1GY3B

Pcdk2/cyclin a in complex with mgadp, nitrate and peptide substrate
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase substrate
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Structural Studies on Phospho-Cdk2/Cyclin a Bound to Nitrate, a Transition State Analogue: Implications for the Protein Kinase Mechanism
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1gy3B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1gy3B02
1OKVB 3EOCB 2IW9B 4BCPB 1W98B 3LQ5B 4G6LB 5EFQB 4BCIB 4OR5B 1KXUA 5HBHB 1D3UB 3K7AM 1H4LD 1OKWB 4EOSB 5BNJB 2QDJA 1OL1B 2IW8B 2C5VB 5CEIB 4EOJB 4F7LB 4FX3B 3BHVB 4NSTB 1JOWA 5HVYB 2C6TB 2WMBB 2B9RA 4EOMB 3F5XB 5LQFB 2WIHB 1FINB 1XO2A 4CFXB 2W9ZA 1UNLD 2UZEB 3QHWB 5HNBB 4ROCA 4EOLB 1AISB 4Y72B 1H1RB 2PK9B 2PHGA 1GUXB 1E9HB 2BPMB 1BU2A 4CFMB 2CCHB 4OGRB 4EC8B 4BCOB 1H1SB 2BKZB 2R7GA 1JSUB 1TFBA 1JKWA 1VYWB 1GH6B 2C5NB 2WXVB 4KRCB 2C5OB 5IDPB 4BCQB 2X1NB 4BCQD 2WMAB 3MY1B 1PKDB 4F6WB 1ZP2A 2CCIB 4ROEA 2WPAB 2WIPB 4EC9B 2IVXA 3BHTB 5IDNB 1UNHD 4BCNB 1VINA 4EOKB 1F5QB 2UUEB 1OGUB 2C5XB 4EONB 2PK2A 2UZDB 2WFYB 5HBEB 4YOSA 4RODA 2EUFA 5HQ0B 2V22B 3DOGB 4CRLB 4F7SB 1AD6A 1H26B 4EORB 5CYIB 1G3NC 1H25B 2CJMB 3EJ1B 3BHUB 1QMZB 2W99A 4UN0A 1H27B 3BLQB 3M03A 1URCB 4I3ZB 4BCMD 3MY5B 1P5EB 4BCMB 5LMKB 4BCGB 4ELLA 1VOLA 2W9FA 1H1PB 1FVVB 4BCHB 1N4MA 3MI9B 4CFUD 3O0GD 4CFUB 4KRDB 3RGFB 4F6UB 5HBJB 4F6SB 4CFVB 4BCND 1OL2B 1O9KA 1H28B 4YC3B 5FGKB 2I53A 2JGZB 3POMA 4CFWB 4CXAB 1O9KB 2I40B 4YOZA 4EOPB 2W2HA 5L2WB 1OI9B 2UZLB 3TNWB 1GY3B 4F70B 2WEVB 3DDQB 5ACBA 1H24B 2UZBB 4ELJA 4BCJB 4EOQB 3EIDB 3TNHB 3MIAB 4EOOB 4F7JB 2PMIB 5I5ZB 4IMYB 4YOOA 4BCKB 2G9XB 3G33B 5ICPB 4F7NB 4II5B 1H1QB 3H4CA 2C4GB 1C9BA 1OIYB 4BCFB 2IW6B 3BLHB 2WHBB 4TTHA 1UNGD 3DDPB 1OIUB 3BLRB 3TNIB 5IF1B 3TN8B 1GUXA 4CFNB 1JSTB 4EOIB 2W96A 2F2CA 3QHRB
chains in the Genus database with same CATH superfamily
3EOCB 2KR6A 4BCPB 3HZJA 3LQ5B 1E7PA 3QYBA 5DQWA 4BCIB 1KXUA 2QDJA 2QF7A 5CEIB 3BHVB 4AKIA 1JOWA 3F5XB 2ZPFB 4ROCA 2W9ZA 2ZZDB 5HNBB 3X28B 3B57A 1E9HB 1BU2A 1AHJB 2CZ0B 4CFMB 1TFBA 1JKWA 4ZGJB 1PKDB 4ZGDB 2CCIB 2WIPB 3A8HB 4EOKB 1VINA 3WVDB 2C5XB 2CZ7B 4BBRM 4RODA 3PO3S 2EUFA 2V22B 5IHYA 4EORB 1UGRB 3EJ1B 4UN0A 4BCGB 1VOLA 1H1PB 4BCHB 1N4MA 5HBJB 4F6SB 4BCND 2I53A 3POMA 1O9KB 4AKGA 5L2WB 1OI9B 3QWLA 3A8GB 4F70B 2WEVB 4FM4B 4Z6YA 4IMYB 1H1QB 1C9BA 3BLHB 2DD5B 4JX4A 1OIUB 3BLRB 5IF1B 3TN8B 1TD6A 4EOIB 4HLQA 1OKVB 4OB0B 2IW9B 1W98B 3BG5A 5EFQB 5HBHB 3K7AM 3HHTB 5BNJB 1OL1B 3QYHB 4FX3B 4NSTB 2C6TB 4JX6A 2WMBB 2LW4A 2WIHB 1UNLD 3QHWB 4EOLB 3DJBA 4LOCA 4OGRB 4EC8B 5EJCA 1H1SB 2ZPHB 1VYWB 2C5NB 2X1NB 2WMAB 3MY1B 4OB3B 4F6WB 3A8LB 3WVEB 3BG9A 3X25B 3BHTB 4HNVA 2UUEB 3VYGB 2UZDB 2CYZB 4HL4A 3DOGB 4CRLB 5CYIB 4NC6A 1G3NC 2CJMB 2ZPGB 1QMZB 3M03A 4I3ZB 1URCB 1QLBA 1P5EB 3TW6A 3O0GD 4KRDB 3RGFB 2CZ6B 2G77A 5HBEB 5FGKB 4EOPB 2I40B 2W2HA 3TNWB 1GY3B 3DDQB 5ACBA 4ELJA 4BCJB 3MIAB 3G33B 2DXBB 5ICPB 4II5B 3H4CA 1OIYB 1UGPB 4BBSM 4CFNB 4QSHA 1IREB 2BS3A 3QYGB 4G6LB 4MFDA 4BY7X 3KHIA 3VYHB 1H4LD 4EOSB 3QXEB 2IW8B 4EOJB 4F7LB 4HNTA 2B9RA 5LQFB 1XO2A 4CFXB 2UZEB 4Y72B 2PK9B 2BPMB 2CCHB 2D0QB 4BCOB 1V29B 2BKZB 2R7GA 3VKHA 2QQ8A 4KRCB 2WXVB 5IDPB 2C5OB 4BCQB 4AI6A 4EC9B 5IDNB 4BXXX 2QGSA 1UNHD 4BCNB 1OGUB 3TW7A 2WFYB 2IN3A 2KMGA 3BG3A 4F7SB 3HB9A 2ZPEB 2W99A 3X26B 3BLQB 2AHJB 4BCMB 5LMKB 2W9FA 2CZ1B 1FVVB 4CFUB 3MI9B 4CFVB 2WJ9A 3NDQA 2ZCFB 1O9KA 1H28B 4CXAB 3QZ5B 3HO8A 4YOZA 2UZLB 5DQVA 1H24B 4EOOB 4F7JB 2PMIB 5I5ZB 2G9XB 4F7NB 2QDYB 4BCFB 2WHBB 3DDPB 3A8OB 4MIMA 2BS4A 3VKGA 1JSTB 2DPPB 2F2CA 2ZPBB 3HBLA 3QYEA 4OR5B 2BS2A 1D3UB 1OKWB 2C5VB 5HVYB 3A8MB 4EOMB 2QFZA 4M6VA 1FINB 3X24B 1AISB 3GTMS 1H1RB 2PHGA 1GUXB 4ZGEB 4OB2B 1FKMA 2ZPIB 1JSUB 1GH6B 4BCQD 1ZP2A 4ROEA 2WPAB 3DTOA 2IVXA 4OB1B 1F5QB 4EONB 1ENWA 2PK2A 4JX5A 4MFEA 4YOSA 1UGSB 5HQ0B 1AD6A 1H26B 1UGQB 1H25B 2DXCB 3BHUB 1H27B 2DD4B 4BCMD 3MY5B 4ELLA 4CFUD 4F6UB 2DMEA 3QZ9B 1OL2B 4YC3B 2JGZB 4CFWB 2UZBB 3X20B 4EOQB 3EIDB 3TNHB 4BY1X 4YOOA 4BCKB 4AKHA 4HNUA 2C4GB 2IW6B 4TTHA 1UNGD 3DL1A 3TNIB 1GUXA 2PJQA 2W96A 3QHRB
chains in the Genus database with same CATH topology
1OKVB 3EOCB 2IW9B 4BCPB 1W98B 3LQ5B 4G6LB 5EFQB 4BCIB 4OR5B 1KXUA 5HBHB 1D3UB 3K7AM 1H4LD 1OKWB 4EOSB 5BNJB 2QDJA 1OL1B 2IW8B 2C5VB 5CEIB 4EOJB 4F7LB 4FX3B 3BHVB 4NSTB 1JOWA 5HVYB 2C6TB 2WMBB 2B9RA 4EOMB 3F5XB 5LQFB 2WIHB 1FINB 1XO2A 4CFXB 2W9ZA 1UNLD 2UZEB 3QHWB 5HNBB 4ROCA 4EOLB 1AISB 4Y72B 1H1RB 2PK9B 2PHGA 1GUXB 1E9HB 2BPMB 1BU2A 4CFMB 2CCHB 4OGRB 4EC8B 4BCOB 1H1SB 2BKZB 2R7GA 1JSUB 1TFBA 1JKWA 1VYWB 1GH6B 2C5NB 2WXVB 4KRCB 2C5OB 5IDPB 4BCQB 2X1NB 4BCQD 2WMAB 3MY1B 1PKDB 4F6WB 1ZP2A 2CCIB 4ROEA 2WPAB 2WIPB 4EC9B 2IVXA 3BHTB 5IDNB 1UNHD 4BCNB 1VINA 4EOKB 1F5QB 2UUEB 1OGUB 2C5XB 4EONB 2PK2A 2UZDB 2WFYB 5HBEB 4YOSA 4RODA 2EUFA 5HQ0B 2V22B 3DOGB 4CRLB 4F7SB 1AD6A 1H26B 4EORB 5CYIB 1G3NC 1H25B 2CJMB 3EJ1B 3BHUB 1QMZB 2W99A 4UN0A 1H27B 3BLQB 3M03A 1URCB 4I3ZB 4BCMD 3MY5B 1P5EB 4BCMB 5LMKB 4BCGB 4ELLA 1VOLA 2W9FA 1H1PB 1FVVB 4BCHB 1N4MA 3MI9B 4CFUD 3O0GD 4CFUB 4KRDB 3RGFB 4F6UB 5HBJB 4F6SB 4CFVB 4BCND 1OL2B 1O9KA 1H28B 4YC3B 5FGKB 2I53A 2JGZB 3POMA 4CFWB 4CXAB 1O9KB 2I40B 4YOZA 4EOPB 2W2HA 5L2WB 1OI9B 2UZLB 3TNWB 1GY3B 4F70B 2WEVB 3DDQB 5ACBA 1H24B 2UZBB 4ELJA 4BCJB 4EOQB 3EIDB 3TNHB 3MIAB 4EOOB 4F7JB 2PMIB 5I5ZB 4IMYB 4YOOA 4BCKB 2G9XB 3G33B 5ICPB 4F7NB 4II5B 1H1QB 3H4CA 2C4GB 1C9BA 1OIYB 4BCFB 2IW6B 3BLHB 2WHBB 4TTHA 1UNGD 3DDPB 1OIUB 3BLRB 3TNIB 5IF1B 3TN8B 1GUXA 4CFNB 1JSTB 4EOIB 2W96A 2F2CA 3QHRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OKV B;  3EOC B;  2IW9 B;  4BCP B;  1W98 B;  3LQ5 B;  4G6L B;  5EFQ B;  4BCI B;  4OR5 B;  1KXU A;  5HBH B;  1D3U B;  3K7A M;  1H4L D;  1OKW B;  4EOS B;  5BNJ B;  2QDJ A;  1OL1 B;  2IW8 B;  2C5V B;  5CEI B;  4EOJ B;  4F7L B;  4FX3 B;  3BHV B;  4NST B;  1JOW A;  5HVY B;  2C6T B;  2WMB B;  2B9R A;  4EOM B;  3F5X B;  5LQF B;  2WIH B;  1FIN B;  1XO2 A;  4CFX B;  2W9Z A;  1UNL D;  2UZE B;  3QHW B;  5HNB B;  4ROC A;  4EOL B;  1AIS B;  4Y72 B;  1H1R B;  2PK9 B;  2PHG A;  1GUX B;  1E9H B;  2BPM B;  1BU2 A;  4CFM B;  2CCH B;  4OGR B;  4EC8 B;  4BCO B;  1H1S B;  2BKZ B;  2R7G A;  1JSU B;  1TFB A;  1JKW A;  1VYW B;  1GH6 B;  2C5N B;  2WXV B;  4KRC B;  2C5O B;  5IDP B;  4BCQ B;  2X1N B;  4BCQ D;  2WMA B;  3MY1 B;  1PKD B;  4F6W B;  1ZP2 A;  2CCI B;  4ROE A;  2WPA B;  2WIP B;  4EC9 B;  2IVX A;  3BHT B;  5IDN B;  1UNH D;  4BCN B;  1VIN A;  4EOK B;  1F5Q B;  2UUE B;  1OGU B;  2C5X B;  4EON B;  2PK2 A;  2UZD B;  2WFY B;  5HBE B;  4YOS A;  4ROD A;  2EUF A;  5HQ0 B;  2V22 B;  3DOG B;  4CRL B;  4F7S B;  1AD6 A;  1H26 B;  4EOR B;  5CYI B;  1G3N C;  1H25 B;  2CJM B;  3EJ1 B;  3BHU B;  1QMZ B;  2W99 A;  4UN0 A;  1H27 B;  3BLQ B;  3M03 A;  1URC B;  4I3Z B;  4BCM D;  3MY5 B;  1P5E B;  4BCM B;  5LMK B;  4BCG B;  4ELL A;  1VOL A;  2W9F A;  1H1P B;  1FVV B;  4BCH B;  1N4M A;  3MI9 B;  4CFU D;  3O0G D;  4CFU B;  4KRD B;  3RGF B;  4F6U B;  5HBJ B;  4F6S B;  4CFV B;  4BCN D;  1OL2 B;  1O9K A;  1H28 B;  4YC3 B;  5FGK B;  2I53 A;  2JGZ B;  3POM A;  4CFW B;  4CXA B;  1O9K B;  2I40 B;  4YOZ A;  4EOP B;  2W2H A;  5L2W B;  1OI9 B;  2UZL B;  3TNW B;  1GY3 B;  4F70 B;  2WEV B;  3DDQ B;  5ACB A;  1H24 B;  2UZB B;  4ELJ A;  4BCJ B;  4EOQ B;  3EID B;  3TNH B;  3MIA B;  4EOO B;  4F7J B;  2PMI B;  5I5Z B;  4IMY B;  4YOO A;  4BCK B;  2G9X B;  3G33 B;  5ICP B;  4F7N B;  4II5 B;  1H1Q B;  3H4C A;  2C4G B;  1C9B A;  1OIY B;  4BCF B;  2IW6 B;  3BLH B;  2WHB B;  4TTH A;  1UNG D;  3DDP B;  1OIU B;  3BLR B;  3TNI B;  5IF1 B;  3TN8 B;  1GUX A;  4CFN B;  1JST B;  4EOI B;  2W96 A;  2F2C A;  3QHR B; 
#chains in the Genus database with same CATH topology
 3EOC B;  2KR6 A;  4BCP B;  3HZJ A;  3LQ5 B;  1E7P A;  3QYB A;  5DQW A;  4BCI B;  1KXU A;  2QDJ A;  2QF7 A;  5CEI B;  3BHV B;  4AKI A;  1JOW A;  3F5X B;  2ZPF B;  4ROC A;  2W9Z A;  2ZZD B;  5HNB B;  3X28 B;  3B57 A;  1E9H B;  1BU2 A;  1AHJ B;  2CZ0 B;  4CFM B;  1TFB A;  1JKW A;  4ZGJ B;  1PKD B;  4ZGD B;  2CCI B;  2WIP B;  3A8H B;  4EOK B;  1VIN A;  3WVD B;  2C5X B;  2CZ7 B;  4BBR M;  4ROD A;  3PO3 S;  2EUF A;  2V22 B;  5IHY A;  4EOR B;  1UGR B;  3EJ1 B;  4UN0 A;  4BCG B;  1VOL A;  1H1P B;  4BCH B;  1N4M A;  5HBJ B;  4F6S B;  4BCN D;  2I53 A;  3POM A;  1O9K B;  4AKG A;  5L2W B;  1OI9 B;  3QWL A;  3A8G B;  4F70 B;  2WEV B;  4FM4 B;  4Z6Y A;  4IMY B;  1H1Q B;  1C9B A;  3BLH B;  2DD5 B;  4JX4 A;  1OIU B;  3BLR B;  5IF1 B;  3TN8 B;  1TD6 A;  4EOI B;  4HLQ A;  1OKV B;  4OB0 B;  2IW9 B;  1W98 B;  3BG5 A;  5EFQ B;  5HBH B;  3K7A M;  3HHT B;  5BNJ B;  1OL1 B;  3QYH B;  4FX3 B;  4NST B;  2C6T B;  4JX6 A;  2WMB B;  2LW4 A;  2WIH B;  1UNL D;  3QHW B;  4EOL B;  3DJB A;  4LOC A;  4OGR B;  4EC8 B;  5EJC A;  1H1S B;  2ZPH B;  1VYW B;  2C5N B;  2X1N B;  2WMA B;  3MY1 B;  4OB3 B;  4F6W B;  3A8L B;  3WVE B;  3BG9 A;  3X25 B;  3BHT B;  4HNV A;  2UUE B;  3VYG B;  2UZD B;  2CYZ B;  4HL4 A;  3DOG B;  4CRL B;  5CYI B;  4NC6 A;  1G3N C;  2CJM B;  2ZPG B;  1QMZ B;  3M03 A;  4I3Z B;  1URC B;  1QLB A;  1P5E B;  3TW6 A;  3O0G D;  4KRD B;  3RGF B;  2CZ6 B;  2G77 A;  5HBE B;  5FGK B;  4EOP B;  2I40 B;  2W2H A;  3TNW B;  1GY3 B;  3DDQ B;  5ACB A;  4ELJ A;  4BCJ B;  3MIA B;  3G33 B;  2DXB B;  5ICP B;  4II5 B;  3H4C A;  1OIY B;  1UGP B;  4BBS M;  4CFN B;  4QSH A;  1IRE B;  2BS3 A;  3QYG B;  4G6L B;  4MFD A;  4BY7 X;  3KHI A;  3VYH B;  1H4L D;  4EOS B;  3QXE B;  2IW8 B;  4EOJ B;  4F7L B;  4HNT A;  2B9R A;  5LQF B;  1XO2 A;  4CFX B;  2UZE B;  4Y72 B;  2PK9 B;  2BPM B;  2CCH B;  2D0Q B;  4BCO B;  1V29 B;  2BKZ B;  2R7G A;  3VKH A;  2QQ8 A;  4KRC B;  2WXV B;  5IDP B;  2C5O B;  4BCQ B;  4AI6 A;  4EC9 B;  5IDN B;  4BXX X;  2QGS A;  1UNH D;  4BCN B;  1OGU B;  3TW7 A;  2WFY B;  2IN3 A;  2KMG A;  3BG3 A;  4F7S B;  3HB9 A;  2ZPE B;  2W99 A;  3X26 B;  3BLQ B;  2AHJ B;  4BCM B;  5LMK B;  2W9F A;  2CZ1 B;  1FVV B;  4CFU B;  3MI9 B;  4CFV B;  2WJ9 A;  3NDQ A;  2ZCF B;  1O9K A;  1H28 B;  4CXA B;  3QZ5 B;  3HO8 A;  4YOZ A;  2UZL B;  5DQV A;  1H24 B;  4EOO B;  4F7J B;  2PMI B;  5I5Z B;  2G9X B;  4F7N B;  2QDY B;  4BCF B;  2WHB B;  3DDP B;  3A8O B;  4MIM A;  2BS4 A;  3VKG A;  1JST B;  2DPP B;  2F2C A;  2ZPB B;  3HBL A;  3QYE A;  4OR5 B;  2BS2 A;  1D3U B;  1OKW B;  2C5V B;  5HVY B;  3A8M B;  4EOM B;  2QFZ A;  4M6V A;  1FIN B;  3X24 B;  1AIS B;  3GTM S;  1H1R B;  2PHG A;  1GUX B;  4ZGE B;  4OB2 B;  1FKM A;  2ZPI B;  1JSU B;  1GH6 B;  4BCQ D;  1ZP2 A;  4ROE A;  2WPA B;  3DTO A;  2IVX A;  4OB1 B;  1F5Q B;  4EON B;  1ENW A;  2PK2 A;  4JX5 A;  4MFE A;  4YOS A;  1UGS B;  5HQ0 B;  1AD6 A;  1H26 B;  1UGQ B;  1H25 B;  2DXC B;  3BHU B;  1H27 B;  2DD4 B;  4BCM D;  3MY5 B;  4ELL A;  4CFU D;  4F6U B;  2DME A;  3QZ9 B;  1OL2 B;  4YC3 B;  2JGZ B;  4CFW B;  2UZB B;  3X20 B;  4EOQ B;  3EID B;  3TNH B;  4BY1 X;  4YOO A;  4BCK B;  4AKH A;  4HNU A;  2C4G B;  2IW6 B;  4TTH A;  1UNG D;  3DL1 A;  3TNI B;  1GUX A;  2PJQ A;  2W96 A;  3QHR B; 
#chains in the Genus database with same CATH homology
 1OKV B;  3EOC B;  2IW9 B;  4BCP B;  1W98 B;  3LQ5 B;  4G6L B;  5EFQ B;  4BCI B;  4OR5 B;  1KXU A;  5HBH B;  1D3U B;  3K7A M;  1H4L D;  1OKW B;  4EOS B;  5BNJ B;  2QDJ A;  1OL1 B;  2IW8 B;  2C5V B;  5CEI B;  4EOJ B;  4F7L B;  4FX3 B;  3BHV B;  4NST B;  1JOW A;  5HVY B;  2C6T B;  2WMB B;  2B9R A;  4EOM B;  3F5X B;  5LQF B;  2WIH B;  1FIN B;  1XO2 A;  4CFX B;  2W9Z A;  1UNL D;  2UZE B;  3QHW B;  5HNB B;  4ROC A;  4EOL B;  1AIS B;  4Y72 B;  1H1R B;  2PK9 B;  2PHG A;  1GUX B;  1E9H B;  2BPM B;  1BU2 A;  4CFM B;  2CCH B;  4OGR B;  4EC8 B;  4BCO B;  1H1S B;  2BKZ B;  2R7G A;  1JSU B;  1TFB A;  1JKW A;  1VYW B;  1GH6 B;  2C5N B;  2WXV B;  4KRC B;  2C5O B;  5IDP B;  4BCQ B;  2X1N B;  4BCQ D;  2WMA B;  3MY1 B;  1PKD B;  4F6W B;  1ZP2 A;  2CCI B;  4ROE A;  2WPA B;  2WIP B;  4EC9 B;  2IVX A;  3BHT B;  5IDN B;  1UNH D;  4BCN B;  1VIN A;  4EOK B;  1F5Q B;  2UUE B;  1OGU B;  2C5X B;  4EON B;  2PK2 A;  2UZD B;  2WFY B;  5HBE B;  4YOS A;  4ROD A;  2EUF A;  5HQ0 B;  2V22 B;  3DOG B;  4CRL B;  4F7S B;  1AD6 A;  1H26 B;  4EOR B;  5CYI B;  1G3N C;  1H25 B;  2CJM B;  3EJ1 B;  3BHU B;  1QMZ B;  2W99 A;  4UN0 A;  1H27 B;  3BLQ B;  3M03 A;  1URC B;  4I3Z B;  4BCM D;  3MY5 B;  1P5E B;  4BCM B;  5LMK B;  4BCG B;  4ELL A;  1VOL A;  2W9F A;  1H1P B;  1FVV B;  4BCH B;  1N4M A;  3MI9 B;  4CFU D;  3O0G D;  4CFU B;  4KRD B;  3RGF B;  4F6U B;  5HBJ B;  4F6S B;  4CFV B;  4BCN D;  1OL2 B;  1O9K A;  1H28 B;  4YC3 B;  5FGK B;  2I53 A;  2JGZ B;  3POM A;  4CFW B;  4CXA B;  1O9K B;  2I40 B;  4YOZ A;  4EOP B;  2W2H A;  5L2W B;  1OI9 B;  2UZL B;  3TNW B;  1GY3 B;  4F70 B;  2WEV B;  3DDQ B;  5ACB A;  1H24 B;  2UZB B;  4ELJ A;  4BCJ B;  4EOQ B;  3EID B;  3TNH B;  3MIA B;  4EOO B;  4F7J B;  2PMI B;  5I5Z B;  4IMY B;  4YOO A;  4BCK B;  2G9X B;  3G33 B;  5ICP B;  4F7N B;  4II5 B;  1H1Q B;  3H4C A;  2C4G B;  1C9B A;  1OIY B;  4BCF B;  2IW6 B;  3BLH B;  2WHB B;  4TTH A;  1UNG D;  3DDP B;  1OIU B;  3BLR B;  3TNI B;  5IF1 B;  3TN8 B;  1GUX A;  4CFN B;  1JST B;  4EOI B;  2W96 A;  2F2C A;  3QHR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...