3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
3S15I 2NVQI 5FLMI 4A3II 2LW4A 3HOXI 3S1RI 1ZB8A 2DE7A 2BJOA 4NBCA 2F4MA 3PO3S 2P3YA 4BBSI 2JNYA 1LQLA 4QTTA 5IP9I 1I6HI 2KPIA 3LUSA 4Y52I 2JS4A 1L1OC 2JA7I 4NBBA 3GTPI 3GTLI 4Y7NI 1VLAA 3D6WA 2NVXI 4NBHA 4A3KI 4A3EI 1Y1WI 4A3MI 4QTUA 1N2FA 1ENWA 2R93I 3M4OI 4NBFA 1I50I 2RBLA 4A3CI 1X3ZA 2E2HI 3S1MI 1TFIA 1ML8A 3Q87A 3VMGA 4NBEA 3M3YI 2JR6A 4BY1I 3I4MI 4XX2A 3K7AI 3HOWI 3EERA 4NBDA 1K83I 1YUAA 4MH4A 3PO2I 1WCMI 1RO4A 2AKLA 5C44I 3H3VJ 2R92I 4NOZA 3CQZI 1TWGI 1DL6A 3GTKI 3RZDI 4BY7I 3GTMS 3S2DI 1NUIA 2R7ZI 3S1NI 3U50C 4NB8A 4A93I 1I3QI 3VMHA 3GTMI 5C4XI 4A3FI 4BXXI 2DE6A 2PK7A 3HOYI 2VUMI 3ESWA 3RZOI 3I4NI 3S2HI 2JA8I 4NBAA 1TWAI 3H0GI 3GTOI 3HOZI 5IP7I 1USPA 1TWCI 3VB9A 1Y1VI 1QYPA 2JA5I 4BY7X 1USPB 1X3WA 1ZB9A 3NDQA 4NB9A 3GCFA 2DMEA 4BBRI 5CM2M 1R9TI 3GKQA 5C3EI 3HOVI 3HOUI 4BXXX 2HF1A 3VMIA 4X6AI 1SFOI 3GTQI 3S16I 5C4JI 1PFTA 1TWFI 4BY1X 3FKII 3PO3I 2F4OA 1TWHI 3GTGI 1RLYA 3I07A 2J6AA 2YU9I 1Y1VS 2B63I 3S14I 4NBGA 2JA6I 4A3DI 2E2JI 2DE5A 3GTJI 4A3JI 4A3GI 2NVTI 3S17I 4A3LI 2K5RA 2E2II 4A3BI 2NVYI 3S1QI 1WW9A
chains in the Genus database with same CATH superfamily
1N8R1 3S15I 3VKHA 2NVQI 4HNVA 3IX0A 3NH8A 3CME1 1FDOA 2WPAB 3S1RI 4BCFB 4CFUD 1UGRB 2F4MA 3BG0B 1FDIA 2I53A 1LQLA 1OIUB 4QTTA 5IP9I 4EC8B 1I6HI 2PK2A 4EOPB 4AYBA 4HNUA 4CFWB 3HHTB 4MFEA 2VPZA 2RHBA 1L1OC 2JA7I 4NBBA 2UZLB 1WIIA 3DDPB 3CC4Z 4EOSB 2M6NA 2NVXI 5T67A 4EWCA 2KR6A 3A8LB 5DQVA 2IW9B 1ENWA 1WZNA 4F7LB 4OB3B 1UGQB 4RVGA 3CCS1 1X3ZA 1K732 2V8IA 1VQ51 1ML8A 3VMGA 3CMAZ 2VF1A 4NBEA 2JR6A 1VQ71 1JSUB 2W2HA 4NBDA 1K83I 3X26B 1VQOZ 2G9XB 2O4HA 1YUAA 4MH4A 4FM4B 1UNGD 1Z02A 2OOXB 1WCMI 1KXUA 4YOZA 3MZKB 2AKLA 1VQ8Z 2GU2A 3QWUA 1VQN1 5ICPB 4NOZA 2C4GB 1JWHC 3QZ9B 2C6TB 3POMA 4OR5B 1YJWZ 4BY7I 3F3PC 1JSTB 2WIHB 1YHQZ 3MY1B 4TNUA 2QKDA 1VQ41 1Q811 2W9ZA 5C4XI 4A3FI 3G4S1 4CRLB 2KMGA 2VUMI 2EGTA 2G77A 3RZOI 3I4NI 1H1RB 4JX5A 2WAQA 5D1PA 1VQ61 3CCLZ 3TN8B 2HU9A 3IR7A 5HBJB 2CYZB 3J80b 3CPWZ 2W96A 3CXCY 2CCIB 4E33A 2QDYB 5IP7I 4JX6A 3NH5A 1USPA 2C5NB 3CCE1 2PMZA 3BLQB 1QYPA 3BG5A 2C5VB 2D0QB 4EOMB 3BHTB 3CCRZ 4BY7X 1USPB 3CCJ1 2NAPA 3BG1B 3GKQA 3CCU1 3DOGB 3HOUI 1QXFA 3MY5B 2UZDB 3X20B 2V3VA 2CZ1B 5LMKB 3CPWY 2YADA 4M6VA 5C4JI 4AKHA 1PFTA 1YJ9Z 5IHYA 4HGZA 4BY1X 3CCQZ 1H28B 3FKII 1YIT1 1UNHD 2F4OA 3BLHB 5IDPB 4RVDA 4HL4A 3I561 2VPXA 1YI21 1Q861 1KQSZ 3A8HB 2B63I 3S14I 3LQ5B 3QYEA 1VQKZ 5FGKB 3QZ5B 4NBGA 2OTL1 2JA6I 2V8JA 4A3GI 2BS4A 1SIWA 3QXEB 2E2II 3WVDB 4HNTA 3NH4A 2I3CA 1Q821 2IW6B 1QVGZ 2WHBB 4EOIB 2WB1A 2M48A 1YJN1 4EOOB 3HOXI 3CCV1 1F5QB 4MONA 1OL1B 3QYGB 3CMEZ 1UGPB 3OW2Y 1KRLA 4MFDA 1O9KA 3DTOA 2ZPHB 4BCJB 4E30A 4AKGA 1UGSB 4Y52I 2IZ4A 1QVFY 1TD6A 5LQFB 2ZPBB 4Y72B 1O9KB 4Y7NI 1VQMZ 5HBEB 2IN3A 3A8OB 4F7JB 4NBHA 3CC21 2OOYB 2X1NB 1N2FA 4E2YA 3M4OI 4NH1C 2DD5B 4F7SB 4NBFA 4E32A 1FVVB 1I50I 2RBLA 4A3CI 2C5OB 5AN9F 4DQYB 2IVXA 3CCSZ 1NJI2 2CZ6B 1TFIA 1YIJ1 3M3YI 2C5XB 3MIAB 4XX2A 1VQ5Z 1K9M2 3I4MI 3DDQB 3NDJA 1VQ7Z 3EERA 3HOWI 3BG9A 1Z03A 1M1K2 2JUBA 4E2XA 1RO4A 5C44I 3TNHB 2DD4B 4UN0A 2R92I 1NP6A 1VQNZ 1K8A2 2ZAEB 4F6UB 3S1NI 3F5XB 2WMAB 1I3QI 4ROEA 1H1PB 2UUEB 3M03A 1VQ4Z 2DE6A 2CJMB 3HOYI 1H24B 1RQFA 3G4SZ 3O0GD 5T64A 3TW6A 2QGSA 1Q16A 4OB0B 4NBAA 1GUXA 4MXUA 4E2WA 1VQ6Z 3H0GI 2JIPA 1JKWA 3BG3A 4EONB 4YOOA 3HOZI 1WJ2A 1VQL1 1N4MA 4I3ZB 4QSHA 2ZZDB 1TWCI 1M902 3CXCZ 1GUXB 3BLRB 3DJBA 3CCEZ 1QLBA 3MI9B 4HLQA 4BBRM 1Q7Y2 2K3RA 1X3WA 4YC3B 4ELJA 4EOLB 4NB9A 2DMEA 3I551 2JIQA 1R9TI 3HOVI 3NFZA 3CCJZ 3VKGA 3CCUZ 3EEDA 1VQ91 4AI6A 3T4NB 3GTQI 1AISB 2E9HA 2F2CA 2KI7B 1W98B 2G2KA 3PO3I 1H26B 1K731 1PKDB 4CFNB 1RLYA 2IW8B 1YITZ 3CC41 4CXAB 2LIYA 3I56Z 1YI2Z 2DXBB 1OL2B 3MONA 2QQ8A 1XO2A 4A3DI 2E2JI 2DE5A 1KD12 1X0TA 3G33B 3MZLB 2OTLZ 2NVTI 1W2BY 1RO0A 3TNIB 5FLMI 4A3II 5BNJB 2LW4A 2WXVB 3DL1A 3P5JB 3J7A4 1YJNZ 1G3NC 2QRDB 2DE7A 3CCVZ 2BJOA 4NBCA 2P3YA 4BBSI 2JNYA 2BS3A 3FQQA 5HVYB 3OW2Z 2KPIA 3BHVB 3LUSA 2JS4A 4BCMB 4E2ZA 3GTPI 2VPYA 1GY3B 2PK9B 3KIHA 3D6WA 2VUGA 1QVFZ 4A3KI 3G71Z 2CZ0B 4BCOB 4ZGEB 3CC2Z 4A3MI 4QTUA 4RV9A 2ZPIB 1H27B 2R93I 4CL1A 4F7NB 3J80f 3TE5B 3BHUB 1VQP1 1ZP2A 4BBSM 1QF8A 5FLXb 2E2HI 3A8MB 2W99A 2RT9A 5D1OA 1V29B 1YIJZ 1KC82 3TNWB 5CYIB 1RO2A 1D3UB 2QDJA 4OGRB 3CCM1 3PO2I 2WMBB 5D1OB 1FKMA 2QFZA 2UZBB 4BCKB 3X24B 3JAMb 3H3VJ 1AD6A 2JGZB 4HGYA 3CC71 3HBLA 1TWGI 1N8R2 3CD61 3GTKI 4IMYB 2Y0SA 5T6BA 2OTJ1 3S2DI 1NUIA 2R7ZI 2V45A 4A93I 3HZJA 1OI9B 4KRDB 5A2Qb 1BU2A 2Q51A 3ESWA 2ZPFB 1YUKA 2R6MA 5LL6f 2QEX1 2Q4ZA 3HB9A 1H1SB 1OGUB 2QA41 4DK1A 2LEXA 1VQK1 4BCIB 2RPRA 3G6E1 1E7PA 2E7ZA 2BPMB 1VQLZ 1P9NA 2QR1B 4BCGB 3NDIA 1E9HB 1TFBA 4BCHB 1Y1VI 2JA5I 2ZPEB 1Z01A 2WFYB 5EJCA 3X25B 1ZB9A 3NDQA 4EORB 3RGFB 4NC6A 4BBRI 5CM2M 2AHJB 2HF1A 3TW7A 5IT9b 3I55Z 3VMIA 1GH6B 4BCQD 2BS2A 1URCB 5HBHB 1SFOI 3EIDB 3D9XA 3JAMf 5I5ZB 3QWLA 1VQ9Z 3D2LA 1TWFI 4ZGJB 3IF8A 3VTNA 2WIPB 1S7MA 4BCQB 1TWHI 4MIMA 1S721 1NJI1 3GTGI 3I07A 3EJ1B 4CFUB 1P5EB 2J6AA 1VQM1 2YU9I 4II5B 1K9M1 1JJ2Y 3A8GB 5A2Qf 2W04A 3KIFA 1Q812 1M1K1 5CEIB 4A3JI 3F3FC 4JX4A 4A3BI 2WJ9A 2NVYI 4MRIA 2I40B 3S1QI 4RS4A 3J81b 4S1TA 4F70B 1W2BZ 1K8A1 2B9RA 1ZB8A 3FQMA 3IFUA 3PO3S 2JIOA 1VINA 4AKIA 4MD7A 1C9BA 2GTIA 2VPWA 2GTHA 4EC9B 5IT9f 2IV2X 5HNBB 5IDNB 3GTLI 2P28A 1VLAA 1Y8CA 2AYDA 3HO8A 5DQWA 2W9FA 3QYBA 4RVFA 4DGLA 4A3EI 1Y1WI 1M901 5L2WB 2PJQA 2DPPB 2PM9A 2QREB 3QYHB 4ELLA 2DXCB 1Q7Y1 2W03A 3CMA1 4RVHA 4EOJB 1H4LD 3S1MI 5IF1B 3Q87A 1QMZB 1VQPZ 2CCHB 4LOCA 4G6LB 4OB2B 4BY1I 1Q862 4ZGDB 4BCMD 1IREB 4FX3B 3K7AI 3KHIA 1VQO1 2PHGA 3QHWB 4F6SB 2H85A 5HQ0B 1VQ81 1VYWB 3J81f 3CCMZ 2OZKA 1AA6A 1YJW1 4CFVB 1Q822 3CQZI 4CFMB 1DL6A 1YHQ1 4F6WB 3RZDI 3QHRB 3GTMS 2V8KA 3CC7Z 3CD6Z 3X28B 3U50C 2OTJZ 2JMOA 4NB8A 3VMHA 3GTMI 4HH4A 4BXXI 1KD11 3TDHB 2PK7A 1VOLA 3K7AM 3CCL1 3S2HI 2JA8I 4NFRA 2QEXZ 2QRCB 5EFQB 2QLVB 1TWAI 2UZEB 3GTOI 4BCPB 4EOKB 2JIRA 3VYGB 2QA4Z 1FINB 4YOSA 3VB9A 4RODA 3G6EZ 1OKWB 2WEVB 5ACBA 2PMIB 1ZH1A 3CCR1 4EOQB 1OIYB 4Z6YA 3HKZA 4ROCA 4MD8A 3GCFA 3B57A 2LFUA 3H4CA 4CFXB 4TTHA 2IZ3A 5C3EI 4BXXX 2BKZB 2O53A 2QF7A 2ZCFB 4X6AI 4OB1B 1YJ91 3S16I 3CCQ1 4NSTB 3EOCB 1OKVB 1JOWA 3WVEB 1KQSY 2V22B 2EUFA 2ZPGB 1S72Z 1H1QB 2CZ7B 3VYHB 1KC81 1RNIA 4BCND 1Y1VS 1AHJB 3G711 2JIMA 4E31A 4KRCB 2R7GA 3GTJI 5FLXf 1QVGY 1JJ2Z 3S17I 4A3LI 2K5RA 4BCNB 1WW9A 2RIQA 1H25B 4MD9A 1UNLD
chains in the Genus database with same CATH topology
1N8R1 3S15I 2NVQI 3IX0A 3NH8A 3CME1 3S1RI 2F4MA 3BG0B 1LQLA 4QTTA 5IP9I 1I6HI 4AYBA 2RHBA 1L1OC 2JA7I 4NBBA 1WIIA 3CC4Z 2M6NA 2NVXI 5T67A 4EWCA 1ENWA 4RVGA 3CCS1 1X3ZA 1K732 2V8IA 1VQ51 1ML8A 3VMGA 3CMAZ 2VF1A 4NBEA 2JR6A 1VQ71 4NBDA 1K83I 1VQOZ 2O4HA 1YUAA 4MH4A 1Z02A 2OOXB 1WCMI 3MZKB 2AKLA 1VQ8Z 2GU2A 3QWUA 1VQN1 4NOZA 1JWHC 1YJWZ 4BY7I 3F3PC 1YHQZ 4TNUA 2QKDA 1VQ41 1Q811 5C4XI 4A3FI 3G4S1 2VUMI 2EGTA 3RZOI 3I4NI 2WAQA 5D1PA 1VQ61 3CCLZ 2HU9A 3J80b 3CPWZ 3CXCY 4E33A 5IP7I 3NH5A 1USPA 3CCE1 2PMZA 1QYPA 3CCRZ 4BY7X 1USPB 3CCJ1 3BG1B 3GKQA 3CCU1 3HOUI 3CPWY 2YADA 5C4JI 1PFTA 1YJ9Z 4HGZA 4BY1X 3CCQZ 3FKII 1YIT1 2F4OA 4RVDA 3I561 1YI21 1Q861 1KQSZ 2B63I 3S14I 1VQKZ 4NBGA 2OTL1 2JA6I 2V8JA 4A3GI 2E2II 3NH4A 2I3CA 1Q821 1QVGZ 2WB1A 2M48A 1YJN1 3HOXI 3CCV1 4MONA 3CMEZ 3OW2Y 1KRLA 4E30A 4Y52I 2IZ4A 1QVFY 1VQMZ 4Y7NI 3CC21 4NBHA 2OOYB 1N2FA 4E2YA 3M4OI 4NH1C 4NBFA 4E32A 1I50I 2RBLA 4A3CI 5AN9F 4DQYB 3CCSZ 1NJI2 1TFIA 1YIJ1 3M3YI 3I4MI 4XX2A 1VQ5Z 1K9M2 3NDJA 1VQ7Z 3EERA 3HOWI 1Z03A 1M1K2 2JUBA 4E2XA 1RO4A 5C44I 2R92I 1NP6A 1VQNZ 1K8A2 2ZAEB 3S1NI 1I3QI 1VQ4Z 2DE6A 3HOYI 1RQFA 3G4SZ 5T64A 4NBAA 4MXUA 4E2WA 1VQ6Z 3H0GI 3HOZI 1VQL1 1TWCI 1M902 3CXCZ 3CCEZ 1Q7Y2 2K3RA 1X3WA 4NB9A 2DMEA 3I551 1R9TI 3HOVI 3NFZA 3CCJZ 3CCUZ 3EEDA 1VQ91 3T4NB 3GTQI 2E9HA 2KI7B 2G2KA 3PO3I 1K731 1RLYA 1YITZ 3CC41 2LIYA 3I56Z 1YI2Z 3MONA 4A3DI 2E2JI 2DE5A 1KD12 1X0TA 3MZLB 2OTLZ 2NVTI 1W2BY 1RO0A 5FLMI 4A3II 2LW4A 3P5JB 3J7A4 1YJNZ 2QRDB 2DE7A 3CCVZ 2BJOA 4NBCA 2P3YA 4BBSI 2JNYA 3FQQA 3OW2Z 2KPIA 3LUSA 2JS4A 4E2ZA 3GTPI 3KIHA 3D6WA 2VUGA 1QVFZ 4A3KI 3G71Z 3CC2Z 4A3MI 4QTUA 4RV9A 2R93I 4CL1A 3J80f 3TE5B 1VQP1 1QF8A 5FLXb 2E2HI 2RT9A 5D1OA 1KC82 1YIJZ 1RO2A 3CCM1 3PO2I 5D1OB 3H3VJ 3JAMb 4HGYA 3CC71 1N8R2 1TWGI 3CD61 3GTKI 2Y0SA 2OTJ1 5T6BA 3S2DI 1NUIA 2R7ZI 4A93I 5A2Qb 2Q51A 3ESWA 1YUKA 2R6MA 5LL6f 2QEX1 2Q4ZA 2QA41 4DK1A 1VQK1 3G6E1 2RPRA 1VQLZ 1P9NA 2QR1B 3NDIA 1Y1VI 2JA5I 1Z01A 1ZB9A 3NDQA 4BBRI 5CM2M 2HF1A 5IT9b 3I55Z 3VMIA 1SFOI 3D9XA 3JAMf 1VQ9Z 1TWFI 3IF8A 3VTNA 1S7MA 1TWHI 1S721 1NJI1 3GTGI 3I07A 2J6AA 2YU9I 1VQM1 1K9M1 1JJ2Y 5A2Qf 2W04A 3KIFA 1Q812 1M1K1 4A3JI 3F3FC 4A3BI 4MRIA 2NVYI 3S1QI 4RS4A 3J81b 4S1TA 1W2BZ 1K8A1 1ZB8A 3FQMA 3IFUA 3PO3S 4MD7A 2GTIA 2GTHA 5IT9f 3GTLI 2P28A 1VLAA 4RVFA 4DGLA 4A3EI 1Y1WI 1M901 2PM9A 2QREB 1Q7Y1 2W03A 3CMA1 4RVHA 3S1MI 3Q87A 1VQPZ 4BY1I 1Q862 1VQO1 3K7AI 2H85A 1VQ81 3J81f 3CCMZ 2OZKA 1YJW1 1Q822 3CQZI 1DL6A 1YHQ1 3RZDI 3GTMS 2V8KA 3CC7Z 3CD6Z 3U50C 2OTJZ 2JMOA 4NB8A 3VMHA 3GTMI 4HH4A 4BXXI 1KD11 3TDHB 2PK7A 3CCL1 3S2HI 2JA8I 4NFRA 2QEXZ 2QRCB 2QLVB 1TWAI 3GTOI 2QA4Z 3VB9A 3G6EZ 1ZH1A 3CCR1 3HKZA 4MD8A 3GCFA 2LFUA 5C3EI 2IZ3A 4BXXX 2O53A 4X6AI 1YJ91 3S16I 3CCQ1 1KQSY 1S72Z 1KC81 1RNIA 1Y1VS 3G711 4E31A 3GTJI 5FLXf 1QVGY 1JJ2Z 3S17I 4A3LI 2K5RA 1WW9A 2RIQA 4MD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S15 I;  2NVQ I;  5FLM I;  4A3I I;  2LW4 A;  3HOX I;  3S1R I;  1ZB8 A;  2DE7 A;  2BJO A;  4NBC A;  2F4M A;  3PO3 S;  2P3Y A;  4BBS I;  2JNY A;  1LQL A;  4QTT A;  5IP9 I;  1I6H I;  2KPI A;  3LUS A;  4Y52 I;  2JS4 A;  1L1O C;  2JA7 I;  4NBB A;  3GTP I;  3GTL I;  4Y7N I;  1VLA A;  3D6W A;  2NVX I;  4NBH A;  4A3K I;  4A3E I;  1Y1W I;  4A3M I;  4QTU A;  1N2F A;  1ENW A;  2R93 I;  3M4O I;  4NBF A;  1I50 I;  2RBL A;  4A3C I;  1X3Z A;  2E2H I;  3S1M I;  1TFI A;  1ML8 A;  3Q87 A;  3VMG A;  4NBE A;  3M3Y I;  2JR6 A;  4BY1 I;  3I4M I;  4XX2 A;  3K7A I;  3HOW I;  3EER A;  4NBD A;  1K83 I;  1YUA A;  4MH4 A;  3PO2 I;  1WCM I;  1RO4 A;  2AKL A;  5C44 I;  3H3V J;  2R92 I;  4NOZ A;  3CQZ I;  1TWG I;  1DL6 A;  3GTK I;  3RZD I;  4BY7 I;  3GTM S;  3S2D I;  1NUI A;  2R7Z I;  3S1N I;  3U50 C;  4NB8 A;  4A93 I;  1I3Q I;  3VMH A;  3GTM I;  5C4X I;  4A3F I;  4BXX I;  2DE6 A;  2PK7 A;  3HOY I;  2VUM I;  3ESW A;  3RZO I;  3I4N I;  3S2H I;  2JA8 I;  4NBA A;  1TWA I;  3H0G I;  3GTO I;  3HOZ I;  5IP7 I;  1USP A;  1TWC I;  3VB9 A;  1Y1V I;  1QYP A;  2JA5 I;  4BY7 X;  1USP B;  1X3W A;  1ZB9 A;  3NDQ A;  4NB9 A;  3GCF A;  2DME A;  4BBR I;  5CM2 M;  1R9T I;  3GKQ A;  5C3E I;  3HOV I;  3HOU I;  4BXX X;  2HF1 A;  3VMI A;  4X6A I;  1SFO I;  3GTQ I;  3S16 I;  5C4J I;  1PFT A;  1TWF I;  4BY1 X;  3FKI I;  3PO3 I;  2F4O A;  1TWH I;  3GTG I;  1RLY A;  3I07 A;  2J6A A;  2YU9 I;  1Y1V S;  2B63 I;  3S14 I;  4NBG A;  2JA6 I;  4A3D I;  2E2J I;  2DE5 A;  3GTJ I;  4A3J I;  4A3G I;  2NVT I;  3S17 I;  4A3L I;  2K5R A;  2E2I I;  4A3B I;  2NVY I;  3S1Q I;  1WW9 A; 
#chains in the Genus database with same CATH topology
 1N8R 1;  3S15 I;  3VKH A;  2NVQ I;  4HNV A;  3IX0 A;  3NH8 A;  3CME 1;  1FDO A;  2WPA B;  3S1R I;  4BCF B;  4CFU D;  1UGR B;  2F4M A;  3BG0 B;  1FDI A;  2I53 A;  1LQL A;  1OIU B;  4QTT A;  5IP9 I;  4EC8 B;  1I6H I;  2PK2 A;  4EOP B;  4AYB A;  4HNU A;  4CFW B;  3HHT B;  4MFE A;  2VPZ A;  2RHB A;  1L1O C;  2JA7 I;  4NBB A;  2UZL B;  1WII A;  3DDP B;  3CC4 Z;  4EOS B;  2M6N A;  2NVX I;  5T67 A;  4EWC A;  2KR6 A;  3A8L B;  5DQV A;  2IW9 B;  1ENW A;  1WZN A;  4F7L B;  4OB3 B;  1UGQ B;  4RVG A;  3CCS 1;  1X3Z A;  1K73 2;  2V8I A;  1VQ5 1;  1ML8 A;  3VMG A;  3CMA Z;  2VF1 A;  4NBE A;  2JR6 A;  1VQ7 1;  1JSU B;  2W2H A;  4NBD A;  1K83 I;  3X26 B;  1VQO Z;  2G9X B;  2O4H A;  1YUA A;  4MH4 A;  4FM4 B;  1UNG D;  1Z02 A;  2OOX B;  1WCM I;  1KXU A;  4YOZ A;  3MZK B;  2AKL A;  1VQ8 Z;  2GU2 A;  3QWU A;  1VQN 1;  5ICP B;  4NOZ A;  2C4G B;  1JWH C;  3QZ9 B;  2C6T B;  3POM A;  4OR5 B;  1YJW Z;  4BY7 I;  3F3P C;  1JST B;  2WIH B;  1YHQ Z;  3MY1 B;  4TNU A;  2QKD A;  1VQ4 1;  1Q81 1;  2W9Z A;  5C4X I;  4A3F I;  3G4S 1;  4CRL B;  2KMG A;  2VUM I;  2EGT A;  2G77 A;  3RZO I;  3I4N I;  1H1R B;  4JX5 A;  2WAQ A;  5D1P A;  1VQ6 1;  3CCL Z;  3TN8 B;  2HU9 A;  3IR7 A;  5HBJ B;  2CYZ B;  3J80 b;  3CPW Z;  2W96 A;  3CXC Y;  2CCI B;  4E33 A;  2QDY B;  5IP7 I;  4JX6 A;  3NH5 A;  1USP A;  2C5N B;  3CCE 1;  2PMZ A;  3BLQ B;  1QYP A;  3BG5 A;  2C5V B;  2D0Q B;  4EOM B;  3BHT B;  3CCR Z;  4BY7 X;  1USP B;  3CCJ 1;  2NAP A;  3BG1 B;  3GKQ A;  3CCU 1;  3DOG B;  3HOU I;  1QXF A;  3MY5 B;  2UZD B;  3X20 B;  2V3V A;  2CZ1 B;  5LMK B;  3CPW Y;  2YAD A;  4M6V A;  5C4J I;  4AKH A;  1PFT A;  1YJ9 Z;  5IHY A;  4HGZ A;  4BY1 X;  3CCQ Z;  1H28 B;  3FKI I;  1YIT 1;  1UNH D;  2F4O A;  3BLH B;  5IDP B;  4RVD A;  4HL4 A;  3I56 1;  2VPX A;  1YI2 1;  1Q86 1;  1KQS Z;  3A8H B;  2B63 I;  3S14 I;  3LQ5 B;  3QYE A;  1VQK Z;  5FGK B;  3QZ5 B;  4NBG A;  2OTL 1;  2JA6 I;  2V8J A;  4A3G I;  2BS4 A;  1SIW A;  3QXE B;  2E2I I;  3WVD B;  4HNT A;  3NH4 A;  2I3C A;  1Q82 1;  2IW6 B;  1QVG Z;  2WHB B;  4EOI B;  2WB1 A;  2M48 A;  1YJN 1;  4EOO B;  3HOX I;  3CCV 1;  1F5Q B;  4MON A;  1OL1 B;  3QYG B;  3CME Z;  1UGP B;  3OW2 Y;  1KRL A;  4MFD A;  1O9K A;  3DTO A;  2ZPH B;  4BCJ B;  4E30 A;  4AKG A;  1UGS B;  4Y52 I;  2IZ4 A;  1QVF Y;  1TD6 A;  5LQF B;  2ZPB B;  4Y72 B;  1O9K B;  4Y7N I;  1VQM Z;  5HBE B;  2IN3 A;  3A8O B;  4F7J B;  4NBH A;  3CC2 1;  2OOY B;  2X1N B;  1N2F A;  4E2Y A;  3M4O I;  4NH1 C;  2DD5 B;  4F7S B;  4NBF A;  4E32 A;  1FVV B;  1I50 I;  2RBL A;  4A3C I;  2C5O B;  5AN9 F;  4DQY B;  2IVX A;  3CCS Z;  1NJI 2;  2CZ6 B;  1TFI A;  1YIJ 1;  3M3Y I;  2C5X B;  3MIA B;  4XX2 A;  1VQ5 Z;  1K9M 2;  3I4M I;  3DDQ B;  3NDJ A;  1VQ7 Z;  3EER A;  3HOW I;  3BG9 A;  1Z03 A;  1M1K 2;  2JUB A;  4E2X A;  1RO4 A;  5C44 I;  3TNH B;  2DD4 B;  4UN0 A;  2R92 I;  1NP6 A;  1VQN Z;  1K8A 2;  2ZAE B;  4F6U B;  3S1N I;  3F5X B;  2WMA B;  1I3Q I;  4ROE A;  1H1P B;  2UUE B;  3M03 A;  1VQ4 Z;  2DE6 A;  2CJM B;  3HOY I;  1H24 B;  1RQF A;  3G4S Z;  3O0G D;  5T64 A;  3TW6 A;  2QGS A;  1Q16 A;  4OB0 B;  4NBA A;  1GUX A;  4MXU A;  4E2W A;  1VQ6 Z;  3H0G I;  2JIP A;  1JKW A;  3BG3 A;  4EON B;  4YOO A;  3HOZ I;  1WJ2 A;  1VQL 1;  1N4M A;  4I3Z B;  4QSH A;  2ZZD B;  1TWC I;  1M90 2;  3CXC Z;  1GUX B;  3BLR B;  3DJB A;  3CCE Z;  1QLB A;  3MI9 B;  4HLQ A;  4BBR M;  1Q7Y 2;  2K3R A;  1X3W A;  4YC3 B;  4ELJ A;  4EOL B;  4NB9 A;  2DME A;  3I55 1;  2JIQ A;  1R9T I;  3HOV I;  3NFZ A;  3CCJ Z;  3VKG A;  3CCU Z;  3EED A;  1VQ9 1;  4AI6 A;  3T4N B;  3GTQ I;  1AIS B;  2E9H A;  2F2C A;  2KI7 B;  1W98 B;  2G2K A;  3PO3 I;  1H26 B;  1K73 1;  1PKD B;  4CFN B;  1RLY A;  2IW8 B;  1YIT Z;  3CC4 1;  4CXA B;  2LIY A;  3I56 Z;  1YI2 Z;  2DXB B;  1OL2 B;  3MON A;  2QQ8 A;  1XO2 A;  4A3D I;  2E2J I;  2DE5 A;  1KD1 2;  1X0T A;  3G33 B;  3MZL B;  2OTL Z;  2NVT I;  1W2B Y;  1RO0 A;  3TNI B;  5FLM I;  4A3I I;  5BNJ B;  2LW4 A;  2WXV B;  3DL1 A;  3P5J B;  3J7A 4;  1YJN Z;  1G3N C;  2QRD B;  2DE7 A;  3CCV Z;  2BJO A;  4NBC A;  2P3Y A;  4BBS I;  2JNY A;  2BS3 A;  3FQQ A;  5HVY B;  3OW2 Z;  2KPI A;  3BHV B;  3LUS A;  2JS4 A;  4BCM B;  4E2Z A;  3GTP I;  2VPY A;  1GY3 B;  2PK9 B;  3KIH A;  3D6W A;  2VUG A;  1QVF Z;  4A3K I;  3G71 Z;  2CZ0 B;  4BCO B;  4ZGE B;  3CC2 Z;  4A3M I;  4QTU A;  4RV9 A;  2ZPI B;  1H27 B;  2R93 I;  4CL1 A;  4F7N B;  3J80 f;  3TE5 B;  3BHU B;  1VQP 1;  1ZP2 A;  4BBS M;  1QF8 A;  5FLX b;  2E2H I;  3A8M B;  2W99 A;  2RT9 A;  5D1O A;  1V29 B;  1YIJ Z;  1KC8 2;  3TNW B;  5CYI B;  1RO2 A;  1D3U B;  2QDJ A;  4OGR B;  3CCM 1;  3PO2 I;  2WMB B;  5D1O B;  1FKM A;  2QFZ A;  2UZB B;  4BCK B;  3X24 B;  3JAM b;  3H3V J;  1AD6 A;  2JGZ B;  4HGY A;  3CC7 1;  3HBL A;  1TWG I;  1N8R 2;  3CD6 1;  3GTK I;  4IMY B;  2Y0S A;  5T6B A;  2OTJ 1;  3S2D I;  1NUI A;  2R7Z I;  2V45 A;  4A93 I;  3HZJ A;  1OI9 B;  4KRD B;  5A2Q b;  1BU2 A;  2Q51 A;  3ESW A;  2ZPF B;  1YUK A;  2R6M A;  5LL6 f;  2QEX 1;  2Q4Z A;  3HB9 A;  1H1S B;  1OGU B;  2QA4 1;  4DK1 A;  2LEX A;  1VQK 1;  4BCI B;  2RPR A;  3G6E 1;  1E7P A;  2E7Z A;  2BPM B;  1VQL Z;  1P9N A;  2QR1 B;  4BCG B;  3NDI A;  1E9H B;  1TFB A;  4BCH B;  1Y1V I;  2JA5 I;  2ZPE B;  1Z01 A;  2WFY B;  5EJC A;  3X25 B;  1ZB9 A;  3NDQ A;  4EOR B;  3RGF B;  4NC6 A;  4BBR I;  5CM2 M;  2AHJ B;  2HF1 A;  3TW7 A;  5IT9 b;  3I55 Z;  3VMI A;  1GH6 B;  4BCQ D;  2BS2 A;  1URC B;  5HBH B;  1SFO I;  3EID B;  3D9X A;  3JAM f;  5I5Z B;  3QWL A;  1VQ9 Z;  3D2L A;  1TWF I;  4ZGJ B;  3IF8 A;  3VTN A;  2WIP B;  1S7M A;  4BCQ B;  1TWH I;  4MIM A;  1S72 1;  1NJI 1;  3GTG I;  3I07 A;  3EJ1 B;  4CFU B;  1P5E B;  2J6A A;  1VQM 1;  2YU9 I;  4II5 B;  1K9M 1;  1JJ2 Y;  3A8G B;  5A2Q f;  2W04 A;  3KIF A;  1Q81 2;  1M1K 1;  5CEI B;  4A3J I;  3F3F C;  4JX4 A;  4A3B I;  2WJ9 A;  2NVY I;  4MRI A;  2I40 B;  3S1Q I;  4RS4 A;  3J81 b;  4S1T A;  4F70 B;  1W2B Z;  1K8A 1;  2B9R A;  1ZB8 A;  3FQM A;  3IFU A;  3PO3 S;  2JIO A;  1VIN A;  4AKI A;  4MD7 A;  1C9B A;  2GTI A;  2VPW A;  2GTH A;  4EC9 B;  5IT9 f;  2IV2 X;  5HNB B;  5IDN B;  3GTL I;  2P28 A;  1VLA A;  1Y8C A;  2AYD A;  3HO8 A;  5DQW A;  2W9F A;  3QYB A;  4RVF A;  4DGL A;  4A3E I;  1Y1W I;  1M90 1;  5L2W B;  2PJQ A;  2DPP B;  2PM9 A;  2QRE B;  3QYH B;  4ELL A;  2DXC B;  1Q7Y 1;  2W03 A;  3CMA 1;  4RVH A;  4EOJ B;  1H4L D;  3S1M I;  5IF1 B;  3Q87 A;  1QMZ B;  1VQP Z;  2CCH B;  4LOC A;  4G6L B;  4OB2 B;  4BY1 I;  1Q86 2;  4ZGD B;  4BCM D;  1IRE B;  4FX3 B;  3K7A I;  3KHI A;  1VQO 1;  2PHG A;  3QHW B;  4F6S B;  2H85 A;  5HQ0 B;  1VQ8 1;  1VYW B;  3J81 f;  3CCM Z;  2OZK A;  1AA6 A;  1YJW 1;  4CFV B;  1Q82 2;  3CQZ I;  4CFM B;  1DL6 A;  1YHQ 1;  4F6W B;  3RZD I;  3QHR B;  3GTM S;  2V8K A;  3CC7 Z;  3CD6 Z;  3X28 B;  3U50 C;  2OTJ Z;  2JMO A;  4NB8 A;  3VMH A;  3GTM I;  4HH4 A;  4BXX I;  1KD1 1;  3TDH B;  2PK7 A;  1VOL A;  3K7A M;  3CCL 1;  3S2H I;  2JA8 I;  4NFR A;  2QEX Z;  2QRC B;  5EFQ B;  2QLV B;  1TWA I;  2UZE B;  3GTO I;  4BCP B;  4EOK B;  2JIR A;  3VYG B;  2QA4 Z;  1FIN B;  4YOS A;  3VB9 A;  4ROD A;  3G6E Z;  1OKW B;  2WEV B;  5ACB A;  2PMI B;  1ZH1 A;  3CCR 1;  4EOQ B;  1OIY B;  4Z6Y A;  3HKZ A;  4ROC A;  4MD8 A;  3GCF A;  3B57 A;  2LFU A;  3H4C A;  4CFX B;  4TTH A;  2IZ3 A;  5C3E I;  4BXX X;  2BKZ B;  2O53 A;  2QF7 A;  2ZCF B;  4X6A I;  4OB1 B;  1YJ9 1;  3S16 I;  3CCQ 1;  4NST B;  3EOC B;  1OKV B;  1JOW A;  3WVE B;  1KQS Y;  2V22 B;  2EUF A;  2ZPG B;  1S72 Z;  1H1Q B;  2CZ7 B;  3VYH B;  1KC8 1;  1RNI A;  4BCN D;  1Y1V S;  1AHJ B;  3G71 1;  2JIM A;  4E31 A;  4KRC B;  2R7G A;  3GTJ I;  5FLX f;  1QVG Y;  1JJ2 Z;  3S17 I;  4A3L I;  2K5R A;  4BCN B;  1WW9 A;  2RIQ A;  1H25 B;  4MD9 A;  1UNL D; 
#chains in the Genus database with same CATH homology
 1N8R 1;  3S15 I;  2NVQ I;  3IX0 A;  3NH8 A;  3CME 1;  3S1R I;  2F4M A;  3BG0 B;  1LQL A;  4QTT A;  5IP9 I;  1I6H I;  4AYB A;  2RHB A;  1L1O C;  2JA7 I;  4NBB A;  1WII A;  3CC4 Z;  2M6N A;  2NVX I;  5T67 A;  4EWC A;  1ENW A;  4RVG A;  3CCS 1;  1X3Z A;  1K73 2;  2V8I A;  1VQ5 1;  1ML8 A;  3VMG A;  3CMA Z;  2VF1 A;  4NBE A;  2JR6 A;  1VQ7 1;  4NBD A;  1K83 I;  1VQO Z;  2O4H A;  1YUA A;  4MH4 A;  1Z02 A;  2OOX B;  1WCM I;  3MZK B;  2AKL A;  1VQ8 Z;  2GU2 A;  3QWU A;  1VQN 1;  4NOZ A;  1JWH C;  1YJW Z;  4BY7 I;  3F3P C;  1YHQ Z;  4TNU A;  2QKD A;  1VQ4 1;  1Q81 1;  5C4X I;  4A3F I;  3G4S 1;  2VUM I;  2EGT A;  3RZO I;  3I4N I;  2WAQ A;  5D1P A;  1VQ6 1;  3CCL Z;  2HU9 A;  3J80 b;  3CPW Z;  3CXC Y;  4E33 A;  5IP7 I;  3NH5 A;  1USP A;  3CCE 1;  2PMZ A;  1QYP A;  3CCR Z;  4BY7 X;  1USP B;  3CCJ 1;  3BG1 B;  3GKQ A;  3CCU 1;  3HOU I;  3CPW Y;  2YAD A;  5C4J I;  1PFT A;  1YJ9 Z;  4HGZ A;  4BY1 X;  3CCQ Z;  3FKI I;  1YIT 1;  2F4O A;  4RVD A;  3I56 1;  1YI2 1;  1Q86 1;  1KQS Z;  2B63 I;  3S14 I;  1VQK Z;  4NBG A;  2OTL 1;  2JA6 I;  2V8J A;  4A3G I;  2E2I I;  3NH4 A;  2I3C A;  1Q82 1;  1QVG Z;  2WB1 A;  2M48 A;  1YJN 1;  3HOX I;  3CCV 1;  4MON A;  3CME Z;  3OW2 Y;  1KRL A;  4E30 A;  4Y52 I;  2IZ4 A;  1QVF Y;  1VQM Z;  4Y7N I;  3CC2 1;  4NBH A;  2OOY B;  1N2F A;  4E2Y A;  3M4O I;  4NH1 C;  4NBF A;  4E32 A;  1I50 I;  2RBL A;  4A3C I;  5AN9 F;  4DQY B;  3CCS Z;  1NJI 2;  1TFI A;  1YIJ 1;  3M3Y I;  3I4M I;  4XX2 A;  1VQ5 Z;  1K9M 2;  3NDJ A;  1VQ7 Z;  3EER A;  3HOW I;  1Z03 A;  1M1K 2;  2JUB A;  4E2X A;  1RO4 A;  5C44 I;  2R92 I;  1NP6 A;  1VQN Z;  1K8A 2;  2ZAE B;  3S1N I;  1I3Q I;  1VQ4 Z;  2DE6 A;  3HOY I;  1RQF A;  3G4S Z;  5T64 A;  4NBA A;  4MXU A;  4E2W A;  1VQ6 Z;  3H0G I;  3HOZ I;  1VQL 1;  1TWC I;  1M90 2;  3CXC Z;  3CCE Z;  1Q7Y 2;  2K3R A;  1X3W A;  4NB9 A;  2DME A;  3I55 1;  1R9T I;  3HOV I;  3NFZ A;  3CCJ Z;  3CCU Z;  3EED A;  1VQ9 1;  3T4N B;  3GTQ I;  2E9H A;  2KI7 B;  2G2K A;  3PO3 I;  1K73 1;  1RLY A;  1YIT Z;  3CC4 1;  2LIY A;  3I56 Z;  1YI2 Z;  3MON A;  4A3D I;  2E2J I;  2DE5 A;  1KD1 2;  1X0T A;  3MZL B;  2OTL Z;  2NVT I;  1W2B Y;  1RO0 A;  5FLM I;  4A3I I;  2LW4 A;  3P5J B;  3J7A 4;  1YJN Z;  2QRD B;  2DE7 A;  3CCV Z;  2BJO A;  4NBC A;  2P3Y A;  4BBS I;  2JNY A;  3FQQ A;  3OW2 Z;  2KPI A;  3LUS A;  2JS4 A;  4E2Z A;  3GTP I;  3KIH A;  3D6W A;  2VUG A;  1QVF Z;  4A3K I;  3G71 Z;  3CC2 Z;  4A3M I;  4QTU A;  4RV9 A;  2R93 I;  4CL1 A;  3J80 f;  3TE5 B;  1VQP 1;  1QF8 A;  5FLX b;  2E2H I;  2RT9 A;  5D1O A;  1KC8 2;  1YIJ Z;  1RO2 A;  3CCM 1;  3PO2 I;  5D1O B;  3H3V J;  3JAM b;  4HGY A;  3CC7 1;  1N8R 2;  1TWG I;  3CD6 1;  3GTK I;  2Y0S A;  2OTJ 1;  5T6B A;  3S2D I;  1NUI A;  2R7Z I;  4A93 I;  5A2Q b;  2Q51 A;  3ESW A;  1YUK A;  2R6M A;  5LL6 f;  2QEX 1;  2Q4Z A;  2QA4 1;  4DK1 A;  1VQK 1;  3G6E 1;  2RPR A;  1VQL Z;  1P9N A;  2QR1 B;  3NDI A;  1Y1V I;  2JA5 I;  1Z01 A;  1ZB9 A;  3NDQ A;  4BBR I;  5CM2 M;  2HF1 A;  5IT9 b;  3I55 Z;  3VMI A;  1SFO I;  3D9X A;  3JAM f;  1VQ9 Z;  1TWF I;  3IF8 A;  3VTN A;  1S7M A;  1TWH I;  1S72 1;  1NJI 1;  3GTG I;  3I07 A;  2J6A A;  2YU9 I;  1VQM 1;  1K9M 1;  1JJ2 Y;  5A2Q f;  2W04 A;  3KIF A;  1Q81 2;  1M1K 1;  4A3J I;  3F3F C;  4A3B I;  4MRI A;  2NVY I;  3S1Q I;  4RS4 A;  3J81 b;  4S1T A;  1W2B Z;  1K8A 1;  1ZB8 A;  3FQM A;  3IFU A;  3PO3 S;  4MD7 A;  2GTI A;  2GTH A;  5IT9 f;  3GTL I;  2P28 A;  1VLA A;  4RVF A;  4DGL A;  4A3E I;  1Y1W I;  1M90 1;  2PM9 A;  2QRE B;  1Q7Y 1;  2W03 A;  3CMA 1;  4RVH A;  3S1M I;  3Q87 A;  1VQP Z;  4BY1 I;  1Q86 2;  1VQO 1;  3K7A I;  2H85 A;  1VQ8 1;  3J81 f;  3CCM Z;  2OZK A;  1YJW 1;  1Q82 2;  3CQZ I;  1DL6 A;  1YHQ 1;  3RZD I;  3GTM S;  2V8K A;  3CC7 Z;  3CD6 Z;  3U50 C;  2OTJ Z;  2JMO A;  4NB8 A;  3VMH A;  3GTM I;  4HH4 A;  4BXX I;  1KD1 1;  3TDH B;  2PK7 A;  3CCL 1;  3S2H I;  2JA8 I;  4NFR A;  2QEX Z;  2QRC B;  2QLV B;  1TWA I;  3GTO I;  2QA4 Z;  3VB9 A;  3G6E Z;  1ZH1 A;  3CCR 1;  3HKZ A;  4MD8 A;  3GCF A;  2LFU A;  5C3E I;  2IZ3 A;  4BXX X;  2O53 A;  4X6A I;  1YJ9 1;  3S16 I;  3CCQ 1;  1KQS Y;  1S72 Z;  1KC8 1;  1RNI A;  1Y1V S;  3G71 1;  4E31 A;  3GTJ I;  5FLX f;  1QVG Y;  1JJ2 Z;  3S17 I;  4A3L I;  2K5R A;  1WW9 A;  2RIQ A;  4MD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...