1GY3B

Pcdk2/cyclin a in complex with mgadp, nitrate and peptide substrate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structural Studies on Phospho-Cdk2/Cyclin a Bound to Nitrate, a Transition State Analogue: Implications for the Protein Kinase Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase substrate
total genus 100
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1gy3B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1gy3B02
5HBJB 2CJMB 3DDPB 4BCFB 2WMBB 4EOSB 4BCMD 2C4GB 3BLQB 1H1QB 4G6LB 4BCOB 1H27B 4OR5B 4BCIB 4EOJB 3K7AM 1P5EB 3BHTB 4EOMB 2WIPB 4F7JB 2WFYB 4KRCB 1TFBA 3O0GD 1JSUB 2W9ZA 2PK9B 2W99A 1F5QB 2R7GA 2F2CA 4UN0A 4CFNB 1FINB 2PHGA 4BCHB 1G3NC 2C5VB 4BCNB 1BU2A 1AISB 3LQ5B 4EC8B 2UUEB 3BHUB 2WMAB 4YOZA 5HBHB 4F6SB 4YOOA 5IDNB 3MI9B 4F7LB 1AD6A 2IW6B 2PK2A 2UZDB 4F70B 5CEIB 4II5B 4I3ZB 3MY5B 4F6UB 2G9XB 1O9KB 4ROCA 2I53A 1XO2A 2IVXA 1O9KA 1VYWB 2X1NB 3TNIB 1OIYB 5IDPB 4BCGB 4CFUD 5I5ZB 1UNLD 4BCKB 3G33B 3BLHB 3DDQB 1UNHD 1GY3B 1ZP2A 2WPAB 5LMKB 2PMIB 1D3UB 1H1SB 1OIUB 2W2HA 2C6TB 1H25B 3DOGB 2IW8B 2QDJA 2BPMB 3M03A 3H4CA 1URCB 5HQ0B 4ELLA 2W9FA 2B9RA 3POMA 4CFWB 2WHBB 1H28B 5ACBA 1C9BA 1OL2B 4YOSA 5BNJB 4EOQB 5IF1B 3QHRB 4KRDB 1OI9B 2W96A 5L2WB 2UZEB 2CCIB 2I40B 4IMYB 5HBEB 4YC3B 5ICPB 1VINA 2WXVB 4BCMB 1OL1B 1H4LD 3TN8B 1W98B 1GUXB 4EOLB 1GUXA 4EONB 2C5XB 4BCQD 4CFUB 5EFQB 4EOIB 4BCJB 4EOKB 4TTHA 2WIHB 1H1RB 2BKZB 4EC9B 4BCPB 4F7SB 2JGZB 4OGRB 5FGKB 3EOCB 3RGFB 2C5NB 1JOWA 3TNWB 4FX3B 1UNGD 4ELJA 4CFVB 5LQFB 1JKWA 4F7NB 4ROEA 5HVYB 1OGUB 3BHVB 4CFXB 1H1PB 4CRLB 5CYIB 4CFMB 1OKWB 1E9HB 2CCHB 2IW9B 2V22B 2WEVB 1H26B 1OKVB 1N4MA 5HNBB 3TNHB 2EUFA 2UZLB 4F6WB 3EJ1B 4RODA 3MY1B 4Y72B 4NSTB 4BCND 4EOOB 1PKDB 1JSTB 1VOLA 3MIAB 1GH6B 1H24B 3EIDB 4EORB 2UZBB 4BCQB 3QHWB 1FVVB 1KXUA 4CXAB 4EOPB 3BLRB 3F5XB 1QMZB 2C5OB
chains in the Genus database with same CATH superfamily
5HBJB 2AHJB 3DDPB 2PJQA 2ZPFB 4EOSB 3A8GB 2ZPEB 4EOJB 3A8OB 3QZ5B 1ENWA 3BHTB 4EOMB 3DJBA 3O0GD 4CFNB 3B57A 4BCHB 1G3NC 2C5VB 4BCNB 2UUEB 2WMAB 4YOZA 5DQVA 5CEIB 4F70B 2QQ8A 1OIYB 4CFUD 5I5ZB 1FKMA 1GY3B 3QXEB 1D3UB 3DOGB 3M03A 5HQ0B 2B9RA 3BG9A 5ACBA 2QDYB 1C9BA 4FM4B 3QHRB 4YC3B 4BCMB 1OL1B 1H4LD 3TN8B 1GUXB 2DXCB 3X25B 4CFUB 5EFQB 4QSHA 3EOCB 4HNUA 2C5NB 3TNWB 4FX3B 4ELJA 4ZGJB 3VYGB 4CFMB 1OKWB 2BS4A 2CCHB 2V22B 2WEVB 2DXBB 5HNBB 4EOOB 2ZPGB 1VOLA 3EIDB 4EORB 4CXAB 4EOPB 2C5OB 4BCFB 4BXXX 3X28B 3BLQB 2WFYB 2QGSA 4MIMA 2DD4B 2PK9B 4AI6A 1F5QB 1FINB 3LQ5B 4EC8B 5HBHB 4I3ZB 4AKIA 1O9KB 3QYEA 2I53A 1XO2A 3HHTB 3TNIB 5IDPB 1UNLD 2QFZA 4OB0B 1ZP2A 5LMKB 4HNTA 2CZ7B 1OIUB 2DPPB 2C6TB 1H25B 3BG3A 3A8HB 1URCB 2IN3A 4ELLA 2W9FA 5BNJB 2G77A 5L2WB 2UZEB 2I40B 2KR6A 1QLBA 3QZ9B 4AKHA 4TTHA 2ZPIB 1H1RB 2BKZB 4NC6A 1UGQB 4CRLB 2ZPHB 3HB9A 4F6WB 1OKVB 2ZPBB 2EUFA 2UZLB 4RODA 3MY1B 3A8MB 3QYBA 1JSTB 2QF7A 1H24B 3QHWB 3F5XB 1QMZB 2CJMB 3X26B 4OR5B 4BCIB 1P5EB 4F7JB 3DL1A 1TFBA 4Z6YA 2CZ0B 2W99A 2R7GA 2F2CA 2PHGA 3KHIA 1AISB 3BHUB 4OB1B 3QYHB 5IDNB 3MI9B 2IW6B 2PK2A 2UZDB 4M6VA 4HNVA 3WVDB 2G9XB 2IVXA 1VYWB 4BCGB 2DD5B 3DDQB 2D0QB 4MFDA 1H1SB 2ZCFB 2W2HA 2IW8B 2QDJA 3TW7A 3POMA 2WHBB 1OL2B 4YOSA 4BBSM 4EOQB 5IHYA 5IF1B 1OI9B 1UGRB 4EOLB 2CZ6B 1GUXA 2C5XB 3BG5A 4BCJB 3VKGA 2ZZDB 5DQWA 1IREB 2KMGA 4EC9B 4BCPB 4F7SB 3VKHA 2JGZB 4OGRB 2LW4A 3RGFB 3X20B 4BBRM 4CFVB 1JKWA 5HVYB 5LQFB 2IW9B 1N4MA 5EJCA 4JX4A 1V29B 3EJ1B 1AHJB 3WVEB 2UZBB 1KXUA 4EONB 3BLRB 4BY1X 2WMBB 4BCMD 3GTMS 4OB3B 2C4GB 1H1QB 4G6LB 4BCOB 1H27B 4LOCA 3QWLA 3K7AM 2WIPB 4KRCB 2BS2A 1JSUB 3HBLA 2W9ZA 4JX5A 4UN0A 2WJ9A 1BU2A 3X24B 4F6SB 3NDQA 4YOOA 4F7LB 1AD6A 4II5B 3MY5B 4F6UB 4ROCA 2X1NB 1O9KA 4BCKB 4BY7X 3HZJA 3G33B 3BLHB 1UNHD 2WPAB 2PMIB 3VYHB 2BPMB 3H4CA 3TW6A 4CFWB 1H28B 4HL4A 4KRDB 2W96A 4MFEA 2CCIB 4IMYB 5HBEB 5ICPB 3HO8A 1VINA 2WXVB 4JX6A 1W98B 2DMEA 2CYZB 4BCQD 1TD6A 4EOIB 4EOKB 2WIHB 3QYGB 5FGKB 1JOWA 1UGSB 1UNGD 4F7NB 4ROEA 1OGUB 3BHVB 4CFXB 1H1PB 5CYIB 3A8LB 2CZ1B 1E7PA 1E9HB 1UGPB 4ZGDB 4ZGEB 1H26B 4OB2B 3TNHB 4Y72B 4AKGA 4NSTB 3PO3S 4BCND 1PKDB 2BS3A 3MIAB 1GH6B 3DTOA 4BCQB 1FVVB 4HLQA
chains in the Genus database with same CATH topology
5HBJB 2CJMB 3DDPB 4BCFB 2WMBB 4EOSB 4BCMD 2C4GB 3BLQB 1H1QB 4G6LB 4BCOB 1H27B 4OR5B 4BCIB 4EOJB 3K7AM 1P5EB 3BHTB 4EOMB 2WIPB 4F7JB 2WFYB 4KRCB 1TFBA 3O0GD 1JSUB 2W9ZA 2PK9B 2W99A 1F5QB 2R7GA 2F2CA 4UN0A 4CFNB 1FINB 2PHGA 4BCHB 1G3NC 2C5VB 4BCNB 1BU2A 1AISB 3LQ5B 4EC8B 2UUEB 3BHUB 2WMAB 4YOZA 5HBHB 4F6SB 4YOOA 5IDNB 3MI9B 4F7LB 1AD6A 2IW6B 2PK2A 2UZDB 4F70B 5CEIB 4II5B 4I3ZB 3MY5B 4F6UB 2G9XB 1O9KB 4ROCA 2I53A 1XO2A 2IVXA 1O9KA 1VYWB 2X1NB 3TNIB 1OIYB 5IDPB 4BCGB 4CFUD 5I5ZB 1UNLD 4BCKB 3G33B 3BLHB 3DDQB 1UNHD 1GY3B 1ZP2A 2WPAB 5LMKB 2PMIB 1D3UB 1H1SB 1OIUB 2W2HA 2C6TB 1H25B 3DOGB 2IW8B 2QDJA 2BPMB 3M03A 3H4CA 1URCB 5HQ0B 4ELLA 2W9FA 2B9RA 3POMA 4CFWB 2WHBB 1H28B 5ACBA 1C9BA 1OL2B 4YOSA 5BNJB 4EOQB 5IF1B 3QHRB 4KRDB 1OI9B 2W96A 5L2WB 2UZEB 2CCIB 2I40B 4IMYB 5HBEB 4YC3B 5ICPB 1VINA 2WXVB 4BCMB 1OL1B 1H4LD 3TN8B 1W98B 1GUXB 4EOLB 1GUXA 4EONB 2C5XB 4BCQD 4CFUB 5EFQB 4EOIB 4BCJB 4EOKB 4TTHA 2WIHB 1H1RB 2BKZB 4EC9B 4BCPB 4F7SB 2JGZB 4OGRB 5FGKB 3EOCB 3RGFB 2C5NB 1JOWA 3TNWB 4FX3B 1UNGD 4ELJA 4CFVB 5LQFB 1JKWA 4F7NB 4ROEA 5HVYB 1OGUB 3BHVB 4CFXB 1H1PB 4CRLB 5CYIB 4CFMB 1OKWB 1E9HB 2CCHB 2IW9B 2V22B 2WEVB 1H26B 1OKVB 1N4MA 5HNBB 3TNHB 2EUFA 2UZLB 4F6WB 3EJ1B 4RODA 3MY1B 4Y72B 4NSTB 4BCND 4EOOB 1PKDB 1JSTB 1VOLA 3MIAB 1GH6B 1H24B 3EIDB 4EORB 2UZBB 4BCQB 3QHWB 1FVVB 1KXUA 4CXAB 4EOPB 3BLRB 3F5XB 1QMZB 2C5OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HBJ B;  2CJM B;  3DDP B;  4BCF B;  2WMB B;  4EOS B;  4BCM D;  2C4G B;  3BLQ B;  1H1Q B;  4G6L B;  4BCO B;  1H27 B;  4OR5 B;  4BCI B;  4EOJ B;  3K7A M;  1P5E B;  3BHT B;  4EOM B;  2WIP B;  4F7J B;  2WFY B;  4KRC B;  1TFB A;  3O0G D;  1JSU B;  2W9Z A;  2PK9 B;  2W99 A;  1F5Q B;  2R7G A;  2F2C A;  4UN0 A;  4CFN B;  1FIN B;  2PHG A;  4BCH B;  1G3N C;  2C5V B;  4BCN B;  1BU2 A;  1AIS B;  3LQ5 B;  4EC8 B;  2UUE B;  3BHU B;  2WMA B;  4YOZ A;  5HBH B;  4F6S B;  4YOO A;  5IDN B;  3MI9 B;  4F7L B;  1AD6 A;  2IW6 B;  2PK2 A;  2UZD B;  4F70 B;  5CEI B;  4II5 B;  4I3Z B;  3MY5 B;  4F6U B;  2G9X B;  1O9K B;  4ROC A;  2I53 A;  1XO2 A;  2IVX A;  1O9K A;  1VYW B;  2X1N B;  3TNI B;  1OIY B;  5IDP B;  4BCG B;  4CFU D;  5I5Z B;  1UNL D;  4BCK B;  3G33 B;  3BLH B;  3DDQ B;  1UNH D;  1GY3 B;  1ZP2 A;  2WPA B;  5LMK B;  2PMI B;  1D3U B;  1H1S B;  1OIU B;  2W2H A;  2C6T B;  1H25 B;  3DOG B;  2IW8 B;  2QDJ A;  2BPM B;  3M03 A;  3H4C A;  1URC B;  5HQ0 B;  4ELL A;  2W9F A;  2B9R A;  3POM A;  4CFW B;  2WHB B;  1H28 B;  5ACB A;  1C9B A;  1OL2 B;  4YOS A;  5BNJ B;  4EOQ B;  5IF1 B;  3QHR B;  4KRD B;  1OI9 B;  2W96 A;  5L2W B;  2UZE B;  2CCI B;  2I40 B;  4IMY B;  5HBE B;  4YC3 B;  5ICP B;  1VIN A;  2WXV B;  4BCM B;  1OL1 B;  1H4L D;  3TN8 B;  1W98 B;  1GUX B;  4EOL B;  1GUX A;  4EON B;  2C5X B;  4BCQ D;  4CFU B;  5EFQ B;  4EOI B;  4BCJ B;  4EOK B;  4TTH A;  2WIH B;  1H1R B;  2BKZ B;  4EC9 B;  4BCP B;  4F7S B;  2JGZ B;  4OGR B;  5FGK B;  3EOC B;  3RGF B;  2C5N B;  1JOW A;  3TNW B;  4FX3 B;  1UNG D;  4ELJ A;  4CFV B;  5LQF B;  1JKW A;  4F7N B;  4ROE A;  5HVY B;  1OGU B;  3BHV B;  4CFX B;  1H1P B;  4CRL B;  5CYI B;  4CFM B;  1OKW B;  1E9H B;  2CCH B;  2IW9 B;  2V22 B;  2WEV B;  1H26 B;  1OKV B;  1N4M A;  5HNB B;  3TNH B;  2EUF A;  2UZL B;  4F6W B;  3EJ1 B;  4ROD A;  3MY1 B;  4Y72 B;  4NST B;  4BCN D;  4EOO B;  1PKD B;  1JST B;  1VOL A;  3MIA B;  1GH6 B;  1H24 B;  3EID B;  4EOR B;  2UZB B;  4BCQ B;  3QHW B;  1FVV B;  1KXU A;  4CXA B;  4EOP B;  3BLR B;  3F5X B;  1QMZ B;  2C5O B; 
#chains in the Genus database with same CATH topology
 5HBJ B;  2AHJ B;  3DDP B;  2PJQ A;  2ZPF B;  4EOS B;  3A8G B;  2ZPE B;  4EOJ B;  3A8O B;  3QZ5 B;  1ENW A;  3BHT B;  4EOM B;  3DJB A;  3O0G D;  4CFN B;  3B57 A;  4BCH B;  1G3N C;  2C5V B;  4BCN B;  2UUE B;  2WMA B;  4YOZ A;  5DQV A;  5CEI B;  4F70 B;  2QQ8 A;  1OIY B;  4CFU D;  5I5Z B;  1FKM A;  1GY3 B;  3QXE B;  1D3U B;  3DOG B;  3M03 A;  5HQ0 B;  2B9R A;  3BG9 A;  5ACB A;  2QDY B;  1C9B A;  4FM4 B;  3QHR B;  4YC3 B;  4BCM B;  1OL1 B;  1H4L D;  3TN8 B;  1GUX B;  2DXC B;  3X25 B;  4CFU B;  5EFQ B;  4QSH A;  3EOC B;  4HNU A;  2C5N B;  3TNW B;  4FX3 B;  4ELJ A;  4ZGJ B;  3VYG B;  4CFM B;  1OKW B;  2BS4 A;  2CCH B;  2V22 B;  2WEV B;  2DXB B;  5HNB B;  4EOO B;  2ZPG B;  1VOL A;  3EID B;  4EOR B;  4CXA B;  4EOP B;  2C5O B;  4BCF B;  4BXX X;  3X28 B;  3BLQ B;  2WFY B;  2QGS A;  4MIM A;  2DD4 B;  2PK9 B;  4AI6 A;  1F5Q B;  1FIN B;  3LQ5 B;  4EC8 B;  5HBH B;  4I3Z B;  4AKI A;  1O9K B;  3QYE A;  2I53 A;  1XO2 A;  3HHT B;  3TNI B;  5IDP B;  1UNL D;  2QFZ A;  4OB0 B;  1ZP2 A;  5LMK B;  4HNT A;  2CZ7 B;  1OIU B;  2DPP B;  2C6T B;  1H25 B;  3BG3 A;  3A8H B;  1URC B;  2IN3 A;  4ELL A;  2W9F A;  5BNJ B;  2G77 A;  5L2W B;  2UZE B;  2I40 B;  2KR6 A;  1QLB A;  3QZ9 B;  4AKH A;  4TTH A;  2ZPI B;  1H1R B;  2BKZ B;  4NC6 A;  1UGQ B;  4CRL B;  2ZPH B;  3HB9 A;  4F6W B;  1OKV B;  2ZPB B;  2EUF A;  2UZL B;  4ROD A;  3MY1 B;  3A8M B;  3QYB A;  1JST B;  2QF7 A;  1H24 B;  3QHW B;  3F5X B;  1QMZ B;  2CJM B;  3X26 B;  4OR5 B;  4BCI B;  1P5E B;  4F7J B;  3DL1 A;  1TFB A;  4Z6Y A;  2CZ0 B;  2W99 A;  2R7G A;  2F2C A;  2PHG A;  3KHI A;  1AIS B;  3BHU B;  4OB1 B;  3QYH B;  5IDN B;  3MI9 B;  2IW6 B;  2PK2 A;  2UZD B;  4M6V A;  4HNV A;  3WVD B;  2G9X B;  2IVX A;  1VYW B;  4BCG B;  2DD5 B;  3DDQ B;  2D0Q B;  4MFD A;  1H1S B;  2ZCF B;  2W2H A;  2IW8 B;  2QDJ A;  3TW7 A;  3POM A;  2WHB B;  1OL2 B;  4YOS A;  4BBS M;  4EOQ B;  5IHY A;  5IF1 B;  1OI9 B;  1UGR B;  4EOL B;  2CZ6 B;  1GUX A;  2C5X B;  3BG5 A;  4BCJ B;  3VKG A;  2ZZD B;  5DQW A;  1IRE B;  2KMG A;  4EC9 B;  4BCP B;  4F7S B;  3VKH A;  2JGZ B;  4OGR B;  2LW4 A;  3RGF B;  3X20 B;  4BBR M;  4CFV B;  1JKW A;  5HVY B;  5LQF B;  2IW9 B;  1N4M A;  5EJC A;  4JX4 A;  1V29 B;  3EJ1 B;  1AHJ B;  3WVE B;  2UZB B;  1KXU A;  4EON B;  3BLR B;  4BY1 X;  2WMB B;  4BCM D;  3GTM S;  4OB3 B;  2C4G B;  1H1Q B;  4G6L B;  4BCO B;  1H27 B;  4LOC A;  3QWL A;  3K7A M;  2WIP B;  4KRC B;  2BS2 A;  1JSU B;  3HBL A;  2W9Z A;  4JX5 A;  4UN0 A;  2WJ9 A;  1BU2 A;  3X24 B;  4F6S B;  3NDQ A;  4YOO A;  4F7L B;  1AD6 A;  4II5 B;  3MY5 B;  4F6U B;  4ROC A;  2X1N B;  1O9K A;  4BCK B;  4BY7 X;  3HZJ A;  3G33 B;  3BLH B;  1UNH D;  2WPA B;  2PMI B;  3VYH B;  2BPM B;  3H4C A;  3TW6 A;  4CFW B;  1H28 B;  4HL4 A;  4KRD B;  2W96 A;  4MFE A;  2CCI B;  4IMY B;  5HBE B;  5ICP B;  3HO8 A;  1VIN A;  2WXV B;  4JX6 A;  1W98 B;  2DME A;  2CYZ B;  4BCQ D;  1TD6 A;  4EOI B;  4EOK B;  2WIH B;  3QYG B;  5FGK B;  1JOW A;  1UGS B;  1UNG D;  4F7N B;  4ROE A;  1OGU B;  3BHV B;  4CFX B;  1H1P B;  5CYI B;  3A8L B;  2CZ1 B;  1E7P A;  1E9H B;  1UGP B;  4ZGD B;  4ZGE B;  1H26 B;  4OB2 B;  3TNH B;  4Y72 B;  4AKG A;  4NST B;  3PO3 S;  4BCN D;  1PKD B;  2BS3 A;  3MIA B;  1GH6 B;  3DTO A;  4BCQ B;  1FVV B;  4HLQ A; 
#chains in the Genus database with same CATH homology
 5HBJ B;  2CJM B;  3DDP B;  4BCF B;  2WMB B;  4EOS B;  4BCM D;  2C4G B;  3BLQ B;  1H1Q B;  4G6L B;  4BCO B;  1H27 B;  4OR5 B;  4BCI B;  4EOJ B;  3K7A M;  1P5E B;  3BHT B;  4EOM B;  2WIP B;  4F7J B;  2WFY B;  4KRC B;  1TFB A;  3O0G D;  1JSU B;  2W9Z A;  2PK9 B;  2W99 A;  1F5Q B;  2R7G A;  2F2C A;  4UN0 A;  4CFN B;  1FIN B;  2PHG A;  4BCH B;  1G3N C;  2C5V B;  4BCN B;  1BU2 A;  1AIS B;  3LQ5 B;  4EC8 B;  2UUE B;  3BHU B;  2WMA B;  4YOZ A;  5HBH B;  4F6S B;  4YOO A;  5IDN B;  3MI9 B;  4F7L B;  1AD6 A;  2IW6 B;  2PK2 A;  2UZD B;  4F70 B;  5CEI B;  4II5 B;  4I3Z B;  3MY5 B;  4F6U B;  2G9X B;  1O9K B;  4ROC A;  2I53 A;  1XO2 A;  2IVX A;  1O9K A;  1VYW B;  2X1N B;  3TNI B;  1OIY B;  5IDP B;  4BCG B;  4CFU D;  5I5Z B;  1UNL D;  4BCK B;  3G33 B;  3BLH B;  3DDQ B;  1UNH D;  1GY3 B;  1ZP2 A;  2WPA B;  5LMK B;  2PMI B;  1D3U B;  1H1S B;  1OIU B;  2W2H A;  2C6T B;  1H25 B;  3DOG B;  2IW8 B;  2QDJ A;  2BPM B;  3M03 A;  3H4C A;  1URC B;  5HQ0 B;  4ELL A;  2W9F A;  2B9R A;  3POM A;  4CFW B;  2WHB B;  1H28 B;  5ACB A;  1C9B A;  1OL2 B;  4YOS A;  5BNJ B;  4EOQ B;  5IF1 B;  3QHR B;  4KRD B;  1OI9 B;  2W96 A;  5L2W B;  2UZE B;  2CCI B;  2I40 B;  4IMY B;  5HBE B;  4YC3 B;  5ICP B;  1VIN A;  2WXV B;  4BCM B;  1OL1 B;  1H4L D;  3TN8 B;  1W98 B;  1GUX B;  4EOL B;  1GUX A;  4EON B;  2C5X B;  4BCQ D;  4CFU B;  5EFQ B;  4EOI B;  4BCJ B;  4EOK B;  4TTH A;  2WIH B;  1H1R B;  2BKZ B;  4EC9 B;  4BCP B;  4F7S B;  2JGZ B;  4OGR B;  5FGK B;  3EOC B;  3RGF B;  2C5N B;  1JOW A;  3TNW B;  4FX3 B;  1UNG D;  4ELJ A;  4CFV B;  5LQF B;  1JKW A;  4F7N B;  4ROE A;  5HVY B;  1OGU B;  3BHV B;  4CFX B;  1H1P B;  4CRL B;  5CYI B;  4CFM B;  1OKW B;  1E9H B;  2CCH B;  2IW9 B;  2V22 B;  2WEV B;  1H26 B;  1OKV B;  1N4M A;  5HNB B;  3TNH B;  2EUF A;  2UZL B;  4F6W B;  3EJ1 B;  4ROD A;  3MY1 B;  4Y72 B;  4NST B;  4BCN D;  4EOO B;  1PKD B;  1JST B;  1VOL A;  3MIA B;  1GH6 B;  1H24 B;  3EID B;  4EOR B;  2UZB B;  4BCQ B;  3QHW B;  1FVV B;  1KXU A;  4CXA B;  4EOP B;  3BLR B;  3F5X B;  1QMZ B;  2C5O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...