3GTMS

Co-complex of backtracked rna polymerase ii with tfiis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
163
structure length
163
Chain Sequence
KLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSADHPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: backtracked RNA polymerase II at 3.4 angstrom resolution.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription, transferase/dna-rna hybrid
total genus 18
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2009-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3gtmS01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3gtmS02
5C44I 3I4MI 3S17I 1WCMI 2F4OA 4NBBA 5IP9I 4A3MI 4A3BI 1K83I 3HOXI 4NBEA 1I50I 2R92I 2P3YA 4NB9A 3EERA 4QTTA 4NBFA 3GTKI 3GTMS 4MH4A 1RO4A 2YU9I 4A3JI 3GTOI 2BJOA 1TFIA 3H3VJ 5C3EI 3GTQI 2AKLA 1I6HI 2DE7A 4BBRI 1USPA 1PFTA 4XX2A 5CM2M 1X3ZA 4QTUA 2JA6I 1WW9A 2R93I 2PK7A 1VLAA 2DMEA 2JR6A 5C4XI 4BXXI 4NBHA 4NBGA 3H0GI 3S2HI 4NOZA 4Y52I 1USPB 4Y7NI 2RBLA 1ZB9A 4A3FI 3VMIA 3PO2I 1N2FA 3HOVI 1R9TI 2JA5I 3RZDI 1TWGI 3I07A 4X6AI 4BXXX 4A93I 3NDQA 1Y1VS 3LUSA 3CQZI 3S1RI 1ML8A 3PO3S 1L1OC 2NVYI 4A3DI 3S15I 1X3WA 4A3KI 3GTMI 3GTLI 2JS4A 3ESWA 1RLYA 3GTJI 1SFOI 2E2HI 2NVTI 1TWFI 1TWAI 3GCFA 3VB9A 2B63I 2DE6A 3U50C 3D6WA 1Y1WI 4BBSI 3GKQA 3S14I 3HOUI 4NBAA 3S2DI 3K7AI 3M4OI 4A3CI 2LW4A 2DE5A 3HOZI 4A3II 1QYPA 1YUAA 3Q87A 2K5RA 3GTPI 4BY1I 4NBDA 2HF1A 4BY7I 2JNYA 3S1NI 2NVQI 3S1MI 2F4MA 3RZOI 2VUMI 4A3LI 3HOYI 1LQLA 1I3QI 1TWHI 1ZB8A 2J6AA 5IP7I 1DL6A 1TWCI 3M3YI 2JA8I 3VMHA 1ENWA 2KPIA 4BY1X 4NBCA 3VMGA 2R7ZI 2E2JI 3S1QI 4BY7X 1NUIA 1Y1VI 2E2II 3S16I 3GTGI 2NVXI 2JA7I 5FLMI 3I4NI 3FKII 4A3GI 4NB8A 3PO3I 5C4JI 3HOWI 4A3EI
chains in the Genus database with same CATH superfamily
1H1QB 2JIQA 4KRDB 2V8IA 1ZH1A 4A3MI 4A3BI 3J81b 1K83I 3DTOA 3HOXI 4NBEA 1I50I 3CME1 2VPXA 4NB9A 1YIJZ 2LIYA 2HU9A 4MH4A 2UUEB 2YU9I 3CCEZ 3CC71 4EOQB 1VQL1 3MI9B 3NH5A 2DE7A 2G2KA 2JMOA 1K8A2 1SIWA 3CD61 1YI2Z 4MONA 1W2BY 4JX6A 1H4LD 1PKDB 4JX4A 3VKGA 4CRLB 3CC4Z 5HBJB 1Q821 2KI7B 5C4XI 4F7NB 1VQP1 1G3NC 4BCNB 4E31A 4RVGA 4NOZA 3J81f 4OB3B 1RQFA 2CYZB 2WXVB 4Y7NI 3CCR1 2WB1A 5IT9b 3HOVI 2PJQA 3CCVZ 4FX3B 4BCKB 3I07A 1KXUA 1JJ2Y 3CMA1 4X6AI 4QSHA 3T4NB 4CL1A 3EIDB 4A93I 2CZ7B 3O0GD 3TW7A 4ZGDB 3NDQA 2GTHA 5FLXf 1VQ4Z 2VPYA 5L2WB 3X25B 2W99A 2WMAB 3OW2Z 4HNUA 1JWHC 2V22B 1L1OC 1ML8A 4RS4A 4II5B 3CCQ1 3NH4A 5ICPB 1UGRB 2OTL1 1VQ7Z 4RV9A 4F7LB 1Y8CA 3GTJI 3NDJA 2V45A 3HKZA 3VB9A 4S1TA 2B63I 1Q822 1Y1WI 1QXFA 2OTJ1 2WIPB 4NH1C 3S14I 2EGTA 4CFMB 1YJWZ 2QQ8A 2CJMB 4KRCB 2IW9B 4BCQB 3HOZI 4A3II 4EC8B 5A2Qb 1Q811 2DD4B 3Q87A 2G9XB 1OL2B 3HB9A 3BLHB 2QA41 1TD6A 3QYHB 1JKWA 3M03A 1E7PA 3S1NI 1VQ81 2F4MA 3QZ9B 3KHIA 2JIOA 1K9M1 2VUMI 1I3QI 1TWHI 1YHQZ 1VQNZ 1TWCI 1VQMZ 1GH6B 2DXCB 4BCJB 1K731 4E33A 2F2CA 1FKMA 2KPIA 5T6BA 3TE5B 1VQ9Z 1YJ9Z 2R7ZI 1OGUB 3S1QI 1URCB 1S721 4NC6A 5FLMI 2R7GA 2ZPBB 3FKII 3A8HB 4YOSA 2ZAEB 4OB1B 3CPWY 1QVFZ 4F6WB 4YC3B 3EOCB 5A2Qf 3CC21 3HOWI 3A8LB 3I4MI 4RVDA 1YJNZ 4HH4A 1UGQB 5T67A 2UZLB 2WIHB 1C9BA 4EWCA 2P3YA 1KD11 1P9NA 4EOOB 4QTTA 1M1K1 4CFUD 3BHTB 3GTMS 4BCGB 1Q7Y2 3GTOI 3BG0B 1H1SB 2ZPIB 1M901 1V29B 3HBLA 2RT9A 3CCLZ 5C3EI 1UGSB 4HGZA 4EOLB 1W98B 3G6EZ 3MIAB 1WIIA 4TNUA 4XX2A 3I56Z 3HZJA 2QR1B 2QEX1 1X3ZA 4QTUA 1NJI1 2QDYB 2R93I 4Y72B 4E2WA 1VYWB 1Q16A 1VLAA 2DMEA 4NBHA 5T64A 1N8R2 4EOSB 3S2HI 3K7AM 2QFZA 3MZKB 2Q4ZA 4MFDA 3QYGB 4MD8A 2JIRA 2RBLA 4RVHA 1ZB9A 4A3FI 3VMIA 1Z03A 3D9XA 2I53A 3I551 3MY1B 2M6NA 1TWGI 2QLVB 3BG3A 1VQK1 2V8KA 2QDJA 1VQ51 4DQYB 1VQ6Z 5FLXb 3CCUZ 3B57A 2V3VA 5AN9F 4DK1A 4I3ZB 4ELLA 2O53A 3QXEB 4ZGEB 3NFZA 1VQPZ 1OI9B 1QVGZ 4HNVA 3S1RI 2BS2A 2QF7A 2ZPFB 3PO3S 2NVYI 4ROCA 3TDHB 1GUXA 3GTMI 4AI6A 1M902 4LOCA 2QKDA 1S7MA 2IV2X 2NVTI 4BCPB 4CFVB 1YITZ 1TWAI 3GCFA 2CCHB 2ZPGB 4E2ZA 1JOWA 2X1NB 3RGFB 3U50C 2Q51A 3D6WA 1H1RB 3CCE1 4HL4A 5EFQB 1GUXB 2C4GB 3K7AI 3M4OI 4A3CI 3QWLA 5HQ0B 1YI21 2W9ZA 1KC81 3GTPI 2M48A 1KQSY 4EOIB 2HF1A 4JX5A 3WVEB 2JNYA 2LFUA 2P28A 3J80b 5LQFB 5HVYB 2NVQI 2VPZA 1D3UB 2IZ3A 1P5EB 4BBRM 3FQQA 1LQLA 5IP7I 1ZB8A 1DL6A 2AHJB 3VYHB 2JUBA 3CCMZ 3M3YI 2JA8I 5I5ZB 2OTJZ 4NBCA 4CFWB 2NAPA 3CXCZ 2BKZB 1H27B 3CCV1 2JA7I 4MFEA 1QLBA 5IDNB 2O4HA 3KIHA 4MD7A 2RHBA 4A3GI 3LQ5B 3G711 3PO3I 1VQ41 2C5NB 1UGPB 1FDIA 3DOGB 2ZCFB 4A3EI 3IX0A 3J80f 1RNIA 4CXAB 5LL6f 3CCS1 1QMZB 3TW6A 1VQ71 4NBFA 3GTKI 4OB2B 2C5OB 1RO4A 1S72Z 3QYBA 1BU2A 4E30A 3QYEA 1KC82 1H24B 2ZZDB 1AA6A 3H3VJ 1OKWB 3GTQI 2CZ1B 5IDPB 2WJ9A 4BBRI 4HGYA 3X24B 3CC2Z 3F3PC 2W2HA 5CEIB 2DXBB 3G4S1 2PK7A 3JAMb 3POMA 2RPRA 2CZ6B 4BBSM 4E2XA 4NBGA 3H0GI 4DGLA 1N4MA 4NFRA 2C6TB 1VOLA 1VQOZ 3BLQB 1H1PB 3OW2Y 2B9RA 3TN8B 3X26B 3DDQB 1YHQ1 1W2BZ 1VQN1 3PO2I 4F6UB 1N2FA 2PMZA 1KRLA 4FM4B 2WPAB 1R9TI 3DJBA 2JA5I 3RZDI 1Q812 4E2YA 3A8MB 2UZEB 1VQ91 1E9HB 2W9FA 2QEXZ 1H28B 3H4CA 1Y1VS 5HBHB 2W04A 5DQWA 1K9M2 3J7A4 2E7ZA 3LUSA 3JAMf 2IN3A 1K8A1 5DQVA 4MD9A 1K732 3CMEZ 4F70B 4YOZA 1RO0A 4A3KI 3BHVB 3QZ5B 1JJ2Z 4CFXB 3GTLI 2JS4A 1WJ2A 1RLYA 2R6MA 2Y0SA 4RVFA 4OR5B 4BCMD 2PK9B 4AKGA 3CC7Z 4AYBA 2IW6B 1VQKZ 2PHGA 1VQLZ 1VQ5Z 2CCIB 4Z6YA 1O9KB 4BBSI 4CFNB 3GKQA 2OOYB 3CD6Z 4NBAA 1GY3B 3BG1B 4TTHA 2DPPB 1UNLD 3X20B 2KMGA 1QYPA 2G77A 4HLQA 1YUAA 3I561 1KD12 1OKVB 4BY1I 3CCJ1 5CYIB 4BY7I 1IREB 2DD5B 3KIFA 1M1K2 2WEVB 3S1MI 1FDOA 3RZOI 3HOYI 3CCRZ 1QVFY 2BPMB 1QF8A 3F5XB 3A8OB 5IF1B 3D2LA 4OB0B 2KR6A 2IW8B 2AYDA 3F3FC 2LEXA 1YIJ1 3VMHA 1ENWA 2W03A 5BNJB 4BY1X 3VMGA 2EUFA 4E32A 3CMAZ 2E2JI 4BY7X 2PMIB 1NUIA 1Y1VI 1NJI2 3S16I 3BLRB 3GTGI 2NVXI 4YOOA 2WAQA 5D1OA 2JGZB 1VQ61 4NB8A 3TNWB 3CCU1 4UN0A 2PM9A 5C4JI 3TNIB 4M6VA 4G6LB 5C44I 3CC41 3S17I 3MY5B 1WCMI 2VF1A 3CCQZ 2F4OA 4NBBA 5IP9I 2OTLZ 2CZ0B 4BCFB 3QHWB 2R92I 2VUGA 1X0TA 2UZDB 3BG9A 1OIUB 2C5XB 3EERA 5D1OB 1AHJB 2VPWA 2H85A 4MRIA 1YIT1 4A3JI 3CPWZ 4F7JB 2BJOA 1FINB 1TFIA 4AKIA 1NP6A 2AKLA 1I6HI 3G71Z 5EJCA 3VYGB 2RIQA 1USPA 1PFTA 2QRDB 2D0QB 4ROEA 4AKHA 2BS3A 2WHBB 5CM2M 4OGRB 1VINA 1Z01A 1WW9A 2QA4Z 2JA6I 2OZKA 2JIMA 5D1PA 1VQ8Z 4CFUB 4HNTA 3CCSZ 2JR6A 2IVXA 4BXXI 4EOMB 3VTNA 4BCOB 4Y52I 5FGKB 4MXUA 1USPB 1Q861 3IR7A 3QWUA 1QVGY 1AISB 5IT9f 1TFBA 3IF8A 3CCM1 3EJ1B 4BCND 3EEDA 4EOJB 4BXXX 1OIYB 1YUKA 3G4SZ 2I3CA 2ZPEB 3QHRB 1Q7Y1 1YJW1 3DL1A 4EOKB 4F7SB 4BCMB 3CQZI 2PK2A 4A3DI 3S15I 4EOPB 2UZBB 1X3WA 3VKHA 3FQMA 2QGSA 3HO8A 4EORB 3ESWA 1UNGD 1SFOI 1AD6A 2E9HA 3P5JB 2E2HI 1TWFI 2V8JA 5LMKB 1JSTB 1N8R1 2DE6A 1VQM1 5ACBA 3BG5A 3BHUB 1JSUB 3HOUI 1YJ91 2I40B 3S2DI 1RO2A 1FVVB 5IHYA 2LW4A 3G33B 2DE5A 2YADA 4EC9B 2K5RA 3CXCY 1Q862 4NBDA 4F6SB 1H25B 2BS4A 3MZLB 4BCHB 1O9KA 1F5QB 1XO2A 2WFYB 2C5VB 3HHTB 4MIMA 5HNBB 5HBEB 2JIPA 4BCIB 4ELJA 4BCQD 4A3LI 3TNHB 3A8GB 1YJN1 3X28B 2J6AA 3WVDB 1VQO1 1WZNA 1UNHD 2IZ4A 3I55Z 2QREB 3MONA 2ZPHB 3NDIA 1Z02A 1KQSZ 2WMBB 2K3RA 2E2II 2GU2A 3DDPB 3IFUA 3CCL1 3I4NI 4IMYB 2QRCB 4NSTB 1OL1B 4EONB 3NH8A 3G6E1 1ZP2A 2GTIA 3CCJZ 2W96A 2OOXB 1H26B 4ZGJB 4RODA
chains in the Genus database with same CATH topology
2V8IA 1ZH1A 4A3MI 4A3BI 3J81b 1K83I 3HOXI 4NBEA 1I50I 3CME1 4NB9A 1YIJZ 2LIYA 2HU9A 4MH4A 2YU9I 3CCEZ 3CC71 1VQL1 3NH5A 2DE7A 2G2KA 2JMOA 1K8A2 3CD61 1YI2Z 4MONA 1W2BY 3CC4Z 1Q821 2KI7B 5C4XI 1VQP1 4E31A 4RVGA 4NOZA 3J81f 1RQFA 4Y7NI 3CCR1 2WB1A 5IT9b 3HOVI 3CCVZ 4X6AI 3I07A 1JJ2Y 3CMA1 3T4NB 4CL1A 4A93I 3NDQA 2GTHA 5FLXf 1VQ4Z 3OW2Z 1JWHC 1ML8A 1L1OC 4RS4A 3CCQ1 3NH4A 2OTL1 1VQ7Z 4RV9A 3GTJI 3NDJA 3HKZA 3VB9A 4S1TA 2B63I 1Q822 1Y1WI 2OTJ1 4NH1C 3S14I 2EGTA 1YJWZ 3HOZI 4A3II 5A2Qb 1Q811 3Q87A 2QA41 3S1NI 1VQ81 2F4MA 1K9M1 2VUMI 1I3QI 1TWHI 1YHQZ 1VQNZ 1TWCI 1VQMZ 1K731 4E33A 2KPIA 5T6BA 3TE5B 1VQ9Z 1YJ9Z 2R7ZI 3S1QI 1S721 5FLMI 3FKII 2ZAEB 3CPWY 1QVFZ 5A2Qf 3CC21 3HOWI 3I4MI 4RVDA 1YJNZ 4HH4A 5T67A 4EWCA 2P3YA 1KD11 1P9NA 4QTTA 1M1K1 3GTMS 1Q7Y2 3GTOI 3BG0B 1M901 2RT9A 3CCLZ 5C3EI 4HGZA 3G6EZ 1WIIA 4TNUA 4XX2A 3I56Z 2QR1B 2QEX1 1X3ZA 4QTUA 1NJI1 2R93I 4E2WA 1VLAA 2DMEA 4NBHA 5T64A 1N8R2 3S2HI 3MZKB 2Q4ZA 4MD8A 2RBLA 4RVHA 1ZB9A 4A3FI 3VMIA 1Z03A 3D9XA 3I551 2M6NA 1TWGI 2QLVB 1VQK1 2V8KA 1VQ51 4DQYB 1VQ6Z 5FLXb 3CCUZ 5AN9F 4DK1A 2O53A 3NFZA 1VQPZ 1QVGZ 3S1RI 3PO3S 2NVYI 3TDHB 3GTMI 1M902 2QKDA 1S7MA 2NVTI 1YITZ 1TWAI 3GCFA 4E2ZA 3U50C 2Q51A 3D6WA 3CCE1 3K7AI 3M4OI 4A3CI 1YI21 1KC81 3GTPI 2M48A 1KQSY 2HF1A 2P28A 2JNYA 2LFUA 3J80b 2NVQI 2IZ3A 3FQQA 1LQLA 5IP7I 1ZB8A 1DL6A 2JUBA 3CCMZ 3M3YI 2JA8I 2OTJZ 4NBCA 3CXCZ 3CCV1 2JA7I 3KIHA 2O4HA 4MD7A 2RHBA 4A3GI 3G711 3PO3I 1VQ41 4A3EI 3IX0A 3J80f 1RNIA 5LL6f 3CCS1 1VQ71 4NBFA 3GTKI 1RO4A 1S72Z 4E30A 1KC82 3H3VJ 3GTQI 4BBRI 4HGYA 3CC2Z 3F3PC 3G4S1 2PK7A 3JAMb 2RPRA 4E2XA 4NBGA 3H0GI 4DGLA 4NFRA 1VQOZ 3OW2Y 1YHQ1 1W2BZ 1VQN1 3PO2I 2PMZA 1N2FA 1KRLA 1R9TI 2JA5I 3RZDI 1Q812 4E2YA 1VQ91 2QEXZ 1Y1VS 2W04A 1K9M2 3J7A4 3LUSA 3JAMf 1K8A1 4MD9A 1K732 3CMEZ 1RO0A 4A3KI 1JJ2Z 3GTLI 2JS4A 1RLYA 2R6MA 2Y0SA 4RVFA 3CC7Z 4AYBA 1VQKZ 1VQLZ 1VQ5Z 4BBSI 3GKQA 2OOYB 3CD6Z 4NBAA 3BG1B 1QYPA 1YUAA 3I561 1KD12 4BY1I 3CCJ1 4BY7I 3KIFA 1M1K2 3S1MI 3RZOI 3HOYI 3CCRZ 1QVFY 1QF8A 3F3FC 1YIJ1 3CMAZ 3VMHA 1ENWA 2W03A 4BY1X 3VMGA 4E32A 2E2JI 4BY7X 1NUIA 1Y1VI 1NJI2 3S16I 3GTGI 2NVXI 2WAQA 5D1OA 1VQ61 4NB8A 3CCU1 2PM9A 5C4JI 5C44I 3CC41 3S17I 2VF1A 1WCMI 3CCQZ 2F4OA 4NBBA 5IP9I 2OTLZ 2R92I 2VUGA 1X0TA 3EERA 5D1OB 2H85A 4MRIA 1YIT1 4A3JI 3CPWZ 2BJOA 1TFIA 1NP6A 2AKLA 1I6HI 3G71Z 2RIQA 1USPA 1PFTA 2QRDB 5CM2M 2JA6I 1Z01A 2QA4Z 1WW9A 2OZKA 5D1PA 1VQ8Z 3CCSZ 2JR6A 4BXXI 3VTNA 4Y52I 4MXUA 1USPB 1Q861 3QWUA 1QVGY 5IT9f 3IF8A 3CCM1 3EEDA 4BXXX 1YUKA 3G4SZ 2I3CA 1Q7Y1 1YJW1 3CQZI 4A3DI 3S15I 1X3WA 3FQMA 3ESWA 1SFOI 2E9HA 3P5JB 2E2HI 1TWFI 2V8JA 1N8R1 2DE6A 1VQM1 3HOUI 1YJ91 3S2DI 1RO2A 2LW4A 2DE5A 2YADA 2K5RA 3CXCY 1Q862 4NBDA 3MZLB 4A3LI 1YJN1 2J6AA 1VQO1 2IZ4A 3I55Z 2QREB 3MONA 3NDIA 1Z02A 1KQSZ 2K3RA 2E2II 2GU2A 3IFUA 3CCL1 3I4NI 2QRCB 3CCJZ 3G6E1 3NH8A 2GTIA 2OOXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 I;  3I4M I;  3S17 I;  1WCM I;  2F4O A;  4NBB A;  5IP9 I;  4A3M I;  4A3B I;  1K83 I;  3HOX I;  4NBE A;  1I50 I;  2R92 I;  2P3Y A;  4NB9 A;  3EER A;  4QTT A;  4NBF A;  3GTK I;  3GTM S;  4MH4 A;  1RO4 A;  2YU9 I;  4A3J I;  3GTO I;  2BJO A;  1TFI A;  3H3V J;  5C3E I;  3GTQ I;  2AKL A;  1I6H I;  2DE7 A;  4BBR I;  1USP A;  1PFT A;  4XX2 A;  5CM2 M;  1X3Z A;  4QTU A;  2JA6 I;  1WW9 A;  2R93 I;  2PK7 A;  1VLA A;  2DME A;  2JR6 A;  5C4X I;  4BXX I;  4NBH A;  4NBG A;  3H0G I;  3S2H I;  4NOZ A;  4Y52 I;  1USP B;  4Y7N I;  2RBL A;  1ZB9 A;  4A3F I;  3VMI A;  3PO2 I;  1N2F A;  3HOV I;  1R9T I;  2JA5 I;  3RZD I;  1TWG I;  3I07 A;  4X6A I;  4BXX X;  4A93 I;  3NDQ A;  1Y1V S;  3LUS A;  3CQZ I;  3S1R I;  1ML8 A;  3PO3 S;  1L1O C;  2NVY I;  4A3D I;  3S15 I;  1X3W A;  4A3K I;  3GTM I;  3GTL I;  2JS4 A;  3ESW A;  1RLY A;  3GTJ I;  1SFO I;  2E2H I;  2NVT I;  1TWF I;  1TWA I;  3GCF A;  3VB9 A;  2B63 I;  2DE6 A;  3U50 C;  3D6W A;  1Y1W I;  4BBS I;  3GKQ A;  3S14 I;  3HOU I;  4NBA A;  3S2D I;  3K7A I;  3M4O I;  4A3C I;  2LW4 A;  2DE5 A;  3HOZ I;  4A3I I;  1QYP A;  1YUA A;  3Q87 A;  2K5R A;  3GTP I;  4BY1 I;  4NBD A;  2HF1 A;  4BY7 I;  2JNY A;  3S1N I;  2NVQ I;  3S1M I;  2F4M A;  3RZO I;  2VUM I;  4A3L I;  3HOY I;  1LQL A;  1I3Q I;  1TWH I;  1ZB8 A;  2J6A A;  5IP7 I;  1DL6 A;  1TWC I;  3M3Y I;  2JA8 I;  3VMH A;  1ENW A;  2KPI A;  4BY1 X;  4NBC A;  3VMG A;  2R7Z I;  2E2J I;  3S1Q I;  4BY7 X;  1NUI A;  1Y1V I;  2E2I I;  3S16 I;  3GTG I;  2NVX I;  2JA7 I;  5FLM I;  3I4N I;  3FKI I;  4A3G I;  4NB8 A;  3PO3 I;  5C4J I;  3HOW I;  4A3E I; 
#chains in the Genus database with same CATH topology
 1H1Q B;  2JIQ A;  4KRD B;  2V8I A;  1ZH1 A;  4A3M I;  4A3B I;  3J81 b;  1K83 I;  3DTO A;  3HOX I;  4NBE A;  1I50 I;  3CME 1;  2VPX A;  4NB9 A;  1YIJ Z;  2LIY A;  2HU9 A;  4MH4 A;  2UUE B;  2YU9 I;  3CCE Z;  3CC7 1;  4EOQ B;  1VQL 1;  3MI9 B;  3NH5 A;  2DE7 A;  2G2K A;  2JMO A;  1K8A 2;  1SIW A;  3CD6 1;  1YI2 Z;  4MON A;  1W2B Y;  4JX6 A;  1H4L D;  1PKD B;  4JX4 A;  3VKG A;  4CRL B;  3CC4 Z;  5HBJ B;  1Q82 1;  2KI7 B;  5C4X I;  4F7N B;  1VQP 1;  1G3N C;  4BCN B;  4E31 A;  4RVG A;  4NOZ A;  3J81 f;  4OB3 B;  1RQF A;  2CYZ B;  2WXV B;  4Y7N I;  3CCR 1;  2WB1 A;  5IT9 b;  3HOV I;  2PJQ A;  3CCV Z;  4FX3 B;  4BCK B;  3I07 A;  1KXU A;  1JJ2 Y;  3CMA 1;  4X6A I;  4QSH A;  3T4N B;  4CL1 A;  3EID B;  4A93 I;  2CZ7 B;  3O0G D;  3TW7 A;  4ZGD B;  3NDQ A;  2GTH A;  5FLX f;  1VQ4 Z;  2VPY A;  5L2W B;  3X25 B;  2W99 A;  2WMA B;  3OW2 Z;  4HNU A;  1JWH C;  2V22 B;  1L1O C;  1ML8 A;  4RS4 A;  4II5 B;  3CCQ 1;  3NH4 A;  5ICP B;  1UGR B;  2OTL 1;  1VQ7 Z;  4RV9 A;  4F7L B;  1Y8C A;  3GTJ I;  3NDJ A;  2V45 A;  3HKZ A;  3VB9 A;  4S1T A;  2B63 I;  1Q82 2;  1Y1W I;  1QXF A;  2OTJ 1;  2WIP B;  4NH1 C;  3S14 I;  2EGT A;  4CFM B;  1YJW Z;  2QQ8 A;  2CJM B;  4KRC B;  2IW9 B;  4BCQ B;  3HOZ I;  4A3I I;  4EC8 B;  5A2Q b;  1Q81 1;  2DD4 B;  3Q87 A;  2G9X B;  1OL2 B;  3HB9 A;  3BLH B;  2QA4 1;  1TD6 A;  3QYH B;  1JKW A;  3M03 A;  1E7P A;  3S1N I;  1VQ8 1;  2F4M A;  3QZ9 B;  3KHI A;  2JIO A;  1K9M 1;  2VUM I;  1I3Q I;  1TWH I;  1YHQ Z;  1VQN Z;  1TWC I;  1VQM Z;  1GH6 B;  2DXC B;  4BCJ B;  1K73 1;  4E33 A;  2F2C A;  1FKM A;  2KPI A;  5T6B A;  3TE5 B;  1VQ9 Z;  1YJ9 Z;  2R7Z I;  1OGU B;  3S1Q I;  1URC B;  1S72 1;  4NC6 A;  5FLM I;  2R7G A;  2ZPB B;  3FKI I;  3A8H B;  4YOS A;  2ZAE B;  4OB1 B;  3CPW Y;  1QVF Z;  4F6W B;  4YC3 B;  3EOC B;  5A2Q f;  3CC2 1;  3HOW I;  3A8L B;  3I4M I;  4RVD A;  1YJN Z;  4HH4 A;  1UGQ B;  5T67 A;  2UZL B;  2WIH B;  1C9B A;  4EWC A;  2P3Y A;  1KD1 1;  1P9N A;  4EOO B;  4QTT A;  1M1K 1;  4CFU D;  3BHT B;  3GTM S;  4BCG B;  1Q7Y 2;  3GTO I;  3BG0 B;  1H1S B;  2ZPI B;  1M90 1;  1V29 B;  3HBL A;  2RT9 A;  3CCL Z;  5C3E I;  1UGS B;  4HGZ A;  4EOL B;  1W98 B;  3G6E Z;  3MIA B;  1WII A;  4TNU A;  4XX2 A;  3I56 Z;  3HZJ A;  2QR1 B;  2QEX 1;  1X3Z A;  4QTU A;  1NJI 1;  2QDY B;  2R93 I;  4Y72 B;  4E2W A;  1VYW B;  1Q16 A;  1VLA A;  2DME A;  4NBH A;  5T64 A;  1N8R 2;  4EOS B;  3S2H I;  3K7A M;  2QFZ A;  3MZK B;  2Q4Z A;  4MFD A;  3QYG B;  4MD8 A;  2JIR A;  2RBL A;  4RVH A;  1ZB9 A;  4A3F I;  3VMI A;  1Z03 A;  3D9X A;  2I53 A;  3I55 1;  3MY1 B;  2M6N A;  1TWG I;  2QLV B;  3BG3 A;  1VQK 1;  2V8K A;  2QDJ A;  1VQ5 1;  4DQY B;  1VQ6 Z;  5FLX b;  3CCU Z;  3B57 A;  2V3V A;  5AN9 F;  4DK1 A;  4I3Z B;  4ELL A;  2O53 A;  3QXE B;  4ZGE B;  3NFZ A;  1VQP Z;  1OI9 B;  1QVG Z;  4HNV A;  3S1R I;  2BS2 A;  2QF7 A;  2ZPF B;  3PO3 S;  2NVY I;  4ROC A;  3TDH B;  1GUX A;  3GTM I;  4AI6 A;  1M90 2;  4LOC A;  2QKD A;  1S7M A;  2IV2 X;  2NVT I;  4BCP B;  4CFV B;  1YIT Z;  1TWA I;  3GCF A;  2CCH B;  2ZPG B;  4E2Z A;  1JOW A;  2X1N B;  3RGF B;  3U50 C;  2Q51 A;  3D6W A;  1H1R B;  3CCE 1;  4HL4 A;  5EFQ B;  1GUX B;  2C4G B;  3K7A I;  3M4O I;  4A3C I;  3QWL A;  5HQ0 B;  1YI2 1;  2W9Z A;  1KC8 1;  3GTP I;  2M48 A;  1KQS Y;  4EOI B;  2HF1 A;  4JX5 A;  3WVE B;  2JNY A;  2LFU A;  2P28 A;  3J80 b;  5LQF B;  5HVY B;  2NVQ I;  2VPZ A;  1D3U B;  2IZ3 A;  1P5E B;  4BBR M;  3FQQ A;  1LQL A;  5IP7 I;  1ZB8 A;  1DL6 A;  2AHJ B;  3VYH B;  2JUB A;  3CCM Z;  3M3Y I;  2JA8 I;  5I5Z B;  2OTJ Z;  4NBC A;  4CFW B;  2NAP A;  3CXC Z;  2BKZ B;  1H27 B;  3CCV 1;  2JA7 I;  4MFE A;  1QLB A;  5IDN B;  2O4H A;  3KIH A;  4MD7 A;  2RHB A;  4A3G I;  3LQ5 B;  3G71 1;  3PO3 I;  1VQ4 1;  2C5N B;  1UGP B;  1FDI A;  3DOG B;  2ZCF B;  4A3E I;  3IX0 A;  3J80 f;  1RNI A;  4CXA B;  5LL6 f;  3CCS 1;  1QMZ B;  3TW6 A;  1VQ7 1;  4NBF A;  3GTK I;  4OB2 B;  2C5O B;  1RO4 A;  1S72 Z;  3QYB A;  1BU2 A;  4E30 A;  3QYE A;  1KC8 2;  1H24 B;  2ZZD B;  1AA6 A;  3H3V J;  1OKW B;  3GTQ I;  2CZ1 B;  5IDP B;  2WJ9 A;  4BBR I;  4HGY A;  3X24 B;  3CC2 Z;  3F3P C;  2W2H A;  5CEI B;  2DXB B;  3G4S 1;  2PK7 A;  3JAM b;  3POM A;  2RPR A;  2CZ6 B;  4BBS M;  4E2X A;  4NBG A;  3H0G I;  4DGL A;  1N4M A;  4NFR A;  2C6T B;  1VOL A;  1VQO Z;  3BLQ B;  1H1P B;  3OW2 Y;  2B9R A;  3TN8 B;  3X26 B;  3DDQ B;  1YHQ 1;  1W2B Z;  1VQN 1;  3PO2 I;  4F6U B;  1N2F A;  2PMZ A;  1KRL A;  4FM4 B;  2WPA B;  1R9T I;  3DJB A;  2JA5 I;  3RZD I;  1Q81 2;  4E2Y A;  3A8M B;  2UZE B;  1VQ9 1;  1E9H B;  2W9F A;  2QEX Z;  1H28 B;  3H4C A;  1Y1V S;  5HBH B;  2W04 A;  5DQW A;  1K9M 2;  3J7A 4;  2E7Z A;  3LUS A;  3JAM f;  2IN3 A;  1K8A 1;  5DQV A;  4MD9 A;  1K73 2;  3CME Z;  4F70 B;  4YOZ A;  1RO0 A;  4A3K I;  3BHV B;  3QZ5 B;  1JJ2 Z;  4CFX B;  3GTL I;  2JS4 A;  1WJ2 A;  1RLY A;  2R6M A;  2Y0S A;  4RVF A;  4OR5 B;  4BCM D;  2PK9 B;  4AKG A;  3CC7 Z;  4AYB A;  2IW6 B;  1VQK Z;  2PHG A;  1VQL Z;  1VQ5 Z;  2CCI B;  4Z6Y A;  1O9K B;  4BBS I;  4CFN B;  3GKQ A;  2OOY B;  3CD6 Z;  4NBA A;  1GY3 B;  3BG1 B;  4TTH A;  2DPP B;  1UNL D;  3X20 B;  2KMG A;  1QYP A;  2G77 A;  4HLQ A;  1YUA A;  3I56 1;  1KD1 2;  1OKV B;  4BY1 I;  3CCJ 1;  5CYI B;  4BY7 I;  1IRE B;  2DD5 B;  3KIF A;  1M1K 2;  2WEV B;  3S1M I;  1FDO A;  3RZO I;  3HOY I;  3CCR Z;  1QVF Y;  2BPM B;  1QF8 A;  3F5X B;  3A8O B;  5IF1 B;  3D2L A;  4OB0 B;  2KR6 A;  2IW8 B;  2AYD A;  3F3F C;  2LEX A;  1YIJ 1;  3VMH A;  1ENW A;  2W03 A;  5BNJ B;  4BY1 X;  3VMG A;  2EUF A;  4E32 A;  3CMA Z;  2E2J I;  4BY7 X;  2PMI B;  1NUI A;  1Y1V I;  1NJI 2;  3S16 I;  3BLR B;  3GTG I;  2NVX I;  4YOO A;  2WAQ A;  5D1O A;  2JGZ B;  1VQ6 1;  4NB8 A;  3TNW B;  3CCU 1;  4UN0 A;  2PM9 A;  5C4J I;  3TNI B;  4M6V A;  4G6L B;  5C44 I;  3CC4 1;  3S17 I;  3MY5 B;  1WCM I;  2VF1 A;  3CCQ Z;  2F4O A;  4NBB A;  5IP9 I;  2OTL Z;  2CZ0 B;  4BCF B;  3QHW B;  2R92 I;  2VUG A;  1X0T A;  2UZD B;  3BG9 A;  1OIU B;  2C5X B;  3EER A;  5D1O B;  1AHJ B;  2VPW A;  2H85 A;  4MRI A;  1YIT 1;  4A3J I;  3CPW Z;  4F7J B;  2BJO A;  1FIN B;  1TFI A;  4AKI A;  1NP6 A;  2AKL A;  1I6H I;  3G71 Z;  5EJC A;  3VYG B;  2RIQ A;  1USP A;  1PFT A;  2QRD B;  2D0Q B;  4ROE A;  4AKH A;  2BS3 A;  2WHB B;  5CM2 M;  4OGR B;  1VIN A;  1Z01 A;  1WW9 A;  2QA4 Z;  2JA6 I;  2OZK A;  2JIM A;  5D1P A;  1VQ8 Z;  4CFU B;  4HNT A;  3CCS Z;  2JR6 A;  2IVX A;  4BXX I;  4EOM B;  3VTN A;  4BCO B;  4Y52 I;  5FGK B;  4MXU A;  1USP B;  1Q86 1;  3IR7 A;  3QWU A;  1QVG Y;  1AIS B;  5IT9 f;  1TFB A;  3IF8 A;  3CCM 1;  3EJ1 B;  4BCN D;  3EED A;  4EOJ B;  4BXX X;  1OIY B;  1YUK A;  3G4S Z;  2I3C A;  2ZPE B;  3QHR B;  1Q7Y 1;  1YJW 1;  3DL1 A;  4EOK B;  4F7S B;  4BCM B;  3CQZ I;  2PK2 A;  4A3D I;  3S15 I;  4EOP B;  2UZB B;  1X3W A;  3VKH A;  3FQM A;  2QGS A;  3HO8 A;  4EOR B;  3ESW A;  1UNG D;  1SFO I;  1AD6 A;  2E9H A;  3P5J B;  2E2H I;  1TWF I;  2V8J A;  5LMK B;  1JST B;  1N8R 1;  2DE6 A;  1VQM 1;  5ACB A;  3BG5 A;  3BHU B;  1JSU B;  3HOU I;  1YJ9 1;  2I40 B;  3S2D I;  1RO2 A;  1FVV B;  5IHY A;  2LW4 A;  3G33 B;  2DE5 A;  2YAD A;  4EC9 B;  2K5R A;  3CXC Y;  1Q86 2;  4NBD A;  4F6S B;  1H25 B;  2BS4 A;  3MZL B;  4BCH B;  1O9K A;  1F5Q B;  1XO2 A;  2WFY B;  2C5V B;  3HHT B;  4MIM A;  5HNB B;  5HBE B;  2JIP A;  4BCI B;  4ELJ A;  4BCQ D;  4A3L I;  3TNH B;  3A8G B;  1YJN 1;  3X28 B;  2J6A A;  3WVD B;  1VQO 1;  1WZN A;  1UNH D;  2IZ4 A;  3I55 Z;  2QRE B;  3MON A;  2ZPH B;  3NDI A;  1Z02 A;  1KQS Z;  2WMB B;  2K3R A;  2E2I I;  2GU2 A;  3DDP B;  3IFU A;  3CCL 1;  3I4N I;  4IMY B;  2QRC B;  4NST B;  1OL1 B;  4EON B;  3NH8 A;  3G6E 1;  1ZP2 A;  2GTI A;  3CCJ Z;  2W96 A;  2OOX B;  1H26 B;  4ZGJ B;  4ROD A; 
#chains in the Genus database with same CATH homology
 2V8I A;  1ZH1 A;  4A3M I;  4A3B I;  3J81 b;  1K83 I;  3HOX I;  4NBE A;  1I50 I;  3CME 1;  4NB9 A;  1YIJ Z;  2LIY A;  2HU9 A;  4MH4 A;  2YU9 I;  3CCE Z;  3CC7 1;  1VQL 1;  3NH5 A;  2DE7 A;  2G2K A;  2JMO A;  1K8A 2;  3CD6 1;  1YI2 Z;  4MON A;  1W2B Y;  3CC4 Z;  1Q82 1;  2KI7 B;  5C4X I;  1VQP 1;  4E31 A;  4RVG A;  4NOZ A;  3J81 f;  1RQF A;  4Y7N I;  3CCR 1;  2WB1 A;  5IT9 b;  3HOV I;  3CCV Z;  4X6A I;  3I07 A;  1JJ2 Y;  3CMA 1;  3T4N B;  4CL1 A;  4A93 I;  3NDQ A;  2GTH A;  5FLX f;  1VQ4 Z;  3OW2 Z;  1JWH C;  1ML8 A;  1L1O C;  4RS4 A;  3CCQ 1;  3NH4 A;  2OTL 1;  1VQ7 Z;  4RV9 A;  3GTJ I;  3NDJ A;  3HKZ A;  3VB9 A;  4S1T A;  2B63 I;  1Q82 2;  1Y1W I;  2OTJ 1;  4NH1 C;  3S14 I;  2EGT A;  1YJW Z;  3HOZ I;  4A3I I;  5A2Q b;  1Q81 1;  3Q87 A;  2QA4 1;  3S1N I;  1VQ8 1;  2F4M A;  1K9M 1;  2VUM I;  1I3Q I;  1TWH I;  1YHQ Z;  1VQN Z;  1TWC I;  1VQM Z;  1K73 1;  4E33 A;  2KPI A;  5T6B A;  3TE5 B;  1VQ9 Z;  1YJ9 Z;  2R7Z I;  3S1Q I;  1S72 1;  5FLM I;  3FKI I;  2ZAE B;  3CPW Y;  1QVF Z;  5A2Q f;  3CC2 1;  3HOW I;  3I4M I;  4RVD A;  1YJN Z;  4HH4 A;  5T67 A;  4EWC A;  2P3Y A;  1KD1 1;  1P9N A;  4QTT A;  1M1K 1;  3GTM S;  1Q7Y 2;  3GTO I;  3BG0 B;  1M90 1;  2RT9 A;  3CCL Z;  5C3E I;  4HGZ A;  3G6E Z;  1WII A;  4TNU A;  4XX2 A;  3I56 Z;  2QR1 B;  2QEX 1;  1X3Z A;  4QTU A;  1NJI 1;  2R93 I;  4E2W A;  1VLA A;  2DME A;  4NBH A;  5T64 A;  1N8R 2;  3S2H I;  3MZK B;  2Q4Z A;  4MD8 A;  2RBL A;  4RVH A;  1ZB9 A;  4A3F I;  3VMI A;  1Z03 A;  3D9X A;  3I55 1;  2M6N A;  1TWG I;  2QLV B;  1VQK 1;  2V8K A;  1VQ5 1;  4DQY B;  1VQ6 Z;  5FLX b;  3CCU Z;  5AN9 F;  4DK1 A;  2O53 A;  3NFZ A;  1VQP Z;  1QVG Z;  3S1R I;  3PO3 S;  2NVY I;  3TDH B;  3GTM I;  1M90 2;  2QKD A;  1S7M A;  2NVT I;  1YIT Z;  1TWA I;  3GCF A;  4E2Z A;  3U50 C;  2Q51 A;  3D6W A;  3CCE 1;  3K7A I;  3M4O I;  4A3C I;  1YI2 1;  1KC8 1;  3GTP I;  2M48 A;  1KQS Y;  2HF1 A;  2P28 A;  2JNY A;  2LFU A;  3J80 b;  2NVQ I;  2IZ3 A;  3FQQ A;  1LQL A;  5IP7 I;  1ZB8 A;  1DL6 A;  2JUB A;  3CCM Z;  3M3Y I;  2JA8 I;  2OTJ Z;  4NBC A;  3CXC Z;  3CCV 1;  2JA7 I;  3KIH A;  2O4H A;  4MD7 A;  2RHB A;  4A3G I;  3G71 1;  3PO3 I;  1VQ4 1;  4A3E I;  3IX0 A;  3J80 f;  1RNI A;  5LL6 f;  3CCS 1;  1VQ7 1;  4NBF A;  3GTK I;  1RO4 A;  1S72 Z;  4E30 A;  1KC8 2;  3H3V J;  3GTQ I;  4BBR I;  4HGY A;  3CC2 Z;  3F3P C;  3G4S 1;  2PK7 A;  3JAM b;  2RPR A;  4E2X A;  4NBG A;  3H0G I;  4DGL A;  4NFR A;  1VQO Z;  3OW2 Y;  1YHQ 1;  1W2B Z;  1VQN 1;  3PO2 I;  2PMZ A;  1N2F A;  1KRL A;  1R9T I;  2JA5 I;  3RZD I;  1Q81 2;  4E2Y A;  1VQ9 1;  2QEX Z;  1Y1V S;  2W04 A;  1K9M 2;  3J7A 4;  3LUS A;  3JAM f;  1K8A 1;  4MD9 A;  1K73 2;  3CME Z;  1RO0 A;  4A3K I;  1JJ2 Z;  3GTL I;  2JS4 A;  1RLY A;  2R6M A;  2Y0S A;  4RVF A;  3CC7 Z;  4AYB A;  1VQK Z;  1VQL Z;  1VQ5 Z;  4BBS I;  3GKQ A;  2OOY B;  3CD6 Z;  4NBA A;  3BG1 B;  1QYP A;  1YUA A;  3I56 1;  1KD1 2;  4BY1 I;  3CCJ 1;  4BY7 I;  3KIF A;  1M1K 2;  3S1M I;  3RZO I;  3HOY I;  3CCR Z;  1QVF Y;  1QF8 A;  3F3F C;  1YIJ 1;  3CMA Z;  3VMH A;  1ENW A;  2W03 A;  4BY1 X;  3VMG A;  4E32 A;  2E2J I;  4BY7 X;  1NUI A;  1Y1V I;  1NJI 2;  3S16 I;  3GTG I;  2NVX I;  2WAQ A;  5D1O A;  1VQ6 1;  4NB8 A;  3CCU 1;  2PM9 A;  5C4J I;  5C44 I;  3CC4 1;  3S17 I;  2VF1 A;  1WCM I;  3CCQ Z;  2F4O A;  4NBB A;  5IP9 I;  2OTL Z;  2R92 I;  2VUG A;  1X0T A;  3EER A;  5D1O B;  2H85 A;  4MRI A;  1YIT 1;  4A3J I;  3CPW Z;  2BJO A;  1TFI A;  1NP6 A;  2AKL A;  1I6H I;  3G71 Z;  2RIQ A;  1USP A;  1PFT A;  2QRD B;  5CM2 M;  2JA6 I;  1Z01 A;  2QA4 Z;  1WW9 A;  2OZK A;  5D1P A;  1VQ8 Z;  3CCS Z;  2JR6 A;  4BXX I;  3VTN A;  4Y52 I;  4MXU A;  1USP B;  1Q86 1;  3QWU A;  1QVG Y;  5IT9 f;  3IF8 A;  3CCM 1;  3EED A;  4BXX X;  1YUK A;  3G4S Z;  2I3C A;  1Q7Y 1;  1YJW 1;  3CQZ I;  4A3D I;  3S15 I;  1X3W A;  3FQM A;  3ESW A;  1SFO I;  2E9H A;  3P5J B;  2E2H I;  1TWF I;  2V8J A;  1N8R 1;  2DE6 A;  1VQM 1;  3HOU I;  1YJ9 1;  3S2D I;  1RO2 A;  2LW4 A;  2DE5 A;  2YAD A;  2K5R A;  3CXC Y;  1Q86 2;  4NBD A;  3MZL B;  4A3L I;  1YJN 1;  2J6A A;  1VQO 1;  2IZ4 A;  3I55 Z;  2QRE B;  3MON A;  3NDI A;  1Z02 A;  1KQS Z;  2K3R A;  2E2I I;  2GU2 A;  3IFU A;  3CCL 1;  3I4N I;  2QRC B;  3CCJ Z;  3G6E 1;  3NH8 A;  2GTI A;  2OOX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...