3A8OB

Crystal structure of nitrile hydratase complexed with trimethylacetamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8oB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8oB02
2DXBA 2PVDB 2CYZB 2CZ0B 2DD5A 3X20B 3VYGB 3A8HB 2ZZDA 1GXIE 2DXCB 2CZ7B 2PU9B 2D0QB 1UGPB 3VYHB 2DD4B 1UGRB 4RKUE 2ZZDB 2ZPFB 3QXEB 2PVGB 2DXCA 1PSFA 4KT0E 3X24B 3QZ9B 2PVOB 2DXBB 3LW5E 3HHTB 2QDYB 4L6V5 4OB1B 2WSCE 4FM4B 1IREB 2PUOB 3VYGA 1DJ7B 3A8GB 1AHJB 1UGQB 3QYGB 1QP2A 3X28B 2AHJB 3WVEB 3A8LB 2WSEE 2ZPEB 2O01E 4OB0B 1V29B 3X25B 4ZGDB 3A8OB 2ZCFB 2DD4A 2DD5B 1QP3A 2PUKB 3QYHB 3A8MB 2ZPGB 2ZPHB 2ZPIB 5L8RE 4OB3B 1JB0E 2WSFE 2CZ6B 2CZ1B 3WVDB 1PSEA 4OB2B 2ZPBB 3X26B 4Y28E 1UGSB 4ZGJB 4XK8E 2DPPB 4ZGEB 3QZ5B
chains in the Genus database with same CATH superfamily
4FYYB 4PLIA 1XO2A 2FRYA 2LT1A 2CSIA 3OW2P 1OL2B 4J7IA 2NUZA 2L0AA 3OYAA 1D0ZA 2KY9A 1ABQA 2QG9B 3QHWB 1IGUA 1JXOA 4M7AE 5LJ3h 3G4ST 1AISB 2DL4A 4JRQA 3UA7A 2QQ9A 2DD4B 2RQRA 1VQMQ 4F6WB 1YJWT 3CCLT 1WYXA 1G3NC 3REBB 2BUDA 4OMPA 4RTWA 3VUBA 1M90U 3OS1A 4AFZC 4RKUE 5ACBA 2CP2A 3PVLA 2DA9A 4J9CA 3V7RA 1RAFB 5CKEA 5BNJB 2DVJA 1NPPA 1RUWA 1Q7YR 3I5RA 1X6OA 3E2UA 1VQ9Q 4AG2C 1YIJA 2KRMA 2NUPA 3N5BB 3JCMX 2JTEA 4RMOA 2GTJA 5I2MA 4HCBA 5LL6S 2LX9A 4MDWA 2LJ3A 4J6YA 5GAOq 2JXBA 3CC7A 2F69A 3CPWS 1WJSA 2CP5A 2F5KA 3CMAQ 4IUUA 4F7UG 2HMAA 2RQTA 3SB2A 3A8MB 3QPHA 4EMHA 4II5B 4M75A 2ZPHB 2YHTA 3CXCP 1KC8R 5CQYA 2DBKA 2D8HA 3DB3A 3D7SB 5HBEB 4DBHA 4ELYC 2KGTA 2RF0A 1I8FA 1AOJA 4QW2A 3CCET 2EYQA 3EGUA 3EG3A 4HVUA 4JX5A 2PTKA 2LDMA 1G8XA 2HBPA 4M77D 2WIPB 1NE8A 1OGUB 3TN8B 3VV0A 4KULA 4UC4A 4CFWB 1WHKA 1VYWB 1BI1A 1UJYA 1ZSZB 1M30A 1XNIA 4DOWA 4RTUA 2RHZA 1FINB 2UUEB 4HCCA 2FZCB 4N4GA 4F6UB 3VKIA 1QVPA 1E7OA 1BK2A 3OMGA 3CCJA 2FRWA 4MMKA 2OAUA 1ARKA 1RLQC 3CCRT 1S72T 2A36A 1UFFA 2JM9A 8ATCB 1G3WA 3A1PA 5IN1A 3EGXB 2DTHA 2C4GB 2P4RA 3U23A 4FU6A 1C0MA 3GNGA 3CC4Q 1X6GA 2ROTA 1LJOA 1ZA2B 4QSHA 1EX4A 1VQPT 4M77B 1BYMA 4PK4A 4OB0B 1H25B 1VQ4Q 4YOOA 1IZ6A 3HFOA 3LX7A 1URCB 3DDPB 2AZVA 2X4WA 2MF2A 1XOVA 3VRYA 1H26B 1M1KC 1R0BG 3R6OA 5GMKl 3TNHB 4AFUC 3I9QA 2V8JA 2JW4A 3SWNC 4N0AC 1YHQT 2O9VA 4BCQB 3OYEA 3CXCS 2NYSA 3I56A 1SSFA 4BCKB 4KRDB 2A3LA 1UEBA 1M5Q1 2HL5C 1M1FA 3G71A 4F70B 4Y91A 4BY6B 3OBYA 5IDPB 2G77A 3BW1A 1M1GA 3NGPA 3G6EQ 2A37A 3K7AM 3GF5A 3TVTA 3L2VA 1CKBA 1Q7YU 3M59A 5FU6B 2DXBA 4QVZA 2AT1B 1M9SA 2YRCA 3QWXX 2QQ8A 1K1ZA 3CCSQ 4N4IA 1Q81C 1YIJT 2PQWA 3JCMb 4VUBA 4ROEA 2EQIA 5GMKe 1TXQA 1SKUB 4N0AA 2KEAA 4ZTFA 5D6YA 1VQ8A 1QVFP 2JS2A 2D8JA 5FWBA 4MIMA 2AKLA 1YBYA 3VS2A 4EOPB 1VQ4T 3QXEB 4D8DA 1NG2A 1UB4A 4BB7A 3PIPA 4XQ3A 2LP5A 5FRNA 4Z88A 1Q7YC 1BI0A 4M7DD 3JB9F 1OKVB 1LNXA 4R55A 2O4XA 1TD6A 3HFNA 2FHDA 4PJOB 2WSCE 5GMKi 3FDRA 2JVVA 2LW4A 2YXYA 1QP2A 3OW2S 1MNEA 1SRMA 1M3CA 5CAIA 1IXDA 3S3MA 3OYHA 5KYNA 4E7JA 1B34B 3EFSA 1WI7A 3GOXA 4EONB 1W2BP 4M7AA 1YFNA 2QQSA 2ABLA 1M90C 3EGDB 1ZBJA 1K9MR 1SG5A 3RKXA 2GFAA 1EIFA 1KK7A 1PNJA 2LTOA 2QI2A 4XTYA 4EOMB 4JS5A 7AT1B 3I56Q 2WXVB 3MY1B 3OSSC 1CSKA 3MEVA 4J9IA 3C0CA 2SEMA 1ZA1B 1M4ZA 2KQWA 3M4GA 4LNPA 4ZN1A 2QGFB 1WHMA 3JCMV 1U1TA 1YITA 5LJ3f 5GMKh 2BZ8A 5FU6C 3G6EA 2VC8A 1UHFA 1AD5A 1KSWA 4OVAA 4AT1B 4J6WA 2HL3A 4DEXA 2FG0A 4HCZA 3HPWA 1B34A 2KROA 2JJ9A 5DQVA 5GAOm 4JRKA 2AKKA 4BCNB 4JZ3A 2DERA 2W99A 5LJ5e 4JLGA 4CC2A 4N4HA 1R77A 1O75A 1UGVA 1WZOA 3G4SQ 2CZ7B 1Y96B 1VQ7A 1Q81R 2L3PA 1YJNQ 4M75C 1VQ8Q 2R5AA 1C1AA 2EVRA 3CCUQ 1KQ2A 2BZYA 1OOTA 4J9EA 2O88A 2K2VA 2OJ2A 3G1JA 3FJPA 5KYXB 2MWPA 1Y7XA 5GAOl 1N4MA 5C0MA 4Z6YA 2KRSA 4JX6A 2ECZA 4JRIA 5GANj 4KT0E 1QLBA 1QCFA 2COWA 3I56T 1PHTA 4C5GA 4E7KA 1ZSZA 4L6V5 4OB1B 1BI3A 2EGEA 2HQHA 4BY7X 4RTTA 3MP1A 3MJXA 2J7IA 1UGQB 1ZQ1A 1JJ2A 2ZPEB 3QDRB 1ZHIA 1WPYA 3UPUA 2QEXA 2LMJA 4A4HA 2YSQA 1I4K1 2LZ6B 2V22B 1UHCA 4PJMA 2PHGA 3EG9A 1PG5B 3HTRA 4DEYA 2AIRB 2EYYA 1BIBA 3EFRA 3SEMA 1NBEB 1RABB 2K4YA 4GLMA 3BHUB 2C5OB 1RI0A 3M55A 3QSUA 1HYOA 2UZEB 1WXBA 4ATOA 2UZDB 3L1AA 5FWCA 2WJ9A 1N8RR 3TNIB 4J6XA 3H6ZA 2RH2A 2OTJQ 2DK3A 1KJWA 5LJ3d 2MK5A 2FPEA 3OS2A 1VQ5T 2K5IA 1QW1A 2DZCA 3M9QA 1VQLA 3FEOA 1PSEA 1M3BA 2LQ8A 2M0YA 1YJNA 4F16A 1OU8A 5GMKm 3JCMd 2DBMA 1FMKA 1SRLA 4C8QA 3GPLA 3CCRA 5CK9A 2E6ZA 3CC4T 2LCLA 1RAGB 3CD6T 4BY6C 2A7YA 3CC2T 1I5LA 2KR3A 1HJDA 2G9XB 2EJ9A 1NPRA 2NUTA 1WHLA 2KVQG 2VWFA 4KGVB 3MI9B 3EHRA 4QVDA 3FLGA 3CC2A 3PGGA 4MZTA 1TH7A 2OTLQ 2I53A 2EGAA 5GAMg 3HRTA 1OL1B 2BE9B 1D3BA 1W6XA 1YP5A 2CP3A 5IHKA 3CCLA 4J9FA 4M77C 1B7TA 4K11A 4BUGA 4KGZB 3OYCA 2XI9A 3PVQA 4AFQC 5KE2A 4OMNA 2J05A 1VQ4A 5IXFA 1TS9A 2PUOB 1H4LD 2WMAB 4EMGA 2YLBA 2E1HA 2BS4A 4RG8A 4MDXA 4OF1A 5CVIA 3LWIA 4JJNK 2VGMA 1FKMA 3MEUA 4BI8B 1MMAA 1VQNT 2IVWA 4ZGDB 3M0SA 2QYZA 1D09B 1TUCA 4E7ZA 1U1SA 2VXEA 3EFOA 1M2VA 2EBPA 2VYTA 3CCQQ 3JB9I 2QGSA 4PFOA 4EOJB 4FT2A 3PT9A 2P4TA 1OV3A 4PJJA 4CFXB 2XKOC 3F5XB 1PWTA 3VJPA 1FVVB 2UZLB 4AKGA 4C0DB 2OAWA 1OPKA 1G3YA 2WSFE 3OYIA 2QFZA 2DMOA 1P5EB 4IIOA 1YJ9A 2EYXA 2K3XA 1R8OB 1SEMA 1OZ2A 2XK0A 2LC4A 2F2CA 3OYJA 4GY5A 2E65A 4ZGEB 1YJ9T 3CCQA 4EDUA 1JJ2P 4M78B 4RTXA 3MO8A 3PMTA 2JN0A 4TVRA 2M9UA 4WCIA 1WGSA 4EOSB 3QO3A 2E12A 1VA7A 1ENWA 3HO8A 3M54A 4XU0A 1U06A 2F2WA 3ZBDA 3CCVQ 3URGA 1Q86U 2CDTA 2OTLA 2E5QA 3M0RA 3VS7A 5GAN3 4CFUD 2EJFA 1GCPA 1UGPB 4M78A 2JUFA 2J06A 5I2SA 1E6HA 1FWZA 4PFZA 3O0GD 1K9AA 4B9XA 3VS3A 2VB6A 4PNOA 1WA7A 5KYWA 5J3BA 1X2KA 2V8IA 5D7UA 2DRKA 5GANf 3MHXA 3CCJQ 1K0XA 4PLLA 1PM3A 3UWNA 1G3SA 1YITT 2K5LA 1H3HA 3DLMA 1T3LA 3OQ5A 4E47A 3QYGB 1OX8A 1LPLA 4BE2A 4J9DA 4BD3A 2E41A 3HP9A 4EOKB 1YHQQ 3TCJA 5IXBA 2LRQA 3CEYA 2FZKB 3A8OB 1M27C 4ESRA 1KIKA 1AD6A 5KYYA 3HRUA 4BBSM 2JGZB 4LN2A 3PNWC 1NJIR 3QYHB 1VQPA 1W2BA 5FU7B 4IMYB 3GTMS 1JBMA 5GMKj 1J3TA 3HZJA 1GCQA 1VINA 4NL3A 5KYYB 1S72A 4J8OA 2E64A 2JNGA 4LE9A 3GIBA 1YWPA 1Z9QA 2EW3A 3HRSA 4PJOE 2DL5A 1KQSS 5FW9A 2EIFA 4OB2B 4C5HA 3CCJT 4XTVA 3DB4A 3S3OA 4FX3B 4XU1A 1FXXA 2DEUA 4NC6A 4BCND 3VKGA 1OQKA 2C0TA 2FVUA 1K73C 2HQXA 4RTZA 4DBFA 5GAOr 5FLXE 4C0DC 4J9BA 2CCIB 4FW1A 4ELJA 2P0QA 3EH2A 2DE0X 2L3SA 4CRIA 1Y57A 1WJRA 3QYBA 2FEIA 5GAN5 1VQ5Q 4II1A 1OI9B 2OTJT 1VQ8T 4JS4A 2LNHB 4QQGA 1K9MU 5GJVB 4XTZA 3RMSA 3S6WA 2OI3A 1TG0A 1CKAA 3BDUA 4FM4B 1NYFA 3H4CA 1QKXA 4F6SB 1BKBA 2M16A 5LQFB 3GNFB 2DFUA 2XDPA 2GQVA 2KRNA 2RQUA 1UDLA 3OYLA 1OYXA 1VIFA 3J80E 2K3BA 4C0ZA 4LDVA 1S72Q 1X75C 4M75D 5KYXA 1GFDA 3REAB 4EORB 2K9GA 4A53A 4BE0A 3ER0A 1TFBA 2DKGA 1KD1U 3OMCA 5LJ5h 3C12A 1D1CA 1VQNQ 3QIIA 1VQLQ 3EG1A 2EQKA 2RNAA 1BIAA 5CIUA 4HVWA 2XG8D 2X4JA 3O8VA 5L23A 3QG1A 2EGCA 1UG1A 1N8RC 3KXTA 5GAN2 1AWJA 4Y92A 3NTIA 1TTHB 4RCCA 2MWOA 4AG1C 2DVEA 1RAAB 1GRIA 1H1RB 1Y71A 5HBHB 4M77F 1VQ5A 2NWMA 2L3QA 2CYZB 1B07A 4M75G 2X1NB 3H9NA 4R56A 1E6GA 4L59A 5I22A 3A8HB 4BI4A 1ZLMA 3VU3C 4F04B 2ZGWA 5DM7R 2RJFA 4RG2A 3CC4A 3OYBA 4BE1A 4C5IA 1PKTA 1W98B 2IW9B 3PO3S 2C06A 1RAEB 2R5MA 2D1XA 5DLOA 1E7PA 3A5ZB 1U5SA 3CD6Q 2QDJA 4BY1X 3PIOA 1AWWA 2LQNA 3ZFJA 4NSTB 2YRDA 1H1PB 3CBPA 4A63B 1VQKQ 2PVOB 3WXMB 1I5OB 4M7AG 3RNJA 5KYUA 1YIJQ 2VUBA 3OYMA 4CC3A 4JZ4A 1BU2A 2CS7A 1UNLD 3VYGA 2L5QA 3A8LB 2B86A 4JJCA 3ME9A 3OYDA 5IT9E 4BCIB 2CUDA 2QTVA 2YUQA 1WHGA 3G71Q 4F14A 2FL7A 4BACA 4E6RA 3L2UA 3BE3A 3QUIA 2CH4A 1Y96A 2JMCA 4F17A 2QTXA 3CD6A 4M7AB 2RQWA 3RUXA 1M1KU 1QVFA 2QQBA 3I35A 2DL8A 2DIGA 2QEXT 4L5GA 1I81A 1LCKA 4FYXB 3Q1JA 3H8ZA 1ABOA 1NM7A 4OGCA 1JEGA 2EJGA 2QQRA 1D3UB 3LWHA 4PJNA 1YHQA 2RM4A 2DNUA 1GL5A 4JRPA 5CKDA 4FYWB 3CCMQ 4E7IA 4RTVA 4PJOF 3BHVB 1MNDA 5IAYA 1UUEA 5ECAA 1N9SA 1NJIU 1WLPB 4FCYA 3JCMP 3X26B 3H0FA 1X27A 1EFNA 1QVGS 2OX7A 4DOVA 2DMEA 3JSCA 2LCSA 4MFEA 5GAMh 3RIRA 4KGXB 5I11A 4J7FA 2GCXA 2K79A 4KUDK 1KQSP 1YITQ 2RHYA 1H27B 2J6FA 2W9ZA 1PD0A 3X20B 3VYGB 1FX7A 2R57A 4PJOD 5GAMe 6AT1B 4V2SA 4Y72B 1JXMA 1VYUA 2M1HA 1B3QA 1WQWA 4M7DG 1BI2A 2RHIA 2HAXA 1PKDB 1TWBA 1U3OA 2FYKA 2RQVA 4PJOA 3RKWA 3CPWA 4M7DA 4BDZA 1W2BS 5A2QE 2LJ1A 2G6FX 3BDLA 4JJDA 2C0IA 4PJOG 3V8LA 1BCMA 3BY7A 2RI5A 2L8DA 3HHTB 3DKMA 1WHHA 2R7GA 3P8BB 1QQJA 4MZPA 2M51A 1VQMA 1KD1C 4PL6A 2YUOA 2G3RA 4JLIA 4GLKA 3QHSA 4QT7A 1VQ6A 4M4ZA 4FT4A 1NJIC 3I55Q 3M56A 2HSPA 1BBZA 3KFVA 2MPXC 2XIDA 5IHYA 2F2XA 3TQ7P 1VQPQ 2HKNA 4LDXA 2DETA 5D6XA 3HBLA 2X35A 2KK4A 1KXUA 2RO0A 3MY5B 3OYYA 1VQ6T 1ACMB 1ZSGA 2RHXA 1JU5C 1XQHA 1QCNA 1K8AR 4ZNXA 3AHUA 4MMLA 1W70A 2ZPGB 2DXTA 3CCMA 3I5SA 4NL2A 4FW2A 1QWEA 1VQ6Q 1K4US 3JCMQ 2YDLA 2HDAA 3CMET 2H3EB 2ED0A 5LJ5j 2DYIA 4F7UA 4G6LB 5IHIA 4EOQB 5A0GA 1C9BA 2QDLA 4BCHB 4FSSA 1LOJA 3QDFA 4HNUA 2KMTA 1H28B 4HCKA 3QZ5B 5LJ3g 3KHIA 2AK5A 2COYA 2LX7A 4KH1B 3MKDA 3NMZC 4A4EA 1GUXA 2BZXA 4BCMB 1AEYA 2KAFA 1WQ7A 1C6VX 2X3WD 1VQOT 5FU7C 2DM1A 1RACB 3O5ZA 4OGEA 2PK9B 2ESWA 5CR2A 1HD3A 3FC3A 3CPWP 1GFCA 3OB9A 3P8HA 4RTYA 3SD4A 2GFUA 2PVGB 1KHIA 1H1SB 3R6NA 5HVYB 4M75E 4WF2A 5GJWB 2GTOA 1XJWB 4KRCB 3MCAB 4LDYA 1D0XA 1UNGD 2KNBB 1M8VA 4OMLA 3RERA 5GAMf 1KC8U 2D6FA 1AHJB 5GAN6 3X28B 1WIEA 3CMAA 3EG0A 3M58A 3FRNA 3KUFA 5L2WB 4M78E 3ULRB 2CP6A 2D0NA 4CRLB 2RI3A 2X51A 3OS5A 4BCFB 5FGKB 2UZBB 3J81E 3BFMA 3JCMW 4AKIA 1MHNA 3THKA 3G7ZA 1QVGA 1JOWA 3SFMA 2HBWA 1Q86R 3DJBA 1F1BB 3ZL7C 4C8QE 4E7LA 4OR5B 4A4FA 3P8DA 2RHUA 1N8RU 2O4XB 5KCHA 4EMKA 5KH6A 2DILA 3WVDB 2IN3A 1NYGA 4C5EA 1Q82C 4F7JB 2XDDA 2DZ9A 3VS0A 5DQWA 1UGSB 1EZZB 4C0GA 4C92A 4ZGJB 2EQJA 2LVMA 3KBGA 4HXJA 4C92C 5KYUB 1ZUYA 2QA4T 5GANg 3G6ET 2K2MA 4ELLA 4M78G 2VXFA 4E2FB 1K0SA 3JAME 1VQKA 3EHQA 3BHTB 4ME7A 2KBTA 4C92G 4C8QF 2XU8A 4EMKC 4EC9B 2C5NB 3QHRB 1ZUUA 1GH6B 1TOVA 2QQAA 3V7SA 2RD1A 2DEQA 1LVKA 1O9KA 4ROCA 1GXIE 2ATCB 1X43A 2LQWA 3SWNB 2D0QB 4HT9A 2IW6B 4RCBA 3LQ5B 5FRMA 5CQXA 1KQSA 1WDXA 4EIKA 1JSTB 3J7AF 2JT4A 4BBRM 1NEBA 5KYWB 4PFPA 1BCOA 1TU0B 3M0QA 4IURA 3BG3A 1SPKA 3CCUA 2QK0A 2YT6A 2DTOA 4Z89A 2FPFA 4QQ6A 2EPDA 4X34A 2COZA 3M0TA 4JDSA 4M78F 2RA2A 1O9SA 2C5VB 4NOYA 3WVEB 3OSVA 3QJYA 5HCKA 2DL3A 2C6TB 1JJ2S 1MMNA 1JO8A 4M77E 4Q5WA 1MMGA 2KSSA 1YI2Q 3TSZA 1V29B 4OP0A 4D6WA 3UATA 4C8QB 8AT1B 3CCQT 2ZCFB 3LH0A 2GBQA 1K73U 4BXXX 2DAQA 4R0KA 3L2RA 1N9RA 5CEIB 5LMKB 3INZA 3M4YA 1VOMA 1SSHA 3L2QA 1VUBA 2H3JA 5CKHA 3VS5A 3CXCA 2X9HA 1VQOQ 2MI6A 3HB9A 3CBMA 5M9OA 3JCMe 2CSQA 3TW7A 3E19A 1AWXA 4YC3B 4P5NA 3EOCB 4KRTA 4JX4A 2BKZB 5IHNA 2JM8A 3LGFA 2EQUA 5A0DA 2OTJA 1JQQA 2E3HA 4IUPA 5GAMd 3QWLA 3EJ1B 3EIDB 1GY3B 3TW6A 2M02A 3CPFA 2CZ0B 2BTTA 4JJBA 5D6WA 3OYKA 3UA6A 2CP0A 1FMVA 1RAIB 2NLUA 3LLRA 3FJ5A 4X9DA 1X2QA 4B9WA 5CO7A 2RI2A 2PU9B 1IHWA 4M75F 5GANh 2JMAA 4LUEA 4OMQA 3NTHA 3EGDA 4OMOA 5GANd 2KYMA 5J39A 2KYBA 2O2OA 2VGNA 3MP6A 2XD0A 3NDQA 3CC2Q 1PRMC 3L42A 4J83A 2BIVA 4C8QD 1IO6A 3QZ9B 4M7DE 3CC7Q 1M8MA 4FYVB 1K76A 2O31A 1RADB 3SDZA 1G5VA 5IDNB 2JOYA 3CCMT 1TUGB 3IQLA 1R0CB 1NLOC 2O9SA 2WSEE 3QBYA 1Q86C 2J6KA 2EUFA 2O01E 1YI2T 2FZGB 2HEQA 1PKSA 1YJWA 3MP8A 5HNBB 2DJQA 1FYNA 4CFVB 1YN8A 2EWNA 2DJZA 3EGXA 5KCOA 2CP7A 2KT1A 2CCHB 3PFSA 2HKQB 3VUZA 2CGHA 4M7DC 3RMQA 2DD5B 3GLXA 3JCMg 3TREA 1PRLC 1YWOA 2F2VA 3OA6A 2CJMB 4PJOC 1Q82R 1OKWB 4BCOB 5AYFA 4M75B 1GBQA 1VQOA 1ZBXA 4LXCA 3BG9A 4C92F 4C8QG 2B9RA 2KMGA 2W0ZA 1V1CA 2MCNA 2IVXA 3DOGB 3V8KA 2CZ1B 1OU9A 2MMPA 3GBQA 1JRIA 4ANJA 4HA8A 2MAMA 1OX9A 1GBRA 2PK2A 1GUXB 4MFDA 2H8HA 1BU1A 2WMBB 1H1QB 2HSEB 2EKOA 3MPUB 1O9KB 2K6DA 3UT1A 3JCMh 2LNVA 2LQKA 5GAOn 3JCMc 5HQ0B 2CT4A 2YRVA 1S1NA 3NHNA 2VASA 2PVDB 4FIBA 3CCST 2KR6A 1M2OA 3UF4A 3CCVA 2QXFA 1PD1A 2VKNA 3S3NA 4XAXB 4CC7A 2EYWA 5EJCA 4IUQA 2YLCA 2MYSA 3LH5A 3CCRQ 4LDUA 2XDBA 2J6OA 1N5ZA 2RK1A 1F5QB 4TTHA 4M78C 1VQ9A 5DLQE 4C92B 1X01A 2W9FA 4BCMD 4JPBW 2DXCA 2JZ2A 3X24B 2XHCA 4KUIA 5C6SA 2JTFA 4C92E 4BCQD 2I40B 1H8KA 2HZYA 4EMKB 1IREB 3RESA 1DJ7B 1KC8C 3H41A 4Z02A 1OPLA 2M0OA 1AZEA 3OYNA 4HNTA 4CFNB 1H3ZA 1OZ3A 3CC7T 1WNLA 3SHWA 4RODA 2D9TA 1QWFA 2K57A 2DLPA 2MOXA 3CCEQ 5GAN4 5CYIB 2DX1A 5GAN8 2GF7A 2DXUA 2QA4A 1G2BA 2A0FB 1NLPC 3LGLA 2CKKA 2XMFA 3H0HA 3HL8A 1QP3A 3C4SA 1U8RA 3OS0A 4O6JA 4M7AD 4LD9K 5DY9A 3E9GA 3EAEA 4A4KA 4CI0C 4AMCA 4ELZC 1OULA 3RGFB 4OGRB 2BPMB 4E7SA 2CZ6B 2Y90A 1QMCA 1D3BB 1PCXA 4UN0A 4NS5A 1SF9A 1UE9A 2IW8B 2ED1A 1YCSB 5ICPB 2EQMA 3UDCA 2KXDA 1P92A 1KQ1A 2RPNA 1OIYB 2L89A 2KDSA 1UNHD 5AT1B 4OMMA 3POMA 2L3RA 1Q81U 1HXDA 2L2PA 4M7AF 2CUBA 2YUNA 1YJ9Q 3T9NA 2P0PA 4B6MA 2PZ1A 2Y4YA 4F7UF 1AVZC 2V1QA 2MIOA 1N6AA 1D1BA 5LJ3j 3CMEQ 2GGRA 4QKUA 5I21A 2Y4XA 2A08A 1Q82U 4OMFB 1MGQA 1QCOA 2W10A 1KG1A 1OEBA 4QQDA 2ZZDB 1E9HB 3HSBA 4RUGA 3FB9A 5HK3A 5CKBA 4FL6A 4D8KA 4KBMB 2Z0WA 3LW5E 2E70A 4IUTA 4BCGB 2QDYB 2SRCA 3M0UA 3H0IA 2A28A 2CT3A 2V8KA 1JSUB 1NZ9A 2EKHA 1YNZA 3G4SA 4F7UE 2DYBA 3QJ6A 4GBQA 1VQ7Q 4PJLA 4C8QC 1A0NB 1Y0MA 1M1KR 2R58A 1M90R 5HBJB 1X69A 1G3TA 1MUZA 3JB9H 3RR6A 5KE3A 2W96A 1OIUB 2DD4A 5J26A 2QF7A 2HCKA 2CREA 4BDYA 3OW2A 2BE7D 2PMIB 1KFZA 3PTAA 4F7UB 2PUKB 3DLLA 2IG0A 5GANe 2PJQA 2IIMA 2X3XD 2DL7A 2P84A 4IUVA 3MIAB 3EG9B 3EG2A 2P0KA 3VRZA 5CKFA 4QVCA 1ZP2A 1VYVA 3AT1B 4CFUB 1W4SA 2EAYA 3C94A 2DTIA 1WXTA 2X4XA 3V7CA 5EG2A 1TSFA 3RKYA 1RI9A 4IKFA 1PC0A 1QLYA 3E9FA 1NEGA 3OY9A 3CMEA 1QVGP 4XU3A 2ROLA 2DO3A 1ZSZC 1M2VB 4HKEA 1SHFA 1QKWA 2DF6A 2JS0A 1I0CA 2NUPB 1GCQC 4LUDA 3M03A 1VQKT 4J9GA 3DL1A 3TNWB 1KD1R 1RLPC 5HY6A 3NFCA 5LJ5d 4M77G 3VYHB 1IHVA 4MZMA 4E7HA 3OYFA 1N27A 5HKCA 1UGRB 4J5YA 2GNCA 2I0NA 2E5KA 1KHCA 1MMDA 1T3SA 1Y07A 3TU4K 1YJNT 3EH1A 3FIFA 5GAOp 1MV3A 9ATCB 2FO0A 1PSFA 2LT4A 4XTXA 2DXBB 4CXAB 3JB9J 1HK9A 4AKHA 1WX6A 4J9HA 1WJQA 2ZAEA 1D1AA 5IF1B 1W1FA 1ZUKA 4AFSC 1IGQA 2QASA 4EPCA 5LJ5g 1T0JA 3MEWA 4DA4A 3ASKA 1Z9ZA 3QYEA 3META 5LJ5f 3CQTA 3HKSA 3QWYA 2QAZA 5FROA 2RJDA 2E4HA 4ZN3A 2DRMA 4CFMB 2JTMA 4HVVA 3V8JA 1WXUA 1VYTA 4LDWA 4PKCC 2CH4W 4HLQA 3TSWA 3ZEHA 3X25B 4BI3A 1V76A 2LJ0A 4DQ2A 3DTOA 4HT8A 4FSXA 2K3YA 4EOLB 1I07A 4CC4B 3CMAT 2WIHB 3M5AA 4XTWA 4F7NB 5EFQB 1IRXA 1YI2A 2C5XB 3JV3A 5LJ3e 2KXCA 2AZSA 3CCSA 4YOZA 3JCMf 1VQLT 3F70A 3GP8A 3OYGA 3CCVT 1TUDA 4OB3B 2RB6A 2C0OA 3TEEA 1JB0E 2WHBB 1HSQA 4EOOB 4DBQA 2KE9A 4M7DB 3B57A 1RAHB 1WHJA 4M7AC 2FB7A 1AWOA 3CCUT 2EFIA 3L2ZA 2FPDA 2ZPBB 2WEVB 4Y28E 1OI1A 2EYZA 1I1JA 2RJEA 4LD6A 5EC7A 1VQNA 4X9CA 2E3IA 2W2HA 1UTIA 3NTKA 4M6VA 2DPPB 4WTOB 1MV0B 1UECA 2HNIA 5GAN7 2ENMA 2IPOB 1BB9A 3VKHA 1WFWA 4XTUA 4KH0B 3CCLQ 3VS4A 4I3ZB 2DD5A 4AI6A 1SHGA 2DIQA 5GAMj 1VQMT 1K8AU 2OTLT 1H24B 3RBBB 2WPAB 2ZZDA 3BLHB 2DXCB 3BLRB 4A4GA 4IIMA 3JB9G 2GQIA 1X6BA 1H641 2KT8A 1VIEA 2YWWA 4DBRA 2RN8A 2PNIA 3CCEA 1JKWA 2RJCA 4JUVA 1UJ0A 4ORZA 2K5FA 3G33B 2V1RA 4M78D 4F7LB 1XTDA 2ZPFB 3RDVA 1G83A 2WFYB 3I55T 4A54A 5CCAA 3JB9D 4M7DF 1YCYA 1Q95G 3PE0A 2YUPA 4EOIB 3VS6A 3M53A 2VV5A 3JRZA 4YTLA 2BS2A 2E10A 3A8GB 1K8AC 1VQ9T 3DDQB 4HL4A 4LOCA 2AHJB 3PMIA 3I55A 1AZGB 1FMWA 1M3AA 4YOSA 2QA4Q 2B8AA 2F5TX 1VOLA 2V26A 3LYIA 3C95A 2WACA 2QEXQ 1H92A 1K9MC 4M77A 2BKDN 1K73R 3EFOB 4Z8AA 3JCMJ 1QMZB 5I5ZB 1IB8A 2NUTB 3BG5A 1ZX6A 4C0FA 3QKJA 2F1LA 3E1SA 1YJWQ 4BCPB 2LCCA 2HD0A 3SWNA 1QVFS 3BLQB 5A0LA 5HK0A 3G71T 2K7AA 2E6NA 3L2WA 2ZPIB 5L8RE 2I2LA 3NPFA 2XICA 2BS3A 4BCJB 4X1VA 4ZTJA 4C92D 3A98A 3M0PA 3MEAA 1RL2A 5IH2A 2QGGA 3CBOA 2RMOA 4O5VA 4HNVA 1D0YA 1AT1B 2HQEA 2VVKA 2KI7A 3M57A 4XU2A 1T0HA 3VS1A 2X4YA 4XK8E 2RK2A 4EC8B 4F7SB 1VQ7T 3OBWA
chains in the Genus database with same CATH topology
4BY6C 2A7YA 4PLIA 3CC2T 1I5LA 2LT1A 2PVDB 4FIBA 4J7FA 3CCST 2GCXA 4KUDK 2EJ9A 1NPRA 2KR6A 4J7IA 2RHYA 3CCVA 2KVQG 3OYAA 2KY9A 3X20B 3VYGB 1FX7A 2R57A 2QXFA 5GAMe 4PJOD 4V2SA 2M1HA 4QVDA 3S3NA 3FLGA 4XAXB 3CC2A 1WQWA 3PGGA 4M7AE 4MZTA 5LJ3h 3G4ST 4M7DG 5EJCA 4IUQA 2YLCA 1BI2A 2RHIA 2HAXA 1TH7A 4JRQA 2QQ9A 2DD4B 4LDUA 2FYKA 1YJWT 3CCLT 5GAMg 2XDBA 4PJOA 3RKWA 2RK1A 2BUDA 3HRTA 3VUBA 1M90U 3CPWA 4M78C 4M7DA 3OS1A 4BDZA 1D3BA 4RKUE 1W2BS 1VQ9A 5A2QE 3CCLA 5DLQE 4C92B 1X01A 3BDLA 4M77C 4PJOG 3V8LA 2DXCA 3V7RA 4BUGA 3BY7A 3OYCA 2JZ2A 3X24B 2XI9A 2RI5A 5CKEA 1NPPA 2XHCA 4KUIA 2L8DA 5C6SA 2JTFA 3HHTB 3DKMA 4C92E 3P8BB 5KE2A 1X6OA 4MZPA 4EMKB 1VQ4A 1IREB 3RESA 2PUOB 1VQMA 1YIJA 1KD1C 4PL6A 1DJ7B 1KC8C 3N5BB 4Z02A 3JCMX 4EMGA 2G3RA 2M0OA 2E1HA 2YLBA 4JLIA 4RMOA 2BS4A 4GLKA 3QHSA 4HNTA 5I2MA 3OYNA 4RG8A 5LL6S 4HCBA 1OZ3A 1VQ6A 4MDXA 1H3ZA 4OF1A 5CVIA 4FT4A 1NJIC 3LWIA 2LX9A 4MDWA 1WNLA 4JJNK 3CC7T 2VGMA 3M56A 4J6YA 1FKMA 3MEUA 4BI8B 2XIDA 2D9TA 1VQNT 5GAOq 2IVWA 2K57A 4ZGDB 4LDXA 5GAN4 5D6XA 3HBLA 3CC7A 2X35A 2F69A 2KK4A 1WJSA 3CPWS 5GAN8 2RO0A 2GF7A 3OYYA 1U1SA 2F5KA 2VXEA 2DXUA 1VQ6T 2QA4A 2RHXA 2VYTA 4IUUA 1XQHA 3JB9I 3LGLA 2CKKA 4F7UG 3HL8A 1QP3A 3C4SA 3PT9A 4FT2A 4MMLA 4O6JA 2P4TA 3OS0A 1U8RA 3AHUA 4M7AD 3SB2A 3A8MB 3QPHA 2ZPGB 2DXTA 4LD9K 2XKOC 5DY9A 3E9GA 4M75A 4EMHA 2ZPHB 2YHTA 3VJPA 3EAEA 4A4KA 3CCMA 4CI0C 4ELZC 5CQYA 4AKGA 4NL2A 4C0DB 1G3YA 2WSFE 3DB3A 3OYIA 2CZ6B 2Y90A 2QFZA 4ELYC 3JCMQ 3CMET 1D3BB 1YJ9A 5LJ5j 1I8FA 4NS5A 4QW2A 4F7UA 2K3XA 2EYQA 1R8OB 3CCET 5A0GA 1VQ7T 1OZ2A 2XK0A 4JX5A 2LDMA 2LC4A 2HBPA 1LOJA 4M77D 4HNUA 2EQMA 2KMTA 1NE8A 3OYJA 3UDCA 4GY5A 1P92A 1KQ1A 2E65A 4ZGEB 1YJ9T 2L89A 2KDSA 3QZ5B 3VV0A 4KULA 4M78B 4UC4A 3MO8A 3PMTA 3KHIA 2JN0A 5LJ3g 4TVRA 2M9UA 1WGSA 1BI1A 3QO3A 2E12A 2L3RA 1XNIA 4DOWA 1HXDA 1Q81U 3HO8A 4M7AF 3M54A 4A4EA 2RHZA 3T9NA 2KAFA 2P0PA 4XU0A 1WQ7A 4HCCA 4N4GA 3ZBDA 1Q86U 3URGA 1VQOT 2Y4YA 4F7UF 5FU7C 2OTLA 2E5QA 5GAN3 1N6AA 2EJFA 1UGPB 4M78A 4OGEA 3VKIA 2JUFA 1QVPA 5I2SA 1FWZA 5CR2A 5LJ3j 3OMGA 3FC3A 3CCJA 4MMKA 2OAUA 4B9XA 5I21A 3CCRT 3OB9A 4PNOA 2Y4XA 1Q82U 1S72T 3P8HA 1MGQA 4OMFB 5J3BA 3SD4A 1KG1A 2GFUA 4QQDA 2V8IA 2ZZDB 2PVGB 1KHIA 5GANf 3HSBA 3MHXA 3FB9A 5HK3A 1G3WA 5CKBA 4FL6A 4M75E 4KBMB 4WF2A 3LW5E 5IN1A 2E70A 4PLLA 4IUTA 2QDYB 3MCAB 2DTHA 1G3SA 4LDYA 3UWNA 1YITT 2K5LA 3DLMA 1M8VA 2V8KA 3RERA 1NZ9A 5GAMf 1KC8U 3G4SA 2D6FA 3OQ5A 1AHJB 4FU6A 3QYGB 4E47A 4F7UE 5GAN6 3X28B 3QJ6A 3GNGA 4BE2A 4C8QC 1LJOA 3CMAA 4QSHA 3M58A 3FRNA 2R58A 2E41A 3HP9A 3KUFA 4BD3A 1VQPT 4M78E 1G3TA 4M77B 1BYMA 2RI3A 3TCJA 3JB9H 4OB0B 5KE3A 3OS5A 1IZ6A 2LRQA 3CEYA 3HFOA 3LX7A 3J81E 3A8OB 2X4WA 2MF2A 1XOVA 3BFMA 3JCMW 5J26A 2DD4A 4AKIA 2QF7A 4BDYA 1MHNA 3OW2A 1M1KC 3R6OA 5GMKl 3HRUA 4BBSM 3G7ZA 1QVGA 3PNWC 3PTAA 2V8JA 4F7UB 2PUKB 3QYHB 3DLLA 1VQPA 3SFMA 1W2BA 2IG0A 3SWNC 4N0AC 5GANe 3JB9G 5FU7B 1YHQT 3OYEA 3CXCS 3I56A 4IUVA 1JBMA 5GMKj 4C8QE 1SSFA 4E7LA 2A3LA 3HZJA 4A4FA 2P0KA 1UEBA 3P8DA 2RHUA 1N8RU 5CKFA 2O4XB 1M5Q1 4QVCA 4NL3A 5KCHA 4EMKA 5KH6A 1S72A 4J8OA 1M1FA 2E64A 3G71A 2JNGA 4Y91A 3GIBA 1W4SA 2EAYA 3C94A 2DTIA 4BY6B 3OBYA 3WVDB 2G77A 4PJOE 3BW1A 3HRSA 1M1GA 2X4XA 4C5EA 1KQSS 1Q82C 2EIFA 4OB2B 4C5HA 3CCJT 2XDDA 4XTVA 3DB4A 3V7CA 5EG2A 2DZ9A 3GF5A 1UGSB 3S3OA 3RKYA 4C0GA 4C92A 4ZGJB 2EQJA 1FXXA 2LVMA 3KBGA 4XU1A 4C92C 3L2VA 2QA4T 4IKFA 4NC6A 5GANg 3G6ET 3E9FA 3VKGA 4M78G 3OY9A 3CMEA 2FVUA 2VXFA 3M59A 1Q7YU 1K73C 5FU6B 2DXBA 4QVZA 1M9SA 4XU3A 3JAME 1VQKA 2QQ8A 2HQXA 2DO3A 4ME7A 4N4IA 5FLXE 5GAOr 4C92G 4C8QF 1Q81C 2XU8A 4EMKC 1YIJT 4C0DC 2PQWA 3JCMb 3V7SA 4HKEA 2QQAA 2RD1A 2DEQA 1VQKT 4ELJA 2P0QA 4VUBA 1GXIE 3DL1A 3SWNB 5GMKe 2D0QB 5HY6A 4CRIA 4HT9A 3NFCA 4N0AA 5LJ5d 4M77G 4RCBA 3VYHB 1WJRA 3QYBA 4MZMA 5FRMA 4ZTFA 5D6YA 1VQ8A 5CQXA 1KQSA 5GAN5 4E7HA 4II1A 3J7AF 3OYFA 1N27A 4BBRM 5HKCA 1UGRB 4J5YA 1KHCA 3TU4K 1Y07A 2OTJT 4IURA 1VQ8T 4JS4A 4MIMA 1YJNT 4QQGA 3BG3A 1YBYA 1VQ4T 3QXEB 3FIFA 5GAOp 3CCUA 1K9MU 1UB4A 4BB7A 3PIPA 1PSFA 2LT4A 4XTZA 4XQ3A 1VQ7A 4XTXA 3RMSA 3S6WA 5FRNA 2DXBB 3JB9J 1Q7YC 2DTOA 1BI0A 4M7DD 3JB9F 1HK9A 4AKHA 1LNXA 4R55A 2O4XA 2FHDA 3HFNA 1WJQA 3BDUA 2WSCE 4QQ6A 4FM4B 3FDRA 4EPCA 5GMKi 4PJOB 4X34A 3H4CA 2JVVA 4JDSA 5LJ5g 1BKBA 4M78F 2RA2A 2M16A 3MEWA 1O9SA 4DA4A 1QP2A 3ASKA 3OW2S 3GNFB 4NOYA 3QYEA 3WVEB 3OSVA 3META 3QJYA 5CAIA 3HKSA 2XDPA 5LJ5f 5FROA 2GQVA 2RJDA 1JJ2S 4ZN3A 3S3MA 3OYHA 2JTMA 4M77E 4Q5WA 4E7JA 3V8JA 1B34B 3EFSA 2KSSA 3OYLA 4LDWA 4PKCC 1OYXA 4HLQA 1VIFA 1V29B 3GOXA 3ZEHA 4HT8A 3X25B 4BI3A 4OP0A 4D6WA 4DQ2A 4M7AA 3J80E 4C0ZA 4FSXA 2QQSA 4LDVA 1X75C 4C8QB 4M75D 3CCQT 1M90C 2ZCFB 3LH0A 2K3YA 1K73U 2DAQA 3L2RA 3CMAT 4A53A 1N9RA 3RKXA 4BE0A 2GFAA 3M5AA 4XTWA 1EIFA 2LTOA 3ER0A 2QI2A 3INZA 3M4YA 2DKGA 4XTYA 1KD1U 3OMCA 4JS5A 5LJ5h 1YI2A 3C12A 5LJ3e 3OSSC 3L2QA 1VUBA 3MEVA 3CCSA 3QIIA 2H3JA 3JCMf 1VQLT 5CKHA 3F70A 2EQKA 3CXCA 3OYGA 3GP8A 1M4ZA 1BIAA 2KQWA 3M4GA 5CIUA 2MI6A 3CCVT 4ZN1A 2XG8D 4OB3B 2X4JA 2RB6A 3O8VA 3QG1A 3HB9A 1JB0E 3CBMA 3TEEA 3JCMV 1U1TA 5M9OA 1N8RC 3JCMe 3TW7A 1YITA 3E19A 3KXTA 5GAN2 4M7DB 5LJ3f 5GMKh 5FU6C 3G6EA 2VC8A 4M7AC 2FB7A 4P5NA 3NTIA 4OVAA 3CCUT 2EFIA 3L2ZA 4RCCA 4JX4A 2MWOA 2ZPBB 2DVEA 4J6WA 1OI1A 4Y28E 3LGFA 2EQUA 2RJEA 1Y71A 4HCZA 4LD6A 4X9CA 5A0DA 1VQNA 3HPWA 1B34A 3NTKA 4M6VA 2DPPB 4IUPA 5GAMd 3CC4A 2HNIA 3QWLA 4M77F 5GAN7 5GAOm 1VQ5A 3TW6A 2CYZB 4JRKA 3CPFA 4M75G 2CZ0B 3VKHA 5D6WA 3OYKA 4XTUA 2OTJA 4R56A 5LJ5e 2DD5A 4AI6A 2DIQA 5GAMj 4L59A 1VQMT 4JLGA 1K8AU 2OTLT 3A8HB 4BI4A 2NLUA 4N4HA 1O75A 3LLRA 4X9DA 3VU3C 2ZZDA 2ZGWA 5DM7R 4B9WA 2DXCB 5CO7A 2RI2A 2CZ7B 2PU9B 1Y96B 2RJFA 4RG2A 4M75F 4A4GA 3OYBA 1H641 4M75C 5GANh 4C5IA 4BE1A 1VIEA 2R5AA 3NTHA 2C06A 1KQ2A 5GANd 5J39A 2R5MA 2K2VA 5DLOA 1E7PA 3FJPA 2VGNA 3MP6A 3CCEA 2RJCA 2XD0A 3A5ZB 4JUVA 2MWPA 1Y7XA 5GAOl 3L42A 5C0MA 4Z6YA 4J83A 2K5FA 2QDJA 4JX6A 4M78D 3PIOA 1XTDA 2ZPFB 2BIVA 4JRIA 3ZFJA 4C8QD 5GANj 4KT0E 1QLBA 3CBPA 3I55T 4A54A 3QZ9B 2PVOB 4M7DE 3WXMB 1Q86C 3I56T 4M7AG 5CCAA 3JB9D 4M7DF 4C5GA 1YCYA 4E7KA 2VUBA 4L6V5 4OB1B 3OYMA 3M53A 1BI3A 2VV5A 3JRZA 2CS7A 2BS2A 4YTLA 2L5QA 3SDZA 2E10A 3A8GB 3MP1A 3VYGA 1VQ9T 2JOYA 3CCMT 1UGQB 4HL4A 4LOCA 1ZQ1A 1K8AC 2AHJB 1JJ2A 3A8LB 3PMIA 2WSEE 3I55A 3QBYA 2ZPEB 3ME9A 1ZHIA 3QDRB 1WPYA 2B8AA 2F5TX 2O01E 3OYDA 2QEXA 3UPUA 5IT9E 1YI2T 2FL7A 4BACA 1YJWA 4A4HA 3MP8A 3LYIA 1I4K1 3C95A 3L2UA 2WACA 3QUIA 1Y96A 1K9MC 2EWNA 4M77A 2BKDN 2DJZA 2QTXA 5KCOA 3CD6A 1G5VA 3CCQA 4M7AB 3PFSA 3VUZA 4EDUA 3JCMJ 2CGHA 3RUXA 1M1KU 1QVFA 1BIBA 2QQBA 4M7DC 3EFRA 3RMQA 2DD5B 3BG5A 3GLXA 3JCMg 3TREA 4C0FA 3QKJA 2K4YA 3OA6A 3E1SA 4PJOC 1RI0A 2LCCA 2DIGA 2HD0A 4M75B 5AYFA 3M55A 2QEXT 5GAMh 1VQOA 1ZBXA 3QSUA 3BG9A 3SWNA 1QVFS 4ATOA 5A0LA 4L5GA 1I81A 3L1AA 5HK0A 3Q1JA 3G71T 2WJ9A 4C92F 4C8QG 3H8ZA 2E6NA 4OGCA 3L2WA 2ZPIB 2EJGA 2QQRA 5L8RE 3LWHA 4J6XA 1YHQA 2KMGA 2RM4A 3H6ZA 2I2LA 4JRPA 2RH2A 5CKDA 2DK3A 2XICA 2BS3A 4ZTJA 5LJ3d 4C92D 3V8KA 2CZ1B 4E7IA 3OS2A 1VQ5T 2K5IA 2MMPA 3MEAA 1QW1A 1RL2A 1JRIA 2DZCA 3M9QA 4PJOF 3CBOA 4HA8A 2MAMA 4O5VA 4HNVA 3FEOA 1PSEA 1N9SA 5IAYA 1VQLA 1NJIU 4MFDA 3JCMP 3X26B 2EKOA 2LQ8A 2HQEA 1YJNA 3UT1A 5GMKm 1QVGS 3M57A 3JCMh 3JCMd 4XU2A 2LNVA 2X4YA 2LQKA 5GAOn 4XK8E 4C8QA 3JCMc 3GPLA 4DOVA 3JSCA 2RK2A 5CK9A 2E6ZA 3CCRA 3CC4T 2LCLA 4MFEA 3OBWA 2YRVA 3RIRA 3CD6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXB A;  2PVD B;  2CYZ B;  2CZ0 B;  2DD5 A;  3X20 B;  3VYG B;  3A8H B;  2ZZD A;  1GXI E;  2DXC B;  2CZ7 B;  2PU9 B;  2D0Q B;  1UGP B;  3VYH B;  2DD4 B;  1UGR B;  4RKU E;  2ZZD B;  2ZPF B;  3QXE B;  2PVG B;  2DXC A;  1PSF A;  4KT0 E;  3X24 B;  3QZ9 B;  2PVO B;  2DXB B;  3LW5 E;  3HHT B;  2QDY B;  4L6V 5;  4OB1 B;  2WSC E;  4FM4 B;  1IRE B;  2PUO B;  3VYG A;  1DJ7 B;  3A8G B;  1AHJ B;  1UGQ B;  3QYG B;  1QP2 A;  3X28 B;  2AHJ B;  3WVE B;  3A8L B;  2WSE E;  2ZPE B;  2O01 E;  4OB0 B;  1V29 B;  3X25 B;  4ZGD B;  3A8O B;  2ZCF B;  2DD4 A;  2DD5 B;  1QP3 A;  2PUK B;  3QYH B;  3A8M B;  2ZPG B;  2ZPH B;  2ZPI B;  5L8R E;  4OB3 B;  1JB0 E;  2WSF E;  2CZ6 B;  2CZ1 B;  3WVD B;  1PSE A;  4OB2 B;  2ZPB B;  3X26 B;  4Y28 E;  1UGS B;  4ZGJ B;  4XK8 E;  2DPP B;  4ZGE B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 4FYY B;  4PLI A;  1XO2 A;  2FRY A;  2LT1 A;  2CSI A;  3OW2 P;  1OL2 B;  4J7I A;  2NUZ A;  2L0A A;  3OYA A;  1D0Z A;  2KY9 A;  1ABQ A;  2QG9 B;  3QHW B;  1IGU A;  1JXO A;  4M7A E;  5LJ3 h;  3G4S T;  1AIS B;  2DL4 A;  4JRQ A;  3UA7 A;  2QQ9 A;  2DD4 B;  2RQR A;  1VQM Q;  4F6W B;  1YJW T;  3CCL T;  1WYX A;  1G3N C;  3REB B;  2BUD A;  4OMP A;  4RTW A;  3VUB A;  1M90 U;  3OS1 A;  4AFZ C;  4RKU E;  5ACB A;  2CP2 A;  3PVL A;  2DA9 A;  4J9C A;  3V7R A;  1RAF B;  5CKE A;  5BNJ B;  2DVJ A;  1NPP A;  1RUW A;  1Q7Y R;  3I5R A;  1X6O A;  3E2U A;  1VQ9 Q;  4AG2 C;  1YIJ A;  2KRM A;  2NUP A;  3N5B B;  3JCM X;  2JTE A;  4RMO A;  2GTJ A;  5I2M A;  4HCB A;  5LL6 S;  2LX9 A;  4MDW A;  2LJ3 A;  4J6Y A;  5GAO q;  2JXB A;  3CC7 A;  2F69 A;  3CPW S;  1WJS A;  2CP5 A;  2F5K A;  3CMA Q;  4IUU A;  4F7U G;  2HMA A;  2RQT A;  3SB2 A;  3A8M B;  3QPH A;  4EMH A;  4II5 B;  4M75 A;  2ZPH B;  2YHT A;  3CXC P;  1KC8 R;  5CQY A;  2DBK A;  2D8H A;  3DB3 A;  3D7S B;  5HBE B;  4DBH A;  4ELY C;  2KGT A;  2RF0 A;  1I8F A;  1AOJ A;  4QW2 A;  3CCE T;  2EYQ A;  3EGU A;  3EG3 A;  4HVU A;  4JX5 A;  2PTK A;  2LDM A;  1G8X A;  2HBP A;  4M77 D;  2WIP B;  1NE8 A;  1OGU B;  3TN8 B;  3VV0 A;  4KUL A;  4UC4 A;  4CFW B;  1WHK A;  1VYW B;  1BI1 A;  1UJY A;  1ZSZ B;  1M30 A;  1XNI A;  4DOW A;  4RTU A;  2RHZ A;  1FIN B;  2UUE B;  4HCC A;  2FZC B;  4N4G A;  4F6U B;  3VKI A;  1QVP A;  1E7O A;  1BK2 A;  3OMG A;  3CCJ A;  2FRW A;  4MMK A;  2OAU A;  1ARK A;  1RLQ C;  3CCR T;  1S72 T;  2A36 A;  1UFF A;  2JM9 A;  8ATC B;  1G3W A;  3A1P A;  5IN1 A;  3EGX B;  2DTH A;  2C4G B;  2P4R A;  3U23 A;  4FU6 A;  1C0M A;  3GNG A;  3CC4 Q;  1X6G A;  2ROT A;  1LJO A;  1ZA2 B;  4QSH A;  1EX4 A;  1VQP T;  4M77 B;  1BYM A;  4PK4 A;  4OB0 B;  1H25 B;  1VQ4 Q;  4YOO A;  1IZ6 A;  3HFO A;  3LX7 A;  1URC B;  3DDP B;  2AZV A;  2X4W A;  2MF2 A;  1XOV A;  3VRY A;  1H26 B;  1M1K C;  1R0B G;  3R6O A;  5GMK l;  3TNH B;  4AFU C;  3I9Q A;  2V8J A;  2JW4 A;  3SWN C;  4N0A C;  1YHQ T;  2O9V A;  4BCQ B;  3OYE A;  3CXC S;  2NYS A;  3I56 A;  1SSF A;  4BCK B;  4KRD B;  2A3L A;  1UEB A;  1M5Q 1;  2HL5 C;  1M1F A;  3G71 A;  4F70 B;  4Y91 A;  4BY6 B;  3OBY A;  5IDP B;  2G77 A;  3BW1 A;  1M1G A;  3NGP A;  3G6E Q;  2A37 A;  3K7A M;  3GF5 A;  3TVT A;  3L2V A;  1CKB A;  1Q7Y U;  3M59 A;  5FU6 B;  2DXB A;  4QVZ A;  2AT1 B;  1M9S A;  2YRC A;  3QWX X;  2QQ8 A;  1K1Z A;  3CCS Q;  4N4I A;  1Q81 C;  1YIJ T;  2PQW A;  3JCM b;  4VUB A;  4ROE A;  2EQI A;  5GMK e;  1TXQ A;  1SKU B;  4N0A A;  2KEA A;  4ZTF A;  5D6Y A;  1VQ8 A;  1QVF P;  2JS2 A;  2D8J A;  5FWB A;  4MIM A;  2AKL A;  1YBY A;  3VS2 A;  4EOP B;  1VQ4 T;  3QXE B;  4D8D A;  1NG2 A;  1UB4 A;  4BB7 A;  3PIP A;  4XQ3 A;  2LP5 A;  5FRN A;  4Z88 A;  1Q7Y C;  1BI0 A;  4M7D D;  3JB9 F;  1OKV B;  1LNX A;  4R55 A;  2O4X A;  1TD6 A;  3HFN A;  2FHD A;  4PJO B;  2WSC E;  5GMK i;  3FDR A;  2JVV A;  2LW4 A;  2YXY A;  1QP2 A;  3OW2 S;  1MNE A;  1SRM A;  1M3C A;  5CAI A;  1IXD A;  3S3M A;  3OYH A;  5KYN A;  4E7J A;  1B34 B;  3EFS A;  1WI7 A;  3GOX A;  4EON B;  1W2B P;  4M7A A;  1YFN A;  2QQS A;  2ABL A;  1M90 C;  3EGD B;  1ZBJ A;  1K9M R;  1SG5 A;  3RKX A;  2GFA A;  1EIF A;  1KK7 A;  1PNJ A;  2LTO A;  2QI2 A;  4XTY A;  4EOM B;  4JS5 A;  7AT1 B;  3I56 Q;  2WXV B;  3MY1 B;  3OSS C;  1CSK A;  3MEV A;  4J9I A;  3C0C A;  2SEM A;  1ZA1 B;  1M4Z A;  2KQW A;  3M4G A;  4LNP A;  4ZN1 A;  2QGF B;  1WHM A;  3JCM V;  1U1T A;  1YIT A;  5LJ3 f;  5GMK h;  2BZ8 A;  5FU6 C;  3G6E A;  2VC8 A;  1UHF A;  1AD5 A;  1KSW A;  4OVA A;  4AT1 B;  4J6W A;  2HL3 A;  4DEX A;  2FG0 A;  4HCZ A;  3HPW A;  1B34 A;  2KRO A;  2JJ9 A;  5DQV A;  5GAO m;  4JRK A;  2AKK A;  4BCN B;  4JZ3 A;  2DER A;  2W99 A;  5LJ5 e;  4JLG A;  4CC2 A;  4N4H A;  1R77 A;  1O75 A;  1UGV A;  1WZO A;  3G4S Q;  2CZ7 B;  1Y96 B;  1VQ7 A;  1Q81 R;  2L3P A;  1YJN Q;  4M75 C;  1VQ8 Q;  2R5A A;  1C1A A;  2EVR A;  3CCU Q;  1KQ2 A;  2BZY A;  1OOT A;  4J9E A;  2O88 A;  2K2V A;  2OJ2 A;  3G1J A;  3FJP A;  5KYX B;  2MWP A;  1Y7X A;  5GAO l;  1N4M A;  5C0M A;  4Z6Y A;  2KRS A;  4JX6 A;  2ECZ A;  4JRI A;  5GAN j;  4KT0 E;  1QLB A;  1QCF A;  2COW A;  3I56 T;  1PHT A;  4C5G A;  4E7K A;  1ZSZ A;  4L6V 5;  4OB1 B;  1BI3 A;  2EGE A;  2HQH A;  4BY7 X;  4RTT A;  3MP1 A;  3MJX A;  2J7I A;  1UGQ B;  1ZQ1 A;  1JJ2 A;  2ZPE B;  3QDR B;  1ZHI A;  1WPY A;  3UPU A;  2QEX A;  2LMJ A;  4A4H A;  2YSQ A;  1I4K 1;  2LZ6 B;  2V22 B;  1UHC A;  4PJM A;  2PHG A;  3EG9 A;  1PG5 B;  3HTR A;  4DEY A;  2AIR B;  2EYY A;  1BIB A;  3EFR A;  3SEM A;  1NBE B;  1RAB B;  2K4Y A;  4GLM A;  3BHU B;  2C5O B;  1RI0 A;  3M55 A;  3QSU A;  1HYO A;  2UZE B;  1WXB A;  4ATO A;  2UZD B;  3L1A A;  5FWC A;  2WJ9 A;  1N8R R;  3TNI B;  4J6X A;  3H6Z A;  2RH2 A;  2OTJ Q;  2DK3 A;  1KJW A;  5LJ3 d;  2MK5 A;  2FPE A;  3OS2 A;  1VQ5 T;  2K5I A;  1QW1 A;  2DZC A;  3M9Q A;  1VQL A;  3FEO A;  1PSE A;  1M3B A;  2LQ8 A;  2M0Y A;  1YJN A;  4F16 A;  1OU8 A;  5GMK m;  3JCM d;  2DBM A;  1FMK A;  1SRL A;  4C8Q A;  3GPL A;  3CCR A;  5CK9 A;  2E6Z A;  3CC4 T;  2LCL A;  1RAG B;  3CD6 T;  4BY6 C;  2A7Y A;  3CC2 T;  1I5L A;  2KR3 A;  1HJD A;  2G9X B;  2EJ9 A;  1NPR A;  2NUT A;  1WHL A;  2KVQ G;  2VWF A;  4KGV B;  3MI9 B;  3EHR A;  4QVD A;  3FLG A;  3CC2 A;  3PGG A;  4MZT A;  1TH7 A;  2OTL Q;  2I53 A;  2EGA A;  5GAM g;  3HRT A;  1OL1 B;  2BE9 B;  1D3B A;  1W6X A;  1YP5 A;  2CP3 A;  5IHK A;  3CCL A;  4J9F A;  4M77 C;  1B7T A;  4K11 A;  4BUG A;  4KGZ B;  3OYC A;  2XI9 A;  3PVQ A;  4AFQ C;  5KE2 A;  4OMN A;  2J05 A;  1VQ4 A;  5IXF A;  1TS9 A;  2PUO B;  1H4L D;  2WMA B;  4EMG A;  2YLB A;  2E1H A;  2BS4 A;  4RG8 A;  4MDX A;  4OF1 A;  5CVI A;  3LWI A;  4JJN K;  2VGM A;  1FKM A;  3MEU A;  4BI8 B;  1MMA A;  1VQN T;  2IVW A;  4ZGD B;  3M0S A;  2QYZ A;  1D09 B;  1TUC A;  4E7Z A;  1U1S A;  2VXE A;  3EFO A;  1M2V A;  2EBP A;  2VYT A;  3CCQ Q;  3JB9 I;  2QGS A;  4PFO A;  4EOJ B;  4FT2 A;  3PT9 A;  2P4T A;  1OV3 A;  4PJJ A;  4CFX B;  2XKO C;  3F5X B;  1PWT A;  3VJP A;  1FVV B;  2UZL B;  4AKG A;  4C0D B;  2OAW A;  1OPK A;  1G3Y A;  2WSF E;  3OYI A;  2QFZ A;  2DMO A;  1P5E B;  4IIO A;  1YJ9 A;  2EYX A;  2K3X A;  1R8O B;  1SEM A;  1OZ2 A;  2XK0 A;  2LC4 A;  2F2C A;  3OYJ A;  4GY5 A;  2E65 A;  4ZGE B;  1YJ9 T;  3CCQ A;  4EDU A;  1JJ2 P;  4M78 B;  4RTX A;  3MO8 A;  3PMT A;  2JN0 A;  4TVR A;  2M9U A;  4WCI A;  1WGS A;  4EOS B;  3QO3 A;  2E12 A;  1VA7 A;  1ENW A;  3HO8 A;  3M54 A;  4XU0 A;  1U06 A;  2F2W A;  3ZBD A;  3CCV Q;  3URG A;  1Q86 U;  2CDT A;  2OTL A;  2E5Q A;  3M0R A;  3VS7 A;  5GAN 3;  4CFU D;  2EJF A;  1GCP A;  1UGP B;  4M78 A;  2JUF A;  2J06 A;  5I2S A;  1E6H A;  1FWZ A;  4PFZ A;  3O0G D;  1K9A A;  4B9X A;  3VS3 A;  2VB6 A;  4PNO A;  1WA7 A;  5KYW A;  5J3B A;  1X2K A;  2V8I A;  5D7U A;  2DRK A;  5GAN f;  3MHX A;  3CCJ Q;  1K0X A;  4PLL A;  1PM3 A;  3UWN A;  1G3S A;  1YIT T;  2K5L A;  1H3H A;  3DLM A;  1T3L A;  3OQ5 A;  4E47 A;  3QYG B;  1OX8 A;  1LPL A;  4BE2 A;  4J9D A;  4BD3 A;  2E41 A;  3HP9 A;  4EOK B;  1YHQ Q;  3TCJ A;  5IXB A;  2LRQ A;  3CEY A;  2FZK B;  3A8O B;  1M27 C;  4ESR A;  1KIK A;  1AD6 A;  5KYY A;  3HRU A;  4BBS M;  2JGZ B;  4LN2 A;  3PNW C;  1NJI R;  3QYH B;  1VQP A;  1W2B A;  5FU7 B;  4IMY B;  3GTM S;  1JBM A;  5GMK j;  1J3T A;  3HZJ A;  1GCQ A;  1VIN A;  4NL3 A;  5KYY B;  1S72 A;  4J8O A;  2E64 A;  2JNG A;  4LE9 A;  3GIB A;  1YWP A;  1Z9Q A;  2EW3 A;  3HRS A;  4PJO E;  2DL5 A;  1KQS S;  5FW9 A;  2EIF A;  4OB2 B;  4C5H A;  3CCJ T;  4XTV A;  3DB4 A;  3S3O A;  4FX3 B;  4XU1 A;  1FXX A;  2DEU A;  4NC6 A;  4BCN D;  3VKG A;  1OQK A;  2C0T A;  2FVU A;  1K73 C;  2HQX A;  4RTZ A;  4DBF A;  5GAO r;  5FLX E;  4C0D C;  4J9B A;  2CCI B;  4FW1 A;  4ELJ A;  2P0Q A;  3EH2 A;  2DE0 X;  2L3S A;  4CRI A;  1Y57 A;  1WJR A;  3QYB A;  2FEI A;  5GAN 5;  1VQ5 Q;  4II1 A;  1OI9 B;  2OTJ T;  1VQ8 T;  4JS4 A;  2LNH B;  4QQG A;  1K9M U;  5GJV B;  4XTZ A;  3RMS A;  3S6W A;  2OI3 A;  1TG0 A;  1CKA A;  3BDU A;  4FM4 B;  1NYF A;  3H4C A;  1QKX A;  4F6S B;  1BKB A;  2M16 A;  5LQF B;  3GNF B;  2DFU A;  2XDP A;  2GQV A;  2KRN A;  2RQU A;  1UDL A;  3OYL A;  1OYX A;  1VIF A;  3J80 E;  2K3B A;  4C0Z A;  4LDV A;  1S72 Q;  1X75 C;  4M75 D;  5KYX A;  1GFD A;  3REA B;  4EOR B;  2K9G A;  4A53 A;  4BE0 A;  3ER0 A;  1TFB A;  2DKG A;  1KD1 U;  3OMC A;  5LJ5 h;  3C12 A;  1D1C A;  1VQN Q;  3QII A;  1VQL Q;  3EG1 A;  2EQK A;  2RNA A;  1BIA A;  5CIU A;  4HVW A;  2XG8 D;  2X4J A;  3O8V A;  5L23 A;  3QG1 A;  2EGC A;  1UG1 A;  1N8R C;  3KXT A;  5GAN 2;  1AWJ A;  4Y92 A;  3NTI A;  1TTH B;  4RCC A;  2MWO A;  4AG1 C;  2DVE A;  1RAA B;  1GRI A;  1H1R B;  1Y71 A;  5HBH B;  4M77 F;  1VQ5 A;  2NWM A;  2L3Q A;  2CYZ B;  1B07 A;  4M75 G;  2X1N B;  3H9N A;  4R56 A;  1E6G A;  4L59 A;  5I22 A;  3A8H B;  4BI4 A;  1ZLM A;  3VU3 C;  4F04 B;  2ZGW A;  5DM7 R;  2RJF A;  4RG2 A;  3CC4 A;  3OYB A;  4BE1 A;  4C5I A;  1PKT A;  1W98 B;  2IW9 B;  3PO3 S;  2C06 A;  1RAE B;  2R5M A;  2D1X A;  5DLO A;  1E7P A;  3A5Z B;  1U5S A;  3CD6 Q;  2QDJ A;  4BY1 X;  3PIO A;  1AWW A;  2LQN A;  3ZFJ A;  4NST B;  2YRD A;  1H1P B;  3CBP A;  4A63 B;  1VQK Q;  2PVO B;  3WXM B;  1I5O B;  4M7A G;  3RNJ A;  5KYU A;  1YIJ Q;  2VUB A;  3OYM A;  4CC3 A;  4JZ4 A;  1BU2 A;  2CS7 A;  1UNL D;  3VYG A;  2L5Q A;  3A8L B;  2B86 A;  4JJC A;  3ME9 A;  3OYD A;  5IT9 E;  4BCI B;  2CUD A;  2QTV A;  2YUQ A;  1WHG A;  3G71 Q;  4F14 A;  2FL7 A;  4BAC A;  4E6R A;  3L2U A;  3BE3 A;  3QUI A;  2CH4 A;  1Y96 A;  2JMC A;  4F17 A;  2QTX A;  3CD6 A;  4M7A B;  2RQW A;  3RUX A;  1M1K U;  1QVF A;  2QQB A;  3I35 A;  2DL8 A;  2DIG A;  2QEX T;  4L5G A;  1I81 A;  1LCK A;  4FYX B;  3Q1J A;  3H8Z A;  1ABO A;  1NM7 A;  4OGC A;  1JEG A;  2EJG A;  2QQR A;  1D3U B;  3LWH A;  4PJN A;  1YHQ A;  2RM4 A;  2DNU A;  1GL5 A;  4JRP A;  5CKD A;  4FYW B;  3CCM Q;  4E7I A;  4RTV A;  4PJO F;  3BHV B;  1MND A;  5IAY A;  1UUE A;  5ECA A;  1N9S A;  1NJI U;  1WLP B;  4FCY A;  3JCM P;  3X26 B;  3H0F A;  1X27 A;  1EFN A;  1QVG S;  2OX7 A;  4DOV A;  2DME A;  3JSC A;  2LCS A;  4MFE A;  5GAM h;  3RIR A;  4KGX B;  5I11 A;  4J7F A;  2GCX A;  2K79 A;  4KUD K;  1KQS P;  1YIT Q;  2RHY A;  1H27 B;  2J6F A;  2W9Z A;  1PD0 A;  3X20 B;  3VYG B;  1FX7 A;  2R57 A;  4PJO D;  5GAM e;  6AT1 B;  4V2S A;  4Y72 B;  1JXM A;  1VYU A;  2M1H A;  1B3Q A;  1WQW A;  4M7D G;  1BI2 A;  2RHI A;  2HAX A;  1PKD B;  1TWB A;  1U3O A;  2FYK A;  2RQV A;  4PJO A;  3RKW A;  3CPW A;  4M7D A;  4BDZ A;  1W2B S;  5A2Q E;  2LJ1 A;  2G6F X;  3BDL A;  4JJD A;  2C0I A;  4PJO G;  3V8L A;  1BCM A;  3BY7 A;  2RI5 A;  2L8D A;  3HHT B;  3DKM A;  1WHH A;  2R7G A;  3P8B B;  1QQJ A;  4MZP A;  2M51 A;  1VQM A;  1KD1 C;  4PL6 A;  2YUO A;  2G3R A;  4JLI A;  4GLK A;  3QHS A;  4QT7 A;  1VQ6 A;  4M4Z A;  4FT4 A;  1NJI C;  3I55 Q;  3M56 A;  2HSP A;  1BBZ A;  3KFV A;  2MPX C;  2XID A;  5IHY A;  2F2X A;  3TQ7 P;  1VQP Q;  2HKN A;  4LDX A;  2DET A;  5D6X A;  3HBL A;  2X35 A;  2KK4 A;  1KXU A;  2RO0 A;  3MY5 B;  3OYY A;  1VQ6 T;  1ACM B;  1ZSG A;  2RHX A;  1JU5 C;  1XQH A;  1QCN A;  1K8A R;  4ZNX A;  3AHU A;  4MML A;  1W70 A;  2ZPG B;  2DXT A;  3CCM A;  3I5S A;  4NL2 A;  4FW2 A;  1QWE A;  1VQ6 Q;  1K4U S;  3JCM Q;  2YDL A;  2HDA A;  3CME T;  2H3E B;  2ED0 A;  5LJ5 j;  2DYI A;  4F7U A;  4G6L B;  5IHI A;  4EOQ B;  5A0G A;  1C9B A;  2QDL A;  4BCH B;  4FSS A;  1LOJ A;  3QDF A;  4HNU A;  2KMT A;  1H28 B;  4HCK A;  3QZ5 B;  5LJ3 g;  3KHI A;  2AK5 A;  2COY A;  2LX7 A;  4KH1 B;  3MKD A;  3NMZ C;  4A4E A;  1GUX A;  2BZX A;  4BCM B;  1AEY A;  2KAF A;  1WQ7 A;  1C6V X;  2X3W D;  1VQO T;  5FU7 C;  2DM1 A;  1RAC B;  3O5Z A;  4OGE A;  2PK9 B;  2ESW A;  5CR2 A;  1HD3 A;  3FC3 A;  3CPW P;  1GFC A;  3OB9 A;  3P8H A;  4RTY A;  3SD4 A;  2GFU A;  2PVG B;  1KHI A;  1H1S B;  3R6N A;  5HVY B;  4M75 E;  4WF2 A;  5GJW B;  2GTO A;  1XJW B;  4KRC B;  3MCA B;  4LDY A;  1D0X A;  1UNG D;  2KNB B;  1M8V A;  4OML A;  3RER A;  5GAM f;  1KC8 U;  2D6F A;  1AHJ B;  5GAN 6;  3X28 B;  1WIE A;  3CMA A;  3EG0 A;  3M58 A;  3FRN A;  3KUF A;  5L2W B;  4M78 E;  3ULR B;  2CP6 A;  2D0N A;  4CRL B;  2RI3 A;  2X51 A;  3OS5 A;  4BCF B;  5FGK B;  2UZB B;  3J81 E;  3BFM A;  3JCM W;  4AKI A;  1MHN A;  3THK A;  3G7Z A;  1QVG A;  1JOW A;  3SFM A;  2HBW A;  1Q86 R;  3DJB A;  1F1B B;  3ZL7 C;  4C8Q E;  4E7L A;  4OR5 B;  4A4F A;  3P8D A;  2RHU A;  1N8R U;  2O4X B;  5KCH A;  4EMK A;  5KH6 A;  2DIL A;  3WVD B;  2IN3 A;  1NYG A;  4C5E A;  1Q82 C;  4F7J B;  2XDD A;  2DZ9 A;  3VS0 A;  5DQW A;  1UGS B;  1EZZ B;  4C0G A;  4C92 A;  4ZGJ B;  2EQJ A;  2LVM A;  3KBG A;  4HXJ A;  4C92 C;  5KYU B;  1ZUY A;  2QA4 T;  5GAN g;  3G6E T;  2K2M A;  4ELL A;  4M78 G;  2VXF A;  4E2F B;  1K0S A;  3JAM E;  1VQK A;  3EHQ A;  3BHT B;  4ME7 A;  2KBT A;  4C92 G;  4C8Q F;  2XU8 A;  4EMK C;  4EC9 B;  2C5N B;  3QHR B;  1ZUU A;  1GH6 B;  1TOV A;  2QQA A;  3V7S A;  2RD1 A;  2DEQ A;  1LVK A;  1O9K A;  4ROC A;  1GXI E;  2ATC B;  1X43 A;  2LQW A;  3SWN B;  2D0Q B;  4HT9 A;  2IW6 B;  4RCB A;  3LQ5 B;  5FRM A;  5CQX A;  1KQS A;  1WDX A;  4EIK A;  1JST B;  3J7A F;  2JT4 A;  4BBR M;  1NEB A;  5KYW B;  4PFP A;  1BCO A;  1TU0 B;  3M0Q A;  4IUR A;  3BG3 A;  1SPK A;  3CCU A;  2QK0 A;  2YT6 A;  2DTO A;  4Z89 A;  2FPF A;  4QQ6 A;  2EPD A;  4X34 A;  2COZ A;  3M0T A;  4JDS A;  4M78 F;  2RA2 A;  1O9S A;  2C5V B;  4NOY A;  3WVE B;  3OSV A;  3QJY A;  5HCK A;  2DL3 A;  2C6T B;  1JJ2 S;  1MMN A;  1JO8 A;  4M77 E;  4Q5W A;  1MMG A;  2KSS A;  1YI2 Q;  3TSZ A;  1V29 B;  4OP0 A;  4D6W A;  3UAT A;  4C8Q B;  8AT1 B;  3CCQ T;  2ZCF B;  3LH0 A;  2GBQ A;  1K73 U;  4BXX X;  2DAQ A;  4R0K A;  3L2R A;  1N9R A;  5CEI B;  5LMK B;  3INZ A;  3M4Y A;  1VOM A;  1SSH A;  3L2Q A;  1VUB A;  2H3J A;  5CKH A;  3VS5 A;  3CXC A;  2X9H A;  1VQO Q;  2MI6 A;  3HB9 A;  3CBM A;  5M9O A;  3JCM e;  2CSQ A;  3TW7 A;  3E19 A;  1AWX A;  4YC3 B;  4P5N A;  3EOC B;  4KRT A;  4JX4 A;  2BKZ B;  5IHN A;  2JM8 A;  3LGF A;  2EQU A;  5A0D A;  2OTJ A;  1JQQ A;  2E3H A;  4IUP A;  5GAM d;  3QWL A;  3EJ1 B;  3EID B;  1GY3 B;  3TW6 A;  2M02 A;  3CPF A;  2CZ0 B;  2BTT A;  4JJB A;  5D6W A;  3OYK A;  3UA6 A;  2CP0 A;  1FMV A;  1RAI B;  2NLU A;  3LLR A;  3FJ5 A;  4X9D A;  1X2Q A;  4B9W A;  5CO7 A;  2RI2 A;  2PU9 B;  1IHW A;  4M75 F;  5GAN h;  2JMA A;  4LUE A;  4OMQ A;  3NTH A;  3EGD A;  4OMO A;  5GAN d;  2KYM A;  5J39 A;  2KYB A;  2O2O A;  2VGN A;  3MP6 A;  2XD0 A;  3NDQ A;  3CC2 Q;  1PRM C;  3L42 A;  4J83 A;  2BIV A;  4C8Q D;  1IO6 A;  3QZ9 B;  4M7D E;  3CC7 Q;  1M8M A;  4FYV B;  1K76 A;  2O31 A;  1RAD B;  3SDZ A;  1G5V A;  5IDN B;  2JOY A;  3CCM T;  1TUG B;  3IQL A;  1R0C B;  1NLO C;  2O9S A;  2WSE E;  3QBY A;  1Q86 C;  2J6K A;  2EUF A;  2O01 E;  1YI2 T;  2FZG B;  2HEQ A;  1PKS A;  1YJW A;  3MP8 A;  5HNB B;  2DJQ A;  1FYN A;  4CFV B;  1YN8 A;  2EWN A;  2DJZ A;  3EGX A;  5KCO A;  2CP7 A;  2KT1 A;  2CCH B;  3PFS A;  2HKQ B;  3VUZ A;  2CGH A;  4M7D C;  3RMQ A;  2DD5 B;  3GLX A;  3JCM g;  3TRE A;  1PRL C;  1YWO A;  2F2V A;  3OA6 A;  2CJM B;  4PJO C;  1Q82 R;  1OKW B;  4BCO B;  5AYF A;  4M75 B;  1GBQ A;  1VQO A;  1ZBX A;  4LXC A;  3BG9 A;  4C92 F;  4C8Q G;  2B9R A;  2KMG A;  2W0Z A;  1V1C A;  2MCN A;  2IVX A;  3DOG B;  3V8K A;  2CZ1 B;  1OU9 A;  2MMP A;  3GBQ A;  1JRI A;  4ANJ A;  4HA8 A;  2MAM A;  1OX9 A;  1GBR A;  2PK2 A;  1GUX B;  4MFD A;  2H8H A;  1BU1 A;  2WMB B;  1H1Q B;  2HSE B;  2EKO A;  3MPU B;  1O9K B;  2K6D A;  3UT1 A;  3JCM h;  2LNV A;  2LQK A;  5GAO n;  3JCM c;  5HQ0 B;  2CT4 A;  2YRV A;  1S1N A;  3NHN A;  2VAS A;  2PVD B;  4FIB A;  3CCS T;  2KR6 A;  1M2O A;  3UF4 A;  3CCV A;  2QXF A;  1PD1 A;  2VKN A;  3S3N A;  4XAX B;  4CC7 A;  2EYW A;  5EJC A;  4IUQ A;  2YLC A;  2MYS A;  3LH5 A;  3CCR Q;  4LDU A;  2XDB A;  2J6O A;  1N5Z A;  2RK1 A;  1F5Q B;  4TTH A;  4M78 C;  1VQ9 A;  5DLQ E;  4C92 B;  1X01 A;  2W9F A;  4BCM D;  4JPB W;  2DXC A;  2JZ2 A;  3X24 B;  2XHC A;  4KUI A;  5C6S A;  2JTF A;  4C92 E;  4BCQ D;  2I40 B;  1H8K A;  2HZY A;  4EMK B;  1IRE B;  3RES A;  1DJ7 B;  1KC8 C;  3H41 A;  4Z02 A;  1OPL A;  2M0O A;  1AZE A;  3OYN A;  4HNT A;  4CFN B;  1H3Z A;  1OZ3 A;  3CC7 T;  1WNL A;  3SHW A;  4ROD A;  2D9T A;  1QWF A;  2K57 A;  2DLP A;  2MOX A;  3CCE Q;  5GAN 4;  5CYI B;  2DX1 A;  5GAN 8;  2GF7 A;  2DXU A;  2QA4 A;  1G2B A;  2A0F B;  1NLP C;  3LGL A;  2CKK A;  2XMF A;  3H0H A;  3HL8 A;  1QP3 A;  3C4S A;  1U8R A;  3OS0 A;  4O6J A;  4M7A D;  4LD9 K;  5DY9 A;  3E9G A;  3EAE A;  4A4K A;  4CI0 C;  4AMC A;  4ELZ C;  1OUL A;  3RGF B;  4OGR B;  2BPM B;  4E7S A;  2CZ6 B;  2Y90 A;  1QMC A;  1D3B B;  1PCX A;  4UN0 A;  4NS5 A;  1SF9 A;  1UE9 A;  2IW8 B;  2ED1 A;  1YCS B;  5ICP B;  2EQM A;  3UDC A;  2KXD A;  1P92 A;  1KQ1 A;  2RPN A;  1OIY B;  2L89 A;  2KDS A;  1UNH D;  5AT1 B;  4OMM A;  3POM A;  2L3R A;  1Q81 U;  1HXD A;  2L2P A;  4M7A F;  2CUB A;  2YUN A;  1YJ9 Q;  3T9N A;  2P0P A;  4B6M A;  2PZ1 A;  2Y4Y A;  4F7U F;  1AVZ C;  2V1Q A;  2MIO A;  1N6A A;  1D1B A;  5LJ3 j;  3CME Q;  2GGR A;  4QKU A;  5I21 A;  2Y4X A;  2A08 A;  1Q82 U;  4OMF B;  1MGQ A;  1QCO A;  2W10 A;  1KG1 A;  1OEB A;  4QQD A;  2ZZD B;  1E9H B;  3HSB A;  4RUG A;  3FB9 A;  5HK3 A;  5CKB A;  4FL6 A;  4D8K A;  4KBM B;  2Z0W A;  3LW5 E;  2E70 A;  4IUT A;  4BCG B;  2QDY B;  2SRC A;  3M0U A;  3H0I A;  2A28 A;  2CT3 A;  2V8K A;  1JSU B;  1NZ9 A;  2EKH A;  1YNZ A;  3G4S A;  4F7U E;  2DYB A;  3QJ6 A;  4GBQ A;  1VQ7 Q;  4PJL A;  4C8Q C;  1A0N B;  1Y0M A;  1M1K R;  2R58 A;  1M90 R;  5HBJ B;  1X69 A;  1G3T A;  1MUZ A;  3JB9 H;  3RR6 A;  5KE3 A;  2W96 A;  1OIU B;  2DD4 A;  5J26 A;  2QF7 A;  2HCK A;  2CRE A;  4BDY A;  3OW2 A;  2BE7 D;  2PMI B;  1KFZ A;  3PTA A;  4F7U B;  2PUK B;  3DLL A;  2IG0 A;  5GAN e;  2PJQ A;  2IIM A;  2X3X D;  2DL7 A;  2P84 A;  4IUV A;  3MIA B;  3EG9 B;  3EG2 A;  2P0K A;  3VRZ A;  5CKF A;  4QVC A;  1ZP2 A;  1VYV A;  3AT1 B;  4CFU B;  1W4S A;  2EAY A;  3C94 A;  2DTI A;  1WXT A;  2X4X A;  3V7C A;  5EG2 A;  1TSF A;  3RKY A;  1RI9 A;  4IKF A;  1PC0 A;  1QLY A;  3E9F A;  1NEG A;  3OY9 A;  3CME A;  1QVG P;  4XU3 A;  2ROL A;  2DO3 A;  1ZSZ C;  1M2V B;  4HKE A;  1SHF A;  1QKW A;  2DF6 A;  2JS0 A;  1I0C A;  2NUP B;  1GCQ C;  4LUD A;  3M03 A;  1VQK T;  4J9G A;  3DL1 A;  3TNW B;  1KD1 R;  1RLP C;  5HY6 A;  3NFC A;  5LJ5 d;  4M77 G;  3VYH B;  1IHV A;  4MZM A;  4E7H A;  3OYF A;  1N27 A;  5HKC A;  1UGR B;  4J5Y A;  2GNC A;  2I0N A;  2E5K A;  1KHC A;  1MMD A;  1T3S A;  1Y07 A;  3TU4 K;  1YJN T;  3EH1 A;  3FIF A;  5GAO p;  1MV3 A;  9ATC B;  2FO0 A;  1PSF A;  2LT4 A;  4XTX A;  2DXB B;  4CXA B;  3JB9 J;  1HK9 A;  4AKH A;  1WX6 A;  4J9H A;  1WJQ A;  2ZAE A;  1D1A A;  5IF1 B;  1W1F A;  1ZUK A;  4AFS C;  1IGQ A;  2QAS A;  4EPC A;  5LJ5 g;  1T0J A;  3MEW A;  4DA4 A;  3ASK A;  1Z9Z A;  3QYE A;  3MET A;  5LJ5 f;  3CQT A;  3HKS A;  3QWY A;  2QAZ A;  5FRO A;  2RJD A;  2E4H A;  4ZN3 A;  2DRM A;  4CFM B;  2JTM A;  4HVV A;  3V8J A;  1WXU A;  1VYT A;  4LDW A;  4PKC C;  2CH4 W;  4HLQ A;  3TSW A;  3ZEH A;  3X25 B;  4BI3 A;  1V76 A;  2LJ0 A;  4DQ2 A;  3DTO A;  4HT8 A;  4FSX A;  2K3Y A;  4EOL B;  1I07 A;  4CC4 B;  3CMA T;  2WIH B;  3M5A A;  4XTW A;  4F7N B;  5EFQ B;  1IRX A;  1YI2 A;  2C5X B;  3JV3 A;  5LJ3 e;  2KXC A;  2AZS A;  3CCS A;  4YOZ A;  3JCM f;  1VQL T;  3F70 A;  3GP8 A;  3OYG A;  3CCV T;  1TUD A;  4OB3 B;  2RB6 A;  2C0O A;  3TEE A;  1JB0 E;  2WHB B;  1HSQ A;  4EOO B;  4DBQ A;  2KE9 A;  4M7D B;  3B57 A;  1RAH B;  1WHJ A;  4M7A C;  2FB7 A;  1AWO A;  3CCU T;  2EFI A;  3L2Z A;  2FPD A;  2ZPB B;  2WEV B;  4Y28 E;  1OI1 A;  2EYZ A;  1I1J A;  2RJE A;  4LD6 A;  5EC7 A;  1VQN A;  4X9C A;  2E3I A;  2W2H A;  1UTI A;  3NTK A;  4M6V A;  2DPP B;  4WTO B;  1MV0 B;  1UEC A;  2HNI A;  5GAN 7;  2ENM A;  2IPO B;  1BB9 A;  3VKH A;  1WFW A;  4XTU A;  4KH0 B;  3CCL Q;  3VS4 A;  4I3Z B;  2DD5 A;  4AI6 A;  1SHG A;  2DIQ A;  5GAM j;  1VQM T;  1K8A U;  2OTL T;  1H24 B;  3RBB B;  2WPA B;  2ZZD A;  3BLH B;  2DXC B;  3BLR B;  4A4G A;  4IIM A;  3JB9 G;  2GQI A;  1X6B A;  1H64 1;  2KT8 A;  1VIE A;  2YWW A;  4DBR A;  2RN8 A;  2PNI A;  3CCE A;  1JKW A;  2RJC A;  4JUV A;  1UJ0 A;  4ORZ A;  2K5F A;  3G33 B;  2V1R A;  4M78 D;  4F7L B;  1XTD A;  2ZPF B;  3RDV A;  1G83 A;  2WFY B;  3I55 T;  4A54 A;  5CCA A;  3JB9 D;  4M7D F;  1YCY A;  1Q95 G;  3PE0 A;  2YUP A;  4EOI B;  3VS6 A;  3M53 A;  2VV5 A;  3JRZ A;  4YTL A;  2BS2 A;  2E10 A;  3A8G B;  1K8A C;  1VQ9 T;  3DDQ B;  4HL4 A;  4LOC A;  2AHJ B;  3PMI A;  3I55 A;  1AZG B;  1FMW A;  1M3A A;  4YOS A;  2QA4 Q;  2B8A A;  2F5T X;  1VOL A;  2V26 A;  3LYI A;  3C95 A;  2WAC A;  2QEX Q;  1H92 A;  1K9M C;  4M77 A;  2BKD N;  1K73 R;  3EFO B;  4Z8A A;  3JCM J;  1QMZ B;  5I5Z B;  1IB8 A;  2NUT B;  3BG5 A;  1ZX6 A;  4C0F A;  3QKJ A;  2F1L A;  3E1S A;  1YJW Q;  4BCP B;  2LCC A;  2HD0 A;  3SWN A;  1QVF S;  3BLQ B;  5A0L A;  5HK0 A;  3G71 T;  2K7A A;  2E6N A;  3L2W A;  2ZPI B;  5L8R E;  2I2L A;  3NPF A;  2XIC A;  2BS3 A;  4BCJ B;  4X1V A;  4ZTJ A;  4C92 D;  3A98 A;  3M0P A;  3MEA A;  1RL2 A;  5IH2 A;  2QGG A;  3CBO A;  2RMO A;  4O5V A;  4HNV A;  1D0Y A;  1AT1 B;  2HQE A;  2VVK A;  2KI7 A;  3M57 A;  4XU2 A;  1T0H A;  3VS1 A;  2X4Y A;  4XK8 E;  2RK2 A;  4EC8 B;  4F7S B;  1VQ7 T;  3OBW A; 
#chains in the Genus database with same CATH homology
 4BY6 C;  2A7Y A;  4PLI A;  3CC2 T;  1I5L A;  2LT1 A;  2PVD B;  4FIB A;  4J7F A;  3CCS T;  2GCX A;  4KUD K;  2EJ9 A;  1NPR A;  2KR6 A;  4J7I A;  2RHY A;  3CCV A;  2KVQ G;  3OYA A;  2KY9 A;  3X20 B;  3VYG B;  1FX7 A;  2R57 A;  2QXF A;  5GAM e;  4PJO D;  4V2S A;  2M1H A;  4QVD A;  3S3N A;  3FLG A;  4XAX B;  3CC2 A;  1WQW A;  3PGG A;  4M7A E;  4MZT A;  5LJ3 h;  3G4S T;  4M7D G;  5EJC A;  4IUQ A;  2YLC A;  1BI2 A;  2RHI A;  2HAX A;  1TH7 A;  4JRQ A;  2QQ9 A;  2DD4 B;  4LDU A;  2FYK A;  1YJW T;  3CCL T;  5GAM g;  2XDB A;  4PJO A;  3RKW A;  2RK1 A;  2BUD A;  3HRT A;  3VUB A;  1M90 U;  3CPW A;  4M78 C;  4M7D A;  3OS1 A;  4BDZ A;  1D3B A;  4RKU E;  1W2B S;  1VQ9 A;  5A2Q E;  3CCL A;  5DLQ E;  4C92 B;  1X01 A;  3BDL A;  4M77 C;  4PJO G;  3V8L A;  2DXC A;  3V7R A;  4BUG A;  3BY7 A;  3OYC A;  2JZ2 A;  3X24 B;  2XI9 A;  2RI5 A;  5CKE A;  1NPP A;  2XHC A;  4KUI A;  2L8D A;  5C6S A;  2JTF A;  3HHT B;  3DKM A;  4C92 E;  3P8B B;  5KE2 A;  1X6O A;  4MZP A;  4EMK B;  1VQ4 A;  1IRE B;  3RES A;  2PUO B;  1VQM A;  1YIJ A;  1KD1 C;  4PL6 A;  1DJ7 B;  1KC8 C;  3N5B B;  4Z02 A;  3JCM X;  4EMG A;  2G3R A;  2M0O A;  2E1H A;  2YLB A;  4JLI A;  4RMO A;  2BS4 A;  4GLK A;  3QHS A;  4HNT A;  5I2M A;  3OYN A;  4RG8 A;  5LL6 S;  4HCB A;  1OZ3 A;  1VQ6 A;  4MDX A;  1H3Z A;  4OF1 A;  5CVI A;  4FT4 A;  1NJI C;  3LWI A;  2LX9 A;  4MDW A;  1WNL A;  4JJN K;  3CC7 T;  2VGM A;  3M56 A;  4J6Y A;  1FKM A;  3MEU A;  4BI8 B;  2XID A;  2D9T A;  1VQN T;  5GAO q;  2IVW A;  2K57 A;  4ZGD B;  4LDX A;  5GAN 4;  5D6X A;  3HBL A;  3CC7 A;  2X35 A;  2F69 A;  2KK4 A;  1WJS A;  3CPW S;  5GAN 8;  2RO0 A;  2GF7 A;  3OYY A;  1U1S A;  2F5K A;  2VXE A;  2DXU A;  1VQ6 T;  2QA4 A;  2RHX A;  2VYT A;  4IUU A;  1XQH A;  3JB9 I;  3LGL A;  2CKK A;  4F7U G;  3HL8 A;  1QP3 A;  3C4S A;  3PT9 A;  4FT2 A;  4MML A;  4O6J A;  2P4T A;  3OS0 A;  1U8R A;  3AHU A;  4M7A D;  3SB2 A;  3A8M B;  3QPH A;  2ZPG B;  2DXT A;  4LD9 K;  2XKO C;  5DY9 A;  3E9G A;  4M75 A;  4EMH A;  2ZPH B;  2YHT A;  3VJP A;  3EAE A;  4A4K A;  3CCM A;  4CI0 C;  4ELZ C;  5CQY A;  4AKG A;  4NL2 A;  4C0D B;  1G3Y A;  2WSF E;  3DB3 A;  3OYI A;  2CZ6 B;  2Y90 A;  2QFZ A;  4ELY C;  3JCM Q;  3CME T;  1D3B B;  1YJ9 A;  5LJ5 j;  1I8F A;  4NS5 A;  4QW2 A;  4F7U A;  2K3X A;  2EYQ A;  1R8O B;  3CCE T;  5A0G A;  1VQ7 T;  1OZ2 A;  2XK0 A;  4JX5 A;  2LDM A;  2LC4 A;  2HBP A;  1LOJ A;  4M77 D;  4HNU A;  2EQM A;  2KMT A;  1NE8 A;  3OYJ A;  3UDC A;  4GY5 A;  1P92 A;  1KQ1 A;  2E65 A;  4ZGE B;  1YJ9 T;  2L89 A;  2KDS A;  3QZ5 B;  3VV0 A;  4KUL A;  4M78 B;  4UC4 A;  3MO8 A;  3PMT A;  3KHI A;  2JN0 A;  5LJ3 g;  4TVR A;  2M9U A;  1WGS A;  1BI1 A;  3QO3 A;  2E12 A;  2L3R A;  1XNI A;  4DOW A;  1HXD A;  1Q81 U;  3HO8 A;  4M7A F;  3M54 A;  4A4E A;  2RHZ A;  3T9N A;  2KAF A;  2P0P A;  4XU0 A;  1WQ7 A;  4HCC A;  4N4G A;  3ZBD A;  1Q86 U;  3URG A;  1VQO T;  2Y4Y A;  4F7U F;  5FU7 C;  2OTL A;  2E5Q A;  5GAN 3;  1N6A A;  2EJF A;  1UGP B;  4M78 A;  4OGE A;  3VKI A;  2JUF A;  1QVP A;  5I2S A;  1FWZ A;  5CR2 A;  5LJ3 j;  3OMG A;  3FC3 A;  3CCJ A;  4MMK A;  2OAU A;  4B9X A;  5I21 A;  3CCR T;  3OB9 A;  4PNO A;  2Y4X A;  1Q82 U;  1S72 T;  3P8H A;  1MGQ A;  4OMF B;  5J3B A;  3SD4 A;  1KG1 A;  2GFU A;  4QQD A;  2V8I A;  2ZZD B;  2PVG B;  1KHI A;  5GAN f;  3HSB A;  3MHX A;  3FB9 A;  5HK3 A;  1G3W A;  5CKB A;  4FL6 A;  4M75 E;  4KBM B;  4WF2 A;  3LW5 E;  5IN1 A;  2E70 A;  4PLL A;  4IUT A;  2QDY B;  3MCA B;  2DTH A;  1G3S A;  4LDY A;  3UWN A;  1YIT T;  2K5L A;  3DLM A;  1M8V A;  2V8K A;  3RER A;  1NZ9 A;  5GAM f;  1KC8 U;  3G4S A;  2D6F A;  3OQ5 A;  1AHJ B;  4FU6 A;  3QYG B;  4E47 A;  4F7U E;  5GAN 6;  3X28 B;  3QJ6 A;  3GNG A;  4BE2 A;  4C8Q C;  1LJO A;  3CMA A;  4QSH A;  3M58 A;  3FRN A;  2R58 A;  2E41 A;  3HP9 A;  3KUF A;  4BD3 A;  1VQP T;  4M78 E;  1G3T A;  4M77 B;  1BYM A;  2RI3 A;  3TCJ A;  3JB9 H;  4OB0 B;  5KE3 A;  3OS5 A;  1IZ6 A;  2LRQ A;  3CEY A;  3HFO A;  3LX7 A;  3J81 E;  3A8O B;  2X4W A;  2MF2 A;  1XOV A;  3BFM A;  3JCM W;  5J26 A;  2DD4 A;  4AKI A;  2QF7 A;  4BDY A;  1MHN A;  3OW2 A;  1M1K C;  3R6O A;  5GMK l;  3HRU A;  4BBS M;  3G7Z A;  1QVG A;  3PNW C;  3PTA A;  2V8J A;  4F7U B;  2PUK B;  3QYH B;  3DLL A;  1VQP A;  3SFM A;  1W2B A;  2IG0 A;  3SWN C;  4N0A C;  5GAN e;  3JB9 G;  5FU7 B;  1YHQ T;  3OYE A;  3CXC S;  3I56 A;  4IUV A;  1JBM A;  5GMK j;  4C8Q E;  1SSF A;  4E7L A;  2A3L A;  3HZJ A;  4A4F A;  2P0K A;  1UEB A;  3P8D A;  2RHU A;  1N8R U;  5CKF A;  2O4X B;  1M5Q 1;  4QVC A;  4NL3 A;  5KCH A;  4EMK A;  5KH6 A;  1S72 A;  4J8O A;  1M1F A;  2E64 A;  3G71 A;  2JNG A;  4Y91 A;  3GIB A;  1W4S A;  2EAY A;  3C94 A;  2DTI A;  4BY6 B;  3OBY A;  3WVD B;  2G77 A;  4PJO E;  3BW1 A;  3HRS A;  1M1G A;  2X4X A;  4C5E A;  1KQS S;  1Q82 C;  2EIF A;  4OB2 B;  4C5H A;  3CCJ T;  2XDD A;  4XTV A;  3DB4 A;  3V7C A;  5EG2 A;  2DZ9 A;  3GF5 A;  1UGS B;  3S3O A;  3RKY A;  4C0G A;  4C92 A;  4ZGJ B;  2EQJ A;  1FXX A;  2LVM A;  3KBG A;  4XU1 A;  4C92 C;  3L2V A;  2QA4 T;  4IKF A;  4NC6 A;  5GAN g;  3G6E T;  3E9F A;  3VKG A;  4M78 G;  3OY9 A;  3CME A;  2FVU A;  2VXF A;  3M59 A;  1Q7Y U;  1K73 C;  5FU6 B;  2DXB A;  4QVZ A;  1M9S A;  4XU3 A;  3JAM E;  1VQK A;  2QQ8 A;  2HQX A;  2DO3 A;  4ME7 A;  4N4I A;  5FLX E;  5GAO r;  4C92 G;  4C8Q F;  1Q81 C;  2XU8 A;  4EMK C;  1YIJ T;  4C0D C;  2PQW A;  3JCM b;  3V7S A;  4HKE A;  2QQA A;  2RD1 A;  2DEQ A;  1VQK T;  4ELJ A;  2P0Q A;  4VUB A;  1GXI E;  3DL1 A;  3SWN B;  5GMK e;  2D0Q B;  5HY6 A;  4CRI A;  4HT9 A;  3NFC A;  4N0A A;  5LJ5 d;  4M77 G;  4RCB A;  3VYH B;  1WJR A;  3QYB A;  4MZM A;  5FRM A;  4ZTF A;  5D6Y A;  1VQ8 A;  5CQX A;  1KQS A;  5GAN 5;  4E7H A;  4II1 A;  3J7A F;  3OYF A;  1N27 A;  4BBR M;  5HKC A;  1UGR B;  4J5Y A;  1KHC A;  3TU4 K;  1Y07 A;  2OTJ T;  4IUR A;  1VQ8 T;  4JS4 A;  4MIM A;  1YJN T;  4QQG A;  3BG3 A;  1YBY A;  1VQ4 T;  3QXE B;  3FIF A;  5GAO p;  3CCU A;  1K9M U;  1UB4 A;  4BB7 A;  3PIP A;  1PSF A;  2LT4 A;  4XTZ A;  4XQ3 A;  1VQ7 A;  4XTX A;  3RMS A;  3S6W A;  5FRN A;  2DXB B;  3JB9 J;  1Q7Y C;  2DTO A;  1BI0 A;  4M7D D;  3JB9 F;  1HK9 A;  4AKH A;  1LNX A;  4R55 A;  2O4X A;  2FHD A;  3HFN A;  1WJQ A;  3BDU A;  2WSC E;  4QQ6 A;  4FM4 B;  3FDR A;  4EPC A;  5GMK i;  4PJO B;  4X34 A;  3H4C A;  2JVV A;  4JDS A;  5LJ5 g;  1BKB A;  4M78 F;  2RA2 A;  2M16 A;  3MEW A;  1O9S A;  4DA4 A;  1QP2 A;  3ASK A;  3OW2 S;  3GNF B;  4NOY A;  3QYE A;  3WVE B;  3OSV A;  3MET A;  3QJY A;  5CAI A;  3HKS A;  2XDP A;  5LJ5 f;  5FRO A;  2GQV A;  2RJD A;  1JJ2 S;  4ZN3 A;  3S3M A;  3OYH A;  2JTM A;  4M77 E;  4Q5W A;  4E7J A;  3V8J A;  1B34 B;  3EFS A;  2KSS A;  3OYL A;  4LDW A;  4PKC C;  1OYX A;  4HLQ A;  1VIF A;  1V29 B;  3GOX A;  3ZEH A;  4HT8 A;  3X25 B;  4BI3 A;  4OP0 A;  4D6W A;  4DQ2 A;  4M7A A;  3J80 E;  4C0Z A;  4FSX A;  2QQS A;  4LDV A;  1X75 C;  4C8Q B;  4M75 D;  3CCQ T;  1M90 C;  2ZCF B;  3LH0 A;  2K3Y A;  1K73 U;  2DAQ A;  3L2R A;  3CMA T;  4A53 A;  1N9R A;  3RKX A;  4BE0 A;  2GFA A;  3M5A A;  4XTW A;  1EIF A;  2LTO A;  3ER0 A;  2QI2 A;  3INZ A;  3M4Y A;  2DKG A;  4XTY A;  1KD1 U;  3OMC A;  4JS5 A;  5LJ5 h;  1YI2 A;  3C12 A;  5LJ3 e;  3OSS C;  3L2Q A;  1VUB A;  3MEV A;  3CCS A;  3QII A;  2H3J A;  3JCM f;  1VQL T;  5CKH A;  3F70 A;  2EQK A;  3CXC A;  3OYG A;  3GP8 A;  1M4Z A;  1BIA A;  2KQW A;  3M4G A;  5CIU A;  2MI6 A;  3CCV T;  4ZN1 A;  2XG8 D;  4OB3 B;  2X4J A;  2RB6 A;  3O8V A;  3QG1 A;  3HB9 A;  1JB0 E;  3CBM A;  3TEE A;  3JCM V;  1U1T A;  5M9O A;  1N8R C;  3JCM e;  3TW7 A;  1YIT A;  3E19 A;  3KXT A;  5GAN 2;  4M7D B;  5LJ3 f;  5GMK h;  5FU6 C;  3G6E A;  2VC8 A;  4M7A C;  2FB7 A;  4P5N A;  3NTI A;  4OVA A;  3CCU T;  2EFI A;  3L2Z A;  4RCC A;  4JX4 A;  2MWO A;  2ZPB B;  2DVE A;  4J6W A;  1OI1 A;  4Y28 E;  3LGF A;  2EQU A;  2RJE A;  1Y71 A;  4HCZ A;  4LD6 A;  4X9C A;  5A0D A;  1VQN A;  3HPW A;  1B34 A;  3NTK A;  4M6V A;  2DPP B;  4IUP A;  5GAM d;  3CC4 A;  2HNI A;  3QWL A;  4M77 F;  5GAN 7;  5GAO m;  1VQ5 A;  3TW6 A;  2CYZ B;  4JRK A;  3CPF A;  4M75 G;  2CZ0 B;  3VKH A;  5D6W A;  3OYK A;  4XTU A;  2OTJ A;  4R56 A;  5LJ5 e;  2DD5 A;  4AI6 A;  2DIQ A;  5GAM j;  4L59 A;  1VQM T;  4JLG A;  1K8A U;  2OTL T;  3A8H B;  4BI4 A;  2NLU A;  4N4H A;  1O75 A;  3LLR A;  4X9D A;  3VU3 C;  2ZZD A;  2ZGW A;  5DM7 R;  4B9W A;  2DXC B;  5CO7 A;  2RI2 A;  2CZ7 B;  2PU9 B;  1Y96 B;  2RJF A;  4RG2 A;  4M75 F;  4A4G A;  3OYB A;  1H64 1;  4M75 C;  5GAN h;  4C5I A;  4BE1 A;  1VIE A;  2R5A A;  3NTH A;  2C06 A;  1KQ2 A;  5GAN d;  5J39 A;  2R5M A;  2K2V A;  5DLO A;  1E7P A;  3FJP A;  2VGN A;  3MP6 A;  3CCE A;  2RJC A;  2XD0 A;  3A5Z B;  4JUV A;  2MWP A;  1Y7X A;  5GAO l;  3L42 A;  5C0M A;  4Z6Y A;  4J83 A;  2K5F A;  2QDJ A;  4JX6 A;  4M78 D;  3PIO A;  1XTD A;  2ZPF B;  2BIV A;  4JRI A;  3ZFJ A;  4C8Q D;  5GAN j;  4KT0 E;  1QLB A;  3CBP A;  3I55 T;  4A54 A;  3QZ9 B;  2PVO B;  4M7D E;  3WXM B;  1Q86 C;  3I56 T;  4M7A G;  5CCA A;  3JB9 D;  4M7D F;  4C5G A;  1YCY A;  4E7K A;  2VUB A;  4L6V 5;  4OB1 B;  3OYM A;  3M53 A;  1BI3 A;  2VV5 A;  3JRZ A;  2CS7 A;  2BS2 A;  4YTL A;  2L5Q A;  3SDZ A;  2E10 A;  3A8G B;  3MP1 A;  3VYG A;  1VQ9 T;  2JOY A;  3CCM T;  1UGQ B;  4HL4 A;  4LOC A;  1ZQ1 A;  1K8A C;  2AHJ B;  1JJ2 A;  3A8L B;  3PMI A;  2WSE E;  3I55 A;  3QBY A;  2ZPE B;  3ME9 A;  1ZHI A;  3QDR B;  1WPY A;  2B8A A;  2F5T X;  2O01 E;  3OYD A;  2QEX A;  3UPU A;  5IT9 E;  1YI2 T;  2FL7 A;  4BAC A;  1YJW A;  4A4H A;  3MP8 A;  3LYI A;  1I4K 1;  3C95 A;  3L2U A;  2WAC A;  3QUI A;  1Y96 A;  1K9M C;  2EWN A;  4M77 A;  2BKD N;  2DJZ A;  2QTX A;  5KCO A;  3CD6 A;  1G5V A;  3CCQ A;  4M7A B;  3PFS A;  3VUZ A;  4EDU A;  3JCM J;  2CGH A;  3RUX A;  1M1K U;  1QVF A;  1BIB A;  2QQB A;  4M7D C;  3EFR A;  3RMQ A;  2DD5 B;  3BG5 A;  3GLX A;  3JCM g;  3TRE A;  4C0F A;  3QKJ A;  2K4Y A;  3OA6 A;  3E1S A;  4PJO C;  1RI0 A;  2LCC A;  2DIG A;  2HD0 A;  4M75 B;  5AYF A;  3M55 A;  2QEX T;  5GAM h;  1VQO A;  1ZBX A;  3QSU A;  3BG9 A;  3SWN A;  1QVF S;  4ATO A;  5A0L A;  4L5G A;  1I81 A;  3L1A A;  5HK0 A;  3Q1J A;  3G71 T;  2WJ9 A;  4C92 F;  4C8Q G;  3H8Z A;  2E6N A;  4OGC A;  3L2W A;  2ZPI B;  2EJG A;  2QQR A;  5L8R E;  3LWH A;  4J6X A;  1YHQ A;  2KMG A;  2RM4 A;  3H6Z A;  2I2L A;  4JRP A;  2RH2 A;  5CKD A;  2DK3 A;  2XIC A;  2BS3 A;  4ZTJ A;  5LJ3 d;  4C92 D;  3V8K A;  2CZ1 B;  4E7I A;  3OS2 A;  1VQ5 T;  2K5I A;  2MMP A;  3MEA A;  1QW1 A;  1RL2 A;  1JRI A;  2DZC A;  3M9Q A;  4PJO F;  3CBO A;  4HA8 A;  2MAM A;  4O5V A;  4HNV A;  3FEO A;  1PSE A;  1N9S A;  5IAY A;  1VQL A;  1NJI U;  4MFD A;  3JCM P;  3X26 B;  2EKO A;  2LQ8 A;  2HQE A;  1YJN A;  3UT1 A;  5GMK m;  1QVG S;  3M57 A;  3JCM h;  3JCM d;  4XU2 A;  2LNV A;  2X4Y A;  2LQK A;  5GAO n;  4XK8 E;  4C8Q A;  3JCM c;  3GPL A;  4DOV A;  3JSC A;  2RK2 A;  5CK9 A;  2E6Z A;  3CCR A;  3CC4 T;  2LCL A;  4MFE A;  3OBW A;  2YRV A;  3RIR A;  3CD6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...