3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
3GTMS 3GTOI 2LW4A 1TWHI 1X3ZA 3GCFA 3VMGA 2DMEA 3ESWA 5C4XI 3EERA 3HOXI 2E2HI 1PFTA 3HOZI 3S16I 3PO3S 4NBDA 3GTLI 2JA8I 1NUIA 1RLYA 3GKQA 3FKII 4XX2A 5C4JI 2E2JI 2R93I 3GTKI 3RZOI 4QTTA 4QTUA 1ML8A 4Y7NI 2NVTI 3HOWI 1Y1VS 3U50C 4BBRI 4A3BI 1WCMI 4BBSI 1TWCI 1K83I 2JR6A 2R92I 4BY7I 1DL6A 2F4OA 3GTQI 2J6AA 3NDQA 3PO2I 3S1QI 1WW9A 2RBLA 3H3VJ 4NOZA 4NB9A 3GTGI 4A3FI 2JA7I 2AKLA 2NVQI 5C3EI 3GTMI 2K5RA 2DE5A 4A3EI 4NBGA 3Q87A 1Y1WI 1LQLA 3D6WA 3I07A 1I6HI 4NBAA 3RZDI 2YU9I 4A3KI 1VLAA 4Y52I 4A3JI 4BXXI 1I50I 4A3II 2JS4A 2P3YA 4BY1I 2NVXI 3I4MI 4NBFA 3VMIA 4NBBA 1USPA 5C44I 3S1MI 1ENWA 3M4OI 2R7ZI 1TFIA 3S17I 1X3WA 4A3LI 2E2II 3K7AI 4BXXX 4NBCA 4BY1X 3H0GI 2NVYI 3HOYI 2JNYA 3GTJI 1L1OC 3LUSA 1R9TI 1ZB9A 4NB8A 3S2DI 4A3MI 2JA6I 1TWGI 1USPB 1N2FA 2DE6A 2F4MA 5CM2M 4A3CI 1YUAA 1TWAI 4A93I 3PO3I 2BJOA 4NBEA 2KPIA 1TWFI 3HOVI 1RO4A 3S14I 1Y1VI 3S1RI 2VUMI 4A3GI 2B63I 4X6AI 3M3YI 3S1NI 4NBHA 2HF1A 3CQZI 5IP9I 3I4NI 3HOUI 1I3QI 2PK7A 1SFOI 1ZB8A 3VB9A 2DE7A 5IP7I 4A3DI 3VMHA 3GTPI 2JA5I 3S15I 4MH4A 1QYPA 5FLMI 3S2HI 4BY7X
chains in the Genus database with same CATH superfamily
3GTMS 3A8HB 4EONB 1UNGD 4JX6A 5IF1B 3CXCZ 4OB2B 1N8R2 1X3ZA 2X1NB 2Q4ZA 2DMEA 2IW6B 2E2HI 2PHGA 3PO3S 2LFUA 1Q812 3F3FC 2GTIA 2BPMB 4EOIB 4FX3B 5T67A 3RZOI 5HBHB 1WZNA 2IVXA 1H26B 1VQ4Z 1Y1VS 1QLBA 4MD9A 1M1K2 5HNBB 3CC2Z 2QRCB 5D1OA 3TW7A 4MD8A 3QHRB 1AD6A 1KD12 3KIFA 2J6AA 3PO2I 4HNTA 2CCIB 3S1QI 1VQ9Z 5A2Qb 3TDHB 3H3VJ 4NC6A 4F6SB 4YOOA 1OGUB 1URCB 2C4GB 3CCUZ 4RS4A 3IF8A 5LMKB 3QZ5B 2HU9A 3I07A 2AYDA 1I6HI 2WPAB 4MD7A 2BS4A 4A3KI 3CMEZ 2JUBA 3MY1B 3WVDB 5CEIB 3CC71 4AI6A 1X0TA 3D2LA 2JS4A 2P3YA 4KRCB 3G71Z 3G4S1 4Z6YA 4BCMB 1VQK1 2W9FA 4RVFA 4ROEA 1RO0A 2G2KA 2V3VA 1H25B 2WMAB 1VQNZ 2R7ZI 1IREB 4AKGA 2I3CA 3JAMb 1X3WA 1H27B 3CCMZ 1YHQZ 1VQ8Z 2V22B 4MFDA 4CXAB 3OW2Z 3QYHB 1OKWB 1OIYB 3HOYI 2LEXA 2JNYA 3GTJI 2PK9B 3LUSA 1R9TI 3TW6A 5EFQB 4EOLB 1FVVB 2OTLZ 4Y72B 3BHTB 1NJI2 4E2XA 3F5XB 2DD4B 3BG5A 1VINA 3NDIA 4OR5B 1M902 2QLVB 3X25B 2CCHB 1TWAI 4A93I 3J80b 1YITZ 3BLRB 2BJOA 2CZ7B 1H1QB 2WHBB 4BCJB 3CCQZ 3S14I 3NH5A 4BCOB 2DD5B 3O0GD 3CCJZ 1FDOA 2VUMI 4NFRA 3CCRZ 2B63I 2EUFA 1VYWB 1YIJZ 4HNVA 1QF8A 4X6AI 2RPRA 3S1NI 4NBHA 3CD6Z 3CCEZ 5FLXb 5HVYB 5ACBA 1K731 2CZ6B 1SFOI 2QDJA 4EORB 5IP7I 1K8A2 4A3DI 3VMHA 3I561 4F7LB 2JA5I 4MH4A 2OTJZ 2ZPBB 3G6EZ 3I55Z 3X28B 1YHQ1 2OOXB 4YC3B 2LW4A 2WFYB 3ESWA 3EERA 3HB9A 4F7JB 4ZGDB 3CMA1 3A8MB 3HOZI 3S16I 3J81f 3TNIB 1M901 1RLYA 3G711 1H4LD 4CFWB 1BU2A 3MI9B 3DJBA 2KI7B 3D9XA 3CCU1 2NVTI 3P5JB 1RNIA 5EJCA 5I5ZB 3MONA 3CCL1 2ZZDB 3NH8A 4YOZA 2R92I 3HBLA 1JKWA 2W03A 1FDIA 1OI9B 3A8OB 4EOPB 3GTQI 3VYHB 2ZPIB 1OKVB 3BHUB 1H1SB 3K7AM 4RVDA 3CCJ1 1GUXA 2OZKA 1H1PB 2DXBB 2YADA 4E30A 2ZPFB 1UGRB 3J80f 3GTGI 1KD11 3BHVB 2AKLA 3NFZA 4F6WB 5C3EI 2K5RA 2DE5A 5BNJB 3MZKB 1Y1WI 2I40B 1LQLA 4OB0B 5FGKB 5D1PA 3CC21 1VQ5Z 1K732 3EJ1B 1XO2A 1JJ2Z 3CCS1 4Y52I 4A3JI 3H4CA 1I50I 4HL4A 4BXXI 2IN3A 5DQVA 1KRLA 4A3II 4BCQB 1VQ51 1TD6A 2VPYA 4NBFA 3HZJA 5HBJB 3EOCB 3NDJA 4LOCA 3X20B 3S1MI 1ENWA 2V8IA 1OL2B 2BS2A 4DQYB 1VQ41 2C5XB 2QKDA 3DL1A 4UN0A 1YI21 3BG9A 3S17I 3LQ5B 4BXXX 3DDQB 4HGYA 4BY1X 3H0GI 3QYGB 2ZAEB 1Y8CA 4BCND 2ZCFB 1QXFA 3G4SZ 5IT9f 1NP6A 3MZLB 4NB8A 3CCSZ 1YI2Z 5L2WB 5IDNB 1VQMZ 2WB1A 3VKGA 1Q862 1W98B 2JA6I 2WIHB 3QXEB 3KIHA 2F4MA 1VQN1 2VPXA 3J7A4 3PO3I 3CCM1 2ZPEB 2B9RA 2KMGA 2GTHA 2WAQA 2KPIA 4RV9A 1K9M1 1YJ9Z 1Y1VI 4TNUA 1KC81 4A3GI 1OL1B 1GUXB 1O9KA 4BCQD 4RVHA 4JX5A 4M6VA 4E31A 2PMIB 2BS3A 3MIAB 2M48A 2PK7A 3I56Z 4DK1A 1F5QB 2JGZB 1VQM1 2DXCB 4E2ZA 1K8A1 3T4NB 2W99A 4BY7X 1SIWA 4E2WA 2IW8B 3DDPB 1E9HB 2BKZB 2O4HA 2G77A 1VOLA 3VMGA 3X24B 3HOXI 3QYEA 1UGQB 1ZH1A 1S7MA 3A8GB 2QA4Z 1H1RB 1VQLZ 2GU2A 2JA8I 3GKQA 1M1K1 1Q7Y1 2E2JI 3GTKI 2PMZA 1Q16A 2LIYA 2WMBB 1QVGY 3CCR1 5CYIB 3HOWI 2WXVB 4A3BI 1WCMI 2QF7A 3I551 2JR6A 1VQ91 3WVEB 3BG0B 4QSHA 3VTNA 2Q51A 2UZBB 2AHJB 4F7NB 2V8JA 2W2HA 4OB1B 1H28B 3G33B 3HO8A 1KC82 1WW9A 1RO2A 2RHBA 3HHTB 4A3FI 1YIT1 1W2BY 2JA7I 4MXUA 2C6TB 2NVQI 3RGFB 3CXCY 2M6NA 4EOOB 1G3NC 3Q87A 3IR7A 2VPZA 1Z03A 4NBAA 1YJWZ 2YU9I 2WEVB 5T6BA 1YIJ1 1VLAA 3CCLZ 2CZ0B 3QHWB 4CFNB 4EOKB 1D3UB 1Q811 4MFEA 1USPA 5C44I 2UUEB 1V29B 5IHYA 4BBSM 1TFIA 3CPWZ 3POMA 2DPPB 3M4OI 4F70B 2F2CA 5DQWA 4RODA 1N8R1 3KHIA 3TN8B 2E2II 4CFMB 2I53A 1VQ7Z 3DTOA 4CFUB 3NH4A 4BBRM 5LL6f 5HBEB 1Q861 1VQKZ 5IT9b 1P9NA 4CL1A 3B57A 2CYZB 1Z02A 4OGRB 2W04A 2WJ9A 3S2DI 4EOQB 4A3MI 5LQFB 1TWGI 1FINB 2RT9A 4CRLB 4FM4B 2DE6A 1AA6A 4KRDB 1YUAA 3JAMf 1KQSY 2W9ZA 3VKHA 2P28A 1W2BZ 4E32A 3HOVI 1JOWA 1UNLD 3CMAZ 3S1RI 2IZ3A 1VQOZ 2KR6A 3CCVZ 3F3PC 4HGZA 4E33A 4HH4A 4II5B 3CME1 2OTJ1 2PJQA 1VQ61 3M3YI 2ZPGB 2QA41 2JIOA 3CQZI 3CCV1 2UZEB 3QWLA 3HOUI 5D1OB 1ZB8A 3VB9A 2QEX1 2DE7A 2QGSA 4NH1C 3GTPI 2OOYB 1YJ91 2PK2A 3CCE1 2C5NB 1QYPA 1S721 2JIQA 3J81b 2W96A 5AN9F 4EC9B 5A2Qf 4CFVB 5T64A 4ELJA 4EOMB 3CD61 4EC8B 3GTOI 1ZP2A 2UZDB 4MIMA 1TWHI 3GCFA 2CJMB 5C4XI 2JIPA 1UNHD 1PFTA 2IV2X 2V8KA 1JJ2Y 2WIPB 4IMYB 4NBDA 3MY5B 3GTLI 2C5VB 1S72Z 1Q7Y2 1NUIA 1TFBA 3FKII 2JIMA 4XX2A 1YJN1 3OW2Y 1O9KB 5C4JI 1Q821 4MRIA 1GH6B 4DGLA 1PKDB 2R93I 2CZ1B 3DOGB 2VPWA 1K9M2 4BCPB 2V45A 4QTTA 1ML8A 4QTUA 4AKIA 4Y7NI 2E9HA 2QEXZ 3U50C 4BBRI 2Y0SA 4RVGA 2G9XB 3QZ9B 3BLQB 3IX0A 3CC7Z 4EOJB 1QVFZ 4BBSI 1P5EB 1H24B 1K83I 1TWCI 4BY7I 1DL6A 2F4OA 3FQMA 1VQO1 3NDQA 2PM9A 1OIUB 1FKMA 4NSTB 1QMZB 1UGPB 4BCHB 2RBLA 4NOZA 2OTL1 4NB9A 1JSTB 3M03A 1JWHC 2VUGA 3BG1B 3GTMI 2JMOA 1WIIA 2IW9B 4A3EI 4NBGA 3D6WA 3RZDI 4G6LB 3FQQA 1VQ81 3TE5B 4EWCA 3I4MI 4BY1I 3QWUA 1GY3B 2NVXI 3VMIA 3A8LB 4ZGJB 1RQFA 1KQSZ 4BCNB 4NBBA 4F7SB 3CC41 4AKHA 5IDPB 2QRDB 4BCGB 4CFXB 4ROCA 2H85A 4A3LI 2ZPHB 4ZGEB 1WJ2A 3K7AI 3CCQ1 4BCFB 1NJI1 1JSUB 4NBCA 2NVYI 1L1OC 3CC4Z 4OB3B 1ZB9A 4BCMD 1VQ6Z 1C9BA 3BG3A 2QREB 1QVFY 1UGSB 5ICPB 2O53A 4S1TA 3QYBA 4F6UB 2QQ8A 4HNUA 2C5OB 1KXUA 2D0QB 3HKZA 2NAPA 2R7GA 3TNHB 1N2FA 1USPB 5CM2M 2RIQA 4CFUD 1YJW1 4A3CI 5FLXf 1Q822 1E7PA 2JIRA 4NBEA 4HLQA 1YUKA 3VYGB 1TWFI 1RO4A 4AYBA 3EIDB 2E7ZA 2K3RA 3BLHB 3EEDA 4BCIB 4BCKB 2QR1B 3CPWY 4TTHA 3TNWB 4ELLA 4MONA 4E2YA 2R6MA 2UZLB 2EGTA 2HF1A 2IZ4A 5IP9I 1QVGZ 2VF1A 3I4NI 2QDYB 2QFZA 1VQP1 4I3ZB 4YOSA 1I3QI 1Z01A 1VQ71 4EOSB 1N4MA 1YJNZ 4JX4A 3S15I 3G6E1 1VQPZ 5HQ0B 5FLMI 1VQL1 3S2HI 3X26B 1AISB 3IFUA 1AHJB
chains in the Genus database with same CATH topology
3GTMS 3CXCZ 1N8R2 1X3ZA 2Q4ZA 2DMEA 2E2HI 3PO3S 2LFUA 1Q812 3F3FC 2GTIA 5T67A 3RZOI 1VQ4Z 1Y1VS 4MD9A 1M1K2 3CC2Z 2QRCB 5D1OA 4MD8A 1KD12 3KIFA 2J6AA 3PO2I 3S1QI 1VQ9Z 5A2Qb 3TDHB 3H3VJ 3CCUZ 4RS4A 3IF8A 2HU9A 3I07A 1I6HI 4MD7A 4A3KI 3CMEZ 2JUBA 3CC71 1X0TA 2JS4A 2P3YA 3G71Z 3G4S1 1VQK1 4RVFA 1RO0A 2G2KA 2R7ZI 1VQNZ 2I3CA 3JAMb 1X3WA 3CCMZ 1YHQZ 1VQ8Z 3OW2Z 3HOYI 2JNYA 3GTJI 3LUSA 1R9TI 2OTLZ 1NJI2 4E2XA 3NDIA 1M902 2QLVB 1TWAI 4A93I 3J80b 1YITZ 2BJOA 3CCQZ 3S14I 3NH5A 3CCJZ 2VUMI 4NFRA 3CCRZ 2B63I 1YIJZ 1QF8A 4X6AI 2RPRA 3S1NI 4NBHA 3CD6Z 3CCEZ 5FLXb 1K731 1SFOI 5IP7I 1K8A2 4A3DI 3VMHA 3I561 2JA5I 4MH4A 2OTJZ 3G6EZ 3I55Z 1YHQ1 2OOXB 2LW4A 3ESWA 3EERA 3CMA1 3HOZI 3S16I 3J81f 1M901 1RLYA 3G711 2KI7B 3D9XA 3CCU1 2NVTI 3P5JB 1RNIA 3MONA 3CCL1 3NH8A 2R92I 2W03A 3GTQI 4RVDA 3CCJ1 4E30A 2OZKA 2YADA 3J80f 3GTGI 1KD11 2AKLA 3NFZA 5C3EI 2K5RA 2DE5A 3MZKB 1Y1WI 3CC21 1LQLA 5D1PA 1VQ5Z 1K732 1JJ2Z 3CCS1 4Y52I 4A3JI 4BXXI 1I50I 1KRLA 4A3II 1VQ51 4NBFA 3NDJA 3S1MI 1ENWA 2V8IA 4DQYB 1VQ41 2QKDA 1YI21 3S17I 4BXXX 4HGYA 4BY1X 3H0GI 2ZAEB 3G4SZ 5IT9f 1NP6A 3MZLB 4NB8A 3CCSZ 1YI2Z 1VQMZ 2WB1A 1Q862 2JA6I 3KIHA 2F4MA 1VQN1 3J7A4 3PO3I 3CCM1 2GTHA 2WAQA 2KPIA 4RV9A 1K9M1 1YJ9Z 1Y1VI 4TNUA 1KC81 4A3GI 4RVHA 4E31A 2M48A 2PK7A 3I56Z 4DK1A 1VQM1 1K8A1 4E2ZA 3T4NB 4BY7X 4E2WA 2O4HA 3VMGA 3HOXI 1ZH1A 1S7MA 2QA4Z 1VQLZ 2GU2A 2JA8I 3GKQA 1M1K1 1Q7Y1 2E2JI 3GTKI 2PMZA 2LIYA 1QVGY 3CCR1 3HOWI 4A3BI 1WCMI 3I551 2JR6A 1VQ91 3BG0B 3VTNA 2Q51A 2V8JA 1KC82 1WW9A 1RO2A 2RHBA 4A3FI 1YIT1 1W2BY 2JA7I 4MXUA 2NVQI 3CXCY 2M6NA 3Q87A 1Z03A 4NBAA 1YJWZ 2YU9I 5T6BA 1YIJ1 1VLAA 3CCLZ 1Q811 1USPA 5C44I 3M4OI 3CPWZ 1TFIA 1N8R1 2E2II 1VQ7Z 3NH4A 5LL6f 1Q861 1VQKZ 5IT9b 1P9NA 4CL1A 1Z02A 2W04A 3S2DI 4A3MI 1TWGI 2RT9A 2DE6A 1YUAA 3JAMf 1KQSY 2P28A 1W2BZ 4E32A 3HOVI 3CMAZ 3S1RI 2IZ3A 1VQOZ 3CCVZ 3F3PC 4E33A 4HH4A 3CME1 2OTJ1 1VQ61 3M3YI 2QA41 3CQZI 3CCV1 3HOUI 5D1OB 1ZB8A 3VB9A 2QEX1 2DE7A 4NH1C 3GTPI 2OOYB 1YJ91 3CCE1 1QYPA 1S721 3J81b 5AN9F 5A2Qf 5T64A 3CD61 3GTOI 1TWHI 3GCFA 5C4XI 1PFTA 1JJ2Y 2V8KA 4NBDA 3GTLI 1S72Z 1Q7Y2 1NUIA 3FKII 4XX2A 1YJN1 3OW2Y 1Q821 5C4JI 4MRIA 4DGLA 2R93I 1K9M2 4QTTA 4QTUA 1ML8A 4Y7NI 2E9HA 2QEXZ 3U50C 4BBRI 2Y0SA 4RVGA 1QVFZ 3IX0A 3CC7Z 3IFUA 4BBSI 1TWCI 1K83I 4BY7I 1DL6A 2F4OA 3FQMA 1VQO1 3NDQA 2PM9A 2RBLA 4NOZA 2OTL1 4NB9A 1JWHC 2VUGA 3BG1B 3GTMI 2JMOA 1WIIA 4A3EI 4NBGA 3D6WA 3RZDI 3FQQA 1VQ81 3TE5B 4EWCA 3I4MI 4BY1I 3QWUA 2NVXI 3VMIA 1RQFA 1KQSZ 4NBBA 3CC41 2QRDB 2H85A 4A3LI 3K7AI 3CCQ1 1NJI1 4NBCA 2NVYI 1L1OC 3CC4Z 1ZB9A 1VQ6Z 2QREB 1QVFY 2O53A 4S1TA 3HKZA 1USPB 1N2FA 1YJW1 5CM2M 2RIQA 4A3CI 5FLXf 1Q822 4NBEA 1YUKA 1TWFI 1RO4A 4AYBA 2K3RA 3EEDA 2QR1B 3CPWY 4MONA 4E2YA 2R6MA 2IZ4A 2EGTA 2HF1A 5IP9I 1QVGZ 2VF1A 3I4NI 1VQP1 1I3QI 1Z01A 1VQ71 1YJNZ 3S15I 3G6E1 1VQPZ 5FLMI 1VQL1 3S2HI 4HGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTM S;  3GTO I;  2LW4 A;  1TWH I;  1X3Z A;  3GCF A;  3VMG A;  2DME A;  3ESW A;  5C4X I;  3EER A;  3HOX I;  2E2H I;  1PFT A;  3HOZ I;  3S16 I;  3PO3 S;  4NBD A;  3GTL I;  2JA8 I;  1NUI A;  1RLY A;  3GKQ A;  3FKI I;  4XX2 A;  5C4J I;  2E2J I;  2R93 I;  3GTK I;  3RZO I;  4QTT A;  4QTU A;  1ML8 A;  4Y7N I;  2NVT I;  3HOW I;  1Y1V S;  3U50 C;  4BBR I;  4A3B I;  1WCM I;  4BBS I;  1TWC I;  1K83 I;  2JR6 A;  2R92 I;  4BY7 I;  1DL6 A;  2F4O A;  3GTQ I;  2J6A A;  3NDQ A;  3PO2 I;  3S1Q I;  1WW9 A;  2RBL A;  3H3V J;  4NOZ A;  4NB9 A;  3GTG I;  4A3F I;  2JA7 I;  2AKL A;  2NVQ I;  5C3E I;  3GTM I;  2K5R A;  2DE5 A;  4A3E I;  4NBG A;  3Q87 A;  1Y1W I;  1LQL A;  3D6W A;  3I07 A;  1I6H I;  4NBA A;  3RZD I;  2YU9 I;  4A3K I;  1VLA A;  4Y52 I;  4A3J I;  4BXX I;  1I50 I;  4A3I I;  2JS4 A;  2P3Y A;  4BY1 I;  2NVX I;  3I4M I;  4NBF A;  3VMI A;  4NBB A;  1USP A;  5C44 I;  3S1M I;  1ENW A;  3M4O I;  2R7Z I;  1TFI A;  3S17 I;  1X3W A;  4A3L I;  2E2I I;  3K7A I;  4BXX X;  4NBC A;  4BY1 X;  3H0G I;  2NVY I;  3HOY I;  2JNY A;  3GTJ I;  1L1O C;  3LUS A;  1R9T I;  1ZB9 A;  4NB8 A;  3S2D I;  4A3M I;  2JA6 I;  1TWG I;  1USP B;  1N2F A;  2DE6 A;  2F4M A;  5CM2 M;  4A3C I;  1YUA A;  1TWA I;  4A93 I;  3PO3 I;  2BJO A;  4NBE A;  2KPI A;  1TWF I;  3HOV I;  1RO4 A;  3S14 I;  1Y1V I;  3S1R I;  2VUM I;  4A3G I;  2B63 I;  4X6A I;  3M3Y I;  3S1N I;  4NBH A;  2HF1 A;  3CQZ I;  5IP9 I;  3I4N I;  3HOU I;  1I3Q I;  2PK7 A;  1SFO I;  1ZB8 A;  3VB9 A;  2DE7 A;  5IP7 I;  4A3D I;  3VMH A;  3GTP I;  2JA5 I;  3S15 I;  4MH4 A;  1QYP A;  5FLM I;  3S2H I;  4BY7 X; 
#chains in the Genus database with same CATH topology
 3GTM S;  3A8H B;  4EON B;  1UNG D;  4JX6 A;  5IF1 B;  3CXC Z;  4OB2 B;  1N8R 2;  1X3Z A;  2X1N B;  2Q4Z A;  2DME A;  2IW6 B;  2E2H I;  2PHG A;  3PO3 S;  2LFU A;  1Q81 2;  3F3F C;  2GTI A;  2BPM B;  4EOI B;  4FX3 B;  5T67 A;  3RZO I;  5HBH B;  1WZN A;  2IVX A;  1H26 B;  1VQ4 Z;  1Y1V S;  1QLB A;  4MD9 A;  1M1K 2;  5HNB B;  3CC2 Z;  2QRC B;  5D1O A;  3TW7 A;  4MD8 A;  3QHR B;  1AD6 A;  1KD1 2;  3KIF A;  2J6A A;  3PO2 I;  4HNT A;  2CCI B;  3S1Q I;  1VQ9 Z;  5A2Q b;  3TDH B;  3H3V J;  4NC6 A;  4F6S B;  4YOO A;  1OGU B;  1URC B;  2C4G B;  3CCU Z;  4RS4 A;  3IF8 A;  5LMK B;  3QZ5 B;  2HU9 A;  3I07 A;  2AYD A;  1I6H I;  2WPA B;  4MD7 A;  2BS4 A;  4A3K I;  3CME Z;  2JUB A;  3MY1 B;  3WVD B;  5CEI B;  3CC7 1;  4AI6 A;  1X0T A;  3D2L A;  2JS4 A;  2P3Y A;  4KRC B;  3G71 Z;  3G4S 1;  4Z6Y A;  4BCM B;  1VQK 1;  2W9F A;  4RVF A;  4ROE A;  1RO0 A;  2G2K A;  2V3V A;  1H25 B;  2WMA B;  1VQN Z;  2R7Z I;  1IRE B;  4AKG A;  2I3C A;  3JAM b;  1X3W A;  1H27 B;  3CCM Z;  1YHQ Z;  1VQ8 Z;  2V22 B;  4MFD A;  4CXA B;  3OW2 Z;  3QYH B;  1OKW B;  1OIY B;  3HOY I;  2LEX A;  2JNY A;  3GTJ I;  2PK9 B;  3LUS A;  1R9T I;  3TW6 A;  5EFQ B;  4EOL B;  1FVV B;  2OTL Z;  4Y72 B;  3BHT B;  1NJI 2;  4E2X A;  3F5X B;  2DD4 B;  3BG5 A;  1VIN A;  3NDI A;  4OR5 B;  1M90 2;  2QLV B;  3X25 B;  2CCH B;  1TWA I;  4A93 I;  3J80 b;  1YIT Z;  3BLR B;  2BJO A;  2CZ7 B;  1H1Q B;  2WHB B;  4BCJ B;  3CCQ Z;  3S14 I;  3NH5 A;  4BCO B;  2DD5 B;  3O0G D;  3CCJ Z;  1FDO A;  2VUM I;  4NFR A;  3CCR Z;  2B63 I;  2EUF A;  1VYW B;  1YIJ Z;  4HNV A;  1QF8 A;  4X6A I;  2RPR A;  3S1N I;  4NBH A;  3CD6 Z;  3CCE Z;  5FLX b;  5HVY B;  5ACB A;  1K73 1;  2CZ6 B;  1SFO I;  2QDJ A;  4EOR B;  5IP7 I;  1K8A 2;  4A3D I;  3VMH A;  3I56 1;  4F7L B;  2JA5 I;  4MH4 A;  2OTJ Z;  2ZPB B;  3G6E Z;  3I55 Z;  3X28 B;  1YHQ 1;  2OOX B;  4YC3 B;  2LW4 A;  2WFY B;  3ESW A;  3EER A;  3HB9 A;  4F7J B;  4ZGD B;  3CMA 1;  3A8M B;  3HOZ I;  3S16 I;  3J81 f;  3TNI B;  1M90 1;  1RLY A;  3G71 1;  1H4L D;  4CFW B;  1BU2 A;  3MI9 B;  3DJB A;  2KI7 B;  3D9X A;  3CCU 1;  2NVT I;  3P5J B;  1RNI A;  5EJC A;  5I5Z B;  3MON A;  3CCL 1;  2ZZD B;  3NH8 A;  4YOZ A;  2R92 I;  3HBL A;  1JKW A;  2W03 A;  1FDI A;  1OI9 B;  3A8O B;  4EOP B;  3GTQ I;  3VYH B;  2ZPI B;  1OKV B;  3BHU B;  1H1S B;  3K7A M;  4RVD A;  3CCJ 1;  1GUX A;  2OZK A;  1H1P B;  2DXB B;  2YAD A;  4E30 A;  2ZPF B;  1UGR B;  3J80 f;  3GTG I;  1KD1 1;  3BHV B;  2AKL A;  3NFZ A;  4F6W B;  5C3E I;  2K5R A;  2DE5 A;  5BNJ B;  3MZK B;  1Y1W I;  2I40 B;  1LQL A;  4OB0 B;  5FGK B;  5D1P A;  3CC2 1;  1VQ5 Z;  1K73 2;  3EJ1 B;  1XO2 A;  1JJ2 Z;  3CCS 1;  4Y52 I;  4A3J I;  3H4C A;  1I50 I;  4HL4 A;  4BXX I;  2IN3 A;  5DQV A;  1KRL A;  4A3I I;  4BCQ B;  1VQ5 1;  1TD6 A;  2VPY A;  4NBF A;  3HZJ A;  5HBJ B;  3EOC B;  3NDJ A;  4LOC A;  3X20 B;  3S1M I;  1ENW A;  2V8I A;  1OL2 B;  2BS2 A;  4DQY B;  1VQ4 1;  2C5X B;  2QKD A;  3DL1 A;  4UN0 A;  1YI2 1;  3BG9 A;  3S17 I;  3LQ5 B;  4BXX X;  3DDQ B;  4HGY A;  4BY1 X;  3H0G I;  3QYG B;  2ZAE B;  1Y8C A;  4BCN D;  2ZCF B;  1QXF A;  3G4S Z;  5IT9 f;  1NP6 A;  3MZL B;  4NB8 A;  3CCS Z;  1YI2 Z;  5L2W B;  5IDN B;  1VQM Z;  2WB1 A;  3VKG A;  1Q86 2;  1W98 B;  2JA6 I;  2WIH B;  3QXE B;  3KIH A;  2F4M A;  1VQN 1;  2VPX A;  3J7A 4;  3PO3 I;  3CCM 1;  2ZPE B;  2B9R A;  2KMG A;  2GTH A;  2WAQ A;  2KPI A;  4RV9 A;  1K9M 1;  1YJ9 Z;  1Y1V I;  4TNU A;  1KC8 1;  4A3G I;  1OL1 B;  1GUX B;  1O9K A;  4BCQ D;  4RVH A;  4JX5 A;  4M6V A;  4E31 A;  2PMI B;  2BS3 A;  3MIA B;  2M48 A;  2PK7 A;  3I56 Z;  4DK1 A;  1F5Q B;  2JGZ B;  1VQM 1;  2DXC B;  4E2Z A;  1K8A 1;  3T4N B;  2W99 A;  4BY7 X;  1SIW A;  4E2W A;  2IW8 B;  3DDP B;  1E9H B;  2BKZ B;  2O4H A;  2G77 A;  1VOL A;  3VMG A;  3X24 B;  3HOX I;  3QYE A;  1UGQ B;  1ZH1 A;  1S7M A;  3A8G B;  2QA4 Z;  1H1R B;  1VQL Z;  2GU2 A;  2JA8 I;  3GKQ A;  1M1K 1;  1Q7Y 1;  2E2J I;  3GTK I;  2PMZ A;  1Q16 A;  2LIY A;  2WMB B;  1QVG Y;  3CCR 1;  5CYI B;  3HOW I;  2WXV B;  4A3B I;  1WCM I;  2QF7 A;  3I55 1;  2JR6 A;  1VQ9 1;  3WVE B;  3BG0 B;  4QSH A;  3VTN A;  2Q51 A;  2UZB B;  2AHJ B;  4F7N B;  2V8J A;  2W2H A;  4OB1 B;  1H28 B;  3G33 B;  3HO8 A;  1KC8 2;  1WW9 A;  1RO2 A;  2RHB A;  3HHT B;  4A3F I;  1YIT 1;  1W2B Y;  2JA7 I;  4MXU A;  2C6T B;  2NVQ I;  3RGF B;  3CXC Y;  2M6N A;  4EOO B;  1G3N C;  3Q87 A;  3IR7 A;  2VPZ A;  1Z03 A;  4NBA A;  1YJW Z;  2YU9 I;  2WEV B;  5T6B A;  1YIJ 1;  1VLA A;  3CCL Z;  2CZ0 B;  3QHW B;  4CFN B;  4EOK B;  1D3U B;  1Q81 1;  4MFE A;  1USP A;  5C44 I;  2UUE B;  1V29 B;  5IHY A;  4BBS M;  1TFI A;  3CPW Z;  3POM A;  2DPP B;  3M4O I;  4F70 B;  2F2C A;  5DQW A;  4ROD A;  1N8R 1;  3KHI A;  3TN8 B;  2E2I I;  4CFM B;  2I53 A;  1VQ7 Z;  3DTO A;  4CFU B;  3NH4 A;  4BBR M;  5LL6 f;  5HBE B;  1Q86 1;  1VQK Z;  5IT9 b;  1P9N A;  4CL1 A;  3B57 A;  2CYZ B;  1Z02 A;  4OGR B;  2W04 A;  2WJ9 A;  3S2D I;  4EOQ B;  4A3M I;  5LQF B;  1TWG I;  1FIN B;  2RT9 A;  4CRL B;  4FM4 B;  2DE6 A;  1AA6 A;  4KRD B;  1YUA A;  3JAM f;  1KQS Y;  2W9Z A;  3VKH A;  2P28 A;  1W2B Z;  4E32 A;  3HOV I;  1JOW A;  1UNL D;  3CMA Z;  3S1R I;  2IZ3 A;  1VQO Z;  2KR6 A;  3CCV Z;  3F3P C;  4HGZ A;  4E33 A;  4HH4 A;  4II5 B;  3CME 1;  2OTJ 1;  2PJQ A;  1VQ6 1;  3M3Y I;  2ZPG B;  2QA4 1;  2JIO A;  3CQZ I;  3CCV 1;  2UZE B;  3QWL A;  3HOU I;  5D1O B;  1ZB8 A;  3VB9 A;  2QEX 1;  2DE7 A;  2QGS A;  4NH1 C;  3GTP I;  2OOY B;  1YJ9 1;  2PK2 A;  3CCE 1;  2C5N B;  1QYP A;  1S72 1;  2JIQ A;  3J81 b;  2W96 A;  5AN9 F;  4EC9 B;  5A2Q f;  4CFV B;  5T64 A;  4ELJ A;  4EOM B;  3CD6 1;  4EC8 B;  3GTO I;  1ZP2 A;  2UZD B;  4MIM A;  1TWH I;  3GCF A;  2CJM B;  5C4X I;  2JIP A;  1UNH D;  1PFT A;  2IV2 X;  2V8K A;  1JJ2 Y;  2WIP B;  4IMY B;  4NBD A;  3MY5 B;  3GTL I;  2C5V B;  1S72 Z;  1Q7Y 2;  1NUI A;  1TFB A;  3FKI I;  2JIM A;  4XX2 A;  1YJN 1;  3OW2 Y;  1O9K B;  5C4J I;  1Q82 1;  4MRI A;  1GH6 B;  4DGL A;  1PKD B;  2R93 I;  2CZ1 B;  3DOG B;  2VPW A;  1K9M 2;  4BCP B;  2V45 A;  4QTT A;  1ML8 A;  4QTU A;  4AKI A;  4Y7N I;  2E9H A;  2QEX Z;  3U50 C;  4BBR I;  2Y0S A;  4RVG A;  2G9X B;  3QZ9 B;  3BLQ B;  3IX0 A;  3CC7 Z;  4EOJ B;  1QVF Z;  4BBS I;  1P5E B;  1H24 B;  1K83 I;  1TWC I;  4BY7 I;  1DL6 A;  2F4O A;  3FQM A;  1VQO 1;  3NDQ A;  2PM9 A;  1OIU B;  1FKM A;  4NST B;  1QMZ B;  1UGP B;  4BCH B;  2RBL A;  4NOZ A;  2OTL 1;  4NB9 A;  1JST B;  3M03 A;  1JWH C;  2VUG A;  3BG1 B;  3GTM I;  2JMO A;  1WII A;  2IW9 B;  4A3E I;  4NBG A;  3D6W A;  3RZD I;  4G6L B;  3FQQ A;  1VQ8 1;  3TE5 B;  4EWC A;  3I4M I;  4BY1 I;  3QWU A;  1GY3 B;  2NVX I;  3VMI A;  3A8L B;  4ZGJ B;  1RQF A;  1KQS Z;  4BCN B;  4NBB A;  4F7S B;  3CC4 1;  4AKH A;  5IDP B;  2QRD B;  4BCG B;  4CFX B;  4ROC A;  2H85 A;  4A3L I;  2ZPH B;  4ZGE B;  1WJ2 A;  3K7A I;  3CCQ 1;  4BCF B;  1NJI 1;  1JSU B;  4NBC A;  2NVY I;  1L1O C;  3CC4 Z;  4OB3 B;  1ZB9 A;  4BCM D;  1VQ6 Z;  1C9B A;  3BG3 A;  2QRE B;  1QVF Y;  1UGS B;  5ICP B;  2O53 A;  4S1T A;  3QYB A;  4F6U B;  2QQ8 A;  4HNU A;  2C5O B;  1KXU A;  2D0Q B;  3HKZ A;  2NAP A;  2R7G A;  3TNH B;  1N2F A;  1USP B;  5CM2 M;  2RIQ A;  4CFU D;  1YJW 1;  4A3C I;  5FLX f;  1Q82 2;  1E7P A;  2JIR A;  4NBE A;  4HLQ A;  1YUK A;  3VYG B;  1TWF I;  1RO4 A;  4AYB A;  3EID B;  2E7Z A;  2K3R A;  3BLH B;  3EED A;  4BCI B;  4BCK B;  2QR1 B;  3CPW Y;  4TTH A;  3TNW B;  4ELL A;  4MON A;  4E2Y A;  2R6M A;  2UZL B;  2EGT A;  2HF1 A;  2IZ4 A;  5IP9 I;  1QVG Z;  2VF1 A;  3I4N I;  2QDY B;  2QFZ A;  1VQP 1;  4I3Z B;  4YOS A;  1I3Q I;  1Z01 A;  1VQ7 1;  4EOS B;  1N4M A;  1YJN Z;  4JX4 A;  3S15 I;  3G6E 1;  1VQP Z;  5HQ0 B;  5FLM I;  1VQL 1;  3S2H I;  3X26 B;  1AIS B;  3IFU A;  1AHJ B; 
#chains in the Genus database with same CATH homology
 3GTM S;  3CXC Z;  1N8R 2;  1X3Z A;  2Q4Z A;  2DME A;  2E2H I;  3PO3 S;  2LFU A;  1Q81 2;  3F3F C;  2GTI A;  5T67 A;  3RZO I;  1VQ4 Z;  1Y1V S;  4MD9 A;  1M1K 2;  3CC2 Z;  2QRC B;  5D1O A;  4MD8 A;  1KD1 2;  3KIF A;  2J6A A;  3PO2 I;  3S1Q I;  1VQ9 Z;  5A2Q b;  3TDH B;  3H3V J;  3CCU Z;  4RS4 A;  3IF8 A;  2HU9 A;  3I07 A;  1I6H I;  4MD7 A;  4A3K I;  3CME Z;  2JUB A;  3CC7 1;  1X0T A;  2JS4 A;  2P3Y A;  3G71 Z;  3G4S 1;  1VQK 1;  4RVF A;  1RO0 A;  2G2K A;  2R7Z I;  1VQN Z;  2I3C A;  3JAM b;  1X3W A;  3CCM Z;  1YHQ Z;  1VQ8 Z;  3OW2 Z;  3HOY I;  2JNY A;  3GTJ I;  3LUS A;  1R9T I;  2OTL Z;  1NJI 2;  4E2X A;  3NDI A;  1M90 2;  2QLV B;  1TWA I;  4A93 I;  3J80 b;  1YIT Z;  2BJO A;  3CCQ Z;  3S14 I;  3NH5 A;  3CCJ Z;  2VUM I;  4NFR A;  3CCR Z;  2B63 I;  1YIJ Z;  1QF8 A;  4X6A I;  2RPR A;  3S1N I;  4NBH A;  3CD6 Z;  3CCE Z;  5FLX b;  1K73 1;  1SFO I;  5IP7 I;  1K8A 2;  4A3D I;  3VMH A;  3I56 1;  2JA5 I;  4MH4 A;  2OTJ Z;  3G6E Z;  3I55 Z;  1YHQ 1;  2OOX B;  2LW4 A;  3ESW A;  3EER A;  3CMA 1;  3HOZ I;  3S16 I;  3J81 f;  1M90 1;  1RLY A;  3G71 1;  2KI7 B;  3D9X A;  3CCU 1;  2NVT I;  3P5J B;  1RNI A;  3MON A;  3CCL 1;  3NH8 A;  2R92 I;  2W03 A;  3GTQ I;  4RVD A;  3CCJ 1;  4E30 A;  2OZK A;  2YAD A;  3J80 f;  3GTG I;  1KD1 1;  2AKL A;  3NFZ A;  5C3E I;  2K5R A;  2DE5 A;  3MZK B;  1Y1W I;  3CC2 1;  1LQL A;  5D1P A;  1VQ5 Z;  1K73 2;  1JJ2 Z;  3CCS 1;  4Y52 I;  4A3J I;  4BXX I;  1I50 I;  1KRL A;  4A3I I;  1VQ5 1;  4NBF A;  3NDJ A;  3S1M I;  1ENW A;  2V8I A;  4DQY B;  1VQ4 1;  2QKD A;  1YI2 1;  3S17 I;  4BXX X;  4HGY A;  4BY1 X;  3H0G I;  2ZAE B;  3G4S Z;  5IT9 f;  1NP6 A;  3MZL B;  4NB8 A;  3CCS Z;  1YI2 Z;  1VQM Z;  2WB1 A;  1Q86 2;  2JA6 I;  3KIH A;  2F4M A;  1VQN 1;  3J7A 4;  3PO3 I;  3CCM 1;  2GTH A;  2WAQ A;  2KPI A;  4RV9 A;  1K9M 1;  1YJ9 Z;  1Y1V I;  4TNU A;  1KC8 1;  4A3G I;  4RVH A;  4E31 A;  2M48 A;  2PK7 A;  3I56 Z;  4DK1 A;  1VQM 1;  1K8A 1;  4E2Z A;  3T4N B;  4BY7 X;  4E2W A;  2O4H A;  3VMG A;  3HOX I;  1ZH1 A;  1S7M A;  2QA4 Z;  1VQL Z;  2GU2 A;  2JA8 I;  3GKQ A;  1M1K 1;  1Q7Y 1;  2E2J I;  3GTK I;  2PMZ A;  2LIY A;  1QVG Y;  3CCR 1;  3HOW I;  4A3B I;  1WCM I;  3I55 1;  2JR6 A;  1VQ9 1;  3BG0 B;  3VTN A;  2Q51 A;  2V8J A;  1KC8 2;  1WW9 A;  1RO2 A;  2RHB A;  4A3F I;  1YIT 1;  1W2B Y;  2JA7 I;  4MXU A;  2NVQ I;  3CXC Y;  2M6N A;  3Q87 A;  1Z03 A;  4NBA A;  1YJW Z;  2YU9 I;  5T6B A;  1YIJ 1;  1VLA A;  3CCL Z;  1Q81 1;  1USP A;  5C44 I;  3M4O I;  3CPW Z;  1TFI A;  1N8R 1;  2E2I I;  1VQ7 Z;  3NH4 A;  5LL6 f;  1Q86 1;  1VQK Z;  5IT9 b;  1P9N A;  4CL1 A;  1Z02 A;  2W04 A;  3S2D I;  4A3M I;  1TWG I;  2RT9 A;  2DE6 A;  1YUA A;  3JAM f;  1KQS Y;  2P28 A;  1W2B Z;  4E32 A;  3HOV I;  3CMA Z;  3S1R I;  2IZ3 A;  1VQO Z;  3CCV Z;  3F3P C;  4E33 A;  4HH4 A;  3CME 1;  2OTJ 1;  1VQ6 1;  3M3Y I;  2QA4 1;  3CQZ I;  3CCV 1;  3HOU I;  5D1O B;  1ZB8 A;  3VB9 A;  2QEX 1;  2DE7 A;  4NH1 C;  3GTP I;  2OOY B;  1YJ9 1;  3CCE 1;  1QYP A;  1S72 1;  3J81 b;  5AN9 F;  5A2Q f;  5T64 A;  3CD6 1;  3GTO I;  1TWH I;  3GCF A;  5C4X I;  1PFT A;  1JJ2 Y;  2V8K A;  4NBD A;  3GTL I;  1S72 Z;  1Q7Y 2;  1NUI A;  3FKI I;  4XX2 A;  1YJN 1;  3OW2 Y;  1Q82 1;  5C4J I;  4MRI A;  4DGL A;  2R93 I;  1K9M 2;  4QTT A;  4QTU A;  1ML8 A;  4Y7N I;  2E9H A;  2QEX Z;  3U50 C;  4BBR I;  2Y0S A;  4RVG A;  1QVF Z;  3IX0 A;  3CC7 Z;  3IFU A;  4BBS I;  1TWC I;  1K83 I;  4BY7 I;  1DL6 A;  2F4O A;  3FQM A;  1VQO 1;  3NDQ A;  2PM9 A;  2RBL A;  4NOZ A;  2OTL 1;  4NB9 A;  1JWH C;  2VUG A;  3BG1 B;  3GTM I;  2JMO A;  1WII A;  4A3E I;  4NBG A;  3D6W A;  3RZD I;  3FQQ A;  1VQ8 1;  3TE5 B;  4EWC A;  3I4M I;  4BY1 I;  3QWU A;  2NVX I;  3VMI A;  1RQF A;  1KQS Z;  4NBB A;  3CC4 1;  2QRD B;  2H85 A;  4A3L I;  3K7A I;  3CCQ 1;  1NJI 1;  4NBC A;  2NVY I;  1L1O C;  3CC4 Z;  1ZB9 A;  1VQ6 Z;  2QRE B;  1QVF Y;  2O53 A;  4S1T A;  3HKZ A;  1USP B;  1N2F A;  1YJW 1;  5CM2 M;  2RIQ A;  4A3C I;  5FLX f;  1Q82 2;  4NBE A;  1YUK A;  1TWF I;  1RO4 A;  4AYB A;  2K3R A;  3EED A;  2QR1 B;  3CPW Y;  4MON A;  4E2Y A;  2R6M A;  2IZ4 A;  2EGT A;  2HF1 A;  5IP9 I;  1QVG Z;  2VF1 A;  3I4N I;  1VQP 1;  1I3Q I;  1Z01 A;  1VQ7 1;  1YJN Z;  3S15 I;  3G6E 1;  1VQP Z;  5FLM I;  1VQL 1;  3S2H I;  4HGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...