3A8OB

Crystal structure of nitrile hydratase complexed with trimethylacetamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8oB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8oB02
4RKUE 3QYGB 4Y28E 2DD4A 2DXCA 1QP2A 4XK8E 2AHJB 3QZ9B 3VYGA 3WVDB 2ZPBB 2PVOB 4OB0B 2ZZDB 2PU9B 3X24B 3A8GB 3A8LB 2ZZDA 4OB1B 2CZ7B 2CZ0B 1PSEA 1GXIE 3QZ5B 2CZ6B 2ZPGB 2DXBB 4KT0E 4ZGJB 1UGQB 2O01E 1QP3A 1UGRB 3WVEB 1JB0E 1UGSB 2ZPFB 3HHTB 3A8MB 4OB2B 2DPPB 1IREB 2ZPEB 4OB3B 2PUKB 1UGPB 2WSCE 1AHJB 4ZGDB 4FM4B 1PSFA 3QXEB 2PUOB 2CZ1B 2DXBA 4ZGEB 3X25B 2CYZB 2D0QB 2ZPIB 2DD4B 2DXCB 3X28B 2PVDB 2ZCFB 3QYHB 2ZPHB 3LW5E 5L8RE 3VYGB 1V29B 3A8OB 2PVGB 2DD5B 2WSFE 2WSEE 2DD5A 2QDYB 3VYHB 4L6V5 3A8HB 1DJ7B 3X20B 3X26B
chains in the Genus database with same CATH superfamily
1Y07A 3THKA 2ROLA 4CFUB 3VKHA 2K6DA 2K79A 2Y90A 1XJWB 3M5AA 5HK3A 4PJOA 3NFCA 2LJ3A 4M7AE 3RGFB 3CC2A 3VYGA 1XNIA 2O4XB 2WPAB 1YJNT 4F7UA 2AZVA 2G3RA 4R56A 2KDSA 3CCEA 4ZNXA 4KH1B 2WHBB 3F5XB 2LT4A 2QI2A 2X3WD 3KBGA 4M78C 5LJ3e 4AFUC 2C5NB 4J9CA 3KUFA 4ZTJA 4KRCB 2FRWA 2KR3A 2RI5A 1MHNA 1SRLA 3BG9A 1TD6A 2DO3A 1PKTA 1YITQ 4E7LA 2Z0WA 4PLLA 2E4HA 2VXFA 3G4ST 3JAME 4BCGB 1H4LD 1AD5A 1VQPT 3RBBB 1TUDA 5GAMd 1WQWA 4OMNA 2QQ8A 2KQWA 1SPKA 1FXXA 4KBMB 3P8DA 4NL3A 4KULA 4M78G 5KYXB 3MCAB 4BY1X 4C92E 2CDTA 5GANe 2FPDA 3M54A 2ENMA 4QQ6A 3FJ5A 3JB9H 2K2VA 5GMKh 4FSSA 3UWNA 5IF1B 4FYWB 2D9TA 1OKWB 3L42A 2K3BA 1Z9ZA 2E5KA 1P5EB 1JXOA 4HNTA 3CC2Q 4ELLA 3OW2P 2HQEA 4JX5A 2VASA 5CKFA 2GTJA 5I2SA 2DA9A 2WJ9A 3OBWA 1ARKA 2LX9A 3OYHA 4CXAB 3JCMb 3SD4A 1D1AA 3URGA 3CCLA 4M78D 4CRIA 5GAOp 5IT9E 4PJOF 5KE2A 4IUUA 3OYYA 3X26B 1NPRA 1UJYA 5KYUB 3JV3A 4M75A 4I3ZB 2QFZA 3BHTB 2DLPA 1G5VA 3NTHA 4OGRB 2OTLT 2IPOB 4F7UF 3CCUA 2E3IA 3T9NA 2LQKA 6AT1B 5I5ZB 4LXCA 3HB9A 5LJ3f 1RABB 5KCHA 4WTOB 1YWPA 4C8QE 4B6MA 3S3OA 1G3TA 1OOTA 4UC4A 3RKWA 5ICPB 3GF5A 2QA4T 2ZZDA 2RK2A 2EGAA 2P0KA 1WI7A 4OF1A 5GMKi 2CS7A 2CZ0B 3CEYA 4IMYB 1P92A 5I11A 3EGXB 1ABQA 2RHIA 2GNCA 3HZJA 2KSSA 3NTIA 2MYSA 2RQVA 1A0NB 3RMQA 1OI9B 3CC7Q 1VQNQ 2PJQA 2F69A 5IHIA 4QSHA 1UJ0A 2KY9A 2CT3A 4FT4A 3G6EA 1Q7YR 1I0CA 3CCLQ 1WX6A 2A3LA 2CP0A 1H1PB 3CMAQ 1D0XA 2HNIA 2JT4A 4OVAA 3QXEB 3QDRB 2XDPA 2BZ8A 2DXTA 3OYMA 3CCUQ 3CXCA 1R77A 3VS3A 2PTKA 2ZAEA 4OMMA 4L5GA 3UPUA 2VVKA 1JKWA 4FL6A 4CFMB 5CO7A 5I2MA 5LJ5j 2C0TA 1NBEB 3M4YA 4EOLB 4PJOB 2QQBA 4E2FB 1JQQA 2OTJA 2K4YA 2R5MA 1D3BA 3QIIA 1BI0A 3VYGB 8ATCB 4FW1A 4OGEA 1W2BA 1IHWA 4M75F 4F7UB 1OIYB 3ASKA 2MAMA 2NWMA 5GAN5 3BFMA 3CCMQ 3LGFA 4F70B 3BDLA 3ULRB 4OP0A 3S3MA 4PK4A 4CFUD 2X4YA 1H1QB 5HBHB 4BBSM 3M4GA 1WJSA 2CSIA 2EYWA 3BLRB 1YP5A 3NHNA 2QGFB 3VUBA 2WACA 3G6EQ 2DD4A 3OYFA 4BCHB 3QSUA 1URCB 1Q82U 4J9GA 2JOYA 4HVVA 4PLIA 2A08A 2H8HA 4OMQA 2UZBB 3G71T 4BBRM 2FL7A 4M78E 4JJDA 2I40B 3REAB 3JCMQ 1M9SA 2CZ7B 4BE0A 2RNAA 2E64A 3CPWA 3L2VA 3JB9D 4KT0E 1R0BG 5GAOn 5DQWA 2OTJQ 4LUDA 2V8KA 3FRNA 1GUXA 2VXEA 4JRPA 2I53A 4EDUA 2KROA 2ZPFB 5LJ5h 4LDYA 5KYNA 4M77F 3CCQT 1E9HB 2EQKA 4LDUA 2FG0A 2L3PA 2PQWA 1KQ2A 1KQSS 1NZ9A 1YN8A 4A4EA 1ZBXA 3RR6A 2YUNA 4XU1A 2NUPA 4OGCA 2MPXC 3QWLA 1ZLMA 3JSCA 2RK1A 2E65A 2PUOB 1IGUA 2KMTA 2G77A 3BW1A 3FDRA 4RG2A 2WEVB 1H26B 2H3EB 4M75B 3BLHB 4E6RA 1N8RC 1ZSZA 1QVPA 3TW7A 4FCYA 1VQMT 1E6GA 3PMIA 1YJ9T 4MFDA 4J6XA 1B34A 4HNUA 2XHCA 2ZGWA 2G9XB 4EONB 1UB4A 3HBLA 3PT9A 5GAOm 3KXTA 2EKHA 2XDBA 5IDNB 1YCSB 5HKCA 4FX3B 2FZGB 4PKCC 1SEMA 2JM8A 4HCKA 2EIFA 1OIUB 2SEMA 1C1AA 1VQ7T 3CD6T 4PJOC 4RCCA 2VV5A 5EFQB 2P4RA 1WNLA 1LJOA 1IHVA 3PMTA 4MIMA 3CBOA 5DM7R 1YJWA 5CYIB 1KQSP 3HRTA 5IHKA 2LRQA 3M58A 1VIFA 4DBHA 1IRXA 5A0GA 1S72T 1YHQT 4AKHA 1S1NA 1I4K1 1NLOC 3BG5A 2YLBA 4PJOG 1H92A 3EAEA 1QKXA 1NG2A 2HSEB 4BD3A 2M9UA 1M2VA 1TG0A 1VQ5T 3QDFA 1D0YA 1ZUYA 3RUXA 4C0FA 2LC4A 1UGSB 1GFCA 4QVCA 4F7UG 3HPWA 1M4ZA 1TWBA 4J9DA 1D3BB 2LT1A 2YXYA 1FINB 4OR5B 3CCST 3AT1B 1WJRA 4FU6A 3EJ1B 1VQ6T 1HD3A 2QGSA 3EG1A 4P5NA 1HSQA 3TEEA 2ECZA 2XK0A 1NE8A 5CVIA 4PJOD 4HNVA 2DAQA 3CCRA 1VQ8A 1VOMA 2P84A 2DD4B 1HK9A 1VOLA 2RJDA 1YJWQ 2YRVA 2XDDA 5IHYA 3EGDB 5GAMj 1ZUKA 4A54A 2LTOA 3JCMV 3MKDA 2VKNA 2V1QA 4MMLA 3VUZA 3QHWB 4OMLA 3P8HA 1FMVA 4FSXA 1WJQA 3CXCS 1AWOA 3PTAA 1W98B 4EOOB 3E9GA 4ESRA 3PGGA 3BY7A 4NS5A 2RI3A 3LH5A 1GL5A 1KC8U 4M75C 3OYAA 1QLBA 1D1BA 1GCQC 2YRCA 1WHGA 4VUBA 2FZCB 4BB7A 2BS2A 1TUGB 2M16A 4N0AA 1GH6B 3J7AF 3SHWA 3BHUB 3E9FA 4Y92A 2FVUA 3MIAB 2YUQA 1AT1B 1GUXB 3OYJA 2K57A 2BS3A 3EG0A 1I5OB 1OZ2A 2LDMA 2WFYB 1WHJA 5C0MA 4HCBA 3GOXA 1OPLA 2BKZB 2LQNA 3VRYA 2EGEA 3VS4A 2NUPB 1MMAA 4M75G 1PWTA 2M1HA 1QW1A 3C0CA 1VQOQ 4E7JA 2XD0A 2YLCA 1PD0A 2KMGA 3AHUA 3G33B 1GXIE 1YI2T 1VQ8Q 1Q82C 1UHCA 4XAXB 2LP5A 1U8RA 4ZGJB 2O01E 3HL8A 1ZSZB 2NLUA 1VINA 3JCMW 1I1JA 1YWOA 2JJ9A 2AT1B 1JB0E 3VS7A 1YNZA 1V76A 1PRMC 3CCJQ 3INZA 5I22A 1NYGA 2C5OB 2IVXA 4XTVA 3LQ5B 4BCQB 4C92D 4IUTA 4N4GA 1ABOA 1B34B 3B57A 2C5XB 1GFDA 1T0HA 4BI8B 4EMHA 4NC6A 5GAOl 3EFRA 1G3SA 4PFPA 4E7KA 2DERA 2K9GA 2O9VA 3M0PA 1X2QA 3C4SA 1LNXA 2EYZA 4DEYA 2LW4A 3X25B 3DLLA 4AI6A 1ZUUA 3I55T 3FLGA 2LJ0A 4G6LB 1FYNA 4EOJB 2W96A 2RD1A 4YOZA 2E12A 3H0IA 2UZLB 2CP2A 2PK9B 4A4HA 4PL6A 2KT8A 2GQVA 3PFSA 4J9HA 3FB9A 5LJ5g 4EORB 1KSWA 2DZCA 1PRLC 2DKGA 2EYQA 2LCCA 3VYHB 1GCPA 2DTOA 3OY9A 2A0FB 2FPEA 2CP3A 1KC8R 1DJ7B 4XTXA 4X9CA 4PJOE 4ELYC 3SFMA 4YC3B 4QVZA 1FMWA 4RODA 8AT1B 3QYGB 1M2VB 1VQKA 3DJBA 2X3XD 4XTYA 3MJXA 3OQ5A 3KHIA 1OULA 1VQLA 4F7UE 4J6YA 1M3CA 2JVVA 2X35A 2P0QA 2PVOB 1Z9QA 4IURA 2JW4A 1BI1A 2HEQA 4KUDK 4ORZA 2YRDA 4EC9B 3LGLA 2IVWA 4Y72B 2RQUA 3OW2S 4AKGA 1PSEA 2CH4W 3M53A 3QZ5B 4TTHA 1XTDA 1ZBJA 1K73U 1X2KA 3MP1A 4PJJA 2DL8A 1TXQA 1AISB 1UGRB 1YJNA 1UECA 1JJ2P 2HAXA 2QGGA 3MY1B 3VKGA 1WZOA 4OB2B 5HVYB 1EZZB 4J5YA 4BCFB 1KQSA 4RG8A 4OB3B 4N4IA 5LJ5e 3PO3S 1VQ4T 4F6UB 2WSCE 2RHZA 1OKVB 3SDZA 3CMEQ 3G4SA 1WGSA 3H41A 5KYYB 1VQKQ 2QQSA 4V2SA 5KCOA 2L2PA 2LQ8A 1VQPA 1T3LA 1ZSZC 1UEBA 2W9FA 4DEXA 4BACA 4CI0C 5CKHA 1UHFA 2D0QB 3M9QA 3V8JA 1Q7YU 1QVFP 1M1KC 2D0NA 4HVUA 3BDUA 1OEBA 2O9SA 3X28B 4LDXA 2PVDB 3M0UA 2DEUA 1HYOA 4LD6A 3SEMA 2DD5B 1C0MA 2KE9A 2W2HA 2F5KA 2KGTA 2K7AA 3HRSA 2E41A 2QDYB 2CT4A 1O9SA 2DTHA 3TVTA 4M75E 4RTZA 2Y4XA 1NPPA 4LDVA 1K9MU 1PM3A 2E10A 1BCMA 2EQUA 1JEGA 3V8LA 3OYGA 2X1NB 1I5LA 4CFXB 3CCEQ 2DXCA 2V8IA 3M56A 3LX7A 2KAFA 1H24B 4HCCA 1VIEA 2XICA 3X24B 2V8JA 2YUPA 5GAN8 3G4SQ 3A8LB 5CEIB 3V8KA 3H0FA 1ENWA 3NMZC 3MEAA 3QO3A 1VQPQ 2D8HA 4JDSA 2OTLA 1Y7XA 1M90C 4LD9K 3CC7T 1VQNT 2DL3A 4ZN3A 3P8BB 1K73R 4F6WB 4ELZC 5LJ5f 2L0AA 4J8OA 4EPCA 4XU3A 1H3HA 4EC8B 4F7NB 4BCQD 4ELJA 2KXCA 1C6VX 3QWYA 4CC4B 2DPPB 3CMAT 1RAHB 3F70A 1OL1B 1LCKA 2RHXA 1VYVA 1KD1R 3DDQB 3POMA 1VQ9A 3CCUT 1PKSA 3LLRA 4PNOA 3LWIA 1UGVA 3O5ZA 5LL6S 2DJZA 2HQHA 3JRZA 1PSFA 5FWCA 2RQTA 1KHIA 1N9RA 2D1XA 4DA4A 1YIJT 3V7CA 1VUBA 2RA2A 2MOXA 2X4WA 3EFOA 4M7AF 3CCVA 4EOIB 1WHLA 4Z02A 4J9FA 1AWJA 1CKBA 2QEXT 1K0XA 4N4HA 5L8RE 3OS2A 4M77A 4PJNA 3CCMT 2KYMA 2VUBA 2RJFA 4WCIA 2VB6A 2OTLQ 1HJDA 3BE3A 3L2QA 4PFZA 4M7DA 5GAMg 2QDLA 3R6OA 4JRIA 2F2XA 3G6ET 3RKXA 1Q86U 5FWBA 3UDCA 3QHRB 1K9MR 2BZXA 4BXXX 4JX6A 1H8KA 1KK7A 3QJ6A 4J9EA 2K2MA 4RCBA 1OU8A 1AOJA 1RLQC 3GNGA 3OYNA 4RTUA 2PK2A 1RI9A 4JRKA 3VU3C 2CSQA 1ZHIA 3JB9I 2CUDA 1G3YA 5IN1A 2YWWA 1MNDA 3JCMh 2WMBB 1VQ9Q 1WYXA 3SWNA 1M8MA 1B07A 2GFAA 4IUQA 1WIEA 1YBYA 1VYUA 2R58A 1XO2A 4OB1B 1RACB 1BIAA 4CC3A 3VS5A 1RAGB 1K8AU 1QVGP 2ZPGB 1TS9A 2W9ZA 1NJIU 5KH6A 4C0GA 3CCVQ 2JGZB 5IXFA 3MEUA 2F2WA 2V22B 3TCJA 3DKMA 4BDYA 1N9SA 4XQ3A 4RTWA 3G71A 2RJCA 3GNFB 1BKBA 3M0QA 1QCNA 2FO0A 2LQWA 4BY6B 3PVLA 2DIQA 4M6VA 1WXUA 4CRLB 2NUZA 1PD1A 1W1FA 3HRUA 1PNJA 2EWNA 1AZEA 1H25B 4ATOA 2ROTA 3RMSA 2DK3A 2R57A 5GAMe 3OSVA 2CKKA 3WXMB 2WXVB 3CCQA 1OGUB 4MFEA 4JS4A 1H1RB 1G2BA 2EJ9A 2JUFA 2DBKA 1Q81U 3QYBA 4M7DF 2DXCB 2EBPA 2AIRB 2E3HA 4C8QF 1MGQA 2E70A 5GMKl 2ZPHB 3EG9A 1QMZB 4O5VA 5L23A 2HD0A 1LVKA 5KE3A 3DL1A 3E2UA 2MWOA 3DOGB 1Q7YC 2EJFA 5FROA 2CGHA 4Y91A 1Q86R 1VQMA 2K3XA 1YJ9A 3OYKA 2HQXA 3NDQA 1JBMA 4BCNB 4QVDA 2W10A 3QKJA 1R8OB 1QKWA 1H3ZA 1SHFA 3G1JA 4BCPB 9ATCB 2K5FA 5GJWB 3H4CA 2DL7A 4BCIB 3EG3A 5FW9A 5GANh 4FYXB 2IW6B 2ZPBB 2B86A 2ZZDB 2MI6A 3OYBA 2L8DA 4CC7A 2KRSA 1GY3B 2ED1A 3CCQQ 1VQ7A 5HBEB 2PMIB 3EH1A 4GY5A 2R7GA 2EW3A 1G83A 1K8AR 3OW2A 1NJIR 2GF7A 3JCMd 2LX7A 5ACBA 1QP3A 2E1HA 1GRIA 2NUTA 1G3NC 3QUIA 4JZ4A 5GAMf 1JSTB 3HHTB 3EFOB 2BE7D 1X6BA 3GP8A 3L2WA 4XTUA 1S72A 2C5VB 4ROCA 1QCOA 3V7RA 4MZMA 4JPBW 4EMKA 4M77B 1JXMA 1YHQA 4AMCA 3CBPA 2MCNA 1VQMQ 1YJ9Q 4M7DB 2CP7A 4PFOA 1VQ5A 3DB4A 1WHHA 2DEQA 3D7SB 2HKNA 5HBJB 1AEYA 3OMGA 4J9IA 3OYLA 1OPKA 2VC8A 2E6NA 2K5IA 3CCSA 2QAZA 4BY6C 1Q81R 2F2CA 4MDXA 1BYMA 2MIOA 1Y96A 1VQ6A 1UUEA 2RQWA 3SWNB 2RB6A 3I5RA 5GAN6 1VQ7Q 4F7JB 2J6OA 2IN3A 3EOCB 1ZQ1A 1VA7A 7AT1B 2VGNA 3TNWB 5GMKe 4KGXB 1ZA1B 3L1AA 3ME9A 3VRZA 2KXDA 2PHGA 2VGMA 1S72Q 2GCXA 1XOVA 5LJ3d 1YHQQ 1H1SB 5CQXA 2X9HA 5GAOr 3HTRA 4BUGA 1X6OA 1VQOT 4XU0A 4IKFA 3K7AM 2PU9B 2V26A 4F17A 2DRMA 2J7IA 2QQAA 3RESA 1JOWA 2RPNA 1JO8A 2A28A 1UFFA 2M51A 2FHDA 3MEWA 2DIGA 2LJ1A 2MWPA 3E1SA 1UE9A 2JNGA 1N4MA 4J7FA 3M0RA 4EMGA 3CCJT 2GQIA 3CCSQ 2RQRA 3MY5B 5D6WA 5GANd 4RTVA 1VQ6Q 4BCMB 2KR6A 1OV3A 3I5SA 2JS2A 3JB9J 4JRQA 5GAN3 4KGZB 2KT1A 3ZFJA 2LVMA 3ZEHA 1MMGA 2YT6A 3OA6A 3OS5A 1YI2A 2LMJA 3JCMg 2FPFA 4AG1C 4J7IA 2HCKA 3CCRQ 1AHJB 1TH7A 2OAWA 5J26A 5EJCA 2DF6A 2H3JA 2I0NA 1WDXA 4ZTFA 3NGPA 2A36A 2EKOA 2CYZB 3J80E 3CC4T 2R5AA 1E6HA 3MPUB 2HBPA 3I56T 4JJBA 3TN8B 5A2QE 2FEIA 3VS1A 3EFSA 2ZCFB 4M77C 5IHNA 3LW5E 3CPFA 1OX9A 4J9BA 4M7DC 4B9XA 4FT2A 4M75D 1U5SA 1FX7A 4HKEA 4D6WA 3ZL7C 2DNUA 2X4XA 1M1GA 3H0HA 1GBQA 3I55A 2CP6A 3X20B 1JJ2S 4BCND 3TQ7P 1D3UB 1AZGB 2QQ9A 2GBQA 4KUIA 4D8DA 1UNLD 2W99A 2ED0A 4Y28E 1OI1A 4M77G 3JCMP 1N6AA 1QP2A 4X9DA 3SWNC 5GAN7 4DOVA 2KEAA 1K4US 4M7DG 1BI3A 4KRDB 4EMKB 4JJNK 1KG1A 2Y4YA 4KGVB 1GBRA 1W2BP 2DX1A 4CFVB 4J83A 3BLQB 4NOYA 1QVFS 3LWHA 1W4SA 2RO0A 3JB9F 3EGXA 2XU8A 4RUGA 1PKDB 1MV0B 4C5HA 2F1LA 3BHVB 2JTEA 4OMOA 1MMDA 2DL5A 2EUFA 1B3QA 2HL3A 2V1RA 2QTVA 5D6YA 4CC2A 1K1ZA 1NLPC 1FVVB 2RM4A 4WF2A 2C6TB 4X1VA 4M77D 2IIMA 2OX7A 2P4TA 1HXDA 3JCMc 1TUCA 3I35A 2IG0A 1Y96B 2BPMB 2JTMA 3OS0A 3CMET 4M7DD 1YITT 3HO8A 3EG2A 2JN0A 1W6XA 2ATCB 2DETA 4ZGDB 5GANg 2CREA 4F04B 2A37A 3TNHB 1YCYA 3Q1JA 2DXBA 1IO6A 5CKBA 4RTTA 4DBQA 4Z6YA 1SSFA 2EYYA 5DQVA 4LOCA 1PHTA 1KD1U 2DBMA 5FRMA 1VQ4A 2LZ6B 4OMFB 1RAEB 2MMPA 1NEBA 3OYEA 4L59A 4F16A 3CC2T 1VYTA 5FLXE 2M02A 1OX8A 1VQLQ 2J6FA 1OL2B 3CCET 3MP6A 4QT7A 5ECAA 2E6ZA 4HT8A 1C9BA 2E5QA 1NYFA 3QHSA 2C06A 2EQJA 5BNJB 4AFZC 4EIKA 3HFOA 2X51A 1D1CA 5FGKB 1ZA2B 2J05A 2J06A 3JCMf 4GLMA 2DVJA 4PJLA 4BI4A 3O8VA 1B7TA 3WVDB 4M7AA 2OI3A 1AWWA 2M0OA 2EAYA 2UZEB 2PNIA 4MZTA 1N5ZA 1N8RU 3META 1M27C 1QWEA 1YJNQ 3R6NA 4DOWA 3DTOA 1V1CA 3PE0A 4XTZA 4ME7A 1PC0A 3UT1A 4A4KA 4AFQC 1K76A 2RF0A 2L89A 1RAIB 4BCMD 2NYSA 2HKQB 1VQ4Q 2RHUA 1KC8C 5GMKm 2DMOA 1RI0A 3A8MB 2JM9A 5M9OA 4EMKC 4EOMB 2DRKA 2RN8A 3J81E 3EGUA 1IREB 1G3WA 5AYFA 2F2VA 5A0LA 4Q5WA 3CC7A 1VQNA 2BKDN 1CKAA 5J3BA 1Y0MA 5GAN2 4JLIA 1PG5B 2QXFA 4C92A 4IIOA 1SKUB 3GIBA 1Y71A 3G7ZA 2VYTA 2FRYA 2M0YA 4NSTB 3CCLT 2FYKA 1IXDA 1M1FA 2DYIA 2KRMA 1KJWA 4LN2A 2QA4A 1OU9A 1KHCA 3CMAA 2HL5C 4MMKA 1GCQA 3IQLA 4M77E 4Z88A 4IIMA 4XU2A 3UA6A 1KQ1A 3RDVA 1UNHD 3BG3A 4M7DE 3QBYA 3E19A 3HSBA 3CQTA 3FJPA 4D8KA 3FEOA 1QVGS 3DDPB 2LCLA 3FC3A 1M5Q1 4A4GA 1YIJA 4YOSA 1E7OA 2G6FX 5D6XA 1R0CB 5KYWA 5DLOA 2QEXA 1M30A 4IUPA 1VQ9T 1RLPC 3CCMA 1MUZA 1QQJA 5CCAA 4XK8E 3TSWA 3EIDB 2QK0A 5GANf 3QZ9B 4HT9A 2C0OA 2KBTA 3VS0A 3QG1A 1KIKA 2L5QA 2VWFA 4R55A 1D09B 4C8QA 4JJCA 3OYIA 2L3RA 3NPFA 2IW8B 1N8RR 3C95A 2CCIB 3CCVT 4E47A 4N0AC 1IB8A 1TOVA 1BK2A 2D8JA 2DTIA 2RJEA 2QA4Q 4JUVA 2SRCA 4C0DB 1QMCA 3M59A 2DXBB 2FZKB 3V7SA 1O75A 3JCMJ 5CR2A 1TFBA 1QLYA 1FMKA 2DL4A 1G8XA 1NEGA 3OMCA 3UATA 4DQ2A 5LJ3j 1SRMA 3UF4A 3A98A 3JCMX 1SHGA 4B9WA 4C92F 4QKUA 5DLQE 3O0GD 2OAUA 4A63B 3SB2A 1YIJQ 1K9AA 2OTJT 5CIUA 1UGPB 3MHXA 2HBWA 4KH0B 2QEXQ 1SG5A 1AD6A 1JU5C 2CZ1B 3UA7A 3ZBDA 4ZGEB 1X27A 4TVRA 3JB9G 3OS1A 5GANj 5HY6A 1MMNA 2CP5A 2BZYA 2YUOA 4IUVA 4AT1B 5DY9A 2WMAB 4CFNB 2HMAA 3LYIA 4M4ZA 1QCFA 1K73C 3EGDA 2L3QA 2RH2A 2PVGB 4M7AB 1I81A 5FRNA 3TW6A 1KXUA 4YTLA 3PNWC 2L3SA 1H28B 2GFUA 3VS6A 2KRNA 2I2LA 4K11A 3A8HB 1WHMA 2QDJA 1KD1C 2LNVA 4FIBA 2UUEB 1RL2A 1JJ2A 2JXBA 5J39A 4F7LB 1RAFB 3MI9B 1H641 2RMOA 1WPYA 2C4GB 4II1A 4RTXA 2B9RA 5CQYA 5LJ3h 2YDLA 1VYWB 4LNPA 4GBQA 1AVZC 1RADB 4XTWA 3VV0A 1K0SA 1EIFA 4R0KA 3TSZA 1UTIA 1EX4A 5FU7B 1WHKA 2QF7A 3A1PA 4M78A 4C92B 2O2OA 2XG8D 3EHQA 3PIPA 3G71Q 1UDLA 2COYA 1T0JA 4Z8AA 5C6SA 2CH4A 1QVFA 5GAN4 4AKIA 1YFNA 2YHTA 2JZ2A 4OMPA 4JX4A 1X43A 1LPLA 2XMFA 2DM1A 2FB7A 2RI2A 2ABLA 2DXUA 2EQMA 2KK4A 2OJ2A 4BE2A 1K9MC 4C0ZA 1I07A 4CFWB 1O9KA 2JMAA 3C12A 3M03A 3ER0A 2DE0X 1JSUB 1FKMA 3CD6A 2DJQA 2PUKB 3H8ZA 1ZX6A 2RHYA 2HDAA 1BCOA 4FM4B 4O6JA 4C0DC 4HCZA 3C94A 2O88A 2A7YA 1X01A 3OB9A 1IZ6A 5KYWB 2DFUA 4C5GA 5IH2A 3EH2A 5HQ0B 2ZPIB 1U3OA 5L2WB 3VS2A 2EVRA 4BCOB 4E7HA 3VJPA 3RNJA 2EPDA 3RERA 1I8FA 3A8OB 2X4JA 2KVQG 1Q82R 4II5B 4C8QB 3U23A 5GAOq 3I9QA 2WIPB 4F6SB 1YJWT 1N27A 4BCJB 2JTFA 1M3AA 2B8AA 2P0PA 5CK9A 4RKUE 3QWXX 1CSKA 2COWA 2F5TX 1UG1A 5IXBA 5IAYA 2BIVA 3M55A 3L2ZA 2LNHB 2DMEA 2MK5A 1BB9A 1NM7A 5A0DA 2XI9A 1RUWA 2C0IA 2QG9B 4DBFA 2HZYA 5EC7A 1FWZA 4M7AC 3CD6Q 1X69A 4M78F 1BU2A 1M8VA 2XIDA 2EGCA 4LE9A 4ROEA 2ESWA 3A8GB 1ACMB 5D7UA 2QASA 3QYEA 1LOJA 1WA7A 3HFNA 3S3NA 2YSQA 1WFWA 4JZ3A 1PCXA 1M1KU 3VKIA 4A4FA 2DILA 2JMCA 5IDPB 1U1SA 2CZ6B 4PJMA 1QWFA 2KNBB 2W0ZA 3PIOA 3MEVA 1UGQB 1BI2A 5LJ5d 1VQOA 4M7AG 2HSPA 1Q86C 4EOPB 1SF9A 1BBZA 4EOKB 3EHRA 1J3TA 2O4XA 1VQ5Q 3CCRT 1VQ8T 4HL4A 1T3SA 4HVWA 4E7IA 5FU7C 2EJGA 2BS4A 3TREA 5CAIA 1D0ZA 4C92C 3CCJA 1M2OA 3MO8A 3M0TA 4ANJA 4FYYB 4GLKA 4JLGA 5FU6B 4E7SA 1Q95G 4RMOA 2DYBA 1SSHA 1XQHA 2GTOA 3CBMA 2EQIA 3A5ZB 3GBQA 5KYYA 1OZ3A 4HA8A 5CKDA 3GPLA 5GJVB 5LQFB 4EOSB 2AKKA 1IGQA 2QYZA 2BTTA 2IW9B 1K8AC 4UN0A 3EG9B 1BU1A 4A53A 4M7AD 4DBRA 3QYHB 1NJIC 4HXJA 1W2BS 1OYXA 2QQRA 1V29B 2O31A 3S6WA 5KYXA 4C92G 1M90U 3RIRA 2EYXA 3TU4K 2JS0A 2WSFE 1ZP2A 3NTKA 4MDWA 2DD5A 4MZPA 1QVGA 2BUDA 3CC4A 1AWXA 3H6ZA 2AZSA 4M78B 2BE9B 1F5QB 3MP8A 2GGRA 3DLMA 3I56A 1TSFA 1X75C 4KRTA 4NL2A 1X6GA 4ZN1A 1WQ7A 4YOOA 2UZDB 2COZA 3N5BB 3KFVA 1F1BB 3OSSC 3OBYA 2AHJB 1ZSGA 3GTMS 4F7SB 3HKSA 2D6FA 2PZ1A 3OYDA 2KYBA 1O9KB 4OB0B 2EFIA 3REBB 4C8QC 1KFZA 1U06A 1M3BA 3L2RA 4C5IA 5GAMh 1Q81C 3LH0A 1Y57A 4QQGA 5LMKB 2AK5A 3L2UA 3OYCA 5HK0A 2CCHB 3CPWS 1M1KR 4FW2A 5KYUA 3DB3A 5EG2A 3QPHA 3CXCP 2DVEA 1RAAB 1OQKA 2NUTB 3GLXA 3QJYA 3WVEB 4AG2C 2K3YA 1YI2Q 1WXTA 4LDWA 5HCKA 4AFSC 4RTYA 2QTXA 4C8QG 3HP9A 4X34A 4JS5A 1UNGD 3M0SA 1TU0B 2ZPEB 3JCMe 3CC4Q 5I21A 1BIBA 4E7ZA 1MNEA 3FIFA 4LUEA 5LJ3g 3I56Q 4Z89A 4EOQB 4BY7X 1WLPB 2DZ9A 1U1TA 2CJMB 2WIHB 4BCKB 3M57A 5AT1B 4BI3A 4C5EA 3CMEA 1YITA 4F14A 4QW2A 3TNIB 5CKEA 1JRIA 3PVQA 2LCSA 3I55Q 1H27B 1VQKT 2K5LA 4C8QD 4FYVB 3H9NA 4J6WA 1M90R 1VQLT 5HNBB 2AKLA 2WSEE 2KI7A 5GMKj 2MF2A 4HLQA 5FU6C 3RKYA 1MV3A 4L6V5 4BE1A 2XKOC 1E7PA 2J6KA 1WXBA 1EFNA 4QQDA 2CUBA 3CPWP 1W70A 4BDZA 1TTHB
chains in the Genus database with same CATH topology
1Y07A 5DLOA 2QEXA 4IUPA 1JBMA 2M16A 4N0AA 1VQ9T 3J7AF 4QVDA 3VKHA 2Y90A 3QKJA 1R8OB 3E9FA 3M5AA 5HK3A 2FVUA 3CCMA 4PJOA 1H3ZA 5CCAA 3NFCA 4XK8E 3OYJA 4M7AE 2K57A 2BS3A 5GANf 3QZ9B 4HT9A 1OZ2A 2K5FA 2LDMA 3H4CA 3CC2A 3VYGA 5C0MA 4HCBA 3QG1A 3GOXA 1XNIA 5GANh 2L5QA 2O4XB 2ZPBB 1YJNT 4R55A 2ZZDB 4F7UA 2MI6A 3OYBA 2G3RA 4R56A 2KDSA 4C8QA 3CCEA 2L8DA 3OYIA 2L3RA 2LT4A 2QI2A 3KBGA 4M75G 3C95A 2M1HA 4M78C 1QW1A 5LJ3e 3CCVT 4E47A 4N0AC 4E7JA 2YLCA 3KUFA 1VQ7A 2XD0A 2DTIA 2RJEA 2KMGA 4ZTJA 3AHUA 4GY5A 2RI5A 1MHNA 1GXIE 1YI2T 3OW2A 1Q82C 3BG9A 4JUVA 2DO3A 4XAXB 4C0DB 3M59A 2DXBB 3V7SA 1U8RA 2GF7A 4E7LA 3JCMd 1O75A 4ZGJB 4PLLA 2VXFA 3G4ST 3JCMJ 3JAME 2O01E 3HL8A 5CR2A 2NLUA 1QP3A 3JCMW 2E1HA 1JB0E 3QUIA 1VQPT 3OMCA 5GAMf 3INZA 4DQ2A 5LJ3j 5GAMd 3HHTB 1WQWA 3JCMX 2QQ8A 2KQWA 4B9WA 4C92F 3L2WA 4XTUA 4XTVA 3GP8A 1S72A 1FXXA 4KBMB 4C92D 3P8DA 4IUTA 4N4GA 1B34B 3V7RA 4MZMA 1YHQA 5DLQE 4M77B 4EMKA 4NL3A 2OAUA 4BI8B 4KULA 4M78G 3SB2A 4EMHA 3CBPA 4NC6A 3MCAB 4C92E 5GANe 3EFRA 5GAOl 1G3SA 5CIUA 2OTJT 4E7KA 3M54A 3JB9H 4QQ6A 1UGPB 4M7DB 3MHXA 2K2VA 5GMKh 3C4SA 1LNXA 1VQ5A 3UWNA 3DB4A 2D9TA 2CZ1B 2DEQA 3ZBDA 3L42A 4ZGEB 3X25B 3OMGA 3DLLA 4AI6A 4TVRA 3OYLA 4HNTA 3I55T 3JB9G 3FLGA 3OS1A 5GANj 2VC8A 2E6NA 2HQEA 4JX5A 5HY6A 2K5IA 3CCSA 5CKFA 4BY6C 5I2SA 4MDXA 4IUVA 2WJ9A 3OBWA 5DY9A 2RD1A 2E12A 1BYMA 1Y96A 3LYIA 1VQ6A 1K73C 4A4HA 2LX9A 4PL6A 3SWNB 2GQVA 2RH2A 2PVGB 2RB6A 3PFSA 4M7AB 3FB9A 3OYHA 5LJ5g 5GAN6 3JCMb 1I81A 3SD4A 5FRNA 3TW6A 3URGA 4YTLA 3CCLA 2DZCA 3PNWC 4M78D 2GFUA 4CRIA 2DKGA 2EYQA 2LCCA 3VYHB 2DTOA 1ZQ1A 5GAOp 3OY9A 2I2LA 5IT9E 4PJOF 5KE2A 3A8HB 2VGNA 1DJ7B 4IUUA 2QDJA 3OYYA 1KD1C 4BDZA 3X26B 1NPRA 2LNVA 4FIBA 4XTXA 4M75A 4X9CA 1RL2A 2QFZA 5GMKe 1JJ2A 5J39A 1G5VA 3L1AA 3NTHA 4ELYC 3ME9A 3SFMA 4PJOE 4QVZA 2OTLT 4F7UF 3CCUA 1H641 3QYGB 3T9NA 2LQKA 1VQKA 1WPYA 2VGMA 4II1A 2GCXA 4XTYA 3HB9A 3OQ5A 5LJ3f 1XOVA 3KHIA 5LJ3d 1VQLA 5KCHA 4F7UE 4J6YA 5CQXA 5CQYA 5LJ3h 5GAOr 4C8QE 2JVVA 4BUGA 2X35A 1X6OA 2P0QA 2PVOB 4XU0A 1G3TA 4XTWA 3VV0A 3S3OA 4IURA 1VQOT 4UC4A 4IKFA 2PU9B 1EIFA 1BI1A 3RKWA 3GF5A 2QQAA 3RESA 2QA4T 4KUDK 2ZZDA 2RK2A 2P0KA 3LGLA 4OF1A 5FU7B 5GMKi 2FHDA 2IVWA 2QF7A 3MEWA 2DIGA 2MWPA 2CS7A 2JNGA 3E1SA 4M78A 4C92B 2CZ0B 2XG8D 3CEYA 1P92A 3PIPA 3OW2S 4AKGA 1PSEA 2RHIA 4J7FA 3M53A 3HZJA 3QZ5B 4EMGA 5C6SA 3CCJT 1QVFA 2KSSA 3NTIA 1XTDA 1K73U 5GAN4 3MP1A 4AKIA 1KC8C 3RMQA 5D6WA 2YHTA 2JZ2A 5GANd 4JX4A 1UGRB 1YJNA 2KR6A 2FB7A 2RI2A 2EQMA 2DXUA 2F69A 3JB9J 4QSHA 2KK4A 4BE2A 2KY9A 2HAXA 1K9MC 4JRQA 4FT4A 4C0ZA 5GAN3 3G6EA 3VKGA 4OB2B 3C12A 3ER0A 4J5YA 2LVMA 4RG8A 3ZFJA 3ZEHA 1KQSA 4OB3B 4N4IA 1FKMA 3OA6A 3CD6A 5LJ5e 3OS5A 1YI2A 2A3LA 2PUKB 3H8ZA 3JCMg 1VQ4T 4J7IA 1AHJB 1TH7A 2RHYA 2WSCE 2RHZA 4FM4B 2HNIA 4O6JA 4OVAA 5J26A 3SDZA 3QXEB 3QDRB 2XDPA 4HCZA 4C0DC 3G4SA 1WGSA 5EJCA 2H3JA 3C94A 2DXTA 3OYMA 2A7YA 3CXCA 1X01A 2QQSA 4V2SA 4ZTFA 5KCOA 2LQ8A 3UPUA 4L5GA 1VQPA 3OB9A 1IZ6A 1UEBA 2EKOA 2CYZB 3J80E 4C5GA 4FL6A 5CKHA 4CI0C 3CC4T 2R5AA 4BACA 5CO7A 5I2MA 2D0QB 3M9QA 5LJ5j 3V8JA 1Q7YU 2ZPIB 3M4YA 2HBPA 1M1KC 3I56T 3BDUA 4PJOB 5A2QE 2QQBA 4E7HA 4LDXA 3X28B 2OTJA 3VJPA 2K4YA 2PVDB 3EFSA 2ZCFB 2R5MA 1D3BA 3QIIA 4M77C 1BI0A 1I8FA 3LW5E 3RERA 3VYGB 4OGEA 3CPFA 3A8OB 4LD6A 2X4JA 1W2BA 2KVQG 2DD5B 4M7DC 4M75F 4B9XA 4F7UB 2F5KA 4FT2A 4M75D 4C8QB 1FX7A 3HRSA 4HKEA 3ASKA 2MAMA 4D6WA 5GAOq 5GAN5 2E41A 2QDYB 3BFMA 1O9SA 1YJWT 2DTHA 3LGFA 2X4XA 4M75E 1M1GA 3BDLA 3I55A 1N27A 3FC3A 2Y4XA 4OP0A 3S3MA 1NPPA 2JTFA 3X20B 4LDVA 1K9MU 1JJ2S 2B8AA 2P0PA 2E10A 2X4YA 5CK9A 2EQUA 4BBSM 3M4GA 1WJSA 4RKUE 2QQ9A 3V8LA 4KUIA 3VUBA 3OYGA 2WACA 2F5TX 4Y28E 1I5LA 2DD4A 3OYFA 3QSUA 1OI1A 5IAYA 2DXCA 2BIVA 3M55A 4M77G 3L2ZA 3JCMP 1N6AA 1QP2A 5A0DA 2XI9A 2V8IA 4X9DA 3SWNC 1FWZA 3M56A 1Q82U 4M7AC 3LX7A 2JOYA 4DOVA 5GAN7 4M7DG 4M78F 4PLIA 1M8VA 2KAFA 1BI3A 2XIDA 4HCCA 1VIEA 2XICA 3X24B 3A8GB 4BBRM 2FL7A 2V8JA 4EMKB 5GAN8 3A8LB 2Y4YA 3QYEA 1LOJA 3V8KA 4JJNK 4M78E 3HFNA 1KG1A 3S3NA 3QO3A 3MEAA 3JCMQ 4JDSA 1M9SA 2OTLA 2CZ7B 4BE0A 4J83A 3VKIA 4A4FA 1M1KU 4NOYA 1Y7XA 1M90C 2E64A 4LD9K 1QVFS 3LWHA 1U1SA 3CC7T 1W4SA 3CPWA 2CZ6B 2RO0A 1VQNT 3JB9F 3L2VA 3JB9D 4ZN3A 3P8BB 2XU8A 4KT0E 5GAOn 3PIOA 3MEVA 1UGQB 4C5HA 4ELZC 5LJ5f 4J8OA 1BI2A 2V8KA 4EPCA 5LJ5d 3FRNA 4XU3A 2VXEA 4JRPA 1VQOA 4M7AG 4EDUA 5D6YA 2ZPFB 5LJ5h 4LDYA 1Q86C 4ELJA 4M77F 3CCQT 2RM4A 2EQKA 4WF2A 4LDUA 4M77D 2P4TA 1HXDA 2O4XA 2PQWA 3JCMc 1KQ2A 2DPPB 2IG0A 3CCRT 1NZ9A 1Y96B 4HL4A 3F70A 4A4EA 4E7IA 1KQSS 1VQ8T 3CMAT 2JTMA 2RHXA 3OS0A 3CMET 1ZBXA 4M7DD 1YITT 3HO8A 5FU7C 2EJGA 2JN0A 2BS4A 4OGCA 4XU1A 3CCUT 1VQ9A 3LLRA 3TREA 5CAIA 4PNOA 3LWIA 4C92C 3CCJA 3QWLA 4ZGDB 5LL6S 5GANg 2DJZA 3MO8A 3JSCA 3JRZA 2RK1A 1PSFA 2E65A 2PUOB 2KMTA 1YCYA 3Q1JA 2G77A 3BW1A 4GLKA 3FDRA 4JLGA 4RG2A 1KHIA 1N9RA 5FU6B 2DXBA 4RMOA 1XQHA 3CBMA 4M75B 3A5ZB 1OZ3A 4HA8A 5CKBA 5CKDA 3GPLA 4DA4A 1YIJT 1N8RC 1QVPA 3V7CA 3TW7A 4Z6YA 1SSFA 1VQMT 3PMIA 1YJ9T 4MFDA 1VUBA 2RA2A 4LOCA 2X4WA 4M7AF 3CCVA 1K8AC 4Z02A 1KD1U 4A53A 4M7AD 2QEXT 4J6XA 3QYHB 5FRMA 1VQ4A 4N4HA 1B34A 1NJIC 4HNUA 2XHCA 2ZGWA 5L8RE 3OS2A 1W2BS 1OYXA 2QQRA 1V29B 4M77A 4OMFB 3CCMT 3S6WA 1M90U 4C92G 1UB4A 2VUBA 3RIRA 2RJFA 2MMPA 3TU4K 3OYEA 3L2QA 2WSFE 4L59A 4M7DA 3HBLA 3NTKA 3PT9A 4MDWA 5GAOm 3CC2T 5GAMg 2DD5A 3KXTA 4MZPA 2XDBA 1QVGA 3R6OA 4JRIA 5FLXE 2BUDA 3CC4A 5HKCA 3H6ZA 3G6ET 4PKCC 3RKXA 1Q86U 3CCET 4M78B 3UDCA 3MP8A 3MP6A 2EIFA 3DLMA 3I56A 2E6ZA 4HT8A 4JX6A 3QJ6A 2E5QA 3QHSA 3G71T 2C06A 4RCBA 1X75C 2EQJA 4NL2A 1VQ7T 3CD6T 3GNGA 3HFOA 4ZN1A 1WQ7A 3OYNA 4PJOC 4RCCA 4JRKA 2VV5A 3VU3C 1ZHIA 3JB9I 3N5BB 3JCMf 3OSSC 3OBYA 2AHJB 1WNLA 1G3YA 5IN1A 4BI4A 1LJOA 3O8VA 3PMTA 3JCMh 3HKSA 4MIMA 3CBOA 3SWNA 3OYDA 2D6FA 3WVDB 5DM7R 4M7AA 1YJWA 4OB0B 2EFIA 4C8QC 2GFAA 4IUQA 2M0OA 3L2RA 3HRTA 2EAYA 2LRQA 3M58A 1VIFA 4C5IA 5GAMh 1Q81C 4MZTA 1YBYA 3LH0A 2R58A 5A0GA 4OB1B 1S72T 3META 4QQGA 1N8RU 1BIAA 3L2UA 1YHQT 4AKHA 3OYCA 4DOWA 5HK0A 4XTZA 3CPWS 1I4K1 3DB3A 4ME7A 5EG2A 1K8AU 3QPHA 3UT1A 4A4KA 3BG5A 2YLBA 4PJOG 2ZPGB 3EAEA 2DVEA 2L89A 1NJIU 4BD3A 5KH6A 4C0GA 2M9UA 3GLXA 1VQ5T 3MEUA 3QJYA 3WVEB 3RUXA 2K3YA 2LC4A 1UGSB 2RHUA 3TCJA 4C0FA 3DKMA 4QVCA 4BDYA 4F7UG 5GMKm 1N9SA 4LDWA 4XQ3A 3G71A 2RJCA 1RI0A 1BKBA 2QTXA 3A8MB 3GNFB 3HPWA 3HP9A 4C8QG 5M9OA 1M4ZA 4BY6B 2DIQA 4EMKC 4M6VA 1D3BB 4X34A 3J81E 2LT1A 4JS5A 3CCST 3JCMe 1IREB 2ZPEB 1G3WA 5AYFA 1WJRA 4FU6A 4Q5WA 1BIBA 5A0LA 5I21A 3HRUA 3FIFA 3CC7A 2EWNA 1VQNA 5LJ3g 1VQ6T 4ATOA 3RMSA 2BKDN 2DK3A 5J3BA 5GAN2 2R57A 4JLIA 2QXFA 4C92A 5GAMe 3OSVA 2CKKA 4P5NA 3GIBA 1Y71A 3G7ZA 2VYTA 3TEEA 2DZ9A 3WXMB 1U1TA 2XK0A 3CCLT 3CCQA 2FYKA 1NE8A 1M1FA 4MFEA 3M57A 4JS4A 5CVIA 4PJOD 2EJ9A 2JUFA 2QA4A 4HNVA 1KHCA 2DAQA 3CCRA 3CMAA 4BI3A 1VQ8A 4MMKA 4C5EA 2DD4B 1HK9A 1Q81U 2RJDA 3QYBA 2YRVA 2DXCB 2XDDA 3CMEA 1YITA 4M7DF 4M77E 4QW2A 5GAMj 5CKEA 1JRIA 4A54A 4XU2A 4C8QF 1MGQA 2E70A 2LTOA 5GMKl 2ZPHB 1KQ1A 3JCMV 1Q7YC 2K5LA 1VQKT 4C8QD 4MMLA 3BG3A 4M7DE 3VUZA 3QBYA 4J6WA 3E19A 3HSBA 3P8HA 4O5VA 1VQLT 2HD0A 3FJPA 4FSXA 5KE3A 3DL1A 1WJQA 3CXCS 3FEOA 3PTAA 1QVGS 2WSEE 2MWOA 3E9GA 2LCLA 5GMKj 2MF2A 4HLQA 5FU6C 2EJFA 1M5Q1 2CGHA 3PGGA 3RKYA 3BY7A 4NS5A 4Y91A 5FROA 2RI3A 4L6V5 4A4GA 2XKOC 4BE1A 1YIJA 1KC8U 4M75C 1E7PA 1QLBA 3OYAA 1VQMA 2K3XA 1YJ9A 3OYKA 4VUBA 5D6XA 4QQDA 2HQXA 4BB7A 2BS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU E;  3QYG B;  4Y28 E;  2DD4 A;  2DXC A;  1QP2 A;  4XK8 E;  2AHJ B;  3QZ9 B;  3VYG A;  3WVD B;  2ZPB B;  2PVO B;  4OB0 B;  2ZZD B;  2PU9 B;  3X24 B;  3A8G B;  3A8L B;  2ZZD A;  4OB1 B;  2CZ7 B;  2CZ0 B;  1PSE A;  1GXI E;  3QZ5 B;  2CZ6 B;  2ZPG B;  2DXB B;  4KT0 E;  4ZGJ B;  1UGQ B;  2O01 E;  1QP3 A;  1UGR B;  3WVE B;  1JB0 E;  1UGS B;  2ZPF B;  3HHT B;  3A8M B;  4OB2 B;  2DPP B;  1IRE B;  2ZPE B;  4OB3 B;  2PUK B;  1UGP B;  2WSC E;  1AHJ B;  4ZGD B;  4FM4 B;  1PSF A;  3QXE B;  2PUO B;  2CZ1 B;  2DXB A;  4ZGE B;  3X25 B;  2CYZ B;  2D0Q B;  2ZPI B;  2DD4 B;  2DXC B;  3X28 B;  2PVD B;  2ZCF B;  3QYH B;  2ZPH B;  3LW5 E;  5L8R E;  3VYG B;  1V29 B;  3A8O B;  2PVG B;  2DD5 B;  2WSF E;  2WSE E;  2DD5 A;  2QDY B;  3VYH B;  4L6V 5;  3A8H B;  1DJ7 B;  3X20 B;  3X26 B; 
#chains in the Genus database with same CATH topology
 1Y07 A;  3THK A;  2ROL A;  4CFU B;  3VKH A;  2K6D A;  2K79 A;  2Y90 A;  1XJW B;  3M5A A;  5HK3 A;  4PJO A;  3NFC A;  2LJ3 A;  4M7A E;  3RGF B;  3CC2 A;  3VYG A;  1XNI A;  2O4X B;  2WPA B;  1YJN T;  4F7U A;  2AZV A;  2G3R A;  4R56 A;  2KDS A;  3CCE A;  4ZNX A;  4KH1 B;  2WHB B;  3F5X B;  2LT4 A;  2QI2 A;  2X3W D;  3KBG A;  4M78 C;  5LJ3 e;  4AFU C;  2C5N B;  4J9C A;  3KUF A;  4ZTJ A;  4KRC B;  2FRW A;  2KR3 A;  2RI5 A;  1MHN A;  1SRL A;  3BG9 A;  1TD6 A;  2DO3 A;  1PKT A;  1YIT Q;  4E7L A;  2Z0W A;  4PLL A;  2E4H A;  2VXF A;  3G4S T;  3JAM E;  4BCG B;  1H4L D;  1AD5 A;  1VQP T;  3RBB B;  1TUD A;  5GAM d;  1WQW A;  4OMN A;  2QQ8 A;  2KQW A;  1SPK A;  1FXX A;  4KBM B;  3P8D A;  4NL3 A;  4KUL A;  4M78 G;  5KYX B;  3MCA B;  4BY1 X;  4C92 E;  2CDT A;  5GAN e;  2FPD A;  3M54 A;  2ENM A;  4QQ6 A;  3FJ5 A;  3JB9 H;  2K2V A;  5GMK h;  4FSS A;  3UWN A;  5IF1 B;  4FYW B;  2D9T A;  1OKW B;  3L42 A;  2K3B A;  1Z9Z A;  2E5K A;  1P5E B;  1JXO A;  4HNT A;  3CC2 Q;  4ELL A;  3OW2 P;  2HQE A;  4JX5 A;  2VAS A;  5CKF A;  2GTJ A;  5I2S A;  2DA9 A;  2WJ9 A;  3OBW A;  1ARK A;  2LX9 A;  3OYH A;  4CXA B;  3JCM b;  3SD4 A;  1D1A A;  3URG A;  3CCL A;  4M78 D;  4CRI A;  5GAO p;  5IT9 E;  4PJO F;  5KE2 A;  4IUU A;  3OYY A;  3X26 B;  1NPR A;  1UJY A;  5KYU B;  3JV3 A;  4M75 A;  4I3Z B;  2QFZ A;  3BHT B;  2DLP A;  1G5V A;  3NTH A;  4OGR B;  2OTL T;  2IPO B;  4F7U F;  3CCU A;  2E3I A;  3T9N A;  2LQK A;  6AT1 B;  5I5Z B;  4LXC A;  3HB9 A;  5LJ3 f;  1RAB B;  5KCH A;  4WTO B;  1YWP A;  4C8Q E;  4B6M A;  3S3O A;  1G3T A;  1OOT A;  4UC4 A;  3RKW A;  5ICP B;  3GF5 A;  2QA4 T;  2ZZD A;  2RK2 A;  2EGA A;  2P0K A;  1WI7 A;  4OF1 A;  5GMK i;  2CS7 A;  2CZ0 B;  3CEY A;  4IMY B;  1P92 A;  5I11 A;  3EGX B;  1ABQ A;  2RHI A;  2GNC A;  3HZJ A;  2KSS A;  3NTI A;  2MYS A;  2RQV A;  1A0N B;  3RMQ A;  1OI9 B;  3CC7 Q;  1VQN Q;  2PJQ A;  2F69 A;  5IHI A;  4QSH A;  1UJ0 A;  2KY9 A;  2CT3 A;  4FT4 A;  3G6E A;  1Q7Y R;  1I0C A;  3CCL Q;  1WX6 A;  2A3L A;  2CP0 A;  1H1P B;  3CMA Q;  1D0X A;  2HNI A;  2JT4 A;  4OVA A;  3QXE B;  3QDR B;  2XDP A;  2BZ8 A;  2DXT A;  3OYM A;  3CCU Q;  3CXC A;  1R77 A;  3VS3 A;  2PTK A;  2ZAE A;  4OMM A;  4L5G A;  3UPU A;  2VVK A;  1JKW A;  4FL6 A;  4CFM B;  5CO7 A;  5I2M A;  5LJ5 j;  2C0T A;  1NBE B;  3M4Y A;  4EOL B;  4PJO B;  2QQB A;  4E2F B;  1JQQ A;  2OTJ A;  2K4Y A;  2R5M A;  1D3B A;  3QII A;  1BI0 A;  3VYG B;  8ATC B;  4FW1 A;  4OGE A;  1W2B A;  1IHW A;  4M75 F;  4F7U B;  1OIY B;  3ASK A;  2MAM A;  2NWM A;  5GAN 5;  3BFM A;  3CCM Q;  3LGF A;  4F70 B;  3BDL A;  3ULR B;  4OP0 A;  3S3M A;  4PK4 A;  4CFU D;  2X4Y A;  1H1Q B;  5HBH B;  4BBS M;  3M4G A;  1WJS A;  2CSI A;  2EYW A;  3BLR B;  1YP5 A;  3NHN A;  2QGF B;  3VUB A;  2WAC A;  3G6E Q;  2DD4 A;  3OYF A;  4BCH B;  3QSU A;  1URC B;  1Q82 U;  4J9G A;  2JOY A;  4HVV A;  4PLI A;  2A08 A;  2H8H A;  4OMQ A;  2UZB B;  3G71 T;  4BBR M;  2FL7 A;  4M78 E;  4JJD A;  2I40 B;  3REA B;  3JCM Q;  1M9S A;  2CZ7 B;  4BE0 A;  2RNA A;  2E64 A;  3CPW A;  3L2V A;  3JB9 D;  4KT0 E;  1R0B G;  5GAO n;  5DQW A;  2OTJ Q;  4LUD A;  2V8K A;  3FRN A;  1GUX A;  2VXE A;  4JRP A;  2I53 A;  4EDU A;  2KRO A;  2ZPF B;  5LJ5 h;  4LDY A;  5KYN A;  4M77 F;  3CCQ T;  1E9H B;  2EQK A;  4LDU A;  2FG0 A;  2L3P A;  2PQW A;  1KQ2 A;  1KQS S;  1NZ9 A;  1YN8 A;  4A4E A;  1ZBX A;  3RR6 A;  2YUN A;  4XU1 A;  2NUP A;  4OGC A;  2MPX C;  3QWL A;  1ZLM A;  3JSC A;  2RK1 A;  2E65 A;  2PUO B;  1IGU A;  2KMT A;  2G77 A;  3BW1 A;  3FDR A;  4RG2 A;  2WEV B;  1H26 B;  2H3E B;  4M75 B;  3BLH B;  4E6R A;  1N8R C;  1ZSZ A;  1QVP A;  3TW7 A;  4FCY A;  1VQM T;  1E6G A;  3PMI A;  1YJ9 T;  4MFD A;  4J6X A;  1B34 A;  4HNU A;  2XHC A;  2ZGW A;  2G9X B;  4EON B;  1UB4 A;  3HBL A;  3PT9 A;  5GAO m;  3KXT A;  2EKH A;  2XDB A;  5IDN B;  1YCS B;  5HKC A;  4FX3 B;  2FZG B;  4PKC C;  1SEM A;  2JM8 A;  4HCK A;  2EIF A;  1OIU B;  2SEM A;  1C1A A;  1VQ7 T;  3CD6 T;  4PJO C;  4RCC A;  2VV5 A;  5EFQ B;  2P4R A;  1WNL A;  1LJO A;  1IHV A;  3PMT A;  4MIM A;  3CBO A;  5DM7 R;  1YJW A;  5CYI B;  1KQS P;  3HRT A;  5IHK A;  2LRQ A;  3M58 A;  1VIF A;  4DBH A;  1IRX A;  5A0G A;  1S72 T;  1YHQ T;  4AKH A;  1S1N A;  1I4K 1;  1NLO C;  3BG5 A;  2YLB A;  4PJO G;  1H92 A;  3EAE A;  1QKX A;  1NG2 A;  2HSE B;  4BD3 A;  2M9U A;  1M2V A;  1TG0 A;  1VQ5 T;  3QDF A;  1D0Y A;  1ZUY A;  3RUX A;  4C0F A;  2LC4 A;  1UGS B;  1GFC A;  4QVC A;  4F7U G;  3HPW A;  1M4Z A;  1TWB A;  4J9D A;  1D3B B;  2LT1 A;  2YXY A;  1FIN B;  4OR5 B;  3CCS T;  3AT1 B;  1WJR A;  4FU6 A;  3EJ1 B;  1VQ6 T;  1HD3 A;  2QGS A;  3EG1 A;  4P5N A;  1HSQ A;  3TEE A;  2ECZ A;  2XK0 A;  1NE8 A;  5CVI A;  4PJO D;  4HNV A;  2DAQ A;  3CCR A;  1VQ8 A;  1VOM A;  2P84 A;  2DD4 B;  1HK9 A;  1VOL A;  2RJD A;  1YJW Q;  2YRV A;  2XDD A;  5IHY A;  3EGD B;  5GAM j;  1ZUK A;  4A54 A;  2LTO A;  3JCM V;  3MKD A;  2VKN A;  2V1Q A;  4MML A;  3VUZ A;  3QHW B;  4OML A;  3P8H A;  1FMV A;  4FSX A;  1WJQ A;  3CXC S;  1AWO A;  3PTA A;  1W98 B;  4EOO B;  3E9G A;  4ESR A;  3PGG A;  3BY7 A;  4NS5 A;  2RI3 A;  3LH5 A;  1GL5 A;  1KC8 U;  4M75 C;  3OYA A;  1QLB A;  1D1B A;  1GCQ C;  2YRC A;  1WHG A;  4VUB A;  2FZC B;  4BB7 A;  2BS2 A;  1TUG B;  2M16 A;  4N0A A;  1GH6 B;  3J7A F;  3SHW A;  3BHU B;  3E9F A;  4Y92 A;  2FVU A;  3MIA B;  2YUQ A;  1AT1 B;  1GUX B;  3OYJ A;  2K57 A;  2BS3 A;  3EG0 A;  1I5O B;  1OZ2 A;  2LDM A;  2WFY B;  1WHJ A;  5C0M A;  4HCB A;  3GOX A;  1OPL A;  2BKZ B;  2LQN A;  3VRY A;  2EGE A;  3VS4 A;  2NUP B;  1MMA A;  4M75 G;  1PWT A;  2M1H A;  1QW1 A;  3C0C A;  1VQO Q;  4E7J A;  2XD0 A;  2YLC A;  1PD0 A;  2KMG A;  3AHU A;  3G33 B;  1GXI E;  1YI2 T;  1VQ8 Q;  1Q82 C;  1UHC A;  4XAX B;  2LP5 A;  1U8R A;  4ZGJ B;  2O01 E;  3HL8 A;  1ZSZ B;  2NLU A;  1VIN A;  3JCM W;  1I1J A;  1YWO A;  2JJ9 A;  2AT1 B;  1JB0 E;  3VS7 A;  1YNZ A;  1V76 A;  1PRM C;  3CCJ Q;  3INZ A;  5I22 A;  1NYG A;  2C5O B;  2IVX A;  4XTV A;  3LQ5 B;  4BCQ B;  4C92 D;  4IUT A;  4N4G A;  1ABO A;  1B34 B;  3B57 A;  2C5X B;  1GFD A;  1T0H A;  4BI8 B;  4EMH A;  4NC6 A;  5GAO l;  3EFR A;  1G3S A;  4PFP A;  4E7K A;  2DER A;  2K9G A;  2O9V A;  3M0P A;  1X2Q A;  3C4S A;  1LNX A;  2EYZ A;  4DEY A;  2LW4 A;  3X25 B;  3DLL A;  4AI6 A;  1ZUU A;  3I55 T;  3FLG A;  2LJ0 A;  4G6L B;  1FYN A;  4EOJ B;  2W96 A;  2RD1 A;  4YOZ A;  2E12 A;  3H0I A;  2UZL B;  2CP2 A;  2PK9 B;  4A4H A;  4PL6 A;  2KT8 A;  2GQV A;  3PFS A;  4J9H A;  3FB9 A;  5LJ5 g;  4EOR B;  1KSW A;  2DZC A;  1PRL C;  2DKG A;  2EYQ A;  2LCC A;  3VYH B;  1GCP A;  2DTO A;  3OY9 A;  2A0F B;  2FPE A;  2CP3 A;  1KC8 R;  1DJ7 B;  4XTX A;  4X9C A;  4PJO E;  4ELY C;  3SFM A;  4YC3 B;  4QVZ A;  1FMW A;  4ROD A;  8AT1 B;  3QYG B;  1M2V B;  1VQK A;  3DJB A;  2X3X D;  4XTY A;  3MJX A;  3OQ5 A;  3KHI A;  1OUL A;  1VQL A;  4F7U E;  4J6Y A;  1M3C A;  2JVV A;  2X35 A;  2P0Q A;  2PVO B;  1Z9Q A;  4IUR A;  2JW4 A;  1BI1 A;  2HEQ A;  4KUD K;  4ORZ A;  2YRD A;  4EC9 B;  3LGL A;  2IVW A;  4Y72 B;  2RQU A;  3OW2 S;  4AKG A;  1PSE A;  2CH4 W;  3M53 A;  3QZ5 B;  4TTH A;  1XTD A;  1ZBJ A;  1K73 U;  1X2K A;  3MP1 A;  4PJJ A;  2DL8 A;  1TXQ A;  1AIS B;  1UGR B;  1YJN A;  1UEC A;  1JJ2 P;  2HAX A;  2QGG A;  3MY1 B;  3VKG A;  1WZO A;  4OB2 B;  5HVY B;  1EZZ B;  4J5Y A;  4BCF B;  1KQS A;  4RG8 A;  4OB3 B;  4N4I A;  5LJ5 e;  3PO3 S;  1VQ4 T;  4F6U B;  2WSC E;  2RHZ A;  1OKV B;  3SDZ A;  3CME Q;  3G4S A;  1WGS A;  3H41 A;  5KYY B;  1VQK Q;  2QQS A;  4V2S A;  5KCO A;  2L2P A;  2LQ8 A;  1VQP A;  1T3L A;  1ZSZ C;  1UEB A;  2W9F A;  4DEX A;  4BAC A;  4CI0 C;  5CKH A;  1UHF A;  2D0Q B;  3M9Q A;  3V8J A;  1Q7Y U;  1QVF P;  1M1K C;  2D0N A;  4HVU A;  3BDU A;  1OEB A;  2O9S A;  3X28 B;  4LDX A;  2PVD B;  3M0U A;  2DEU A;  1HYO A;  4LD6 A;  3SEM A;  2DD5 B;  1C0M A;  2KE9 A;  2W2H A;  2F5K A;  2KGT A;  2K7A A;  3HRS A;  2E41 A;  2QDY B;  2CT4 A;  1O9S A;  2DTH A;  3TVT A;  4M75 E;  4RTZ A;  2Y4X A;  1NPP A;  4LDV A;  1K9M U;  1PM3 A;  2E10 A;  1BCM A;  2EQU A;  1JEG A;  3V8L A;  3OYG A;  2X1N B;  1I5L A;  4CFX B;  3CCE Q;  2DXC A;  2V8I A;  3M56 A;  3LX7 A;  2KAF A;  1H24 B;  4HCC A;  1VIE A;  2XIC A;  3X24 B;  2V8J A;  2YUP A;  5GAN 8;  3G4S Q;  3A8L B;  5CEI B;  3V8K A;  3H0F A;  1ENW A;  3NMZ C;  3MEA A;  3QO3 A;  1VQP Q;  2D8H A;  4JDS A;  2OTL A;  1Y7X A;  1M90 C;  4LD9 K;  3CC7 T;  1VQN T;  2DL3 A;  4ZN3 A;  3P8B B;  1K73 R;  4F6W B;  4ELZ C;  5LJ5 f;  2L0A A;  4J8O A;  4EPC A;  4XU3 A;  1H3H A;  4EC8 B;  4F7N B;  4BCQ D;  4ELJ A;  2KXC A;  1C6V X;  3QWY A;  4CC4 B;  2DPP B;  3CMA T;  1RAH B;  3F70 A;  1OL1 B;  1LCK A;  2RHX A;  1VYV A;  1KD1 R;  3DDQ B;  3POM A;  1VQ9 A;  3CCU T;  1PKS A;  3LLR A;  4PNO A;  3LWI A;  1UGV A;  3O5Z A;  5LL6 S;  2DJZ A;  2HQH A;  3JRZ A;  1PSF A;  5FWC A;  2RQT A;  1KHI A;  1N9R A;  2D1X A;  4DA4 A;  1YIJ T;  3V7C A;  1VUB A;  2RA2 A;  2MOX A;  2X4W A;  3EFO A;  4M7A F;  3CCV A;  4EOI B;  1WHL A;  4Z02 A;  4J9F A;  1AWJ A;  1CKB A;  2QEX T;  1K0X A;  4N4H A;  5L8R E;  3OS2 A;  4M77 A;  4PJN A;  3CCM T;  2KYM A;  2VUB A;  2RJF A;  4WCI A;  2VB6 A;  2OTL Q;  1HJD A;  3BE3 A;  3L2Q A;  4PFZ A;  4M7D A;  5GAM g;  2QDL A;  3R6O A;  4JRI A;  2F2X A;  3G6E T;  3RKX A;  1Q86 U;  5FWB A;  3UDC A;  3QHR B;  1K9M R;  2BZX A;  4BXX X;  4JX6 A;  1H8K A;  1KK7 A;  3QJ6 A;  4J9E A;  2K2M A;  4RCB A;  1OU8 A;  1AOJ A;  1RLQ C;  3GNG A;  3OYN A;  4RTU A;  2PK2 A;  1RI9 A;  4JRK A;  3VU3 C;  2CSQ A;  1ZHI A;  3JB9 I;  2CUD A;  1G3Y A;  5IN1 A;  2YWW A;  1MND A;  3JCM h;  2WMB B;  1VQ9 Q;  1WYX A;  3SWN A;  1M8M A;  1B07 A;  2GFA A;  4IUQ A;  1WIE A;  1YBY A;  1VYU A;  2R58 A;  1XO2 A;  4OB1 B;  1RAC B;  1BIA A;  4CC3 A;  3VS5 A;  1RAG B;  1K8A U;  1QVG P;  2ZPG B;  1TS9 A;  2W9Z A;  1NJI U;  5KH6 A;  4C0G A;  3CCV Q;  2JGZ B;  5IXF A;  3MEU A;  2F2W A;  2V22 B;  3TCJ A;  3DKM A;  4BDY A;  1N9S A;  4XQ3 A;  4RTW A;  3G71 A;  2RJC A;  3GNF B;  1BKB A;  3M0Q A;  1QCN A;  2FO0 A;  2LQW A;  4BY6 B;  3PVL A;  2DIQ A;  4M6V A;  1WXU A;  4CRL B;  2NUZ A;  1PD1 A;  1W1F A;  3HRU A;  1PNJ A;  2EWN A;  1AZE A;  1H25 B;  4ATO A;  2ROT A;  3RMS A;  2DK3 A;  2R57 A;  5GAM e;  3OSV A;  2CKK A;  3WXM B;  2WXV B;  3CCQ A;  1OGU B;  4MFE A;  4JS4 A;  1H1R B;  1G2B A;  2EJ9 A;  2JUF A;  2DBK A;  1Q81 U;  3QYB A;  4M7D F;  2DXC B;  2EBP A;  2AIR B;  2E3H A;  4C8Q F;  1MGQ A;  2E70 A;  5GMK l;  2ZPH B;  3EG9 A;  1QMZ B;  4O5V A;  5L23 A;  2HD0 A;  1LVK A;  5KE3 A;  3DL1 A;  3E2U A;  2MWO A;  3DOG B;  1Q7Y C;  2EJF A;  5FRO A;  2CGH A;  4Y91 A;  1Q86 R;  1VQM A;  2K3X A;  1YJ9 A;  3OYK A;  2HQX A;  3NDQ A;  1JBM A;  4BCN B;  4QVD A;  2W10 A;  3QKJ A;  1R8O B;  1QKW A;  1H3Z A;  1SHF A;  3G1J A;  4BCP B;  9ATC B;  2K5F A;  5GJW B;  3H4C A;  2DL7 A;  4BCI B;  3EG3 A;  5FW9 A;  5GAN h;  4FYX B;  2IW6 B;  2ZPB B;  2B86 A;  2ZZD B;  2MI6 A;  3OYB A;  2L8D A;  4CC7 A;  2KRS A;  1GY3 B;  2ED1 A;  3CCQ Q;  1VQ7 A;  5HBE B;  2PMI B;  3EH1 A;  4GY5 A;  2R7G A;  2EW3 A;  1G83 A;  1K8A R;  3OW2 A;  1NJI R;  2GF7 A;  3JCM d;  2LX7 A;  5ACB A;  1QP3 A;  2E1H A;  1GRI A;  2NUT A;  1G3N C;  3QUI A;  4JZ4 A;  5GAM f;  1JST B;  3HHT B;  3EFO B;  2BE7 D;  1X6B A;  3GP8 A;  3L2W A;  4XTU A;  1S72 A;  2C5V B;  4ROC A;  1QCO A;  3V7R A;  4MZM A;  4JPB W;  4EMK A;  4M77 B;  1JXM A;  1YHQ A;  4AMC A;  3CBP A;  2MCN A;  1VQM Q;  1YJ9 Q;  4M7D B;  2CP7 A;  4PFO A;  1VQ5 A;  3DB4 A;  1WHH A;  2DEQ A;  3D7S B;  2HKN A;  5HBJ B;  1AEY A;  3OMG A;  4J9I A;  3OYL A;  1OPK A;  2VC8 A;  2E6N A;  2K5I A;  3CCS A;  2QAZ A;  4BY6 C;  1Q81 R;  2F2C A;  4MDX A;  1BYM A;  2MIO A;  1Y96 A;  1VQ6 A;  1UUE A;  2RQW A;  3SWN B;  2RB6 A;  3I5R A;  5GAN 6;  1VQ7 Q;  4F7J B;  2J6O A;  2IN3 A;  3EOC B;  1ZQ1 A;  1VA7 A;  7AT1 B;  2VGN A;  3TNW B;  5GMK e;  4KGX B;  1ZA1 B;  3L1A A;  3ME9 A;  3VRZ A;  2KXD A;  2PHG A;  2VGM A;  1S72 Q;  2GCX A;  1XOV A;  5LJ3 d;  1YHQ Q;  1H1S B;  5CQX A;  2X9H A;  5GAO r;  3HTR A;  4BUG A;  1X6O A;  1VQO T;  4XU0 A;  4IKF A;  3K7A M;  2PU9 B;  2V26 A;  4F17 A;  2DRM A;  2J7I A;  2QQA A;  3RES A;  1JOW A;  2RPN A;  1JO8 A;  2A28 A;  1UFF A;  2M51 A;  2FHD A;  3MEW A;  2DIG A;  2LJ1 A;  2MWP A;  3E1S A;  1UE9 A;  2JNG A;  1N4M A;  4J7F A;  3M0R A;  4EMG A;  3CCJ T;  2GQI A;  3CCS Q;  2RQR A;  3MY5 B;  5D6W A;  5GAN d;  4RTV A;  1VQ6 Q;  4BCM B;  2KR6 A;  1OV3 A;  3I5S A;  2JS2 A;  3JB9 J;  4JRQ A;  5GAN 3;  4KGZ B;  2KT1 A;  3ZFJ A;  2LVM A;  3ZEH A;  1MMG A;  2YT6 A;  3OA6 A;  3OS5 A;  1YI2 A;  2LMJ A;  3JCM g;  2FPF A;  4AG1 C;  4J7I A;  2HCK A;  3CCR Q;  1AHJ B;  1TH7 A;  2OAW A;  5J26 A;  5EJC A;  2DF6 A;  2H3J A;  2I0N A;  1WDX A;  4ZTF A;  3NGP A;  2A36 A;  2EKO A;  2CYZ B;  3J80 E;  3CC4 T;  2R5A A;  1E6H A;  3MPU B;  2HBP A;  3I56 T;  4JJB A;  3TN8 B;  5A2Q E;  2FEI A;  3VS1 A;  3EFS A;  2ZCF B;  4M77 C;  5IHN A;  3LW5 E;  3CPF A;  1OX9 A;  4J9B A;  4M7D C;  4B9X A;  4FT2 A;  4M75 D;  1U5S A;  1FX7 A;  4HKE A;  4D6W A;  3ZL7 C;  2DNU A;  2X4X A;  1M1G A;  3H0H A;  1GBQ A;  3I55 A;  2CP6 A;  3X20 B;  1JJ2 S;  4BCN D;  3TQ7 P;  1D3U B;  1AZG B;  2QQ9 A;  2GBQ A;  4KUI A;  4D8D A;  1UNL D;  2W99 A;  2ED0 A;  4Y28 E;  1OI1 A;  4M77 G;  3JCM P;  1N6A A;  1QP2 A;  4X9D A;  3SWN C;  5GAN 7;  4DOV A;  2KEA A;  1K4U S;  4M7D G;  1BI3 A;  4KRD B;  4EMK B;  4JJN K;  1KG1 A;  2Y4Y A;  4KGV B;  1GBR A;  1W2B P;  2DX1 A;  4CFV B;  4J83 A;  3BLQ B;  4NOY A;  1QVF S;  3LWH A;  1W4S A;  2RO0 A;  3JB9 F;  3EGX A;  2XU8 A;  4RUG A;  1PKD B;  1MV0 B;  4C5H A;  2F1L A;  3BHV B;  2JTE A;  4OMO A;  1MMD A;  2DL5 A;  2EUF A;  1B3Q A;  2HL3 A;  2V1R A;  2QTV A;  5D6Y A;  4CC2 A;  1K1Z A;  1NLP C;  1FVV B;  2RM4 A;  4WF2 A;  2C6T B;  4X1V A;  4M77 D;  2IIM A;  2OX7 A;  2P4T A;  1HXD A;  3JCM c;  1TUC A;  3I35 A;  2IG0 A;  1Y96 B;  2BPM B;  2JTM A;  3OS0 A;  3CME T;  4M7D D;  1YIT T;  3HO8 A;  3EG2 A;  2JN0 A;  1W6X A;  2ATC B;  2DET A;  4ZGD B;  5GAN g;  2CRE A;  4F04 B;  2A37 A;  3TNH B;  1YCY A;  3Q1J A;  2DXB A;  1IO6 A;  5CKB A;  4RTT A;  4DBQ A;  4Z6Y A;  1SSF A;  2EYY A;  5DQV A;  4LOC A;  1PHT A;  1KD1 U;  2DBM A;  5FRM A;  1VQ4 A;  2LZ6 B;  4OMF B;  1RAE B;  2MMP A;  1NEB A;  3OYE A;  4L59 A;  4F16 A;  3CC2 T;  1VYT A;  5FLX E;  2M02 A;  1OX8 A;  1VQL Q;  2J6F A;  1OL2 B;  3CCE T;  3MP6 A;  4QT7 A;  5ECA A;  2E6Z A;  4HT8 A;  1C9B A;  2E5Q A;  1NYF A;  3QHS A;  2C06 A;  2EQJ A;  5BNJ B;  4AFZ C;  4EIK A;  3HFO A;  2X51 A;  1D1C A;  5FGK B;  1ZA2 B;  2J05 A;  2J06 A;  3JCM f;  4GLM A;  2DVJ A;  4PJL A;  4BI4 A;  3O8V A;  1B7T A;  3WVD B;  4M7A A;  2OI3 A;  1AWW A;  2M0O A;  2EAY A;  2UZE B;  2PNI A;  4MZT A;  1N5Z A;  1N8R U;  3MET A;  1M27 C;  1QWE A;  1YJN Q;  3R6N A;  4DOW A;  3DTO A;  1V1C A;  3PE0 A;  4XTZ A;  4ME7 A;  1PC0 A;  3UT1 A;  4A4K A;  4AFQ C;  1K76 A;  2RF0 A;  2L89 A;  1RAI B;  4BCM D;  2NYS A;  2HKQ B;  1VQ4 Q;  2RHU A;  1KC8 C;  5GMK m;  2DMO A;  1RI0 A;  3A8M B;  2JM9 A;  5M9O A;  4EMK C;  4EOM B;  2DRK A;  2RN8 A;  3J81 E;  3EGU A;  1IRE B;  1G3W A;  5AYF A;  2F2V A;  5A0L A;  4Q5W A;  3CC7 A;  1VQN A;  2BKD N;  1CKA A;  5J3B A;  1Y0M A;  5GAN 2;  4JLI A;  1PG5 B;  2QXF A;  4C92 A;  4IIO A;  1SKU B;  3GIB A;  1Y71 A;  3G7Z A;  2VYT A;  2FRY A;  2M0Y A;  4NST B;  3CCL T;  2FYK A;  1IXD A;  1M1F A;  2DYI A;  2KRM A;  1KJW A;  4LN2 A;  2QA4 A;  1OU9 A;  1KHC A;  3CMA A;  2HL5 C;  4MMK A;  1GCQ A;  3IQL A;  4M77 E;  4Z88 A;  4IIM A;  4XU2 A;  3UA6 A;  1KQ1 A;  3RDV A;  1UNH D;  3BG3 A;  4M7D E;  3QBY A;  3E19 A;  3HSB A;  3CQT A;  3FJP A;  4D8K A;  3FEO A;  1QVG S;  3DDP B;  2LCL A;  3FC3 A;  1M5Q 1;  4A4G A;  1YIJ A;  4YOS A;  1E7O A;  2G6F X;  5D6X A;  1R0C B;  5KYW A;  5DLO A;  2QEX A;  1M30 A;  4IUP A;  1VQ9 T;  1RLP C;  3CCM A;  1MUZ A;  1QQJ A;  5CCA A;  4XK8 E;  3TSW A;  3EID B;  2QK0 A;  5GAN f;  3QZ9 B;  4HT9 A;  2C0O A;  2KBT A;  3VS0 A;  3QG1 A;  1KIK A;  2L5Q A;  2VWF A;  4R55 A;  1D09 B;  4C8Q A;  4JJC A;  3OYI A;  2L3R A;  3NPF A;  2IW8 B;  1N8R R;  3C95 A;  2CCI B;  3CCV T;  4E47 A;  4N0A C;  1IB8 A;  1TOV A;  1BK2 A;  2D8J A;  2DTI A;  2RJE A;  2QA4 Q;  4JUV A;  2SRC A;  4C0D B;  1QMC A;  3M59 A;  2DXB B;  2FZK B;  3V7S A;  1O75 A;  3JCM J;  5CR2 A;  1TFB A;  1QLY A;  1FMK A;  2DL4 A;  1G8X A;  1NEG A;  3OMC A;  3UAT A;  4DQ2 A;  5LJ3 j;  1SRM A;  3UF4 A;  3A98 A;  3JCM X;  1SHG A;  4B9W A;  4C92 F;  4QKU A;  5DLQ E;  3O0G D;  2OAU A;  4A63 B;  3SB2 A;  1YIJ Q;  1K9A A;  2OTJ T;  5CIU A;  1UGP B;  3MHX A;  2HBW A;  4KH0 B;  2QEX Q;  1SG5 A;  1AD6 A;  1JU5 C;  2CZ1 B;  3UA7 A;  3ZBD A;  4ZGE B;  1X27 A;  4TVR A;  3JB9 G;  3OS1 A;  5GAN j;  5HY6 A;  1MMN A;  2CP5 A;  2BZY A;  2YUO A;  4IUV A;  4AT1 B;  5DY9 A;  2WMA B;  4CFN B;  2HMA A;  3LYI A;  4M4Z A;  1QCF A;  1K73 C;  3EGD A;  2L3Q A;  2RH2 A;  2PVG B;  4M7A B;  1I81 A;  5FRN A;  3TW6 A;  1KXU A;  4YTL A;  3PNW C;  2L3S A;  1H28 B;  2GFU A;  3VS6 A;  2KRN A;  2I2L A;  4K11 A;  3A8H B;  1WHM A;  2QDJ A;  1KD1 C;  2LNV A;  4FIB A;  2UUE B;  1RL2 A;  1JJ2 A;  2JXB A;  5J39 A;  4F7L B;  1RAF B;  3MI9 B;  1H64 1;  2RMO A;  1WPY A;  2C4G B;  4II1 A;  4RTX A;  2B9R A;  5CQY A;  5LJ3 h;  2YDL A;  1VYW B;  4LNP A;  4GBQ A;  1AVZ C;  1RAD B;  4XTW A;  3VV0 A;  1K0S A;  1EIF A;  4R0K A;  3TSZ A;  1UTI A;  1EX4 A;  5FU7 B;  1WHK A;  2QF7 A;  3A1P A;  4M78 A;  4C92 B;  2O2O A;  2XG8 D;  3EHQ A;  3PIP A;  3G71 Q;  1UDL A;  2COY A;  1T0J A;  4Z8A A;  5C6S A;  2CH4 A;  1QVF A;  5GAN 4;  4AKI A;  1YFN A;  2YHT A;  2JZ2 A;  4OMP A;  4JX4 A;  1X43 A;  1LPL A;  2XMF A;  2DM1 A;  2FB7 A;  2RI2 A;  2ABL A;  2DXU A;  2EQM A;  2KK4 A;  2OJ2 A;  4BE2 A;  1K9M C;  4C0Z A;  1I07 A;  4CFW B;  1O9K A;  2JMA A;  3C12 A;  3M03 A;  3ER0 A;  2DE0 X;  1JSU B;  1FKM A;  3CD6 A;  2DJQ A;  2PUK B;  3H8Z A;  1ZX6 A;  2RHY A;  2HDA A;  1BCO A;  4FM4 B;  4O6J A;  4C0D C;  4HCZ A;  3C94 A;  2O88 A;  2A7Y A;  1X01 A;  3OB9 A;  1IZ6 A;  5KYW B;  2DFU A;  4C5G A;  5IH2 A;  3EH2 A;  5HQ0 B;  2ZPI B;  1U3O A;  5L2W B;  3VS2 A;  2EVR A;  4BCO B;  4E7H A;  3VJP A;  3RNJ A;  2EPD A;  3RER A;  1I8F A;  3A8O B;  2X4J A;  2KVQ G;  1Q82 R;  4II5 B;  4C8Q B;  3U23 A;  5GAO q;  3I9Q A;  2WIP B;  4F6S B;  1YJW T;  1N27 A;  4BCJ B;  2JTF A;  1M3A A;  2B8A A;  2P0P A;  5CK9 A;  4RKU E;  3QWX X;  1CSK A;  2COW A;  2F5T X;  1UG1 A;  5IXB A;  5IAY A;  2BIV A;  3M55 A;  3L2Z A;  2LNH B;  2DME A;  2MK5 A;  1BB9 A;  1NM7 A;  5A0D A;  2XI9 A;  1RUW A;  2C0I A;  2QG9 B;  4DBF A;  2HZY A;  5EC7 A;  1FWZ A;  4M7A C;  3CD6 Q;  1X69 A;  4M78 F;  1BU2 A;  1M8V A;  2XID A;  2EGC A;  4LE9 A;  4ROE A;  2ESW A;  3A8G B;  1ACM B;  5D7U A;  2QAS A;  3QYE A;  1LOJ A;  1WA7 A;  3HFN A;  3S3N A;  2YSQ A;  1WFW A;  4JZ3 A;  1PCX A;  1M1K U;  3VKI A;  4A4F A;  2DIL A;  2JMC A;  5IDP B;  1U1S A;  2CZ6 B;  4PJM A;  1QWF A;  2KNB B;  2W0Z A;  3PIO A;  3MEV A;  1UGQ B;  1BI2 A;  5LJ5 d;  1VQO A;  4M7A G;  2HSP A;  1Q86 C;  4EOP B;  1SF9 A;  1BBZ A;  4EOK B;  3EHR A;  1J3T A;  2O4X A;  1VQ5 Q;  3CCR T;  1VQ8 T;  4HL4 A;  1T3S A;  4HVW A;  4E7I A;  5FU7 C;  2EJG A;  2BS4 A;  3TRE A;  5CAI A;  1D0Z A;  4C92 C;  3CCJ A;  1M2O A;  3MO8 A;  3M0T A;  4ANJ A;  4FYY B;  4GLK A;  4JLG A;  5FU6 B;  4E7S A;  1Q95 G;  4RMO A;  2DYB A;  1SSH A;  1XQH A;  2GTO A;  3CBM A;  2EQI A;  3A5Z B;  3GBQ A;  5KYY A;  1OZ3 A;  4HA8 A;  5CKD A;  3GPL A;  5GJV B;  5LQF B;  4EOS B;  2AKK A;  1IGQ A;  2QYZ A;  2BTT A;  2IW9 B;  1K8A C;  4UN0 A;  3EG9 B;  1BU1 A;  4A53 A;  4M7A D;  4DBR A;  3QYH B;  1NJI C;  4HXJ A;  1W2B S;  1OYX A;  2QQR A;  1V29 B;  2O31 A;  3S6W A;  5KYX A;  4C92 G;  1M90 U;  3RIR A;  2EYX A;  3TU4 K;  2JS0 A;  2WSF E;  1ZP2 A;  3NTK A;  4MDW A;  2DD5 A;  4MZP A;  1QVG A;  2BUD A;  3CC4 A;  1AWX A;  3H6Z A;  2AZS A;  4M78 B;  2BE9 B;  1F5Q B;  3MP8 A;  2GGR A;  3DLM A;  3I56 A;  1TSF A;  1X75 C;  4KRT A;  4NL2 A;  1X6G A;  4ZN1 A;  1WQ7 A;  4YOO A;  2UZD B;  2COZ A;  3N5B B;  3KFV A;  1F1B B;  3OSS C;  3OBY A;  2AHJ B;  1ZSG A;  3GTM S;  4F7S B;  3HKS A;  2D6F A;  2PZ1 A;  3OYD A;  2KYB A;  1O9K B;  4OB0 B;  2EFI A;  3REB B;  4C8Q C;  1KFZ A;  1U06 A;  1M3B A;  3L2R A;  4C5I A;  5GAM h;  1Q81 C;  3LH0 A;  1Y57 A;  4QQG A;  5LMK B;  2AK5 A;  3L2U A;  3OYC A;  5HK0 A;  2CCH B;  3CPW S;  1M1K R;  4FW2 A;  5KYU A;  3DB3 A;  5EG2 A;  3QPH A;  3CXC P;  2DVE A;  1RAA B;  1OQK A;  2NUT B;  3GLX A;  3QJY A;  3WVE B;  4AG2 C;  2K3Y A;  1YI2 Q;  1WXT A;  4LDW A;  5HCK A;  4AFS C;  4RTY A;  2QTX A;  4C8Q G;  3HP9 A;  4X34 A;  4JS5 A;  1UNG D;  3M0S A;  1TU0 B;  2ZPE B;  3JCM e;  3CC4 Q;  5I21 A;  1BIB A;  4E7Z A;  1MNE A;  3FIF A;  4LUE A;  5LJ3 g;  3I56 Q;  4Z89 A;  4EOQ B;  4BY7 X;  1WLP B;  2DZ9 A;  1U1T A;  2CJM B;  2WIH B;  4BCK B;  3M57 A;  5AT1 B;  4BI3 A;  4C5E A;  3CME A;  1YIT A;  4F14 A;  4QW2 A;  3TNI B;  5CKE A;  1JRI A;  3PVQ A;  2LCS A;  3I55 Q;  1H27 B;  1VQK T;  2K5L A;  4C8Q D;  4FYV B;  3H9N A;  4J6W A;  1M90 R;  1VQL T;  5HNB B;  2AKL A;  2WSE E;  2KI7 A;  5GMK j;  2MF2 A;  4HLQ A;  5FU6 C;  3RKY A;  1MV3 A;  4L6V 5;  4BE1 A;  2XKO C;  1E7P A;  2J6K A;  1WXB A;  1EFN A;  4QQD A;  2CUB A;  3CPW P;  1W70 A;  4BDZ A;  1TTH B; 
#chains in the Genus database with same CATH homology
 1Y07 A;  5DLO A;  2QEX A;  4IUP A;  1JBM A;  2M16 A;  4N0A A;  1VQ9 T;  3J7A F;  4QVD A;  3VKH A;  2Y90 A;  3QKJ A;  1R8O B;  3E9F A;  3M5A A;  5HK3 A;  2FVU A;  3CCM A;  4PJO A;  1H3Z A;  5CCA A;  3NFC A;  4XK8 E;  3OYJ A;  4M7A E;  2K57 A;  2BS3 A;  5GAN f;  3QZ9 B;  4HT9 A;  1OZ2 A;  2K5F A;  2LDM A;  3H4C A;  3CC2 A;  3VYG A;  5C0M A;  4HCB A;  3QG1 A;  3GOX A;  1XNI A;  5GAN h;  2L5Q A;  2O4X B;  2ZPB B;  1YJN T;  4R55 A;  2ZZD B;  4F7U A;  2MI6 A;  3OYB A;  2G3R A;  4R56 A;  2KDS A;  4C8Q A;  3CCE A;  2L8D A;  3OYI A;  2L3R A;  2LT4 A;  2QI2 A;  3KBG A;  4M75 G;  3C95 A;  2M1H A;  4M78 C;  1QW1 A;  5LJ3 e;  3CCV T;  4E47 A;  4N0A C;  4E7J A;  2YLC A;  3KUF A;  1VQ7 A;  2XD0 A;  2DTI A;  2RJE A;  2KMG A;  4ZTJ A;  3AHU A;  4GY5 A;  2RI5 A;  1MHN A;  1GXI E;  1YI2 T;  3OW2 A;  1Q82 C;  3BG9 A;  4JUV A;  2DO3 A;  4XAX B;  4C0D B;  3M59 A;  2DXB B;  3V7S A;  1U8R A;  2GF7 A;  4E7L A;  3JCM d;  1O75 A;  4ZGJ B;  4PLL A;  2VXF A;  3G4S T;  3JCM J;  3JAM E;  2O01 E;  3HL8 A;  5CR2 A;  2NLU A;  1QP3 A;  3JCM W;  2E1H A;  1JB0 E;  3QUI A;  1VQP T;  3OMC A;  5GAM f;  3INZ A;  4DQ2 A;  5LJ3 j;  5GAM d;  3HHT B;  1WQW A;  3JCM X;  2QQ8 A;  2KQW A;  4B9W A;  4C92 F;  3L2W A;  4XTU A;  4XTV A;  3GP8 A;  1S72 A;  1FXX A;  4KBM B;  4C92 D;  3P8D A;  4IUT A;  4N4G A;  1B34 B;  3V7R A;  4MZM A;  1YHQ A;  5DLQ E;  4M77 B;  4EMK A;  4NL3 A;  2OAU A;  4BI8 B;  4KUL A;  4M78 G;  3SB2 A;  4EMH A;  3CBP A;  4NC6 A;  3MCA B;  4C92 E;  5GAN e;  3EFR A;  5GAO l;  1G3S A;  5CIU A;  2OTJ T;  4E7K A;  3M54 A;  3JB9 H;  4QQ6 A;  1UGP B;  4M7D B;  3MHX A;  2K2V A;  5GMK h;  3C4S A;  1LNX A;  1VQ5 A;  3UWN A;  3DB4 A;  2D9T A;  2CZ1 B;  2DEQ A;  3ZBD A;  3L42 A;  4ZGE B;  3X25 B;  3OMG A;  3DLL A;  4AI6 A;  4TVR A;  3OYL A;  4HNT A;  3I55 T;  3JB9 G;  3FLG A;  3OS1 A;  5GAN j;  2VC8 A;  2E6N A;  2HQE A;  4JX5 A;  5HY6 A;  2K5I A;  3CCS A;  5CKF A;  4BY6 C;  5I2S A;  4MDX A;  4IUV A;  2WJ9 A;  3OBW A;  5DY9 A;  2RD1 A;  2E12 A;  1BYM A;  1Y96 A;  3LYI A;  1VQ6 A;  1K73 C;  4A4H A;  2LX9 A;  4PL6 A;  3SWN B;  2GQV A;  2RH2 A;  2PVG B;  2RB6 A;  3PFS A;  4M7A B;  3FB9 A;  3OYH A;  5LJ5 g;  5GAN 6;  3JCM b;  1I81 A;  3SD4 A;  5FRN A;  3TW6 A;  3URG A;  4YTL A;  3CCL A;  2DZC A;  3PNW C;  4M78 D;  2GFU A;  4CRI A;  2DKG A;  2EYQ A;  2LCC A;  3VYH B;  2DTO A;  1ZQ1 A;  5GAO p;  3OY9 A;  2I2L A;  5IT9 E;  4PJO F;  5KE2 A;  3A8H B;  2VGN A;  1DJ7 B;  4IUU A;  2QDJ A;  3OYY A;  1KD1 C;  4BDZ A;  3X26 B;  1NPR A;  2LNV A;  4FIB A;  4XTX A;  4M75 A;  4X9C A;  1RL2 A;  2QFZ A;  5GMK e;  1JJ2 A;  5J39 A;  1G5V A;  3L1A A;  3NTH A;  4ELY C;  3ME9 A;  3SFM A;  4PJO E;  4QVZ A;  2OTL T;  4F7U F;  3CCU A;  1H64 1;  3QYG B;  3T9N A;  2LQK A;  1VQK A;  1WPY A;  2VGM A;  4II1 A;  2GCX A;  4XTY A;  3HB9 A;  3OQ5 A;  5LJ3 f;  1XOV A;  3KHI A;  5LJ3 d;  1VQL A;  5KCH A;  4F7U E;  4J6Y A;  5CQX A;  5CQY A;  5LJ3 h;  5GAO r;  4C8Q E;  2JVV A;  4BUG A;  2X35 A;  1X6O A;  2P0Q A;  2PVO B;  4XU0 A;  1G3T A;  4XTW A;  3VV0 A;  3S3O A;  4IUR A;  1VQO T;  4UC4 A;  4IKF A;  2PU9 B;  1EIF A;  1BI1 A;  3RKW A;  3GF5 A;  2QQA A;  3RES A;  2QA4 T;  4KUD K;  2ZZD A;  2RK2 A;  2P0K A;  3LGL A;  4OF1 A;  5FU7 B;  5GMK i;  2FHD A;  2IVW A;  2QF7 A;  3MEW A;  2DIG A;  2MWP A;  2CS7 A;  2JNG A;  3E1S A;  4M78 A;  4C92 B;  2CZ0 B;  2XG8 D;  3CEY A;  1P92 A;  3PIP A;  3OW2 S;  4AKG A;  1PSE A;  2RHI A;  4J7F A;  3M53 A;  3HZJ A;  3QZ5 B;  4EMG A;  5C6S A;  3CCJ T;  1QVF A;  2KSS A;  3NTI A;  1XTD A;  1K73 U;  5GAN 4;  3MP1 A;  4AKI A;  1KC8 C;  3RMQ A;  5D6W A;  2YHT A;  2JZ2 A;  5GAN d;  4JX4 A;  1UGR B;  1YJN A;  2KR6 A;  2FB7 A;  2RI2 A;  2EQM A;  2DXU A;  2F69 A;  3JB9 J;  4QSH A;  2KK4 A;  4BE2 A;  2KY9 A;  2HAX A;  1K9M C;  4JRQ A;  4FT4 A;  4C0Z A;  5GAN 3;  3G6E A;  3VKG A;  4OB2 B;  3C12 A;  3ER0 A;  4J5Y A;  2LVM A;  4RG8 A;  3ZFJ A;  3ZEH A;  1KQS A;  4OB3 B;  4N4I A;  1FKM A;  3OA6 A;  3CD6 A;  5LJ5 e;  3OS5 A;  1YI2 A;  2A3L A;  2PUK B;  3H8Z A;  3JCM g;  1VQ4 T;  4J7I A;  1AHJ B;  1TH7 A;  2RHY A;  2WSC E;  2RHZ A;  4FM4 B;  2HNI A;  4O6J A;  4OVA A;  5J26 A;  3SDZ A;  3QXE B;  3QDR B;  2XDP A;  4HCZ A;  4C0D C;  3G4S A;  1WGS A;  5EJC A;  2H3J A;  3C94 A;  2DXT A;  3OYM A;  2A7Y A;  3CXC A;  1X01 A;  2QQS A;  4V2S A;  4ZTF A;  5KCO A;  2LQ8 A;  3UPU A;  4L5G A;  1VQP A;  3OB9 A;  1IZ6 A;  1UEB A;  2EKO A;  2CYZ B;  3J80 E;  4C5G A;  4FL6 A;  5CKH A;  4CI0 C;  3CC4 T;  2R5A A;  4BAC A;  5CO7 A;  5I2M A;  2D0Q B;  3M9Q A;  5LJ5 j;  3V8J A;  1Q7Y U;  2ZPI B;  3M4Y A;  2HBP A;  1M1K C;  3I56 T;  3BDU A;  4PJO B;  5A2Q E;  2QQB A;  4E7H A;  4LDX A;  3X28 B;  2OTJ A;  3VJP A;  2K4Y A;  2PVD B;  3EFS A;  2ZCF B;  2R5M A;  1D3B A;  3QII A;  4M77 C;  1BI0 A;  1I8F A;  3LW5 E;  3RER A;  3VYG B;  4OGE A;  3CPF A;  3A8O B;  4LD6 A;  2X4J A;  1W2B A;  2KVQ G;  2DD5 B;  4M7D C;  4M75 F;  4B9X A;  4F7U B;  2F5K A;  4FT2 A;  4M75 D;  4C8Q B;  1FX7 A;  3HRS A;  4HKE A;  3ASK A;  2MAM A;  4D6W A;  5GAO q;  5GAN 5;  2E41 A;  2QDY B;  3BFM A;  1O9S A;  1YJW T;  2DTH A;  3LGF A;  2X4X A;  4M75 E;  1M1G A;  3BDL A;  3I55 A;  1N27 A;  3FC3 A;  2Y4X A;  4OP0 A;  3S3M A;  1NPP A;  2JTF A;  3X20 B;  4LDV A;  1K9M U;  1JJ2 S;  2B8A A;  2P0P A;  2E10 A;  2X4Y A;  5CK9 A;  2EQU A;  4BBS M;  3M4G A;  1WJS A;  4RKU E;  2QQ9 A;  3V8L A;  4KUI A;  3VUB A;  3OYG A;  2WAC A;  2F5T X;  4Y28 E;  1I5L A;  2DD4 A;  3OYF A;  3QSU A;  1OI1 A;  5IAY A;  2DXC A;  2BIV A;  3M55 A;  4M77 G;  3L2Z A;  3JCM P;  1N6A A;  1QP2 A;  5A0D A;  2XI9 A;  2V8I A;  4X9D A;  3SWN C;  1FWZ A;  3M56 A;  1Q82 U;  4M7A C;  3LX7 A;  2JOY A;  4DOV A;  5GAN 7;  4M7D G;  4M78 F;  4PLI A;  1M8V A;  2KAF A;  1BI3 A;  2XID A;  4HCC A;  1VIE A;  2XIC A;  3X24 B;  3A8G B;  4BBR M;  2FL7 A;  2V8J A;  4EMK B;  5GAN 8;  3A8L B;  2Y4Y A;  3QYE A;  1LOJ A;  3V8K A;  4JJN K;  4M78 E;  3HFN A;  1KG1 A;  3S3N A;  3QO3 A;  3MEA A;  3JCM Q;  4JDS A;  1M9S A;  2OTL A;  2CZ7 B;  4BE0 A;  4J83 A;  3VKI A;  4A4F A;  1M1K U;  4NOY A;  1Y7X A;  1M90 C;  2E64 A;  4LD9 K;  1QVF S;  3LWH A;  1U1S A;  3CC7 T;  1W4S A;  3CPW A;  2CZ6 B;  2RO0 A;  1VQN T;  3JB9 F;  3L2V A;  3JB9 D;  4ZN3 A;  3P8B B;  2XU8 A;  4KT0 E;  5GAO n;  3PIO A;  3MEV A;  1UGQ B;  4C5H A;  4ELZ C;  5LJ5 f;  4J8O A;  1BI2 A;  2V8K A;  4EPC A;  5LJ5 d;  3FRN A;  4XU3 A;  2VXE A;  4JRP A;  1VQO A;  4M7A G;  4EDU A;  5D6Y A;  2ZPF B;  5LJ5 h;  4LDY A;  1Q86 C;  4ELJ A;  4M77 F;  3CCQ T;  2RM4 A;  2EQK A;  4WF2 A;  4LDU A;  4M77 D;  2P4T A;  1HXD A;  2O4X A;  2PQW A;  3JCM c;  1KQ2 A;  2DPP B;  2IG0 A;  3CCR T;  1NZ9 A;  1Y96 B;  4HL4 A;  3F70 A;  4A4E A;  4E7I A;  1KQS S;  1VQ8 T;  3CMA T;  2JTM A;  2RHX A;  3OS0 A;  3CME T;  1ZBX A;  4M7D D;  1YIT T;  3HO8 A;  5FU7 C;  2EJG A;  2JN0 A;  2BS4 A;  4OGC A;  4XU1 A;  3CCU T;  1VQ9 A;  3LLR A;  3TRE A;  5CAI A;  4PNO A;  3LWI A;  4C92 C;  3CCJ A;  3QWL A;  4ZGD B;  5LL6 S;  5GAN g;  2DJZ A;  3MO8 A;  3JSC A;  3JRZ A;  2RK1 A;  1PSF A;  2E65 A;  2PUO B;  2KMT A;  1YCY A;  3Q1J A;  2G77 A;  3BW1 A;  4GLK A;  3FDR A;  4JLG A;  4RG2 A;  1KHI A;  1N9R A;  5FU6 B;  2DXB A;  4RMO A;  1XQH A;  3CBM A;  4M75 B;  3A5Z B;  1OZ3 A;  4HA8 A;  5CKB A;  5CKD A;  3GPL A;  4DA4 A;  1YIJ T;  1N8R C;  1QVP A;  3V7C A;  3TW7 A;  4Z6Y A;  1SSF A;  1VQM T;  3PMI A;  1YJ9 T;  4MFD A;  1VUB A;  2RA2 A;  4LOC A;  2X4W A;  4M7A F;  3CCV A;  1K8A C;  4Z02 A;  1KD1 U;  4A53 A;  4M7A D;  2QEX T;  4J6X A;  3QYH B;  5FRM A;  1VQ4 A;  4N4H A;  1B34 A;  1NJI C;  4HNU A;  2XHC A;  2ZGW A;  5L8R E;  3OS2 A;  1W2B S;  1OYX A;  2QQR A;  1V29 B;  4M77 A;  4OMF B;  3CCM T;  3S6W A;  1M90 U;  4C92 G;  1UB4 A;  2VUB A;  3RIR A;  2RJF A;  2MMP A;  3TU4 K;  3OYE A;  3L2Q A;  2WSF E;  4L59 A;  4M7D A;  3HBL A;  3NTK A;  3PT9 A;  4MDW A;  5GAO m;  3CC2 T;  5GAM g;  2DD5 A;  3KXT A;  4MZP A;  2XDB A;  1QVG A;  3R6O A;  4JRI A;  5FLX E;  2BUD A;  3CC4 A;  5HKC A;  3H6Z A;  3G6E T;  4PKC C;  3RKX A;  1Q86 U;  3CCE T;  4M78 B;  3UDC A;  3MP8 A;  3MP6 A;  2EIF A;  3DLM A;  3I56 A;  2E6Z A;  4HT8 A;  4JX6 A;  3QJ6 A;  2E5Q A;  3QHS A;  3G71 T;  2C06 A;  4RCB A;  1X75 C;  2EQJ A;  4NL2 A;  1VQ7 T;  3CD6 T;  3GNG A;  3HFO A;  4ZN1 A;  1WQ7 A;  3OYN A;  4PJO C;  4RCC A;  4JRK A;  2VV5 A;  3VU3 C;  1ZHI A;  3JB9 I;  3N5B B;  3JCM f;  3OSS C;  3OBY A;  2AHJ B;  1WNL A;  1G3Y A;  5IN1 A;  4BI4 A;  1LJO A;  3O8V A;  3PMT A;  3JCM h;  3HKS A;  4MIM A;  3CBO A;  3SWN A;  3OYD A;  2D6F A;  3WVD B;  5DM7 R;  4M7A A;  1YJW A;  4OB0 B;  2EFI A;  4C8Q C;  2GFA A;  4IUQ A;  2M0O A;  3L2R A;  3HRT A;  2EAY A;  2LRQ A;  3M58 A;  1VIF A;  4C5I A;  5GAM h;  1Q81 C;  4MZT A;  1YBY A;  3LH0 A;  2R58 A;  5A0G A;  4OB1 B;  1S72 T;  3MET A;  4QQG A;  1N8R U;  1BIA A;  3L2U A;  1YHQ T;  4AKH A;  3OYC A;  4DOW A;  5HK0 A;  4XTZ A;  3CPW S;  1I4K 1;  3DB3 A;  4ME7 A;  5EG2 A;  1K8A U;  3QPH A;  3UT1 A;  4A4K A;  3BG5 A;  2YLB A;  4PJO G;  2ZPG B;  3EAE A;  2DVE A;  2L89 A;  1NJI U;  4BD3 A;  5KH6 A;  4C0G A;  2M9U A;  3GLX A;  1VQ5 T;  3MEU A;  3QJY A;  3WVE B;  3RUX A;  2K3Y A;  2LC4 A;  1UGS B;  2RHU A;  3TCJ A;  4C0F A;  3DKM A;  4QVC A;  4BDY A;  4F7U G;  5GMK m;  1N9S A;  4LDW A;  4XQ3 A;  3G71 A;  2RJC A;  1RI0 A;  1BKB A;  2QTX A;  3A8M B;  3GNF B;  3HPW A;  3HP9 A;  4C8Q G;  5M9O A;  1M4Z A;  4BY6 B;  2DIQ A;  4EMK C;  4M6V A;  1D3B B;  4X34 A;  3J81 E;  2LT1 A;  4JS5 A;  3CCS T;  3JCM e;  1IRE B;  2ZPE B;  1G3W A;  5AYF A;  1WJR A;  4FU6 A;  4Q5W A;  1BIB A;  5A0L A;  5I21 A;  3HRU A;  3FIF A;  3CC7 A;  2EWN A;  1VQN A;  5LJ3 g;  1VQ6 T;  4ATO A;  3RMS A;  2BKD N;  2DK3 A;  5J3B A;  5GAN 2;  2R57 A;  4JLI A;  2QXF A;  4C92 A;  5GAM e;  3OSV A;  2CKK A;  4P5N A;  3GIB A;  1Y71 A;  3G7Z A;  2VYT A;  3TEE A;  2DZ9 A;  3WXM B;  1U1T A;  2XK0 A;  3CCL T;  3CCQ A;  2FYK A;  1NE8 A;  1M1F A;  4MFE A;  3M57 A;  4JS4 A;  5CVI A;  4PJO D;  2EJ9 A;  2JUF A;  2QA4 A;  4HNV A;  1KHC A;  2DAQ A;  3CCR A;  3CMA A;  4BI3 A;  1VQ8 A;  4MMK A;  4C5E A;  2DD4 B;  1HK9 A;  1Q81 U;  2RJD A;  3QYB A;  2YRV A;  2DXC B;  2XDD A;  3CME A;  1YIT A;  4M7D F;  4M77 E;  4QW2 A;  5GAM j;  5CKE A;  1JRI A;  4A54 A;  4XU2 A;  4C8Q F;  1MGQ A;  2E70 A;  2LTO A;  5GMK l;  2ZPH B;  1KQ1 A;  3JCM V;  1Q7Y C;  2K5L A;  1VQK T;  4C8Q D;  4MML A;  3BG3 A;  4M7D E;  3VUZ A;  3QBY A;  4J6W A;  3E19 A;  3HSB A;  3P8H A;  4O5V A;  1VQL T;  2HD0 A;  3FJP A;  4FSX A;  5KE3 A;  3DL1 A;  1WJQ A;  3CXC S;  3FEO A;  3PTA A;  1QVG S;  2WSE E;  2MWO A;  3E9G A;  2LCL A;  5GMK j;  2MF2 A;  4HLQ A;  5FU6 C;  2EJF A;  1M5Q 1;  2CGH A;  3PGG A;  3RKY A;  3BY7 A;  4NS5 A;  4Y91 A;  5FRO A;  2RI3 A;  4L6V 5;  4A4G A;  2XKO C;  4BE1 A;  1YIJ A;  1KC8 U;  4M75 C;  1E7P A;  1QLB A;  3OYA A;  1VQM A;  2K3X A;  1YJ9 A;  3OYK A;  4VUB A;  5D6X A;  4QQD A;  2HQX A;  4BB7 A;  2BS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...