3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
4A3FI 1TFIA 4NB9A 3GTGI 1USPB 1TWCI 3HOYI 1ENWA 2NVQI 4A3CI 2NVTI 2JNYA 2JS4A 1NUIA 2DMEA 3H0GI 1TWGI 1Y1WI 4BXXX 2J6AA 1DL6A 2B63I 3GTMS 2P3YA 4A3LI 3S1MI 4Y52I 4NBHA 2E2II 3U50C 3HOWI 4BY7X 2AKLA 3GKQA 1Y1VS 3GTLI 3VMGA 4BY1I 4A3BI 5CM2M 5C3EI 1RLYA 3M3YI 2RBLA 5C44I 3S14I 4NB8A 4NOZA 3RZOI 4A3DI 2DE5A 1ZB8A 3M4OI 3VMIA 1K83I 3GCFA 4BBRI 3VMHA 3CQZI 2LW4A 4NBGA 4A93I 4NBDA 3GTJI 1RO4A 3Q87A 5IP7I 4QTUA 1I6HI 4Y7NI 4BXXI 2R93I 1I3QI 1N2FA 3PO3I 4NBAA 4NBCA 3FKII 3RZDI 3GTQI 3VB9A 3I07A 2JA5I 4A3EI 2K5RA 1SFOI 1R9TI 3HOVI 2YU9I 1X3ZA 4NBFA 4A3MI 2JA6I 4BY1X 2DE7A 3S16I 4A3KI 1QYPA 1X3WA 4A3GI 3PO3S 1VLAA 2NVXI 3I4MI 3S1RI 2R7ZI 3GTMI 1TWHI 5IP9I 3HOZI 5C4JI 2KPIA 3H3VJ 2F4OA 2PK7A 3PO2I 1PFTA 3S17I 3S2HI 3NDQA 4XX2A 4BY7I 2E2JI 2DE6A 3S2DI 4BBSI 1LQLA 1ZB9A 1ML8A 3K7AI 2R92I 3D6WA 3S15I 3S1QI 4NBEA 5FLMI 3ESWA 2NVYI 4X6AI 4QTTA 1USPA 3S1NI 3GTOI 1WW9A 4MH4A 2JA7I 3I4NI 2HF1A 5C4XI 1Y1VI 1L1OC 1TWAI 1TWFI 2F4MA 4A3II 1WCMI 3HOXI 3GTPI 1YUAA 2JA8I 4A3JI 3HOUI 4NBBA 2VUMI 2JR6A 3LUSA 2BJOA 3EERA 2E2HI 3GTKI 1I50I
chains in the Genus database with same CATH superfamily
3HO8A 3X20B 1H1QB 4NB9A 4DGLA 3CME1 3QWUA 2PMIB 1UGQB 2JNYA 1S7MA 1P9NA 4ROEA 1K9M2 3MZKB 4E33A 2X1NB 1DL6A 5T67A 3DL1A 2QF7A 2P3YA 2Q51A 3JAMf 2V8KA 3G71Z 1OI9B 2AKLA 3BLRB 5HNBB 4Z6YA 4E2WA 1Q861 1D3UB 3VMGA 5DQVA 1YI21 1VQP1 2IV2X 5CM2M 1OL1B 4A3BI 5C3EI 1VQM1 3DOGB 3EEDA 1G3NC 5C44I 1TFBA 3FQQA 2W9ZA 2QLVB 4F7JB 3TW7A 4YOZA 2QDJA 3CD61 1Q822 1ZP2A 4F6WB 5D1OA 4NB8A 2DE5A 2CZ1B 2LFUA 2UUEB 3CCUZ 2ZPEB 3CQZI 3D9XA 2LW4A 2BS2A 1P5EB 3HHTB 2WMAB 4HGYA 2EGTA 2C5NB 5HBJB 4EOLB 2M48A 3GTJI 3QYGB 1VQ7Z 1RO4A 2C5VB 2WIPB 1XO2A 4HLQA 3CCE1 2R93I 1N2FA 2JMOA 2WXVB 3CCMZ 1H1SB 3NH4A 1VQPZ 4NBAA 3BHUB 3CMAZ 1Z02A 3I07A 3TNHB 3CXCY 2DD5B 2K5RA 4ZGEB 3CD6Z 3P5JB 3HOVI 3D2LA 3BG5A 5T64A 4NBFA 4A3MI 4BY1X 4JX5A 3CC4Z 4A3GI 2BS3A 2G2KA 4BCOB 2W04A 2JIMA 4IMYB 4AKHA 1VLAA 2NVXI 3F3PC 3I4MI 5LL6f 3CXCZ 1VQ71 4ZGDB 1VQN1 1JSUB 3J80f 5IP9I 3G6EZ 2KPIA 1VINA 4CFMB 3MY1B 3PO2I 1PFTA 1SIWA 4MD9A 2V22B 1V29B 1GH6B 1KQSY 1LQLA 1ZB9A 4CFUB 3VKHA 1ML8A 3HKZA 2JUBA 3S1QI 3QYBA 2E9HA 4YOOA 1N8R2 3X26B 3S1NI 1KXUA 3BHTB 1WZNA 3IFUA 5EFQB 4MH4A 3CCU1 3S15I 2LEXA 1Y1VI 1TWAI 1YJN1 3G4S1 1WCMI 4HNVA 1C9BA 4CFVB 4NBBA 3BG0B 3CCS1 3LQ5B 3CCVZ 3POMA 3CCM1 1UNGD 1PKDB 2BJOA 3TDHB 1YJ9Z 5D1PA 1W2BY 1Q7Y2 2E2HI 3GTKI 2C6TB 1I50I 2IZ3A 1OKVB 4HL4A 5ICPB 1USPB 4Y72B 3NFZA 1VQ81 4F6UB 1ENWA 2NVQI 2NVTI 2JS4A 2DMEA 2QEXZ 3QHWB 1W2BZ 4BXXX 3DDQB 1O9KB 2V45A 3VYGB 3A8OB 3GTMS 2BKZB 1RQFA 3BLHB 4RVFA 2OTJ1 3G711 5ACBA 1KRLA 5EJCA 2HU9A 3GKQA 1Y1VS 3GTLI 1QMZB 1E9HB 4EC8B 2JIQA 4BY1I 5A2Qb 1VQ91 4AYBA 3WVDB 4MFEA 1K8A1 3A8LB 2RBLA 1O9KA 3G33B 2H85A 2VUGA 4HGZA 3CCL1 3S14I 2QFZA 4ELLA 1AD6A 3RZOI 4NOZA 4A3DI 3VMIA 5A2Qf 3X28B 4AI6A 2AYDA 3VMHA 2O4HA 3KIFA 3EJ1B 2VF1A 4OB3B 1UGPB 1VQ4Z 2VPWA 2PK9B 3Q87A 1I6HI 4F7LB 2W03A 4QTUA 4RVHA 2C5XB 4Y7NI 4BXXI 2IN3A 1YIJ1 2PHGA 2LIYA 3MY5B 4CL1A 1VQL1 1Q7Y1 4MONA 3VB9A 3VYHB 1Q812 1OGUB 3NDIA 1S721 1X0TA 4BCMD 5FGKB 5FLXb 1OIYB 3CCLZ 3QYHB 3I55Z 1SFOI 3CMA1 2D0QB 2UZLB 4CFNB 4FM4B 5LMKB 2BPMB 2ZPBB 4KRCB 1Q16A 3KIHA 1JOWA 3CC41 1FDIA 3S1RI 2G77A 4OGRB 5FLXf 3GTMI 3CCJ1 3TN8B 2QKDA 4BCJB 3HOZI 4CFUD 3S17I 1QXFA 1H1RB 3S2HI 1VQLZ 1JJ2Z 4KRDB 2I3CA 4TTHA 3F5XB 4HNUA 1N4MA 2JGZB 2BS4A 4DK1A 1VQ5Z 5IHYA 4BCNB 3J81f 2QGSA 4HH4A 2ZPGB 4NBEA 3ESWA 1FVVB 2NVYI 1JJ2Y 3QHRB 2WPAB 1USPA 1VQKZ 3I56Z 1VQ61 4CFXB 1M901 2HF1A 2QRDB 1KQSZ 1L1OC 2F4MA 2RT9A 4F7NB 3OW2Z 4ELJA 1ZH1A 1UGSB 1QF8A 1K732 4JX6A 1QVGZ 2JR6A 3RGFB 3CC7Z 4BCMB 5BNJB 2OTL1 3HBLA 4E30A 1QLBA 4I3ZB 3DDPB 4A3FI 4BBRM 5LQFB 1Z01A 5IDNB 1AISB 1TFIA 2G9XB 2OZKA 3OW2Y 3GTGI 2RHBA 3NH8A 3HOYI 2CJMB 1VQOZ 4A3CI 1NP6A 3I551 1OL2B 1NUIA 4OB2B 3H0GI 4NSTB 1OIUB 2CZ7B 2ZPHB 3BG9A 3MZLB 1Y1WI 2J6AA 4EONB 2IW8B 3S1MI 2IZ4A 2W9FA 2WMBB 3CC2Z 3CCEZ 3HOWI 2OTJZ 4BY7X 1F5QB 2Q4ZA 4BCFB 4EWCA 4BCQD 5CYIB 3EIDB 4RODA 2CZ6B 4G6LB 1NJI2 2ZAEB 3KHIA 3BLQB 1H26B 4F7SB 2YADA 3T4NB 2JIOA 4S1TA 2R7GA 1RLYA 2PK2A 3M3YI 3JAMb 1VQ9Z 2PMZA 1FKMA 1UNHD 4ROCA 2VPZA 1YJWZ 2JIPA 1K731 2OOYB 4E2ZA 1AHJB 2F2CA 3QWLA 1K83I 2OOXB 4BBRI 3I561 4DQYB 3M03A 1VQNZ 3CCSZ 1K9M1 3QYEA 1YUKA 4A93I 4NBDA 2KMGA 1H1PB 1BU2A 2W99A 4ZGJB 1I3QI 4LOCA 3TW6A 4MD7A 4CXAB 4BBSM 2Y0SA 5IF1B 1VOLA 2UZEB 2WIHB 4A3EI 2UZBB 3A8MB 1YJW1 4EOOB 3IF8A 2YU9I 1M1K2 3O0GD 1RO0A 2DE7A 4NFRA 1Q821 2CZ0B 2KI7B 1QYPA 4AKGA 2W2HA 3PO3S 1M902 4F70B 4BCPB 3CCJZ 2VPXA 3QZ5B 1JSTB 2UZDB 1TWHI 1YIT1 2OTLZ 5T6BA 5C4JI 2F4OA 3TE5B 2QA4Z 1QVFY 1URCB 3NDQA 1KD11 4EOJB 4NC6A 2DXCB 2E2JI 4BBSI 2JIRA 4II5B 4RVGA 3K7AI 1VQMZ 3BG3A 2R92I 5FLMI 1VQ51 4X6AI 4YOSA 1VQ6Z 2K3RA 1H28B 1WW9A 3QXEB 3I4NI 1GUXA 1H4LD 3QZ9B 1TWFI 5C4XI 2QQ8A 4A3II 1VQK1 3GTPI 3HOXI 4A3LI 3CCQZ 3DJBA 1M1K1 4MXUA 2JA8I 3TNIB 2IW9B 4RV9A 3MI9B 4M6VA 3J81b 1YITZ 3HOUI 2VUMI 2GTHA 2QDYB 1YHQZ 3TNWB 1Z03A 5D1OB 1UNLD 4FX3B 2ZPIB 3EERA 5HVYB 1JKWA 1K8A2 3CMEZ 1OKWB 5CEIB 2KR6A 1TWCI 3B57A 4F6SB 1N8R1 1W98B 4BCHB 3NH5A 2E7ZA 1QVGY 3IX0A 2V8JA 2WB1A 4QSHA 5IDPB 1H24B 5HBEB 5IT9b 2CCHB 4TNUA 1TWGI 3X24B 1VQO1 2ZZDB 2I53A 3F3FC 2B63I 1Q811 2GU2A 3CCQ1 4NBHA 2WAQA 1YJNZ 4Y52I 2CCIB 3CC21 1KC81 2E2II 3U50C 5HQ0B 1VQ41 1YIJZ 3CCV1 1FINB 2P28A 1UGRB 1TD6A 2WHBB 1GY3B 2DXBB 3G6E1 1YJ91 4BCND 4BCIB 1RNIA 2IW6B 3CCR1 1IREB 1AA6A 1FDOA 1H27B 4E2XA 3FQMA 4OB1B 1KC82 1VYWB 4MFDA 3NDJA 4EOSB 2EUFA 1ZB8A 3VTNA 3M4OI 3GCFA 2M6NA 3X25B 4NBGA 4EORB 3BG1B 5DQWA 4CFWB 4UN0A 2QRCB 4E2YA 4EOIB 5IP7I 2RIQA 3K7AM 4MRIA 3HZJA 2W96A 4EOQB 3VKGA 4NH1C 3PO3I 2PJQA 2VPYA 3FKII 1JWHC 4MIMA 4EC9B 1WJ2A 4NBCA 3RZDI 4BCGB 3GTQI 2DPPB 4HNTA 2R6MA 2JA5I 2QR1B 4YC3B 2GTIA 2AHJB 4OB0B 2I40B 1R9TI 1X3ZA 3S16I 2ZCFB 4OR5B 2RPRA 4EOPB 3J80b 4A3KI 1VQ8Z 2JA6I 1X3WA 4EOKB 3H4CA 2QEX1 1GUXB 2V3VA 2ZPFB 2R7ZI 1NJI1 3HB9A 1YHQ1 4BCQB 4AKIA 5AN9F 2WEVB 3J7A4 5L2WB 1RO2A 4MD8A 3CPWY 2O53A 2QA41 3H3VJ 2PK7A 4E32A 1KD12 4CRLB 3CC71 4XX2A 4BY7I 3BHVB 3EOCB 2DE6A 2IVXA 3IR7A 3CCRZ 4E31A 1Y8CA 1S72Z 2WJ9A 3D6WA 2WFYB 3CPWZ 2C4GB 3WVEB 3MONA 2NAPA 2PM9A 4QTTA 1QVFZ 4JX4A 4BCKB 3G4SZ 1WIIA 3GTOI 2JA7I 3S2DI 2CYZB 1YUAA 3MIAB 1Q862 1E7PA 2B9RA 2DD4B 3A8GB 4RS4A 4A3JI 3DTOA 2QREB 2V8IA 3LUSA 4RVDA 1H25B 3A8HB 5IT9f 5HBHB 2C5OB 1YI2Z 5I5ZB 4EOMB
chains in the Genus database with same CATH topology
4NB9A 4DGLA 3CME1 3QWUA 2JNYA 1S7MA 1P9NA 1K9M2 3MZKB 4E33A 1DL6A 5T67A 2P3YA 2Q51A 3JAMf 2V8KA 3G71Z 2AKLA 4E2WA 1Q861 3VMGA 1YI21 1VQP1 4A3BI 5CM2M 5C3EI 1VQM1 3EEDA 5C44I 3FQQA 2QLVB 3CD61 1Q822 5D1OA 4NB8A 2DE5A 2LFUA 3CCUZ 3CQZI 3D9XA 2LW4A 4HGYA 2EGTA 1VQ7Z 2M48A 3GTJI 1RO4A 3CCE1 2R93I 1N2FA 2JMOA 3CCMZ 3NH4A 1VQPZ 4NBAA 3CMAZ 1Z02A 3I07A 3CXCY 2K5RA 3CD6Z 3P5JB 3HOVI 5T64A 4NBFA 4A3MI 4BY1X 3CC4Z 4A3GI 2G2KA 2W04A 1VLAA 2NVXI 3I4MI 3F3PC 5LL6f 3CXCZ 1VQ71 1VQN1 3J80f 5IP9I 3G6EZ 2KPIA 3PO2I 1PFTA 4MD9A 1KQSY 1LQLA 1ZB9A 1ML8A 3HKZA 2JUBA 3S1QI 2E9HA 1N8R2 3S1NI 3IFUA 3CCU1 4MH4A 3S15I 1YJN1 1Y1VI 1TWAI 3G4S1 1WCMI 4NBBA 3BG0B 3CCS1 3CCVZ 3CCM1 2BJOA 3TDHB 1YJ9Z 1W2BY 1Q7Y2 5D1PA 2E2HI 3GTKI 1I50I 2IZ3A 1USPB 3NFZA 1VQ81 1ENWA 2NVQI 2NVTI 2JS4A 2DMEA 2QEXZ 1W2BZ 4BXXX 3GTMS 1RQFA 4RVFA 2OTJ1 3G711 1KRLA 2HU9A 3GKQA 1Y1VS 3GTLI 4BY1I 5A2Qb 1VQ91 4AYBA 1K8A1 2RBLA 2H85A 2VUGA 4HGZA 3CCL1 3S14I 3RZOI 4NOZA 4A3DI 3VMIA 5A2Qf 3VMHA 2O4HA 3KIFA 2VF1A 1VQ4Z 3Q87A 1I6HI 4QTUA 2W03A 4RVHA 4Y7NI 4BXXI 1YIJ1 2LIYA 4CL1A 1VQL1 1Q7Y1 4MONA 3VB9A 1Q812 3NDIA 1S721 1X0TA 3CMA1 5FLXb 3CCLZ 1SFOI 3I55Z 3KIHA 3CC41 3S1RI 5FLXf 3GTMI 3CCJ1 2QKDA 3HOZI 3S17I 3S2HI 1VQLZ 1JJ2Z 2I3CA 4DK1A 1VQ5Z 3J81f 4HH4A 4NBEA 3ESWA 2NVYI 1JJ2Y 1USPA 1VQKZ 3I56Z 1VQ61 1M901 2HF1A 2QRDB 1KQSZ 1L1OC 2F4MA 2RT9A 3OW2Z 1ZH1A 1QF8A 1K732 1QVGZ 2JR6A 3CC7Z 2OTL1 4E30A 4A3FI 1Z01A 1TFIA 2OZKA 3GTGI 3OW2Y 2RHBA 3NH8A 3HOYI 1VQOZ 4A3CI 1NP6A 3I551 1NUIA 3H0GI 3MZLB 1Y1WI 2J6AA 3S1MI 2IZ4A 3CC2Z 3CCEZ 3HOWI 2OTJZ 4BY7X 4EWCA 2Q4ZA 1NJI2 2ZAEB 2YADA 3T4NB 4S1TA 1RLYA 3M3YI 3JAMb 1VQ9Z 2PMZA 1YJWZ 1K731 2OOYB 4E2ZA 1K83I 2OOXB 4BBRI 3I561 4DQYB 1VQNZ 3CCSZ 1K9M1 4A93I 1YUKA 4NBDA 1I3QI 4MD7A 2Y0SA 4A3EI 1YJW1 3IF8A 2YU9I 1M1K2 2DE7A 1RO0A 4NFRA 1Q821 2KI7B 1QYPA 3PO3S 1M902 3CCJZ 1TWHI 1YIT1 2OTLZ 5T6BA 5C4JI 2F4OA 3TE5B 2QA4Z 1QVFY 3NDQA 1KD11 2E2JI 4BBSI 4RVGA 3K7AI 1VQMZ 2R92I 5FLMI 1VQ51 4X6AI 1VQ6Z 2K3RA 1WW9A 3I4NI 5C4XI 4A3II 1TWFI 4A3LI 1VQK1 3GTPI 3HOXI 3CCQZ 1M1K1 4MXUA 2JA8I 4RV9A 3HOUI 3J81b 1YITZ 2VUMI 2GTHA 1YHQZ 1Z03A 5D1OB 3EERA 1K8A2 3CMEZ 1TWCI 1N8R1 3NH5A 1QVGY 3IX0A 2V8JA 2WB1A 5IT9b 4TNUA 1TWGI 1VQO1 3F3FC 2B63I 1Q811 2GU2A 3CCQ1 4NBHA 2WAQA 1YJNZ 4Y52I 3CC21 1KC81 2E2II 3U50C 1VQ41 1YIJZ 3CCV1 2P28A 3G6E1 1YJ91 1RNIA 3CCR1 4E2XA 3FQMA 1KC82 3NDJA 3VTNA 3M4OI 1ZB8A 3GCFA 2M6NA 4NBGA 3BG1B 2QRCB 4E2YA 5IP7I 2RIQA 4MRIA 4NH1C 3PO3I 4NBCA 3FKII 1JWHC 3RZDI 3GTQI 2R6MA 2JA5I 2QR1B 2GTIA 1R9TI 1X3ZA 3S16I 2JA6I 1VQ8Z 2RPRA 3J80b 4A3KI 1X3WA 2QEX1 2R7ZI 1NJI1 1YHQ1 5AN9F 3J7A4 1RO2A 4MD8A 3CPWY 2O53A 2QA41 3H3VJ 2PK7A 4E32A 1KD12 3CC71 4XX2A 4BY7I 2DE6A 3CCRZ 4E31A 1S72Z 3D6WA 3CPWZ 3MONA 2PM9A 4QTTA 1QVFZ 3G4SZ 1WIIA 3GTOI 2JA7I 3S2DI 1YUAA 1Q862 4A3JI 4RS4A 2QREB 2V8IA 3LUSA 4RVDA 5IT9f 1YI2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F I;  1TFI A;  4NB9 A;  3GTG I;  1USP B;  1TWC I;  3HOY I;  1ENW A;  2NVQ I;  4A3C I;  2NVT I;  2JNY A;  2JS4 A;  1NUI A;  2DME A;  3H0G I;  1TWG I;  1Y1W I;  4BXX X;  2J6A A;  1DL6 A;  2B63 I;  3GTM S;  2P3Y A;  4A3L I;  3S1M I;  4Y52 I;  4NBH A;  2E2I I;  3U50 C;  3HOW I;  4BY7 X;  2AKL A;  3GKQ A;  1Y1V S;  3GTL I;  3VMG A;  4BY1 I;  4A3B I;  5CM2 M;  5C3E I;  1RLY A;  3M3Y I;  2RBL A;  5C44 I;  3S14 I;  4NB8 A;  4NOZ A;  3RZO I;  4A3D I;  2DE5 A;  1ZB8 A;  3M4O I;  3VMI A;  1K83 I;  3GCF A;  4BBR I;  3VMH A;  3CQZ I;  2LW4 A;  4NBG A;  4A93 I;  4NBD A;  3GTJ I;  1RO4 A;  3Q87 A;  5IP7 I;  4QTU A;  1I6H I;  4Y7N I;  4BXX I;  2R93 I;  1I3Q I;  1N2F A;  3PO3 I;  4NBA A;  4NBC A;  3FKI I;  3RZD I;  3GTQ I;  3VB9 A;  3I07 A;  2JA5 I;  4A3E I;  2K5R A;  1SFO I;  1R9T I;  3HOV I;  2YU9 I;  1X3Z A;  4NBF A;  4A3M I;  2JA6 I;  4BY1 X;  2DE7 A;  3S16 I;  4A3K I;  1QYP A;  1X3W A;  4A3G I;  3PO3 S;  1VLA A;  2NVX I;  3I4M I;  3S1R I;  2R7Z I;  3GTM I;  1TWH I;  5IP9 I;  3HOZ I;  5C4J I;  2KPI A;  3H3V J;  2F4O A;  2PK7 A;  3PO2 I;  1PFT A;  3S17 I;  3S2H I;  3NDQ A;  4XX2 A;  4BY7 I;  2E2J I;  2DE6 A;  3S2D I;  4BBS I;  1LQL A;  1ZB9 A;  1ML8 A;  3K7A I;  2R92 I;  3D6W A;  3S15 I;  3S1Q I;  4NBE A;  5FLM I;  3ESW A;  2NVY I;  4X6A I;  4QTT A;  1USP A;  3S1N I;  3GTO I;  1WW9 A;  4MH4 A;  2JA7 I;  3I4N I;  2HF1 A;  5C4X I;  1Y1V I;  1L1O C;  1TWA I;  1TWF I;  2F4M A;  4A3I I;  1WCM I;  3HOX I;  3GTP I;  1YUA A;  2JA8 I;  4A3J I;  3HOU I;  4NBB A;  2VUM I;  2JR6 A;  3LUS A;  2BJO A;  3EER A;  2E2H I;  3GTK I;  1I50 I; 
#chains in the Genus database with same CATH topology
 3HO8 A;  3X20 B;  1H1Q B;  4NB9 A;  4DGL A;  3CME 1;  3QWU A;  2PMI B;  1UGQ B;  2JNY A;  1S7M A;  1P9N A;  4ROE A;  1K9M 2;  3MZK B;  4E33 A;  2X1N B;  1DL6 A;  5T67 A;  3DL1 A;  2QF7 A;  2P3Y A;  2Q51 A;  3JAM f;  2V8K A;  3G71 Z;  1OI9 B;  2AKL A;  3BLR B;  5HNB B;  4Z6Y A;  4E2W A;  1Q86 1;  1D3U B;  3VMG A;  5DQV A;  1YI2 1;  1VQP 1;  2IV2 X;  5CM2 M;  1OL1 B;  4A3B I;  5C3E I;  1VQM 1;  3DOG B;  3EED A;  1G3N C;  5C44 I;  1TFB A;  3FQQ A;  2W9Z A;  2QLV B;  4F7J B;  3TW7 A;  4YOZ A;  2QDJ A;  3CD6 1;  1Q82 2;  1ZP2 A;  4F6W B;  5D1O A;  4NB8 A;  2DE5 A;  2CZ1 B;  2LFU A;  2UUE B;  3CCU Z;  2ZPE B;  3CQZ I;  3D9X A;  2LW4 A;  2BS2 A;  1P5E B;  3HHT B;  2WMA B;  4HGY A;  2EGT A;  2C5N B;  5HBJ B;  4EOL B;  2M48 A;  3GTJ I;  3QYG B;  1VQ7 Z;  1RO4 A;  2C5V B;  2WIP B;  1XO2 A;  4HLQ A;  3CCE 1;  2R93 I;  1N2F A;  2JMO A;  2WXV B;  3CCM Z;  1H1S B;  3NH4 A;  1VQP Z;  4NBA A;  3BHU B;  3CMA Z;  1Z02 A;  3I07 A;  3TNH B;  3CXC Y;  2DD5 B;  2K5R A;  4ZGE B;  3CD6 Z;  3P5J B;  3HOV I;  3D2L A;  3BG5 A;  5T64 A;  4NBF A;  4A3M I;  4BY1 X;  4JX5 A;  3CC4 Z;  4A3G I;  2BS3 A;  2G2K A;  4BCO B;  2W04 A;  2JIM A;  4IMY B;  4AKH A;  1VLA A;  2NVX I;  3F3P C;  3I4M I;  5LL6 f;  3CXC Z;  1VQ7 1;  4ZGD B;  1VQN 1;  1JSU B;  3J80 f;  5IP9 I;  3G6E Z;  2KPI A;  1VIN A;  4CFM B;  3MY1 B;  3PO2 I;  1PFT A;  1SIW A;  4MD9 A;  2V22 B;  1V29 B;  1GH6 B;  1KQS Y;  1LQL A;  1ZB9 A;  4CFU B;  3VKH A;  1ML8 A;  3HKZ A;  2JUB A;  3S1Q I;  3QYB A;  2E9H A;  4YOO A;  1N8R 2;  3X26 B;  3S1N I;  1KXU A;  3BHT B;  1WZN A;  3IFU A;  5EFQ B;  4MH4 A;  3CCU 1;  3S15 I;  2LEX A;  1Y1V I;  1TWA I;  1YJN 1;  3G4S 1;  1WCM I;  4HNV A;  1C9B A;  4CFV B;  4NBB A;  3BG0 B;  3CCS 1;  3LQ5 B;  3CCV Z;  3POM A;  3CCM 1;  1UNG D;  1PKD B;  2BJO A;  3TDH B;  1YJ9 Z;  5D1P A;  1W2B Y;  1Q7Y 2;  2E2H I;  3GTK I;  2C6T B;  1I50 I;  2IZ3 A;  1OKV B;  4HL4 A;  5ICP B;  1USP B;  4Y72 B;  3NFZ A;  1VQ8 1;  4F6U B;  1ENW A;  2NVQ I;  2NVT I;  2JS4 A;  2DME A;  2QEX Z;  3QHW B;  1W2B Z;  4BXX X;  3DDQ B;  1O9K B;  2V45 A;  3VYG B;  3A8O B;  3GTM S;  2BKZ B;  1RQF A;  3BLH B;  4RVF A;  2OTJ 1;  3G71 1;  5ACB A;  1KRL A;  5EJC A;  2HU9 A;  3GKQ A;  1Y1V S;  3GTL I;  1QMZ B;  1E9H B;  4EC8 B;  2JIQ A;  4BY1 I;  5A2Q b;  1VQ9 1;  4AYB A;  3WVD B;  4MFE A;  1K8A 1;  3A8L B;  2RBL A;  1O9K A;  3G33 B;  2H85 A;  2VUG A;  4HGZ A;  3CCL 1;  3S14 I;  2QFZ A;  4ELL A;  1AD6 A;  3RZO I;  4NOZ A;  4A3D I;  3VMI A;  5A2Q f;  3X28 B;  4AI6 A;  2AYD A;  3VMH A;  2O4H A;  3KIF A;  3EJ1 B;  2VF1 A;  4OB3 B;  1UGP B;  1VQ4 Z;  2VPW A;  2PK9 B;  3Q87 A;  1I6H I;  4F7L B;  2W03 A;  4QTU A;  4RVH A;  2C5X B;  4Y7N I;  4BXX I;  2IN3 A;  1YIJ 1;  2PHG A;  2LIY A;  3MY5 B;  4CL1 A;  1VQL 1;  1Q7Y 1;  4MON A;  3VB9 A;  3VYH B;  1Q81 2;  1OGU B;  3NDI A;  1S72 1;  1X0T A;  4BCM D;  5FGK B;  5FLX b;  1OIY B;  3CCL Z;  3QYH B;  3I55 Z;  1SFO I;  3CMA 1;  2D0Q B;  2UZL B;  4CFN B;  4FM4 B;  5LMK B;  2BPM B;  2ZPB B;  4KRC B;  1Q16 A;  3KIH A;  1JOW A;  3CC4 1;  1FDI A;  3S1R I;  2G77 A;  4OGR B;  5FLX f;  3GTM I;  3CCJ 1;  3TN8 B;  2QKD A;  4BCJ B;  3HOZ I;  4CFU D;  3S17 I;  1QXF A;  1H1R B;  3S2H I;  1VQL Z;  1JJ2 Z;  4KRD B;  2I3C A;  4TTH A;  3F5X B;  4HNU A;  1N4M A;  2JGZ B;  2BS4 A;  4DK1 A;  1VQ5 Z;  5IHY A;  4BCN B;  3J81 f;  2QGS A;  4HH4 A;  2ZPG B;  4NBE A;  3ESW A;  1FVV B;  2NVY I;  1JJ2 Y;  3QHR B;  2WPA B;  1USP A;  1VQK Z;  3I56 Z;  1VQ6 1;  4CFX B;  1M90 1;  2HF1 A;  2QRD B;  1KQS Z;  1L1O C;  2F4M A;  2RT9 A;  4F7N B;  3OW2 Z;  4ELJ A;  1ZH1 A;  1UGS B;  1QF8 A;  1K73 2;  4JX6 A;  1QVG Z;  2JR6 A;  3RGF B;  3CC7 Z;  4BCM B;  5BNJ B;  2OTL 1;  3HBL A;  4E30 A;  1QLB A;  4I3Z B;  3DDP B;  4A3F I;  4BBR M;  5LQF B;  1Z01 A;  5IDN B;  1AIS B;  1TFI A;  2G9X B;  2OZK A;  3OW2 Y;  3GTG I;  2RHB A;  3NH8 A;  3HOY I;  2CJM B;  1VQO Z;  4A3C I;  1NP6 A;  3I55 1;  1OL2 B;  1NUI A;  4OB2 B;  3H0G I;  4NST B;  1OIU B;  2CZ7 B;  2ZPH B;  3BG9 A;  3MZL B;  1Y1W I;  2J6A A;  4EON B;  2IW8 B;  3S1M I;  2IZ4 A;  2W9F A;  2WMB B;  3CC2 Z;  3CCE Z;  3HOW I;  2OTJ Z;  4BY7 X;  1F5Q B;  2Q4Z A;  4BCF B;  4EWC A;  4BCQ D;  5CYI B;  3EID B;  4ROD A;  2CZ6 B;  4G6L B;  1NJI 2;  2ZAE B;  3KHI A;  3BLQ B;  1H26 B;  4F7S B;  2YAD A;  3T4N B;  2JIO A;  4S1T A;  2R7G A;  1RLY A;  2PK2 A;  3M3Y I;  3JAM b;  1VQ9 Z;  2PMZ A;  1FKM A;  1UNH D;  4ROC A;  2VPZ A;  1YJW Z;  2JIP A;  1K73 1;  2OOY B;  4E2Z A;  1AHJ B;  2F2C A;  3QWL A;  1K83 I;  2OOX B;  4BBR I;  3I56 1;  4DQY B;  3M03 A;  1VQN Z;  3CCS Z;  1K9M 1;  3QYE A;  1YUK A;  4A93 I;  4NBD A;  2KMG A;  1H1P B;  1BU2 A;  2W99 A;  4ZGJ B;  1I3Q I;  4LOC A;  3TW6 A;  4MD7 A;  4CXA B;  4BBS M;  2Y0S A;  5IF1 B;  1VOL A;  2UZE B;  2WIH B;  4A3E I;  2UZB B;  3A8M B;  1YJW 1;  4EOO B;  3IF8 A;  2YU9 I;  1M1K 2;  3O0G D;  1RO0 A;  2DE7 A;  4NFR A;  1Q82 1;  2CZ0 B;  2KI7 B;  1QYP A;  4AKG A;  2W2H A;  3PO3 S;  1M90 2;  4F70 B;  4BCP B;  3CCJ Z;  2VPX A;  3QZ5 B;  1JST B;  2UZD B;  1TWH I;  1YIT 1;  2OTL Z;  5T6B A;  5C4J I;  2F4O A;  3TE5 B;  2QA4 Z;  1QVF Y;  1URC B;  3NDQ A;  1KD1 1;  4EOJ B;  4NC6 A;  2DXC B;  2E2J I;  4BBS I;  2JIR A;  4II5 B;  4RVG A;  3K7A I;  1VQM Z;  3BG3 A;  2R92 I;  5FLM I;  1VQ5 1;  4X6A I;  4YOS A;  1VQ6 Z;  2K3R A;  1H28 B;  1WW9 A;  3QXE B;  3I4N I;  1GUX A;  1H4L D;  3QZ9 B;  1TWF I;  5C4X I;  2QQ8 A;  4A3I I;  1VQK 1;  3GTP I;  3HOX I;  4A3L I;  3CCQ Z;  3DJB A;  1M1K 1;  4MXU A;  2JA8 I;  3TNI B;  2IW9 B;  4RV9 A;  3MI9 B;  4M6V A;  3J81 b;  1YIT Z;  3HOU I;  2VUM I;  2GTH A;  2QDY B;  1YHQ Z;  3TNW B;  1Z03 A;  5D1O B;  1UNL D;  4FX3 B;  2ZPI B;  3EER A;  5HVY B;  1JKW A;  1K8A 2;  3CME Z;  1OKW B;  5CEI B;  2KR6 A;  1TWC I;  3B57 A;  4F6S B;  1N8R 1;  1W98 B;  4BCH B;  3NH5 A;  2E7Z A;  1QVG Y;  3IX0 A;  2V8J A;  2WB1 A;  4QSH A;  5IDP B;  1H24 B;  5HBE B;  5IT9 b;  2CCH B;  4TNU A;  1TWG I;  3X24 B;  1VQO 1;  2ZZD B;  2I53 A;  3F3F C;  2B63 I;  1Q81 1;  2GU2 A;  3CCQ 1;  4NBH A;  2WAQ A;  1YJN Z;  4Y52 I;  2CCI B;  3CC2 1;  1KC8 1;  2E2I I;  3U50 C;  5HQ0 B;  1VQ4 1;  1YIJ Z;  3CCV 1;  1FIN B;  2P28 A;  1UGR B;  1TD6 A;  2WHB B;  1GY3 B;  2DXB B;  3G6E 1;  1YJ9 1;  4BCN D;  4BCI B;  1RNI A;  2IW6 B;  3CCR 1;  1IRE B;  1AA6 A;  1FDO A;  1H27 B;  4E2X A;  3FQM A;  4OB1 B;  1KC8 2;  1VYW B;  4MFD A;  3NDJ A;  4EOS B;  2EUF A;  1ZB8 A;  3VTN A;  3M4O I;  3GCF A;  2M6N A;  3X25 B;  4NBG A;  4EOR B;  3BG1 B;  5DQW A;  4CFW B;  4UN0 A;  2QRC B;  4E2Y A;  4EOI B;  5IP7 I;  2RIQ A;  3K7A M;  4MRI A;  3HZJ A;  2W96 A;  4EOQ B;  3VKG A;  4NH1 C;  3PO3 I;  2PJQ A;  2VPY A;  3FKI I;  1JWH C;  4MIM A;  4EC9 B;  1WJ2 A;  4NBC A;  3RZD I;  4BCG B;  3GTQ I;  2DPP B;  4HNT A;  2R6M A;  2JA5 I;  2QR1 B;  4YC3 B;  2GTI A;  2AHJ B;  4OB0 B;  2I40 B;  1R9T I;  1X3Z A;  3S16 I;  2ZCF B;  4OR5 B;  2RPR A;  4EOP B;  3J80 b;  4A3K I;  1VQ8 Z;  2JA6 I;  1X3W A;  4EOK B;  3H4C A;  2QEX 1;  1GUX B;  2V3V A;  2ZPF B;  2R7Z I;  1NJI 1;  3HB9 A;  1YHQ 1;  4BCQ B;  4AKI A;  5AN9 F;  2WEV B;  3J7A 4;  5L2W B;  1RO2 A;  4MD8 A;  3CPW Y;  2O53 A;  2QA4 1;  3H3V J;  2PK7 A;  4E32 A;  1KD1 2;  4CRL B;  3CC7 1;  4XX2 A;  4BY7 I;  3BHV B;  3EOC B;  2DE6 A;  2IVX A;  3IR7 A;  3CCR Z;  4E31 A;  1Y8C A;  1S72 Z;  2WJ9 A;  3D6W A;  2WFY B;  3CPW Z;  2C4G B;  3WVE B;  3MON A;  2NAP A;  2PM9 A;  4QTT A;  1QVF Z;  4JX4 A;  4BCK B;  3G4S Z;  1WII A;  3GTO I;  2JA7 I;  3S2D I;  2CYZ B;  1YUA A;  3MIA B;  1Q86 2;  1E7P A;  2B9R A;  2DD4 B;  3A8G B;  4RS4 A;  4A3J I;  3DTO A;  2QRE B;  2V8I A;  3LUS A;  4RVD A;  1H25 B;  3A8H B;  5IT9 f;  5HBH B;  2C5O B;  1YI2 Z;  5I5Z B;  4EOM B; 
#chains in the Genus database with same CATH homology
 4NB9 A;  4DGL A;  3CME 1;  3QWU A;  2JNY A;  1S7M A;  1P9N A;  1K9M 2;  3MZK B;  4E33 A;  1DL6 A;  5T67 A;  2P3Y A;  2Q51 A;  3JAM f;  2V8K A;  3G71 Z;  2AKL A;  4E2W A;  1Q86 1;  3VMG A;  1YI2 1;  1VQP 1;  4A3B I;  5CM2 M;  5C3E I;  1VQM 1;  3EED A;  5C44 I;  3FQQ A;  2QLV B;  3CD6 1;  1Q82 2;  5D1O A;  4NB8 A;  2DE5 A;  2LFU A;  3CCU Z;  3CQZ I;  3D9X A;  2LW4 A;  4HGY A;  2EGT A;  1VQ7 Z;  2M48 A;  3GTJ I;  1RO4 A;  3CCE 1;  2R93 I;  1N2F A;  2JMO A;  3CCM Z;  3NH4 A;  1VQP Z;  4NBA A;  3CMA Z;  1Z02 A;  3I07 A;  3CXC Y;  2K5R A;  3CD6 Z;  3P5J B;  3HOV I;  5T64 A;  4NBF A;  4A3M I;  4BY1 X;  3CC4 Z;  4A3G I;  2G2K A;  2W04 A;  1VLA A;  2NVX I;  3I4M I;  3F3P C;  5LL6 f;  3CXC Z;  1VQ7 1;  1VQN 1;  3J80 f;  5IP9 I;  3G6E Z;  2KPI A;  3PO2 I;  1PFT A;  4MD9 A;  1KQS Y;  1LQL A;  1ZB9 A;  1ML8 A;  3HKZ A;  2JUB A;  3S1Q I;  2E9H A;  1N8R 2;  3S1N I;  3IFU A;  3CCU 1;  4MH4 A;  3S15 I;  1YJN 1;  1Y1V I;  1TWA I;  3G4S 1;  1WCM I;  4NBB A;  3BG0 B;  3CCS 1;  3CCV Z;  3CCM 1;  2BJO A;  3TDH B;  1YJ9 Z;  1W2B Y;  1Q7Y 2;  5D1P A;  2E2H I;  3GTK I;  1I50 I;  2IZ3 A;  1USP B;  3NFZ A;  1VQ8 1;  1ENW A;  2NVQ I;  2NVT I;  2JS4 A;  2DME A;  2QEX Z;  1W2B Z;  4BXX X;  3GTM S;  1RQF A;  4RVF A;  2OTJ 1;  3G71 1;  1KRL A;  2HU9 A;  3GKQ A;  1Y1V S;  3GTL I;  4BY1 I;  5A2Q b;  1VQ9 1;  4AYB A;  1K8A 1;  2RBL A;  2H85 A;  2VUG A;  4HGZ A;  3CCL 1;  3S14 I;  3RZO I;  4NOZ A;  4A3D I;  3VMI A;  5A2Q f;  3VMH A;  2O4H A;  3KIF A;  2VF1 A;  1VQ4 Z;  3Q87 A;  1I6H I;  4QTU A;  2W03 A;  4RVH A;  4Y7N I;  4BXX I;  1YIJ 1;  2LIY A;  4CL1 A;  1VQL 1;  1Q7Y 1;  4MON A;  3VB9 A;  1Q81 2;  3NDI A;  1S72 1;  1X0T A;  3CMA 1;  5FLX b;  3CCL Z;  1SFO I;  3I55 Z;  3KIH A;  3CC4 1;  3S1R I;  5FLX f;  3GTM I;  3CCJ 1;  2QKD A;  3HOZ I;  3S17 I;  3S2H I;  1VQL Z;  1JJ2 Z;  2I3C A;  4DK1 A;  1VQ5 Z;  3J81 f;  4HH4 A;  4NBE A;  3ESW A;  2NVY I;  1JJ2 Y;  1USP A;  1VQK Z;  3I56 Z;  1VQ6 1;  1M90 1;  2HF1 A;  2QRD B;  1KQS Z;  1L1O C;  2F4M A;  2RT9 A;  3OW2 Z;  1ZH1 A;  1QF8 A;  1K73 2;  1QVG Z;  2JR6 A;  3CC7 Z;  2OTL 1;  4E30 A;  4A3F I;  1Z01 A;  1TFI A;  2OZK A;  3GTG I;  3OW2 Y;  2RHB A;  3NH8 A;  3HOY I;  1VQO Z;  4A3C I;  1NP6 A;  3I55 1;  1NUI A;  3H0G I;  3MZL B;  1Y1W I;  2J6A A;  3S1M I;  2IZ4 A;  3CC2 Z;  3CCE Z;  3HOW I;  2OTJ Z;  4BY7 X;  4EWC A;  2Q4Z A;  1NJI 2;  2ZAE B;  2YAD A;  3T4N B;  4S1T A;  1RLY A;  3M3Y I;  3JAM b;  1VQ9 Z;  2PMZ A;  1YJW Z;  1K73 1;  2OOY B;  4E2Z A;  1K83 I;  2OOX B;  4BBR I;  3I56 1;  4DQY B;  1VQN Z;  3CCS Z;  1K9M 1;  4A93 I;  1YUK A;  4NBD A;  1I3Q I;  4MD7 A;  2Y0S A;  4A3E I;  1YJW 1;  3IF8 A;  2YU9 I;  1M1K 2;  2DE7 A;  1RO0 A;  4NFR A;  1Q82 1;  2KI7 B;  1QYP A;  3PO3 S;  1M90 2;  3CCJ Z;  1TWH I;  1YIT 1;  2OTL Z;  5T6B A;  5C4J I;  2F4O A;  3TE5 B;  2QA4 Z;  1QVF Y;  3NDQ A;  1KD1 1;  2E2J I;  4BBS I;  4RVG A;  3K7A I;  1VQM Z;  2R92 I;  5FLM I;  1VQ5 1;  4X6A I;  1VQ6 Z;  2K3R A;  1WW9 A;  3I4N I;  5C4X I;  4A3I I;  1TWF I;  4A3L I;  1VQK 1;  3GTP I;  3HOX I;  3CCQ Z;  1M1K 1;  4MXU A;  2JA8 I;  4RV9 A;  3HOU I;  3J81 b;  1YIT Z;  2VUM I;  2GTH A;  1YHQ Z;  1Z03 A;  5D1O B;  3EER A;  1K8A 2;  3CME Z;  1TWC I;  1N8R 1;  3NH5 A;  1QVG Y;  3IX0 A;  2V8J A;  2WB1 A;  5IT9 b;  4TNU A;  1TWG I;  1VQO 1;  3F3F C;  2B63 I;  1Q81 1;  2GU2 A;  3CCQ 1;  4NBH A;  2WAQ A;  1YJN Z;  4Y52 I;  3CC2 1;  1KC8 1;  2E2I I;  3U50 C;  1VQ4 1;  1YIJ Z;  3CCV 1;  2P28 A;  3G6E 1;  1YJ9 1;  1RNI A;  3CCR 1;  4E2X A;  3FQM A;  1KC8 2;  3NDJ A;  3VTN A;  3M4O I;  1ZB8 A;  3GCF A;  2M6N A;  4NBG A;  3BG1 B;  2QRC B;  4E2Y A;  5IP7 I;  2RIQ A;  4MRI A;  4NH1 C;  3PO3 I;  4NBC A;  3FKI I;  1JWH C;  3RZD I;  3GTQ I;  2R6M A;  2JA5 I;  2QR1 B;  2GTI A;  1R9T I;  1X3Z A;  3S16 I;  2JA6 I;  1VQ8 Z;  2RPR A;  3J80 b;  4A3K I;  1X3W A;  2QEX 1;  2R7Z I;  1NJI 1;  1YHQ 1;  5AN9 F;  3J7A 4;  1RO2 A;  4MD8 A;  3CPW Y;  2O53 A;  2QA4 1;  3H3V J;  2PK7 A;  4E32 A;  1KD1 2;  3CC7 1;  4XX2 A;  4BY7 I;  2DE6 A;  3CCR Z;  4E31 A;  1S72 Z;  3D6W A;  3CPW Z;  3MON A;  2PM9 A;  4QTT A;  1QVF Z;  3G4S Z;  1WII A;  3GTO I;  2JA7 I;  3S2D I;  1YUA A;  1Q86 2;  4A3J I;  4RS4 A;  2QRE B;  2V8I A;  3LUS A;  4RVD A;  5IT9 f;  1YI2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...