3A8OB

Crystal structure of nitrile hydratase complexed with trimethylacetamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8oB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8oB02
2CYZB 1UGSB 2PVDB 3QYGB 1PSFA 2DXBB 2DD5B 1GXIE 4FM4B 3VYGB 4ZGDB 2ZZDA 1IREB 5L8RE 2CZ0B 4RKUE 2DD4B 4OB0B 2PVGB 3QXEB 3WVEB 2ZPBB 3A8MB 3WVDB 1QP2A 2DXBA 2DXCB 3QZ9B 2CZ6B 2CZ1B 4OB3B 4XK8E 1UGPB 4L6V5 4OB1B 1V29B 3A8GB 3QZ5B 4ZGJB 4KT0E 3X26B 3QYHB 4ZGEB 1UGRB 2PUOB 2ZPEB 2ZPGB 3X24B 2WSFE 2DD5A 2ZPIB 2PUKB 3VYGA 3LW5E 2D0QB 2ZCFB 3A8LB 2WSEE 3A8HB 2DPPB 2DD4A 2PVOB 3VYHB 2DXCA 2ZPFB 3X28B 1AHJB 3X20B 3X25B 1UGQB 2PU9B 1JB0E 4OB2B 2ZPHB 2ZZDB 1QP3A 3HHTB 2CZ7B 2AHJB 4Y28E 1PSEA 2QDYB 2O01E 1DJ7B 3A8OB 2WSCE
chains in the Genus database with same CATH superfamily
3ZFJA 1PSFA 5LJ5j 3NHNA 4HT8A 3T9NA 2QGFB 3BW1A 5ECAA 2E70A 4UN0A 1ARKA 3DOGB 3VKGA 2CKKA 1R0CB 1AVZC 1UEBA 3V8LA 2BKZB 3J7AF 5IAYA 4EOSB 1TTHB 3M57A 1SRMA 3HFNA 1ZQ1A 3M4GA 2DXCB 5AYFA 4Z88A 4YOZA 4M7AE 3MY5B 3RGFB 1UGPB 1XQHA 4C0DC 4BCJB 3HBLA 1BIAA 4G6LB 3CXCS 3CCRT 1N8RU 2ED0A 1U1TA 2LTOA 4Y92A 3LQ5B 1WNLA 3BG5A 2LT4A 1E7OA 5CVIA 2DO3A 2ZPGB 1VQ7Q 2WFYB 4M7DE 3CCJQ 3O5ZA 2ZPIB 3TCJA 1K0XA 2KXCA 2UUEB 5CAIA 5CO7A 1YJNA 4EMGA 3EJ1B 2PMIB 3CC7T 2J7IA 3JCMJ 2F2XA 1WJSA 2KNBB 2YUOA 1HXDA 4M77F 2OTLQ 3EH1A 1QLYA 4M77D 2E3IA 3EFOB 2ATCB 4R56A 3TVTA 4BCPB 2R58A 2VGMA 3E19A 4PJOF 1KG1A 1K1ZA 2DIGA 4V2SA 2PZ1A 1AHJB 4PJOD 3G4SA 3CCQQ 1UGQB 1PD0A 1RLQC 4PFZA 1WLPB 1KSWA 4TTHA 2XU8A 5CQYA 1YI2A 2HQXA 2MCNA 3META 1QVGS 4ZTFA 4PLIA 4RG8A 4XAXB 2KRSA 2CZ7B 2P0KA 4WTOB 5GAMf 4OMFB 2X3WD 2GNCA 2DL4A 1AD5A 1B07A 2JS2A 2CP6A 3MEUA 3OS2A 1YJ9Q 2EYXA 3RDVA 4C5EA 4E47A 4J9IA 2DVJA 3FC3A 1VQNQ 2D1XA 2E6ZA 3CC4T 1NJIC 3QYEA 4C0ZA 4BY1X 2YLCA 4F6SB 3MJXA 1VA7A 2ZZDA 5EJCA 3UA6A 3LYIA 2DETA 1Y0MA 3QIIA 1S72Q 1YWPA 4RTTA 1QVGA 4JS4A 2FZCB 2CGHA 2MF2A 5GANh 2R5AA 3CCUA 2YDLA 2C0OA 1AZEA 3PVQA 4NS5A 2IPOB 2RM4A 4ATOA 5IXFA 1RABB 1MMGA 4AMCA 1NPPA 2JW4A 1MUZA 1RLPC 4ORZA 2FZKB 1GFDA 4BCQB 2K5FA 1BCMA 4L6V5 2J6FA 4OMOA 2F69A 2J06A 4OGRB 2VC8A 4ZGJB 3JB9I 4F70B 1UDLA 1Q7YU 3NDQA 4QSHA 4JJCA 1IGUA 3M56A 2D0NA 2P4RA 4LXCA 2EPDA 1Z9QA 4ELZC 4HA8A 1D1BA 4UC4A 3OYNA 5DY9A 3OYYA 2RB6A 5GANj 4KH0B 3VYGA 1JOWA 2M51A 2QA4T 5EG2A 1LPLA 1TXQA 4BI8B 5LJ3d 3A8HB 2BTTA 1LVKA 2EKHA 1H1RB 3GLXA 3MEVA 2DL7A 1H1QB 4C92E 4C8QC 2BS3A 4HNVA 1Q86U 2UZEB 2WHBB 3RMQA 1RI9A 1YCSB 3C0CA 4C0DB 2COYA 1N8RC 2CT3A 1ZA2B 2FB7A 1HK9A 1YJWT 4JJNK 4FW1A 2RI3A 2I53A 4CFNB 3QG1A 2LMJA 2ZZDB 1OPLA 3QHSA 4E7HA 3CPWP 3TSZA 2O4XA 1BI2A 1ZUKA 1KC8R 4LDXA 3RIRA 4JRKA 4K11A 2KMGA 2LJ1A 3TNHB 1VINA 2CYZB 3OBYA 5HK3A 3JCMX 1IRXA 1M2OA 4XU3A 2RPNA 5DQVA 1WI7A 1OEBA 1X2QA 3EGDA 2UZDB 2RJEA 2EQUA 2RMOA 3VKHA 3M4YA 5GMKe 1K8AC 4EONB 2QXFA 3KXTA 4M75E 2XDPA 4BD3A 2MK5A 2A7YA 4RCCA 6AT1B 5IH2A 2DX1A 4BCGB 1ZP2A 4PJJA 5KE3A 3A8MB 2FYKA 1FINB 3FRNA 3H4CA 2FHDA 2COZA 3OYAA 2HL5C 3G71T 3I55Q 1UHFA 4C8QA 3BHVB 3CCRQ 2HZYA 4QVCA 1H1SB 1KHIA 1XOVA 5CKDA 1Y96B 3QWXX 3UT1A 2PJQA 3GTMS 4IUUA 5GAN7 1VQ8A 4EMHA 4XTWA 1FKMA 2OTJQ 2D8HA 2DTHA 2ZGWA 3PTAA 1W6XA 2MAMA 2EVRA 3OYKA 2KT1A 1H3ZA 1NEBA 4X34A 2R57A 2M9UA 3L2VA 4FSXA 3CC7Q 2VASA 3SFMA 3NGPA 3NTHA 2EQIA 1NPRA 2K2VA 5LJ3e 2EGEA 3HB9A 1WHGA 3H0FA 4FU6A 2EW3A 3M59A 4AFUC 1WA7A 1JB0E 4OR5B 4ME7A 3OYEA 4LOCA 4AI6A 2LP5A 3OS5A 1BIBA 4ZTJA 4OMQA 4C5IA 4F04B 5LJ3g 1MGQA 1G83A 4OVAA 5HCKA 4EOQB 1TG0A 1K73U 4RMOA 1OU9A 3C4SA 4M4ZA 3RKYA 2E1HA 2HSPA 4M78F 4L5GA 3QYGB 3VS6A 4C8QG 4A4FA 4J5YA 4M78D 2DD5B 2E64A 1GXIE 4JJBA 3PT9A 1TUDA 1AWJA 3ZBDA 2M1HA 4A54A 1URCB 4ZGDB 3QBYA 3E2UA 3CC4Q 2EBPA 3CPWS 1KC8U 4N4IA 2WACA 2OTLA 2L3QA 1JJ2S 2B9RA 1D1CA 1QVPA 1KHCA 1QKXA 5KYUB 2BE7D 3LH5A 3H8ZA 2DBMA 5IHNA 4IIMA 4M77C 1Y57A 2JMAA 4KUIA 3KHIA 2EQKA 1OX9A 1PWTA 1ZUUA 1ZUYA 2X3XD 3KFVA 4WCIA 4F7UA 1GL5A 4MZMA 5GANf 1UGVA 4PJOC 4P5NA 2L8DA 4IURA 3EG2A 2BUDA 1Q81U 1BB9A 2CS7A 4HXJA 4BCMD 4CC2A 4OMLA 4JS5A 2C5NB 3EGXA 3JAME 1JJ2A 4LN2A 3M0UA 1YJ9A 1YJNQ 2QQBA 2C5XB 3SWNB 5KYXA 2GFAA 2FEIA 1VQNA 4CC3A 3M0RA 4JRQA 1QKWA 2YRVA 2CDTA 1AZGB 4Z89A 2J05A 3L2WA 1T0JA 3C94A 2FRWA 5CR2A 3M0TA 2K3BA 4DOVA 3OYLA 3PIPA 1JU5C 3BHUB 2D9TA 2K3YA 3L2RA 1RAHB 4XTVA 4BCNB 1M4ZA 3EG0A 2QA4Q 4J9HA 2DEQA 2EGCA 2RQWA 3BG9A 1D0YA 4E7LA 2CJMB 2QG9B 1XO2A 3U23A 1NJIR 1BU1A 4BCKB 1PG5B 3MCAB 4X9DA 4F7JB 1KFZA 1NM7A 2VYTA 4F7SB 4GY5A 1AWXA 4F17A 2KXDA 1PHTA 4M77A 3OYMA 3MY1B 2X4YA 1PKTA 1D3UB 2DVEA 3M58A 4PJOA 4F7UG 3R6NA 3JCMQ 2DERA 1F5QB 1RAEB 3V7RA 3DJBA 2GF7A 2CP0A 3A8OB 3UA7A 2A08A 4VUBA 1JRIA 1BK2A 4BE1A 5DM7R 2FPFA 4N0AC 2AZVA 3TU4K 3CEYA 4PLLA 4AFQC 3S3MA 1MV3A 5GAMh 4GLKA 5GAOn 3CCMT 3OS0A 2PK9B 1UHCA 3CMAA 2QDLA 4J8OA 1E6HA 3EG9A 5KYXB 4M7AF 2ZPBB 1VQKT 2FPEA 4J9EA 1U1SA 1LOJA 4M7AD 4AFSC 2LC4A 4AT1B 4OB3B 4XK8E 3F5XB 2LCSA 1K73C 3G71Q 5D6WA 3HRTA 3LGLA 5D7UA 3JCMh 2QK0A 1WHMA 2KROA 4AG2C 3FB9A 4FIBA 1N8RR 4M7DF 1VYUA 4LNPA 5GAMj 1KC8C 4M7DD 2K9GA 4M77G 4KGZB 1VQLT 2K7AA 4XTZA 1X6OA 3CPFA 4PJOG 5J3BA 2RJDA 4M77B 3REAB 3GOXA 1BBZA 2FZGB 3KUFA 2WIPB 4N0AA 4QQ6A 2HEQA 1PC0A 2QTXA 1K9MU 3S6WA 2CP5A 4JJDA 2P0QA 2Y4XA 4YC3B 2IIMA 2M0OA 1Q81C 2DXCA 4CFWB 1VQ5T 4CFVB 5ACBA 3TEEA 4BE2A 1G5VA 3F70A 3M5AA 3CCRA 3P8HA 5FLXE 3P8BB 1B34B 3PNWC 5D6XA 1BI3A 3HL8A 3TQ7P 1QVGP 2WXVB 2QGGA 2AK5A 5KYWB 4BCND 1ABOA 2DILA 3CD6T 4B9XA 2OTJA 1U8RA 1OYXA 3UF4A 1BCOA 1AEYA 3CC7A 2BE9B 3CCVQ 4LDWA 5FRMA 2CZ0B 2AT1B 4ZN1A 3EHRA 4N4GA 2EFIA 4HKEA 4EDUA 1VQ9T 5KCHA 1S1NA 3MPUB 3QXEB 2ED1A 3EFOA 3QDFA 4BACA 3NTKA 1H25B 5GMKm 1H1PB 3DL1A 1M1KU 3OMCA 1KQ2A 4PJMA 2CCIB 4YOSA 1UUEA 2GTJA 2W9FA 1OULA 2IN3A 4DEXA 3INZA 2EJFA 4CC7A 1VQ8Q 3OBWA 1UECA 1JEGA 1KD1R 2RHZA 1W1FA 4J83A 3JCMW 1RUWA 3DB3A 4KH1B 2RI5A 3RR6A 1ZHIA 2SRCA 3CC4A 1Q7YR 2CCHB 2IVWA 1QCFA 2X9HA 2G9XB 1B7TA 4XU2A 2LX7A 1C9BA 4RTUA 4BDYA 3VS4A 2K57A 1FMWA 1IGQA 4FYXB 4BCHB 4C92F 3HRSA 5LJ5e 4C92D 3VU3C 4KGXB 2EKOA 4XU0A 5I21A 2YHTA 3OYHA 2YRCA 2XKOC 2KE9A 1O9SA 2V1QA 1P5EB 4HCKA 1OPKA 4NL2A 1TOVA 3HRUA 2HL3A 1Q86R 1KJWA 3CCET 3C95A 4DBQA 2D8JA 3PIOA 2ZPHB 2V1RA 3GNGA 2JS0A 3QJYA 3HHTB 1GCQC 1WQ7A 5FU6C 4Y28E 3EGUA 3EH2A 2YT6A 2JM9A 4MDXA 2I2LA 2DYIA 3JV3A 2YUPA 4C8QE 1HYOA 1OGUB 4PJLA 3H0IA 3FDRA 2MOXA 2KI7A 5C0MA 1N27A 3HSBA 1M2VA 2QA4A 4E7IA 1K9MC 3R6OA 4M75F 4MFDA 2MWOA 2C06A 2GQVA 4M75D 1IREB 5L8RE 2C0IA 2XIDA 4BI4A 2J6OA 3LX7A 7AT1B 1D0XA 3NMZC 3URGA 1QMZB 3CCMQ 2K2MA 2HNIA 2M16A 1MMAA 1ZSZC 1WJQA 4BI3A 4C0FA 1GCPA 3CC2T 1WHKA 2LVMA 4HVVA 2F2VA 1VQMT 1RAFB 2JZ2A 5IF1B 5KE2A 1JQQA 2EIFA 4BDZA 1ZSGA 3UPUA 2AKKA 3MP6A 4EPCA 3X26B 5HQ0B 1X6GA 2H3EB 1VUBA 1YBYA 2M0YA 1RACB 2XK0A 3JCMf 2RQTA 1OKVB 5GAN4 1GCQA 4PNOA 1WHLA 1WXTA 3OA6A 1VQLQ 2CSIA 1KD1U 4BCOB 2WSEE 1UNHD 4EOJB 1JXOA 5CKHA 3I9QA 1WDXA 1M1KC 1UJYA 3ASKA 1AWWA 3OW2S 3BLRB 3VYHB 2RF0A 2K4YA 4QKUA 4M7AC 2XDDA 2O9VA 3G71A 2LQKA 3PVLA 1M2VB 1VQ5Q 1ZBXA 2H3JA 5GMKh 3OYCA 1C6VX 1QP3A 1ZSZA 2GCXA 4F7UE 4EOIB 2MPXC 3REBB 4M78B 2PK2A 1WIEA 2RN8A 1M1FA 5A0LA 4PL6A 5EC7A 3I56Q 1Y96A 1WJRA 2KK4A 1NBEB 1M90U 1PD1A 3DTOA 1XTDA 1Z9ZA 3OW2A 1ZBJA 5KYNA 3CMAQ 1K73R 1XNIA 1YHQT 3CD6Q 2LQNA 4OMMA 5CKEA 2V8KA 4HT9A 4Z6YA 1ZX6A 1VYVA 1M8MA 3RESA 3OS1A 3MEWA 4CFXB 5LL6S 2Y90A 2UZLB 5GANe 3Q1JA 3CMET 5IT9E 2QQ9A 4BE0A 1JJ2P 2HDAA 2KAFA 1W70A 1VQ9Q 2E65A 2DBKA 1QP2A 1WQWA 4BCMB 4JZ4A 2RH2A 4IUQA 4A53A 4JDSA 3SWNC 5FU6B 1U06A 4BUGA 2K79A 4KRTA 4BCFB 3FEOA 3JCMc 2BZYA 1WPYA 3O8VA 1VYTA 4M7AA 2B8AA 1Q81R 4F7NB 3J81E 1U5SA 1OL2B 4M77E 3BLHB 4HLQA 2DRKA 3A98A 2YLBA 5DLQE 5LJ3h 2DD5A 2MYSA 1Q95G 4PJOE 1TS9A 4ROCA 3CCVA 5IHIA 1VOMA 2R5MA 2XD0A 3G1JA 5KYUA 3L1AA 1ZSZB 2HMAA 4AG1C 3QDRB 2BPMB 2XG8D 2VUBA 1HJDA 4AKIA 3OB9A 3L2QA 2JTEA 2DMEA 1HSQA 2A0FB 1FMVA 3G7ZA 2LNHB 3JRZA 4DBHA 2DFUA 1VOLA 2ESWA 4IMYB 5FWBA 3ZEHA 3EOCB 1O9KB 2QAZA 2JUFA 3CCEQ 1CKBA 3EG1A 5CCAA 3CCST 2LRQA 3SWNA 3RNJA 2W10A 4JLGA 1DJ7B 1PNJA 3BLQB 4XTYA 1YP5A 4C5HA 1KD1C 4F16A 4J9GA 2LZ6B 3MP1A 1AISB 2L0AA 1IHWA 4M7AG 2RD1A 3UATA 1Q7YC 3EAEA 4MMKA 4D8KA 2DJQA 4M7AB 4LDUA 1GBQA 5DQWA 1N6AA 4OF1A 4EORB 2DZ9A 3SD4A 1VQ6T 3G33B 1KXUA 1X27A 1WFWA 4JRIA 2YUNA 2F5TX 4YTLA 2JGZB 2X4XA 3DLMA 1T3SA 1OI1A 3CC2Q 3PMTA 1FYNA 2W99A 1VQMQ 1Q86C 1ZA1B 5J26A 1M90C 1BYMA 4M7DB 1Q82U 4KT0E 2LW4A 2YXYA 2RK2A 2QQ8A 3CBOA 1YCYA 4R0KA 5IHKA 4J6XA 4PFOA 2A3LA 3G6ET 2I40B 1I8FA 1QW1A 3BDUA 2JM8A 5J39A 3TW6A 3BDLA 1SPKA 2DJZA 2JTFA 4M75C 3CCMA 3GPLA 3KBGA 4DOWA 2BZ8A 4LD6A 1WXUA 2JJ9A 1IXDA 3CCLT 2B86A 3H0HA 1K9MR 2EUFA 2K6DA 4JPBW 1U3OA 5KCOA 5A0DA 3OSSC 4EOOB 5GAN5 2X4WA 4EMKB 1YITT 2X35A 4B9WA 5GMKi 2QQRA 4F14A 4JRPA 2BKDN 1TUGB 1YNZA 5EFQB 2NYSA 4E6RA 2YWWA 1AWOA 9ATCB 3TN8B 2LCLA 4NOYA 1KQ1A 5FGKB 2F1LA 2HBPA 1AD6A 1I4K1 2VXEA 1VQLA 1Y71A 2ZAEA 5HVYB 2OI3A 3PE0A 1WYXA 1IZ6A 1YHQQ 1SHGA 4F6UB 5GMKl 5CQXA 4FT2A 1YJWQ 1VQOT 1SEMA 3VS1A 3VS2A 3M0QA 2KT8A 4KRCB 2LNVA 4J9DA 5A0GA 2VXFA 2FPDA 2P4TA 1VQ7T 1GFCA 1IO6A 2P0PA 3CCJT 1M5Q1 3SHWA 4EC9B 1R77A 4PFPA 1D1AA 4M75A 1VQ5A 2KEAA 2DE0X 5DLOA 3EG3A 1FX7A 3V8JA 3QHRB 1YIJT 5I11A 2V22B 2JMCA 5ICPB 3JB9J 3TNIB 5HY6A 2KSSA 5CIUA 5I5ZB 1VIEA 2KYMA 3K7AM 1M1KR 1B34A 1H3HA 2A37A 1JO8A 3QJ6A 4AKGA 3JCMb 3I56A 2E3HA 1H92A 2XI9A 1I81A 2RK1A 5KYWA 4HL4A 4DA4A 3CD6A 2Y4YA 1FMKA 2GFUA 3CCQT 2VGNA 1RADB 2V8IA 4D6WA 5HK0A 4LD9K 2IG0A 1KQSA 2OJ2A 3JB9H 1SKUB 2K5IA 2RQRA 4C92B 3JSCA 2AKLA 4J7FA 2E5KA 2NUTB 5LJ3f 4EOPB 4D8DA 2CH4A 2W2HA 2KRNA 2DPPB 1VQ9A 4AFZC 2W9ZA 2QASA 2R7GA 3VRZA 2X4JA 4PK4A 2KRMA 3D7SB 1KK7A 3GNFB 4MDWA 2XMFA 3H6ZA 1Q82C 5LJ5d 2LDMA 2PU9B 1F1BB 4QQDA 1E7PA 1S72T 3PFSA 1LJOA 3TSWA 1D09B 2NWMA 3DDPB 1KIKA 4C8QF 4FYVB 1PCXA 1PSEA 1PM3A 4II1A 2NUPA 4C8QD 3CCSQ 2WMBB 2DNUA 1UGSB 1G3TA 1VQPT 1Y7XA 2PTKA 2XICA 4QW2A 4M75B 2MI6A 3POMA 2EJGA 4FM4B 1PKDB 4E2FB 5IN1A 1O75A 5IDPB 3EFRA 5IXBA 2RNAA 5GAMe 4MZPA 1QVFA 3S3OA 1OI9B 2KQWA 3JCMP 1QWFA 1CSKA 2RHYA 1NG2A 4RKUE 2EQMA 2DD4B 4ESRA 1N9RA 2DTOA 5GAOr 4HVUA 1NLPC 2FO0A 2O2OA 3I5RA 4E7JA 2CZ6B 1NYFA 3CCEA 2SEMA 3EHQA 2JN0A 3MKDA 4F6WB 2PNIA 4OMNA 1MMDA 2BIVA 2DXUA 2Z0WA 4J6WA 4RTYA 4EC8B 1W2BA 2L5QA 3QWYA 4BBRM 1H8KA 2DZCA 4ELJA 2QEXT 4Z02A 1J3TA 4DEYA 8ATCB 1TFBA 5FRNA 4XTXA 3NPFA 3VUBA 3G6EQ 5KYYB 1GUXB 3LGFA 2JOYA 3NTIA 1OIUB 4M6VA 1H27B 1EX4A 1OL1B 1PRLC 1NZ9A 2VKNA 4E7SA 5GAN6 3UDCA 4MMLA 2LCCA 5C6SA 2NUPB 5IHYA 3RERA 3CC2A 3CCLQ 3OW2P 4M78C 1VYWB 1W98B 2A28A 2IVXA 1VQMA 4ROEA 1V76A 5GAOm 3OYGA 1K0SA 4JX4A 3M53A 3BY7A 4F7UF 5A2QE 2H8HA 2YUQA 1E6GA 3L2ZA 4JLIA 2QTVA 4RTWA 1TU0B 5HKCA 1I1JA 5I2SA 1WZOA 1YITQ 2CT4A 3M54A 4GLMA 2HBWA 4KBMB 5L2WB 3FIFA 2E12A 1WHHA 2QGSA 1FVVB 2CREA 3I55T 5CYIB 5GAN3 4BBSM 2C5VB 1EFNA 2ROTA 5LJ5g 1M90R 2FRYA 1M3CA 3E9GA 1AOJA 1M3AA 1JBMA 2X51A 4Q5WA 5GJVB 2WPAB 4QT7A 1VQOQ 1X01A 1WHJA 1FXXA 1OOTA 1PKSA 1JSTB 1OV3A 1QLBA 4PKCC 3RKXA 4JX6A 2DK3A 2DLPA 4OGEA 1SHFA 2OTJT 5D6YA 4AKHA 5CK9A 5GANd 2VB6A 1N4MA 1RL2A 1YIJQ 4A4HA 1IB8A 2WEVB 4OB1B 2C4GB 2DKGA 3CXCA 3M0PA 2HQEA 4M78A 2QF7A 5CEIB 2EQJA 3BHTB 1Y07A 4RG2A 1VQ4T 3RBBB 2LQ8A 1K8AU 2BZXA 1H24B 1PRMC 4Z8AA 2IW6B 3X24B 1YHQA 1V1CA 1YJWA 1I0CA 1VQKQ 2HKQB 1UNGD 4A63B 3P8DA 3LW5E 5FU7C 4N4HA 1EZZB 3HPWA 4Y91A 3TW7A 1X6BA 1H4LD 1EIFA 1MNDA 2ABLA 3CMEA 2OX7A 2RA2A 4XTUA 2O31A 1E9HB 2QDJA 3E1SA 1M1GA 1M3BA 4ELLA 1B3QA 2RI2A 3LWIA 3VS0A 2E10A 2DF6A 2FL7A 3OMGA 4F7LB 4O5VA 4C0GA 2KY9A 1M27C 1HD3A 4KUDK 3HTRA 1QWEA 3E9FA 3JB9F 4IUVA 4II5B 3JB9D 3HFOA 2F2WA 2EAYA 2QDYB 1QCNA 4EOKB 1RAGB 2WSCE 2XHCA 4E7KA 3L2UA 4EIKA 1RAIB 4GBQA 1VQPQ 4FT4A 2DIQA 4BB7A 4RCBA 1MNEA 1ZLMA 4FYYB 4BY6B 3M03A 4M78G 3ME9A 4WF2A 3CBPA 1YJNT 2DL8A 4IKFA 1BKBA 3CQTA 3H41A 2CP2A 5KH6A 4OB0B 3QSUA 4IUTA 2F2CA 1K76A 3WVEB 3VV0A 2I0NA 3WVDB 4M7DC 2DYBA 1G2BA 1R0BG 1RAAB 2CZ1B 1IHVA 2VV5A 2O9SA 3G4ST 2L2PA 4BCIB 1GRIA 3VKIA 1O9KA 3MI9B 1YI2T 3VRYA 1H641 1V29B 1K9AA 3CCSA 4XQ3A 5I2MA 3QZ5B 4MZTA 2G3RA 3MO8A 4JUVA 1TD6A 2KR6A 4X1VA 3L42A 2L3PA 4MIMA 1UGRB 8AT1B 1YN8A 4BXXX 4CI0C 1Q82R 5GMKj 2WSFE 5IDNB 5LJ5f 2PUKB 2QEXQ 3S3NA 3O0GD 2QQAA 4PJNA 4R55A 5CKFA 5GANg 1SSHA 2DA9A 4RTXA 1OQKA 3THKA 4FYWB 1N9SA 3OSVA 2OAWA 1TUCA 1A0NB 1BU2A 3SDZA 2X1NB 1D0ZA 2KR3A 1GY3B 4NSTB 2E4HA 3CCUT 4EMKC 1VQ6A 1GH6B 2UZBB 2ZPFB 3X28B 2FVUA 2RQVA 3X20B 3X25B 2AZSA 4KRDB 1X69A 1G8XA 2JNGA 1NE8A 4JZ3A 3ER0A 3OQ5A 1WX6A 3PGGA 1T0HA 4M7DA 1ACMB 3BE3A 4QVDA 1MHNA 1C0MA 2YSQA 2LJ3A 2EYQA 5GAOp 4A4EA 5FU7B 4ANJA 1MMNA 3G6EA 3QO3A 2WMAB 4J7IA 4J9CA 3J80E 3N5BB 1G3WA 3VYGB 2E41A 4FX3B 4NL3A 2DL3A 1SF9A 4DQ2A 3A5ZB 3B57A 1G3SA 1OU8A 2K5LA 2RJCA 5M9OA 3LLRA 5LJ3j 1I07A 3OY9A 3BG3A 2CP7A 3CCLA 3I35A 3V7SA 1CKAA 2DXBA 4IUPA 2GQIA 1QMCA 1X75C 3EFSA 3FLGA 2F5KA 1KQSP 4FCYA 2JTMA 1LNXA 5AT1B 1YITA 4EMKA 2QFZA 4EOMB 5GJWB 1NYGA 5L23A 1VIFA 2O4XB 1NLOC 4HVWA 3OYIA 2WIHB 4BCQD 4C92C 3QYHB 2QYZA 2HSEB 2PUOB 5HNBB 4O6JA 1VQ4Q 2VVKA 5FWCA 4A4GA 2HCKA 2EWNA 1SG5A 4I3ZB 1OZ2A 4KULA 3PO3S 1TSFA 4M7DG 4RTZA 3EGDB 4OMPA 1VQOA 2ZCFB 2LX9A 2EJ9A 3GP8A 1TWBA 2WJ9A 1G3YA 2RHUA 3M0SA 3NFCA 1VQ7A 3QPHA 4NC6A 5BNJB 3CCJA 3DLLA 2DRMA 5FROA 3VS7A 4LUEA 2HAXA 1YIJA 1OX8A 2FG0A 1SRLA 2VWFA 3CCVT 4EOLB 2G77A 3HO8A 1GBRA 1G3NC 4DBFA 1MV0B 4C8QB 1QVFP 2HD0A 2DEUA 1M8VA 2L3RA 2CP3A 1TH7A 2JT4A 1JXMA 2GTOA 2O88A 3CCQA 1VQKA 3MP8A 1QQJA 2PVDB 2CH4W 1UTIA 2DXBB 2NLUA 3TREA 4CFUB 4ELYC 4C92A 3OYFA 1VQ8T 1QCOA 3MHXA 2NUTA 1R8OB 3I5SA 2DXTA 3RKWA 1XJWB 3CPWA 3FJ5A 2HKNA 5FW9A 1UNLD 1UFFA 1W2BP 2PVGB 3RMSA 2KVQG 5GAMd 1ENWA 4HCCA 1YFNA 4QVZA 4HNTA 1YWOA 4RTVA 3LWHA 2BS2A 2DM1A 3VUZA 2MWPA 2EGAA 4ZNXA 1I5LA 3QKJA 3SB2A 1S72A 3SEMA 1X2KA 3G4SQ 4Y72B 4FL6A 1YI2Q 4C5GA 1OIYB 4YOOA 1N5ZA 4KGVB 1VQPA 3PMIA 4ZGEB 3AHUA 1X43A 3CMEQ 2ZPEB 2KBTA 1K4US 4J9BA 2KDSA 2LJ0A 1KQSS 3A1PA 2IW8B 3JCMd 3QUIA 3GIBA 1BI0A 2A36A 3VS3A 3H9NA 3VJPA 1LCKA 2D0QB 4XU1A 3AT1B 5GAOq 3M9QA 2HQHA 5GAOl 1AT1B 2C5OB 3FJPA 2OTLT 2DD4A 3QYBA 2MMPA 4FW2A 1C1AA 2JVVA 2EYZA 4C92G 3V8KA 1WXBA 2ENMA 2RHIA 2DAQA 3CCUQ 4F7UB 4FSSA 2AIRB 3GBQA 4B6MA 4OB2B 1UE9A 3CBMA 2KGTA 1T3LA 2COWA 2KMTA 4L59A 3BFMA 3RUXA 4ZN3A 4DBRA 3EGXB 2CUBA 1UB4A 2E6NA 3WXMB 2AHJB 4RUGA 1UJ0A 1ABQA 1W4SA 1H26B 1YJ9T 2O01E 2ROLA 4OP0A 2CSQA 2DMOA 2QEXA 2RHXA 5GAN2 1VQNT 1RI0A 2M02A 4OGCA 1M9SA 4LUDA 4CFMB 2DL5A 3M55A 3V7CA 4M78E 3TNWB 3DB4A 5KYYA 1QVFS 1OKWB 1GUXA 4J6YA 2DTIA 2XDBA 3EIDB 3MEAA 5I22A 3CXCP 2W96A 2V26A 2KYBA 4M75G 2L3SA 2OAUA 1D3BA 2K3XA 4A4KA 2C6TB 2PHGA 2C0TA 2YRDA 5LMKB 2BS4A 3HP9A 2QI2A 3LH0A 3QZ9B 2EYYA 4CXAB 2J6KA 3OYBA 4JX5A 2EYWA 1I5OB 3JCMV 5CKBA 2GGRA 4HNUA 3DDQB 2D6FA 4HCBA 2RO0A 2RQUA 5HBEB 2NUZA 5HBJB 3A8GB 4X9CA 1W2BS 4CFUD 4PJOB 1H28B 4J9FA 3ZL7C 2LQWA 2ECZA 5GAMg 3QHWB 3I55A 4LDVA 4RODA 2MIOA 1JSUB 4E7ZA 5LQFB 1P92A 4HCZA 1K8AR 2V8JA 3VS5A 2L89A 1VQ6Q 4IIOA 3DKMA 3GF5A 1NEGA 3A8LB 3OYJA 5HBHB 2RJFA 4LDYA 2PQWA 4TVRA 3ULRB 3JCMe 3MIAB 4CRLB 2CUDA 3I56T 1UG1A 2PVOB 1NJIU 5LJ5h 4MFEA 3HKSA 3QWLA 3JB9G 3CMAT 1FWZA 3EG9B 2JXBA 3HZJA 2IW9B 3OYDA 2G6FX 2QQSA 1M30A 4LE9A 1BI1A 3JCMg 4CC4B 5GAN8 2P84A 1OZ3A 4CRIA 3UWNA 2E5QA 3IQLA 2LT1A 2W0ZA 3C12A 4QQGA 1WGSA 1JKWA 1VQ4A 4BY6C 4BY7X 1D3BB 2GBQA 1SSFA
chains in the Genus database with same CATH topology
4XTYA 4VUBA 2XHCA 3ZFJA 1JRIA 4E7KA 4C5HA 1KD1C 3L2UA 4BE1A 1PSFA 5DM7R 4N0AC 3MP1A 3TU4K 3CEYA 2DIQA 4FT4A 4RCBA 4BB7A 5LJ5j 4HT8A 4M7AG 4PLLA 3T9NA 3S3MA 4BY6B 4M78G 3BW1A 2RD1A 2E70A 3ME9A 5GAMh 1Q7YC 4WF2A 3CBPA 4GLKA 3VKGA 1YJNT 5GAOn 2CKKA 3EAEA 3CCMT 3OS0A 1UEBA 3V8LA 4IKFA 4MMKA 1BKBA 4M7AB 5KH6A 4LDUA 3J7AF 5IAYA 3CMAA 4OB0B 4J8OA 3QSUA 4IUTA 1N6AA 4OF1A 3M57A 4M7AF 3WVEB 2ZPBB 3HFNA 1ZQ1A 3VV0A 1VQKT 3WVDB 2DZ9A 3M4GA 3SD4A 2DXCB 1VQ6T 5AYFA 4M7DC 4M7AD 1U1SA 1LOJA 4JRIA 2LC4A 2CZ1B 2F5TX 4M7AE 4OB3B 2VV5A 4YTLA 2X4XA 3DLMA 4XK8E 1UGPB 1OI1A 3G4ST 3VKIA 1K73C 1XQHA 3PMTA 4C0DC 3HBLA 1BIAA 5D6WA 3HRTA 3CXCS 1YI2T 3CCRT 1N8RU 3LGLA 1Q86C 5J26A 1H641 1M90C 1V29B 4M7DB 3CCSA 1U1TA 1BYMA 3JCMh 4XQ3A 1Q82U 5I2MA 3QZ5B 2LTOA 4KT0E 4MZTA 2G3RA 3FB9A 1WNLA 3MO8A 4FIBA 4JUVA 2RK2A 2KR6A 2QQ8A 2LT4A 4M7DF 3CBOA 3L42A 5GAMj 4MIMA 5CVIA 1UGRB 1YCYA 1KC8C 4CI0C 2DO3A 2ZPGB 4M7DD 5GMKj 4J6XA 4M77G 2WSFE 2A3LA 5LJ5f 4M7DE 3G6ET 3TCJA 2ZPIB 2PUKB 1VQLT 3S3NA 4XTZA 1I8FA 1QW1A 1X6OA 3BDUA 5CAIA 2QQAA 5CO7A 3CPFA 4R55A 5CKFA 5GANg 5J39A 3TW6A 3BDLA 2DJZA 4PJOG 1YJNA 2JTFA 5J3BA 2RJDA 4EMGA 4M75C 4M77B 3CCMA 1N9SA 3GPLA 3CC7T 3GOXA 3OSVA 3KUFA 3JCMJ 1WJSA 3KBGA 4N0AA 4QQ6A 4DOWA 1HXDA 4LD6A 2QTXA 1K9MU 4M77F 3S6WA 3SDZA 2P0QA 2Y4XA 3CCUT 4M77D 3CCLT 2M0OA 4EMKC 1Q81C 4R56A 1VQ6A 2DXCA 2R58A 2VGMA 3E19A 4PJOF 1KG1A 2DIGA 2ZPFB 4V2SA 1VQ5T 3X28B 1AHJB 2FVUA 3TEEA 3X20B 3X25B 4BE2A 3G4SA 4PJOD 1G5VA 1UGQB 3F70A 5KCOA 5A0DA 3OSSC 2JNGA 1NE8A 3M5AA 2WSCE 5GAN5 3CCRA 2XU8A 5CQYA 3ER0A 3OQ5A 2HQXA 1YI2A 3PGGA 3P8HA 5FLXE 2X4WA 4EMKB 3META 3P8BB 1YITT 2X35A 1QVGS 4B9WA 4ZTFA 1KD1U 1B34B 3PNWC 4PLIA 4RG8A 4XAXB 2QQRA 5D6XA 4QVDA 5GMKi 2BKDN 4JRPA 1MHNA 2CZ7B 1BI3A 2P0KA 3HL8A 5GAMf 2EYQA 4OMFB 5GAOp 2LCLA 4NOYA 4A4EA 1KQ1A 5FU7B 2HBPA 3MEUA 3CD6T 3OS2A 1I4K1 2VXEA 3G6EA 3QO3A 4J7IA 3J80E 1VQLA 4B9XA 2OTJA 3N5BB 1U8RA 1Y71A 4C5EA 4E47A 3FC3A 1OYXA 2E6ZA 3CC4T 1G3WA 1NJIC 3QYEA 3VYGB 1IZ6A 4C0ZA 2E41A 2YLCA 4NL3A 5GMKl 5CQXA 4FT2A 2ZZDA 3CC7A 5EJCA 1VQOT 4DQ2A 3A5ZB 3LYIA 5M9OA 1G3SA 2RJCA 2K5LA 4LDWA 2CZ0B 3LLRA 4ZN1A 3QIIA 5LJ3j 2LNVA 5A0GA 1VQ9T 1QVGA 3OY9A 2VXFA 4N4GA 4JS4A 2EFIA 2CGHA 2MF2A 4HKEA 4EDUA 3BG3A 2P4TA 2R5AA 5KCHA 5GANh 3CCUA 1VQ7T 3CCLA 3QXEB 3V7SA 2P0PA 3CCJT 4NS5A 1M5Q1 2RM4A 4ATOA 2DXBA 4M75A 4BACA 4IUPA 1VQ5A 1K8AC 3NTKA 1NPPA 5DLOA 5GMKm 1FX7A 3V8JA 3DL1A 3EFSA 1X75C 3FLGA 1YIJT 2F5KA 3OMCA 1M1KU 3JB9J 1KQ2A 2JTMA 1LNXA 5HY6A 2KSSA 2K5FA 5CIUA 1YITA 1VIEA 4L6V5 4EMKA 2QFZA 1B34A 3INZA 2EJFA 3OBWA 3QJ6A 2F69A 4AKGA 3JCMb 3I56A 1VIFA 2O4XB 4ZGJB 2VC8A 2XI9A 3JB9I 1I81A 2RK1A 3OYIA 4C92C 4HL4A 2RHZA 1Q7YU 4DA4A 3QYHB 4QSHA 3CD6A 2Y4YA 4J83A 3JCMW 2GFUA 2PUOB 3M56A 4ELZC 3CCQT 2VGNA 3DB3A 4O6JA 2V8IA 2RI5A 4A4GA 4HA8A 4D6WA 5HK0A 4LD9K 1ZHIA 4UC4A 2EWNA 3CC4A 2IG0A 3OYNA 3S3OA 1OZ2A 4KULA 5DY9A 2IVWA 1KQSA 3OYYA 2RB6A 5GANj 3JB9H 4M7DG 2K5IA 3VYGA 2QA4T 4C92B 5EG2A 3JSCA 2ZCFB 1VQOA 4J7FA 4XU2A 5LJ3f 2LX9A 4BDYA 2EJ9A 2K57A 4BI8B 5LJ3d 3GP8A 3A8HB 4C92F 2DPPB 3GLXA 3HRSA 3MEVA 5LJ5e 2WJ9A 1G3YA 2RHUA 3NFCA 1VQ7A 1VQ9A 3QPHA 4NC6A 4C92D 3VU3C 3CCJA 3DLLA 2X4JA 2EKOA 4XU0A 4C92E 2YHTA 5I21A 5FROA 3OYHA 2XKOC 4C8QC 2BS3A 4HNVA 1O9SA 1Q86U 3RMQA 4C0DB 2HAXA 1N8RC 3GNFB 2FB7A 1YIJA 4MDWA 4NL2A 1HK9A 1YJWT 3H6ZA 1Q82C 5LJ5d 3HRUA 2LDMA 2PU9B 3CCET 4JJNK 3C95A 3CCVT 2G77A 3HO8A 2RI3A 1E7PA 4QQDA 1S72T 3PFSA 3PIOA 1LJOA 2ZPHB 4C8QB 3QG1A 2HD0A 2ZZDB 3QHSA 4E7HA 3GNGA 3QJYA 3HHTB 1M8VA 1WQ7A 2L3RA 5FU6C 2O4XA 1BI2A 1TH7A 4Y28E 4C8QF 4LDXA 3RIRA 1PSEA 4JRKA 4MDXA 2I2LA 2KMGA 4II1A 4C8QD 3CCQA 1VQKA 2CYZB 1UGSB 1G3TA 3MP8A 1Y7XA 3OBYA 2PVDB 4C8QE 5HK3A 2XICA 1VQPT 3JCMX 4QW2A 2DXBB 4M75B 2MI6A 4XU3A 3FDRA 2NLUA 2EJGA 4FM4B 3TREA 5C0MA 1N27A 5IN1A 1O75A 3HSBA 2QA4A 3EFRA 4ELYC 4E7IA 1K9MC 2RJEA 3R6OA 4C92A 4M75F 5GAMe 3OYFA 4MFDA 1VQ8T 2EQUA 2MWOA 3MHXA 2C06A 4MZPA 1QVFA 2GQVA 1R8OB 4M75D 3VKHA 3M4YA 1IREB 2DXTA 2QXFA 5L8RE 2XIDA 3RKWA 2KQWA 4BI4A 3CPWA 3LX7A 3KXTA 4M75E 2RHYA 3JCMP 2XDPA 4RKUE 2EQMA 2DD4B 3URGA 4BD3A 2A7YA 4RCCA 1N9RA 2DTOA 2PVGB 3RMSA 2KVQG 5GAMd 5GAOr 4HCCA 5KE3A 4QVZA 4HNTA 3A8MB 2HNIA 2M16A 2FYKA 3FRNA 4E7JA 3H4CA 2FHDA 1WJQA 2BS2A 4BI3A 2CZ6B 4C0FA 3OYAA 3LWHA 3VUZA 3CC2T 2MWPA 3CCEA 1I5LA 2LVMA 2JN0A 3G71T 3QKJA 3SB2A 1VQMT 1S72A 2JZ2A 4C8QA 2BIVA 5KE2A 2DXUA 2EIFA 4J6WA 4FL6A 4C5GA 4QVCA 4BDZA 3UPUA 1W2BA 2L5QA 1KHIA 3MP6A 4EPCA 3X26B 3PMIA 4BBRM 4ZGEB 1VQPA 1XOVA 3AHUA 2DZCA 1VUBA 1Y96B 1YBYA 5CKDA 2ZPEB 4ELJA 2QEXT 4Z02A 3UT1A 2XK0A 2KDSA 3JCMf 1KQSS 5GAN4 3JCMd 3QUIA 3GIBA 4IUUA 5GAN7 1BI0A 4PNOA 5FRNA 1VQ8A 4XTXA 3VUBA 4EMHA 3VJPA 2D0QB 4XTWA 1FKMA 3OA6A 4XU1A 2DTHA 3LGFA 3M9QA 2ZGWA 2JOYA 3NTIA 2MAMA 5GAOq 2WSEE 5GAOl 3OYKA 3PTAA 4M6VA 3FJPA 2OTLT 4X34A 2R57A 1H3ZA 2M9UA 5CKHA 2DD4A 3L2VA 4FSXA 3SFMA 1M1KC 3QYBA 1NZ9A 2MMPA 5GAN6 3ASKA 3UDCA 4MMLA 2LCCA 3OW2S 2JVVA 3NTHA 5C6SA 2K2VA 1NPRA 4C92G 3VYHB 3V8KA 3RERA 5LJ3e 3HB9A 2K4YA 2RHIA 4FU6A 2DAQA 3CC2A 4M7AC 4F7UB 2XDDA 3M59A 4M78C 2LQKA 3G71A 1VQMA 5GAOm 3OYGA 4JX4A 1JB0E 4OB2B 3M53A 4ME7A 3BY7A 3OYEA 4F7UF 5A2QE 4LOCA 3CBMA 4AI6A 1ZBXA 2KMTA 3OS5A 4L59A 2H3JA 1BIBA 3BFMA 3L2ZA 4JLIA 3RUXA 4ZN3A 5GMKh 3OYCA 4ZTJA 1QP3A 4C5IA 5HKCA 2GCXA 1MGQA 4F7UE 5LJ3g 5I2SA 1UB4A 2E6NA 3WXMB 2AHJB 4M78B 4OVAA 3M54A 1W4SA 4M7DA 1K73U 4RMOA 1YJ9T 2O01E 4OP0A 1M1FA 3C4SA 4KBMB 3RKYA 4PL6A 5A0LA 2E1HA 2RHXA 3FIFA 5GAN2 1Y96A 4M78F 2QEXA 1WJRA 2KK4A 1VQNT 4L5GA 3QYGB 1RI0A 4OGCA 1M90U 3OW2A 1XTDA 4C8QG 4A4FA 1M9SA 2E12A 4J5YA 4M78D 2DD5B 3I55T 2E64A 1XNIA 3M55A 1GXIE 1YHQT 5GAN3 4BBSM 3PT9A 4M78E 5CKEA 3V7CA 2V8KA 4HT9A 3DB4A 4Z6YA 3ZBDA 5LJ5g 2M1HA 4A54A 1QVFS 4ZGDB 3QBYA 4J6YA 3E9GA 3RESA 3OS1A 3CPWS 3MEWA 2DTIA 4N4IA 1KC8U 2XDBA 2WACA 1JBMA 5LL6S 2OTLA 4Q5WA 2Y90A 1JJ2S 3MEAA 1QVPA 1KHCA 5GANe 3Q1JA 1X01A 4M75G 2OAUA 3H8ZA 3CMET 5IT9E 2QQ9A 4BE0A 1D3BA 1FXXA 2K3XA 4A4KA 2KAFA 4M77C 1QLBA 2E65A 4KUIA 4PKCC 1QP2A 3RKXA 4JX6A 1WQWA 3KHIA 2DK3A 2EQKA 4OGEA 2BS4A 5GMKe 3HP9A 4F7UA 2QI2A 2RH2A 3LH0A 3QZ9B 4IUQA 4JDSA 4MZMA 4A53A 2OTJT 5GANf 4PJOC 5D6YA 4AKHA 5CK9A 4P5NA 3SWNC 2L8DA 5FU6B 5GANd 3OYBA 4JX5A 4BUGA 4IURA 3JCMV 1RL2A 5CKBA 2BUDA 4A4HA 1Q81U 2CS7A 3FEOA 3JCMc 4HNUA 1WPYA 4OB1B 2D6FA 4HCBA 2RO0A 4JS5A 2DKGA 3CXCA 3O8VA 3JAME 4M7AA 3A8GB 2HQEA 4X9CA 4M78A 2QF7A 2B8AA 2EQJA 1W2BS 1JJ2A 1Y07A 1YJ9A 4PJOB 2QQBA 3SWNB 3J81E 4RG2A 2GFAA 1VQ4T 1VQNA 2LQ8A 4JRQA 1K8AU 4M77E 2YRVA 5GAMg 4HLQA 3I55A 2YLBA 4LDVA 5DLQE 3C94A 3X24B 5LJ3h 5CR2A 3L2WA 1YHQA 2DD5A 4DOVA 3OYLA 1YJWA 4HCZA 1P92A 3PIPA 2V8JA 4PJOE 2L89A 2D9TA 3CCVA 2K3YA 3DKMA 3LW5E 3GF5A 3P8DA 5FU7C 4N4HA 3L2RA 3A8LB 2R5MA 4XTVA 2XD0A 3HPWA 4Y91A 1M4ZA 3OYJA 3TW7A 2RJFA 4LDYA 2DEQA 2PQWA 1EIFA 4TVRA 3BG9A 3L1AA 3JCMe 3CMEA 2RA2A 4XTUA 3I56T 2PVOB 4E7LA 1NJIU 5LJ5h 4MFEA 2QDJA 3QDRB 3E1SA 2XG8D 3HKSA 1M1GA 3QWLA 2VUBA 4AKIA 3JB9G 3CMAT 1FWZA 3OB9A 3L2QA 2RI2A 3LWIA 3HZJA 2E10A 3G7ZA 3OYDA 3JRZA 2QQSA 2FL7A 3OMGA 1BI1A 3MCAB 4X9DA 3JCMg 4O5VA 2VYTA 2KY9A 4GY5A 3ZEHA 4C0GA 4KUDK 5GAN8 1OZ3A 4M77A 4CRIA 2JUFA 3UWNA 3E9FA 3OYMA 2E5QA 3JB9F 5CCAA 2LT1A 2X4YA 1D3BB 3C12A 4IUVA 4QQGA 1WGSA 2DVEA 2LRQA 3M58A 3CCST 4F7UG 3SWNA 3JB9D 3HFOA 1VQ4A 4PJOA 4BY6C 3JCMQ 5FRMA 2EAYA 2QDYB 4JLGA 3V7RA 1DJ7B 2GF7A 3A8OB 3BG5A 1SSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CYZ B;  1UGS B;  2PVD B;  3QYG B;  1PSF A;  2DXB B;  2DD5 B;  1GXI E;  4FM4 B;  3VYG B;  4ZGD B;  2ZZD A;  1IRE B;  5L8R E;  2CZ0 B;  4RKU E;  2DD4 B;  4OB0 B;  2PVG B;  3QXE B;  3WVE B;  2ZPB B;  3A8M B;  3WVD B;  1QP2 A;  2DXB A;  2DXC B;  3QZ9 B;  2CZ6 B;  2CZ1 B;  4OB3 B;  4XK8 E;  1UGP B;  4L6V 5;  4OB1 B;  1V29 B;  3A8G B;  3QZ5 B;  4ZGJ B;  4KT0 E;  3X26 B;  3QYH B;  4ZGE B;  1UGR B;  2PUO B;  2ZPE B;  2ZPG B;  3X24 B;  2WSF E;  2DD5 A;  2ZPI B;  2PUK B;  3VYG A;  3LW5 E;  2D0Q B;  2ZCF B;  3A8L B;  2WSE E;  3A8H B;  2DPP B;  2DD4 A;  2PVO B;  3VYH B;  2DXC A;  2ZPF B;  3X28 B;  1AHJ B;  3X20 B;  3X25 B;  1UGQ B;  2PU9 B;  1JB0 E;  4OB2 B;  2ZPH B;  2ZZD B;  1QP3 A;  3HHT B;  2CZ7 B;  2AHJ B;  4Y28 E;  1PSE A;  2QDY B;  2O01 E;  1DJ7 B;  3A8O B;  2WSC E; 
#chains in the Genus database with same CATH topology
 3ZFJ A;  1PSF A;  5LJ5 j;  3NHN A;  4HT8 A;  3T9N A;  2QGF B;  3BW1 A;  5ECA A;  2E70 A;  4UN0 A;  1ARK A;  3DOG B;  3VKG A;  2CKK A;  1R0C B;  1AVZ C;  1UEB A;  3V8L A;  2BKZ B;  3J7A F;  5IAY A;  4EOS B;  1TTH B;  3M57 A;  1SRM A;  3HFN A;  1ZQ1 A;  3M4G A;  2DXC B;  5AYF A;  4Z88 A;  4YOZ A;  4M7A E;  3MY5 B;  3RGF B;  1UGP B;  1XQH A;  4C0D C;  4BCJ B;  3HBL A;  1BIA A;  4G6L B;  3CXC S;  3CCR T;  1N8R U;  2ED0 A;  1U1T A;  2LTO A;  4Y92 A;  3LQ5 B;  1WNL A;  3BG5 A;  2LT4 A;  1E7O A;  5CVI A;  2DO3 A;  2ZPG B;  1VQ7 Q;  2WFY B;  4M7D E;  3CCJ Q;  3O5Z A;  2ZPI B;  3TCJ A;  1K0X A;  2KXC A;  2UUE B;  5CAI A;  5CO7 A;  1YJN A;  4EMG A;  3EJ1 B;  2PMI B;  3CC7 T;  2J7I A;  3JCM J;  2F2X A;  1WJS A;  2KNB B;  2YUO A;  1HXD A;  4M77 F;  2OTL Q;  3EH1 A;  1QLY A;  4M77 D;  2E3I A;  3EFO B;  2ATC B;  4R56 A;  3TVT A;  4BCP B;  2R58 A;  2VGM A;  3E19 A;  4PJO F;  1KG1 A;  1K1Z A;  2DIG A;  4V2S A;  2PZ1 A;  1AHJ B;  4PJO D;  3G4S A;  3CCQ Q;  1UGQ B;  1PD0 A;  1RLQ C;  4PFZ A;  1WLP B;  1KSW A;  4TTH A;  2XU8 A;  5CQY A;  1YI2 A;  2HQX A;  2MCN A;  3MET A;  1QVG S;  4ZTF A;  4PLI A;  4RG8 A;  4XAX B;  2KRS A;  2CZ7 B;  2P0K A;  4WTO B;  5GAM f;  4OMF B;  2X3W D;  2GNC A;  2DL4 A;  1AD5 A;  1B07 A;  2JS2 A;  2CP6 A;  3MEU A;  3OS2 A;  1YJ9 Q;  2EYX A;  3RDV A;  4C5E A;  4E47 A;  4J9I A;  2DVJ A;  3FC3 A;  1VQN Q;  2D1X A;  2E6Z A;  3CC4 T;  1NJI C;  3QYE A;  4C0Z A;  4BY1 X;  2YLC A;  4F6S B;  3MJX A;  1VA7 A;  2ZZD A;  5EJC A;  3UA6 A;  3LYI A;  2DET A;  1Y0M A;  3QII A;  1S72 Q;  1YWP A;  4RTT A;  1QVG A;  4JS4 A;  2FZC B;  2CGH A;  2MF2 A;  5GAN h;  2R5A A;  3CCU A;  2YDL A;  2C0O A;  1AZE A;  3PVQ A;  4NS5 A;  2IPO B;  2RM4 A;  4ATO A;  5IXF A;  1RAB B;  1MMG A;  4AMC A;  1NPP A;  2JW4 A;  1MUZ A;  1RLP C;  4ORZ A;  2FZK B;  1GFD A;  4BCQ B;  2K5F A;  1BCM A;  4L6V 5;  2J6F A;  4OMO A;  2F69 A;  2J06 A;  4OGR B;  2VC8 A;  4ZGJ B;  3JB9 I;  4F70 B;  1UDL A;  1Q7Y U;  3NDQ A;  4QSH A;  4JJC A;  1IGU A;  3M56 A;  2D0N A;  2P4R A;  4LXC A;  2EPD A;  1Z9Q A;  4ELZ C;  4HA8 A;  1D1B A;  4UC4 A;  3OYN A;  5DY9 A;  3OYY A;  2RB6 A;  5GAN j;  4KH0 B;  3VYG A;  1JOW A;  2M51 A;  2QA4 T;  5EG2 A;  1LPL A;  1TXQ A;  4BI8 B;  5LJ3 d;  3A8H B;  2BTT A;  1LVK A;  2EKH A;  1H1R B;  3GLX A;  3MEV A;  2DL7 A;  1H1Q B;  4C92 E;  4C8Q C;  2BS3 A;  4HNV A;  1Q86 U;  2UZE B;  2WHB B;  3RMQ A;  1RI9 A;  1YCS B;  3C0C A;  4C0D B;  2COY A;  1N8R C;  2CT3 A;  1ZA2 B;  2FB7 A;  1HK9 A;  1YJW T;  4JJN K;  4FW1 A;  2RI3 A;  2I53 A;  4CFN B;  3QG1 A;  2LMJ A;  2ZZD B;  1OPL A;  3QHS A;  4E7H A;  3CPW P;  3TSZ A;  2O4X A;  1BI2 A;  1ZUK A;  1KC8 R;  4LDX A;  3RIR A;  4JRK A;  4K11 A;  2KMG A;  2LJ1 A;  3TNH B;  1VIN A;  2CYZ B;  3OBY A;  5HK3 A;  3JCM X;  1IRX A;  1M2O A;  4XU3 A;  2RPN A;  5DQV A;  1WI7 A;  1OEB A;  1X2Q A;  3EGD A;  2UZD B;  2RJE A;  2EQU A;  2RMO A;  3VKH A;  3M4Y A;  5GMK e;  1K8A C;  4EON B;  2QXF A;  3KXT A;  4M75 E;  2XDP A;  4BD3 A;  2MK5 A;  2A7Y A;  4RCC A;  6AT1 B;  5IH2 A;  2DX1 A;  4BCG B;  1ZP2 A;  4PJJ A;  5KE3 A;  3A8M B;  2FYK A;  1FIN B;  3FRN A;  3H4C A;  2FHD A;  2COZ A;  3OYA A;  2HL5 C;  3G71 T;  3I55 Q;  1UHF A;  4C8Q A;  3BHV B;  3CCR Q;  2HZY A;  4QVC A;  1H1S B;  1KHI A;  1XOV A;  5CKD A;  1Y96 B;  3QWX X;  3UT1 A;  2PJQ A;  3GTM S;  4IUU A;  5GAN 7;  1VQ8 A;  4EMH A;  4XTW A;  1FKM A;  2OTJ Q;  2D8H A;  2DTH A;  2ZGW A;  3PTA A;  1W6X A;  2MAM A;  2EVR A;  3OYK A;  2KT1 A;  1H3Z A;  1NEB A;  4X34 A;  2R57 A;  2M9U A;  3L2V A;  4FSX A;  3CC7 Q;  2VAS A;  3SFM A;  3NGP A;  3NTH A;  2EQI A;  1NPR A;  2K2V A;  5LJ3 e;  2EGE A;  3HB9 A;  1WHG A;  3H0F A;  4FU6 A;  2EW3 A;  3M59 A;  4AFU C;  1WA7 A;  1JB0 E;  4OR5 B;  4ME7 A;  3OYE A;  4LOC A;  4AI6 A;  2LP5 A;  3OS5 A;  1BIB A;  4ZTJ A;  4OMQ A;  4C5I A;  4F04 B;  5LJ3 g;  1MGQ A;  1G83 A;  4OVA A;  5HCK A;  4EOQ B;  1TG0 A;  1K73 U;  4RMO A;  1OU9 A;  3C4S A;  4M4Z A;  3RKY A;  2E1H A;  2HSP A;  4M78 F;  4L5G A;  3QYG B;  3VS6 A;  4C8Q G;  4A4F A;  4J5Y A;  4M78 D;  2DD5 B;  2E64 A;  1GXI E;  4JJB A;  3PT9 A;  1TUD A;  1AWJ A;  3ZBD A;  2M1H A;  4A54 A;  1URC B;  4ZGD B;  3QBY A;  3E2U A;  3CC4 Q;  2EBP A;  3CPW S;  1KC8 U;  4N4I A;  2WAC A;  2OTL A;  2L3Q A;  1JJ2 S;  2B9R A;  1D1C A;  1QVP A;  1KHC A;  1QKX A;  5KYU B;  2BE7 D;  3LH5 A;  3H8Z A;  2DBM A;  5IHN A;  4IIM A;  4M77 C;  1Y57 A;  2JMA A;  4KUI A;  3KHI A;  2EQK A;  1OX9 A;  1PWT A;  1ZUU A;  1ZUY A;  2X3X D;  3KFV A;  4WCI A;  4F7U A;  1GL5 A;  4MZM A;  5GAN f;  1UGV A;  4PJO C;  4P5N A;  2L8D A;  4IUR A;  3EG2 A;  2BUD A;  1Q81 U;  1BB9 A;  2CS7 A;  4HXJ A;  4BCM D;  4CC2 A;  4OML A;  4JS5 A;  2C5N B;  3EGX A;  3JAM E;  1JJ2 A;  4LN2 A;  3M0U A;  1YJ9 A;  1YJN Q;  2QQB A;  2C5X B;  3SWN B;  5KYX A;  2GFA A;  2FEI A;  1VQN A;  4CC3 A;  3M0R A;  4JRQ A;  1QKW A;  2YRV A;  2CDT A;  1AZG B;  4Z89 A;  2J05 A;  3L2W A;  1T0J A;  3C94 A;  2FRW A;  5CR2 A;  3M0T A;  2K3B A;  4DOV A;  3OYL A;  3PIP A;  1JU5 C;  3BHU B;  2D9T A;  2K3Y A;  3L2R A;  1RAH B;  4XTV A;  4BCN B;  1M4Z A;  3EG0 A;  2QA4 Q;  4J9H A;  2DEQ A;  2EGC A;  2RQW A;  3BG9 A;  1D0Y A;  4E7L A;  2CJM B;  2QG9 B;  1XO2 A;  3U23 A;  1NJI R;  1BU1 A;  4BCK B;  1PG5 B;  3MCA B;  4X9D A;  4F7J B;  1KFZ A;  1NM7 A;  2VYT A;  4F7S B;  4GY5 A;  1AWX A;  4F17 A;  2KXD A;  1PHT A;  4M77 A;  3OYM A;  3MY1 B;  2X4Y A;  1PKT A;  1D3U B;  2DVE A;  3M58 A;  4PJO A;  4F7U G;  3R6N A;  3JCM Q;  2DER A;  1F5Q B;  1RAE B;  3V7R A;  3DJB A;  2GF7 A;  2CP0 A;  3A8O B;  3UA7 A;  2A08 A;  4VUB A;  1JRI A;  1BK2 A;  4BE1 A;  5DM7 R;  2FPF A;  4N0A C;  2AZV A;  3TU4 K;  3CEY A;  4PLL A;  4AFQ C;  3S3M A;  1MV3 A;  5GAM h;  4GLK A;  5GAO n;  3CCM T;  3OS0 A;  2PK9 B;  1UHC A;  3CMA A;  2QDL A;  4J8O A;  1E6H A;  3EG9 A;  5KYX B;  4M7A F;  2ZPB B;  1VQK T;  2FPE A;  4J9E A;  1U1S A;  1LOJ A;  4M7A D;  4AFS C;  2LC4 A;  4AT1 B;  4OB3 B;  4XK8 E;  3F5X B;  2LCS A;  1K73 C;  3G71 Q;  5D6W A;  3HRT A;  3LGL A;  5D7U A;  3JCM h;  2QK0 A;  1WHM A;  2KRO A;  4AG2 C;  3FB9 A;  4FIB A;  1N8R R;  4M7D F;  1VYU A;  4LNP A;  5GAM j;  1KC8 C;  4M7D D;  2K9G A;  4M77 G;  4KGZ B;  1VQL T;  2K7A A;  4XTZ A;  1X6O A;  3CPF A;  4PJO G;  5J3B A;  2RJD A;  4M77 B;  3REA B;  3GOX A;  1BBZ A;  2FZG B;  3KUF A;  2WIP B;  4N0A A;  4QQ6 A;  2HEQ A;  1PC0 A;  2QTX A;  1K9M U;  3S6W A;  2CP5 A;  4JJD A;  2P0Q A;  2Y4X A;  4YC3 B;  2IIM A;  2M0O A;  1Q81 C;  2DXC A;  4CFW B;  1VQ5 T;  4CFV B;  5ACB A;  3TEE A;  4BE2 A;  1G5V A;  3F70 A;  3M5A A;  3CCR A;  3P8H A;  5FLX E;  3P8B B;  1B34 B;  3PNW C;  5D6X A;  1BI3 A;  3HL8 A;  3TQ7 P;  1QVG P;  2WXV B;  2QGG A;  2AK5 A;  5KYW B;  4BCN D;  1ABO A;  2DIL A;  3CD6 T;  4B9X A;  2OTJ A;  1U8R A;  1OYX A;  3UF4 A;  1BCO A;  1AEY A;  3CC7 A;  2BE9 B;  3CCV Q;  4LDW A;  5FRM A;  2CZ0 B;  2AT1 B;  4ZN1 A;  3EHR A;  4N4G A;  2EFI A;  4HKE A;  4EDU A;  1VQ9 T;  5KCH A;  1S1N A;  3MPU B;  3QXE B;  2ED1 A;  3EFO A;  3QDF A;  4BAC A;  3NTK A;  1H25 B;  5GMK m;  1H1P B;  3DL1 A;  1M1K U;  3OMC A;  1KQ2 A;  4PJM A;  2CCI B;  4YOS A;  1UUE A;  2GTJ A;  2W9F A;  1OUL A;  2IN3 A;  4DEX A;  3INZ A;  2EJF A;  4CC7 A;  1VQ8 Q;  3OBW A;  1UEC A;  1JEG A;  1KD1 R;  2RHZ A;  1W1F A;  4J83 A;  3JCM W;  1RUW A;  3DB3 A;  4KH1 B;  2RI5 A;  3RR6 A;  1ZHI A;  2SRC A;  3CC4 A;  1Q7Y R;  2CCH B;  2IVW A;  1QCF A;  2X9H A;  2G9X B;  1B7T A;  4XU2 A;  2LX7 A;  1C9B A;  4RTU A;  4BDY A;  3VS4 A;  2K57 A;  1FMW A;  1IGQ A;  4FYX B;  4BCH B;  4C92 F;  3HRS A;  5LJ5 e;  4C92 D;  3VU3 C;  4KGX B;  2EKO A;  4XU0 A;  5I21 A;  2YHT A;  3OYH A;  2YRC A;  2XKO C;  2KE9 A;  1O9S A;  2V1Q A;  1P5E B;  4HCK A;  1OPK A;  4NL2 A;  1TOV A;  3HRU A;  2HL3 A;  1Q86 R;  1KJW A;  3CCE T;  3C95 A;  4DBQ A;  2D8J A;  3PIO A;  2ZPH B;  2V1R A;  3GNG A;  2JS0 A;  3QJY A;  3HHT B;  1GCQ C;  1WQ7 A;  5FU6 C;  4Y28 E;  3EGU A;  3EH2 A;  2YT6 A;  2JM9 A;  4MDX A;  2I2L A;  2DYI A;  3JV3 A;  2YUP A;  4C8Q E;  1HYO A;  1OGU B;  4PJL A;  3H0I A;  3FDR A;  2MOX A;  2KI7 A;  5C0M A;  1N27 A;  3HSB A;  1M2V A;  2QA4 A;  4E7I A;  1K9M C;  3R6O A;  4M75 F;  4MFD A;  2MWO A;  2C06 A;  2GQV A;  4M75 D;  1IRE B;  5L8R E;  2C0I A;  2XID A;  4BI4 A;  2J6O A;  3LX7 A;  7AT1 B;  1D0X A;  3NMZ C;  3URG A;  1QMZ B;  3CCM Q;  2K2M A;  2HNI A;  2M16 A;  1MMA A;  1ZSZ C;  1WJQ A;  4BI3 A;  4C0F A;  1GCP A;  3CC2 T;  1WHK A;  2LVM A;  4HVV A;  2F2V A;  1VQM T;  1RAF B;  2JZ2 A;  5IF1 B;  5KE2 A;  1JQQ A;  2EIF A;  4BDZ A;  1ZSG A;  3UPU A;  2AKK A;  3MP6 A;  4EPC A;  3X26 B;  5HQ0 B;  1X6G A;  2H3E B;  1VUB A;  1YBY A;  2M0Y A;  1RAC B;  2XK0 A;  3JCM f;  2RQT A;  1OKV B;  5GAN 4;  1GCQ A;  4PNO A;  1WHL A;  1WXT A;  3OA6 A;  1VQL Q;  2CSI A;  1KD1 U;  4BCO B;  2WSE E;  1UNH D;  4EOJ B;  1JXO A;  5CKH A;  3I9Q A;  1WDX A;  1M1K C;  1UJY A;  3ASK A;  1AWW A;  3OW2 S;  3BLR B;  3VYH B;  2RF0 A;  2K4Y A;  4QKU A;  4M7A C;  2XDD A;  2O9V A;  3G71 A;  2LQK A;  3PVL A;  1M2V B;  1VQ5 Q;  1ZBX A;  2H3J A;  5GMK h;  3OYC A;  1C6V X;  1QP3 A;  1ZSZ A;  2GCX A;  4F7U E;  4EOI B;  2MPX C;  3REB B;  4M78 B;  2PK2 A;  1WIE A;  2RN8 A;  1M1F A;  5A0L A;  4PL6 A;  5EC7 A;  3I56 Q;  1Y96 A;  1WJR A;  2KK4 A;  1NBE B;  1M90 U;  1PD1 A;  3DTO A;  1XTD A;  1Z9Z A;  3OW2 A;  1ZBJ A;  5KYN A;  3CMA Q;  1K73 R;  1XNI A;  1YHQ T;  3CD6 Q;  2LQN A;  4OMM A;  5CKE A;  2V8K A;  4HT9 A;  4Z6Y A;  1ZX6 A;  1VYV A;  1M8M A;  3RES A;  3OS1 A;  3MEW A;  4CFX B;  5LL6 S;  2Y90 A;  2UZL B;  5GAN e;  3Q1J A;  3CME T;  5IT9 E;  2QQ9 A;  4BE0 A;  1JJ2 P;  2HDA A;  2KAF A;  1W70 A;  1VQ9 Q;  2E65 A;  2DBK A;  1QP2 A;  1WQW A;  4BCM B;  4JZ4 A;  2RH2 A;  4IUQ A;  4A53 A;  4JDS A;  3SWN C;  5FU6 B;  1U06 A;  4BUG A;  2K79 A;  4KRT A;  4BCF B;  3FEO A;  3JCM c;  2BZY A;  1WPY A;  3O8V A;  1VYT A;  4M7A A;  2B8A A;  1Q81 R;  4F7N B;  3J81 E;  1U5S A;  1OL2 B;  4M77 E;  3BLH B;  4HLQ A;  2DRK A;  3A98 A;  2YLB A;  5DLQ E;  5LJ3 h;  2DD5 A;  2MYS A;  1Q95 G;  4PJO E;  1TS9 A;  4ROC A;  3CCV A;  5IHI A;  1VOM A;  2R5M A;  2XD0 A;  3G1J A;  5KYU A;  3L1A A;  1ZSZ B;  2HMA A;  4AG1 C;  3QDR B;  2BPM B;  2XG8 D;  2VUB A;  1HJD A;  4AKI A;  3OB9 A;  3L2Q A;  2JTE A;  2DME A;  1HSQ A;  2A0F B;  1FMV A;  3G7Z A;  2LNH B;  3JRZ A;  4DBH A;  2DFU A;  1VOL A;  2ESW A;  4IMY B;  5FWB A;  3ZEH A;  3EOC B;  1O9K B;  2QAZ A;  2JUF A;  3CCE Q;  1CKB A;  3EG1 A;  5CCA A;  3CCS T;  2LRQ A;  3SWN A;  3RNJ A;  2W10 A;  4JLG A;  1DJ7 B;  1PNJ A;  3BLQ B;  4XTY A;  1YP5 A;  4C5H A;  1KD1 C;  4F16 A;  4J9G A;  2LZ6 B;  3MP1 A;  1AIS B;  2L0A A;  1IHW A;  4M7A G;  2RD1 A;  3UAT A;  1Q7Y C;  3EAE A;  4MMK A;  4D8K A;  2DJQ A;  4M7A B;  4LDU A;  1GBQ A;  5DQW A;  1N6A A;  4OF1 A;  4EOR B;  2DZ9 A;  3SD4 A;  1VQ6 T;  3G33 B;  1KXU A;  1X27 A;  1WFW A;  4JRI A;  2YUN A;  2F5T X;  4YTL A;  2JGZ B;  2X4X A;  3DLM A;  1T3S A;  1OI1 A;  3CC2 Q;  3PMT A;  1FYN A;  2W99 A;  1VQM Q;  1Q86 C;  1ZA1 B;  5J26 A;  1M90 C;  1BYM A;  4M7D B;  1Q82 U;  4KT0 E;  2LW4 A;  2YXY A;  2RK2 A;  2QQ8 A;  3CBO A;  1YCY A;  4R0K A;  5IHK A;  4J6X A;  4PFO A;  2A3L A;  3G6E T;  2I40 B;  1I8F A;  1QW1 A;  3BDU A;  2JM8 A;  5J39 A;  3TW6 A;  3BDL A;  1SPK A;  2DJZ A;  2JTF A;  4M75 C;  3CCM A;  3GPL A;  3KBG A;  4DOW A;  2BZ8 A;  4LD6 A;  1WXU A;  2JJ9 A;  1IXD A;  3CCL T;  2B86 A;  3H0H A;  1K9M R;  2EUF A;  2K6D A;  4JPB W;  1U3O A;  5KCO A;  5A0D A;  3OSS C;  4EOO B;  5GAN 5;  2X4W A;  4EMK B;  1YIT T;  2X35 A;  4B9W A;  5GMK i;  2QQR A;  4F14 A;  4JRP A;  2BKD N;  1TUG B;  1YNZ A;  5EFQ B;  2NYS A;  4E6R A;  2YWW A;  1AWO A;  9ATC B;  3TN8 B;  2LCL A;  4NOY A;  1KQ1 A;  5FGK B;  2F1L A;  2HBP A;  1AD6 A;  1I4K 1;  2VXE A;  1VQL A;  1Y71 A;  2ZAE A;  5HVY B;  2OI3 A;  3PE0 A;  1WYX A;  1IZ6 A;  1YHQ Q;  1SHG A;  4F6U B;  5GMK l;  5CQX A;  4FT2 A;  1YJW Q;  1VQO T;  1SEM A;  3VS1 A;  3VS2 A;  3M0Q A;  2KT8 A;  4KRC B;  2LNV A;  4J9D A;  5A0G A;  2VXF A;  2FPD A;  2P4T A;  1VQ7 T;  1GFC A;  1IO6 A;  2P0P A;  3CCJ T;  1M5Q 1;  3SHW A;  4EC9 B;  1R77 A;  4PFP A;  1D1A A;  4M75 A;  1VQ5 A;  2KEA A;  2DE0 X;  5DLO A;  3EG3 A;  1FX7 A;  3V8J A;  3QHR B;  1YIJ T;  5I11 A;  2V22 B;  2JMC A;  5ICP B;  3JB9 J;  3TNI B;  5HY6 A;  2KSS A;  5CIU A;  5I5Z B;  1VIE A;  2KYM A;  3K7A M;  1M1K R;  1B34 A;  1H3H A;  2A37 A;  1JO8 A;  3QJ6 A;  4AKG A;  3JCM b;  3I56 A;  2E3H A;  1H92 A;  2XI9 A;  1I81 A;  2RK1 A;  5KYW A;  4HL4 A;  4DA4 A;  3CD6 A;  2Y4Y A;  1FMK A;  2GFU A;  3CCQ T;  2VGN A;  1RAD B;  2V8I A;  4D6W A;  5HK0 A;  4LD9 K;  2IG0 A;  1KQS A;  2OJ2 A;  3JB9 H;  1SKU B;  2K5I A;  2RQR A;  4C92 B;  3JSC A;  2AKL A;  4J7F A;  2E5K A;  2NUT B;  5LJ3 f;  4EOP B;  4D8D A;  2CH4 A;  2W2H A;  2KRN A;  2DPP B;  1VQ9 A;  4AFZ C;  2W9Z A;  2QAS A;  2R7G A;  3VRZ A;  2X4J A;  4PK4 A;  2KRM A;  3D7S B;  1KK7 A;  3GNF B;  4MDW A;  2XMF A;  3H6Z A;  1Q82 C;  5LJ5 d;  2LDM A;  2PU9 B;  1F1B B;  4QQD A;  1E7P A;  1S72 T;  3PFS A;  1LJO A;  3TSW A;  1D09 B;  2NWM A;  3DDP B;  1KIK A;  4C8Q F;  4FYV B;  1PCX A;  1PSE A;  1PM3 A;  4II1 A;  2NUP A;  4C8Q D;  3CCS Q;  2WMB B;  2DNU A;  1UGS B;  1G3T A;  1VQP T;  1Y7X A;  2PTK A;  2XIC A;  4QW2 A;  4M75 B;  2MI6 A;  3POM A;  2EJG A;  4FM4 B;  1PKD B;  4E2F B;  5IN1 A;  1O75 A;  5IDP B;  3EFR A;  5IXB A;  2RNA A;  5GAM e;  4MZP A;  1QVF A;  3S3O A;  1OI9 B;  2KQW A;  3JCM P;  1QWF A;  1CSK A;  2RHY A;  1NG2 A;  4RKU E;  2EQM A;  2DD4 B;  4ESR A;  1N9R A;  2DTO A;  5GAO r;  4HVU A;  1NLP C;  2FO0 A;  2O2O A;  3I5R A;  4E7J A;  2CZ6 B;  1NYF A;  3CCE A;  2SEM A;  3EHQ A;  2JN0 A;  3MKD A;  4F6W B;  2PNI A;  4OMN A;  1MMD A;  2BIV A;  2DXU A;  2Z0W A;  4J6W A;  4RTY A;  4EC8 B;  1W2B A;  2L5Q A;  3QWY A;  4BBR M;  1H8K A;  2DZC A;  4ELJ A;  2QEX T;  4Z02 A;  1J3T A;  4DEY A;  8ATC B;  1TFB A;  5FRN A;  4XTX A;  3NPF A;  3VUB A;  3G6E Q;  5KYY B;  1GUX B;  3LGF A;  2JOY A;  3NTI A;  1OIU B;  4M6V A;  1H27 B;  1EX4 A;  1OL1 B;  1PRL C;  1NZ9 A;  2VKN A;  4E7S A;  5GAN 6;  3UDC A;  4MML A;  2LCC A;  5C6S A;  2NUP B;  5IHY A;  3RER A;  3CC2 A;  3CCL Q;  3OW2 P;  4M78 C;  1VYW B;  1W98 B;  2A28 A;  2IVX A;  1VQM A;  4ROE A;  1V76 A;  5GAO m;  3OYG A;  1K0S A;  4JX4 A;  3M53 A;  3BY7 A;  4F7U F;  5A2Q E;  2H8H A;  2YUQ A;  1E6G A;  3L2Z A;  4JLI A;  2QTV A;  4RTW A;  1TU0 B;  5HKC A;  1I1J A;  5I2S A;  1WZO A;  1YIT Q;  2CT4 A;  3M54 A;  4GLM A;  2HBW A;  4KBM B;  5L2W B;  3FIF A;  2E12 A;  1WHH A;  2QGS A;  1FVV B;  2CRE A;  3I55 T;  5CYI B;  5GAN 3;  4BBS M;  2C5V B;  1EFN A;  2ROT A;  5LJ5 g;  1M90 R;  2FRY A;  1M3C A;  3E9G A;  1AOJ A;  1M3A A;  1JBM A;  2X51 A;  4Q5W A;  5GJV B;  2WPA B;  4QT7 A;  1VQO Q;  1X01 A;  1WHJ A;  1FXX A;  1OOT A;  1PKS A;  1JST B;  1OV3 A;  1QLB A;  4PKC C;  3RKX A;  4JX6 A;  2DK3 A;  2DLP A;  4OGE A;  1SHF A;  2OTJ T;  5D6Y A;  4AKH A;  5CK9 A;  5GAN d;  2VB6 A;  1N4M A;  1RL2 A;  1YIJ Q;  4A4H A;  1IB8 A;  2WEV B;  4OB1 B;  2C4G B;  2DKG A;  3CXC A;  3M0P A;  2HQE A;  4M78 A;  2QF7 A;  5CEI B;  2EQJ A;  3BHT B;  1Y07 A;  4RG2 A;  1VQ4 T;  3RBB B;  2LQ8 A;  1K8A U;  2BZX A;  1H24 B;  1PRM C;  4Z8A A;  2IW6 B;  3X24 B;  1YHQ A;  1V1C A;  1YJW A;  1I0C A;  1VQK Q;  2HKQ B;  1UNG D;  4A63 B;  3P8D A;  3LW5 E;  5FU7 C;  4N4H A;  1EZZ B;  3HPW A;  4Y91 A;  3TW7 A;  1X6B A;  1H4L D;  1EIF A;  1MND A;  2ABL A;  3CME A;  2OX7 A;  2RA2 A;  4XTU A;  2O31 A;  1E9H B;  2QDJ A;  3E1S A;  1M1G A;  1M3B A;  4ELL A;  1B3Q A;  2RI2 A;  3LWI A;  3VS0 A;  2E10 A;  2DF6 A;  2FL7 A;  3OMG A;  4F7L B;  4O5V A;  4C0G A;  2KY9 A;  1M27 C;  1HD3 A;  4KUD K;  3HTR A;  1QWE A;  3E9F A;  3JB9 F;  4IUV A;  4II5 B;  3JB9 D;  3HFO A;  2F2W A;  2EAY A;  2QDY B;  1QCN A;  4EOK B;  1RAG B;  2WSC E;  2XHC A;  4E7K A;  3L2U A;  4EIK A;  1RAI B;  4GBQ A;  1VQP Q;  4FT4 A;  2DIQ A;  4BB7 A;  4RCB A;  1MNE A;  1ZLM A;  4FYY B;  4BY6 B;  3M03 A;  4M78 G;  3ME9 A;  4WF2 A;  3CBP A;  1YJN T;  2DL8 A;  4IKF A;  1BKB A;  3CQT A;  3H41 A;  2CP2 A;  5KH6 A;  4OB0 B;  3QSU A;  4IUT A;  2F2C A;  1K76 A;  3WVE B;  3VV0 A;  2I0N A;  3WVD B;  4M7D C;  2DYB A;  1G2B A;  1R0B G;  1RAA B;  2CZ1 B;  1IHV A;  2VV5 A;  2O9S A;  3G4S T;  2L2P A;  4BCI B;  1GRI A;  3VKI A;  1O9K A;  3MI9 B;  1YI2 T;  3VRY A;  1H64 1;  1V29 B;  1K9A A;  3CCS A;  4XQ3 A;  5I2M A;  3QZ5 B;  4MZT A;  2G3R A;  3MO8 A;  4JUV A;  1TD6 A;  2KR6 A;  4X1V A;  3L42 A;  2L3P A;  4MIM A;  1UGR B;  8AT1 B;  1YN8 A;  4BXX X;  4CI0 C;  1Q82 R;  5GMK j;  2WSF E;  5IDN B;  5LJ5 f;  2PUK B;  2QEX Q;  3S3N A;  3O0G D;  2QQA A;  4PJN A;  4R55 A;  5CKF A;  5GAN g;  1SSH A;  2DA9 A;  4RTX A;  1OQK A;  3THK A;  4FYW B;  1N9S A;  3OSV A;  2OAW A;  1TUC A;  1A0N B;  1BU2 A;  3SDZ A;  2X1N B;  1D0Z A;  2KR3 A;  1GY3 B;  4NST B;  2E4H A;  3CCU T;  4EMK C;  1VQ6 A;  1GH6 B;  2UZB B;  2ZPF B;  3X28 B;  2FVU A;  2RQV A;  3X20 B;  3X25 B;  2AZS A;  4KRD B;  1X69 A;  1G8X A;  2JNG A;  1NE8 A;  4JZ3 A;  3ER0 A;  3OQ5 A;  1WX6 A;  3PGG A;  1T0H A;  4M7D A;  1ACM B;  3BE3 A;  4QVD A;  1MHN A;  1C0M A;  2YSQ A;  2LJ3 A;  2EYQ A;  5GAO p;  4A4E A;  5FU7 B;  4ANJ A;  1MMN A;  3G6E A;  3QO3 A;  2WMA B;  4J7I A;  4J9C A;  3J80 E;  3N5B B;  1G3W A;  3VYG B;  2E41 A;  4FX3 B;  4NL3 A;  2DL3 A;  1SF9 A;  4DQ2 A;  3A5Z B;  3B57 A;  1G3S A;  1OU8 A;  2K5L A;  2RJC A;  5M9O A;  3LLR A;  5LJ3 j;  1I07 A;  3OY9 A;  3BG3 A;  2CP7 A;  3CCL A;  3I35 A;  3V7S A;  1CKA A;  2DXB A;  4IUP A;  2GQI A;  1QMC A;  1X75 C;  3EFS A;  3FLG A;  2F5K A;  1KQS P;  4FCY A;  2JTM A;  1LNX A;  5AT1 B;  1YIT A;  4EMK A;  2QFZ A;  4EOM B;  5GJW B;  1NYG A;  5L23 A;  1VIF A;  2O4X B;  1NLO C;  4HVW A;  3OYI A;  2WIH B;  4BCQ D;  4C92 C;  3QYH B;  2QYZ A;  2HSE B;  2PUO B;  5HNB B;  4O6J A;  1VQ4 Q;  2VVK A;  5FWC A;  4A4G A;  2HCK A;  2EWN A;  1SG5 A;  4I3Z B;  1OZ2 A;  4KUL A;  3PO3 S;  1TSF A;  4M7D G;  4RTZ A;  3EGD B;  4OMP A;  1VQO A;  2ZCF B;  2LX9 A;  2EJ9 A;  3GP8 A;  1TWB A;  2WJ9 A;  1G3Y A;  2RHU A;  3M0S A;  3NFC A;  1VQ7 A;  3QPH A;  4NC6 A;  5BNJ B;  3CCJ A;  3DLL A;  2DRM A;  5FRO A;  3VS7 A;  4LUE A;  2HAX A;  1YIJ A;  1OX8 A;  2FG0 A;  1SRL A;  2VWF A;  3CCV T;  4EOL B;  2G77 A;  3HO8 A;  1GBR A;  1G3N C;  4DBF A;  1MV0 B;  4C8Q B;  1QVF P;  2HD0 A;  2DEU A;  1M8V A;  2L3R A;  2CP3 A;  1TH7 A;  2JT4 A;  1JXM A;  2GTO A;  2O88 A;  3CCQ A;  1VQK A;  3MP8 A;  1QQJ A;  2PVD B;  2CH4 W;  1UTI A;  2DXB B;  2NLU A;  3TRE A;  4CFU B;  4ELY C;  4C92 A;  3OYF A;  1VQ8 T;  1QCO A;  3MHX A;  2NUT A;  1R8O B;  3I5S A;  2DXT A;  3RKW A;  1XJW B;  3CPW A;  3FJ5 A;  2HKN A;  5FW9 A;  1UNL D;  1UFF A;  1W2B P;  2PVG B;  3RMS A;  2KVQ G;  5GAM d;  1ENW A;  4HCC A;  1YFN A;  4QVZ A;  4HNT A;  1YWO A;  4RTV A;  3LWH A;  2BS2 A;  2DM1 A;  3VUZ A;  2MWP A;  2EGA A;  4ZNX A;  1I5L A;  3QKJ A;  3SB2 A;  1S72 A;  3SEM A;  1X2K A;  3G4S Q;  4Y72 B;  4FL6 A;  1YI2 Q;  4C5G A;  1OIY B;  4YOO A;  1N5Z A;  4KGV B;  1VQP A;  3PMI A;  4ZGE B;  3AHU A;  1X43 A;  3CME Q;  2ZPE B;  2KBT A;  1K4U S;  4J9B A;  2KDS A;  2LJ0 A;  1KQS S;  3A1P A;  2IW8 B;  3JCM d;  3QUI A;  3GIB A;  1BI0 A;  2A36 A;  3VS3 A;  3H9N A;  3VJP A;  1LCK A;  2D0Q B;  4XU1 A;  3AT1 B;  5GAO q;  3M9Q A;  2HQH A;  5GAO l;  1AT1 B;  2C5O B;  3FJP A;  2OTL T;  2DD4 A;  3QYB A;  2MMP A;  4FW2 A;  1C1A A;  2JVV A;  2EYZ A;  4C92 G;  3V8K A;  1WXB A;  2ENM A;  2RHI A;  2DAQ A;  3CCU Q;  4F7U B;  4FSS A;  2AIR B;  3GBQ A;  4B6M A;  4OB2 B;  1UE9 A;  3CBM A;  2KGT A;  1T3L A;  2COW A;  2KMT A;  4L59 A;  3BFM A;  3RUX A;  4ZN3 A;  4DBR A;  3EGX B;  2CUB A;  1UB4 A;  2E6N A;  3WXM B;  2AHJ B;  4RUG A;  1UJ0 A;  1ABQ A;  1W4S A;  1H26 B;  1YJ9 T;  2O01 E;  2ROL A;  4OP0 A;  2CSQ A;  2DMO A;  2QEX A;  2RHX A;  5GAN 2;  1VQN T;  1RI0 A;  2M02 A;  4OGC A;  1M9S A;  4LUD A;  4CFM B;  2DL5 A;  3M55 A;  3V7C A;  4M78 E;  3TNW B;  3DB4 A;  5KYY A;  1QVF S;  1OKW B;  1GUX A;  4J6Y A;  2DTI A;  2XDB A;  3EID B;  3MEA A;  5I22 A;  3CXC P;  2W96 A;  2V26 A;  2KYB A;  4M75 G;  2L3S A;  2OAU A;  1D3B A;  2K3X A;  4A4K A;  2C6T B;  2PHG A;  2C0T A;  2YRD A;  5LMK B;  2BS4 A;  3HP9 A;  2QI2 A;  3LH0 A;  3QZ9 B;  2EYY A;  4CXA B;  2J6K A;  3OYB A;  4JX5 A;  2EYW A;  1I5O B;  3JCM V;  5CKB A;  2GGR A;  4HNU A;  3DDQ B;  2D6F A;  4HCB A;  2RO0 A;  2RQU A;  5HBE B;  2NUZ A;  5HBJ B;  3A8G B;  4X9C A;  1W2B S;  4CFU D;  4PJO B;  1H28 B;  4J9F A;  3ZL7 C;  2LQW A;  2ECZ A;  5GAM g;  3QHW B;  3I55 A;  4LDV A;  4ROD A;  2MIO A;  1JSU B;  4E7Z A;  5LQF B;  1P92 A;  4HCZ A;  1K8A R;  2V8J A;  3VS5 A;  2L89 A;  1VQ6 Q;  4IIO A;  3DKM A;  3GF5 A;  1NEG A;  3A8L B;  3OYJ A;  5HBH B;  2RJF A;  4LDY A;  2PQW A;  4TVR A;  3ULR B;  3JCM e;  3MIA B;  4CRL B;  2CUD A;  3I56 T;  1UG1 A;  2PVO B;  1NJI U;  5LJ5 h;  4MFE A;  3HKS A;  3QWL A;  3JB9 G;  3CMA T;  1FWZ A;  3EG9 B;  2JXB A;  3HZJ A;  2IW9 B;  3OYD A;  2G6F X;  2QQS A;  1M30 A;  4LE9 A;  1BI1 A;  3JCM g;  4CC4 B;  5GAN 8;  2P84 A;  1OZ3 A;  4CRI A;  3UWN A;  2E5Q A;  3IQL A;  2LT1 A;  2W0Z A;  3C12 A;  4QQG A;  1WGS A;  1JKW A;  1VQ4 A;  4BY6 C;  4BY7 X;  1D3B B;  2GBQ A;  1SSF A; 
#chains in the Genus database with same CATH homology
 4XTY A;  4VUB A;  2XHC A;  3ZFJ A;  1JRI A;  4E7K A;  4C5H A;  1KD1 C;  3L2U A;  4BE1 A;  1PSF A;  5DM7 R;  4N0A C;  3MP1 A;  3TU4 K;  3CEY A;  2DIQ A;  4FT4 A;  4RCB A;  4BB7 A;  5LJ5 j;  4HT8 A;  4M7A G;  4PLL A;  3T9N A;  3S3M A;  4BY6 B;  4M78 G;  3BW1 A;  2RD1 A;  2E70 A;  3ME9 A;  5GAM h;  1Q7Y C;  4WF2 A;  3CBP A;  4GLK A;  3VKG A;  1YJN T;  5GAO n;  2CKK A;  3EAE A;  3CCM T;  3OS0 A;  1UEB A;  3V8L A;  4IKF A;  4MMK A;  1BKB A;  4M7A B;  5KH6 A;  4LDU A;  3J7A F;  5IAY A;  3CMA A;  4OB0 B;  4J8O A;  3QSU A;  4IUT A;  1N6A A;  4OF1 A;  3M57 A;  4M7A F;  3WVE B;  2ZPB B;  3HFN A;  1ZQ1 A;  3VV0 A;  1VQK T;  3WVD B;  2DZ9 A;  3M4G A;  3SD4 A;  2DXC B;  1VQ6 T;  5AYF A;  4M7D C;  4M7A D;  1U1S A;  1LOJ A;  4JRI A;  2LC4 A;  2CZ1 B;  2F5T X;  4M7A E;  4OB3 B;  2VV5 A;  4YTL A;  2X4X A;  3DLM A;  4XK8 E;  1UGP B;  1OI1 A;  3G4S T;  3VKI A;  1K73 C;  1XQH A;  3PMT A;  4C0D C;  3HBL A;  1BIA A;  5D6W A;  3HRT A;  3CXC S;  1YI2 T;  3CCR T;  1N8R U;  3LGL A;  1Q86 C;  5J26 A;  1H64 1;  1M90 C;  1V29 B;  4M7D B;  3CCS A;  1U1T A;  1BYM A;  3JCM h;  4XQ3 A;  1Q82 U;  5I2M A;  3QZ5 B;  2LTO A;  4KT0 E;  4MZT A;  2G3R A;  3FB9 A;  1WNL A;  3MO8 A;  4FIB A;  4JUV A;  2RK2 A;  2KR6 A;  2QQ8 A;  2LT4 A;  4M7D F;  3CBO A;  3L42 A;  5GAM j;  4MIM A;  5CVI A;  1UGR B;  1YCY A;  1KC8 C;  4CI0 C;  2DO3 A;  2ZPG B;  4M7D D;  5GMK j;  4J6X A;  4M77 G;  2WSF E;  2A3L A;  5LJ5 f;  4M7D E;  3G6E T;  3TCJ A;  2ZPI B;  2PUK B;  1VQL T;  3S3N A;  4XTZ A;  1I8F A;  1QW1 A;  1X6O A;  3BDU A;  5CAI A;  2QQA A;  5CO7 A;  3CPF A;  4R55 A;  5CKF A;  5GAN g;  5J39 A;  3TW6 A;  3BDL A;  2DJZ A;  4PJO G;  1YJN A;  2JTF A;  5J3B A;  2RJD A;  4EMG A;  4M75 C;  4M77 B;  3CCM A;  1N9S A;  3GPL A;  3CC7 T;  3GOX A;  3OSV A;  3KUF A;  3JCM J;  1WJS A;  3KBG A;  4N0A A;  4QQ6 A;  4DOW A;  1HXD A;  4LD6 A;  2QTX A;  1K9M U;  4M77 F;  3S6W A;  3SDZ A;  2P0Q A;  2Y4X A;  3CCU T;  4M77 D;  3CCL T;  2M0O A;  4EMK C;  1Q81 C;  4R56 A;  1VQ6 A;  2DXC A;  2R58 A;  2VGM A;  3E19 A;  4PJO F;  1KG1 A;  2DIG A;  2ZPF B;  4V2S A;  1VQ5 T;  3X28 B;  1AHJ B;  2FVU A;  3TEE A;  3X20 B;  3X25 B;  4BE2 A;  3G4S A;  4PJO D;  1G5V A;  1UGQ B;  3F70 A;  5KCO A;  5A0D A;  3OSS C;  2JNG A;  1NE8 A;  3M5A A;  2WSC E;  5GAN 5;  3CCR A;  2XU8 A;  5CQY A;  3ER0 A;  3OQ5 A;  2HQX A;  1YI2 A;  3PGG A;  3P8H A;  5FLX E;  2X4W A;  4EMK B;  3MET A;  3P8B B;  1YIT T;  2X35 A;  1QVG S;  4B9W A;  4ZTF A;  1KD1 U;  1B34 B;  3PNW C;  4PLI A;  4RG8 A;  4XAX B;  2QQR A;  5D6X A;  4QVD A;  5GMK i;  2BKD N;  4JRP A;  1MHN A;  2CZ7 B;  1BI3 A;  2P0K A;  3HL8 A;  5GAM f;  2EYQ A;  4OMF B;  5GAO p;  2LCL A;  4NOY A;  4A4E A;  1KQ1 A;  5FU7 B;  2HBP A;  3MEU A;  3CD6 T;  3OS2 A;  1I4K 1;  2VXE A;  3G6E A;  3QO3 A;  4J7I A;  3J80 E;  1VQL A;  4B9X A;  2OTJ A;  3N5B B;  1U8R A;  1Y71 A;  4C5E A;  4E47 A;  3FC3 A;  1OYX A;  2E6Z A;  3CC4 T;  1G3W A;  1NJI C;  3QYE A;  3VYG B;  1IZ6 A;  4C0Z A;  2E41 A;  2YLC A;  4NL3 A;  5GMK l;  5CQX A;  4FT2 A;  2ZZD A;  3CC7 A;  5EJC A;  1VQO T;  4DQ2 A;  3A5Z B;  3LYI A;  5M9O A;  1G3S A;  2RJC A;  2K5L A;  4LDW A;  2CZ0 B;  3LLR A;  4ZN1 A;  3QII A;  5LJ3 j;  2LNV A;  5A0G A;  1VQ9 T;  1QVG A;  3OY9 A;  2VXF A;  4N4G A;  4JS4 A;  2EFI A;  2CGH A;  2MF2 A;  4HKE A;  4EDU A;  3BG3 A;  2P4T A;  2R5A A;  5KCH A;  5GAN h;  3CCU A;  1VQ7 T;  3CCL A;  3QXE B;  3V7S A;  2P0P A;  3CCJ T;  4NS5 A;  1M5Q 1;  2RM4 A;  4ATO A;  2DXB A;  4M75 A;  4BAC A;  4IUP A;  1VQ5 A;  1K8A C;  3NTK A;  1NPP A;  5DLO A;  5GMK m;  1FX7 A;  3V8J A;  3DL1 A;  3EFS A;  1X75 C;  3FLG A;  1YIJ T;  2F5K A;  3OMC A;  1M1K U;  3JB9 J;  1KQ2 A;  2JTM A;  1LNX A;  5HY6 A;  2KSS A;  2K5F A;  5CIU A;  1YIT A;  1VIE A;  4L6V 5;  4EMK A;  2QFZ A;  1B34 A;  3INZ A;  2EJF A;  3OBW A;  3QJ6 A;  2F69 A;  4AKG A;  3JCM b;  3I56 A;  1VIF A;  2O4X B;  4ZGJ B;  2VC8 A;  2XI9 A;  3JB9 I;  1I81 A;  2RK1 A;  3OYI A;  4C92 C;  4HL4 A;  2RHZ A;  1Q7Y U;  4DA4 A;  3QYH B;  4QSH A;  3CD6 A;  2Y4Y A;  4J83 A;  3JCM W;  2GFU A;  2PUO B;  3M56 A;  4ELZ C;  3CCQ T;  2VGN A;  3DB3 A;  4O6J A;  2V8I A;  2RI5 A;  4A4G A;  4HA8 A;  4D6W A;  5HK0 A;  4LD9 K;  1ZHI A;  4UC4 A;  2EWN A;  3CC4 A;  2IG0 A;  3OYN A;  3S3O A;  1OZ2 A;  4KUL A;  5DY9 A;  2IVW A;  1KQS A;  3OYY A;  2RB6 A;  5GAN j;  3JB9 H;  4M7D G;  2K5I A;  3VYG A;  2QA4 T;  4C92 B;  5EG2 A;  3JSC A;  2ZCF B;  1VQO A;  4J7F A;  4XU2 A;  5LJ3 f;  2LX9 A;  4BDY A;  2EJ9 A;  2K57 A;  4BI8 B;  5LJ3 d;  3GP8 A;  3A8H B;  4C92 F;  2DPP B;  3GLX A;  3HRS A;  3MEV A;  5LJ5 e;  2WJ9 A;  1G3Y A;  2RHU A;  3NFC A;  1VQ7 A;  1VQ9 A;  3QPH A;  4NC6 A;  4C92 D;  3VU3 C;  3CCJ A;  3DLL A;  2X4J A;  2EKO A;  4XU0 A;  4C92 E;  2YHT A;  5I21 A;  5FRO A;  3OYH A;  2XKO C;  4C8Q C;  2BS3 A;  4HNV A;  1O9S A;  1Q86 U;  3RMQ A;  4C0D B;  2HAX A;  1N8R C;  3GNF B;  2FB7 A;  1YIJ A;  4MDW A;  4NL2 A;  1HK9 A;  1YJW T;  3H6Z A;  1Q82 C;  5LJ5 d;  3HRU A;  2LDM A;  2PU9 B;  3CCE T;  4JJN K;  3C95 A;  3CCV T;  2G77 A;  3HO8 A;  2RI3 A;  1E7P A;  4QQD A;  1S72 T;  3PFS A;  3PIO A;  1LJO A;  2ZPH B;  4C8Q B;  3QG1 A;  2HD0 A;  2ZZD B;  3QHS A;  4E7H A;  3GNG A;  3QJY A;  3HHT B;  1M8V A;  1WQ7 A;  2L3R A;  5FU6 C;  2O4X A;  1BI2 A;  1TH7 A;  4Y28 E;  4C8Q F;  4LDX A;  3RIR A;  1PSE A;  4JRK A;  4MDX A;  2I2L A;  2KMG A;  4II1 A;  4C8Q D;  3CCQ A;  1VQK A;  2CYZ B;  1UGS B;  1G3T A;  3MP8 A;  1Y7X A;  3OBY A;  2PVD B;  4C8Q E;  5HK3 A;  2XIC A;  1VQP T;  3JCM X;  4QW2 A;  2DXB B;  4M75 B;  2MI6 A;  4XU3 A;  3FDR A;  2NLU A;  2EJG A;  4FM4 B;  3TRE A;  5C0M A;  1N27 A;  5IN1 A;  1O75 A;  3HSB A;  2QA4 A;  3EFR A;  4ELY C;  4E7I A;  1K9M C;  2RJE A;  3R6O A;  4C92 A;  4M75 F;  5GAM e;  3OYF A;  4MFD A;  1VQ8 T;  2EQU A;  2MWO A;  3MHX A;  2C06 A;  4MZP A;  1QVF A;  2GQV A;  1R8O B;  4M75 D;  3VKH A;  3M4Y A;  1IRE B;  2DXT A;  2QXF A;  5L8R E;  2XID A;  3RKW A;  2KQW A;  4BI4 A;  3CPW A;  3LX7 A;  3KXT A;  4M75 E;  2RHY A;  3JCM P;  2XDP A;  4RKU E;  2EQM A;  2DD4 B;  3URG A;  4BD3 A;  2A7Y A;  4RCC A;  1N9R A;  2DTO A;  2PVG B;  3RMS A;  2KVQ G;  5GAM d;  5GAO r;  4HCC A;  5KE3 A;  4QVZ A;  4HNT A;  3A8M B;  2HNI A;  2M16 A;  2FYK A;  3FRN A;  4E7J A;  3H4C A;  2FHD A;  1WJQ A;  2BS2 A;  4BI3 A;  2CZ6 B;  4C0F A;  3OYA A;  3LWH A;  3VUZ A;  3CC2 T;  2MWP A;  3CCE A;  1I5L A;  2LVM A;  2JN0 A;  3G71 T;  3QKJ A;  3SB2 A;  1VQM T;  1S72 A;  2JZ2 A;  4C8Q A;  2BIV A;  5KE2 A;  2DXU A;  2EIF A;  4J6W A;  4FL6 A;  4C5G A;  4QVC A;  4BDZ A;  3UPU A;  1W2B A;  2L5Q A;  1KHI A;  3MP6 A;  4EPC A;  3X26 B;  3PMI A;  4BBR M;  4ZGE B;  1VQP A;  1XOV A;  3AHU A;  2DZC A;  1VUB A;  1Y96 B;  1YBY A;  5CKD A;  2ZPE B;  4ELJ A;  2QEX T;  4Z02 A;  3UT1 A;  2XK0 A;  2KDS A;  3JCM f;  1KQS S;  5GAN 4;  3JCM d;  3QUI A;  3GIB A;  4IUU A;  5GAN 7;  1BI0 A;  4PNO A;  5FRN A;  1VQ8 A;  4XTX A;  3VUB A;  4EMH A;  3VJP A;  2D0Q B;  4XTW A;  1FKM A;  3OA6 A;  4XU1 A;  2DTH A;  3LGF A;  3M9Q A;  2ZGW A;  2JOY A;  3NTI A;  2MAM A;  5GAO q;  2WSE E;  5GAO l;  3OYK A;  3PTA A;  4M6V A;  3FJP A;  2OTL T;  4X34 A;  2R57 A;  1H3Z A;  2M9U A;  5CKH A;  2DD4 A;  3L2V A;  4FSX A;  3SFM A;  1M1K C;  3QYB A;  1NZ9 A;  2MMP A;  5GAN 6;  3ASK A;  3UDC A;  4MML A;  2LCC A;  3OW2 S;  2JVV A;  3NTH A;  5C6S A;  2K2V A;  1NPR A;  4C92 G;  3VYH B;  3V8K A;  3RER A;  5LJ3 e;  3HB9 A;  2K4Y A;  2RHI A;  4FU6 A;  2DAQ A;  3CC2 A;  4M7A C;  4F7U B;  2XDD A;  3M59 A;  4M78 C;  2LQK A;  3G71 A;  1VQM A;  5GAO m;  3OYG A;  4JX4 A;  1JB0 E;  4OB2 B;  3M53 A;  4ME7 A;  3BY7 A;  3OYE A;  4F7U F;  5A2Q E;  4LOC A;  3CBM A;  4AI6 A;  1ZBX A;  2KMT A;  3OS5 A;  4L59 A;  2H3J A;  1BIB A;  3BFM A;  3L2Z A;  4JLI A;  3RUX A;  4ZN3 A;  5GMK h;  3OYC A;  4ZTJ A;  1QP3 A;  4C5I A;  5HKC A;  2GCX A;  1MGQ A;  4F7U E;  5LJ3 g;  5I2S A;  1UB4 A;  2E6N A;  3WXM B;  2AHJ B;  4M78 B;  4OVA A;  3M54 A;  1W4S A;  4M7D A;  1K73 U;  4RMO A;  1YJ9 T;  2O01 E;  4OP0 A;  1M1F A;  3C4S A;  4KBM B;  3RKY A;  4PL6 A;  5A0L A;  2E1H A;  2RHX A;  3FIF A;  5GAN 2;  1Y96 A;  4M78 F;  2QEX A;  1WJR A;  2KK4 A;  1VQN T;  4L5G A;  3QYG B;  1RI0 A;  4OGC A;  1M90 U;  3OW2 A;  1XTD A;  4C8Q G;  4A4F A;  1M9S A;  2E12 A;  4J5Y A;  4M78 D;  2DD5 B;  3I55 T;  2E64 A;  1XNI A;  3M55 A;  1GXI E;  1YHQ T;  5GAN 3;  4BBS M;  3PT9 A;  4M78 E;  5CKE A;  3V7C A;  2V8K A;  4HT9 A;  3DB4 A;  4Z6Y A;  3ZBD A;  5LJ5 g;  2M1H A;  4A54 A;  1QVF S;  4ZGD B;  3QBY A;  4J6Y A;  3E9G A;  3RES A;  3OS1 A;  3CPW S;  3MEW A;  2DTI A;  4N4I A;  1KC8 U;  2XDB A;  2WAC A;  1JBM A;  5LL6 S;  2OTL A;  4Q5W A;  2Y90 A;  1JJ2 S;  3MEA A;  1QVP A;  1KHC A;  5GAN e;  3Q1J A;  1X01 A;  4M75 G;  2OAU A;  3H8Z A;  3CME T;  5IT9 E;  2QQ9 A;  4BE0 A;  1D3B A;  1FXX A;  2K3X A;  4A4K A;  2KAF A;  4M77 C;  1QLB A;  2E65 A;  4KUI A;  4PKC C;  1QP2 A;  3RKX A;  4JX6 A;  1WQW A;  3KHI A;  2DK3 A;  2EQK A;  4OGE A;  2BS4 A;  5GMK e;  3HP9 A;  4F7U A;  2QI2 A;  2RH2 A;  3LH0 A;  3QZ9 B;  4IUQ A;  4JDS A;  4MZM A;  4A53 A;  2OTJ T;  5GAN f;  4PJO C;  5D6Y A;  4AKH A;  5CK9 A;  4P5N A;  3SWN C;  2L8D A;  5FU6 B;  5GAN d;  3OYB A;  4JX5 A;  4BUG A;  4IUR A;  3JCM V;  1RL2 A;  5CKB A;  2BUD A;  4A4H A;  1Q81 U;  2CS7 A;  3FEO A;  3JCM c;  4HNU A;  1WPY A;  4OB1 B;  2D6F A;  4HCB A;  2RO0 A;  4JS5 A;  2DKG A;  3CXC A;  3O8V A;  3JAM E;  4M7A A;  3A8G B;  2HQE A;  4X9C A;  4M78 A;  2QF7 A;  2B8A A;  2EQJ A;  1W2B S;  1JJ2 A;  1Y07 A;  1YJ9 A;  4PJO B;  2QQB A;  3SWN B;  3J81 E;  4RG2 A;  2GFA A;  1VQ4 T;  1VQN A;  2LQ8 A;  4JRQ A;  1K8A U;  4M77 E;  2YRV A;  5GAM g;  4HLQ A;  3I55 A;  2YLB A;  4LDV A;  5DLQ E;  3C94 A;  3X24 B;  5LJ3 h;  5CR2 A;  3L2W A;  1YHQ A;  2DD5 A;  4DOV A;  3OYL A;  1YJW A;  4HCZ A;  1P92 A;  3PIP A;  2V8J A;  4PJO E;  2L89 A;  2D9T A;  3CCV A;  2K3Y A;  3DKM A;  3LW5 E;  3GF5 A;  3P8D A;  5FU7 C;  4N4H A;  3L2R A;  3A8L B;  2R5M A;  4XTV A;  2XD0 A;  3HPW A;  4Y91 A;  1M4Z A;  3OYJ A;  3TW7 A;  2RJF A;  4LDY A;  2DEQ A;  2PQW A;  1EIF A;  4TVR A;  3BG9 A;  3L1A A;  3JCM e;  3CME A;  2RA2 A;  4XTU A;  3I56 T;  2PVO B;  4E7L A;  1NJI U;  5LJ5 h;  4MFE A;  2QDJ A;  3QDR B;  3E1S A;  2XG8 D;  3HKS A;  1M1G A;  3QWL A;  2VUB A;  4AKI A;  3JB9 G;  3CMA T;  1FWZ A;  3OB9 A;  3L2Q A;  2RI2 A;  3LWI A;  3HZJ A;  2E10 A;  3G7Z A;  3OYD A;  3JRZ A;  2QQS A;  2FL7 A;  3OMG A;  1BI1 A;  3MCA B;  4X9D A;  3JCM g;  4O5V A;  2VYT A;  2KY9 A;  4GY5 A;  3ZEH A;  4C0G A;  4KUD K;  5GAN 8;  1OZ3 A;  4M77 A;  4CRI A;  2JUF A;  3UWN A;  3E9F A;  3OYM A;  2E5Q A;  3JB9 F;  5CCA A;  2LT1 A;  2X4Y A;  1D3B B;  3C12 A;  4IUV A;  4QQG A;  1WGS A;  2DVE A;  2LRQ A;  3M58 A;  3CCS T;  4F7U G;  3SWN A;  3JB9 D;  3HFO A;  1VQ4 A;  4PJO A;  4BY6 C;  3JCM Q;  5FRM A;  2EAY A;  2QDY B;  4JLG A;  3V7R A;  1DJ7 B;  2GF7 A;  3A8O B;  3BG5 A;  1SSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...