3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
3I4MI 3K7AI 2E2HI 1I3QI 3NDQA 4QTUA 4Y7NI 2E2JI 4A93I 2BJOA 3S1RI 3S1MI 2DE7A 2E2II 5IP7I 1X3WA 3GTMI 2NVTI 3GCFA 4BXXX 4MH4A 3HOUI 1L1OC 3HOVI 1WCMI 2KPIA 4A3GI 4BY7I 1I6HI 4NBCA 2JR6A 4A3FI 1VLAA 5CM2M 1DL6A 1X3ZA 3M3YI 3GTKI 1ZB9A 1WW9A 3GTJI 2DMEA 3RZDI 3S2DI 3ESWA 3S2HI 1LQLA 2NVXI 1YUAA 4BBSI 1I50I 5IP9I 3M4OI 3HOYI 1TFIA 3VMIA 3I4NI 3S16I 3PO3I 1K83I 4NB9A 5C3EI 2F4MA 4A3EI 1PFTA 1RO4A 3D6WA 4BY1X 4A3CI 2B63I 1USPA 3LUSA 3H3VJ 4NBBA 4NOZA 2JNYA 2JA7I 3GTQI 5C4XI 3HOWI 3S17I 2DE6A 1Y1VS 3VMHA 4Y52I 1TWFI 3HOXI 3VMGA 1RLYA 2JA6I 3GTOI 2VUMI 5C44I 4NBEA 5C4JI 2JA8I 4NBGA 4NBDA 2J6AA 3PO2I 4X6AI 2AKLA 4BY7X 1TWHI 3U50C 3GTMS 2P3YA 2PK7A 1Y1WI 4NB8A 1QYPA 5FLMI 3I07A 3GTLI 4BXXI 2F4OA 1TWAI 3GKQA 2DE5A 2R93I 4A3LI 3EERA 2JS4A 3GTPI 3S15I 4A3KI 4QTTA 4NBAA 1NUIA 1TWCI 4BBRI 1N2FA 2HF1A 3CQZI 3PO3S 2YU9I 4A3II 1SFOI 3Q87A 2LW4A 3H0GI 4XX2A 1ML8A 2NVQI 3S1NI 1ZB8A 4A3JI 3S1QI 1USPB 2R92I 3HOZI 4A3BI 3GTGI 2R7ZI 2JA5I 4NBFA 4A3DI 3VB9A 4BY1I 1ENWA 1TWGI 2K5RA 4A3MI 1R9TI 2RBLA 3RZOI 1Y1VI 4NBHA 2NVYI 3S14I 3FKII
chains in the Genus database with same CATH superfamily
2C4GB 1D3UB 2JGZB 1VQ6Z 1OKVB 1JKWA 3CCLZ 1S7MA 4BCIB 5D1PA 2WMBB 2IZ4A 3FQQA 4HL4A 2BKZB 5I5ZB 4MFDA 1KD11 1YJN1 1GY3B 3HB9A 1X3WA 4BCNB 3K7AM 2Q4ZA 4MH4A 4JX6A 5A2Qb 3CMA1 1L1OC 4F7LB 3HOVI 1QXFA 1WCMI 2RPRA 1UNLD 1W2BZ 2RT9A 4EC9B 4YOZA 3CME1 3EIDB 2X1NB 5CM2M 1DL6A 3GTKI 1ZB9A 1C9BA 3GTJI 3RZDI 3ESWA 2QEX1 1K9M2 3S2HI 4YC3B 1I50I 3D9XA 5IP9I 2D0QB 3M4OI 3CCSZ 1TD6A 1OL2B 3HOYI 1UNHD 3PO3I 4HLQA 2QA41 2F4MA 2ZPEB 4F6SB 1PFTA 3G71Z 2WFYB 3TN8B 2PMIB 4EOPB 1F5QB 3I561 3CCM1 3LUSA 2DXBB 3MONA 2IZ3A 5CYIB 2R6MA 3KIFA 3F3PC 1VQNZ 4E30A 2KR6A 3X28B 3CPWY 3CC2Z 1M1K1 1QVFZ 4OB2B 5C4XI 2O4HA 4RS4A 3MIAB 3BLHB 5AN9F 1URCB 4ZGEB 1RLYA 2VUMI 3CCR1 2P28A 4E2WA 2BS2A 1YJ9Z 1VQ9Z 2J6AA 3PO2I 2CCIB 1YIJZ 1GUXB 2BPMB 4CFNB 3A8GB 1JOWA 3CD6Z 1VQ51 4BY7X 2CYZB 4ROCA 3HO8A 4OGRB 1Z01A 3QHWB 2W96A 4RVGA 3OW2Z 3GTLI 2V22B 3J81b 1VQP1 2W99A 5HBEB 2DE5A 5ICPB 4EC8B 2EUFA 5IDNB 3DJBA 1KD12 2R93I 1VQ7Z 4BCQD 1VQK1 1YUKA 2IVXA 2V8KA 3S15I 5L2WB 3M03A 2K3RA 2ZPFB 3VKGA 5IDPB 1YJW1 3VTNA 1H1PB 2WIHB 4BCFB 4BCGB 1GUXA 3CQZI 3PO3S 3Q87A 5HQ0B 3BG5A 3H0GI 1QVGZ 2NVQI 4QSHA 4F70B 4EOMB 1ZB8A 4MRIA 3S1NI 3TW7A 1K9M1 3EJ1B 4DGLA 3EEDA 4A3BI 3CC4Z 2OTLZ 3IR7A 3GTGI 2R7ZI 4NBFA 3A8OB 3VYHB 3IFUA 3TDHB 2VPZA 2ZAEB 2K5RA 2UZDB 4A3MI 2PJQA 3IX0A 2NVYI 3S14I 1YHQ1 4BCMB 3B57A 4RVFA 1UGRB 4DK1A 2WIPB 3VKHA 1Q7Y2 1AHJB 3K7AI 4CFMB 5T6BA 3NDQA 4QTUA 1OGUB 3CCQZ 2AHJB 4A93I 1G3NC 2E2II 3VYGB 1VQ61 3FQMA 5IP7I 3J81f 4AYBA 2CZ6B 4ZGJB 2NVTI 3GCFA 2I40B 3GTMI 3CCL1 2VPWA 2BS3A 4RODA 3BLRB 2LFUA 3NDIA 3CC71 1Q822 2C5XB 4BY7I 3BG0B 3POMA 3JAMb 2CZ1B 4CXAB 3NH8A 1X3ZA 3M3YI 4EWCA 2V8IA 3D2LA 2OTJZ 4EONB 2GU2A 2LEXA 1YUAA 1YIT1 3BHVB 4FX3B 2RIQA 1PKDB 3VMIA 3LQ5B 4CFUB 4NB9A 4DQYB 3A8MB 2PMZA 1S72Z 1N8R2 4F6WB 3QXEB 5CEIB 4AI6A 4BY1X 4BCOB 3CCEZ 3CCS1 3G4S1 3DDPB 2C5OB 3CCJZ 3QZ9B 4IMYB 1K8A2 4NBBA 5ACBA 3G711 4NOZA 2EGTA 2H85A 4BCJB 2VPYA 1P9NA 3TW6A 1AISB 2F2CA 3HOWI 4EOOB 1VQL1 4OB0B 4MXUA 1QF8A 1VQN1 3I55Z 1Z03A 2DE6A 4RV9A 3CC21 3HOXI 2WEVB 2IW6B 4ELLA 2QKDA 5C4JI 2JA8I 4NBDA 4HNTA 1JJ2Y 3CXCY 1NJI1 2AKLA 1UNGD 1YJ91 1VQ91 2PHGA 2O53A 1Q7Y1 3GTMS 4OB1B 1Y1WI 3TNIB 1VQMZ 2B9RA 2JIRA 1P5EB 5LMKB 3GKQA 3NH4A 4OB3B 1WIIA 1WZNA 4MD8A 4A3LI 4TTHA 1OKWB 3EERA 4HGZA 3NDJA 4MD9A 2R7GA 2UUEB 1H4LD 1H24B 1FINB 3J7A4 4NC6A 1Q821 2C5NB 1ZP2A 5A2Qf 3DDQB 1NUIA 2JIMA 3CMAZ 1GH6B 1KC82 4KRDB 2HF1A 5HBHB 2LW4A 3IF8A 1ML8A 3S1QI 1USPB 5FLXb 3BHTB 3BG1B 1Q862 4KRCB 4UN0A 4BBRM 2WJ9A 4F6UB 3VB9A 3KIHA 4BY1I 4BCND 4LOCA 2QEXZ 1ENWA 1TWGI 2NAPA 1YI2Z 1N8R1 1H1QB 2QQ8A 3QZ5B 2QREB 2RBLA 2ZPBB 4F7JB 2OTL1 1Y1VI 4NBHA 3CPWZ 3WVEB 2IW9B 4BCHB 2QA4Z 5IT9b 1K8A1 1ZH1A 3I4MI 2DD4B 4YOSA 2QFZA 2V8JA 1I3QI 2E2HI 3QWLA 1E9HB 3J80b 3I56Z 2E2JI 5DQVA 3S1MI 2DE7A 1XO2A 2QDJA 4BXXX 1VQOZ 3F3FC 3HOUI 4G6LB 3DL1A 2BS4A 1BU2A 1H1SB 2QLVB 2WAQA 3BG9A 4EOLB 2RHBA 1FDOA 3KHIA 1TFBA 2PM9A 5HVYB 1I6HI 4NBCA 2G2KA 4MD7A 1K732 3DOGB 4A3FI 1VLAA 3CCU1 1Q16A 4YOOA 2I53A 4RVDA 1NJI2 4AKIA 1WW9A 2CJMB 4OR5B 3RGFB 2QRCB 5LL6f 3S2DI 1LQLA 4E32A 4E2XA 2OTJ1 1H1RB 2PK9B 2V45A 1K83I 1KXUA 1Q812 5C3EI 3X20B 2M48A 4NFRA 4E2YA 1RO4A 4A3CI 5T64A 4TNUA 3QYEA 1S721 3H3VJ 2GTIA 2YADA 4JX4A 4MIMA 1VQ4Z 1FDIA 2JIOA 2UZEB 2PK2A 1KC81 3A8LB 4NSTB 3GTQI 5T67A 2CCHB 3S17I 1YJWZ 1H27B 2ZZDB 3BG3A 1Y1VS 1Q861 1TWFI 3GTOI 4BCPB 2M6NA 2JA6I 3HKZA 1X0TA 1Y8CA 5C44I 1OIUB 3TNWB 4NBEA 2DD5B 4MONA 4Z6YA 3QYBA 1RO2A 4X6AI 4RVHA 4M6VA 3F5XB 5FGKB 1VINA 1TWHI 3TE5B 4HH4A 1E7PA 1Z02A 5D1OB 1IREB 5IHYA 4EOIB 2PK7A 1W2BY 3G33B 1JWHC 5FLMI 3QHRB 1AA6A 3WVDB 3CCVZ 5BNJB 3T4NB 1VQ8Z 4E31A 3DTOA 2ZPIB 2F4OA 4BXXI 1VOLA 1VQM1 4ZGDB 5EFQB 2QF7A 3TNHB 2OOYB 3G6EZ 3EOCB 4EOKB 2JS4A 2HU9A 1RQFA 4MFEA 4QTTA 2JIQA 2W04A 2IW8B 4BCMD 4BBRI 1K731 1N2FA 1OI9B 1KQSY 4A3II 1SFOI 2JMOA 2C6TB 3CC7Z 5D1OA 3JAMf 2KMGA 1JSTB 2DXCB 1SIWA 2WMAB 2E7ZA 3HOZI 1YIJ1 3CD61 1Q811 1QVFY 4E33A 1JSUB 2UZBB 2ZPHB 4BCQB 2KI7B 1YITZ 2Y0SA 2GTHA 2CZ0B 1M902 4HGYA 4II5B 1OIYB 1RNIA 3FKII 1YI21 3HBLA 1FVVB 1O9KB 4F7SB 5LQFB 4CFVB 1UGSB 3G4SZ 1YJNZ 2OZKA 4Y7NI 2BJOA 3S1RI 1VQ71 5DQWA 3X25B 4AKGA 1JJ2Z 3CXCZ 1W98B 1KQSZ 2WXVB 2VPXA 4S1TA 4CFUD 3CMEZ 4CFWB 3OW2Y 1FKMA 2W9ZA 3MY5B 1VQLZ 2KPIA 1QLBA 4EOJB 4A3GI 1VQO1 2DPPB 4ELJA 2I3CA 2JR6A 3CC41 4JX5A 2OOXB 3H4CA 5HBJB 2AYDA 2DMEA 1RO0A 1O9KA 1H25B 2NVXI 4BBSI 5IF1B 1TFIA 3I4NI 3S16I 2JIPA 2VUGA 3CCMZ 1QVGY 4CL1A 4A3EI 2JUBA 3D6WA 4CFXB 1V29B 5EJCA 3P5JB 2B63I 2QGSA 1USPA 4I3ZB 3CCQ1 2JNYA 2CZ7B 2JA7I 2W03A 3CCRZ 1VQ41 1AD6A 1WJ2A 4CRLB 4EORB 2LIYA 3VMHA 4Y52I 2C5VB 3VMGA 2ZPGB 5HNBB 3NH5A 5FLXf 1VQ5Z 3BHUB 3QWUA 4NBGA 3MZKB 3QYGB 1UGPB 3O0GD 4FM4B 1M901 2WPAB 3QYHB 4BBSM 2QR1B 3NFZA 2G9XB 4HNUA 4BCKB 3U50C 1VQPZ 2P3YA 2QDYB 1H28B 1QMZB 3X24B 4NB8A 2VF1A 5IT9f 1QYPA 3MY1B 3I07A 3CCE1 3BLQB 1TWAI 2E9HA 3CCJ1 1VQKZ 3MI9B 4EOSB 3J80f 2G77A 3X26B 2UZLB 2W2HA 3A8HB 3CCV1 2IV2X 1VQ81 1KRLA 3GTPI 4HNVA 4A3KI 2QRDB 3HZJA 3HHTB 3G6E1 1H26B 4NBAA 1UGQB 1TWCI 3I551 2V3VA 4ROEA 4EOQB 2YU9I 4E2ZA 3MZLB 1M1K2 2W9FA 4XX2A 2IN3A 4A3JI 2R92I 3CCUZ 2Q51A 4A3DI 2JA5I 2WHBB 1VYWB 2WB1A 1YHQZ 1R9TI 4AKHA 1OL1B 3RZOI 1N4MA 2ZCFB 4NH1C 4F7NB 4Y72B 1NP6A
chains in the Genus database with same CATH topology
1VQ6Z 3CCLZ 1S7MA 5D1PA 2IZ4A 3FQQA 1KD11 1YJN1 1X3WA 2Q4ZA 4MH4A 5A2Qb 3CMA1 1L1OC 3HOVI 1WCMI 2RPRA 1W2BZ 2RT9A 3CME1 5CM2M 1DL6A 3GTKI 1ZB9A 3GTJI 3RZDI 3ESWA 2QEX1 1K9M2 3S2HI 1I50I 3D9XA 5IP9I 3M4OI 3CCSZ 3HOYI 3PO3I 2QA41 2F4MA 1PFTA 3G71Z 3I561 3CCM1 3LUSA 3MONA 2IZ3A 2R6MA 3KIFA 3F3PC 1VQNZ 4E30A 3CPWY 3CC2Z 1M1K1 1QVFZ 5C4XI 2O4HA 4RS4A 5AN9F 1RLYA 2VUMI 3CCR1 2P28A 4E2WA 1YJ9Z 1VQ9Z 2J6AA 3PO2I 1YIJZ 3CD6Z 1VQ51 4BY7X 1Z01A 4RVGA 3OW2Z 3GTLI 3J81b 1VQP1 2DE5A 2R93I 1KD12 1VQ7Z 1VQK1 1YUKA 2V8KA 3S15I 2K3RA 1YJW1 3VTNA 3CQZI 3PO3S 3Q87A 3H0GI 1QVGZ 2NVQI 4MRIA 3S1NI 1ZB8A 1K9M1 4DGLA 3EEDA 4A3BI 3CC4Z 2OTLZ 3GTGI 2R7ZI 4NBFA 3IFUA 3TDHB 2ZAEB 2K5RA 4A3MI 3IX0A 2NVYI 3S14I 1YHQ1 4RVFA 4DK1A 1Q7Y2 3K7AI 5T6BA 3NDQA 4QTUA 3CCQZ 4A93I 2E2II 1VQ61 3FQMA 5IP7I 3J81f 4AYBA 3GTMI 2NVTI 3GCFA 3CCL1 2LFUA 3NDIA 3CC71 1Q822 4BY7I 3BG0B 3JAMb 3NH8A 1X3ZA 3M3YI 4EWCA 2V8IA 2OTJZ 2GU2A 1YUAA 1YIT1 2RIQA 3VMIA 4NB9A 4DQYB 2PMZA 1S72Z 1N8R2 4BY1X 3CCEZ 3CCS1 3G4S1 3CCJZ 1K8A2 4NBBA 3G711 4NOZA 2EGTA 2H85A 1P9NA 3HOWI 1VQL1 4MXUA 1QF8A 1VQN1 3I55Z 1Z03A 2DE6A 4RV9A 3CC21 3HOXI 2QKDA 5C4JI 2JA8I 4NBDA 1JJ2Y 3CXCY 1NJI1 2AKLA 1YJ91 1VQ91 2O53A 1Q7Y1 3GTMS 1Y1WI 1VQMZ 3GKQA 3NH4A 1WIIA 4A3LI 4MD8A 3EERA 4HGZA 3NDJA 4MD9A 3J7A4 1Q821 5A2Qf 1NUIA 3CMAZ 1KC82 2HF1A 2LW4A 3IF8A 1ML8A 3S1QI 1USPB 5FLXb 3BG1B 1Q862 3VB9A 3KIHA 4BY1I 2QEXZ 1ENWA 1TWGI 1YI2Z 1N8R1 2RBLA 2QREB 2OTL1 1Y1VI 4NBHA 3CPWZ 2QA4Z 5IT9b 1K8A1 1ZH1A 3I4MI 2V8JA 2E2HI 1I3QI 3J80b 3I56Z 2E2JI 3S1MI 2DE7A 4BXXX 1VQOZ 3F3FC 3HOUI 2QLVB 2WAQA 2RHBA 2PM9A 1I6HI 4NBCA 2G2KA 4MD7A 1K732 4A3FI 1VLAA 3CCU1 4RVDA 1NJI2 1WW9A 2QRCB 5LL6f 3S2DI 1LQLA 4E32A 4E2XA 2OTJ1 1Q812 1K83I 5C3EI 2M48A 4NFRA 4E2YA 1RO4A 4A3CI 5T64A 4TNUA 1S721 3H3VJ 2GTIA 2YADA 1VQ4Z 1KC81 3GTQI 5T67A 3S17I 1YJWZ 1Y1VS 1Q861 1TWFI 3GTOI 2M6NA 2JA6I 3HKZA 1X0TA 5C44I 4NBEA 4MONA 1RO2A 4X6AI 4RVHA 1TWHI 3TE5B 4HH4A 1Z02A 5D1OB 2PK7A 1W2BY 1JWHC 5FLMI 3CCVZ 3T4NB 1VQ8Z 4E31A 4BXXI 2F4OA 1VQM1 2OOYB 3G6EZ 2JS4A 2HU9A 1RQFA 4QTTA 2W04A 1K731 4BBRI 1N2FA 1KQSY 4A3II 1SFOI 2JMOA 3CC7Z 5D1OA 3JAMf 3HOZI 1YIJ1 3CD61 1Q811 1QVFY 4E33A 2KI7B 1YITZ 2Y0SA 2GTHA 1M902 4HGYA 1RNIA 3FKII 1YI21 3G4SZ 1YJNZ 2OZKA 4Y7NI 2BJOA 3S1RI 1VQ71 1JJ2Z 3CXCZ 1KQSZ 4S1TA 3CMEZ 3OW2Y 1VQLZ 2KPIA 4A3GI 1VQO1 2I3CA 2JR6A 3CC41 2OOXB 2DMEA 1RO0A 2NVXI 4BBSI 1TFIA 3I4NI 3S16I 2VUGA 3CCMZ 1QVGY 4CL1A 4A3EI 2JUBA 3D6WA 3P5JB 2B63I 1USPA 3CCQ1 2JNYA 2JA7I 2W03A 3CCRZ 1VQ41 2LIYA 3VMHA 4Y52I 3VMGA 3NH5A 5FLXf 1VQ5Z 3QWUA 4NBGA 3MZKB 1M901 2QR1B 3NFZA 1VQPZ 3U50C 2P3YA 4NB8A 2VF1A 5IT9f 1QYPA 3I07A 3CCE1 1TWAI 2E9HA 3CCJ1 1VQKZ 3J80f 3CCV1 1VQ81 1KRLA 3GTPI 4A3KI 2QRDB 3G6E1 4NBAA 1TWCI 3I551 2YU9I 4E2ZA 3MZLB 1M1K2 4XX2A 4A3JI 2R92I 3CCUZ 2Q51A 4A3DI 2JA5I 2WB1A 1YHQZ 1R9TI 3RZOI 4NH1C 1NP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4M I;  3K7A I;  2E2H I;  1I3Q I;  3NDQ A;  4QTU A;  4Y7N I;  2E2J I;  4A93 I;  2BJO A;  3S1R I;  3S1M I;  2DE7 A;  2E2I I;  5IP7 I;  1X3W A;  3GTM I;  2NVT I;  3GCF A;  4BXX X;  4MH4 A;  3HOU I;  1L1O C;  3HOV I;  1WCM I;  2KPI A;  4A3G I;  4BY7 I;  1I6H I;  4NBC A;  2JR6 A;  4A3F I;  1VLA A;  5CM2 M;  1DL6 A;  1X3Z A;  3M3Y I;  3GTK I;  1ZB9 A;  1WW9 A;  3GTJ I;  2DME A;  3RZD I;  3S2D I;  3ESW A;  3S2H I;  1LQL A;  2NVX I;  1YUA A;  4BBS I;  1I50 I;  5IP9 I;  3M4O I;  3HOY I;  1TFI A;  3VMI A;  3I4N I;  3S16 I;  3PO3 I;  1K83 I;  4NB9 A;  5C3E I;  2F4M A;  4A3E I;  1PFT A;  1RO4 A;  3D6W A;  4BY1 X;  4A3C I;  2B63 I;  1USP A;  3LUS A;  3H3V J;  4NBB A;  4NOZ A;  2JNY A;  2JA7 I;  3GTQ I;  5C4X I;  3HOW I;  3S17 I;  2DE6 A;  1Y1V S;  3VMH A;  4Y52 I;  1TWF I;  3HOX I;  3VMG A;  1RLY A;  2JA6 I;  3GTO I;  2VUM I;  5C44 I;  4NBE A;  5C4J I;  2JA8 I;  4NBG A;  4NBD A;  2J6A A;  3PO2 I;  4X6A I;  2AKL A;  4BY7 X;  1TWH I;  3U50 C;  3GTM S;  2P3Y A;  2PK7 A;  1Y1W I;  4NB8 A;  1QYP A;  5FLM I;  3I07 A;  3GTL I;  4BXX I;  2F4O A;  1TWA I;  3GKQ A;  2DE5 A;  2R93 I;  4A3L I;  3EER A;  2JS4 A;  3GTP I;  3S15 I;  4A3K I;  4QTT A;  4NBA A;  1NUI A;  1TWC I;  4BBR I;  1N2F A;  2HF1 A;  3CQZ I;  3PO3 S;  2YU9 I;  4A3I I;  1SFO I;  3Q87 A;  2LW4 A;  3H0G I;  4XX2 A;  1ML8 A;  2NVQ I;  3S1N I;  1ZB8 A;  4A3J I;  3S1Q I;  1USP B;  2R92 I;  3HOZ I;  4A3B I;  3GTG I;  2R7Z I;  2JA5 I;  4NBF A;  4A3D I;  3VB9 A;  4BY1 I;  1ENW A;  1TWG I;  2K5R A;  4A3M I;  1R9T I;  2RBL A;  3RZO I;  1Y1V I;  4NBH A;  2NVY I;  3S14 I;  3FKI I; 
#chains in the Genus database with same CATH topology
 2C4G B;  1D3U B;  2JGZ B;  1VQ6 Z;  1OKV B;  1JKW A;  3CCL Z;  1S7M A;  4BCI B;  5D1P A;  2WMB B;  2IZ4 A;  3FQQ A;  4HL4 A;  2BKZ B;  5I5Z B;  4MFD A;  1KD1 1;  1YJN 1;  1GY3 B;  3HB9 A;  1X3W A;  4BCN B;  3K7A M;  2Q4Z A;  4MH4 A;  4JX6 A;  5A2Q b;  3CMA 1;  1L1O C;  4F7L B;  3HOV I;  1QXF A;  1WCM I;  2RPR A;  1UNL D;  1W2B Z;  2RT9 A;  4EC9 B;  4YOZ A;  3CME 1;  3EID B;  2X1N B;  5CM2 M;  1DL6 A;  3GTK I;  1ZB9 A;  1C9B A;  3GTJ I;  3RZD I;  3ESW A;  2QEX 1;  1K9M 2;  3S2H I;  4YC3 B;  1I50 I;  3D9X A;  5IP9 I;  2D0Q B;  3M4O I;  3CCS Z;  1TD6 A;  1OL2 B;  3HOY I;  1UNH D;  3PO3 I;  4HLQ A;  2QA4 1;  2F4M A;  2ZPE B;  4F6S B;  1PFT A;  3G71 Z;  2WFY B;  3TN8 B;  2PMI B;  4EOP B;  1F5Q B;  3I56 1;  3CCM 1;  3LUS A;  2DXB B;  3MON A;  2IZ3 A;  5CYI B;  2R6M A;  3KIF A;  3F3P C;  1VQN Z;  4E30 A;  2KR6 A;  3X28 B;  3CPW Y;  3CC2 Z;  1M1K 1;  1QVF Z;  4OB2 B;  5C4X I;  2O4H A;  4RS4 A;  3MIA B;  3BLH B;  5AN9 F;  1URC B;  4ZGE B;  1RLY A;  2VUM I;  3CCR 1;  2P28 A;  4E2W A;  2BS2 A;  1YJ9 Z;  1VQ9 Z;  2J6A A;  3PO2 I;  2CCI B;  1YIJ Z;  1GUX B;  2BPM B;  4CFN B;  3A8G B;  1JOW A;  3CD6 Z;  1VQ5 1;  4BY7 X;  2CYZ B;  4ROC A;  3HO8 A;  4OGR B;  1Z01 A;  3QHW B;  2W96 A;  4RVG A;  3OW2 Z;  3GTL I;  2V22 B;  3J81 b;  1VQP 1;  2W99 A;  5HBE B;  2DE5 A;  5ICP B;  4EC8 B;  2EUF A;  5IDN B;  3DJB A;  1KD1 2;  2R93 I;  1VQ7 Z;  4BCQ D;  1VQK 1;  1YUK A;  2IVX A;  2V8K A;  3S15 I;  5L2W B;  3M03 A;  2K3R A;  2ZPF B;  3VKG A;  5IDP B;  1YJW 1;  3VTN A;  1H1P B;  2WIH B;  4BCF B;  4BCG B;  1GUX A;  3CQZ I;  3PO3 S;  3Q87 A;  5HQ0 B;  3BG5 A;  3H0G I;  1QVG Z;  2NVQ I;  4QSH A;  4F70 B;  4EOM B;  1ZB8 A;  4MRI A;  3S1N I;  3TW7 A;  1K9M 1;  3EJ1 B;  4DGL A;  3EED A;  4A3B I;  3CC4 Z;  2OTL Z;  3IR7 A;  3GTG I;  2R7Z I;  4NBF A;  3A8O B;  3VYH B;  3IFU A;  3TDH B;  2VPZ A;  2ZAE B;  2K5R A;  2UZD B;  4A3M I;  2PJQ A;  3IX0 A;  2NVY I;  3S14 I;  1YHQ 1;  4BCM B;  3B57 A;  4RVF A;  1UGR B;  4DK1 A;  2WIP B;  3VKH A;  1Q7Y 2;  1AHJ B;  3K7A I;  4CFM B;  5T6B A;  3NDQ A;  4QTU A;  1OGU B;  3CCQ Z;  2AHJ B;  4A93 I;  1G3N C;  2E2I I;  3VYG B;  1VQ6 1;  3FQM A;  5IP7 I;  3J81 f;  4AYB A;  2CZ6 B;  4ZGJ B;  2NVT I;  3GCF A;  2I40 B;  3GTM I;  3CCL 1;  2VPW A;  2BS3 A;  4ROD A;  3BLR B;  2LFU A;  3NDI A;  3CC7 1;  1Q82 2;  2C5X B;  4BY7 I;  3BG0 B;  3POM A;  3JAM b;  2CZ1 B;  4CXA B;  3NH8 A;  1X3Z A;  3M3Y I;  4EWC A;  2V8I A;  3D2L A;  2OTJ Z;  4EON B;  2GU2 A;  2LEX A;  1YUA A;  1YIT 1;  3BHV B;  4FX3 B;  2RIQ A;  1PKD B;  3VMI A;  3LQ5 B;  4CFU B;  4NB9 A;  4DQY B;  3A8M B;  2PMZ A;  1S72 Z;  1N8R 2;  4F6W B;  3QXE B;  5CEI B;  4AI6 A;  4BY1 X;  4BCO B;  3CCE Z;  3CCS 1;  3G4S 1;  3DDP B;  2C5O B;  3CCJ Z;  3QZ9 B;  4IMY B;  1K8A 2;  4NBB A;  5ACB A;  3G71 1;  4NOZ A;  2EGT A;  2H85 A;  4BCJ B;  2VPY A;  1P9N A;  3TW6 A;  1AIS B;  2F2C A;  3HOW I;  4EOO B;  1VQL 1;  4OB0 B;  4MXU A;  1QF8 A;  1VQN 1;  3I55 Z;  1Z03 A;  2DE6 A;  4RV9 A;  3CC2 1;  3HOX I;  2WEV B;  2IW6 B;  4ELL A;  2QKD A;  5C4J I;  2JA8 I;  4NBD A;  4HNT A;  1JJ2 Y;  3CXC Y;  1NJI 1;  2AKL A;  1UNG D;  1YJ9 1;  1VQ9 1;  2PHG A;  2O53 A;  1Q7Y 1;  3GTM S;  4OB1 B;  1Y1W I;  3TNI B;  1VQM Z;  2B9R A;  2JIR A;  1P5E B;  5LMK B;  3GKQ A;  3NH4 A;  4OB3 B;  1WII A;  1WZN A;  4MD8 A;  4A3L I;  4TTH A;  1OKW B;  3EER A;  4HGZ A;  3NDJ A;  4MD9 A;  2R7G A;  2UUE B;  1H4L D;  1H24 B;  1FIN B;  3J7A 4;  4NC6 A;  1Q82 1;  2C5N B;  1ZP2 A;  5A2Q f;  3DDQ B;  1NUI A;  2JIM A;  3CMA Z;  1GH6 B;  1KC8 2;  4KRD B;  2HF1 A;  5HBH B;  2LW4 A;  3IF8 A;  1ML8 A;  3S1Q I;  1USP B;  5FLX b;  3BHT B;  3BG1 B;  1Q86 2;  4KRC B;  4UN0 A;  4BBR M;  2WJ9 A;  4F6U B;  3VB9 A;  3KIH A;  4BY1 I;  4BCN D;  4LOC A;  2QEX Z;  1ENW A;  1TWG I;  2NAP A;  1YI2 Z;  1N8R 1;  1H1Q B;  2QQ8 A;  3QZ5 B;  2QRE B;  2RBL A;  2ZPB B;  4F7J B;  2OTL 1;  1Y1V I;  4NBH A;  3CPW Z;  3WVE B;  2IW9 B;  4BCH B;  2QA4 Z;  5IT9 b;  1K8A 1;  1ZH1 A;  3I4M I;  2DD4 B;  4YOS A;  2QFZ A;  2V8J A;  1I3Q I;  2E2H I;  3QWL A;  1E9H B;  3J80 b;  3I56 Z;  2E2J I;  5DQV A;  3S1M I;  2DE7 A;  1XO2 A;  2QDJ A;  4BXX X;  1VQO Z;  3F3F C;  3HOU I;  4G6L B;  3DL1 A;  2BS4 A;  1BU2 A;  1H1S B;  2QLV B;  2WAQ A;  3BG9 A;  4EOL B;  2RHB A;  1FDO A;  3KHI A;  1TFB A;  2PM9 A;  5HVY B;  1I6H I;  4NBC A;  2G2K A;  4MD7 A;  1K73 2;  3DOG B;  4A3F I;  1VLA A;  3CCU 1;  1Q16 A;  4YOO A;  2I53 A;  4RVD A;  1NJI 2;  4AKI A;  1WW9 A;  2CJM B;  4OR5 B;  3RGF B;  2QRC B;  5LL6 f;  3S2D I;  1LQL A;  4E32 A;  4E2X A;  2OTJ 1;  1H1R B;  2PK9 B;  2V45 A;  1K83 I;  1KXU A;  1Q81 2;  5C3E I;  3X20 B;  2M48 A;  4NFR A;  4E2Y A;  1RO4 A;  4A3C I;  5T64 A;  4TNU A;  3QYE A;  1S72 1;  3H3V J;  2GTI A;  2YAD A;  4JX4 A;  4MIM A;  1VQ4 Z;  1FDI A;  2JIO A;  2UZE B;  2PK2 A;  1KC8 1;  3A8L B;  4NST B;  3GTQ I;  5T67 A;  2CCH B;  3S17 I;  1YJW Z;  1H27 B;  2ZZD B;  3BG3 A;  1Y1V S;  1Q86 1;  1TWF I;  3GTO I;  4BCP B;  2M6N A;  2JA6 I;  3HKZ A;  1X0T A;  1Y8C A;  5C44 I;  1OIU B;  3TNW B;  4NBE A;  2DD5 B;  4MON A;  4Z6Y A;  3QYB A;  1RO2 A;  4X6A I;  4RVH A;  4M6V A;  3F5X B;  5FGK B;  1VIN A;  1TWH I;  3TE5 B;  4HH4 A;  1E7P A;  1Z02 A;  5D1O B;  1IRE B;  5IHY A;  4EOI B;  2PK7 A;  1W2B Y;  3G33 B;  1JWH C;  5FLM I;  3QHR B;  1AA6 A;  3WVD B;  3CCV Z;  5BNJ B;  3T4N B;  1VQ8 Z;  4E31 A;  3DTO A;  2ZPI B;  2F4O A;  4BXX I;  1VOL A;  1VQM 1;  4ZGD B;  5EFQ B;  2QF7 A;  3TNH B;  2OOY B;  3G6E Z;  3EOC B;  4EOK B;  2JS4 A;  2HU9 A;  1RQF A;  4MFE A;  4QTT A;  2JIQ A;  2W04 A;  2IW8 B;  4BCM D;  4BBR I;  1K73 1;  1N2F A;  1OI9 B;  1KQS Y;  4A3I I;  1SFO I;  2JMO A;  2C6T B;  3CC7 Z;  5D1O A;  3JAM f;  2KMG A;  1JST B;  2DXC B;  1SIW A;  2WMA B;  2E7Z A;  3HOZ I;  1YIJ 1;  3CD6 1;  1Q81 1;  1QVF Y;  4E33 A;  1JSU B;  2UZB B;  2ZPH B;  4BCQ B;  2KI7 B;  1YIT Z;  2Y0S A;  2GTH A;  2CZ0 B;  1M90 2;  4HGY A;  4II5 B;  1OIY B;  1RNI A;  3FKI I;  1YI2 1;  3HBL A;  1FVV B;  1O9K B;  4F7S B;  5LQF B;  4CFV B;  1UGS B;  3G4S Z;  1YJN Z;  2OZK A;  4Y7N I;  2BJO A;  3S1R I;  1VQ7 1;  5DQW A;  3X25 B;  4AKG A;  1JJ2 Z;  3CXC Z;  1W98 B;  1KQS Z;  2WXV B;  2VPX A;  4S1T A;  4CFU D;  3CME Z;  4CFW B;  3OW2 Y;  1FKM A;  2W9Z A;  3MY5 B;  1VQL Z;  2KPI A;  1QLB A;  4EOJ B;  4A3G I;  1VQO 1;  2DPP B;  4ELJ A;  2I3C A;  2JR6 A;  3CC4 1;  4JX5 A;  2OOX B;  3H4C A;  5HBJ B;  2AYD A;  2DME A;  1RO0 A;  1O9K A;  1H25 B;  2NVX I;  4BBS I;  5IF1 B;  1TFI A;  3I4N I;  3S16 I;  2JIP A;  2VUG A;  3CCM Z;  1QVG Y;  4CL1 A;  4A3E I;  2JUB A;  3D6W A;  4CFX B;  1V29 B;  5EJC A;  3P5J B;  2B63 I;  2QGS A;  1USP A;  4I3Z B;  3CCQ 1;  2JNY A;  2CZ7 B;  2JA7 I;  2W03 A;  3CCR Z;  1VQ4 1;  1AD6 A;  1WJ2 A;  4CRL B;  4EOR B;  2LIY A;  3VMH A;  4Y52 I;  2C5V B;  3VMG A;  2ZPG B;  5HNB B;  3NH5 A;  5FLX f;  1VQ5 Z;  3BHU B;  3QWU A;  4NBG A;  3MZK B;  3QYG B;  1UGP B;  3O0G D;  4FM4 B;  1M90 1;  2WPA B;  3QYH B;  4BBS M;  2QR1 B;  3NFZ A;  2G9X B;  4HNU A;  4BCK B;  3U50 C;  1VQP Z;  2P3Y A;  2QDY B;  1H28 B;  1QMZ B;  3X24 B;  4NB8 A;  2VF1 A;  5IT9 f;  1QYP A;  3MY1 B;  3I07 A;  3CCE 1;  3BLQ B;  1TWA I;  2E9H A;  3CCJ 1;  1VQK Z;  3MI9 B;  4EOS B;  3J80 f;  2G77 A;  3X26 B;  2UZL B;  2W2H A;  3A8H B;  3CCV 1;  2IV2 X;  1VQ8 1;  1KRL A;  3GTP I;  4HNV A;  4A3K I;  2QRD B;  3HZJ A;  3HHT B;  3G6E 1;  1H26 B;  4NBA A;  1UGQ B;  1TWC I;  3I55 1;  2V3V A;  4ROE A;  4EOQ B;  2YU9 I;  4E2Z A;  3MZL B;  1M1K 2;  2W9F A;  4XX2 A;  2IN3 A;  4A3J I;  2R92 I;  3CCU Z;  2Q51 A;  4A3D I;  2JA5 I;  2WHB B;  1VYW B;  2WB1 A;  1YHQ Z;  1R9T I;  4AKH A;  1OL1 B;  3RZO I;  1N4M A;  2ZCF B;  4NH1 C;  4F7N B;  4Y72 B;  1NP6 A; 
#chains in the Genus database with same CATH homology
 1VQ6 Z;  3CCL Z;  1S7M A;  5D1P A;  2IZ4 A;  3FQQ A;  1KD1 1;  1YJN 1;  1X3W A;  2Q4Z A;  4MH4 A;  5A2Q b;  3CMA 1;  1L1O C;  3HOV I;  1WCM I;  2RPR A;  1W2B Z;  2RT9 A;  3CME 1;  5CM2 M;  1DL6 A;  3GTK I;  1ZB9 A;  3GTJ I;  3RZD I;  3ESW A;  2QEX 1;  1K9M 2;  3S2H I;  1I50 I;  3D9X A;  5IP9 I;  3M4O I;  3CCS Z;  3HOY I;  3PO3 I;  2QA4 1;  2F4M A;  1PFT A;  3G71 Z;  3I56 1;  3CCM 1;  3LUS A;  3MON A;  2IZ3 A;  2R6M A;  3KIF A;  3F3P C;  1VQN Z;  4E30 A;  3CPW Y;  3CC2 Z;  1M1K 1;  1QVF Z;  5C4X I;  2O4H A;  4RS4 A;  5AN9 F;  1RLY A;  2VUM I;  3CCR 1;  2P28 A;  4E2W A;  1YJ9 Z;  1VQ9 Z;  2J6A A;  3PO2 I;  1YIJ Z;  3CD6 Z;  1VQ5 1;  4BY7 X;  1Z01 A;  4RVG A;  3OW2 Z;  3GTL I;  3J81 b;  1VQP 1;  2DE5 A;  2R93 I;  1KD1 2;  1VQ7 Z;  1VQK 1;  1YUK A;  2V8K A;  3S15 I;  2K3R A;  1YJW 1;  3VTN A;  3CQZ I;  3PO3 S;  3Q87 A;  3H0G I;  1QVG Z;  2NVQ I;  4MRI A;  3S1N I;  1ZB8 A;  1K9M 1;  4DGL A;  3EED A;  4A3B I;  3CC4 Z;  2OTL Z;  3GTG I;  2R7Z I;  4NBF A;  3IFU A;  3TDH B;  2ZAE B;  2K5R A;  4A3M I;  3IX0 A;  2NVY I;  3S14 I;  1YHQ 1;  4RVF A;  4DK1 A;  1Q7Y 2;  3K7A I;  5T6B A;  3NDQ A;  4QTU A;  3CCQ Z;  4A93 I;  2E2I I;  1VQ6 1;  3FQM A;  5IP7 I;  3J81 f;  4AYB A;  3GTM I;  2NVT I;  3GCF A;  3CCL 1;  2LFU A;  3NDI A;  3CC7 1;  1Q82 2;  4BY7 I;  3BG0 B;  3JAM b;  3NH8 A;  1X3Z A;  3M3Y I;  4EWC A;  2V8I A;  2OTJ Z;  2GU2 A;  1YUA A;  1YIT 1;  2RIQ A;  3VMI A;  4NB9 A;  4DQY B;  2PMZ A;  1S72 Z;  1N8R 2;  4BY1 X;  3CCE Z;  3CCS 1;  3G4S 1;  3CCJ Z;  1K8A 2;  4NBB A;  3G71 1;  4NOZ A;  2EGT A;  2H85 A;  1P9N A;  3HOW I;  1VQL 1;  4MXU A;  1QF8 A;  1VQN 1;  3I55 Z;  1Z03 A;  2DE6 A;  4RV9 A;  3CC2 1;  3HOX I;  2QKD A;  5C4J I;  2JA8 I;  4NBD A;  1JJ2 Y;  3CXC Y;  1NJI 1;  2AKL A;  1YJ9 1;  1VQ9 1;  2O53 A;  1Q7Y 1;  3GTM S;  1Y1W I;  1VQM Z;  3GKQ A;  3NH4 A;  1WII A;  4A3L I;  4MD8 A;  3EER A;  4HGZ A;  3NDJ A;  4MD9 A;  3J7A 4;  1Q82 1;  5A2Q f;  1NUI A;  3CMA Z;  1KC8 2;  2HF1 A;  2LW4 A;  3IF8 A;  1ML8 A;  3S1Q I;  1USP B;  5FLX b;  3BG1 B;  1Q86 2;  3VB9 A;  3KIH A;  4BY1 I;  2QEX Z;  1ENW A;  1TWG I;  1YI2 Z;  1N8R 1;  2RBL A;  2QRE B;  2OTL 1;  1Y1V I;  4NBH A;  3CPW Z;  2QA4 Z;  5IT9 b;  1K8A 1;  1ZH1 A;  3I4M I;  2V8J A;  2E2H I;  1I3Q I;  3J80 b;  3I56 Z;  2E2J I;  3S1M I;  2DE7 A;  4BXX X;  1VQO Z;  3F3F C;  3HOU I;  2QLV B;  2WAQ A;  2RHB A;  2PM9 A;  1I6H I;  4NBC A;  2G2K A;  4MD7 A;  1K73 2;  4A3F I;  1VLA A;  3CCU 1;  4RVD A;  1NJI 2;  1WW9 A;  2QRC B;  5LL6 f;  3S2D I;  1LQL A;  4E32 A;  4E2X A;  2OTJ 1;  1Q81 2;  1K83 I;  5C3E I;  2M48 A;  4NFR A;  4E2Y A;  1RO4 A;  4A3C I;  5T64 A;  4TNU A;  1S72 1;  3H3V J;  2GTI A;  2YAD A;  1VQ4 Z;  1KC8 1;  3GTQ I;  5T67 A;  3S17 I;  1YJW Z;  1Y1V S;  1Q86 1;  1TWF I;  3GTO I;  2M6N A;  2JA6 I;  3HKZ A;  1X0T A;  5C44 I;  4NBE A;  4MON A;  1RO2 A;  4X6A I;  4RVH A;  1TWH I;  3TE5 B;  4HH4 A;  1Z02 A;  5D1O B;  2PK7 A;  1W2B Y;  1JWH C;  5FLM I;  3CCV Z;  3T4N B;  1VQ8 Z;  4E31 A;  4BXX I;  2F4O A;  1VQM 1;  2OOY B;  3G6E Z;  2JS4 A;  2HU9 A;  1RQF A;  4QTT A;  2W04 A;  1K73 1;  4BBR I;  1N2F A;  1KQS Y;  4A3I I;  1SFO I;  2JMO A;  3CC7 Z;  5D1O A;  3JAM f;  3HOZ I;  1YIJ 1;  3CD6 1;  1Q81 1;  1QVF Y;  4E33 A;  2KI7 B;  1YIT Z;  2Y0S A;  2GTH A;  1M90 2;  4HGY A;  1RNI A;  3FKI I;  1YI2 1;  3G4S Z;  1YJN Z;  2OZK A;  4Y7N I;  2BJO A;  3S1R I;  1VQ7 1;  1JJ2 Z;  3CXC Z;  1KQS Z;  4S1T A;  3CME Z;  3OW2 Y;  1VQL Z;  2KPI A;  4A3G I;  1VQO 1;  2I3C A;  2JR6 A;  3CC4 1;  2OOX B;  2DME A;  1RO0 A;  2NVX I;  4BBS I;  1TFI A;  3I4N I;  3S16 I;  2VUG A;  3CCM Z;  1QVG Y;  4CL1 A;  4A3E I;  2JUB A;  3D6W A;  3P5J B;  2B63 I;  1USP A;  3CCQ 1;  2JNY A;  2JA7 I;  2W03 A;  3CCR Z;  1VQ4 1;  2LIY A;  3VMH A;  4Y52 I;  3VMG A;  3NH5 A;  5FLX f;  1VQ5 Z;  3QWU A;  4NBG A;  3MZK B;  1M90 1;  2QR1 B;  3NFZ A;  1VQP Z;  3U50 C;  2P3Y A;  4NB8 A;  2VF1 A;  5IT9 f;  1QYP A;  3I07 A;  3CCE 1;  1TWA I;  2E9H A;  3CCJ 1;  1VQK Z;  3J80 f;  3CCV 1;  1VQ8 1;  1KRL A;  3GTP I;  4A3K I;  2QRD B;  3G6E 1;  4NBA A;  1TWC I;  3I55 1;  2YU9 I;  4E2Z A;  3MZL B;  1M1K 2;  4XX2 A;  4A3J I;  2R92 I;  3CCU Z;  2Q51 A;  4A3D I;  2JA5 I;  2WB1 A;  1YHQ Z;  1R9T I;  3RZO I;  4NH1 C;  1NP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...