ZUUA 4HKEA 4ME7A 4KGVB 4NL2A 4F70B 2IPOB 4JZ3A 4CRIA 2BS4A 1SEMA 2KXCA 3TNWB 3QXEB 3VUBA 3OYNA 2A08A 4BCIB 1U1TA 4M78A 3JB9H 3VUZA 3EGDB 2NUTB 1Q86U 2DTIA 1B7TA 1Y07A 3E19A 1HYOA 1ZX6A 3B57A 1PM3A 3PFSA 4BE1A 4OMLA 2F5TX 1MMGA 4J9CA 2WACA 3GTMS 2B8AA 4AKHA 4BCND 3HO8A 2HL5C 3UA7A 4OB0B 2FB7A 2HL3A 4FW2A 4M7AD 1V76A 1EFNA 1X75C 2HKNA 4J7IA 1QVGS 1QLBA 5HBJB 4A4KA 2QQAA 3EG2A 1BKBA 2R5MA 3SDZA 2J06A 1XOVA 4FYYB 2JT4A 3I55T 1PKTA 2J7IA 2FHDA 3OW2A 3X20B 4E7HA 1YJ9A 2L3QA 3S3NA 4EMKA 2KRNA 3CMET 4JJBA 2P84A 1QP2A 1Y57A 4EPCA 5FWCA 4M75C 3BDLA 4JRQA 1WIEA 3CCSQ 3OYLA 3JB9D 2QI2A 1XTDA 5FU7B 4M7DC 3G6EQ 2CT3A 2LNVA 3MP6A 3KHIA 4L5GA 1VQLT 1OL1B 3NDQA 4CI0C 1K9MU 3JCMc 4ANJA 1KG1A 2JVVA 4FYXB 5CKDA 4RCCA 1D0ZA 1VOMA 3CC7A 1YJ9T 3OBYA 1WI7A 1WZOA 4HCZA 3VV0A 1BB9A 2CGHA 2QA4Q 1RAFB 2XG8D 4RTTA 2DERA 2RD1A 3F70A 4EIKA 2C5XB 3T9NA 3EG1A 4PJJA 1ACMB 3CCJA 1RAHB 5GMKm 3CBMA 1H8KA 2C6TB 1X43A 3FJPA 5HCKA 1D3BA 3DOGB 4AFZC 4L59A 3DJBA 2CP0A 4F7UB 4MMLA 3OS5A 4J9BA 1AD5A 3NMZC 4BCMD 4A63B 3JCMV 5LMKB 2LCLA 2DTHA 3OSVA 4HT8A 4BCKB 3OYIA 1QVFA 3OYKA 3MO8A 1C9BA 5I21A 3A98A 4M77A 1VQLA 1T0HA 2O31A 4I3ZB 3VRZA 4BY6C 2MOXA 1YNZA 2HNIA 1UJYA 1VQKA 2GFUA 1Q7YC 3ULRB 2QGSA 1GUXA 1QCFA 3EIDB 5D6WA 4HT9A 3JRZA 4HNUA 5KCOA 2VVKA 2E3IA 5A0DA 2K7AA 2EKOA 3JCMe 5CQYA 4J9IA 2PUKB 3DDQB 4LUEA 1UGRB 1VQKQ 4MDWA 3M58A 2E6NA 2NWMA 2LQ8A 2M9UA 4CXAB 2DRKA 3V8JA 2E4HA 3N5BB 3ZL7C 3CCQQ 3HTRA 5I5ZB 4AFSC 2OTJQ 1AWWA 3P8HA 1AISB 1D0YA 4M7DG 2LJ0A 2LP5A 1HJDA 5L23A 2RHXA 2ZPHB 1W70A 4QQGA 5LQFB 2KVQG 3M55A 1QKWA 4EC9B 3DLMA 4J9FA 3EGUA 1VA7A 5ICPB 2DLPA 4KRTA 3QG1A 4QSHA 2F1LA 4LXCA 2QK0A 2QQ8A 1LPLA 3OMGA 1EIFA 5I11A 1N9SA 3QBYA 2G77A 2C5NB 3MEUA 2KROA 1ZBJA 2V26A 4HCKA 3C94A 1SHGA 1QWEA 3PE0A 1PD0A 3WXMB 2M0OA 1WHGA 2YUPA 2MYSA 4M75F 4C8QF 2KGTA 3OYGA 4EOOB 2ROLA 3BG5A 5D7UA 1BCOA 2E3HA 4J8OA 2RJEA 1VQNA 1O9SA 1RAIB 5IDPB 1G8XA 4C92A 2D0NA 1KQSP 3QUIA 2MWOA 2L0AA 4LDYA 4JUVA 1YI2A 4EMGA 2KMTA 2JNGA 2JS2A 2VWFA 1ZP2A 5LL6S 2DEUA 4NC6A 3ME9A 2RHUA 3MY1B 1ZSZA 1D1CA 4J6XA 1MMNA 2X4JA 4LDUA 3SB2A 4ZGJB 4BCGB 1WYXA 4M78E 3M57A 2RHZA 2E6ZA 1SPKA 2C0IA 1M1KU 4WF2A 3CCMA 1U3OA 4Z88A 2IN3A 1JB0E 2GCXA 1C1AA 3NHNA 2NLUA 4FU6A 1R0BG 3CBOA 1WXUA 2VGNA 1UNHD 2H3JA 4MDXA 1OQKA 2OTLQ 4PJOG 3SHWA 4Y91A 3NPFA 2XI9A 1IB8A 2XK0A 4V2SA 3HKSA 1NG2A 4ORZA 2WHBB 1T0JA 4E7ZA 4FYVB 2HSPA 2A0FB 2IIMA 1FMWA 1Q82R 2JZ2A 2CREA 3E9GA 5ECAA 1KK7A 1K9MC 3JCMg 3C95A 5IHYA 1UFFA 3M0PA 1GCQA 1TS9A 4OR5B 3L2WA 1QLYA 2NUPA 4F7UE 2X4YA 1YN8A 1ZA1B 4X34A 5LJ5j 3QIIA 8AT1B 5GAN2 3C4SA 2DVJA 4RTUA 3H0HA 4PFZA 4EOJB 3G6EA 1QVFP 2DTOA 4OMQA 5CKEA 1EX4A 3OYHA 1YHQA 4M77F 3TQ7P 1YCYA 2YT6A 1MHNA 2DAQA 3EFOB 3EFSA 4OVAA 1F1BB 4BY1X 4HVVA 4QVCA 2XKOC 3I56A 3MEAA 5DQWA 1TTHB 3BHUB 3EOCB 4M7AF 4Y72B 2HQHA 2EKHA 1B07A 2CP5A 1OIUB 1OULA 1MGQA 2KRSA 4GLKA 2CH4A 2FRWA 1KC8U 2P0KA 3UATA 2YLCA 2ZGWA 5GAMh 4Y92A 1VQ5Q 1U06A 1ZBXA 2VXFA 2YHTA 3V8KA 4ZTJA 2C5OB 3RUXA 1TUDA 3X24B 4F6UB 4R55A 3QYBA 2EAYA 1Q86C 4J5YA 1YITQ 3CC4Q 4PL6A 5FROA 3OYYA 1VQPQ 4YOOA 1D09B 3SD4A 4OP0A 1WXBA 1OEBA 1RADB 2YUOA 2PK2A 5GMKl 1UGSB 5GMKe 1VQ8A 3NGPA 1VUBA 2QQSA 2YUNA 2QEXA 3VKHA 2VYTA 4ZTFA 5GAN7 3VYGB 1TUCA 3R6OA 3MHXA 1SSFA 1W1FA 2O2OA 1H1RB 4LN2A 1RL2A 4AG2C 4GBQA 5GANh 3EGDA 1R8OB 3INZA 5KYYB 5GMKj 4AMCA 3A8HB 1YFNA 3LW5E 2A7YA 4ZN1A 4LOCA 2RPNA 2DO3A 4MZTA 2L89A 4BE0A 4E6RA 4CFUD 3VYHB 3BE3A 5IHKA 4JJCA 2KT1A 1Z9ZA 2YRCA 3UPUA 3G4SA 2LC4A 5HKCA 2OAUA 2RK1A 4MZMA 2P0PA 3SFMA 5EG2A 2V8KA 2ROTA 5EFQB 1H3HA 1A0NB 4EMKC 3L1AA 4M78B 1NM7A 3HB9A 2YUQA 2K4YA 1PC0A 3QYHB 4HCBA 2O4XA 5KE2A 1OI1A 1PRLC 3PMIA 3JCMX 2WXVB 1U5SA 2K79A 2VXEA 4TVRA 1JO8A 3M4GA 1WNLA 4M78G 5D6XA 3NTHA 4C92C 4XU3A 4PK4A 2BS3A 3GNGA 2CZ0B 4XTVA 4D8KA 3OSSC 2R58A 4XTUA 1UTIA 2HDAA 2JMAA 5LJ3h 2K5LA 3JV3A 2EQJA 2KMGA 3C0CA 1BBZA 3UWNA 1WHMA 3L2RA 3SEMA 1CKAA 1K9MR 4F7UF 1IXDA 5LJ5g 2ZZDA 3G7ZA 2EQUA 4IUVA 1M2VB 2JXBA 3M0SA 1OKWB 4KGZB 1MNEA 2DPPB 2A37A 2PVGB 3EGXB 1YJNT 4C92F 2KRMA 1ENWA 4YC3B 1M4ZA 3GIBA 2W9FA 5FLXE 1YITA 1IZ6A 2LQWA 4M7AC 5I22A 4IUQA 4FX3B 1VQ9T 3BW1A 4P5NA 2DA9A 1YCSB 1M1KR 3CBPA 1I4K1 3H8ZA 4JDSA 2WPAB 2EIFA 2E70A 1AT1B 2QFZA 1BI3A 4M7AE 1M3AA 1D1AA 4EOPB 3CC7T 2XIDA 1PSEA 2G6FX 4WTOB 2OI3A 5CKBA 2YDLA 3VS6A 3RESA 3F5XB 4OB2B 4M77E 5DLOA 3TCJA 4Z8AA 1WJQA 2W0ZA 3CCMQ 2QAZA 5GAN3 1UGVA 3A8GB 4M77G 4M78F 1VQKT 2F69A 4BCMB 1LNXA 3OYFA 3I56Q 2KR3A 2B9RA 3HHTB 2R57A 2R5AA 2CCHB 2EGEA 4M7DD 1O75A 5LJ5d 4CRLB 1GY3B 5GJVB 1ARKA 3OS1A 1WQWA 4M7AG 3CXCS 1QWFA 4C8QG 3RGFB 3DKMA 5CO7A 2KNBB 2C4GB 3EAEA 4A4EA 4RTZA 3QJ6A 3OS2A 1GXIE 1WQ7A 2DEQA 2PU9B 4AG1C 3J80E 1FYNA 4J9EA 1FKMA 4ESRA 5KYNA 1VQOT 1LVKA 5D6YA 1JJ2A 3HBLA 5FU6C 2RF0A 4QVDA 4F7LB 4PNOA 3OY9A 4II5B 1VQ5A 3M0QA 4F6SB 3MJXA 4FIBA 5CK9A 1TUGB 5IAYA 3OYMA 4AKGA 1ZUKA 2CZ7B 1RUWA 1WDXA 3CEYA 3Q1JA 3ZEHA 5EC7A 1BK2A 2FZCB 2QQRA 1JBMA 4J6YA 4Z02A 1UUEA 2HQEA 2EJ9A 1YHQQ 1VQNT 1K73R 1RLQC 3FB9A 4PJMA 2M02A 4BI3A 2UZEB 1ABQA 1H25B 2BZYA 2QGFB 4JZ4A 5HVYB 3QJYA 2EQKA 3CCQA 1AEYA 1VQOA 4JS4A 4BE2A 1Q81R 2QDYB 3RMSA 1X01A 2LDMA 4RG2A 1YWOA 4R56A 3NFCA 4HNVA 1VQ4Q 2DVEA 4E7KA 5FW9A 1VQ7Q 3QDFA 1KC8C 2VB6A 3MPUB 2AZVA 2CZ1B 1KQSA 2DL5A 2DBMA 1X6OA 1M1KC 3MY5B 3HZJA 2QTXA 2VUBA 4M6VA 2DL7A 4A4HA 1N8RR 2FPEA 2KSSA 2A36A 1FMKA 1OX8A 3DTOA 2EYXA 1PD1A 1VYWB 3P8DA 5IHIA 2Y4YA 3G6ET 3SWNA 4OB3B 1JEGA 5CQXA 2MI6A 3CCJT 3JB9I 1O9KB 2CDTA 1H1QB 3RERA 3I5RA 2L5QA 2KE9A 1JQQA 2DE0X 4DA4A 2RMOA 3PVQA 4EOSB 1P5EB 3ASKA 1S72T 3K7AM 2L2PA 1H3ZA 5GAMe 2L3SA 2H8HA 4C5GA 2KK4A 5IF1B 1RI0A 3WVDB 3M9QA 3RKXA 2V1QA 2WEVB 5IXBA 2CP7A 2MWPA 3QZ9B 2RHIA 2XMFA 2DMEA 3EG9B 2E65A 2L3PA 1YIJQ 1FWZA 1PSFA 2HEQA 1GRIA 1UJ0A 4KT0E 5DLQE 3G71T 3TN8B 1WJRA 4A4FA 2K9GA 2J6OA 2HKQB 5KE3A 4KUDK 2LJ3A 2C5VB 3KBGA 4M7DA 5GMKh 3CPWA 4AI6A 3LGFA 4TTHA 3PNWC 4ATOA 4C0DC 2ZPBB 2AIRB 2LRQA 3CC7Q 1B34A 2F5KA 1PNJA 3EG9A 1M2VA 4CFVB 4ZNXA 1YIJT 3V7SA 1UHFA 2PVDB 4RTVA 4BY6B 1KQ1A 1W6XA 3M0TA 1QQJA 4PLLA 2Y4XA 2FPDA 1VQNQ 1VYVA 4FSSA 2CSIA 3CC2T 3TSWA 2PQWA 3PT9A 1W2BA 9ATCB 1M90U 5DQVA 1M1FA 3VJPA 2M51A 1C0MA 1M1GA 1BI1A 2MPXC 2JGZB 2FG0A 1O9KA 2MAMA 3QYGB 4F6WB 4OGRB 2QDJA 1G2BA 4LUDA 4RG8A 3M59A 1VQMT 4FSXA 2O9VA 2RJFA 5HY6A 1TFBA 2LTOA 2LX9A 1I0CA 2MCNA 4C92G 3L2QA 3OB9A 1UG1A 5J26A 1ZA2B 3V7RA 3O5ZA 2C0TA 3H9NA 3M5AA 1QVGA 2OTLA 1AVZC 4R0KA 1XJWB 2EGCA 5HK0A 3EGXA 4A53A 2DFUA 4N4GA 1VIFA 2BZXA 4PJOC 4PJNA 2W9ZA 2E41A 2CP6A 4KULA 2L8DA 3I56T 4X9CA 4ROCA 1KHIA 3H0FA 2FEIA 4DOWA 1GBRA 2CS7A 4IUTA 5FWBA 2LMJA 5AYFA 3VKIA 2ESWA 4C8QC 1F5QB 1Q81C 1G3YA 2CSQA 4MZPA 4F7UA 1GH6B 3GPLA 2JTEA 3HSBA 1OYXA 1MV3A 4BI4A 3ER0A 2OJ2A 3A8OB 2DIQA 4C8QE 1VQ4T 3VYGA 5J3BA 5A2QE 3VS1A 3EH2A 3P8BB 2EFIA 3M54A 3CCLA 4HNTA 1K0XA 2E12A 3FJ5A 2X1NB 1BI0A 8ATCB 5KYXB 4LE9A 1H4LD 7AT1B 3GF5A 1VQOQ 1TG0A 2JTMA 1JSTB 2EBPA 1KXUA 3CD6T 4J9HA 3AHUA 1XO2A 3TU4K 1JXMA 1VINA 5IDNB 3FRNA 1OGUB 5C6SA 1PG5B 4C5IA 2DZCA 3KXTA 3OW2P 3BG9A 2YLBA 5GANf 5I2MA 1NLOC 2LZ6B 1OI9B 4IUUA 3ZBDA 3UF4A 2DL4A 2ZPIB 5FGKB 3CMAT 2GBQA 3FDRA 4M75A 1M9SA 1UB4A 2CH4W 3LWIA 3M03A 3JCMf 1MMDA 1WHJA 2E64A 5GAOl 3HFOA 4E2FB 2DYIA 3CCMT 3S3MA 1NPRA 2JUFA 1K73C 3GNFB 4IKFA 2BPMB 2I0NA 4RKUE 2CT4A 2JW4A 1QVGP 2DX1A 6AT1B 4M78D 3MI9B 3M56A 4BACA 3E9FA 1W2BS 3GLXA 2MMPA 2K3BA 3M0UA 4JX5A 1FINB 1N6AA 2GF7A 2RNAA 2BUDA 3MCAB 2RQWA 2UUEB 2X3XD 1YJWA 1AHJB 2XDPA 3BLQB 1JU5C 2EVRA 4HCCA 2IVXA 1MUZA 2Y90A 4F14A 4FM4B 3OA6A 4X9DA 1KD1R 4B9XA 4F16A 4RTWA 2BE7D 1TSFA 3EG0A 1ZLMA 4ELJA 2CUDA 3JCMb 1BIAA 5FRNA 3I5SA 4EOIB 4OMPA 5GAMd 1IGQA 1D0XA 1JOWA 2WSCE 4PKCC 1AWXA 2F2CA 4BCFB 2F2WA 5GANe 4DBFA 1I5LA 3URGA 3TW7A 1TU0B 4LD6A 1XNIA 2X3WD 1YJNQ 4JJDA 4D8DA 3GP8A 2O4XB 1GBQA 1VQ6A 3FIFA 4RUGA 4M77C 1BI2A 3J7AF 2DMOA 1OPKA 2FPFA 5GAMg 1M27C 1AZEA 3MKDA 4J9DA 4PLIA 4RTYA 1KIKA 2QEXQ 4II1A 5I2SA 1G3NC 3ZFJA 2XDBA 5HBEB 4XK8E 3EFRA 1NE8A 4M78C 1K8AR 2FVUA 3RIRA 4BDYA 2ECZA 4ROEA 4KGXB 5HBHB 4QQDA 1YJNA 4JLIA 1FX7A 2EYQA 3OYJA 2BZ8A 1CKBA 2YWWA 1ZQ1A 3OYCA 1RABB 3EHQA 4J9GA 3JCMJ 1AWOA 4CFMB 1QKXA 2GFAA 4ZGEB 4JLGA 1M8MA 1RAGB 2ZAEA 2IW6B 4M75B 3D7SB 2CUBA 2QEXT 1KSWA 2ZPFB 4OGCA 2DNUA 4K11A 3V7CA 4UN0A 2M16A 2SEMA 4PFOA 2GQIA 1VQ9A 1SG5A 4QKUA 2HBPA 3I55A 4QVZA 4CFXB 1KQSS 3JCMh 2Z0WA 2A3LA 1LJOA 2K3YA 4BCQB 2EGAA 2CP3A 3GBQA 3REBB 2DXCB 2DK3A 2DETA 1UE9A 3CCJQ 2WFYB 4C92D 3QSUA 1YITT 1UGPB 1KFZA 5GAN8 2KEAA 1RLPC 2RI5A 2I40B 2IG0A 3QKJA 3A5ZB 2RN8A 5IXFA 3DLLA 3VS3A 1PHTA 1K0SA 4XU0A 1VQMQ 1UEBA 1M5Q1 4C5HA 1H27B 3H41A 1QCNA 2G3RA 3S3OA 1FMVA 2RJCA 3TNHB 5LJ3f 1Q7YU 2L3RA 2WMAB 1VQPT 5LJ5f 2E5KA 3DDPB 2HSEB 4ZGDB 1QVPA 3TW6A 1WHKA 1Q86R 4Z89A 3L42A 4DEYA 5AT1B 4YOZA 1X27A 3CCVA 5J39A 1AZGB 1KJWA 3LX7A 5GAOm 1H1PB 3BLHB 2GTOA 4EOQB 3OW2S 4O5VA 1VQ5T 4Y28E 3M53A 2QA4T 2FZGB 1G5VA 1JRIA 3HRTA 2OTJA 1FVVB 2WIHB 2DD5A 2WSFE 3I9QA 1TD6A 1K73U 2NYSA 3E2UA 1C6VX 4NSTB 2YRDA 4JJNK 4IUPA 4NL3A 5C0MA 3QWLA 5KYUA 1NYGA 2LCSA 2VGMA 1W2BP 2A28A 2X51A 3CCVQ 1ZSGA 5IHNA 4ELZC 1G3WA 5GAOr 4LNPA 2DL8A 3PVLA 3QHWB 5CYIB 3S6WA 1GUXB 2KXDA 2DIGA 2KAFA 4OMFB 3CC2Q 1I07A 1T3SA 2PZ1A 4E7JA 2RK2A 3TREA 2OTLT 5IN1A 1H28B 2K57A 4M7DF 2DF6A 2LX7A 1CSKA 2JN0A 2H3EB 4A4GA 1DJ7B 1PKSA 3CPWP 1URCB 1ZSZB 3JCMP 2WJ9A 5M9OA 2GTJA 4MFDA 2F2VA 2DXTA 3CPFA 2C0OA 2FZKB 4NS5A 2XD0A 3CC2A 1V29B 5GAN6 3O8VA 4YTLA 3CCLT 4F17A 1MNDA 3X26B 2EYWA 1WXTA 1VQ7T 1AOJA 1Y96A 4OMMA 2OX7A 3VS0A 4FL6A 3CCEA 2ATCB 2UZLB 4N0AA 4C5EA 4EMKB 2QQBA 4FCYA 1TOVA 1K8AC 2XICA 1PRMC 5LJ5h 3DL1A 2FYKA 3MEWA 1D3BB 2GNCA 1Y0MA 2R7GA 1X6GA 3EHRA 3O0GD 2YRVA 1MMAA 4XU1A 5GAMj 4PJOA 2E10A 2JJ9A 1YHQT 1Y7XA 1Q82U 1NJIC 1YP5A 1BCMA 4CFUB 2KYBA 1S72Q 1K4US 2PHGA 4PJOE 2W96A 3QWYA 3POMA 2K2VA 2UZDB 1I81A 1OX9A 4C8QA 1PKDB 2X35A 1VQ7A 2COZA 1M3BA 4DBHA 1VQLQ 2ABLA 1WLPB 4BB7A 2LW4A 1AD6A 2QF7A 2DXUA 2D6FA 1RAEB 2LQKA 2HD0A 1I5OB 3IQLA 3FC3A 4LD9K 3PTAA 3CC4A 3OYDA 4F7UG 1M8VA 2W99A 4EOKB 1LCKA 2FO0A 5KH6A 2OAWA 2EYZA 2LCCA 1E6HA 1SSHA 4WCIA 4B9WA 4BXXX 2P0QA 4XTYA 3QDRB 4FT2A 3A8MB 4OB1B 2KQWA 2DD4B 2HCKA 4HLQA 2D9TA 3OYAA 1H1SB 1KHCA 1IRXA 4M7AB 4F7SB 2RJDA 2K5FA 4KBMB 2DJQA 4AFUC 1ZSZC 2BKDN 5GMKi 5CCAA 1OZ2A 4IMYB 5GAMf 4M75G 2KT8A 1NJIU 4BDZA 3DB4A 2RB6A 5GANj 1SKUB 4MIMA 4M77B 3UA6A 2EPDA 2ZZDB 1GCPA 2D1XA 4OMOA 3PIPA 1GL5A 3E1SA 1OV3A 1WFWA 2E1HA 2BTTA 2RI3A 3RR6A 5IT9E 2DJZA 3G71Q 4YOSA 3LQ5B 3LGLA 1RI9A 5CKFA 2RI2A 2J6FA 1VYTA 5CR2A 2I53A 2VKNA 1EZZB 2RHYA 1H24B 3RNJA 2ZPGB 4XQ3A 2KYMA 4KRDB 2PTKA 3HRUA 4HA8A 1UNGD 1OU8A 2IVWA 1E7PA 1RACB 4XAXB 1VQ4A 4DQ2A 3CCSA 2NUTA 2DKGA 1LOJA 2VC8A 3UT1A 2X4WA 4M7DE 2YSQA 3TSZA 1GFDA 3M4YA 4RCBA 1QW1A 4IURA 5ACBA 2WIPB 4KH0B 4C8QD 2IW8B 4M75D 4QW2A 3BY7A 3A1PA 1B3QA 4BBRM 2FL7A 2K5IA 5A0LA 1X69A 2KI7A 5KCHA 3CXCA 4JRKA 4J6WA 1IGUA 2XU8A 4AFQC 1VOLA 1JKWA 5L2WB 5A0GA 4BBSM 3META 3VS7A 4EOLB 3TEEA 4C0GA 1QMCA 4JPBW 2JTFA 4MFEA 2AK5A 2IW9B 2X4XA 2ZCFB 2F2XA 2KDSA 1VQ8T 5CEIB 3G4SQ 2DXBA 2FRYA 1SHFA 1OPLA 5LJ3g 1N5ZA 4BY7X 1UGQB 2QG9B 2COYA 4ELYC 3TVTA 1BU2A 1IHVA 1BIBA 2DILA 2COWA 3JCMd 2P4RA 1NLPC 5FRMA 3VS2A 3LH0A 1UHCA 1OL2B 3L2ZA 3CCEQ 1WGSA 5EJCA 3UDCA 4DOVA 3U23A 5KYXA 1TWBA 4M77D 4PJOB 1AWJA 4HL4A 4A54A 3FLGA 3AT1B 1K1ZA 2BIVA 1IHWA 1K76A 1K8AU 3LWHA 2WSEE 4F7NB 4EDUA 4EMHA 1KD1U 2AT1B 1OZ3A 1M30A 4E7LA 3QHSA 1QMZB 2D0QB 2LNHB 4LDXA 2C06A 5IH2A 3QO3A 1JJ2P 3TNIB 4ZN3A 4HXJA 4C0FA 3VS5A 1ZHIA 2V8JA 4DBQA 3CCVT 4RODA 2I2LA 4CC7A 4JRPA 1OKVB 5GANg 5GAN5 3X25B 2EQIA 3RKYA 1ABOA 5KYWB 2BKZB 1WJSA 5GAOq 1N8RC 2DBKA 3CXCP 2MF2A 2RO0A 4PFPA 2PVOB 2CP2A 2K2MA 4C92E 1FXXA 3FEOA 2RQUA 2AKKA 3DB3A 3MP8A 2HAXA 2ENMA 1ZUYA 4CC2A 3JAME 2DD4A 2XDDA 3H0IA 5GJWB 1HXDA 1WX6A 4E7IA 1KQ2A 3RKWA 3H6ZA 1Z9QA 3A8LB 3KFVA 1QP3A 2NUZA 2YXYA 1D1BA 4BCQD 2JOYA 2ED1A 5LJ3j 3L2UA 2G9XB 3CPWS 2VASA 1YJWQ 4EONB 5FU6B 1GCQC 2SRCA 1BYMA 1VQPA 1VQ6T 3OBWA 3SWNC 2V22B 1Q82C 4DBRA 1M90C 4C0ZA 2RQRA 3CCRQ 2AKLA 1W4SA 2EWNA 2PJQA 2CZ6B 3OQ5A 3WVEB 2EUFA 2O01E 2BE9B 3CMEA 2AHJB 2KBTA 1TXQA 3G71A 4CC3A 3C12A 4QT7A 1TH7A 4EORB 3HP9A 4PJOF 4MMKA 4M7DB 1V1CA 2KY9A 2QDLA 1YWPA 3RDVA 2J6KA 4ELLA 4GLMA 2JM8A 4O6JA 4F04B 2HZYA 1NPPA 2LJ1A 2QGGA 1NJIR 2EYYA 4M7AA 1IREB 1I8FA 2DYBA 1WHHA 5GANd 4BCOB 2QASA 5KYYA 1NBEB 3CCUA 3CCUT 1W98B 3R6NA 3CCRA 4C8QB 1NEGA 2CJMB 1H26B 1VIEA 3EJ1B 2JS0A 5HQ0B 2MK5A 5CVIA 3RBBB 2RQVA 1P92A 2M0YA
chains in the Genus database with same CATH topology
4O5VA 4HNVA 4Y28E 1VQ5T 3M53A 3P8HA 2DVEA 2QA4T 3BDUA 4E7KA 1G5VA 1JRIA 1VQMA 3PGGA 1KC8C 4GY5A 4M7DG 3HRTA 2OTJA 2OTJT 2CZ1B 1KQSA 2LT1A 2LT4A 2RHXA 2XHCA 2ZPHB 1X6OA 2DD5A 2KVQG 2WSFE 2CKKA 3M55A 4QQGA 4BD3A 3HZJA 2QTXA 4LDWA 5CIUA 3DLMA 5GAOn 1M1KC 2VUBA 4M6VA 1K73U 4A4HA 1B34B 4D6WA 3MP1A 2KSSA 1U8RA 5L8RE 3P8DA 4JJNK 4IUPA 2Y4YA 3QG1A 4QSHA 1Y71A 3G6ET 4NL3A 5C0MA 3SWNA 3QWLA 4OB3B 5CQXA 2QQ8A 1HK9A 2VGMA 3OMGA 1EIFA 2MI6A 2QXFA 4N0AC 1N9SA 3JB9I 3CCJT 1QVFS 4Z6YA 3QBYA 4J83A 2G77A 3MEUA 3RERA 2L5QA 3BG3A 3C94A 4DA4A 3WXMB 3JCMW 4ELZC 1G3WA 5GAOr 2M0OA 3ASKA 1S72T 3OMCA 1S72A 4M75F 4C8QF 1H3ZA 4AKIA 4XTWA 3V8LA 5GAMe 3S6WA 3OYGA 4C5GA 2DIGA 2KAFA 2KK4A 4OMFB 3BG5A 3JCMQ 1RI0A 4E7JA 3WVDB 4J8OA 3CC4T 2RJEA 2RK2A 1Y96B 3QZ5B 3M9QA 1O9SA 3RKXA 3TREA 1VQNA 2OTLT 5IN1A 4NOYA 2K57A 2MWPA 4C92A 4M7DF 3QZ9B 2RHIA 4OGEA 1YIJA 3QUIA 2JN0A 4A4GA 2MWOA 2HQXA 4XTXA 1DJ7B 4LDYA 4JUVA 1YI2A 4EMGA 3JCMP 2KMTA 2WJ9A 2E65A 2JNGA 5DM7R 1FWZA 1PSFA 5M9OA 2RH2A 5DLQE 4MFDA 4KT0E 3MEVA 4NC6A 1U1SA 1WJRA 2DXTA 2RHUA 3ME9A 3OYEA 3G71T 3JB9J 4J6XA 4A4FA 4JS5A 3CPFA 2X4JA 5HK3A 3CCRT 2KR6A 4VUBA 5CKHA 5KE3A 4LDUA 3CMAA 3SB2A 4NS5A 4ZGJB 4KUDK 3CC2A 1V29B 3KBGA 4M78E 3M57A 3O8VA 4YTLA 2RHZA 5GAN6 5GMKh 3CPWA 3X26B 3CCLT 4AI6A 1VQ7T 3LGFA 2E6ZA 3PNWC 4ATOA 1Y96A 4C0DC 1M1KU 2ZPBB 4WF2A 5DY9A 3CCMA 1VQKT 4FL6A 2LRQA 2QEXA 3CCEA 3PIOA 4OF1A 1B34A 2GQVA 2F5KA 1JB0E 4JX4A 4N0AA 2GCXA 4C5EA 4LDVA 3LLRA 4EMKB 2NLUA 1YIJT 2VV5A 4FU6A 2QQBA 1K8AC 4JX6A 2XICA 3CBOA 2PVDB 3V7SA 4C92B 4BY6B 1KQ1A 5LJ5h 3DL1A 2FYKA 3MEWA 1D3BB 2VGNA 5LJ3e 4PLLA 5GAOp 2Y4XA 2H3JA 4MDXA 3HL8A 4PJOG 4Y91A 2XI9A 2YRVA 2LVMA 4XU1A 2XK0A 4XU2A 1H641 5GAMj 4PJOA 2E10A 1Q82U 1YHQT 1Y7XA 1YBYA 3HKSA 1JJ2S 1NJIC 3CC2T 4V2SA 2PQWA 3PT9A 4C0DB 3GOXA 1W2BA 4J7FA 1M90U 1N9RA 1M1FA 3VJPA 3PMTA 3L2VA 3X28B 1WPYA 1M1GA 1BI1A 2JZ2A 2CYZB 3QPHA 4PJOE 2K2VA 3E9GA 1N8RU 1K9MC 2MAMA 4KUIA 3JB9F 3QYGB 1I81A 3JCMg 3C95A 4C8QA 2QDJA 3QYEA 3CD6A 2X35A 2DD5B 2DXCA 2QQ9A 4RG8A 1VQ7A 3M59A 2P4TA 3L2WA 1VQMT 4FSXA 4N4IA 3LYIA 4F7UE 2X4YA 2RJFA 5HY6A 4X34A 2LTOA 2LX9A 3QIIA 4BB7A 5LJ5j 5GAN2 3C4SA 2QF7A 2E5QA 2DXUA 2D6FA 2LQKA 4C92G 2HD0A 1YI2T 3HRSA 4QQ6A 3OB9A 3L2QA 5J26A 3V7RA 2RA2A 3FC3A 4LD9K 3PTAA 1G3SA 3OYDA 4F7UG 3CC4A 1M8VA 3G6EA 3M5AA 2DZ9A 5KH6A 1NZ9A 2DTOA 5CKEA 1QVGA 2OTLA 2LCCA 5HK0A 3OYHA 1YHQA 4M77F 1G3TA 1YCYA 4A53A 4B9WA 1MHNA 2M1HA 2DAQA 4N4GA 1VIFA 3BFMA 2P0QA 4XTYA 3QDRB 3EFSA 4FT2A 4OVAA 3A8MB 4XTZA 3CCQT 3CCET 4OB1B 2KQWA 2DD4B 4PJOC 4HLQA 2D9TA 4QVCA 3OS0A 2E41A 2XKOC 3OYAA 1KHCA 1XQHA 3JSCA 4KULA 5FU7C 4M7AB 3I56A 3MEAA 2L8DA 2RJDA 2K5FA 4X9CA 3I56T 4KBMB 1KHIA 2QA4A 4M7AF 4DOWA 2BKDN 5GMKi 5CCAA 1OZ2A 2CS7A 5GAMf 4IUTA 4M75G 5AYFA 3VKIA 4E47A 3OYBA 4BDZA 3DB4A 3HFNA 4C8QC 1NJIU 1Q81C 1MGQA 1G3YA 4MZPA 4GLKA 2RB6A 4Q5WA 4F7UA 5GANj 2EJFA 4MIMA 4M77B 3G4ST 1KC8U 2XD0A 2ZZDB 3GPLA 1KD1C 3J81E 1Q81U 2P0KA 3HSBA 1OYXA 4BI4A 4RMOA 3NTKA 3ER0A 3VU3C 4M75E 3A8OB 2DIQA 4C8QE 2YLCA 2ZGWA 5GAMh 3PIPA 3VYGA 1VQ4T 3E1SA 2PUOB 5J3BA 5A2QE 3KUFA 2E1HA 2RI3A 3P8BB 1ZBXA 2RM4A 2VXFA 2YHTA 4UC4A 2EFIA 3V8KA 5IT9E 4ZTJA 2DJZA 5LJ3d 1N27A 2EJGA 3M54A 3SWNB 3RUXA 4BUGA 2ZPEB 3LGLA 3CCLA 4HNTA 2E12A 3X24B 5CKFA 2BS2A 2RI2A 4BI8B 1BI0A 5CR2A 4R55A 2V8IA 3QYBA 2RHYA 2EAYA 1Q86C 3GF5A 4FT4A 4J5YA 2JTMA 2ZPGB 4XQ3A 3JB9G 3CD6T 4JRIA 4PL6A 3AHUA 3HRUA 4HA8A 5FROA 3OYYA 3TU4K 2IVWA 4L6V5 1E7PA 2DXBB 4XAXB 1VQ4A 3FRNA 3SD4A 4DQ2A 5C6SA 4OP0A 3CCST 3CCSA 2DKGA 1LOJA 4N4HA 3VKGA 2VC8A 4PJOD 4C5IA 5GAN4 2DZCA 3UT1A 5GMKl 3KXTA 1UGSB 5GMKe 1VQ8A 3BG9A 1VUBA 2K3XA 2QQSA 2X4WA 2EQMA 2YLBA 3VKHA 3NTIA 2VYTA 5I2MA 5GANf 4ZTFA 5GAN7 3VYGB 4M7DE 3R6OA 3MHXA 5CAIA 3H4CA 5LJ5e 1YJWT 1SSFA 4IUUA 3M4YA 3ZBDA 4RCBA 1QW1A 2ZPIB 1RL2A 3CMAT 4IURA 3FDRA 4C8QD 4M75A 1M9SA 1UB4A 4M75D 4QW2A 3RMQA 1R8OB 3HPWA 5GANh 4HKEA 3LWIA 3BY7A 4ME7A 2E64A 3JCMf 5GAOl 3HFOA 3INZA 3CCMT 4BBRM 5GMKj 3S3MA 1NPRA 2FL7A 2K5IA 4NL2A 3A8HB 2JUFA 1K73C 5A0LA 3LW5E 2A7YA 3GNFB 4ZN1A 4CRIA 2BS4A 4IKFA 4LOCA 4RKUE 5KCHA 3CXCA 2DO3A 4MZTA 3QXEB 2L89A 4JRKA 4J6WA 3VUBA 2XU8A 4BE0A 3OYNA 3VYHB 1U1TA 4M78A 4M78D 4BBSM 5A0GA 3M56A 3META 4BACA 3JB9H 3E9FA 1W2BS 3GLXA 3TEEA 4C0GA 2JTFA 3VUZA 2MMPA 4MFEA 3UPUA 3G4SA 2X4XA 2LC4A 2ZCFB 5HKCA 2OAUA 2RK1A 4MZMA 2P0PA 1Q86U 2DTIA 2KDSA 1Y07A 3E19A 1VQ8T 3SFMA 5EG2A 4JX5A 2V8KA 2DXBA 1N6AA 2GF7A 2BUDA 3MCAB 4EMKC 3L1AA 4M78B 1YJWA 1AHJB 3HB9A 2K4YA 2XDPA 1UGQB 3QYHB 3PFSA 5LJ3g 2O4XA 4ELYC 5KE2A 1OI1A 4BE1A 4HCCA 4HCBA 2F5TX 3PMIA 4M7DA 3JCMX 1BIBA 2WACA 2Y90A 2B8AA 4FM4B 3JCMd 4AKHA 3OA6A 4X9DA 5FRMA 3HO8A 4B9XA 2VXEA 3LH0A 4TVRA 4OB0B 2FB7A 3M4GA 3L2ZA 1WGSA 4M7AD 1X75C 4J7IA 4ELJA 1WNLA 4M78G 5D6XA 3JCMb 1BIAA 5FRNA 3NTHA 1QVGS 1QLBA 5EJCA 3UDCA 4A4KA 4C92C 4XU3A 4DOVA 2QQAA 2BS3A 1BKBA 5GAMd 2R5MA 3GNGA 2CZ0B 4XTVA 3SDZA 3OSSC 2WSCE 2R58A 4PKCC 4XTUA 1XOVA 5LJ3h 2K5LA 4M77D 3I55T 5GANe 4PJOB 4HL4A 4A54A 2EQJA 1I5LA 2KMGA 3FLGA 3URGA 3TW7A 2FHDA 4LD6A 1XNIA 2BIVA 3OW2A 3UWNA 1K8AU 3L2RA 3LWHA 3X20B 2WSEE 4EDUA 4EMHA 4F7UF 4E7HA 5LJ5g 2ZZDA 3GP8A 1YJ9A 1KD1U 1OZ3A 3G7ZA 2EQUA 4IUVA 4E7LA 2O4XB 4EMKA 3S3NA 3QHSA 2D0QB 3CMET 1VQ6A 3FIFA 1QP2A 4M77C 4LDXA 1BI2A 2C06A 3QO3A 4EPCA 3J7AF 4M75C 2DPPB 3BDLA 4ZN3A 5GAMg 4JRQA 2PVGB 1YJNT 4C0FA 4C92F 1ZHIA 2V8JA 4PLIA 3CCVT 1M4ZA 3OYLA 3JB9D 3GIBA 5FLXE 2I2LA 1YITA 2QI2A 1IZ6A 4II1A 4JRPA 1XTDA 5FU7B 5LL6S 5I2SA 4M7AC 4M7DC 5GANg 5GAN5 3X25B 4IUQA 3ZFJA 2XDBA 3RKYA 1VQ9T 3BW1A 4P5NA 2LNVA 4XK8E 3EFRA 3CBPA 3MP6A 1I4K1 3H8ZA 4JDSA 1NE8A 3KHIA 4L5GA 4M78C 2EIFA 1VQLT 1WJSA 2FVUA 4CI0C 5GAOq 1N8RC 2E70A 1K9MU 2QFZA 3RIRA 1BI3A 3JCMc 2MF2A 2RO0A 4BDYA 4M7AE 2PVOB 1KG1A 2JVVA 4C92E 4QQDA 1FXXA 5CKDA 3FEOA 4RCCA 3CC7T 3CC7A 2XIDA 1PSEA 1YJNA 4JLIA 1YJ9T 3OBYA 5CKBA 3DB3A 4HCZA 1FX7A 2EYQA 3OYJA 3MP8A 3VV0A 2CGHA 2HAXA 3RESA 1ZQ1A 4OB2B 2XG8D 3JAME 3OYCA 2DD4A 4M77E 3JCMJ 2XDDA 2RD1A 3F70A 5DLOA 3TCJA 2GFAA 1HXDA 4ZGEB 4JLGA 1WJQA 4E7IA 1KQ2A 3RKWA 3H6ZA 3A8LB 4M75B 1QP3A 3T9NA 2QEXT 3CCJA 5GAN3 5GMKm 2ZPFB 3A8GB 3CBMA 4M77G 4M78F 2F69A 2JOYA 1LNXA 4OGCA 3OYFA 3V7CA 3FJPA 5LJ3j 3L2UA 1D3BA 2M16A 3CPWS 3HHTB 2R57A 2R5AA 4L59A 5FU6B 1VQ9A 2HBPA 3I55A 4QVZA 4F7UB 4MMLA 1KQSS 4M7DD 3OS5A 1BYMA 1VQPA 1VQ6T 1O75A 3OBWA 3SWNC 5LJ5d 3JCMh 3OS1A 1WQWA 4M7AG 1Q82C 3CXCS 2A3LA 1LJOA 2K3YA 4C8QG 3DKMA 5CO7A 3JCMV 1M90C 4C0ZA 3EAEA 4A4EA 2DXCB 3QJ6A 1W4SA 2DK3A 2EWNA 2CZ6B 3OS2A 1GXIE 1WQ7A 2DEQA 2PU9B 3J80E 3OQ5A 2LCLA 3WVEB 2DTHA 2O01E 4C92D 3QSUA 3CMEA 1YITT 3OSVA 1UGPB 1FKMA 2AHJB 4HT8A 1VQOT 3OYIA 5D6YA 1JJ2A 3G71A 1QVFA 3HBLA 5FU6C 5GAN8 3OYKA 2RI5A 3C12A 3MO8A 1TH7A 3HP9A 4PJOF 4QVDA 2IG0A 4PNOA 3QKJA 4MMKA 5I21A 3OY9A 1VQ5A 3A5ZB 4M77A 1VQLA 2KY9A 3DLLA 4M7DB 4BY6C 4XU0A 1UEBA 2HNIA 1VQKA 1M5Q1 4FIBA 4C5HA 2GFUA 5CK9A 1Q7YC 4O6JA 2G3RA 3S3OA 5IAYA 3OYMA 4AKGA 5D6WA 4HT9A 1NPPA 2RJCA 3JRZA 4HNUA 2CZ7B 5KCOA 5LJ3f 1Q7YU 2L3RA 3CEYA 3Q1JA 3ZEHA 1IREB 5A0DA 4M7AA 2QQRA 2EKOA 1JBMA 1I8FA 5LJ5f 5GANd 1VQPT 3JCMe 4J6YA 4Z02A 2HQEA 4ZGDB 1QVPA 2EJ9A 3TW6A 2PUKB 5CQYA 1VQNT 3CCUA 3FB9A 3CCUT 3L42A 3CCRA 4BI3A 4C8QB 1UGRB 4MDWA 3CCVA 5J39A 3M58A 1VIEA 2E6NA 2LQ8A 3QJYA 2EQKA 2M9UA 3LX7A 3CCQA 1VQOA 5GAOm 5CVIA 4JS4A 4BE2A 3V8JA 3N5BB 2QDYB 1P92A 1X01A 3RMSA 2LDMA 4RG2A 3OW2S 4R56A 3NFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 E;  2DD5 B;  2DXC A;  2PVO B;  2CZ1 B;  3A8H B;  3LW5 E;  2ZPH B;  1PSE A;  2DD5 A;  2WSF E;  4RKU E;  3QXE B;  3VYH B;  4OB2 B;  2DD4 A;  5L8R E;  4ZGE B;  3A8L B;  4OB3 B;  2ZCF B;  1QP3 A;  2ZPF B;  3A8G B;  2DXB A;  3A8M B;  4OB1 B;  2DD4 B;  1AHJ B;  1UGQ B;  3QYH B;  3HHT B;  4FM4 B;  3WVD B;  3QZ5 B;  4OB0 B;  2DXC B;  3QZ9 B;  2CZ6 B;  1GXI E;  2ZZD B;  2PU9 B;  1DJ7 B;  3WVE B;  2O01 E;  1UGP B;  2AHJ B;  3A8O B;  1PSF A;  4KT0 E;  3VYG A;  2CZ0 B;  2PUO B;  2WSC E;  4ZGJ B;  1V29 B;  2ZPE B;  3X26 B;  3X24 B;  2ZPB B;  1JB0 E;  3X20 B;  2WSE E;  2ZZD A;  2ZPG B;  2CZ7 B;  1IRE B;  2PVD B;  2D0Q B;  1QP2 A;  4L6V 5;  2DXB B;  4ZGD B;  2PUK B;  2DPP B;  2PVG B;  1UGR B;  1UGS B;  3VYG B;  3X28 B;  2CYZ B;  3X25 B;  2QDY B;  2ZPI B;  4XK8 E;  3QYG B; 
#chains in the Genus database with same CATH topology
 3BDU A;  3CCL Q;  2MIO A;  3CQT A;  1VQM A;  3PGG A;  4GY5 A;  4KRC B;  2OTJ T;  4RTX A;  2LT1 A;  2LT4 A;  2XHC A;  2CKK A;  4BD3 A;  4LDW A;  5CIU A;  5GAO n;  4AT1 B;  1YI2 Q;  1I1J A;  1NEB A;  4BCH B;  1B34 B;  4D6W A;  3MP1 A;  1MV0 B;  1U8R A;  1E9H B;  5L8R E;  3CMA Q;  1Y71 A;  4KH1 B;  4IIO A;  3CCU Q;  1HK9 A;  4N0A C;  2QXF A;  1QVF S;  2EW3 A;  4Z6Y A;  4J83 A;  1NYF A;  3BG3 A;  2B86 A;  3JCM W;  1N4M A;  4FYW B;  3OMC A;  1S72 A;  1VQ6 Q;  4AKI A;  4XTW A;  3V8L A;  4OMN A;  3JCM Q;  1Q95 G;  1VYU A;  3LH5 A;  2D8H A;  3REA B;  2J05 A;  1J3T A;  3CC4 T;  1Y96 B;  3QZ5 B;  2QYZ A;  4F7J B;  1UDL A;  4NOY A;  4OGE A;  1YIJ A;  4PJL A;  2HQX A;  4XTX A;  1PWT A;  2LQN A;  5DM7 R;  3BLR B;  4CFN B;  2RH2 A;  3EFO A;  1OOT A;  3MEV A;  1U1S A;  2RQT A;  3OYE A;  3JB9 J;  4HVU A;  4JS5 A;  5HK3 A;  3CCR T;  2KR6 A;  4VUB A;  5CKH A;  5KYU B;  3CMA A;  2JMC A;  4E7S A;  3QWX X;  4CFW B;  5DY9 A;  2UZB B;  4IIM A;  1X2Q A;  3PIO A;  4OF1 A;  2GQV A;  4JX4 A;  2V1R A;  3LLR A;  4LDV A;  2VV5 A;  4JX6 A;  4EOM B;  4C92 B;  3VRY A;  1JXO A;  5LJ3 e;  2NUP B;  3EG3 A;  5HNB B;  5GAO p;  3HL8 A;  1R0C B;  2LVM A;  4BCJ B;  4XU2 A;  1H64 1;  2GGR A;  1SRM A;  1JJ2 S;  1YBY A;  2X9H A;  4X1V A;  1VQ8 Q;  3GOX A;  4C0D B;  4J7F A;  2JM9 A;  1N9R A;  3PMT A;  3QHR B;  3X28 B;  1WPY A;  3L2V A;  2CYZ B;  3QPH A;  1BU1 A;  1N8R U;  4KUI A;  3JB9 F;  1E6G A;  1HSQ A;  3QYE A;  3CD6 A;  2DD5 B;  2DXC A;  2QQ9 A;  4B6M A;  1OU9 A;  2P4T A;  2D8J A;  1WA7 A;  3EH1 A;  4N4I A;  3LYI A;  2QTV A;  5KYW A;  1S1N A;  4M4Z A;  2E5Q A;  1YI2 T;  3HRS A;  4QQ6 A;  3I55 Q;  2RA2 A;  1SF9 A;  1KC8 R;  1G3S A;  4EC8 B;  2DZ9 A;  1SRL A;  1NZ9 A;  2DL3 A;  2CCI B;  1UNL D;  1IO6 A;  2W10 A;  1GFC A;  1G3T A;  1HD3 A;  3VS4 A;  1R77 A;  2PMI B;  4BCP B;  2M1H A;  3BFM A;  1KD1 C;  4HVW A;  4XTZ A;  1UEC A;  3CCQ T;  3CCE T;  1PCX A;  3OS0 A;  1XQH A;  1WHL A;  3JSC A;  5FU7 C;  3PO3 S;  2QA4 A;  1JSU B;  3CD6 Q;  4E47 A;  3OYB A;  1Q7Y R;  3HFN A;  2K6D A;  2DRM A;  4FW1 A;  4Q5W A;  2EJF A;  3G4S T;  2O9S A;  3BHT B;  1T3L A;  3J81 E;  1Q81 U;  4CC4 B;  1H92 A;  4RMO A;  3NTK A;  3MIA B;  5BNJ B;  1E7O A;  3VU3 C;  4M75 E;  4BCN B;  3M0R A;  3G33 B;  1YJ9 Q;  2PUO B;  3KUF A;  2RM4 A;  4UC4 A;  3I35 A;  5LJ3 d;  1X2K A;  1N27 A;  2EJG A;  3SWN B;  3THK A;  2DM1 A;  4BUG A;  2ZPE B;  4BI8 B;  2BS2 A;  1RAA B;  2V8I A;  1M90 R;  1VQ9 Q;  4FT4 A;  2PNI A;  1M3C A;  2HMA A;  4DEX A;  3JB9 G;  2WMB B;  4JRI A;  2O88 A;  3BHV B;  4L6V 5;  2DXB B;  1M2O A;  1D3U B;  2W2H A;  3CCS T;  2HBW A;  4N4H A;  3VKG A;  4PJO D;  2ED0 A;  5GAN 4;  1OIY B;  2AZS A;  1X6B A;  2K3X A;  3NTI A;  3CME Q;  1G83 A;  2EQM A;  3G1J A;  5CAI A;  3H4C A;  5LJ5 e;  1YJW T;  1QCO A;  2PK9 B;  4G6L B;  1K9A A;  3RMQ A;  3HPW A;  1ZUU A;  4HKE A;  4ME7 A;  4KGV B;  4NL2 A;  4F70 B;  2IPO B;  4JZ3 A;  4CRI A;  2BS4 A;  1SEM A;  2KXC A;  3TNW B;  3QXE B;  3VUB A;  3OYN A;  2A08 A;  4BCI B;  1U1T A;  4M78 A;  3JB9 H;  3VUZ A;  3EGD B;  2NUT B;  1Q86 U;  2DTI A;  1B7T A;  1Y07 A;  3E19 A;  1HYO A;  1ZX6 A;  3B57 A;  1PM3 A;  3PFS A;  4BE1 A;  4OML A;  2F5T X;  1MMG A;  4J9C A;  2WAC A;  3GTM S;  2B8A A;  4AKH A;  4BCN D;  3HO8 A;  2HL5 C;  3UA7 A;  4OB0 B;  2FB7 A;  2HL3 A;  4FW2 A;  4M7A D;  1V76 A;  1EFN A;  1X75 C;  2HKN A;  4J7I A;  1QVG S;  1QLB A;  5HBJ B;  4A4K A;  2QQA A;  3EG2 A;  1BKB A;  2R5M A;  3SDZ A;  2J06 A;  1XOV A;  4FYY B;  2JT4 A;  3I55 T;  1PKT A;  2J7I A;  2FHD A;  3OW2 A;  3X20 B;  4E7H A;  1YJ9 A;  2L3Q A;  3S3N A;  4EMK A;  2KRN A;  3CME T;  4JJB A;  2P84 A;  1QP2 A;  1Y57 A;  4EPC A;  5FWC A;  4M75 C;  3BDL A;  4JRQ A;  1WIE A;  3CCS Q;  3OYL A;  3JB9 D;  2QI2 A;  1XTD A;  5FU7 B;  4M7D C;  3G6E Q;  2CT3 A;  2LNV A;  3MP6 A;  3KHI A;  4L5G A;  1VQL T;  1OL1 B;  3NDQ A;  4CI0 C;  1K9M U;  3JCM c;  4ANJ A;  1KG1 A;  2JVV A;  4FYX B;  5CKD A;  4RCC A;  1D0Z A;  1VOM A;  3CC7 A;  1YJ9 T;  3OBY A;  1WI7 A;  1WZO A;  4HCZ A;  3VV0 A;  1BB9 A;  2CGH A;  2QA4 Q;  1RAF B;  2XG8 D;  4RTT A;  2DER A;  2RD1 A;  3F70 A;  4EIK A;  2C5X B;  3T9N A;  3EG1 A;  4PJJ A;  1ACM B;  3CCJ A;  1RAH B;  5GMK m;  3CBM A;  1H8K A;  2C6T B;  1X43 A;  3FJP A;  5HCK A;  1D3B A;  3DOG B;  4AFZ C;  4L59 A;  3DJB A;  2CP0 A;  4F7U B;  4MML A;  3OS5 A;  4J9B A;  1AD5 A;  3NMZ C;  4BCM D;  4A63 B;  3JCM V;  5LMK B;  2LCL A;  2DTH A;  3OSV A;  4HT8 A;  4BCK B;  3OYI A;  1QVF A;  3OYK A;  3MO8 A;  1C9B A;  5I21 A;  3A98 A;  4M77 A;  1VQL A;  1T0H A;  2O31 A;  4I3Z B;  3VRZ A;  4BY6 C;  2MOX A;  1YNZ A;  2HNI A;  1UJY A;  1VQK A;  2GFU A;  1Q7Y C;  3ULR B;  2QGS A;  1GUX A;  1QCF A;  3EID B;  5D6W A;  4HT9 A;  3JRZ A;  4HNU A;  5KCO A;  2VVK A;  2E3I A;  5A0D A;  2K7A A;  2EKO A;  3JCM e;  5CQY A;  4J9I A;  2PUK B;  3DDQ B;  4LUE A;  1UGR B;  1VQK Q;  4MDW A;  3M58 A;  2E6N A;  2NWM A;  2LQ8 A;  2M9U A;  4CXA B;  2DRK A;  3V8J A;  2E4H A;  3N5B B;  3ZL7 C;  3CCQ Q;  3HTR A;  5I5Z B;  4AFS C;  2OTJ Q;  1AWW A;  3P8H A;  1AIS B;  1D0Y A;  4M7D G;  2LJ0 A;  2LP5 A;  1HJD A;  5L23 A;  2RHX A;  2ZPH B;  1W70 A;  4QQG A;  5LQF B;  2KVQ G;  3M55 A;  1QKW A;  4EC9 B;  3DLM A;  4J9F A;  3EGU A;  1VA7 A;  5ICP B;  2DLP A;  4KRT A;  3QG1 A;  4QSH A;  2F1L A;  4LXC A;  2QK0 A;  2QQ8 A;  1LPL A;  3OMG A;  1EIF A;  5I11 A;  1N9S A;  3QBY A;  2G77 A;  2C5N B;  3MEU A;  2KRO A;  1ZBJ A;  2V26 A;  4HCK A;  3C94 A;  1SHG A;  1QWE A;  3PE0 A;  1PD0 A;  3WXM B;  2M0O A;  1WHG A;  2YUP A;  2MYS A;  4M75 F;  4C8Q F;  2KGT A;  3OYG A;  4EOO B;  2ROL A;  3BG5 A;  5D7U A;  1BCO A;  2E3H A;  4J8O A;  2RJE A;  1VQN A;  1O9S A;  1RAI B;  5IDP B;  1G8X A;  4C92 A;  2D0N A;  1KQS P;  3QUI A;  2MWO A;  2L0A A;  4LDY A;  4JUV A;  1YI2 A;  4EMG A;  2KMT A;  2JNG A;  2JS2 A;  2VWF A;  1ZP2 A;  5LL6 S;  2DEU A;  4NC6 A;  3ME9 A;  2RHU A;  3MY1 B;  1ZSZ A;  1D1C A;  4J6X A;  1MMN A;  2X4J A;  4LDU A;  3SB2 A;  4ZGJ B;  4BCG B;  1WYX A;  4M78 E;  3M57 A;  2RHZ A;  2E6Z A;  1SPK A;  2C0I A;  1M1K U;  4WF2 A;  3CCM A;  1U3O A;  4Z88 A;  2IN3 A;  1JB0 E;  2GCX A;  1C1A A;  3NHN A;  2NLU A;  4FU6 A;  1R0B G;  3CBO A;  1WXU A;  2VGN A;  1UNH D;  2H3J A;  4MDX A;  1OQK A;  2OTL Q;  4PJO G;  3SHW A;  4Y91 A;  3NPF A;  2XI9 A;  1IB8 A;  2XK0 A;  4V2S A;  3HKS A;  1NG2 A;  4ORZ A;  2WHB B;  1T0J A;  4E7Z A;  4FYV B;  2HSP A;  2A0F B;  2IIM A;  1FMW A;  1Q82 R;  2JZ2 A;  2CRE A;  3E9G A;  5ECA A;  1KK7 A;  1K9M C;  3JCM g;  3C95 A;  5IHY A;  1UFF A;  3M0P A;  1GCQ A;  1TS9 A;  4OR5 B;  3L2W A;  1QLY A;  2NUP A;  4F7U E;  2X4Y A;  1YN8 A;  1ZA1 B;  4X34 A;  5LJ5 j;  3QII A;  8AT1 B;  5GAN 2;  3C4S A;  2DVJ A;  4RTU A;  3H0H A;  4PFZ A;  4EOJ B;  3G6E A;  1QVF P;  2DTO A;  4OMQ A;  5CKE A;  1EX4 A;  3OYH A;  1YHQ A;  4M77 F;  3TQ7 P;  1YCY A;  2YT6 A;  1MHN A;  2DAQ A;  3EFO B;  3EFS A;  4OVA A;  1F1B B;  4BY1 X;  4HVV A;  4QVC A;  2XKO C;  3I56 A;  3MEA A;  5DQW A;  1TTH B;  3BHU B;  3EOC B;  4M7A F;  4Y72 B;  2HQH A;  2EKH A;  1B07 A;  2CP5 A;  1OIU B;  1OUL A;  1MGQ A;  2KRS A;  4GLK A;  2CH4 A;  2FRW A;  1KC8 U;  2P0K A;  3UAT A;  2YLC A;  2ZGW A;  5GAM h;  4Y92 A;  1VQ5 Q;  1U06 A;  1ZBX A;  2VXF A;  2YHT A;  3V8K A;  4ZTJ A;  2C5O B;  3RUX A;  1TUD A;  3X24 B;  4F6U B;  4R55 A;  3QYB A;  2EAY A;  1Q86 C;  4J5Y A;  1YIT Q;  3CC4 Q;  4PL6 A;  5FRO A;  3OYY A;  1VQP Q;  4YOO A;  1D09 B;  3SD4 A;  4OP0 A;  1WXB A;  1OEB A;  1RAD B;  2YUO A;  2PK2 A;  5GMK l;  1UGS B;  5GMK e;  1VQ8 A;  3NGP A;  1VUB A;  2QQS A;  2YUN A;  2QEX A;  3VKH A;  2VYT A;  4ZTF A;  5GAN 7;  3VYG B;  1TUC A;  3R6O A;  3MHX A;  1SSF A;  1W1F A;  2O2O A;  1H1R B;  4LN2 A;  1RL2 A;  4AG2 C;  4GBQ A;  5GAN h;  3EGD A;  1R8O B;  3INZ A;  5KYY B;  5GMK j;  4AMC A;  3A8H B;  1YFN A;  3LW5 E;  2A7Y A;  4ZN1 A;  4LOC A;  2RPN A;  2DO3 A;  4MZT A;  2L89 A;  4BE0 A;  4E6R A;  4CFU D;  3VYH B;  3BE3 A;  5IHK A;  4JJC A;  2KT1 A;  1Z9Z A;  2YRC A;  3UPU A;  3G4S A;  2LC4 A;  5HKC A;  2OAU A;  2RK1 A;  4MZM A;  2P0P A;  3SFM A;  5EG2 A;  2V8K A;  2ROT A;  5EFQ B;  1H3H A;  1A0N B;  4EMK C;  3L1A A;  4M78 B;  1NM7 A;  3HB9 A;  2YUQ A;  2K4Y A;  1PC0 A;  3QYH B;  4HCB A;  2O4X A;  5KE2 A;  1OI1 A;  1PRL C;  3PMI A;  3JCM X;  2WXV B;  1U5S A;  2K79 A;  2VXE A;  4TVR A;  1JO8 A;  3M4G A;  1WNL A;  4M78 G;  5D6X A;  3NTH A;  4C92 C;  4XU3 A;  4PK4 A;  2BS3 A;  3GNG A;  2CZ0 B;  4XTV A;  4D8K A;  3OSS C;  2R58 A;  4XTU A;  1UTI A;  2HDA A;  2JMA A;  5LJ3 h;  2K5L A;  3JV3 A;  2EQJ A;  2KMG A;  3C0C A;  1BBZ A;  3UWN A;  1WHM A;  3L2R A;  3SEM A;  1CKA A;  1K9M R;  4F7U F;  1IXD A;  5LJ5 g;  2ZZD A;  3G7Z A;  2EQU A;  4IUV A;  1M2V B;  2JXB A;  3M0S A;  1OKW B;  4KGZ B;  1MNE A;  2DPP B;  2A37 A;  2PVG B;  3EGX B;  1YJN T;  4C92 F;  2KRM A;  1ENW A;  4YC3 B;  1M4Z A;  3GIB A;  2W9F A;  5FLX E;  1YIT A;  1IZ6 A;  2LQW A;  4M7A C;  5I22 A;  4IUQ A;  4FX3 B;  1VQ9 T;  3BW1 A;  4P5N A;  2DA9 A;  1YCS B;  1M1K R;  3CBP A;  1I4K 1;  3H8Z A;  4JDS A;  2WPA B;  2EIF A;  2E70 A;  1AT1 B;  2QFZ A;  1BI3 A;  4M7A E;  1M3A A;  1D1A A;  4EOP B;  3CC7 T;  2XID A;  1PSE A;  2G6F X;  4WTO B;  2OI3 A;  5CKB A;  2YDL A;  3VS6 A;  3RES A;  3F5X B;  4OB2 B;  4M77 E;  5DLO A;  3TCJ A;  4Z8A A;  1WJQ A;  2W0Z A;  3CCM Q;  2QAZ A;  5GAN 3;  1UGV A;  3A8G B;  4M77 G;  4M78 F;  1VQK T;  2F69 A;  4BCM B;  1LNX A;  3OYF A;  3I56 Q;  2KR3 A;  2B9R A;  3HHT B;  2R57 A;  2R5A A;  2CCH B;  2EGE A;  4M7D D;  1O75 A;  5LJ5 d;  4CRL B;  1GY3 B;  5GJV B;  1ARK A;  3OS1 A;  1WQW A;  4M7A G;  3CXC S;  1QWF A;  4C8Q G;  3RGF B;  3DKM A;  5CO7 A;  2KNB B;  2C4G B;  3EAE A;  4A4E A;  4RTZ A;  3QJ6 A;  3OS2 A;  1GXI E;  1WQ7 A;  2DEQ A;  2PU9 B;  4AG1 C;  3J80 E;  1FYN A;  4J9E A;  1FKM A;  4ESR A;  5KYN A;  1VQO T;  1LVK A;  5D6Y A;  1JJ2 A;  3HBL A;  5FU6 C;  2RF0 A;  4QVD A;  4F7L B;  4PNO A;  3OY9 A;  4II5 B;  1VQ5 A;  3M0Q A;  4F6S B;  3MJX A;  4FIB A;  5CK9 A;  1TUG B;  5IAY A;  3OYM A;  4AKG A;  1ZUK A;  2CZ7 B;  1RUW A;  1WDX A;  3CEY A;  3Q1J A;  3ZEH A;  5EC7 A;  1BK2 A;  2FZC B;  2QQR A;  1JBM A;  4J6Y A;  4Z02 A;  1UUE A;  2HQE A;  2EJ9 A;  1YHQ Q;  1VQN T;  1K73 R;  1RLQ C;  3FB9 A;  4PJM A;  2M02 A;  4BI3 A;  2UZE B;  1ABQ A;  1H25 B;  2BZY A;  2QGF B;  4JZ4 A;  5HVY B;  3QJY A;  2EQK A;  3CCQ A;  1AEY A;  1VQO A;  4JS4 A;  4BE2 A;  1Q81 R;  2QDY B;  3RMS A;  1X01 A;  2LDM A;  4RG2 A;  1YWO A;  4R56 A;  3NFC A;  4HNV A;  1VQ4 Q;  2DVE A;  4E7K A;  5FW9 A;  1VQ7 Q;  3QDF A;  1KC8 C;  2VB6 A;  3MPU B;  2AZV A;  2CZ1 B;  1KQS A;  2DL5 A;  2DBM A;  1X6O A;  1M1K C;  3MY5 B;  3HZJ A;  2QTX A;  2VUB A;  4M6V A;  2DL7 A;  4A4H A;  1N8R R;  2FPE A;  2KSS A;  2A36 A;  1FMK A;  1OX8 A;  3DTO A;  2EYX A;  1PD1 A;  1VYW B;  3P8D A;  5IHI A;  2Y4Y A;  3G6E T;  3SWN A;  4OB3 B;  1JEG A;  5CQX A;  2MI6 A;  3CCJ T;  3JB9 I;  1O9K B;  2CDT A;  1H1Q B;  3RER A;  3I5R A;  2L5Q A;  2KE9 A;  1JQQ A;  2DE0 X;  4DA4 A;  2RMO A;  3PVQ A;  4EOS B;  1P5E B;  3ASK A;  1S72 T;  3K7A M;  2L2P A;  1H3Z A;  5GAM e;  2L3S A;  2H8H A;  4C5G A;  2KK4 A;  5IF1 B;  1RI0 A;  3WVD B;  3M9Q A;  3RKX A;  2V1Q A;  2WEV B;  5IXB A;  2CP7 A;  2MWP A;  3QZ9 B;  2RHI A;  2XMF A;  2DME A;  3EG9 B;  2E65 A;  2L3P A;  1YIJ Q;  1FWZ A;  1PSF A;  2HEQ A;  1GRI A;  1UJ0 A;  4KT0 E;  5DLQ E;  3G71 T;  3TN8 B;  1WJR A;  4A4F A;  2K9G A;  2J6O A;  2HKQ B;  5KE3 A;  4KUD K;  2LJ3 A;  2C5V B;  3KBG A;  4M7D A;  5GMK h;  3CPW A;  4AI6 A;  3LGF A;  4TTH A;  3PNW C;  4ATO A;  4C0D C;  2ZPB B;  2AIR B;  2LRQ A;  3CC7 Q;  1B34 A;  2F5K A;  1PNJ A;  3EG9 A;  1M2V A;  4CFV B;  4ZNX A;  1YIJ T;  3V7S A;  1UHF A;  2PVD B;  4RTV A;  4BY6 B;  1KQ1 A;  1W6X A;  3M0T A;  1QQJ A;  4PLL A;  2Y4X A;  2FPD A;  1VQN Q;  1VYV A;  4FSS A;  2CSI A;  3CC2 T;  3TSW A;  2PQW A;  3PT9 A;  1W2B A;  9ATC B;  1M90 U;  5DQV A;  1M1F A;  3VJP A;  2M51 A;  1C0M A;  1M1G A;  1BI1 A;  2MPX C;  2JGZ B;  2FG0 A;  1O9K A;  2MAM A;  3QYG B;  4F6W B;  4OGR B;  2QDJ A;  1G2B A;  4LUD A;  4RG8 A;  3M59 A;  1VQM T;  4FSX A;  2O9V A;  2RJF A;  5HY6 A;  1TFB A;  2LTO A;  2LX9 A;  1I0C A;  2MCN A;  4C92 G;  3L2Q A;  3OB9 A;  1UG1 A;  5J26 A;  1ZA2 B;  3V7R A;  3O5Z A;  2C0T A;  3H9N A;  3M5A A;  1QVG A;  2OTL A;  1AVZ C;  4R0K A;  1XJW B;  2EGC A;  5HK0 A;  3EGX A;  4A53 A;  2DFU A;  4N4G A;  1VIF A;  2BZX A;  4PJO C;  4PJN A;  2W9Z A;  2E41 A;  2CP6 A;  4KUL A;  2L8D A;  3I56 T;  4X9C A;  4ROC A;  1KHI A;  3H0F A;  2FEI A;  4DOW A;  1GBR A;  2CS7 A;  4IUT A;  5FWB A;  2LMJ A;  5AYF A;  3VKI A;  2ESW A;  4C8Q C;  1F5Q B;  1Q81 C;  1G3Y A;  2CSQ A;  4MZP A;  4F7U A;  1GH6 B;  3GPL A;  2JTE A;  3HSB A;  1OYX A;  1MV3 A;  4BI4 A;  3ER0 A;  2OJ2 A;  3A8O B;  2DIQ A;  4C8Q E;  1VQ4 T;  3VYG A;  5J3B A;  5A2Q E;  3VS1 A;  3EH2 A;  3P8B B;  2EFI A;  3M54 A;  3CCL A;  4HNT A;  1K0X A;  2E12 A;  3FJ5 A;  2X1N B;  1BI0 A;  8ATC B;  5KYX B;  4LE9 A;  1H4L D;  7AT1 B;  3GF5 A;  1VQO Q;  1TG0 A;  2JTM A;  1JST B;  2EBP A;  1KXU A;  3CD6 T;  4J9H A;  3AHU A;  1XO2 A;  3TU4 K;  1JXM A;  1VIN A;  5IDN B;  3FRN A;  1OGU B;  5C6S A;  1PG5 B;  4C5I A;  2DZC A;  3KXT A;  3OW2 P;  3BG9 A;  2YLB A;  5GAN f;  5I2M A;  1NLO C;  2LZ6 B;  1OI9 B;  4IUU A;  3ZBD A;  3UF4 A;  2DL4 A;  2ZPI B;  5FGK B;  3CMA T;  2GBQ A;  3FDR A;  4M75 A;  1M9S A;  1UB4 A;  2CH4 W;  3LWI A;  3M03 A;  3JCM f;  1MMD A;  1WHJ A;  2E64 A;  5GAO l;  3HFO A;  4E2F B;  2DYI A;  3CCM T;  3S3M A;  1NPR A;  2JUF A;  1K73 C;  3GNF B;  4IKF A;  2BPM B;  2I0N A;  4RKU E;  2CT4 A;  2JW4 A;  1QVG P;  2DX1 A;  6AT1 B;  4M78 D;  3MI9 B;  3M56 A;  4BAC A;  3E9F A;  1W2B S;  3GLX A;  2MMP A;  2K3B A;  3M0U A;  4JX5 A;  1FIN B;  1N6A A;  2GF7 A;  2RNA A;  2BUD A;  3MCA B;  2RQW A;  2UUE B;  2X3X D;  1YJW A;  1AHJ B;  2XDP A;  3BLQ B;  1JU5 C;  2EVR A;  4HCC A;  2IVX A;  1MUZ A;  2Y90 A;  4F14 A;  4FM4 B;  3OA6 A;  4X9D A;  1KD1 R;  4B9X A;  4F16 A;  4RTW A;  2BE7 D;  1TSF A;  3EG0 A;  1ZLM A;  4ELJ A;  2CUD A;  3JCM b;  1BIA A;  5FRN A;  3I5S A;  4EOI B;  4OMP A;  5GAM d;  1IGQ A;  1D0X A;  1JOW A;  2WSC E;  4PKC C;  1AWX A;  2F2C A;  4BCF B;  2F2W A;  5GAN e;  4DBF A;  1I5L A;  3URG A;  3TW7 A;  1TU0 B;  4LD6 A;  1XNI A;  2X3W D;  1YJN Q;  4JJD A;  4D8D A;  3GP8 A;  2O4X B;  1GBQ A;  1VQ6 A;  3FIF A;  4RUG A;  4M77 C;  1BI2 A;  3J7A F;  2DMO A;  1OPK A;  2FPF A;  5GAM g;  1M27 C;  1AZE A;  3MKD A;  4J9D A;  4PLI A;  4RTY A;  1KIK A;  2QEX Q;  4II1 A;  5I2S A;  1G3N C;  3ZFJ A;  2XDB A;  5HBE B;  4XK8 E;  3EFR A;  1NE8 A;  4M78 C;  1K8A R;  2FVU A;  3RIR A;  4BDY A;  2ECZ A;  4ROE A;  4KGX B;  5HBH B;  4QQD A;  1YJN A;  4JLI A;  1FX7 A;  2EYQ A;  3OYJ A;  2BZ8 A;  1CKB A;  2YWW A;  1ZQ1 A;  3OYC A;  1RAB B;  3EHQ A;  4J9G A;  3JCM J;  1AWO A;  4CFM B;  1QKX A;  2GFA A;  4ZGE B;  4JLG A;  1M8M A;  1RAG B;  2ZAE A;  2IW6 B;  4M75 B;  3D7S B;  2CUB A;  2QEX T;  1KSW A;  2ZPF B;  4OGC A;  2DNU A;  4K11 A;  3V7C A;  4UN0 A;  2M16 A;  2SEM A;  4PFO A;  2GQI A;  1VQ9 A;  1SG5 A;  4QKU A;  2HBP A;  3I55 A;  4QVZ A;  4CFX B;  1KQS S;  3JCM h;  2Z0W A;  2A3L A;  1LJO A;  2K3Y A;  4BCQ B;  2EGA A;  2CP3 A;  3GBQ A;  3REB B;  2DXC B;  2DK3 A;  2DET A;  1UE9 A;  3CCJ Q;  2WFY B;  4C92 D;  3QSU A;  1YIT T;  1UGP B;  1KFZ A;  5GAN 8;  2KEA A;  1RLP C;  2RI5 A;  2I40 B;  2IG0 A;  3QKJ A;  3A5Z B;  2RN8 A;  5IXF A;  3DLL A;  3VS3 A;  1PHT A;  1K0S A;  4XU0 A;  1VQM Q;  1UEB A;  1M5Q 1;  4C5H A;  1H27 B;  3H41 A;  1QCN A;  2G3R A;  3S3O A;  1FMV A;  2RJC A;  3TNH B;  5LJ3 f;  1Q7Y U;  2L3R A;  2WMA B;  1VQP T;  5LJ5 f;  2E5K A;  3DDP B;  2HSE B;  4ZGD B;  1QVP A;  3TW6 A;  1WHK A;  1Q86 R;  4Z89 A;  3L42 A;  4DEY A;  5AT1 B;  4YOZ A;  1X27 A;  3CCV A;  5J39 A;  1AZG B;  1KJW A;  3LX7 A;  5GAO m;  1H1P B;  3BLH B;  2GTO A;  4EOQ B;  3OW2 S;  4O5V A;  1VQ5 T;  4Y28 E;  3M53 A;  2QA4 T;  2FZG B;  1G5V A;  1JRI A;  3HRT A;  2OTJ A;  1FVV B;  2WIH B;  2DD5 A;  2WSF E;  3I9Q A;  1TD6 A;  1K73 U;  2NYS A;  3E2U A;  1C6V X;  4NST B;  2YRD A;  4JJN K;  4IUP A;  4NL3 A;  5C0M A;  3QWL A;  5KYU A;  1NYG A;  2LCS A;  2VGM A;  1W2B P;  2A28 A;  2X51 A;  3CCV Q;  1ZSG A;  5IHN A;  4ELZ C;  1G3W A;  5GAO r;  4LNP A;  2DL8 A;  3PVL A;  3QHW B;  5CYI B;  3S6W A;  1GUX B;  2KXD A;  2DIG A;  2KAF A;  4OMF B;  3CC2 Q;  1I07 A;  1T3S A;  2PZ1 A;  4E7J A;  2RK2 A;  3TRE A;  2OTL T;  5IN1 A;  1H28 B;  2K57 A;  4M7D F;  2DF6 A;  2LX7 A;  1CSK A;  2JN0 A;  2H3E B;  4A4G A;  1DJ7 B;  1PKS A;  3CPW P;  1URC B;  1ZSZ B;  3JCM P;  2WJ9 A;  5M9O A;  2GTJ A;  4MFD A;  2F2V A;  2DXT A;  3CPF A;  2C0O A;  2FZK B;  4NS5 A;  2XD0 A;  3CC2 A;  1V29 B;  5GAN 6;  3O8V A;  4YTL A;  3CCL T;  4F17 A;  1MND A;  3X26 B;  2EYW A;  1WXT A;  1VQ7 T;  1AOJ A;  1Y96 A;  4OMM A;  2OX7 A;  3VS0 A;  4FL6 A;  3CCE A;  2ATC B;  2UZL B;  4N0A A;  4C5E A;  4EMK B;  2QQB A;  4FCY A;  1TOV A;  1K8A C;  2XIC A;  1PRM C;  5LJ5 h;  3DL1 A;  2FYK A;  3MEW A;  1D3B B;  2GNC A;  1Y0M A;  2R7G A;  1X6G A;  3EHR A;  3O0G D;  2YRV A;  1MMA A;  4XU1 A;  5GAM j;  4PJO A;  2E10 A;  2JJ9 A;  1YHQ T;  1Y7X A;  1Q82 U;  1NJI C;  1YP5 A;  1BCM A;  4CFU B;  2KYB A;  1S72 Q;  1K4U S;  2PHG A;  4PJO E;  2W96 A;  3QWY A;  3POM A;  2K2V A;  2UZD B;  1I81 A;  1OX9 A;  4C8Q A;  1PKD B;  2X35 A;  1VQ7 A;  2COZ A;  1M3B A;  4DBH A;  1VQL Q;  2ABL A;  1WLP B;  4BB7 A;  2LW4 A;  1AD6 A;  2QF7 A;  2DXU A;  2D6F A;  1RAE B;  2LQK A;  2HD0 A;  1I5O B;  3IQL A;  3FC3 A;  4LD9 K;  3PTA A;  3CC4 A;  3OYD A;  4F7U G;  1M8V A;  2W99 A;  4EOK B;  1LCK A;  2FO0 A;  5KH6 A;  2OAW A;  2EYZ A;  2LCC A;  1E6H A;  1SSH A;  4WCI A;  4B9W A;  4BXX X;  2P0Q A;  4XTY A;  3QDR B;  4FT2 A;  3A8M B;  4OB1 B;  2KQW A;  2DD4 B;  2HCK A;  4HLQ A;  2D9T A;  3OYA A;  1H1S B;  1KHC A;  1IRX A;  4M7A B;  4F7S B;  2RJD A;  2K5F A;  4KBM B;  2DJQ A;  4AFU C;  1ZSZ C;  2BKD N;  5GMK i;  5CCA A;  1OZ2 A;  4IMY B;  5GAM f;  4M75 G;  2KT8 A;  1NJI U;  4BDZ A;  3DB4 A;  2RB6 A;  5GAN j;  1SKU B;  4MIM A;  4M77 B;  3UA6 A;  2EPD A;  2ZZD B;  1GCP A;  2D1X A;  4OMO A;  3PIP A;  1GL5 A;  3E1S A;  1OV3 A;  1WFW A;  2E1H A;  2BTT A;  2RI3 A;  3RR6 A;  5IT9 E;  2DJZ A;  3G71 Q;  4YOS A;  3LQ5 B;  3LGL A;  1RI9 A;  5CKF A;  2RI2 A;  2J6F A;  1VYT A;  5CR2 A;  2I53 A;  2VKN A;  1EZZ B;  2RHY A;  1H24 B;  3RNJ A;  2ZPG B;  4XQ3 A;  2KYM A;  4KRD B;  2PTK A;  3HRU A;  4HA8 A;  1UNG D;  1OU8 A;  2IVW A;  1E7P A;  1RAC B;  4XAX B;  1VQ4 A;  4DQ2 A;  3CCS A;  2NUT A;  2DKG A;  1LOJ A;  2VC8 A;  3UT1 A;  2X4W A;  4M7D E;  2YSQ A;  3TSZ A;  1GFD A;  3M4Y A;  4RCB A;  1QW1 A;  4IUR A;  5ACB A;  2WIP B;  4KH0 B;  4C8Q D;  2IW8 B;  4M75 D;  4QW2 A;  3BY7 A;  3A1P A;  1B3Q A;  4BBR M;  2FL7 A;  2K5I A;  5A0L A;  1X69 A;  2KI7 A;  5KCH A;  3CXC A;  4JRK A;  4J6W A;  1IGU A;  2XU8 A;  4AFQ C;  1VOL A;  1JKW A;  5L2W B;  5A0G A;  4BBS M;  3MET A;  3VS7 A;  4EOL B;  3TEE A;  4C0G A;  1QMC A;  4JPB W;  2JTF A;  4MFE A;  2AK5 A;  2IW9 B;  2X4X A;  2ZCF B;  2F2X A;  2KDS A;  1VQ8 T;  5CEI B;  3G4S Q;  2DXB A;  2FRY A;  1SHF A;  1OPL A;  5LJ3 g;  1N5Z A;  4BY7 X;  1UGQ B;  2QG9 B;  2COY A;  4ELY C;  3TVT A;  1BU2 A;  1IHV A;  1BIB A;  2DIL A;  2COW A;  3JCM d;  2P4R A;  1NLP C;  5FRM A;  3VS2 A;  3LH0 A;  1UHC A;  1OL2 B;  3L2Z A;  3CCE Q;  1WGS A;  5EJC A;  3UDC A;  4DOV A;  3U23 A;  5KYX A;  1TWB A;  4M77 D;  4PJO B;  1AWJ A;  4HL4 A;  4A54 A;  3FLG A;  3AT1 B;  1K1Z A;  2BIV A;  1IHW A;  1K76 A;  1K8A U;  3LWH A;  2WSE E;  4F7N B;  4EDU A;  4EMH A;  1KD1 U;  2AT1 B;  1OZ3 A;  1M30 A;  4E7L A;  3QHS A;  1QMZ B;  2D0Q B;  2LNH B;  4LDX A;  2C06 A;  5IH2 A;  3QO3 A;  1JJ2 P;  3TNI B;  4ZN3 A;  4HXJ A;  4C0F A;  3VS5 A;  1ZHI A;  2V8J A;  4DBQ A;  3CCV T;  4ROD A;  2I2L A;  4CC7 A;  4JRP A;  1OKV B;  5GAN g;  5GAN 5;  3X25 B;  2EQI A;  3RKY A;  1ABO A;  5KYW B;  2BKZ B;  1WJS A;  5GAO q;  1N8R C;  2DBK A;  3CXC P;  2MF2 A;  2RO0 A;  4PFP A;  2PVO B;  2CP2 A;  2K2M A;  4C92 E;  1FXX A;  3FEO A;  2RQU A;  2AKK A;  3DB3 A;  3MP8 A;  2HAX A;  2ENM A;  1ZUY A;  4CC2 A;  3JAM E;  2DD4 A;  2XDD A;  3H0I A;  5GJW B;  1HXD A;  1WX6 A;  4E7I A;  1KQ2 A;  3RKW A;  3H6Z A;  1Z9Q A;  3A8L B;  3KFV A;  1QP3 A;  2NUZ A;  2YXY A;  1D1B A;  4BCQ D;  2JOY A;  2ED1 A;  5LJ3 j;  3L2U A;  2G9X B;  3CPW S;  2VAS A;  1YJW Q;  4EON B;  5FU6 B;  1GCQ C;  2SRC A;  1BYM A;  1VQP A;  1VQ6 T;  3OBW A;  3SWN C;  2V22 B;  1Q82 C;  4DBR A;  1M90 C;  4C0Z A;  2RQR A;  3CCR Q;  2AKL A;  1W4S A;  2EWN A;  2PJQ A;  2CZ6 B;  3OQ5 A;  3WVE B;  2EUF A;  2O01 E;  2BE9 B;  3CME A;  2AHJ B;  2KBT A;  1TXQ A;  3G71 A;  4CC3 A;  3C12 A;  4QT7 A;  1TH7 A;  4EOR B;  3HP9 A;  4PJO F;  4MMK A;  4M7D B;  1V1C A;  2KY9 A;  2QDL A;  1YWP A;  3RDV A;  2J6K A;  4ELL A;  4GLM A;  2JM8 A;  4O6J A;  4F04 B;  2HZY A;  1NPP A;  2LJ1 A;  2QGG A;  1NJI R;  2EYY A;  4M7A A;  1IRE B;  1I8F A;  2DYB A;  1WHH A;  5GAN d;  4BCO B;  2QAS A;  5KYY A;  1NBE B;  3CCU A;  3CCU T;  1W98 B;  3R6N A;  3CCR A;  4C8Q B;  1NEG A;  2CJM B;  1H26 B;  1VIE A;  3EJ1 B;  2JS0 A;  5HQ0 B;  2MK5 A;  5CVI A;  3RBB B;  2RQV A;  1P92 A;  2M0Y A; 
#chains in the Genus database with same CATH homology
 4O5V A;  4HNV A;  4Y28 E;  1VQ5 T;  3M53 A;  3P8H A;  2DVE A;  2QA4 T;  3BDU A;  4E7K A;  1G5V A;  1JRI A;  1VQM A;  3PGG A;  1KC8 C;  4GY5 A;  4M7D G;  3HRT A;  2OTJ A;  2OTJ T;  2CZ1 B;  1KQS A;  2LT1 A;  2LT4 A;  2RHX A;  2XHC A;  2ZPH B;  1X6O A;  2DD5 A;  2KVQ G;  2WSF E;  2CKK A;  3M55 A;  4QQG A;  4BD3 A;  3HZJ A;  2QTX A;  4LDW A;  5CIU A;  3DLM A;  5GAO n;  1M1K C;  2VUB A;  4M6V A;  1K73 U;  4A4H A;  1B34 B;  4D6W A;  3MP1 A;  2KSS A;  1U8R A;  5L8R E;  3P8D A;  4JJN K;  4IUP A;  2Y4Y A;  3QG1 A;  4QSH A;  1Y71 A;  3G6E T;  4NL3 A;  5C0M A;  3SWN A;  3QWL A;  4OB3 B;  5CQX A;  2QQ8 A;  1HK9 A;  2VGM A;  3OMG A;  1EIF A;  2MI6 A;  2QXF A;  4N0A C;  1N9S A;  3JB9 I;  3CCJ T;  1QVF S;  4Z6Y A;  3QBY A;  4J83 A;  2G77 A;  3MEU A;  3RER A;  2L5Q A;  3BG3 A;  3C94 A;  4DA4 A;  3WXM B;  3JCM W;  4ELZ C;  1G3W A;  5GAO r;  2M0O A;  3ASK A;  1S72 T;  3OMC A;  1S72 A;  4M75 F;  4C8Q F;  1H3Z A;  4AKI A;  4XTW A;  3V8L A;  5GAM e;  3S6W A;  3OYG A;  4C5G A;  2DIG A;  2KAF A;  2KK4 A;  4OMF B;  3BG5 A;  3JCM Q;  1RI0 A;  4E7J A;  3WVD B;  4J8O A;  3CC4 T;  2RJE A;  2RK2 A;  1Y96 B;  3QZ5 B;  3M9Q A;  1O9S A;  3RKX A;  3TRE A;  1VQN A;  2OTL T;  5IN1 A;  4NOY A;  2K57 A;  2MWP A;  4C92 A;  4M7D F;  3QZ9 B;  2RHI A;  4OGE A;  1YIJ A;  3QUI A;  2JN0 A;  4A4G A;  2MWO A;  2HQX A;  4XTX A;  1DJ7 B;  4LDY A;  4JUV A;  1YI2 A;  4EMG A;  3JCM P;  2KMT A;  2WJ9 A;  2E65 A;  2JNG A;  5DM7 R;  1FWZ A;  1PSF A;  5M9O A;  2RH2 A;  5DLQ E;  4MFD A;  4KT0 E;  3MEV A;  4NC6 A;  1U1S A;  1WJR A;  2DXT A;  2RHU A;  3ME9 A;  3OYE A;  3G71 T;  3JB9 J;  4J6X A;  4A4F A;  4JS5 A;  3CPF A;  2X4J A;  5HK3 A;  3CCR T;  2KR6 A;  4VUB A;  5CKH A;  5KE3 A;  4LDU A;  3CMA A;  3SB2 A;  4NS5 A;  4ZGJ B;  4KUD K;  3CC2 A;  1V29 B;  3KBG A;  4M78 E;  3M57 A;  3O8V A;  4YTL A;  2RHZ A;  5GAN 6;  5GMK h;  3CPW A;  3X26 B;  3CCL T;  4AI6 A;  1VQ7 T;  3LGF A;  2E6Z A;  3PNW C;  4ATO A;  1Y96 A;  4C0D C;  1M1K U;  2ZPB B;  4WF2 A;  5DY9 A;  3CCM A;  1VQK T;  4FL6 A;  2LRQ A;  2QEX A;  3CCE A;  3PIO A;  4OF1 A;  1B34 A;  2GQV A;  2F5K A;  1JB0 E;  4JX4 A;  4N0A A;  2GCX A;  4C5E A;  4LDV A;  3LLR A;  4EMK B;  2NLU A;  1YIJ T;  2VV5 A;  4FU6 A;  2QQB A;  1K8A C;  4JX6 A;  2XIC A;  3CBO A;  2PVD B;  3V7S A;  4C92 B;  4BY6 B;  1KQ1 A;  5LJ5 h;  3DL1 A;  2FYK A;  3MEW A;  1D3B B;  2VGN A;  5LJ3 e;  4PLL A;  5GAO p;  2Y4X A;  2H3J A;  4MDX A;  3HL8 A;  4PJO G;  4Y91 A;  2XI9 A;  2YRV A;  2LVM A;  4XU1 A;  2XK0 A;  4XU2 A;  1H64 1;  5GAM j;  4PJO A;  2E10 A;  1Q82 U;  1YHQ T;  1Y7X A;  1YBY A;  3HKS A;  1JJ2 S;  1NJI C;  3CC2 T;  4V2S A;  2PQW A;  3PT9 A;  4C0D B;  3GOX A;  1W2B A;  4J7F A;  1M90 U;  1N9R A;  1M1F A;  3VJP A;  3PMT A;  3L2V A;  3X28 B;  1WPY A;  1M1G A;  1BI1 A;  2JZ2 A;  2CYZ B;  3QPH A;  4PJO E;  2K2V A;  3E9G A;  1N8R U;  1K9M C;  2MAM A;  4KUI A;  3JB9 F;  3QYG B;  1I81 A;  3JCM g;  3C95 A;  4C8Q A;  2QDJ A;  3QYE A;  3CD6 A;  2X35 A;  2DD5 B;  2DXC A;  2QQ9 A;  4RG8 A;  1VQ7 A;  3M59 A;  2P4T A;  3L2W A;  1VQM T;  4FSX A;  4N4I A;  3LYI A;  4F7U E;  2X4Y A;  2RJF A;  5HY6 A;  4X34 A;  2LTO A;  2LX9 A;  3QII A;  4BB7 A;  5LJ5 j;  5GAN 2;  3C4S A;  2QF7 A;  2E5Q A;  2DXU A;  2D6F A;  2LQK A;  4C92 G;  2HD0 A;  1YI2 T;  3HRS A;  4QQ6 A;  3OB9 A;  3L2Q A;  5J26 A;  3V7R A;  2RA2 A;  3FC3 A;  4LD9 K;  3PTA A;  1G3S A;  3OYD A;  4F7U G;  3CC4 A;  1M8V A;  3G6E A;  3M5A A;  2DZ9 A;  5KH6 A;  1NZ9 A;  2DTO A;  5CKE A;  1QVG A;  2OTL A;  2LCC A;  5HK0 A;  3OYH A;  1YHQ A;  4M77 F;  1G3T A;  1YCY A;  4A53 A;  4B9W A;  1MHN A;  2M1H A;  2DAQ A;  4N4G A;  1VIF A;  3BFM A;  2P0Q A;  4XTY A;  3QDR B;  3EFS A;  4FT2 A;  4OVA A;  3A8M B;  4XTZ A;  3CCQ T;  3CCE T;  4OB1 B;  2KQW A;  2DD4 B;  4PJO C;  4HLQ A;  2D9T A;  4QVC A;  3OS0 A;  2E41 A;  2XKO C;  3OYA A;  1KHC A;  1XQH A;  3JSC A;  4KUL A;  5FU7 C;  4M7A B;  3I56 A;  3MEA A;  2L8D A;  2RJD A;  2K5F A;  4X9C A;  3I56 T;  4KBM B;  1KHI A;  2QA4 A;  4M7A F;  4DOW A;  2BKD N;  5GMK i;  5CCA A;  1OZ2 A;  2CS7 A;  5GAM f;  4IUT A;  4M75 G;  5AYF A;  3VKI A;  4E47 A;  3OYB A;  4BDZ A;  3DB4 A;  3HFN A;  4C8Q C;  1NJI U;  1Q81 C;  1MGQ A;  1G3Y A;  4MZP A;  4GLK A;  2RB6 A;  4Q5W A;  4F7U A;  5GAN j;  2EJF A;  4MIM A;  4M77 B;  3G4S T;  1KC8 U;  2XD0 A;  2ZZD B;  3GPL A;  1KD1 C;  3J81 E;  1Q81 U;  2P0K A;  3HSB A;  1OYX A;  4BI4 A;  4RMO A;  3NTK A;  3ER0 A;  3VU3 C;  4M75 E;  3A8O B;  2DIQ A;  4C8Q E;  2YLC A;  2ZGW A;  5GAM h;  3PIP A;  3VYG A;  1VQ4 T;  3E1S A;  2PUO B;  5J3B A;  5A2Q E;  3KUF A;  2E1H A;  2RI3 A;  3P8B B;  1ZBX A;  2RM4 A;  2VXF A;  2YHT A;  4UC4 A;  2EFI A;  3V8K A;  5IT9 E;  4ZTJ A;  2DJZ A;  5LJ3 d;  1N27 A;  2EJG A;  3M54 A;  3SWN B;  3RUX A;  4BUG A;  2ZPE B;  3LGL A;  3CCL A;  4HNT A;  2E12 A;  3X24 B;  5CKF A;  2BS2 A;  2RI2 A;  4BI8 B;  1BI0 A;  5CR2 A;  4R55 A;  2V8I A;  3QYB A;  2RHY A;  2EAY A;  1Q86 C;  3GF5 A;  4FT4 A;  4J5Y A;  2JTM A;  2ZPG B;  4XQ3 A;  3JB9 G;  3CD6 T;  4JRI A;  4PL6 A;  3AHU A;  3HRU A;  4HA8 A;  5FRO A;  3OYY A;  3TU4 K;  2IVW A;  4L6V 5;  1E7P A;  2DXB B;  4XAX B;  1VQ4 A;  3FRN A;  3SD4 A;  4DQ2 A;  5C6S A;  4OP0 A;  3CCS T;  3CCS A;  2DKG A;  1LOJ A;  4N4H A;  3VKG A;  2VC8 A;  4PJO D;  4C5I A;  5GAN 4;  2DZC A;  3UT1 A;  5GMK l;  3KXT A;  1UGS B;  5GMK e;  1VQ8 A;  3BG9 A;  1VUB A;  2K3X A;  2QQS A;  2X4W A;  2EQM A;  2YLB A;  3VKH A;  3NTI A;  2VYT A;  5I2M A;  5GAN f;  4ZTF A;  5GAN 7;  3VYG B;  4M7D E;  3R6O A;  3MHX A;  5CAI A;  3H4C A;  5LJ5 e;  1YJW T;  1SSF A;  4IUU A;  3M4Y A;  3ZBD A;  4RCB A;  1QW1 A;  2ZPI B;  1RL2 A;  3CMA T;  4IUR A;  3FDR A;  4C8Q D;  4M75 A;  1M9S A;  1UB4 A;  4M75 D;  4QW2 A;  3RMQ A;  1R8O B;  3HPW A;  5GAN h;  4HKE A;  3LWI A;  3BY7 A;  4ME7 A;  2E64 A;  3JCM f;  5GAO l;  3HFO A;  3INZ A;  3CCM T;  4BBR M;  5GMK j;  3S3M A;  1NPR A;  2FL7 A;  2K5I A;  4NL2 A;  3A8H B;  2JUF A;  1K73 C;  5A0L A;  3LW5 E;  2A7Y A;  3GNF B;  4ZN1 A;  4CRI A;  2BS4 A;  4IKF A;  4LOC A;  4RKU E;  5KCH A;  3CXC A;  2DO3 A;  4MZT A;  3QXE B;  2L89 A;  4JRK A;  4J6W A;  3VUB A;  2XU8 A;  4BE0 A;  3OYN A;  3VYH B;  1U1T A;  4M78 A;  4M78 D;  4BBS M;  5A0G A;  3M56 A;  3MET A;  4BAC A;  3JB9 H;  3E9F A;  1W2B S;  3GLX A;  3TEE A;  4C0G A;  2JTF A;  3VUZ A;  2MMP A;  4MFE A;  3UPU A;  3G4S A;  2X4X A;  2LC4 A;  2ZCF B;  5HKC A;  2OAU A;  2RK1 A;  4MZM A;  2P0P A;  1Q86 U;  2DTI A;  2KDS A;  1Y07 A;  3E19 A;  1VQ8 T;  3SFM A;  5EG2 A;  4JX5 A;  2V8K A;  2DXB A;  1N6A A;  2GF7 A;  2BUD A;  3MCA B;  4EMK C;  3L1A A;  4M78 B;  1YJW A;  1AHJ B;  3HB9 A;  2K4Y A;  2XDP A;  1UGQ B;  3QYH B;  3PFS A;  5LJ3 g;  2O4X A;  4ELY C;  5KE2 A;  1OI1 A;  4BE1 A;  4HCC A;  4HCB A;  2F5T X;  3PMI A;  4M7D A;  3JCM X;  1BIB A;  2WAC A;  2Y90 A;  2B8A A;  4FM4 B;  3JCM d;  4AKH A;  3OA6 A;  4X9D A;  5FRM A;  3HO8 A;  4B9X A;  2VXE A;  3LH0 A;  4TVR A;  4OB0 B;  2FB7 A;  3M4G A;  3L2Z A;  1WGS A;  4M7A D;  1X75 C;  4J7I A;  4ELJ A;  1WNL A;  4M78 G;  5D6X A;  3JCM b;  1BIA A;  5FRN A;  3NTH A;  1QVG S;  1QLB A;  5EJC A;  3UDC A;  4A4K A;  4C92 C;  4XU3 A;  4DOV A;  2QQA A;  2BS3 A;  1BKB A;  5GAM d;  2R5M A;  3GNG A;  2CZ0 B;  4XTV A;  3SDZ A;  3OSS C;  2WSC E;  2R58 A;  4PKC C;  4XTU A;  1XOV A;  5LJ3 h;  2K5L A;  4M77 D;  3I55 T;  5GAN e;  4PJO B;  4HL4 A;  4A54 A;  2EQJ A;  1I5L A;  2KMG A;  3FLG A;  3URG A;  3TW7 A;  2FHD A;  4LD6 A;  1XNI A;  2BIV A;  3OW2 A;  3UWN A;  1K8A U;  3L2R A;  3LWH A;  3X20 B;  2WSE E;  4EDU A;  4EMH A;  4F7U F;  4E7H A;  5LJ5 g;  2ZZD A;  3GP8 A;  1YJ9 A;  1KD1 U;  1OZ3 A;  3G7Z A;  2EQU A;  4IUV A;  4E7L A;  2O4X B;  4EMK A;  3S3N A;  3QHS A;  2D0Q B;  3CME T;  1VQ6 A;  3FIF A;  1QP2 A;  4M77 C;  4LDX A;  1BI2 A;  2C06 A;  3QO3 A;  4EPC A;  3J7A F;  4M75 C;  2DPP B;  3BDL A;  4ZN3 A;  5GAM g;  4JRQ A;  2PVG B;  1YJN T;  4C0F A;  4C92 F;  1ZHI A;  2V8J A;  4PLI A;  3CCV T;  1M4Z A;  3OYL A;  3JB9 D;  3GIB A;  5FLX E;  2I2L A;  1YIT A;  2QI2 A;  1IZ6 A;  4II1 A;  4JRP A;  1XTD A;  5FU7 B;  5LL6 S;  5I2S A;  4M7A C;  4M7D C;  5GAN g;  5GAN 5;  3X25 B;  4IUQ A;  3ZFJ A;  2XDB A;  3RKY A;  1VQ9 T;  3BW1 A;  4P5N A;  2LNV A;  4XK8 E;  3EFR A;  3CBP A;  3MP6 A;  1I4K 1;  3H8Z A;  4JDS A;  1NE8 A;  3KHI A;  4L5G A;  4M78 C;  2EIF A;  1VQL T;  1WJS A;  2FVU A;  4CI0 C;  5GAO q;  1N8R C;  2E70 A;  1K9M U;  2QFZ A;  3RIR A;  1BI3 A;  3JCM c;  2MF2 A;  2RO0 A;  4BDY A;  4M7A E;  2PVO B;  1KG1 A;  2JVV A;  4C92 E;  4QQD A;  1FXX A;  5CKD A;  3FEO A;  4RCC A;  3CC7 T;  3CC7 A;  2XID A;  1PSE A;  1YJN A;  4JLI A;  1YJ9 T;  3OBY A;  5CKB A;  3DB3 A;  4HCZ A;  1FX7 A;  2EYQ A;  3OYJ A;  3MP8 A;  3VV0 A;  2CGH A;  2HAX A;  3RES A;  1ZQ1 A;  4OB2 B;  2XG8 D;  3JAM E;  3OYC A;  2DD4 A;  4M77 E;  3JCM J;  2XDD A;  2RD1 A;  3F70 A;  5DLO A;  3TCJ A;  2GFA A;  1HXD A;  4ZGE B;  4JLG A;  1WJQ A;  4E7I A;  1KQ2 A;  3RKW A;  3H6Z A;  3A8L B;  4M75 B;  1QP3 A;  3T9N A;  2QEX T;  3CCJ A;  5GAN 3;  5GMK m;  2ZPF B;  3A8G B;  3CBM A;  4M77 G;  4M78 F;  2F69 A;  2JOY A;  1LNX A;  4OGC A;  3OYF A;  3V7C A;  3FJP A;  5LJ3 j;  3L2U A;  1D3B A;  2M16 A;  3CPW S;  3HHT B;  2R57 A;  2R5A A;  4L59 A;  5FU6 B;  1VQ9 A;  2HBP A;  3I55 A;  4QVZ A;  4F7U B;  4MML A;  1KQS S;  4M7D D;  3OS5 A;  1BYM A;  1VQP A;  1VQ6 T;  1O75 A;  3OBW A;  3SWN C;  5LJ5 d;  3JCM h;  3OS1 A;  1WQW A;  4M7A G;  1Q82 C;  3CXC S;  2A3L A;  1LJO A;  2K3Y A;  4C8Q G;  3DKM A;  5CO7 A;  3JCM V;  1M90 C;  4C0Z A;  3EAE A;  4A4E A;  2DXC B;  3QJ6 A;  1W4S A;  2DK3 A;  2EWN A;  2CZ6 B;  3OS2 A;  1GXI E;  1WQ7 A;  2DEQ A;  2PU9 B;  3J80 E;  3OQ5 A;  2LCL A;  3WVE B;  2DTH A;  2O01 E;  4C92 D;  3QSU A;  3CME A;  1YIT T;  3OSV A;  1UGP B;  1FKM A;  2AHJ B;  4HT8 A;  1VQO T;  3OYI A;  5D6Y A;  1JJ2 A;  3G71 A;  1QVF A;  3HBL A;  5FU6 C;  5GAN 8;  3OYK A;  2RI5 A;  3C12 A;  3MO8 A;  1TH7 A;  3HP9 A;  4PJO F;  4QVD A;  2IG0 A;  4PNO A;  3QKJ A;  4MMK A;  5I21 A;  3OY9 A;  1VQ5 A;  3A5Z B;  4M77 A;  1VQL A;  2KY9 A;  3DLL A;  4M7D B;  4BY6 C;  4XU0 A;  1UEB A;  2HNI A;  1VQK A;  1M5Q 1;  4FIB A;  4C5H A;  2GFU A;  5CK9 A;  1Q7Y C;  4O6J A;  2G3R A;  3S3O A;  5IAY A;  3OYM A;  4AKG A;  5D6W A;  4HT9 A;  1NPP A;  2RJC A;  3JRZ A;  4HNU A;  2CZ7 B;  5KCO A;  5LJ3 f;  1Q7Y U;  2L3R A;  3CEY A;  3Q1J A;  3ZEH A;  1IRE B;  5A0D A;  4M7A A;  2QQR A;  2EKO A;  1JBM A;  1I8F A;  5LJ5 f;  5GAN d;  1VQP T;  3JCM e;  4J6Y A;  4Z02 A;  2HQE A;  4ZGD B;  1QVP A;  2EJ9 A;  3TW6 A;  2PUK B;  5CQY A;  1VQN T;  3CCU A;  3FB9 A;  3CCU T;  3L42 A;  3CCR A;  4BI3 A;  4C8Q B;  1UGR B;  4MDW A;  3CCV A;  5J39 A;  3M58 A;  1VIE A;  2E6N A;  2LQ8 A;  3QJY A;  2EQK A;  2M9U A;  3LX7 A;  3CCQ A;  1VQO A;  5GAO m;  5CVI A;  4JS4 A;  4BE2 A;  3V8J A;  3N5B B;  2QDY B;  1P92 A;  1X01 A;  3RMS A;  2LDM A;  4RG2 A;  3OW2 S;  4R56 A;  3NFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...