1H26B

Cdk2/cyclina in complex with an 11-residue recruitment peptide from p53
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 97
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h26B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h26B02
3DDPB 4NSTB 2WMBB 4ROEA 2C6TB 5EFQB 2X1NB 4YOSA 2R7GA 4CFUD 3LQ5B 4EOJB 2C5XB 4CFWB 3BHUB 3F5XB 4FX3B 2G9XB 2JGZB 2UZDB 3BHTB 2WXVB 3POMA 1FVVB 2PK9B 2BPMB 4OGRB 5HBHB 4BCKB 1N4MA 2PHGA 4II5B 2W2HA 5IDNB 4EOPB 1O9KB 4EC8B 1H27B 1UNHD 3TNIB 1AD6A 3O0GD 2WFYB 3MY5B 1H24B 4KRCB 1P5EB 1H28B 3M03A 5IDPB 2W99A 5BNJB 1F5QB 1UNGD 4CFMB 2PMIB 4EOSB 3QHWB 3MI9B 5ACBA 3G33B 1G3NC 2UZEB 3EOCB 4YOOA 4BCIB 2WMAB 1UNLD 4CFNB 4IMYB 4YC3B 2CJMB 1E9HB 4BCOB 2W96A 4F7NB 4BCMB 2IW6B 4ELJA 1JSUB 2UUEB 2WEVB 5LQFB 1PKDB 3TNWB 4CFXB 5ICPB 3QHRB 4KRDB 1O9KA 4EOKB 1VOLA 4BCJB 3BHVB 2F2CA 4RODA 3TNHB 2WIPB 4BCNB 3TN8B 5CYIB 2W9FA 1VINA 1GY3B 4F7JB 2I40B 5FGKB 2B9RA 1TFBA 4TTHA 1H1SB 3RGFB 5LMKB 4BCQD 1BU2A 4UN0A 4EOIB 5CEIB 3BLQB 4F7SB 4EOOB 1D3UB 2WIHB 4BCGB 4BCFB 1OGUB 3K7AM 5HBJB 5L2WB 2UZLB 4BCHB 2BKZB 2EUFA 2IVXA 4F70B 4CFVB 2W9ZA 2C5NB 3BLRB 4G6LB 4CXAB 4CFUB 1OI9B 2IW8B 4EONB 4F6UB 1JSTB 1OL2B 4BCPB 4EOQB 5HBEB 3DOGB 1URCB 2C4GB 5HNBB 2WPAB 1OL1B 2I53A 2QDJA 1W98B 1ZP2A 1C9BA 1H1RB 2WHBB 4ELLA 1H4LD 5I5ZB 4OR5B 4EOLB 3BLHB 3MY1B 1QMZB 4BCND 4YOZA 1H1QB 3EIDB 4EC9B 1OIUB 3EJ1B 5IF1B 1OIYB 1FINB 1AISB 2CCIB 2C5OB 4F7LB 1OKVB 3DDQB 3MIAB 1JOWA 4I3ZB 4ROCA 1KXUA 1JKWA 4BCQB 1GH6B 1H1PB 4Y72B 5HVYB 2CCHB 2PK2A 4BCMD 4F6SB 4CRLB 2IW9B 1H26B 1OKWB 2V22B 1XO2A 1VYWB 5HQ0B 1GUXA 1H25B 4F6WB 2C5VB 4EOMB 4EORB 2UZBB 1GUXB 3H4CA
chains in the Genus database with same CATH superfamily
1C9BA 4BY7X 4ROEA 2C6TB 2X1NB 2QDYB 2R7GA 2C5XB 4CFWB 3BHUB 4JX4A 2JGZB 2UZDB 3PO3S 4BCKB 1N4MA 2PHGA 4II5B 2W2HA 3DL1A 1UGSB 2KMGA 1AD6A 3O0GD 3MY5B 4OB0B 3NDQA 1P5EB 1H28B 3M03A 5IDPB 1F5QB 4EOSB 3QHWB 1G3NC 3QZ9B 2WMAB 4CFNB 4IMYB 4YC3B 4LOCA 4F7NB 1AHJB 2UUEB 2WEVB 1O9KA 1VOLA 4BY1X 4BCJB 2F2CA 1TD6A 4BCNB 3TN8B 1GY3B 4M6VA 4ZGJB 4QSHA 4F7SB 1D3UB 4BCGB 1V29B 2CZ7B 5HBJB 4OB1B 2W9ZA 2C5NB 3BLRB 2IW8B 4F6UB 5HBEB 2QDJA 4BXXX 2DD4B 4OR5B 4EOLB 2QF7A 4Z6YA 1OIYB 4F7LB 1OKVB 3MIAB 1GH6B 1H1PB 4FM4B 3A8MB 3A8OB 2IW9B 1OKWB 1XO2A 4EOQB 4EOMB 3F5XB 4FX3B 2CZ0B 3A8HB 3BHTB 2BPMB 4OGRB 2BS4A 2CZ1B 1O9KB 4EC8B 2KR6A 1UNHD 3TNIB 2QFZA 5BNJB 4CFMB 3B57A 2ZPBB 2UZEB 3EOCB 4YOOA 2QQ8A 2CJMB 2IW6B 2CYZB 3KHIA 3TNWB 4CFXB 4HNUA 1E7PA 3VYHB 5ICPB 3BHVB 2QGSA 2DMEA 2WIPB 3DJBA 2I40B 1IREB 1H1SB 4AKIA 1BU2A 3VKGA 2BS2A 2DPPB 5CEIB 3VYGB 3BLQB 4BCFB 3K7AM 2UZLB 2IVXA 4F70B 3WVDB 4BBSM 4MFEA 3TW6A 3X24B 2ZCFB 4MIMA 3DOGB 1URCB 3QXEB 1OL1B 2DXCB 2I53A 1W98B 1ZP2A 1H1RB 2WHBB 4ELLA 5I5ZB 5DQWA 4EC9B 1QLBA 2ZPFB 3EJ1B 1FINB 3QZ5B 2C5OB 1JKWA 2IN3A 5HVYB 4F6SB 2PK2A 1H26B 2V22B 3X26B 5HQ0B 3VKHA 2AHJB 4F6WB 2C5VB 1GUXB 3H4CA 2WMBB 2ZZDB 3LQ5B 4EOJB 3X25B 3BG9A 2PK9B 4HL4A 1FKMA 2WFYB 2ZPGB 1H24B 3X28B 5LQFB 2W99A 1UNGD 2PMIB 5ACBA 3G33B 3QYHB 3QWLA 4BCIB 1UNLD 1E9HB 2LW4A 3HO8A 3HHTB 3QHRB 3BG5A 3TNHB 1UGQB 4AKGA 4F7JB 1UGPB 4HNVA 2B9RA 1TFBA 4TTHA 3HB9A 3QYBA 4EOOB 1OGUB 4BCHB 4CFVB 4G6LB 2D0QB 4JX5A 4ZGEB 4EONB 1JSTB 2C4GB 2G77A 3GTMS 1H4LD 3BLHB 3MY1B 1QMZB 5DQVA 4YOZA 2ZPIB 3EIDB 1OIUB 5IF1B 3X20B 2PJQA 2ZPHB 3DDQB 1JOWA 4ROCA 1KXUA 4BCQB 4Y72B 1UGRB 4HNTA 4CRLB 4BBRM 4OB2B 1H25B 4EORB 2UZBB 3DDPB 4NSTB 5EFQB 4MFDA 4YOSA 4CFUD 3HZJA 2G9XB 2WXVB 3POMA 1FVVB 3TW7A 5HBHB 3QYEA 5IDNB 2DXBB 4EOPB 4HLQA 1H27B 4JX6A 2CZ6B 4KRCB 3A8LB 3MI9B 4AKHA 3BG3A 4BCOB 2W96A 4BCMB 4ELJA 1JSUB 3DTOA 1PKDB 4KRDB 4EOKB 4AI6A 2ZPEB 4RODA 3QYGB 5CYIB 2W9FA 1VINA 5FGKB 3RGFB 5LMKB 4EOIB 4BCQD 4UN0A 3HBLA 2WIHB 5L2WB 2BKZB 2EUFA 4OB3B 3WVEB 4CXAB 4CFUB 1OI9B 1OL2B 4BCPB 5HNBB 2WPAB 4BCND 1H1QB 2DD5B 2BS3A 1AISB 5EJCA 2CCIB 4I3ZB 2CCHB 4BCMD 2WJ9A 1VYWB 1ENWA 1GUXA 4NC6A 5IHYA 3A8GB 4ZGDB
chains in the Genus database with same CATH topology
3DDPB 4NSTB 2WMBB 4ROEA 2C6TB 5EFQB 2X1NB 4YOSA 2R7GA 4CFUD 3LQ5B 4EOJB 2C5XB 4CFWB 3BHUB 3F5XB 4FX3B 2G9XB 2JGZB 2UZDB 3BHTB 2WXVB 3POMA 1FVVB 2PK9B 2BPMB 4OGRB 5HBHB 4BCKB 1N4MA 2PHGA 4II5B 2W2HA 5IDNB 4EOPB 1O9KB 4EC8B 1H27B 1UNHD 3TNIB 1AD6A 3O0GD 2WFYB 3MY5B 1H24B 4KRCB 1P5EB 1H28B 3M03A 5IDPB 2W99A 5BNJB 1F5QB 1UNGD 4CFMB 2PMIB 4EOSB 3QHWB 3MI9B 5ACBA 3G33B 1G3NC 2UZEB 3EOCB 4YOOA 4BCIB 2WMAB 1UNLD 4CFNB 4IMYB 4YC3B 2CJMB 1E9HB 4BCOB 2W96A 4F7NB 4BCMB 2IW6B 4ELJA 1JSUB 2UUEB 2WEVB 5LQFB 1PKDB 3TNWB 4CFXB 5ICPB 3QHRB 4KRDB 1O9KA 4EOKB 1VOLA 4BCJB 3BHVB 2F2CA 4RODA 3TNHB 2WIPB 4BCNB 3TN8B 5CYIB 2W9FA 1VINA 1GY3B 4F7JB 2I40B 5FGKB 2B9RA 1TFBA 4TTHA 1H1SB 3RGFB 5LMKB 4BCQD 1BU2A 4UN0A 4EOIB 5CEIB 3BLQB 4F7SB 4EOOB 1D3UB 2WIHB 4BCGB 4BCFB 1OGUB 3K7AM 5HBJB 5L2WB 2UZLB 4BCHB 2BKZB 2EUFA 2IVXA 4F70B 4CFVB 2W9ZA 2C5NB 3BLRB 4G6LB 4CXAB 4CFUB 1OI9B 2IW8B 4EONB 4F6UB 1JSTB 1OL2B 4BCPB 4EOQB 5HBEB 3DOGB 1URCB 2C4GB 5HNBB 2WPAB 1OL1B 2I53A 2QDJA 1W98B 1ZP2A 1C9BA 1H1RB 2WHBB 4ELLA 1H4LD 5I5ZB 4OR5B 4EOLB 3BLHB 3MY1B 1QMZB 4BCND 4YOZA 1H1QB 3EIDB 4EC9B 1OIUB 3EJ1B 5IF1B 1OIYB 1FINB 1AISB 2CCIB 2C5OB 4F7LB 1OKVB 3DDQB 3MIAB 1JOWA 4I3ZB 4ROCA 1KXUA 1JKWA 4BCQB 1GH6B 1H1PB 4Y72B 5HVYB 2CCHB 2PK2A 4BCMD 4F6SB 4CRLB 2IW9B 1H26B 1OKWB 2V22B 1XO2A 1VYWB 5HQ0B 1GUXA 1H25B 4F6WB 2C5VB 4EOMB 4EORB 2UZBB 1GUXB 3H4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DDP B;  4NST B;  2WMB B;  4ROE A;  2C6T B;  5EFQ B;  2X1N B;  4YOS A;  2R7G A;  4CFU D;  3LQ5 B;  4EOJ B;  2C5X B;  4CFW B;  3BHU B;  3F5X B;  4FX3 B;  2G9X B;  2JGZ B;  2UZD B;  3BHT B;  2WXV B;  3POM A;  1FVV B;  2PK9 B;  2BPM B;  4OGR B;  5HBH B;  4BCK B;  1N4M A;  2PHG A;  4II5 B;  2W2H A;  5IDN B;  4EOP B;  1O9K B;  4EC8 B;  1H27 B;  1UNH D;  3TNI B;  1AD6 A;  3O0G D;  2WFY B;  3MY5 B;  1H24 B;  4KRC B;  1P5E B;  1H28 B;  3M03 A;  5IDP B;  2W99 A;  5BNJ B;  1F5Q B;  1UNG D;  4CFM B;  2PMI B;  4EOS B;  3QHW B;  3MI9 B;  5ACB A;  3G33 B;  1G3N C;  2UZE B;  3EOC B;  4YOO A;  4BCI B;  2WMA B;  1UNL D;  4CFN B;  4IMY B;  4YC3 B;  2CJM B;  1E9H B;  4BCO B;  2W96 A;  4F7N B;  4BCM B;  2IW6 B;  4ELJ A;  1JSU B;  2UUE B;  2WEV B;  5LQF B;  1PKD B;  3TNW B;  4CFX B;  5ICP B;  3QHR B;  4KRD B;  1O9K A;  4EOK B;  1VOL A;  4BCJ B;  3BHV B;  2F2C A;  4ROD A;  3TNH B;  2WIP B;  4BCN B;  3TN8 B;  5CYI B;  2W9F A;  1VIN A;  1GY3 B;  4F7J B;  2I40 B;  5FGK B;  2B9R A;  1TFB A;  4TTH A;  1H1S B;  3RGF B;  5LMK B;  4BCQ D;  1BU2 A;  4UN0 A;  4EOI B;  5CEI B;  3BLQ B;  4F7S B;  4EOO B;  1D3U B;  2WIH B;  4BCG B;  4BCF B;  1OGU B;  3K7A M;  5HBJ B;  5L2W B;  2UZL B;  4BCH B;  2BKZ B;  2EUF A;  2IVX A;  4F70 B;  4CFV B;  2W9Z A;  2C5N B;  3BLR B;  4G6L B;  4CXA B;  4CFU B;  1OI9 B;  2IW8 B;  4EON B;  4F6U B;  1JST B;  1OL2 B;  4BCP B;  4EOQ B;  5HBE B;  3DOG B;  1URC B;  2C4G B;  5HNB B;  2WPA B;  1OL1 B;  2I53 A;  2QDJ A;  1W98 B;  1ZP2 A;  1C9B A;  1H1R B;  2WHB B;  4ELL A;  1H4L D;  5I5Z B;  4OR5 B;  4EOL B;  3BLH B;  3MY1 B;  1QMZ B;  4BCN D;  4YOZ A;  1H1Q B;  3EID B;  4EC9 B;  1OIU B;  3EJ1 B;  5IF1 B;  1OIY B;  1FIN B;  1AIS B;  2CCI B;  2C5O B;  4F7L B;  1OKV B;  3DDQ B;  3MIA B;  1JOW A;  4I3Z B;  4ROC A;  1KXU A;  1JKW A;  4BCQ B;  1GH6 B;  1H1P B;  4Y72 B;  5HVY B;  2CCH B;  2PK2 A;  4BCM D;  4F6S B;  4CRL B;  2IW9 B;  1H26 B;  1OKW B;  2V22 B;  1XO2 A;  1VYW B;  5HQ0 B;  1GUX A;  1H25 B;  4F6W B;  2C5V B;  4EOM B;  4EOR B;  2UZB B;  1GUX B;  3H4C A; 
#chains in the Genus database with same CATH topology
 1C9B A;  4BY7 X;  4ROE A;  2C6T B;  2X1N B;  2QDY B;  2R7G A;  2C5X B;  4CFW B;  3BHU B;  4JX4 A;  2JGZ B;  2UZD B;  3PO3 S;  4BCK B;  1N4M A;  2PHG A;  4II5 B;  2W2H A;  3DL1 A;  1UGS B;  2KMG A;  1AD6 A;  3O0G D;  3MY5 B;  4OB0 B;  3NDQ A;  1P5E B;  1H28 B;  3M03 A;  5IDP B;  1F5Q B;  4EOS B;  3QHW B;  1G3N C;  3QZ9 B;  2WMA B;  4CFN B;  4IMY B;  4YC3 B;  4LOC A;  4F7N B;  1AHJ B;  2UUE B;  2WEV B;  1O9K A;  1VOL A;  4BY1 X;  4BCJ B;  2F2C A;  1TD6 A;  4BCN B;  3TN8 B;  1GY3 B;  4M6V A;  4ZGJ B;  4QSH A;  4F7S B;  1D3U B;  4BCG B;  1V29 B;  2CZ7 B;  5HBJ B;  4OB1 B;  2W9Z A;  2C5N B;  3BLR B;  2IW8 B;  4F6U B;  5HBE B;  2QDJ A;  4BXX X;  2DD4 B;  4OR5 B;  4EOL B;  2QF7 A;  4Z6Y A;  1OIY B;  4F7L B;  1OKV B;  3MIA B;  1GH6 B;  1H1P B;  4FM4 B;  3A8M B;  3A8O B;  2IW9 B;  1OKW B;  1XO2 A;  4EOQ B;  4EOM B;  3F5X B;  4FX3 B;  2CZ0 B;  3A8H B;  3BHT B;  2BPM B;  4OGR B;  2BS4 A;  2CZ1 B;  1O9K B;  4EC8 B;  2KR6 A;  1UNH D;  3TNI B;  2QFZ A;  5BNJ B;  4CFM B;  3B57 A;  2ZPB B;  2UZE B;  3EOC B;  4YOO A;  2QQ8 A;  2CJM B;  2IW6 B;  2CYZ B;  3KHI A;  3TNW B;  4CFX B;  4HNU A;  1E7P A;  3VYH B;  5ICP B;  3BHV B;  2QGS A;  2DME A;  2WIP B;  3DJB A;  2I40 B;  1IRE B;  1H1S B;  4AKI A;  1BU2 A;  3VKG A;  2BS2 A;  2DPP B;  5CEI B;  3VYG B;  3BLQ B;  4BCF B;  3K7A M;  2UZL B;  2IVX A;  4F70 B;  3WVD B;  4BBS M;  4MFE A;  3TW6 A;  3X24 B;  2ZCF B;  4MIM A;  3DOG B;  1URC B;  3QXE B;  1OL1 B;  2DXC B;  2I53 A;  1W98 B;  1ZP2 A;  1H1R B;  2WHB B;  4ELL A;  5I5Z B;  5DQW A;  4EC9 B;  1QLB A;  2ZPF B;  3EJ1 B;  1FIN B;  3QZ5 B;  2C5O B;  1JKW A;  2IN3 A;  5HVY B;  4F6S B;  2PK2 A;  1H26 B;  2V22 B;  3X26 B;  5HQ0 B;  3VKH A;  2AHJ B;  4F6W B;  2C5V B;  1GUX B;  3H4C A;  2WMB B;  2ZZD B;  3LQ5 B;  4EOJ B;  3X25 B;  3BG9 A;  2PK9 B;  4HL4 A;  1FKM A;  2WFY B;  2ZPG B;  1H24 B;  3X28 B;  5LQF B;  2W99 A;  1UNG D;  2PMI B;  5ACB A;  3G33 B;  3QYH B;  3QWL A;  4BCI B;  1UNL D;  1E9H B;  2LW4 A;  3HO8 A;  3HHT B;  3QHR B;  3BG5 A;  3TNH B;  1UGQ B;  4AKG A;  4F7J B;  1UGP B;  4HNV A;  2B9R A;  1TFB A;  4TTH A;  3HB9 A;  3QYB A;  4EOO B;  1OGU B;  4BCH B;  4CFV B;  4G6L B;  2D0Q B;  4JX5 A;  4ZGE B;  4EON B;  1JST B;  2C4G B;  2G77 A;  3GTM S;  1H4L D;  3BLH B;  3MY1 B;  1QMZ B;  5DQV A;  4YOZ A;  2ZPI B;  3EID B;  1OIU B;  5IF1 B;  3X20 B;  2PJQ A;  2ZPH B;  3DDQ B;  1JOW A;  4ROC A;  1KXU A;  4BCQ B;  4Y72 B;  1UGR B;  4HNT A;  4CRL B;  4BBR M;  4OB2 B;  1H25 B;  4EOR B;  2UZB B;  3DDP B;  4NST B;  5EFQ B;  4MFD A;  4YOS A;  4CFU D;  3HZJ A;  2G9X B;  2WXV B;  3POM A;  1FVV B;  3TW7 A;  5HBH B;  3QYE A;  5IDN B;  2DXB B;  4EOP B;  4HLQ A;  1H27 B;  4JX6 A;  2CZ6 B;  4KRC B;  3A8L B;  3MI9 B;  4AKH A;  3BG3 A;  4BCO B;  2W96 A;  4BCM B;  4ELJ A;  1JSU B;  3DTO A;  1PKD B;  4KRD B;  4EOK B;  4AI6 A;  2ZPE B;  4ROD A;  3QYG B;  5CYI B;  2W9F A;  1VIN A;  5FGK B;  3RGF B;  5LMK B;  4EOI B;  4BCQ D;  4UN0 A;  3HBL A;  2WIH B;  5L2W B;  2BKZ B;  2EUF A;  4OB3 B;  3WVE B;  4CXA B;  4CFU B;  1OI9 B;  1OL2 B;  4BCP B;  5HNB B;  2WPA B;  4BCN D;  1H1Q B;  2DD5 B;  2BS3 A;  1AIS B;  5EJC A;  2CCI B;  4I3Z B;  2CCH B;  4BCM D;  2WJ9 A;  1VYW B;  1ENW A;  1GUX A;  4NC6 A;  5IHY A;  3A8G B;  4ZGD B; 
#chains in the Genus database with same CATH homology
 3DDP B;  4NST B;  2WMB B;  4ROE A;  2C6T B;  5EFQ B;  2X1N B;  4YOS A;  2R7G A;  4CFU D;  3LQ5 B;  4EOJ B;  2C5X B;  4CFW B;  3BHU B;  3F5X B;  4FX3 B;  2G9X B;  2JGZ B;  2UZD B;  3BHT B;  2WXV B;  3POM A;  1FVV B;  2PK9 B;  2BPM B;  4OGR B;  5HBH B;  4BCK B;  1N4M A;  2PHG A;  4II5 B;  2W2H A;  5IDN B;  4EOP B;  1O9K B;  4EC8 B;  1H27 B;  1UNH D;  3TNI B;  1AD6 A;  3O0G D;  2WFY B;  3MY5 B;  1H24 B;  4KRC B;  1P5E B;  1H28 B;  3M03 A;  5IDP B;  2W99 A;  5BNJ B;  1F5Q B;  1UNG D;  4CFM B;  2PMI B;  4EOS B;  3QHW B;  3MI9 B;  5ACB A;  3G33 B;  1G3N C;  2UZE B;  3EOC B;  4YOO A;  4BCI B;  2WMA B;  1UNL D;  4CFN B;  4IMY B;  4YC3 B;  2CJM B;  1E9H B;  4BCO B;  2W96 A;  4F7N B;  4BCM B;  2IW6 B;  4ELJ A;  1JSU B;  2UUE B;  2WEV B;  5LQF B;  1PKD B;  3TNW B;  4CFX B;  5ICP B;  3QHR B;  4KRD B;  1O9K A;  4EOK B;  1VOL A;  4BCJ B;  3BHV B;  2F2C A;  4ROD A;  3TNH B;  2WIP B;  4BCN B;  3TN8 B;  5CYI B;  2W9F A;  1VIN A;  1GY3 B;  4F7J B;  2I40 B;  5FGK B;  2B9R A;  1TFB A;  4TTH A;  1H1S B;  3RGF B;  5LMK B;  4BCQ D;  1BU2 A;  4UN0 A;  4EOI B;  5CEI B;  3BLQ B;  4F7S B;  4EOO B;  1D3U B;  2WIH B;  4BCG B;  4BCF B;  1OGU B;  3K7A M;  5HBJ B;  5L2W B;  2UZL B;  4BCH B;  2BKZ B;  2EUF A;  2IVX A;  4F70 B;  4CFV B;  2W9Z A;  2C5N B;  3BLR B;  4G6L B;  4CXA B;  4CFU B;  1OI9 B;  2IW8 B;  4EON B;  4F6U B;  1JST B;  1OL2 B;  4BCP B;  4EOQ B;  5HBE B;  3DOG B;  1URC B;  2C4G B;  5HNB B;  2WPA B;  1OL1 B;  2I53 A;  2QDJ A;  1W98 B;  1ZP2 A;  1C9B A;  1H1R B;  2WHB B;  4ELL A;  1H4L D;  5I5Z B;  4OR5 B;  4EOL B;  3BLH B;  3MY1 B;  1QMZ B;  4BCN D;  4YOZ A;  1H1Q B;  3EID B;  4EC9 B;  1OIU B;  3EJ1 B;  5IF1 B;  1OIY B;  1FIN B;  1AIS B;  2CCI B;  2C5O B;  4F7L B;  1OKV B;  3DDQ B;  3MIA B;  1JOW A;  4I3Z B;  4ROC A;  1KXU A;  1JKW A;  4BCQ B;  1GH6 B;  1H1P B;  4Y72 B;  5HVY B;  2CCH B;  2PK2 A;  4BCM D;  4F6S B;  4CRL B;  2IW9 B;  1H26 B;  1OKW B;  2V22 B;  1XO2 A;  1VYW B;  5HQ0 B;  1GUX A;  1H25 B;  4F6W B;  2C5V B;  4EOM B;  4EOR B;  2UZB B;  1GUX B;  3H4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...