3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
b'KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
3GCFA 3I4NI 3GTMI 2R7ZI 2JR6A 4NOZA 4BY1I 2NVTI 3VMIA 2E2HI 4BBSI 4BY7I 3GTGI 1X3WA 3Q87A 3GTPI 3S1RI 3GTJI 2DE7A 2JNYA 2DMEA 3GTKI 5CM2M 1R9TI 1RO4A 3H3VJ 2DE6A 3M4OI 1DL6A 3GTOI 1WW9A 2E2JI 3HOUI 3S1QI 5C44I 2DE5A 2JA8I 2B63I 1VLAA 4A3JI 3NDQA 1TWGI 4NB8A 4NBAA 4A3EI 1ZB9A 2BJOA 3S1NI 1YUAA 3HOVI 3H0GI 3M3YI 1TFIA 4NBBA 2NVQI 4A93I 3LUSA 3K7AI 4BY1X 3PO3S 1USPB 1ZB8A 3ESWA 3PO2I 4QTTA 1I6HI 4A3FI 1ML8A 1K83I 1WCMI 3GTLI 3S2HI 4NBEA 1ENWA 3VMHA 1SFOI 3GKQA 5C4JI 3S16I 2J6AA 2P3YA 4XX2A 3VMGA 2JA7I 1I50I 3S15I 3S17I 4A3DI 4Y52I 2YU9I 2VUMI 2LW4A 3EERA 2JA5I 4A3LI 2PK7A 4QTUA 4A3KI 2R93I 4BXXI 3S1MI 1Y1VS 3GTQI 1RLYA 3RZDI 4A3II 1N2FA 3I4MI 2NVXI 4A3BI 2E2II 4NBHA 5C4XI 4BY7X 4A3MI 3RZOI 1NUIA 1TWCI 3FKII 4NBFA 1QYPA 3GTMS 5C3EI 3PO3I 4A3CI 1L1OC 5IP9I 4Y7NI 3S14I 3S2DI 2R92I 4BBRI 4A3GI 1LQLA 1X3ZA 1PFTA 4X6AI 1I3QI 5IP7I 3HOYI 4NB9A 1USPA 2NVYI 4NBCA 4NBGA 4NBDA 4MH4A 3I07A 1TWHI 2HF1A 2K5RA 1Y1VI 3CQZI 5FLMI 3HOWI 1TWFI 4BXXX 2JA6I 3D6WA 1TWAI 3U50C 1Y1WI 3VB9A 2F4OA 2JS4A 2AKLA 2KPIA 3HOZI 2RBLA 3HOXI 2F4MA
chains in the Genus database with same CATH superfamily
3QWUA 5HVYB 3X20B 3J80b 3CXCY 3WVEB 4HGYA 1M1K2 3CCE1 3QXEB 4TNUA 2Q4ZA 5CYIB 3S1RI 2IW9B 2IN3A 2JNYA 2UZDB 2KI7B 2PJQA 3O0GD 2DE6A 3VKHA 1O9KB 4ELJA 1DL6A 1YJNZ 3A8OB 3BLHB 3TN8B 3F3PC 3HOUI 3M03A 5C44I 1VQM1 2RIQA 3NDJA 1VLAA 4A3JI 3JAMf 3CMAZ 4BCNB 1VQ91 4YOSA 2CCIB 2W03A 4CFXB 1E7PA 3M3YI 4EORB 2V22B 2QEXZ 2EUFA 3QYHB 5ACBA 4YC3B 5EJCA 1VQ8Z 3HKZA 3CCL1 2W9ZA 1WJ2A 5IT9f 2WMBB 3TW6A 4BCJB 2WFYB 3CPWY 2CZ7B 2QF7A 4BY1X 2DPPB 4QSHA 1USPB 3I551 3G6E1 2H85A 1M901 1VQP1 3CCVZ 3DDQB 4QTTA 4OR5B 4LOCA 4CXAB 4MFDA 2CCHB 1ENWA 3VMHA 1H24B 1SFOI 4BCQB 5C4JI 4F6WB 2J6AA 2P3YA 5FLXb 3BLRB 1NJI2 4XX2A 3S15I 2C5OB 2VPZA 4Y52I 2ZZDB 2DD4B 2LW4A 2UZEB 3I56Z 1KC81 1GUXB 3LQ5B 4EOIB 3TNHB 3A8MB 4A3LI 4EONB 1VQ71 1GY3B 2C6TB 4BXXI 3BG5A 1AISB 1AD6A 2C5VB 5CEIB 3G4SZ 3GTQI 2M48A 3RZDI 4OGRB 1Y8CA 3I4MI 1XO2A 1YJ91 1G3NC 1VQ4Z 4A3BI 2E9HA 4Z6YA 1VQN1 2I40B 4A3MI 1FDOA 1K731 1QVFZ 2OTJ1 3QYEA 1JSUB 1QYPA 5ICPB 5C3EI 3PO3I 4E2ZA 3DJBA 4A3CI 3WVDB 4ROCA 2X1NB 4E2WA 2OOYB 3S2DI 2R92I 3DTOA 4HNUA 5LQFB 4BBRI 1F5QB 1H1PB 1JWHC 2JMOA 1S721 4BCND 2WMAB 1FDIA 1K9M2 3A8LB 3MZLB 2CZ6B 4X6AI 1I3QI 2ZPGB 1OGUB 2LIYA 4NB9A 1YIJZ 1Q862 2R7GA 4MRIA 2ZAEB 3F5XB 1H1QB 1Y1VI 4FX3B 5FLMI 1M1K1 2JUBA 3CC2Z 1OKVB 2WIPB 2QREB 2I3CA 3OW2Z 4AKIA 4OB0B 2W9FA 2AKLA 1YJW1 5T67A 2D0QB 1VQOZ 3HOZI 4AYBA 4NBDA 5D1OB 1Q812 3TW7A 3EEDA 5FLXf 5HBJB 4II5B 2QLVB 3K7AM 3X28B 2I53A 4BCQD 4F6SB 2WJ9A 2LFUA 3GTGI 4F70B 3GTPI 3NH4A 2DE7A 2C5XB 3CC4Z 2DMEA 2WB1A 4NFRA 5HBHB 1RO2A 3H3VJ 5D1PA 2IZ4A 3CXCZ 2YADA 1PKDB 2QDJA 1K8A2 2OTLZ 3MY5B 2E2JI 1TFBA 3CCUZ 1VQLZ 2C5NB 1Q16A 2B63I 2K3RA 3NDQA 5A2Qb 2GTHA 3T4NB 3VKGA 3MZKB 1Z03A 3FQQA 4CL1A 4E2YA 1FKMA 2Y0SA 3CCM1 4F7SB 2QKDA 4EC9B 3TE5B 4KRCB 3CCRZ 5HBEB 1NJI1 3K7AI 4EOKB 1N8R2 1ZB8A 3X26B 1JSTB 4A3FI 2V3VA 2G77A 4IMYB 1K83I 2HU9A 3S2HI 3GTLI 4MD7A 3CPWZ 1GH6B 4CFMB 3S16I 3VYGB 3NFZA 4EWCA 3S17I 2CZ0B 2PMZA 3EERA 5LL6f 1QLBA 2PK7A 4QTUA 3HBLA 4A3KI 2R93I 1X0TA 3H4CA 1YJN1 3S1MI 3QHWB 2WPAB 2UZBB 1RLYA 2BS4A 3J81f 5DQVA 2QR1B 4A3II 2QQ8A 2LEXA 3BHVB 3CMA1 1RO0A 1OL1B 2RHBA 2IV2X 1VOLA 1C9BA 4BY7X 2QEX1 4JX4A 3RZOI 1NUIA 2KR6A 1TWCI 3FKII 1JKWA 4NBFA 2QA4Z 1VQ81 3GTMS 4DQYB 2O4HA 3TNIB 1H1RB 1L1OC 1ZP2A 2IZ3A 3CC7Z 3EIDB 1IREB 4Y7NI 3EJ1B 3NH5A 5IHYA 2NAPA 3CCJZ 1VQ6Z 5A2Qf 3QHRB 4EOQB 3CCV1 4HL4A 3IFUA 3CD6Z 1AA6A 5IF1B 2PMIB 1H27B 2ZPEB 1N4MA 3G71Z 1JOWA 3TDHB 3KIFA 1USPA 2NVYI 3BG0B 4NBCA 3HOYI 2QRCB 4MH4A 1TD6A 3IX0A 4BXXX 3I561 1TWAI 3CMEZ 1Y1WI 1UNHD 4CFUB 3VB9A 2VF1A 3VTNA 2F4OA 5HQ0B 2JS4A 2C4GB 3DL1A 2BKZB 3EOCB 3G4S1 3BHUB 4BCHB 2ZPBB 4HNVA 1Z02A 3NH8A 2RT9A 1KQSY 2W04A 3G711 1VQ41 3DOGB 4MIMA 2V8IA 3GCFA 3I4NI 1P9NA 2W96A 5T6BA 4HNTA 1QVGY 1OIYB 1K8A1 2NVTI 2E2HI 4BCOB 2CJMB 4MD9A 3BG3A 4OB1B 2IVXA 2OZKA 1H1SB 3FQMA 4EOPB 1R9TI 4CFNB 1YHQZ 3KHIA 1OIUB 3TNWB 4ZGDB 4EOLB 4AI6A 3A8HB 4RVGA 1WW9A 3GTOI 1JJ2Y 2R6MA 2ZPHB 3D9XA 4NBAA 1ZB9A 2G9XB 1VYWB 5HNBB 2BJOA 1N8R1 2PM9A 1VQKZ 1YIJ1 3A8GB 1YUAA 1M902 3H0GI 3MONA 1VQ5Z 3HOVI 1TFIA 1UNGD 4YOOA 2GTIA 2M6NA 3CC21 3J81b 2W2HA 1RQFA 3LUSA 4F7LB 5I5ZB 3CCQZ 2ZPFB 4RVHA 4MONA 2EGTA 2Q51A 1VQO1 4AKGA 2AYDA 2CYZB 1QXFA 1KC82 2W99A 3ESWA 4FM4B 3F3FC 1Z01A 4BCPB 2JIPA 1YUKA 4YOZA 4BCGB 1ML8A 4ZGEB 1I6HI 1OI9B 1KXUA 5D1OA 3CC41 2JIQA 1D3UB 4DK1A 3VMGA 1I50I 4CFUD 2YU9I 1BU2A 1Q7Y2 1W2BY 3X24B 4ZGJB 2OTL1 2JGZB 3NDIA 3CCU1 1VQL1 1N2FA 1YI2Z 1UGQB 3G33B 3MIAB 4F7JB 2QFZA 4CFVB 2QDYB 4OB3B 2E2II 2DXCB 2PHGA 4AKHA 4NBHA 2GU2A 1Q822 3CCEZ 2DXBB 4NSTB 4E31A 4HH4A 4DGLA 1V29B 4BCMB 4HLQA 4RVDA 3RGFB 4EOMB 2PK2A 5BNJB 4EOJB 4BBSM 2G2KA 4E33A 2E7ZA 3CCR1 5IDNB 4I3ZB 4CRLB 4EOSB 4E2XA 5DQWA 4A3GI 1VQMZ 3HZJA 1X3ZA 3KIHA 1PFTA 5EFQB 4E32A 1VQ9Z 5L2WB 1OKWB 3DDPB 1S7MA 2RPRA 1O9KA 1AHJB 3CQZI 2IW6B 1H26B 1TWFI 2JA6I 4F7NB 3D6WA 3CCLZ 4RV9A 4NC6A 1QF8A 1K9M1 3P5JB 2UZLB 4TTHA 3HB9A 2AHJB 2RBLA 3I55Z 3G6EZ 1Q861 1KRLA 1KD12 1VQPZ 3GTMI 2R7ZI 2JR6A 4NOZA 4BY1I 4UN0A 3VMIA 3BHTB 4EC8B 4BBSI 3J7A4 4BY7I 2BS2A 3IF8A 4G6LB 1X3WA 3Q87A 1WZNA 2DD5B 2P28A 3GTJI 1KQSZ 2QA41 2ZPIB 1W98B 2ZCFB 5CM2M 3GTKI 1RO4A 3BLQB 2V8JA 3CC71 1Q811 3M4OI 1QVGZ 1UGSB 1VQ7Z 2JIRA 3CCJ1 1VQ61 4RODA 3VYHB 1H4LD 5FGKB 3S1QI 1OL2B 2DE5A 1YJ9Z 2JA8I 4BBRM 2BS3A 3QWLA 3CD61 1VINA 4RS4A 2QRDB 1TWGI 2B9RA 4NB8A 4A3EI 3S1NI 3BG9A 1QMZB 1VQNZ 1GUXA 1RNIA 1FVVB 4BCMD 2OTJZ 4NBBA 1JJ2Z 3J80f 1NP6A 2NVQI 3MI9B 1UGRB 4BCKB 1URCB 3CME1 4A93I 2V45A 3QZ5B 4JX5A 5LMKB 2JIOA 2KMGA 4Y72B 4ROEA 4CFWB 3POMA 2WEVB 2IW8B 3PO3S 1WIIA 2V8KA 4E30A 1Q7Y1 3MY1B 3PO2I 1YITZ 1S72Z 4JX6A 2VPXA 4EOOB 1WCMI 3BG1B 4NBEA 2PK9B 2BPMB 2WHBB 1H25B 3GKQA 1UNLD 2JA7I 3QYGB 2WAQA 4MFEA 4A3DI 2VUMI 1YHQ1 1Q821 2JA5I 1YIT1 1YJWZ 1Y1VS 4RVFA 1QVFY 3CCSZ 3B57A 3IR7A 3X25B 3HO8A 2NVXI 4HGZA 5IDPB 2UUEB 1VQK1 1W2BZ 4OB2B 5C4XI 1VQ51 2VPWA 5T64A 3JAMb 2WXVB 2OOXB 2VUGA 4NH1C 1FINB 3CCS1 4M6VA 4F6UB 3CCQ1 4KRDB 5IP9I 3S14I 4ELLA 4BCIB 2WIHB 5IT9b 1LQLA 4MXUA 1SIWA 1E9HB 5AN9F 1K732 1ZH1A 3OW2Y 2F2CA 5IP7I 3QYBA 1KD11 4NBGA 2QGSA 2VPYA 3I07A 1TWHI 2HF1A 2K5RA 3QZ9B 3HOWI 4S1TA 3CCMZ 3U50C 3HHTB 2CZ1B 2KPIA 2O53A 1H28B 1P5EB 4BCFB 1YI21 4MD8A 3HOXI 3D2LA 2JIMA 2F4MA 1UGPB
chains in the Genus database with same CATH topology
3QWUA 3J80b 1M1K2 3CXCY 4HGYA 3CCE1 4TNUA 2Q4ZA 3S1RI 2JNYA 2KI7B 2DE6A 1DL6A 1YJNZ 3F3PC 3HOUI 5C44I 1VQM1 2RIQA 3NDJA 1VLAA 4A3JI 3JAMf 3CMAZ 1VQ91 2W03A 3M3YI 2QEXZ 1VQ8Z 3HKZA 3CCL1 5IT9f 3CPWY 4BY1X 3I551 1USPB 3G6E1 2H85A 1M901 1VQP1 3CCVZ 4QTTA 1ENWA 3VMHA 1SFOI 5C4JI 2J6AA 2P3YA 5FLXb 1NJI2 4XX2A 3S15I 4Y52I 2LW4A 1KC81 3I56Z 4A3LI 1VQ71 4BXXI 3G4SZ 3GTQI 2M48A 3RZDI 3I4MI 1YJ91 1VQ4Z 4A3BI 2E9HA 1VQN1 4A3MI 1K731 1QVFZ 2OTJ1 1QYPA 5C3EI 3PO3I 4E2ZA 4A3CI 4E2WA 2OOYB 3S2DI 2R92I 4BBRI 1JWHC 2JMOA 1S721 1K9M2 3MZLB 4X6AI 1I3QI 4NB9A 2LIYA 1YIJZ 1Q862 4MRIA 2ZAEB 1Y1VI 5FLMI 1M1K1 2JUBA 3CC2Z 2QREB 2I3CA 3OW2Z 2AKLA 1YJW1 5T67A 1VQOZ 3HOZI 4AYBA 4NBDA 5D1OB 1Q812 3EEDA 5FLXf 2QLVB 2LFUA 3GTGI 3GTPI 3NH4A 2DE7A 3CC4Z 2DMEA 2WB1A 4NFRA 1RO2A 3H3VJ 5D1PA 2IZ4A 3CXCZ 2YADA 1K8A2 2OTLZ 2E2JI 3CCUZ 1VQLZ 2B63I 2K3RA 3NDQA 5A2Qb 2GTHA 3T4NB 3MZKB 1Z03A 3FQQA 4CL1A 4E2YA 2Y0SA 3CCM1 2QKDA 3TE5B 3CCRZ 1NJI1 3K7AI 1N8R2 1ZB8A 4A3FI 1K83I 2HU9A 3S2HI 3GTLI 4MD7A 3CPWZ 3S16I 3NFZA 4EWCA 3S17I 2PMZA 3EERA 5LL6f 2PK7A 4QTUA 4A3KI 2R93I 1X0TA 1YJN1 3S1MI 1RLYA 3J81f 4A3II 2QR1B 3CMA1 1RO0A 2RHBA 4BY7X 2QEX1 3RZOI 1NUIA 1TWCI 3FKII 2QA4Z 4NBFA 1VQ81 3GTMS 4DQYB 2O4HA 1L1OC 2IZ3A 3CC7Z 4Y7NI 3NH5A 3CCJZ 1VQ6Z 5A2Qf 3CCV1 3CD6Z 3IFUA 3G71Z 3TDHB 3HOYI 3KIFA 1USPA 2NVYI 3BG0B 4NBCA 2QRCB 4MH4A 3IX0A 4BXXX 3I561 1TWAI 3CMEZ 1Y1WI 3VTNA 3VB9A 2VF1A 2F4OA 2JS4A 3G4S1 3NH8A 1Z02A 1KQSY 2RT9A 2W04A 3G711 1VQ41 2V8IA 3GCFA 3I4NI 1P9NA 5T6BA 1QVGY 1K8A1 2NVTI 2E2HI 4MD9A 2OZKA 3FQMA 1R9TI 1YHQZ 4RVGA 1WW9A 3GTOI 1JJ2Y 2R6MA 3D9XA 4NBAA 1ZB9A 1N8R1 1VQKZ 2BJOA 2PM9A 1YIJ1 1YUAA 1M902 3H0GI 3MONA 1VQ5Z 3HOVI 1TFIA 2GTIA 2M6NA 3CC21 3J81b 1RQFA 3LUSA 3CCQZ 4RVHA 4MONA 2EGTA 2Q51A 1VQO1 1KC82 3ESWA 3F3FC 1Z01A 1I6HI 1YUKA 1ML8A 5D1OA 3CC41 4DK1A 3VMGA 1I50I 2YU9I 1Q7Y2 1W2BY 2OTL1 3CCU1 3NDIA 1VQL1 1N2FA 1YI2Z 2E2II 4NBHA 2GU2A 1Q822 3CCEZ 4E31A 4HH4A 4DGLA 4RVDA 2G2KA 4E33A 3CCR1 4E2XA 4A3GI 1VQMZ 1X3ZA 3KIHA 1PFTA 4E32A 1VQ9Z 1S7MA 2RPRA 3CQZI 1TWFI 2JA6I 3D6WA 3CCLZ 4RV9A 1QF8A 1K9M1 3P5JB 2RBLA 3I55Z 3G6EZ 1Q861 1KRLA 1KD12 1VQPZ 3GTMI 2R7ZI 2JR6A 4NOZA 4BY1I 3VMIA 4BBSI 3J7A4 4BY7I 3IF8A 1X3WA 3Q87A 2P28A 3GTJI 1KQSZ 2QA41 3GTKI 5CM2M 1RO4A 2V8JA 3CC71 1Q811 3M4OI 1QVGZ 1VQ7Z 3CCJ1 1VQ61 3S1QI 2DE5A 1YJ9Z 2JA8I 3CD61 4RS4A 2QRDB 1TWGI 4NB8A 4A3EI 3S1NI 1VQNZ 1RNIA 2OTJZ 4NBBA 1JJ2Z 3J80f 1NP6A 2NVQI 3CME1 4A93I 1WIIA 3PO3S 2V8KA 4E30A 1Q7Y1 3PO2I 1YITZ 1S72Z 1WCMI 3BG1B 4NBEA 3GKQA 2JA7I 2WAQA 4A3DI 2VUMI 1YHQ1 1Q821 2JA5I 1YIT1 1YJWZ 1Y1VS 4RVFA 1QVFY 3CCSZ 2NVXI 4HGZA 1VQK1 1W2BZ 5C4XI 1VQ51 5T64A 3JAMb 4NH1C 2OOXB 2VUGA 3CCS1 3CCQ1 5IP9I 3S14I 5IT9b 1LQLA 4MXUA 5AN9F 1K732 1ZH1A 3OW2Y 5IP7I 1KD11 4NBGA 3I07A 1TWHI 2HF1A 2K5RA 3HOWI 4S1TA 3CCMZ 3U50C 2KPIA 2O53A 1YI21 4MD8A 3HOXI 2F4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GCF A;  3I4N I;  3GTM I;  2R7Z I;  2JR6 A;  4NOZ A;  4BY1 I;  2NVT I;  3VMI A;  2E2H I;  4BBS I;  4BY7 I;  3GTG I;  1X3W A;  3Q87 A;  3GTP I;  3S1R I;  3GTJ I;  2DE7 A;  2JNY A;  2DME A;  3GTK I;  5CM2 M;  1R9T I;  1RO4 A;  3H3V J;  2DE6 A;  3M4O I;  1DL6 A;  3GTO I;  1WW9 A;  2E2J I;  3HOU I;  3S1Q I;  5C44 I;  2DE5 A;  2JA8 I;  2B63 I;  1VLA A;  4A3J I;  3NDQ A;  1TWG I;  4NB8 A;  4NBA A;  4A3E I;  1ZB9 A;  2BJO A;  3S1N I;  1YUA A;  3HOV I;  3H0G I;  3M3Y I;  1TFI A;  4NBB A;  2NVQ I;  4A93 I;  3LUS A;  3K7A I;  4BY1 X;  3PO3 S;  1USP B;  1ZB8 A;  3ESW A;  3PO2 I;  4QTT A;  1I6H I;  4A3F I;  1ML8 A;  1K83 I;  1WCM I;  3GTL I;  3S2H I;  4NBE A;  1ENW A;  3VMH A;  1SFO I;  3GKQ A;  5C4J I;  3S16 I;  2J6A A;  2P3Y A;  4XX2 A;  3VMG A;  2JA7 I;  1I50 I;  3S15 I;  3S17 I;  4A3D I;  4Y52 I;  2YU9 I;  2VUM I;  2LW4 A;  3EER A;  2JA5 I;  4A3L I;  2PK7 A;  4QTU A;  4A3K I;  2R93 I;  4BXX I;  3S1M I;  1Y1V S;  3GTQ I;  1RLY A;  3RZD I;  4A3I I;  1N2F A;  3I4M I;  2NVX I;  4A3B I;  2E2I I;  4NBH A;  5C4X I;  4BY7 X;  4A3M I;  3RZO I;  1NUI A;  1TWC I;  3FKI I;  4NBF A;  1QYP A;  3GTM S;  5C3E I;  3PO3 I;  4A3C I;  1L1O C;  5IP9 I;  4Y7N I;  3S14 I;  3S2D I;  2R92 I;  4BBR I;  4A3G I;  1LQL A;  1X3Z A;  1PFT A;  4X6A I;  1I3Q I;  5IP7 I;  3HOY I;  4NB9 A;  1USP A;  2NVY I;  4NBC A;  4NBG A;  4NBD A;  4MH4 A;  3I07 A;  1TWH I;  2HF1 A;  2K5R A;  1Y1V I;  3CQZ I;  5FLM I;  3HOW I;  1TWF I;  4BXX X;  2JA6 I;  3D6W A;  1TWA I;  3U50 C;  1Y1W I;  3VB9 A;  2F4O A;  2JS4 A;  2AKL A;  2KPI A;  3HOZ I;  2RBL A;  3HOX I;  2F4M A; 
#chains in the Genus database with same CATH topology
 3QWU A;  5HVY B;  3X20 B;  3J80 b;  3CXC Y;  3WVE B;  4HGY A;  1M1K 2;  3CCE 1;  3QXE B;  4TNU A;  2Q4Z A;  5CYI B;  3S1R I;  2IW9 B;  2IN3 A;  2JNY A;  2UZD B;  2KI7 B;  2PJQ A;  3O0G D;  2DE6 A;  3VKH A;  1O9K B;  4ELJ A;  1DL6 A;  1YJN Z;  3A8O B;  3BLH B;  3TN8 B;  3F3P C;  3HOU I;  3M03 A;  5C44 I;  1VQM 1;  2RIQ A;  3NDJ A;  1VLA A;  4A3J I;  3JAM f;  3CMA Z;  4BCN B;  1VQ9 1;  4YOS A;  2CCI B;  2W03 A;  4CFX B;  1E7P A;  3M3Y I;  4EOR B;  2V22 B;  2QEX Z;  2EUF A;  3QYH B;  5ACB A;  4YC3 B;  5EJC A;  1VQ8 Z;  3HKZ A;  3CCL 1;  2W9Z A;  1WJ2 A;  5IT9 f;  2WMB B;  3TW6 A;  4BCJ B;  2WFY B;  3CPW Y;  2CZ7 B;  2QF7 A;  4BY1 X;  2DPP B;  4QSH A;  1USP B;  3I55 1;  3G6E 1;  2H85 A;  1M90 1;  1VQP 1;  3CCV Z;  3DDQ B;  4QTT A;  4OR5 B;  4LOC A;  4CXA B;  4MFD A;  2CCH B;  1ENW A;  3VMH A;  1H24 B;  1SFO I;  4BCQ B;  5C4J I;  4F6W B;  2J6A A;  2P3Y A;  5FLX b;  3BLR B;  1NJI 2;  4XX2 A;  3S15 I;  2C5O B;  2VPZ A;  4Y52 I;  2ZZD B;  2DD4 B;  2LW4 A;  2UZE B;  3I56 Z;  1KC8 1;  1GUX B;  3LQ5 B;  4EOI B;  3TNH B;  3A8M B;  4A3L I;  4EON B;  1VQ7 1;  1GY3 B;  2C6T B;  4BXX I;  3BG5 A;  1AIS B;  1AD6 A;  2C5V B;  5CEI B;  3G4S Z;  3GTQ I;  2M48 A;  3RZD I;  4OGR B;  1Y8C A;  3I4M I;  1XO2 A;  1YJ9 1;  1G3N C;  1VQ4 Z;  4A3B I;  2E9H A;  4Z6Y A;  1VQN 1;  2I40 B;  4A3M I;  1FDO A;  1K73 1;  1QVF Z;  2OTJ 1;  3QYE A;  1JSU B;  1QYP A;  5ICP B;  5C3E I;  3PO3 I;  4E2Z A;  3DJB A;  4A3C I;  3WVD B;  4ROC A;  2X1N B;  4E2W A;  2OOY B;  3S2D I;  2R92 I;  3DTO A;  4HNU A;  5LQF B;  4BBR I;  1F5Q B;  1H1P B;  1JWH C;  2JMO A;  1S72 1;  4BCN D;  2WMA B;  1FDI A;  1K9M 2;  3A8L B;  3MZL B;  2CZ6 B;  4X6A I;  1I3Q I;  2ZPG B;  1OGU B;  2LIY A;  4NB9 A;  1YIJ Z;  1Q86 2;  2R7G A;  4MRI A;  2ZAE B;  3F5X B;  1H1Q B;  1Y1V I;  4FX3 B;  5FLM I;  1M1K 1;  2JUB A;  3CC2 Z;  1OKV B;  2WIP B;  2QRE B;  2I3C A;  3OW2 Z;  4AKI A;  4OB0 B;  2W9F A;  2AKL A;  1YJW 1;  5T67 A;  2D0Q B;  1VQO Z;  3HOZ I;  4AYB A;  4NBD A;  5D1O B;  1Q81 2;  3TW7 A;  3EED A;  5FLX f;  5HBJ B;  4II5 B;  2QLV B;  3K7A M;  3X28 B;  2I53 A;  4BCQ D;  4F6S B;  2WJ9 A;  2LFU A;  3GTG I;  4F70 B;  3GTP I;  3NH4 A;  2DE7 A;  2C5X B;  3CC4 Z;  2DME A;  2WB1 A;  4NFR A;  5HBH B;  1RO2 A;  3H3V J;  5D1P A;  2IZ4 A;  3CXC Z;  2YAD A;  1PKD B;  2QDJ A;  1K8A 2;  2OTL Z;  3MY5 B;  2E2J I;  1TFB A;  3CCU Z;  1VQL Z;  2C5N B;  1Q16 A;  2B63 I;  2K3R A;  3NDQ A;  5A2Q b;  2GTH A;  3T4N B;  3VKG A;  3MZK B;  1Z03 A;  3FQQ A;  4CL1 A;  4E2Y A;  1FKM A;  2Y0S A;  3CCM 1;  4F7S B;  2QKD A;  4EC9 B;  3TE5 B;  4KRC B;  3CCR Z;  5HBE B;  1NJI 1;  3K7A I;  4EOK B;  1N8R 2;  1ZB8 A;  3X26 B;  1JST B;  4A3F I;  2V3V A;  2G77 A;  4IMY B;  1K83 I;  2HU9 A;  3S2H I;  3GTL I;  4MD7 A;  3CPW Z;  1GH6 B;  4CFM B;  3S16 I;  3VYG B;  3NFZ A;  4EWC A;  3S17 I;  2CZ0 B;  2PMZ A;  3EER A;  5LL6 f;  1QLB A;  2PK7 A;  4QTU A;  3HBL A;  4A3K I;  2R93 I;  1X0T A;  3H4C A;  1YJN 1;  3S1M I;  3QHW B;  2WPA B;  2UZB B;  1RLY A;  2BS4 A;  3J81 f;  5DQV A;  2QR1 B;  4A3I I;  2QQ8 A;  2LEX A;  3BHV B;  3CMA 1;  1RO0 A;  1OL1 B;  2RHB A;  2IV2 X;  1VOL A;  1C9B A;  4BY7 X;  2QEX 1;  4JX4 A;  3RZO I;  1NUI A;  2KR6 A;  1TWC I;  3FKI I;  1JKW A;  4NBF A;  2QA4 Z;  1VQ8 1;  3GTM S;  4DQY B;  2O4H A;  3TNI B;  1H1R B;  1L1O C;  1ZP2 A;  2IZ3 A;  3CC7 Z;  3EID B;  1IRE B;  4Y7N I;  3EJ1 B;  3NH5 A;  5IHY A;  2NAP A;  3CCJ Z;  1VQ6 Z;  5A2Q f;  3QHR B;  4EOQ B;  3CCV 1;  4HL4 A;  3IFU A;  3CD6 Z;  1AA6 A;  5IF1 B;  2PMI B;  1H27 B;  2ZPE B;  1N4M A;  3G71 Z;  1JOW A;  3TDH B;  3KIF A;  1USP A;  2NVY I;  3BG0 B;  4NBC A;  3HOY I;  2QRC B;  4MH4 A;  1TD6 A;  3IX0 A;  4BXX X;  3I56 1;  1TWA I;  3CME Z;  1Y1W I;  1UNH D;  4CFU B;  3VB9 A;  2VF1 A;  3VTN A;  2F4O A;  5HQ0 B;  2JS4 A;  2C4G B;  3DL1 A;  2BKZ B;  3EOC B;  3G4S 1;  3BHU B;  4BCH B;  2ZPB B;  4HNV A;  1Z02 A;  3NH8 A;  2RT9 A;  1KQS Y;  2W04 A;  3G71 1;  1VQ4 1;  3DOG B;  4MIM A;  2V8I A;  3GCF A;  3I4N I;  1P9N A;  2W96 A;  5T6B A;  4HNT A;  1QVG Y;  1OIY B;  1K8A 1;  2NVT I;  2E2H I;  4BCO B;  2CJM B;  4MD9 A;  3BG3 A;  4OB1 B;  2IVX A;  2OZK A;  1H1S B;  3FQM A;  4EOP B;  1R9T I;  4CFN B;  1YHQ Z;  3KHI A;  1OIU B;  3TNW B;  4ZGD B;  4EOL B;  4AI6 A;  3A8H B;  4RVG A;  1WW9 A;  3GTO I;  1JJ2 Y;  2R6M A;  2ZPH B;  3D9X A;  4NBA A;  1ZB9 A;  2G9X B;  1VYW B;  5HNB B;  2BJO A;  1N8R 1;  2PM9 A;  1VQK Z;  1YIJ 1;  3A8G B;  1YUA A;  1M90 2;  3H0G I;  3MON A;  1VQ5 Z;  3HOV I;  1TFI A;  1UNG D;  4YOO A;  2GTI A;  2M6N A;  3CC2 1;  3J81 b;  2W2H A;  1RQF A;  3LUS A;  4F7L B;  5I5Z B;  3CCQ Z;  2ZPF B;  4RVH A;  4MON A;  2EGT A;  2Q51 A;  1VQO 1;  4AKG A;  2AYD A;  2CYZ B;  1QXF A;  1KC8 2;  2W99 A;  3ESW A;  4FM4 B;  3F3F C;  1Z01 A;  4BCP B;  2JIP A;  1YUK A;  4YOZ A;  4BCG B;  1ML8 A;  4ZGE B;  1I6H I;  1OI9 B;  1KXU A;  5D1O A;  3CC4 1;  2JIQ A;  1D3U B;  4DK1 A;  3VMG A;  1I50 I;  4CFU D;  2YU9 I;  1BU2 A;  1Q7Y 2;  1W2B Y;  3X24 B;  4ZGJ B;  2OTL 1;  2JGZ B;  3NDI A;  3CCU 1;  1VQL 1;  1N2F A;  1YI2 Z;  1UGQ B;  3G33 B;  3MIA B;  4F7J B;  2QFZ A;  4CFV B;  2QDY B;  4OB3 B;  2E2I I;  2DXC B;  2PHG A;  4AKH A;  4NBH A;  2GU2 A;  1Q82 2;  3CCE Z;  2DXB B;  4NST B;  4E31 A;  4HH4 A;  4DGL A;  1V29 B;  4BCM B;  4HLQ A;  4RVD A;  3RGF B;  4EOM B;  2PK2 A;  5BNJ B;  4EOJ B;  4BBS M;  2G2K A;  4E33 A;  2E7Z A;  3CCR 1;  5IDN B;  4I3Z B;  4CRL B;  4EOS B;  4E2X A;  5DQW A;  4A3G I;  1VQM Z;  3HZJ A;  1X3Z A;  3KIH A;  1PFT A;  5EFQ B;  4E32 A;  1VQ9 Z;  5L2W B;  1OKW B;  3DDP B;  1S7M A;  2RPR A;  1O9K A;  1AHJ B;  3CQZ I;  2IW6 B;  1H26 B;  1TWF I;  2JA6 I;  4F7N B;  3D6W A;  3CCL Z;  4RV9 A;  4NC6 A;  1QF8 A;  1K9M 1;  3P5J B;  2UZL B;  4TTH A;  3HB9 A;  2AHJ B;  2RBL A;  3I55 Z;  3G6E Z;  1Q86 1;  1KRL A;  1KD1 2;  1VQP Z;  3GTM I;  2R7Z I;  2JR6 A;  4NOZ A;  4BY1 I;  4UN0 A;  3VMI A;  3BHT B;  4EC8 B;  4BBS I;  3J7A 4;  4BY7 I;  2BS2 A;  3IF8 A;  4G6L B;  1X3W A;  3Q87 A;  1WZN A;  2DD5 B;  2P28 A;  3GTJ I;  1KQS Z;  2QA4 1;  2ZPI B;  1W98 B;  2ZCF B;  5CM2 M;  3GTK I;  1RO4 A;  3BLQ B;  2V8J A;  3CC7 1;  1Q81 1;  3M4O I;  1QVG Z;  1UGS B;  1VQ7 Z;  2JIR A;  3CCJ 1;  1VQ6 1;  4ROD A;  3VYH B;  1H4L D;  5FGK B;  3S1Q I;  1OL2 B;  2DE5 A;  1YJ9 Z;  2JA8 I;  4BBR M;  2BS3 A;  3QWL A;  3CD6 1;  1VIN A;  4RS4 A;  2QRD B;  1TWG I;  2B9R A;  4NB8 A;  4A3E I;  3S1N I;  3BG9 A;  1QMZ B;  1VQN Z;  1GUX A;  1RNI A;  1FVV B;  4BCM D;  2OTJ Z;  4NBB A;  1JJ2 Z;  3J80 f;  1NP6 A;  2NVQ I;  3MI9 B;  1UGR B;  4BCK B;  1URC B;  3CME 1;  4A93 I;  2V45 A;  3QZ5 B;  4JX5 A;  5LMK B;  2JIO A;  2KMG A;  4Y72 B;  4ROE A;  4CFW B;  3POM A;  2WEV B;  2IW8 B;  3PO3 S;  1WII A;  2V8K A;  4E30 A;  1Q7Y 1;  3MY1 B;  3PO2 I;  1YIT Z;  1S72 Z;  4JX6 A;  2VPX A;  4EOO B;  1WCM I;  3BG1 B;  4NBE A;  2PK9 B;  2BPM B;  2WHB B;  1H25 B;  3GKQ A;  1UNL D;  2JA7 I;  3QYG B;  2WAQ A;  4MFE A;  4A3D I;  2VUM I;  1YHQ 1;  1Q82 1;  2JA5 I;  1YIT 1;  1YJW Z;  1Y1V S;  4RVF A;  1QVF Y;  3CCS Z;  3B57 A;  3IR7 A;  3X25 B;  3HO8 A;  2NVX I;  4HGZ A;  5IDP B;  2UUE B;  1VQK 1;  1W2B Z;  4OB2 B;  5C4X I;  1VQ5 1;  2VPW A;  5T64 A;  3JAM b;  2WXV B;  2OOX B;  2VUG A;  4NH1 C;  1FIN B;  3CCS 1;  4M6V A;  4F6U B;  3CCQ 1;  4KRD B;  5IP9 I;  3S14 I;  4ELL A;  4BCI B;  2WIH B;  5IT9 b;  1LQL A;  4MXU A;  1SIW A;  1E9H B;  5AN9 F;  1K73 2;  1ZH1 A;  3OW2 Y;  2F2C A;  5IP7 I;  3QYB A;  1KD1 1;  4NBG A;  2QGS A;  2VPY A;  3I07 A;  1TWH I;  2HF1 A;  2K5R A;  3QZ9 B;  3HOW I;  4S1T A;  3CCM Z;  3U50 C;  3HHT B;  2CZ1 B;  2KPI A;  2O53 A;  1H28 B;  1P5E B;  4BCF B;  1YI2 1;  4MD8 A;  3HOX I;  3D2L A;  2JIM A;  2F4M A;  1UGP B; 
#chains in the Genus database with same CATH homology
 3QWU A;  3J80 b;  1M1K 2;  3CXC Y;  4HGY A;  3CCE 1;  4TNU A;  2Q4Z A;  3S1R I;  2JNY A;  2KI7 B;  2DE6 A;  1DL6 A;  1YJN Z;  3F3P C;  3HOU I;  5C44 I;  1VQM 1;  2RIQ A;  3NDJ A;  1VLA A;  4A3J I;  3JAM f;  3CMA Z;  1VQ9 1;  2W03 A;  3M3Y I;  2QEX Z;  1VQ8 Z;  3HKZ A;  3CCL 1;  5IT9 f;  3CPW Y;  4BY1 X;  3I55 1;  1USP B;  3G6E 1;  2H85 A;  1M90 1;  1VQP 1;  3CCV Z;  4QTT A;  1ENW A;  3VMH A;  1SFO I;  5C4J I;  2J6A A;  2P3Y A;  5FLX b;  1NJI 2;  4XX2 A;  3S15 I;  4Y52 I;  2LW4 A;  1KC8 1;  3I56 Z;  4A3L I;  1VQ7 1;  4BXX I;  3G4S Z;  3GTQ I;  2M48 A;  3RZD I;  3I4M I;  1YJ9 1;  1VQ4 Z;  4A3B I;  2E9H A;  1VQN 1;  4A3M I;  1K73 1;  1QVF Z;  2OTJ 1;  1QYP A;  5C3E I;  3PO3 I;  4E2Z A;  4A3C I;  4E2W A;  2OOY B;  3S2D I;  2R92 I;  4BBR I;  1JWH C;  2JMO A;  1S72 1;  1K9M 2;  3MZL B;  4X6A I;  1I3Q I;  4NB9 A;  2LIY A;  1YIJ Z;  1Q86 2;  4MRI A;  2ZAE B;  1Y1V I;  5FLM I;  1M1K 1;  2JUB A;  3CC2 Z;  2QRE B;  2I3C A;  3OW2 Z;  2AKL A;  1YJW 1;  5T67 A;  1VQO Z;  3HOZ I;  4AYB A;  4NBD A;  5D1O B;  1Q81 2;  3EED A;  5FLX f;  2QLV B;  2LFU A;  3GTG I;  3GTP I;  3NH4 A;  2DE7 A;  3CC4 Z;  2DME A;  2WB1 A;  4NFR A;  1RO2 A;  3H3V J;  5D1P A;  2IZ4 A;  3CXC Z;  2YAD A;  1K8A 2;  2OTL Z;  2E2J I;  3CCU Z;  1VQL Z;  2B63 I;  2K3R A;  3NDQ A;  5A2Q b;  2GTH A;  3T4N B;  3MZK B;  1Z03 A;  3FQQ A;  4CL1 A;  4E2Y A;  2Y0S A;  3CCM 1;  2QKD A;  3TE5 B;  3CCR Z;  1NJI 1;  3K7A I;  1N8R 2;  1ZB8 A;  4A3F I;  1K83 I;  2HU9 A;  3S2H I;  3GTL I;  4MD7 A;  3CPW Z;  3S16 I;  3NFZ A;  4EWC A;  3S17 I;  2PMZ A;  3EER A;  5LL6 f;  2PK7 A;  4QTU A;  4A3K I;  2R93 I;  1X0T A;  1YJN 1;  3S1M I;  1RLY A;  3J81 f;  4A3I I;  2QR1 B;  3CMA 1;  1RO0 A;  2RHB A;  4BY7 X;  2QEX 1;  3RZO I;  1NUI A;  1TWC I;  3FKI I;  2QA4 Z;  4NBF A;  1VQ8 1;  3GTM S;  4DQY B;  2O4H A;  1L1O C;  2IZ3 A;  3CC7 Z;  4Y7N I;  3NH5 A;  3CCJ Z;  1VQ6 Z;  5A2Q f;  3CCV 1;  3CD6 Z;  3IFU A;  3G71 Z;  3TDH B;  3HOY I;  3KIF A;  1USP A;  2NVY I;  3BG0 B;  4NBC A;  2QRC B;  4MH4 A;  3IX0 A;  4BXX X;  3I56 1;  1TWA I;  3CME Z;  1Y1W I;  3VTN A;  3VB9 A;  2VF1 A;  2F4O A;  2JS4 A;  3G4S 1;  3NH8 A;  1Z02 A;  1KQS Y;  2RT9 A;  2W04 A;  3G71 1;  1VQ4 1;  2V8I A;  3GCF A;  3I4N I;  1P9N A;  5T6B A;  1QVG Y;  1K8A 1;  2NVT I;  2E2H I;  4MD9 A;  2OZK A;  3FQM A;  1R9T I;  1YHQ Z;  4RVG A;  1WW9 A;  3GTO I;  1JJ2 Y;  2R6M A;  3D9X A;  4NBA A;  1ZB9 A;  1N8R 1;  1VQK Z;  2BJO A;  2PM9 A;  1YIJ 1;  1YUA A;  1M90 2;  3H0G I;  3MON A;  1VQ5 Z;  3HOV I;  1TFI A;  2GTI A;  2M6N A;  3CC2 1;  3J81 b;  1RQF A;  3LUS A;  3CCQ Z;  4RVH A;  4MON A;  2EGT A;  2Q51 A;  1VQO 1;  1KC8 2;  3ESW A;  3F3F C;  1Z01 A;  1I6H I;  1YUK A;  1ML8 A;  5D1O A;  3CC4 1;  4DK1 A;  3VMG A;  1I50 I;  2YU9 I;  1Q7Y 2;  1W2B Y;  2OTL 1;  3CCU 1;  3NDI A;  1VQL 1;  1N2F A;  1YI2 Z;  2E2I I;  4NBH A;  2GU2 A;  1Q82 2;  3CCE Z;  4E31 A;  4HH4 A;  4DGL A;  4RVD A;  2G2K A;  4E33 A;  3CCR 1;  4E2X A;  4A3G I;  1VQM Z;  1X3Z A;  3KIH A;  1PFT A;  4E32 A;  1VQ9 Z;  1S7M A;  2RPR A;  3CQZ I;  1TWF I;  2JA6 I;  3D6W A;  3CCL Z;  4RV9 A;  1QF8 A;  1K9M 1;  3P5J B;  2RBL A;  3I55 Z;  3G6E Z;  1Q86 1;  1KRL A;  1KD1 2;  1VQP Z;  3GTM I;  2R7Z I;  2JR6 A;  4NOZ A;  4BY1 I;  3VMI A;  4BBS I;  3J7A 4;  4BY7 I;  3IF8 A;  1X3W A;  3Q87 A;  2P28 A;  3GTJ I;  1KQS Z;  2QA4 1;  3GTK I;  5CM2 M;  1RO4 A;  2V8J A;  3CC7 1;  1Q81 1;  3M4O I;  1QVG Z;  1VQ7 Z;  3CCJ 1;  1VQ6 1;  3S1Q I;  2DE5 A;  1YJ9 Z;  2JA8 I;  3CD6 1;  4RS4 A;  2QRD B;  1TWG I;  4NB8 A;  4A3E I;  3S1N I;  1VQN Z;  1RNI A;  2OTJ Z;  4NBB A;  1JJ2 Z;  3J80 f;  1NP6 A;  2NVQ I;  3CME 1;  4A93 I;  1WII A;  3PO3 S;  2V8K A;  4E30 A;  1Q7Y 1;  3PO2 I;  1YIT Z;  1S72 Z;  1WCM I;  3BG1 B;  4NBE A;  3GKQ A;  2JA7 I;  2WAQ A;  4A3D I;  2VUM I;  1YHQ 1;  1Q82 1;  2JA5 I;  1YIT 1;  1YJW Z;  1Y1V S;  4RVF A;  1QVF Y;  3CCS Z;  2NVX I;  4HGZ A;  1VQK 1;  1W2B Z;  5C4X I;  1VQ5 1;  5T64 A;  3JAM b;  4NH1 C;  2OOX B;  2VUG A;  3CCS 1;  3CCQ 1;  5IP9 I;  3S14 I;  5IT9 b;  1LQL A;  4MXU A;  5AN9 F;  1K73 2;  1ZH1 A;  3OW2 Y;  5IP7 I;  1KD1 1;  4NBG A;  3I07 A;  1TWH I;  2HF1 A;  2K5R A;  3HOW I;  4S1T A;  3CCM Z;  3U50 C;  2KPI A;  2O53 A;  1YI2 1;  4MD8 A;  3HOX I;  2F4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...