3A8OB

Crystal structure of nitrile hydratase complexed with trimethylacetamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8oB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8oB02
3A8HB 1JB0E 3LW5E 1UGSB 3WVDB 2PVDB 3VYGB 3QYGB 4Y28E 4FM4B 5L8RE 4L6V5 2AHJB 2DD5A 2ZPFB 2ZPIB 3QYHB 3WVEB 2PU9B 2CZ7B 2DD4B 1UGRB 1UGQB 3QXEB 2PVGB 2WSFE 2ZCFB 3VYGA 2PUKB 2QDYB 2DXCB 2WSCE 3A8MB 4KT0E 2DPPB 1GXIE 3X20B 3VYHB 1AHJB 2CZ0B 2DD4A 2D0QB 1V29B 2ZPEB 4ZGJB 2CZ1B 2DXCA 2ZPHB 3X25B 2ZPGB 2ZPBB 4OB3B 4OB0B 3X26B 4XK8E 2DXBB 3QZ5B 4OB1B 2CZ6B 4ZGDB 3QZ9B 2PUOB 2ZZDB 3X28B 1IREB 1QP2A 1DJ7B 4ZGEB 4OB2B 3A8OB 2DXBA 3A8GB 2WSEE 2O01E 1QP3A 2ZZDA 3X24B 1UGPB 4RKUE 3A8LB 1PSEA 3HHTB 2CYZB 1PSFA 2DD5B 2PVOB
chains in the Genus database with same CATH superfamily
4RCCA 2JMAA 1VQPT 3RUXA 1YJWT 5D6YA 4MZTA 2YT6A 2X4YA 3NPFA 1KQSP 3CPWA 5IHKA 4DBQA 1KC8U 4M7DC 3JCMX 4LUDA 2EJGA 5L8RE 1RI0A 2DXUA 1VQNT 4KUDK 2C0IA 3META 5J39A 2IPOB 5FW9A 4HKEA 3H0IA 3JCMW 2DD5A 1R0BG 2LTOA 1FKMA 3CC2Q 1EZZB 4M7AD 5J26A 3CCVA 3G7ZA 3CCQA 1VQ8Q 1T0HA 3BDUA 3VYGA 3HB9A 1VYTA 3INZA 4FYWB 5IDPB 2BE9B 1JJ2A 2HQXA 4Z89A 1E7PA 1JXOA 2GTJA 1AEYA 1K73U 3OYAA 3LX7A 5KCHA 2CUBA 1GY3B 1V29B 4C8QG 2JOYA 2QK0A 2O31A 5GMKj 4IUQA 4M7AB 1TD6A 3QHSA 3MEAA 3O0GD 2DBKA 1YP5A 2OTLA 5GAOm 4MDWA 2UZEB 2DA9A 1N9SA 2RMOA 2B9RA 4FYVB 4WTOB 1AT1B 4XK8E 4BDYA 2DXBB 1NLPC 1U5SA 2P0KA 3RGFB 3VS5A 4BBSM 2YLCA 3DB3A 2LT4A 2DIGA 1AOJA 4PFPA 4CI0C 1YJNT 1D3BA 3E9FA 3TNIB 4AG1C 4FX3B 2V8JA 2PTKA 1T0JA 2XKOC 4PJOC 4JRPA 1ZSZC 3EOCB 5HK3A 2NLUA 1I1JA 2RPNA 4HCZA 4NS5A 3PO3S 4RUGA 2YUQA 3EFSA 1PG5B 3CD6Q 3CCVQ 2ATCB 1QQJA 3A8LB 1PSEA 5CQYA 1W98B 1M1GA 2AKLA 4C0GA 1VQLA 2EW3A 3EHQA 5DLOA 2G77A 1M90U 4QQDA 1NPPA 1R77A 1QMZB 1UGVA 2XHCA 1ZLMA 1MMDA 4ELLA 1M3BA 5FU7B 1YITT 1U3OA 2WFYB 2EGEA 2ROTA 2FZCB 1UNGD 4LDVA 1TFBA 2H8HA 5HQ0B 2GBQA 4LUEA 3SWNC 5HK0A 4PJJA 4PLIA 3CCRA 1KC8C 4C0DC 2EQJA 4LD9K 3OMCA 2DZ9A 5EFQB 1AWOA 1H25B 2C5OB 2KNBB 4BI8B 2OTLQ 4RTYA 3NTHA 2QG9B 3H41A 4JRQA 3PMTA 2DVJA 3CC2T 4FCYA 3BLRB 3EG9A 9ATCB 4HT9A 3OS1A 2EFIA 4KRCB 2RHUA 2QGGA 3OS5A 2Y4YA 2QGSA 2DYIA 1MHNA 2A36A 2O4XB 4QVZA 1K73C 3OYNA 5LJ3g 4M7DD 4C8QE 4CFWB 2L0AA 2BKZB 3CBMA 2HKQB 4JUVA 3I9QA 4OB3B 4OB0B 1NM7A 3EG1A 2RI5A 1UG1A 2QGFB 3JRZA 4BE1A 2DXTA 1VQLQ 4F7JB 4F14A 4QKUA 5LJ3h 1Q86U 1ZUYA 4FSXA 2XICA 3EG2A 3QJYA 1H3ZA 3OYGA 2ESWA 2A28A 2K3XA 3F70A 3OYHA 1E9HB 4M7DB 1Y57A 1QP2A 3CCET 2JM9A 2QDLA 3RKYA 1CKAA 4AFUC 2EYQA 4HNUA 4E6RA 1VQ6T 4EIKA 2VASA 3CCRQ 1ZA2B 4Z02A 3CPFA 4MFDA 4ROEA 1AWXA 4ZN3A 3EG0A 3V7SA 1KIKA 4PFOA 4AMCA 2RHXA 4RMOA 4A4KA 4E7IA 1X6BA 2RK2A 3VRZA 1RUWA 2DK3A 3CD6T 5FLXE 3CCVT 1RI9A 3E1SA 2CJMB 2LCLA 2DL3A 2CSIA 1WFWA 3TCJA 1M90C 3NHNA 1JKWA 1H26B 1FX7A 4RG2A 2KYBA 4HVUA 1Q82C 2XDDA 2KXDA 4C5GA 1WQ7A 1HSQA 2RJFA 2JTMA 2A08A 2KROA 4F70B 1PRMC 4M78D 1FMKA 3HZJA 1IZ6A 4PJOD 1OEBA 2PVGB 2W0ZA 4B6MA 1MV3A 2KSSA 2OTLT 3VS4A 3MI9B 4DEXA 5GAOr 3GBQA 5GANj 3CEYA 3A8MB 1RAHB 1GFDA 1YNZA 4KT0E 1BIBA 1PC0A 1WI7A 3M03A 3UA7A 3PVQA 2EAYA 5IHNA 1S1NA 2L3PA 1NYGA 2DL7A 2HNIA 2DXCA 4PJOB 4A4GA 1ZSZB 2DF6A 4G6LB 1VQKA 1URCB 3GP8A 1QMCA 2W9FA 5I11A 4CC3A 3ZL7C 3VKHA 2PJQA 5GAN7 4A4HA 2RF0A 3LGFA 2VB6A 4ANJA 3QZ5B 3P8HA 1M1KU 1JSUB 3K7AM 5A2QE 1N8RR 1YI2A 4HT8A 1M3AA 4F7UF 1VQLT 4EMKC 1Q86C 1WXBA 4VUBA 1UHFA 1DJ7B 3SWNB 3JSCA 2D1XA 1JEGA 2HL5C 3HL8A 4E7ZA 4BCOB 5AT1B 1QVFS 2FPEA 3CPWS 4A4EA 2K6DA 4ZTFA 3JB9J 5HBHB 3MY1B 3VUZA 3REBB 5HY6A 3GF5A 3CC7A 3MIAB 5D6XA 1KHCA 2GGRA 3QHRB 2YRDA 1BIAA 2EKHA 2VWFA 3GNFB 2LZ6B 2WACA 1SSHA 4N0AC 4M75C 2JGZB 1VIEA 1H92A 4QW2A 5ECAA 3OYBA 1AD5A 1S72A 2HQHA 2ZAEA 3S3MA 4DQ2A 4BCFB 2LDMA 2BUDA 4F7UA 2HSEB 5I22A 4F7SB 1ABOA 1OQKA 1OZ2A 2HBPA 1NLOC 5FU6C 2CH4A 2BS3A 2AZSA 2DRKA 5HVYB 1UGQB 2YSQA 2WSFE 1QWEA 1UJ0A 1ZUUA 4OGRB 2LJ0A 3L2RA 1OL2B 4M77D 3VKGA 1Y96A 4CRIA 2WSCE 4F7UG 1WZOA 3FJ5A 4O5VA 4LDUA 2DL8A 1VQ4A 2CP6A 4DOWA 1YI2Q 2P4TA 4J8OA 1TUCA 1KXUA 2CZ0B 4HNVA 1KG1A 2OX7A 2E1HA 3TSWA 2EQMA 3JCMJ 4J9FA 1QCFA 3SDZA 2F2CA 2X4XA 1MNEA 2FZKB 4DOVA 2ZPGB 1IO6A 2LMJA 4IIMA 1UNHD 5HBJB 4BY1X 2JMCA 4J7IA 5KYNA 5GMKh 2HL3A 4C92C 1OKVB 3X26B 4KH0B 3PTAA 1B34B 2GNCA 1F5QB 1WJRA 3E2UA 3CC7Q 3MHXA 3QIIA 5LJ5j 1D3UB 3JB9H 3OYYA 2JJ9A 2I40B 1M1KC 3CMAQ 5GANd 4EOPB 1S72Q 4IIOA 1JBMA 4JS4A 2A7YA 2WMAB 2K2VA 4RTXA 1SKUB 1BK2A 2RI2A 2C5NB 5LJ3e 1XO2A 4ZNXA 1QCOA 5I21A 1D09B 5L2WB 1AWJA 4IUTA 4EPCA 1D0XA 2EKOA 4BI4A 3H6ZA 2OTJQ 4LN2A 1KD1R 4LD6A 4B9WA 1VQ4Q 5KE3A 1G3YA 3OA6A 3ME9A 4FYYB 5FROA 3M0QA 2AHJB 3PMIA 1AZEA 3AHUA 2IW6B 3CBOA 2EUFA 2ED1A 5KYWB 3OYJA 2V1QA 2E10A 3I56T 2ZCFB 3QWYA 4J5YA 2K7AA 3CCMA 2RM4A 1AZGB 2E4HA 5KH6A 3I55T 1G5VA 4F7UE 1X75C 4QVCA 4XTWA 4EMKB 2CCIB 1VYWB 2PQWA 1LPLA 2DNUA 4N4IA 5LMKB 2MYSA 2A3LA 2J6FA 3EH1A 3OY9A 2H3JA 4J9CA 4GLMA 2UZDB 2YWWA 3TU4K 1M27C 1NJIR 1VUBA 1D0ZA 2AKKA 1ABQA 5DM7R 3KUFA 1IB8A 5CCAA 5GAOl 1K9AA 3EHRA 1RLPC 4BI3A 2HD0A 3C4SA 1ARKA 4FYXB 5I2MA 3LYIA 5KE2A 5IH2A 3BFMA 3G33B 3B57A 2HMAA 4M75B 2GF7A 4J9HA 2FL7A 2IVWA 1VOMA 3HKSA 4KULA 4L5GA 1D1BA 2NUPB 3G4SA 2XDBA 3QYBA 2DXBA 2YRVA 3EGUA 2G3RA 2KI7A 3CMAT 3RMQA 2E65A 3HRTA 5FU6B 2WIHB 5I5ZB 4M7AG 2VC8A 1VQMA 5GJVB 2EVRA 2F5TX 2P4RA 1JOWA 1OZ3A 1XQHA 1PSFA 4C92D 2L3QA 4LDWA 3CCMQ 1YCYA 1ACMB 2SEMA 1WJSA 2RJDA 2LX9A 1QVGA 2AK5A 1H4LD 1VQOA 4AG2C 1OULA 4C8QF 4Y28E 4BDZA 1KD1U 2WMBB 2OTJT 5GAN3 4OMLA 3OYKA 2J7IA 2P84A 2W10A 3I5RA 3MP8A 3UT1A 5DY9A 1KQSA 2RJCA 5KYYB 2R57A 1MUZA 4C92B 4YOSA 3JCMd 2WPAB 4R0KA 1IGUA 4HCBA 1I0CA 5HCKA 1QVFA 1XNIA 2DLPA 4C5EA 1Q95G 5GANh 1ZQ1A 3UATA 3CXCP 1N27A 2ZPEB 5ACBA 2DE0X 5GANf 4GBQA 2MMPA 2KE9A 3M59A 4C8QA 3G4SQ 4Z8AA 3X25B 1VINA 3JCMP 3DOGB 4M7DF 2LQNA 3CCJA 4JPBW 4QVDA 1UB4A 1VQMQ 3M5AA 1NJIU 2EYZA 2OAUA 3JB9D 2O4XA 2LP5A 2HDAA 4WF2A 5GAMd 1XOVA 2CCHB 2KR6A 3ZFJA 4OMPA 2W9ZA 1KK7A 3EGDB 1VQ9Q 5CKEA 2QTXA 2KRMA 3X28B 1AD6A 1M2VB 1YJ9A 1VQOQ 3OMGA 2E5QA 4TVRA 5GMKe 2C0OA 2QQ8A 4BACA 4HXJA 1TSFA 4F7LB 2E6NA 1Q7YR 1UJYA 1FWZA 3NGPA 2NUTB 2GQIA 1JXMA 1BCOA 4JLGA 1JJ2P 1U06A 2MF2A 3OW2S 3GNGA 3MCAB 3S6WA 2QQRA 4M7DA 4M7AE 1I5OB 1YHQA 2DEQA 1WX6A 4BD3A 2L89A 1HYOA 1B07A 2IW9B 2ABLA 4FT2A 4XQ3A 4O6JA 1KFZA 3TW6A 1OOTA 2LVMA 4M78C 1WHMA 5GAN4 3CCLA 2LW4A 4OGCA 3CCMT 4QSHA 3JCMV 1H1RB 4QQ6A 1MGQA 1BKBA 4BCGB 1UNLD 2RHYA 4M7DG 1E7OA 2DO3A 1KD1C 1PHTA 1V1CA 3TVTA 3CCQQ 2BZYA 4BY6C 2GCXA 4KRDB 2DD4B 2DAQA 2WEVB 1ZBXA 1G3WA 2GFAA 3CCJQ 3M0PA 3MEWA 2YHTA 1WJQA 2DYBA 4JZ3A 4I3ZB 2IG0A 4RG8A 4LNPA 1C6VX 1OIYB 2O9VA 2BPMB 4K11A 3RDVA 2L5QA 3A5ZB 2DPPB 4RTUA 1GXIE 5IF1B 2ROLA 5D7UA 3VS6A 1LJOA 4HVWA 3OYLA 2F2WA 4X34A 1UECA 4F17A 4J6WA 4KGZB 2KT8A 3VU3C 4XTZA 2QQBA 3OSVA 2EQKA 3HPWA 3U23A 2X9HA 4ZN1A 5LJ5g 3G4ST 3M53A 1VQ8T 2YDLA 4OMQA 3BLQB 1PKDB 3RKWA 2HEQA 5KYUB 1C1AA 5KCOA 1KJWA 1YHQQ 2M0YA 4PJOA 1NJIC 4JJDA 1VIFA 3QZ9B 3V7RA 5D6WA 4EOMB 2QASA 1NG2A 2Y90A 3QDFA 4YOOA 1FVVB 3CCLQ 3LQ5B 2CP7A 2DX1A 3VS2A 5LJ5h 4OMNA 3D7SB 4FU6A 3LH5A 3AT1B 5LJ5f 1VQ9T 2W2HA 4IKFA 1U8RA 1GUXB 2QYZA 3MY5B 3JB9I 1OPKA 4PJOG 3CC4A 3JCMh 1UGPB 1Q7YU 1QCNA 2KGTA 3JCMf 3SWNA 3URGA 3DJBA 1PD1A 3PVLA 4RCBA 4C5HA 4FL6A 2GTOA 2KAFA 1WPYA 5CQXA 1O9SA 2UZLB 2R5MA 1OU8A 1VA7A 4F7NB 3HRSA 4II1A 3QWLA 1OU9A 1TS9A 4IUPA 2CKKA 4MMLA 2FB7A 4JLIA 4F6UB 2I53A 2IVXA 2RQWA 3CCUA 2MOXA 3MPUB 2YUPA 2R58A 4M77C 2KMGA 2K5IA 2QA4A 2YUOA 2VXEA 3WVEB 3HBLA 2EGCA 1G83A 1GFCA 4AKHA 1KSWA 2AIRB 2CT3A 2JTFA 3HP9A 2ECZA 4M7DE 3QXEB 3VS0A 2JM8A 1TG0A 1B7TA 1ZA1B 3CCQT 1WHLA 5FRNA 1TTHB 2SRCA 2WHBB 3PFSA 2LQKA 4J9EA 2PK2A 3G6EA 4ME7A 5GAMf 3FIFA 3S3NA 5CVIA 2V8KA 3MP6A 2EJFA 4BCIB 7AT1B 2D0QB 1IGQA 2FEIA 2FPFA 3TQ7P 2DRMA 4NL2A 2LJ3A 2PK9B 4PJNA 4N4HA 3DKMA 1G8XA 8ATCB 4E7LA 1M30A 3RERA 3MP1A 1NYFA 4OF1A 3CC4Q 2E12A 1RABB 4CRLB 5GANe 2V8IA 3ASKA 2KYMA 4AFZC 3WXMB 1G3NC 2DMOA 4UN0A 2HBWA 4M78B 2LNHB 2OAWA 2L2PA 1IREB 1B34A 3DLLA 4ZGEB 1QVGS 1OYXA 4OB2B 1ZHIA 2DL5A 4DBHA 2J6KA 1E6HA 1QVPA 3CCLT 1W2BP 3JCMc 2QA4Q 4CC2A 4M6VA 4BY6B 3BW1A 3NTIA 1KQSS 4BCKB 4LOCA 4PJOE 2FRWA 3LH0A 4HCCA 1RACB 1GBRA 5DQWA 2K4YA 1X6OA 1WXTA 4RTTA 1Q7YC 1X01A 2NYSA 4BE0A 5GMKi 1JQQA 1OPLA 2RHZA 2MPXC 2EGAA 1NPRA 4C0DB 5IHIA 3CMEA 1X43A 1BU1A 4NL3A 3SHWA 2LX7A 4M4ZA 2KK4A 4AT1B 1PWTA 2ZPIB 3KFVA 3GTMS 3CCRT 4E7JA 5GAOp 5KYXB 1UGRB 4E7SA 2O2OA 1WHGA 1OGUB 3O8VA 3L2WA 1H1PB 1M1FA 3DTOA 1BI1A 1K8AR 4OVAA 1JO8A 1YIJA 5KYWA 1MMAA 1R0CB 1UEBA 4E7HA 3OW2A 1P5EB 2K3YA 5GMKl 2RJEA 3HFNA 1VQKQ 4KH1B 2E64A 1I8FA 1PNJA 5I2SA 2E41A 4PJLA 4M75F 1MMNA 3G71A 4OGEA 2CDTA 4FT4A 2L8DA 1K4US 2M9UA 2E5KA 2EJ9A 1UTIA 1HJDA 4EMKA 3KXTA 4EDUA 1RAGB 2DERA 2DTIA 2XIDA 4A54A 3M0SA 3CC4T 2MWOA 3M0TA 3UF4A 2J06A 4J9GA 3L2QA 2PUOB 2CH4W 4XTYA 2CP2A 1GRIA 4KBMB 1X69A 4PJMA 1H27B 2IN3A 3TW7A 2XDPA 1SHFA 3PE0A 4KRTA 5EG2A 3CMEQ 4M77B 3E9GA 4BCQD 2QAZA 3HRUA 3NFCA 4ROCA 4IURA 2O01E 4EOLB 1V76A 2PZ1A 2D6FA 3EG3A 3A98A 4N0AA 4M75A 1NEBA 2BZ8A 3FB9A 4BCPB 2X3WD 3HHTB 3RIRA 4CC4B 2QA4T 1VQPA 4PLLA 3BY7A 1YJWA 4DBFA 2A0FB 2PVOB 2NUPA 5LJ5e 4BCND 5J3BA 1O9KB 1N8RU 5FWCA 2O88A 3M4YA 2KQWA 2CGHA 1MMGA 4Z88A 4BCQB 4FM4B 1E6GA 4M75G 3JCMe 4L6V5 3KBGA 2JW4A 1N4MA 2DTHA 2R7GA 2PU9B 4RTVA 1Y0MA 3M4GA 3G71Q 1H1SB 1EX4A 4NOYA 4BCNB 2PUKB 2LJ1A 2DM1A 3OB9A 3L2UA 1K0XA 2YLBA 2EYYA 2KVQG 4XTUA 3GIBA 5LJ3j 1RLQC 2K5FA 3POMA 1UFFA 2EYXA 2UZBB 1AHJB 1P92A 3M57A 5HKCA 3J7AF 1FXXA 4C92A 1GCQC 1K9MR 3ZBDA 1K8AU 3BG9A 4BB7A 1LCKA 3OSSC 2XG8D 5GAMj 2J6OA 5HBEB 2G9XB 2BKDN 4M7AF 5EJCA 2DEUA 3VV0A 2C5XB 1VQKT 3RKXA 3EGXB 2HAXA 2RQUA 4C92G 1VQPQ 3TREA 4Y91A 1QLBA 1HXDA 4Q5WA 3REAB 2DMEA 1YJNA 1H8KA 3UA6A 1OX8A 1OV3A 1YI2T 1KC8R 4BBRM 2QTVA 2AZVA 3A8OB 2WSEE 3QBYA 4JX6A 4XU3A 2EWNA 3EGDA 3SB2A 3QDRB 3CMET 4KUIA 2RB6A 2Z0WA 4M7AA 1X2KA 1M2VA 3E19A 1TH7A 4KGXB 5CAIA 3THKA 4X9CA 3CC7T 4L59A 2XMFA 4JRIA 3VRYA 2JN0A 2PVDB 2HZYA 3KHIA 2VGNA 1N8RC 4YC3B 1X6GA 2DFUA 3FJPA 1S72T 3R6OA 2M16A 2BS2A 4A53A 2RQVA 4M75E 8AT1B 3H0HA 2DILA 2JS0A 5A0LA 4EOSB 1WGSA 2K57A 4EMGA 1M8VA 1Z9ZA 3C95A 2BZXA 4EOOB 3BHVB 2EYWA 3JB9G 1D1AA 1WIEA 3HFOA 1OKWB 3G71T 2LCSA 2PMIB 1M9SA 2RQTA 2HQEA 3TNWB 2VYTA 2RN8A 4C8QC 1WA7A 2WXVB 1YWPA 4XU0A 2EBPA 4GLKA 1VQ4T 2DD4A 5CR2A 4ELYC 2A37A 2FVUA 2B86A 2QXFA 1TWBA 4AFSC 2DTOA 3JCMb 5GANg 1N9RA 2MWPA 1K9MU 1OX9A 1K8AC 2E3IA 4NC6A 3O5ZA 2IIMA 4A63B 3M0RA 2MCNA 3C12A 4RODA 1RL2A 2LRQA 1IXDA 4QT7A 4UC4A 4QQGA 1TUDA 3OYIA 2ENMA 4CFNB 3OYCA 1W4SA 3H0FA 2MI6A 1IRXA 4JRKA 1M90R 1TXQA 4BCHB 2HSPA 1HK9A 4ZGDB 4C92E 4CXAB 3CCEA 1Q82R 3QHWB 1A0NB 3RESA 1UHCA 5LJ3d 1PKSA 2C6TB 1VQ6A 1CKBA 5KYUA 1Y07A 2FPDA 2G6FX 4MZPA 1ZUKA 2RO0A 4E47A 4FIBA 4RTZA 2E3HA 3SEMA 5GAN5 5M9OA 4XU2A 2F5KA 1SPKA 1LNXA 4OMMA 1QVFP 2KDSA 3CPWP 1G2BA 2D8JA 3FDRA 2EPDA 3CD6A 2HKNA 3M58A 1YCSB 3PGGA 1NEGA 3EFOB 3VKIA 3BDLA 3NTKA 1JB0E 1GUXA 3WVDB 2MIOA 1RAIB 2DL4A 3OQ5A 4BCMD 1Q81R 4F6SB 2D8HA 4PL6A 3BG3A 3I35A 5FWBA 2VV5A 3UDCA 2J05A 1WDXA 3QWXX 3M55A 1AVZC 4MDXA 4EOKB 3JAME 3EJ1B 2CZ7B 1I5LA 4YOZA 3TN8B 4MMKA 2JS2A 4ELZC 2BE7D 1KHIA 4PFZA 1Y71A 1H1QB 5CK9A 5CKFA 1YBYA 4A4FA 4BCMB 1CSKA 2BS4A 1Q86R 5ICPB 2DJQA 3JCMQ 1WNLA 1OI9B 1NBEB 2ZGWA 2CT4A 2EIFA 3MEVA 2EQUA 3H4CA 4CFUD 3CCEQ 3SFMA 1BB9A 4XU1A 4GY5A 3CBPA 4ZGJB 1SF9A 2YXYA 1GH6B 2DKGA 1RAEB 1VQ6Q 3VS7A 2ZPHB 6AT1B 4M78F 2RI3A 4PJOF 3LWIA 2W96A 3A1PA 1NE8A 1K9MC 2QEXA 1JRIA 1QW1A 4JDSA 3EAEA 2JZ2A 4J7FA 2V22B 4ZTJA 2QI2A 4CFUB 2CZ6B 2H3EB 2ZZDB 2K9GA 5DQVA 2WIPB 1YJ9Q 1QKXA 3J80E 3TNHB 1WXUA 2F2XA 4C8QD 4J9DA 1Q82U 3UPUA 4R56A 2DZCA 4V2SA 1HD3A 2MK5A 2PHGA 3M56A 3EIDB 2OJ2A 1K1ZA 3M9QA 1QP3A 5CEIB 1RAFB 3RBBB 4DEYA 4M78A 2DJZA 4FW1A 1VQMT 5A0DA 2UUEB 2GFUA 1ZSZA 5GAOn 2AT1B 4LDYA 3JCMg 4EONB 3CQTA 3PIOA 2DD5B 3HSBA 1SEMA 1OL1B 3RNJA 2KBTA 3EFRA 3A8HB 2K3BA 4D8KA 4C8QB 2RA2A 3VS3A 3H8ZA 1MV0B 4E2FB 2C5VB 3HO8A 3VYGB 1KQ1A 4X1VA 2QF7A 1RADB 1U1TA 2RNAA 1VQOT 1Q81U 5FGKB 4M78G 1M3CA 5IXFA 2M1HA 1F1BB 1BI3A 4ATOA 2KR3A 4ESRA 1JU5C 1M4ZA 5HNBB 2RQRA 2QEXQ 4CFVB 5IAYA 1TU0B 3VJPA 3VUBA 1W6XA 1M1KR 2CREA 2DVEA 1I81A 2X1NB 2X35A 3P8BB 4B9XA 1ZSGA 2PNIA 5GAMg 1LOJA 2VVKA 3VYHB 4EC8B 2K5LA 2VKNA 1WHKA 5KYXA 2EQIA 4EORB 5GAOq 2VUBA 3BE3A 5LJ3f 4KGVB 2DETA 1PM3A 1SSFA 1XTDA 1WQWA 3ZEHA 5CO7A 1H24B 1EIFA 2GQVA 2LCCA 2JVVA 3I5SA 2KY9A 1UE9A 3QPHA 4JJBA 4NSTB 1D3BB 5GAMh 1JSTB 2KMTA 1I07A 4M77F 3BHTB 4C0FA 5GAN2 3CCJT 5LQFB 4LDXA 3GPLA 4D6WA 1RAAB 2HCKA 4C5IA 3OS0A 4OR5B 1J3TA 3CCSA 2I0NA 4XAXB 2CP5A 3N5BB 3BG5A 1Y7XA 2C0TA 2COWA 5IXBA 2W99A 2XD0A 4HCKA 1YJ9T 1WLPB 5LL6S 3A8GB 5EC7A 4EMHA 2FG0A 5AYFA 1FMWA 2IW8B 2XU8A 1R8OB 1W2BA 3F5XB 1YHQT 4M77A 3LW5E 5CKBA 4LE9A 3V7CA 2KT1A 2X4WA 3QO3A 2NWMA 5CKHA 2LNVA 3CCUQ 1BU2A 1K76A 3LLRA 1VYVA 4PK4A 3EG9B 2CUDA 4JX5A 2R5AA 1VQ5A 3Q1JA 4CFMB 3QYHB 3I56A 3LWHA 4M78E 1Q81C 3OYFA 1O9KA 4M77G 1VQ7A 1YFNA 4Y72B 3V8LA 2KXCA 3L1AA 2C06A 2QDYB 3FRNA 3I55A 3G6EQ 1B3QA 3CXCS 5IHYA 2I2LA 1C9BA 4XTVA 3QG1A 1X2QA 4PNOA 2QEXT 1SRMA 1BI0A 3T9NA 1C0MA 3PNWC 4AKGA 4PKCC 1PRLC 3CCSQ 1SHGA 1IHWA 1AWWA 3SD4A 4CFXB 2FYKA 3GLXA 2P0QA 1T3SA 2QQ9A 4BE2A 3UWNA 1TUGB 3ER0A 2QQAA 3NDQA 2CP0A 1WHJA 4Y92A 2RK1A 1M8MA 1N6AA 4EOJB 1MNDA 4OB1B 4HLQA 5C6SA 4X9DA 4EOIB 3OS2A 2DBMA 2V26A 3R6NA 1LVKA 3V8JA 2MAMA 4BCJB 3EGXA 1JJ2S 4LXCA 3CMAA 2RD1A 2WJ9A 5CKDA 2F69A 2M51A 4EOQB 2E70A 3JV3A 3TSZA 2JTEA 2RH2A 1VQ5Q 3I56Q 4HNTA 3FLGA 3X24B 1M5Q1 1VQ7Q 3P8DA 1OIUB 3S3OA 4YTLA 3L2VA 1YWOA 2CYZB 1FINB 1PCXA 2K2MA 3DDPB 4JX4A 2K79A 2D9TA 3I55Q 4F6WB 3MO8A 4WCIA 3FEOA 3RR6A 1YN8A 3QJ6A 3OBYA 3OW2P 2C4GB 2OTJA 2COZA 3QYGB 4HVVA 2CS7A 1GBQA 1FMVA 3EH2A 1KQ2A 3L42A 2V1RA 5BNJB 3CCUT 3M0UA 3FC3A 3H9NA 3IQLA 2LQWA 3PIPA 4M77E 4C92F 1PKTA 4XTXA 3OYDA 1SRLA 2DXCB 4JZ4A 2QQSA 1UDLA 5CYIB 1VQNA 2KEAA 1YIJQ 1G3SA 3MJXA 2VXFA 3QKJA 5IT9E 4HL4A 1UUEA 2LT1A 3G6ET 1ZP2A 2CZ1B 1AISB 2JUFA 2DIQA 2KRNA 1QLYA 2CSQA 4OMOA 3CCST 1WHHA 4J6XA 4EC9B 5A0GA 1VOLA 2F1LA 2ZPBB 1W1FA 2FZGB 5GAN6 2VGMA 3V8KA 1H3HA 4BXXX 3RMSA 2B8AA 5KYYA 1ENWA 1XJWB 4N4GA 2COYA 2XK0A 4MZMA 2OI3A 3C94A 3ULRB 4FW2A 1G3TA 2X4JA 1GCPA 1EFNA 3MEUA 2X51A 5GAMe 2BTTA 4M7AC 2X3XD 1Z9QA 4IMYB 1W70A 4JJNK 1GL5A 1IHVA 1X27A 4Z6YA 3J81E 4IUUA 4F04B 3DDQB 2D0NA 2QDJA 4MFEA 2Y4XA 3VS1A 3JB9F 1QKWA 1YJWQ 4F7UB 4D8DA 4AI6A 2M02A 2JNGA 1VQ5T 5DLQE 1ZX6A 4OMFB 3L2ZA 1K0SA 1SG5A 1VQ7T 2RHIA 4DBRA 1UGSB 2QFZA 5IDNB 4BUGA 1BCMA 5CIUA 1VQNQ 3GOXA 1BYMA 4ORZA 2L3RA 3OBWA 4C0ZA 1H28B 1TOVA 1Y96B 1U1SA 2FRYA 4BY7X 4E7KA 3BLHB 4P5NA 5GMKm 4HA8A 3EFOA 1D0YA 2ZPFB 3DB4A 1D1CA 4M75D 4MIMA 3LGLA 4ELJA 5GJWB 1O75A 2O9SA 1YITA 3QUIA 1GCQA 4JS5A 1OI1A 1K73R 1WYXA 4FSSA 1H641 5GAN8 4R55A 1FYNA 3QYEA 2NUTA 1PD0A 4AKIA 3NMZC 2M0OA 1NZ9A 5FU7C 3X20B 4CC7A 2CP3A 4OP0A 2P0PA 4AFQC 1YIJT 2FO0A 2NUZA 1BI2A 4J9BA 5C0MA 2F2VA 3CC2A 1M2OA 3BHUB 2YUNA 1VQ8A 3TEEA 4J9IA 1QWFA 2JT4A 3QSUA 2JXBA 2L3SA 4II5B 1BBZA 2XI9A 1I4K1 1VYUA 2YRCA 1T3LA 3M54A 4J83A 4JJCA 5L23A 1YJNQ 3C0CA 2E6ZA 2BIVA 2ED0A 2KRSA 1W2BS 2LQ8A 3OYEA 1VQ9A 4DA4A 2LC4A 4RTWA 2FHDA 3CXCA 3HTRA 1N5ZA 3PT9A 3G1JA 5LJ5d 4J6YA 2ZZDA 4TTHA 5FRMA 3DL1A 1ZBJA 4RKUE 4F16A 5IN1A 3MKDA 1QVGP 1YITQ 3DLMA 4IUVA 3OYMA
chains in the Genus database with same CATH topology
4RCCA 1VQPT 1X01A 3A8HB 3EFRA 3H6ZA 3RUXA 1YJWT 4BE0A 5D6YA 5GMKi 4MZTA 4C8QB 2RA2A 2X4YA 4LD6A 4B9WA 2RHZA 3H8ZA 3CPWA 5KE3A 3VYGB 3HO8A 1KQ1A 1KC8U 1G3YA 2QF7A 3OA6A 4M7DC 1U1TA 1NPRA 4C0DB 3JCMX 2EJGA 5L8RE 1VQOT 1RI0A 3CMEA 3ME9A 2DXUA 4M78G 1Q81U 1VQNT 4KUDK 4NL3A 5FROA 3META 5J39A 2M1HA 2AHJB 3PMIA 4HKEA 3JCMW 2DD5A 2KK4A 2LTOA 1BI3A 2ZPIB 3AHUA 4ATOA 3CBOA 1FKMA 3CCRT 4E7JA 3OYJA 1M4ZA 5GAOp 4M7AD 5J26A 2E10A 3I56T 3CCVA 4PJOD 3G7ZA 1UGRB 3CCQA 2ZCFB 4J5YA 3BDUA 3VYGA 3HB9A 3INZA 3O8VA 5IAYA 1JJ2A 2HQXA 3L2WA 1E7PA 3VJPA 3CCMA 3HSBA 3VUBA 1M1FA 2RM4A 2DVEA 5KH6A 3I55T 1I81A 1BI1A 2X35A 4OVAA 3P8BB 4B9XA 5GAMg 1K73U 1LOJA 3OYAA 1YIJA 1G5VA 4F7UE 3VYHB 2K5LA 1X75C 4QVCA 3LX7A 4XTWA 4EMKB 5GAOq 5KCHA 2PQWA 2VUBA 1V29B 1UEBA 4N4IA 4C8QG 4E7HA 3OW2A 2JOYA 2A3LA 5LJ3f 2K3YA 5GMKl 2RJEA 5GMKj 1SSFA 1XTDA 2H3JA 3HFNA 4IUQA 4M7AB 3OY9A 1WQWA 2E64A 1I8FA 5CO7A 3ZEHA 1EIFA 2GQVA 2E41A 3MEAA 3QHSA 4M75F 5I2SA 2LCCA 3G71A 3TU4K 4OGEA 2JVVA 2KY9A 4FT4A 2OTLA 2L8DA 5GAOm 2M9UA 1VUBA 2EJ9A 4MDWA 5DM7R 3KUFA 3QPHA 1D3BB 5GAMh 5CCAA 1N9SA 2KMTA 5GAOl 4EMKA 4M77F 4C0FA 5GAN2 3CCJT 3S3OA 3KXTA 4EDUA 4LDXA 3GPLA 4BI3A 2HD0A 4XK8E 4BDYA 4D6WA 2DXBB 2DTIA 3C4SA 2XIDA 2P0KA 4A54A 5I2MA 4C5IA 3CC4T 3LYIA 2MWOA 4BBSM 3L2QA 3OS0A 2PUOB 2YLCA 4XTYA 5KE2A 3BFMA 3DB3A 2LT4A 3CCSA 4KBMB 4M75B 2GF7A 2DIGA 4XAXB 2FL7A 2IVWA 3N5BB 4CI0C 3BG5A 1Y7XA 1YJNT 1D3BA 3E9FA 3TW7A 3HKSA 2XDPA 1VQ5A 4KULA 2XD0A 2V8JA 4L5GA 5EG2A 3PIOA 3G4SA 1YJ9T 2XDBA 2XKOC 4M77B 4PJOC 3QYBA 2DXBA 2YRVA 3E9GA 2G3RA 5LL6S 5HK3A 3A8GB 3RMQA 4JRPA 2NLUA 2E65A 3HRUA 4HCZA 3HRTA 3NFCA 4NS5A 5FU6B 4EMHA 4IURA 5AYFA 2O01E 4M7AG 2VC8A 1VQMA 3EFSA 2D6FA 2F5TX 4M7DA 4N0AA 4M75A 3FB9A 2XU8A 3A8LB 1PSEA 3HHTB 1M1GA 5CQYA 3RIRA 4C0GA 2QA4T 1OZ3A 1XQHA 1VQPA 1VQLA 4PLLA 1PSFA 1R8OB 3BY7A 2G77A 4C92D 5DLOA 4QQDA 1YJWA 1W2BA 1NPPA 2PVOB 5LJ5e 4LDWA 5J3BA 1YHQT 4M77A 3LW5E 1N8RU 5CKBA 2XHCA 3V7CA 3M4YA 2KQWA 1YCYA 2X4WA 2CGHA 5FU7B 1YITT 3QO3A 1WJSA 2RJDA 2LX9A 1QVGA 5CKHA 1VQOA 2LNVA 4C8QF 4LDVA 4Y28E 4BDZA 4FM4B 1KD1U 3SWNC 5HK0A 3LLRA 2OTJT 4M75G 5GAN3 3JCMe 3OYKA 4L6V5 4PLIA 3KBGA 4JX5A 3CCRA 1KC8C 3MP8A 3UT1A 5DY9A 4C0DC 2EQJA 2R5AA 2DTHA 3OMCA 2DZ9A 2RJCA 3Q1JA 3QYHB 3I56A 1KQSA 2PU9B 4M78E 3LWHA 2R57A 3OYFA 1Q81C 3M4GA 4M77G 1VQ7A 3V8LA 4BI8B 4NOYA 4C92B 3NTHA 3L1AA 3JCMd 2PUKB 2C06A 2QDYB 4JRQA 3OB9A 3PMTA 3L2UA 3CC2T 2YLBA 4HCBA 2KVQG 3FRNA 3I55A 4XTUA 3GIBA 5LJ3j 3CXCS 1QVFA 2I2LA 4HT9A 1XNIA 2K5FA 3OS1A 2EFIA 4XTVA 3QG1A 2RHUA 4PNOA 2QEXT 4C5EA 3OS5A 1BI0A 3T9NA 3PNWC 1AHJB 1P92A 2Y4YA 3M57A 5HKCA 4AKGA 4PKCC 1FXXA 5GANh 3J7AF 4C92A 1ZQ1A 3ZBDA 1K8AU 3BG9A 1MHNA 1N27A 2O4XB 2ZPEB 4QVZA 4BB7A 1K73C 3OSSC 5GANf 3OYNA 3SD4A 2FYKA 2MMPA 3GLXA 5LJ3g 2XG8D 2P0QA 3M59A 4C8QA 5GAMj 2QQ9A 2BKDN 4M7DD 4C8QE 3X25B 4BE2A 3CBMA 3UWNA 4M7AF 3ER0A 3JCMP 5EJCA 4M7DF 3VV0A 2QQAA 4JUVA 3CCJA 4OB3B 1UB4A 4QVDA 4OB0B 1VQKT 3RKXA 2HAXA 3M5AA 1NJIU 2RI5A 2RK1A 2OAUA 3JB9D 2O4XA 3JRZA 1N6AA 4C92G 4BE1A 2DXTA 4WF2A 4OB1B 5GAMd 4HLQA 1XOVA 5C6SA 5LJ3h 4X9DA 4Y91A 2KR6A 3TREA 3ZFJA 3OS2A 1Q86U 1QLBA 1HXDA 4FSXA 2XICA 4Q5WA 3QJYA 1H3ZA 3OYGA 1YJNA 3V8JA 2K3XA 3F70A 2MAMA 3OYHA 5CKEA 2QTXA 1YI2T 3X28B 4BBRM 4M7DB 1YJ9A 1QP2A 3OMGA 2E5QA 4TVRA 5GMKe 1JJ2S 3RKYA 3CMAA 3CCET 2QQ8A 2RD1A 2WJ9A 5CKDA 2F69A 4BACA 3A8OB 2E70A 2EYQA 4HNUA 1VQ6T 2RH2A 2E6NA 4Z02A 2WSEE 3QBYA 1FWZA 3CPFA 4MFDA 4JX6A 4XU3A 4JLGA 4HNTA 2EWNA 3FLGA 3SB2A 3QDRB 3X24B 4ZN3A 3CMET 1M5Q1 3V7SA 4KUIA 3P8DA 2RB6A 4M7AA 2MF2A 3OW2S 2RHXA 3GNGA 3MCAB 4YTLA 2QQRA 3S6WA 4A4KA 4RMOA 3OYMA 2CYZB 1TH7A 2DEQA 3E19A 5CAIA 3L2VA 4E7IA 2RK2A 1YHQA 4BD3A 1M8VA 4X9CA 4JX4A 2D9TA 2L89A 3CC7T 2DK3A 3CD6T 5FLXE 3MO8A 4XQ3A 4L59A 4FT2A 3CCVT 4O6JA 3E1SA 3TW6A 2LCLA 3FEOA 4JRIA 2LVMA 3TCJA 1M90C 3QJ6A 3OBYA 2JN0A 4M78C 5GAN4 2PVDB 4OGCA 3CCLA 2OTJA 3QYGB 3KHIA 2VGNA 2CS7A 1N8RC 1FX7A 3CCMT 4QSHA 3JCMV 4RG2A 4QQ6A 1MGQA 3FJPA 3L42A 1S72T 1Q82C 1KQ2A 1BKBA 2XDDA 2RHYA 3R6OA 4M7DG 2M16A 4C5GA 1WQ7A 2DO3A 3CCUT 2RJFA 2BS2A 2JTMA 4A53A 1KD1C 4M75E 4M78D 5A0LA 4BY6C 2GCXA 3HZJA 1IZ6A 1WGSA 2DD4B 2K57A 2DAQA 4EMGA 1ZBXA 3C95A 3FC3A 1G3WA 2GFAA 2PVGB 3MEWA 2YHTA 1WJQA 2IG0A 4RG8A 3PIPA 4M77E 4C92F 3JB9G 4XTXA 3OYDA 3HFOA 2KSSA 3G71T 2DXCB 2QQSA 1M9SA 5GAOr 2OTLT 5GANj 2HQEA 1VQNA 3CEYA 3A8MB 1G3SA 2VYTA 2L5QA 3A5ZB 2VXFA 4C8QC 4KT0E 3QKJA 1BIBA 2DPPB 4HL4A 2LT1A 3G6ET 4XU0A 5IT9E 1GXIE 4GLKA 1VQ4T 2EAYA 1LJOA 2DD4A 3OYLA 5CR2A 4ELYC 4X34A 2FVUA 4J6WA 2QXFA 2HNIA 2CZ1B 3VU3C 2DTOA 2DIQA 2JUFA 3JCMb 5GANg 4XTZA 1N9RA 2DXCA 4PJOB 2MWPA 1K9MU 3CCST 4A4GA 4J6XA 1K8AC 4NC6A 5A0GA 1VQKA 2QQBA 3OSVA 2EQKA 3GP8A 3HPWA 3C12A 2ZPBB 1RL2A 4ZN1A 5LJ5g 2LRQA 3VKHA 4UC4A 4QQGA 5GAN6 3M53A 3OYIA 3G4ST 1VQ8T 3OYCA 5GAN7 4A4HA 1W4SA 2VGMA 3LGFA 2MI6A 4JRKA 3RKWA 2B8AA 3RMSA 3V8KA 5KCOA 3QZ5B 3P8HA 1M1KU 4N4GA 4PJOA 1HK9A 4ZGDB 5A2QE 2XK0A 1NJIC 4MZMA 1YI2A 1VIFA 3QZ9B 3V7RA 5D6WA 4C92E 4HT8A 3C94A 4F7UF 3CCEA 1G3TA 1VQLT 4EMKC 2X4JA 2Y90A 3RESA 1Q86C 4VUBA 5LJ3d 5LJ5h 1DJ7B 3SWNB 3JSCA 3MEUA 3HL8A 4FU6A 5GAMe 1VQ6A 1QVFS 4M7AC 3CPWS 1Y07A 4JJNK 3CMAT 5LJ5f 4MZPA 1VQ9T 2RO0A 4A4EA 4IKFA 1U8RA 4E47A 4FIBA 4Z6YA 3JB9I 3J81E 4IUUA 4PJOG 5GAN5 5M9OA 4ZTFA 3CC4A 2QDJA 4MFEA 4XU2A 3JB9J 4LD9K 3JCMh 2F5KA 2Y4XA 1UGPB 1LNXA 3VUZA 1Q7YU 1M90U 3JB9F 2KDSA 3FDRA 4F7UB 5HY6A 4AI6A 3GF5A 3CC7A 2JNGA 3CD6A 3JCMf 1VQ5T 3M58A 5DLQE 3SWNA 3PGGA 3URGA 4OMFB 5D6XA 1KHCA 3VKIA 3L2ZA 4RCBA 4FL6A 2KAFA 5CQXA 1WPYA 4C5HA 1BIAA 1O9SA 2R5MA 3BDLA 1VQ7T 2RHIA 1JB0E 3NTKA 1UGSB 2QFZA 3GNFB 3WVDB 4BUGA 2WACA 5CIUA 3HRSA 4II1A 3QWLA 3OQ5A 3GOXA 1BYMA 4N0AC 2L3RA 1VIEA 4M75C 4IUPA 2CKKA 4MMLA 4QW2A 3OYBA 2FB7A 3OBWA 4JLIA 4C0ZA 1S72A 3S3MA 4DQ2A 4PL6A 3BG3A 2LDMA 2BUDA 4F7UA 1Y96B 3CCUA 2VV5A 3UDCA 1U1SA 4E7KA 2R58A 4P5NA 4M77C 5GMKm 2KMGA 3M55A 1OZ2A 4HA8A 2HBPA 2K5IA 2QA4A 2VXEA 2ZPFB 3WVEB 3HBLA 5FU6C 4MDXA 3DB4A 3JAME 2BS3A 4M75D 3HP9A 4AKHA 2JTFA 4MIMA 3LGLA 2CZ7B 4M7DE 4ELJA 1I5LA 1UGQB 3QXEB 1O75A 2WSFE 4MMKA 3QUIA 4ELZC 3L2RA 1YITA 1KHIA 5CK9A 1Y71A 4JS5A 3CCQT 5CKFA 1YBYA 4M77D 5FRNA 3VKGA 1OI1A 4A4FA 1Y96A 4CRIA 1H641 2WSCE 5GAN8 3PFSA 2LQKA 3QYEA 4R55A 4F7UG 2BS4A 4AKIA 3G6EA 2M0OA 4O5VA 4LDUA 1NZ9A 1WNLA 4ME7A 5GAMf 3JCMQ 1VQ4A 4DOWA 3FIFA 5FU7C 3S3NA 5CVIA 2ZGWA 2V8KA 2EIFA 3MEVA 3X20B 2P4TA 2EJFA 2EQUA 3H4CA 3MP6A 4J8OA 4OP0A 2CZ0B 2D0QB 3SFMA 2P0PA 1YIJT 4HNVA 4XU1A 4GY5A 1KG1A 3CBPA 4ZGJB 1BI2A 2DKGA 2E1HA 5C0MA 2EQMA 4NL2A 3JCMJ 2ZPHB 3CC2A 4M78F 3SDZA 2RI3A 2X4XA 4DOVA 4N4HA 3DKMA 2ZPGB 4PJOF 3LWIA 1VQ8A 4E7LA 4J7IA 1NE8A 5GMKh 4C92C 3TEEA 1K9MC 3RERA 3X26B 3MP1A 4OF1A 2QEXA 1JRIA 1QW1A 3PTAA 3QSUA 1B34B 2E12A 4JDSA 1WJRA 2XI9A 1I4K1 3EAEA 2JZ2A 5GANe 4J7FA 2V8IA 3ASKA 4ZTJA 3M54A 4J83A 2QI2A 3WXMB 3MHXA 3QIIA 2CZ6B 5LJ5j 3JB9H 3OYYA 2E6ZA 2BIVA 2ZZDB 1W2BS 2LQ8A 4M78B 1M1KC 3OYEA 3J80E 5GANd 1IREB 1VQ9A 4DA4A 1B34A 2LC4A 4C8QD 3DLLA 1JBMA 4ZGEB 1Q82U 4JS4A 1QVGS 2FHDA 1OYXA 2A7YA 4OB2B 3UPUA 1ZHIA 2DZCA 4R56A 3CXCA 4V2SA 1QVPA 3CCLT 2K2VA 3PT9A 5LJ5d 4J6YA 3JCMc 3M56A 2RI2A 4M6VA 4BY6B 4M7AE 5LJ3e 3M9QA 1QP3A 2ZZDA 3BW1A 5FRMA 3DL1A 3NTIA 4M78A 5I21A 2DJZA 4RKUE 1KQSS 5IN1A 1VQMT 5A0DA 2GFUA 4LOCA 4IUTA 4PJOE 3LH0A 5GAOn 4EPCA 4HCCA 3DLMA 2EKOA 4LDYA 3JCMg 4BI4A 2K4YA 4IUVA 1X6OA 2DD5B 1Q7YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8H B;  1JB0 E;  3LW5 E;  1UGS B;  3WVD B;  2PVD B;  3VYG B;  3QYG B;  4Y28 E;  4FM4 B;  5L8R E;  4L6V 5;  2AHJ B;  2DD5 A;  2ZPF B;  2ZPI B;  3QYH B;  3WVE B;  2PU9 B;  2CZ7 B;  2DD4 B;  1UGR B;  1UGQ B;  3QXE B;  2PVG B;  2WSF E;  2ZCF B;  3VYG A;  2PUK B;  2QDY B;  2DXC B;  2WSC E;  3A8M B;  4KT0 E;  2DPP B;  1GXI E;  3X20 B;  3VYH B;  1AHJ B;  2CZ0 B;  2DD4 A;  2D0Q B;  1V29 B;  2ZPE B;  4ZGJ B;  2CZ1 B;  2DXC A;  2ZPH B;  3X25 B;  2ZPG B;  2ZPB B;  4OB3 B;  4OB0 B;  3X26 B;  4XK8 E;  2DXB B;  3QZ5 B;  4OB1 B;  2CZ6 B;  4ZGD B;  3QZ9 B;  2PUO B;  2ZZD B;  3X28 B;  1IRE B;  1QP2 A;  1DJ7 B;  4ZGE B;  4OB2 B;  3A8O B;  2DXB A;  3A8G B;  2WSE E;  2O01 E;  1QP3 A;  2ZZD A;  3X24 B;  1UGP B;  4RKU E;  3A8L B;  1PSE A;  3HHT B;  2CYZ B;  1PSF A;  2DD5 B;  2PVO B; 
#chains in the Genus database with same CATH topology
 4RCC A;  2JMA A;  1VQP T;  3RUX A;  1YJW T;  5D6Y A;  4MZT A;  2YT6 A;  2X4Y A;  3NPF A;  1KQS P;  3CPW A;  5IHK A;  4DBQ A;  1KC8 U;  4M7D C;  3JCM X;  4LUD A;  2EJG A;  5L8R E;  1RI0 A;  2DXU A;  1VQN T;  4KUD K;  2C0I A;  3MET A;  5J39 A;  2IPO B;  5FW9 A;  4HKE A;  3H0I A;  3JCM W;  2DD5 A;  1R0B G;  2LTO A;  1FKM A;  3CC2 Q;  1EZZ B;  4M7A D;  5J26 A;  3CCV A;  3G7Z A;  3CCQ A;  1VQ8 Q;  1T0H A;  3BDU A;  3VYG A;  3HB9 A;  1VYT A;  3INZ A;  4FYW B;  5IDP B;  2BE9 B;  1JJ2 A;  2HQX A;  4Z89 A;  1E7P A;  1JXO A;  2GTJ A;  1AEY A;  1K73 U;  3OYA A;  3LX7 A;  5KCH A;  2CUB A;  1GY3 B;  1V29 B;  4C8Q G;  2JOY A;  2QK0 A;  2O31 A;  5GMK j;  4IUQ A;  4M7A B;  1TD6 A;  3QHS A;  3MEA A;  3O0G D;  2DBK A;  1YP5 A;  2OTL A;  5GAO m;  4MDW A;  2UZE B;  2DA9 A;  1N9S A;  2RMO A;  2B9R A;  4FYV B;  4WTO B;  1AT1 B;  4XK8 E;  4BDY A;  2DXB B;  1NLP C;  1U5S A;  2P0K A;  3RGF B;  3VS5 A;  4BBS M;  2YLC A;  3DB3 A;  2LT4 A;  2DIG A;  1AOJ A;  4PFP A;  4CI0 C;  1YJN T;  1D3B A;  3E9F A;  3TNI B;  4AG1 C;  4FX3 B;  2V8J A;  2PTK A;  1T0J A;  2XKO C;  4PJO C;  4JRP A;  1ZSZ C;  3EOC B;  5HK3 A;  2NLU A;  1I1J A;  2RPN A;  4HCZ A;  4NS5 A;  3PO3 S;  4RUG A;  2YUQ A;  3EFS A;  1PG5 B;  3CD6 Q;  3CCV Q;  2ATC B;  1QQJ A;  3A8L B;  1PSE A;  5CQY A;  1W98 B;  1M1G A;  2AKL A;  4C0G A;  1VQL A;  2EW3 A;  3EHQ A;  5DLO A;  2G77 A;  1M90 U;  4QQD A;  1NPP A;  1R77 A;  1QMZ B;  1UGV A;  2XHC A;  1ZLM A;  1MMD A;  4ELL A;  1M3B A;  5FU7 B;  1YIT T;  1U3O A;  2WFY B;  2EGE A;  2ROT A;  2FZC B;  1UNG D;  4LDV A;  1TFB A;  2H8H A;  5HQ0 B;  2GBQ A;  4LUE A;  3SWN C;  5HK0 A;  4PJJ A;  4PLI A;  3CCR A;  1KC8 C;  4C0D C;  2EQJ A;  4LD9 K;  3OMC A;  2DZ9 A;  5EFQ B;  1AWO A;  1H25 B;  2C5O B;  2KNB B;  4BI8 B;  2OTL Q;  4RTY A;  3NTH A;  2QG9 B;  3H41 A;  4JRQ A;  3PMT A;  2DVJ A;  3CC2 T;  4FCY A;  3BLR B;  3EG9 A;  9ATC B;  4HT9 A;  3OS1 A;  2EFI A;  4KRC B;  2RHU A;  2QGG A;  3OS5 A;  2Y4Y A;  2QGS A;  2DYI A;  1MHN A;  2A36 A;  2O4X B;  4QVZ A;  1K73 C;  3OYN A;  5LJ3 g;  4M7D D;  4C8Q E;  4CFW B;  2L0A A;  2BKZ B;  3CBM A;  2HKQ B;  4JUV A;  3I9Q A;  4OB3 B;  4OB0 B;  1NM7 A;  3EG1 A;  2RI5 A;  1UG1 A;  2QGF B;  3JRZ A;  4BE1 A;  2DXT A;  1VQL Q;  4F7J B;  4F14 A;  4QKU A;  5LJ3 h;  1Q86 U;  1ZUY A;  4FSX A;  2XIC A;  3EG2 A;  3QJY A;  1H3Z A;  3OYG A;  2ESW A;  2A28 A;  2K3X A;  3F70 A;  3OYH A;  1E9H B;  4M7D B;  1Y57 A;  1QP2 A;  3CCE T;  2JM9 A;  2QDL A;  3RKY A;  1CKA A;  4AFU C;  2EYQ A;  4HNU A;  4E6R A;  1VQ6 T;  4EIK A;  2VAS A;  3CCR Q;  1ZA2 B;  4Z02 A;  3CPF A;  4MFD A;  4ROE A;  1AWX A;  4ZN3 A;  3EG0 A;  3V7S A;  1KIK A;  4PFO A;  4AMC A;  2RHX A;  4RMO A;  4A4K A;  4E7I A;  1X6B A;  2RK2 A;  3VRZ A;  1RUW A;  2DK3 A;  3CD6 T;  5FLX E;  3CCV T;  1RI9 A;  3E1S A;  2CJM B;  2LCL A;  2DL3 A;  2CSI A;  1WFW A;  3TCJ A;  1M90 C;  3NHN A;  1JKW A;  1H26 B;  1FX7 A;  4RG2 A;  2KYB A;  4HVU A;  1Q82 C;  2XDD A;  2KXD A;  4C5G A;  1WQ7 A;  1HSQ A;  2RJF A;  2JTM A;  2A08 A;  2KRO A;  4F70 B;  1PRM C;  4M78 D;  1FMK A;  3HZJ A;  1IZ6 A;  4PJO D;  1OEB A;  2PVG B;  2W0Z A;  4B6M A;  1MV3 A;  2KSS A;  2OTL T;  3VS4 A;  3MI9 B;  4DEX A;  5GAO r;  3GBQ A;  5GAN j;  3CEY A;  3A8M B;  1RAH B;  1GFD A;  1YNZ A;  4KT0 E;  1BIB A;  1PC0 A;  1WI7 A;  3M03 A;  3UA7 A;  3PVQ A;  2EAY A;  5IHN A;  1S1N A;  2L3P A;  1NYG A;  2DL7 A;  2HNI A;  2DXC A;  4PJO B;  4A4G A;  1ZSZ B;  2DF6 A;  4G6L B;  1VQK A;  1URC B;  3GP8 A;  1QMC A;  2W9F A;  5I11 A;  4CC3 A;  3ZL7 C;  3VKH A;  2PJQ A;  5GAN 7;  4A4H A;  2RF0 A;  3LGF A;  2VB6 A;  4ANJ A;  3QZ5 B;  3P8H A;  1M1K U;  1JSU B;  3K7A M;  5A2Q E;  1N8R R;  1YI2 A;  4HT8 A;  1M3A A;  4F7U F;  1VQL T;  4EMK C;  1Q86 C;  1WXB A;  4VUB A;  1UHF A;  1DJ7 B;  3SWN B;  3JSC A;  2D1X A;  1JEG A;  2HL5 C;  3HL8 A;  4E7Z A;  4BCO B;  5AT1 B;  1QVF S;  2FPE A;  3CPW S;  4A4E A;  2K6D A;  4ZTF A;  3JB9 J;  5HBH B;  3MY1 B;  3VUZ A;  3REB B;  5HY6 A;  3GF5 A;  3CC7 A;  3MIA B;  5D6X A;  1KHC A;  2GGR A;  3QHR B;  2YRD A;  1BIA A;  2EKH A;  2VWF A;  3GNF B;  2LZ6 B;  2WAC A;  1SSH A;  4N0A C;  4M75 C;  2JGZ B;  1VIE A;  1H92 A;  4QW2 A;  5ECA A;  3OYB A;  1AD5 A;  1S72 A;  2HQH A;  2ZAE A;  3S3M A;  4DQ2 A;  4BCF B;  2LDM A;  2BUD A;  4F7U A;  2HSE B;  5I22 A;  4F7S B;  1ABO A;  1OQK A;  1OZ2 A;  2HBP A;  1NLO C;  5FU6 C;  2CH4 A;  2BS3 A;  2AZS A;  2DRK A;  5HVY B;  1UGQ B;  2YSQ A;  2WSF E;  1QWE A;  1UJ0 A;  1ZUU A;  4OGR B;  2LJ0 A;  3L2R A;  1OL2 B;  4M77 D;  3VKG A;  1Y96 A;  4CRI A;  2WSC E;  4F7U G;  1WZO A;  3FJ5 A;  4O5V A;  4LDU A;  2DL8 A;  1VQ4 A;  2CP6 A;  4DOW A;  1YI2 Q;  2P4T A;  4J8O A;  1TUC A;  1KXU A;  2CZ0 B;  4HNV A;  1KG1 A;  2OX7 A;  2E1H A;  3TSW A;  2EQM A;  3JCM J;  4J9F A;  1QCF A;  3SDZ A;  2F2C A;  2X4X A;  1MNE A;  2FZK B;  4DOV A;  2ZPG B;  1IO6 A;  2LMJ A;  4IIM A;  1UNH D;  5HBJ B;  4BY1 X;  2JMC A;  4J7I A;  5KYN A;  5GMK h;  2HL3 A;  4C92 C;  1OKV B;  3X26 B;  4KH0 B;  3PTA A;  1B34 B;  2GNC A;  1F5Q B;  1WJR A;  3E2U A;  3CC7 Q;  3MHX A;  3QII A;  5LJ5 j;  1D3U B;  3JB9 H;  3OYY A;  2JJ9 A;  2I40 B;  1M1K C;  3CMA Q;  5GAN d;  4EOP B;  1S72 Q;  4IIO A;  1JBM A;  4JS4 A;  2A7Y A;  2WMA B;  2K2V A;  4RTX A;  1SKU B;  1BK2 A;  2RI2 A;  2C5N B;  5LJ3 e;  1XO2 A;  4ZNX A;  1QCO A;  5I21 A;  1D09 B;  5L2W B;  1AWJ A;  4IUT A;  4EPC A;  1D0X A;  2EKO A;  4BI4 A;  3H6Z A;  2OTJ Q;  4LN2 A;  1KD1 R;  4LD6 A;  4B9W A;  1VQ4 Q;  5KE3 A;  1G3Y A;  3OA6 A;  3ME9 A;  4FYY B;  5FRO A;  3M0Q A;  2AHJ B;  3PMI A;  1AZE A;  3AHU A;  2IW6 B;  3CBO A;  2EUF A;  2ED1 A;  5KYW B;  3OYJ A;  2V1Q A;  2E10 A;  3I56 T;  2ZCF B;  3QWY A;  4J5Y A;  2K7A A;  3CCM A;  2RM4 A;  1AZG B;  2E4H A;  5KH6 A;  3I55 T;  1G5V A;  4F7U E;  1X75 C;  4QVC A;  4XTW A;  4EMK B;  2CCI B;  1VYW B;  2PQW A;  1LPL A;  2DNU A;  4N4I A;  5LMK B;  2MYS A;  2A3L A;  2J6F A;  3EH1 A;  3OY9 A;  2H3J A;  4J9C A;  4GLM A;  2UZD B;  2YWW A;  3TU4 K;  1M27 C;  1NJI R;  1VUB A;  1D0Z A;  2AKK A;  1ABQ A;  5DM7 R;  3KUF A;  1IB8 A;  5CCA A;  5GAO l;  1K9A A;  3EHR A;  1RLP C;  4BI3 A;  2HD0 A;  3C4S A;  1ARK A;  4FYX B;  5I2M A;  3LYI A;  5KE2 A;  5IH2 A;  3BFM A;  3G33 B;  3B57 A;  2HMA A;  4M75 B;  2GF7 A;  4J9H A;  2FL7 A;  2IVW A;  1VOM A;  3HKS A;  4KUL A;  4L5G A;  1D1B A;  2NUP B;  3G4S A;  2XDB A;  3QYB A;  2DXB A;  2YRV A;  3EGU A;  2G3R A;  2KI7 A;  3CMA T;  3RMQ A;  2E65 A;  3HRT A;  5FU6 B;  2WIH B;  5I5Z B;  4M7A G;  2VC8 A;  1VQM A;  5GJV B;  2EVR A;  2F5T X;  2P4R A;  1JOW A;  1OZ3 A;  1XQH A;  1PSF A;  4C92 D;  2L3Q A;  4LDW A;  3CCM Q;  1YCY A;  1ACM B;  2SEM A;  1WJS A;  2RJD A;  2LX9 A;  1QVG A;  2AK5 A;  1H4L D;  1VQO A;  4AG2 C;  1OUL A;  4C8Q F;  4Y28 E;  4BDZ A;  1KD1 U;  2WMB B;  2OTJ T;  5GAN 3;  4OML A;  3OYK A;  2J7I A;  2P84 A;  2W10 A;  3I5R A;  3MP8 A;  3UT1 A;  5DY9 A;  1KQS A;  2RJC A;  5KYY B;  2R57 A;  1MUZ A;  4C92 B;  4YOS A;  3JCM d;  2WPA B;  4R0K A;  1IGU A;  4HCB A;  1I0C A;  5HCK A;  1QVF A;  1XNI A;  2DLP A;  4C5E A;  1Q95 G;  5GAN h;  1ZQ1 A;  3UAT A;  3CXC P;  1N27 A;  2ZPE B;  5ACB A;  2DE0 X;  5GAN f;  4GBQ A;  2MMP A;  2KE9 A;  3M59 A;  4C8Q A;  3G4S Q;  4Z8A A;  3X25 B;  1VIN A;  3JCM P;  3DOG B;  4M7D F;  2LQN A;  3CCJ A;  4JPB W;  4QVD A;  1UB4 A;  1VQM Q;  3M5A A;  1NJI U;  2EYZ A;  2OAU A;  3JB9 D;  2O4X A;  2LP5 A;  2HDA A;  4WF2 A;  5GAM d;  1XOV A;  2CCH B;  2KR6 A;  3ZFJ A;  4OMP A;  2W9Z A;  1KK7 A;  3EGD B;  1VQ9 Q;  5CKE A;  2QTX A;  2KRM A;  3X28 B;  1AD6 A;  1M2V B;  1YJ9 A;  1VQO Q;  3OMG A;  2E5Q A;  4TVR A;  5GMK e;  2C0O A;  2QQ8 A;  4BAC A;  4HXJ A;  1TSF A;  4F7L B;  2E6N A;  1Q7Y R;  1UJY A;  1FWZ A;  3NGP A;  2NUT B;  2GQI A;  1JXM A;  1BCO A;  4JLG A;  1JJ2 P;  1U06 A;  2MF2 A;  3OW2 S;  3GNG A;  3MCA B;  3S6W A;  2QQR A;  4M7D A;  4M7A E;  1I5O B;  1YHQ A;  2DEQ A;  1WX6 A;  4BD3 A;  2L89 A;  1HYO A;  1B07 A;  2IW9 B;  2ABL A;  4FT2 A;  4XQ3 A;  4O6J A;  1KFZ A;  3TW6 A;  1OOT A;  2LVM A;  4M78 C;  1WHM A;  5GAN 4;  3CCL A;  2LW4 A;  4OGC A;  3CCM T;  4QSH A;  3JCM V;  1H1R B;  4QQ6 A;  1MGQ A;  1BKB A;  4BCG B;  1UNL D;  2RHY A;  4M7D G;  1E7O A;  2DO3 A;  1KD1 C;  1PHT A;  1V1C A;  3TVT A;  3CCQ Q;  2BZY A;  4BY6 C;  2GCX A;  4KRD B;  2DD4 B;  2DAQ A;  2WEV B;  1ZBX A;  1G3W A;  2GFA A;  3CCJ Q;  3M0P A;  3MEW A;  2YHT A;  1WJQ A;  2DYB A;  4JZ3 A;  4I3Z B;  2IG0 A;  4RG8 A;  4LNP A;  1C6V X;  1OIY B;  2O9V A;  2BPM B;  4K11 A;  3RDV A;  2L5Q A;  3A5Z B;  2DPP B;  4RTU A;  1GXI E;  5IF1 B;  2ROL A;  5D7U A;  3VS6 A;  1LJO A;  4HVW A;  3OYL A;  2F2W A;  4X34 A;  1UEC A;  4F17 A;  4J6W A;  4KGZ B;  2KT8 A;  3VU3 C;  4XTZ A;  2QQB A;  3OSV A;  2EQK A;  3HPW A;  3U23 A;  2X9H A;  4ZN1 A;  5LJ5 g;  3G4S T;  3M53 A;  1VQ8 T;  2YDL A;  4OMQ A;  3BLQ B;  1PKD B;  3RKW A;  2HEQ A;  5KYU B;  1C1A A;  5KCO A;  1KJW A;  1YHQ Q;  2M0Y A;  4PJO A;  1NJI C;  4JJD A;  1VIF A;  3QZ9 B;  3V7R A;  5D6W A;  4EOM B;  2QAS A;  1NG2 A;  2Y90 A;  3QDF A;  4YOO A;  1FVV B;  3CCL Q;  3LQ5 B;  2CP7 A;  2DX1 A;  3VS2 A;  5LJ5 h;  4OMN A;  3D7S B;  4FU6 A;  3LH5 A;  3AT1 B;  5LJ5 f;  1VQ9 T;  2W2H A;  4IKF A;  1U8R A;  1GUX B;  2QYZ A;  3MY5 B;  3JB9 I;  1OPK A;  4PJO G;  3CC4 A;  3JCM h;  1UGP B;  1Q7Y U;  1QCN A;  2KGT A;  3JCM f;  3SWN A;  3URG A;  3DJB A;  1PD1 A;  3PVL A;  4RCB A;  4C5H A;  4FL6 A;  2GTO A;  2KAF A;  1WPY A;  5CQX A;  1O9S A;  2UZL B;  2R5M A;  1OU8 A;  1VA7 A;  4F7N B;  3HRS A;  4II1 A;  3QWL A;  1OU9 A;  1TS9 A;  4IUP A;  2CKK A;  4MML A;  2FB7 A;  4JLI A;  4F6U B;  2I53 A;  2IVX A;  2RQW A;  3CCU A;  2MOX A;  3MPU B;  2YUP A;  2R58 A;  4M77 C;  2KMG A;  2K5I A;  2QA4 A;  2YUO A;  2VXE A;  3WVE B;  3HBL A;  2EGC A;  1G83 A;  1GFC A;  4AKH A;  1KSW A;  2AIR B;  2CT3 A;  2JTF A;  3HP9 A;  2ECZ A;  4M7D E;  3QXE B;  3VS0 A;  2JM8 A;  1TG0 A;  1B7T A;  1ZA1 B;  3CCQ T;  1WHL A;  5FRN A;  1TTH B;  2SRC A;  2WHB B;  3PFS A;  2LQK A;  4J9E A;  2PK2 A;  3G6E A;  4ME7 A;  5GAM f;  3FIF A;  3S3N A;  5CVI A;  2V8K A;  3MP6 A;  2EJF A;  4BCI B;  7AT1 B;  2D0Q B;  1IGQ A;  2FEI A;  2FPF A;  3TQ7 P;  2DRM A;  4NL2 A;  2LJ3 A;  2PK9 B;  4PJN A;  4N4H A;  3DKM A;  1G8X A;  8ATC B;  4E7L A;  1M30 A;  3RER A;  3MP1 A;  1NYF A;  4OF1 A;  3CC4 Q;  2E12 A;  1RAB B;  4CRL B;  5GAN e;  2V8I A;  3ASK A;  2KYM A;  4AFZ C;  3WXM B;  1G3N C;  2DMO A;  4UN0 A;  2HBW A;  4M78 B;  2LNH B;  2OAW A;  2L2P A;  1IRE B;  1B34 A;  3DLL A;  4ZGE B;  1QVG S;  1OYX A;  4OB2 B;  1ZHI A;  2DL5 A;  4DBH A;  2J6K A;  1E6H A;  1QVP A;  3CCL T;  1W2B P;  3JCM c;  2QA4 Q;  4CC2 A;  4M6V A;  4BY6 B;  3BW1 A;  3NTI A;  1KQS S;  4BCK B;  4LOC A;  4PJO E;  2FRW A;  3LH0 A;  4HCC A;  1RAC B;  1GBR A;  5DQW A;  2K4Y A;  1X6O A;  1WXT A;  4RTT A;  1Q7Y C;  1X01 A;  2NYS A;  4BE0 A;  5GMK i;  1JQQ A;  1OPL A;  2RHZ A;  2MPX C;  2EGA A;  1NPR A;  4C0D B;  5IHI A;  3CME A;  1X43 A;  1BU1 A;  4NL3 A;  3SHW A;  2LX7 A;  4M4Z A;  2KK4 A;  4AT1 B;  1PWT A;  2ZPI B;  3KFV A;  3GTM S;  3CCR T;  4E7J A;  5GAO p;  5KYX B;  1UGR B;  4E7S A;  2O2O A;  1WHG A;  1OGU B;  3O8V A;  3L2W A;  1H1P B;  1M1F A;  3DTO A;  1BI1 A;  1K8A R;  4OVA A;  1JO8 A;  1YIJ A;  5KYW A;  1MMA A;  1R0C B;  1UEB A;  4E7H A;  3OW2 A;  1P5E B;  2K3Y A;  5GMK l;  2RJE A;  3HFN A;  1VQK Q;  4KH1 B;  2E64 A;  1I8F A;  1PNJ A;  5I2S A;  2E41 A;  4PJL A;  4M75 F;  1MMN A;  3G71 A;  4OGE A;  2CDT A;  4FT4 A;  2L8D A;  1K4U S;  2M9U A;  2E5K A;  2EJ9 A;  1UTI A;  1HJD A;  4EMK A;  3KXT A;  4EDU A;  1RAG B;  2DER A;  2DTI A;  2XID A;  4A54 A;  3M0S A;  3CC4 T;  2MWO A;  3M0T A;  3UF4 A;  2J06 A;  4J9G A;  3L2Q A;  2PUO B;  2CH4 W;  4XTY A;  2CP2 A;  1GRI A;  4KBM B;  1X69 A;  4PJM A;  1H27 B;  2IN3 A;  3TW7 A;  2XDP A;  1SHF A;  3PE0 A;  4KRT A;  5EG2 A;  3CME Q;  4M77 B;  3E9G A;  4BCQ D;  2QAZ A;  3HRU A;  3NFC A;  4ROC A;  4IUR A;  2O01 E;  4EOL B;  1V76 A;  2PZ1 A;  2D6F A;  3EG3 A;  3A98 A;  4N0A A;  4M75 A;  1NEB A;  2BZ8 A;  3FB9 A;  4BCP B;  2X3W D;  3HHT B;  3RIR A;  4CC4 B;  2QA4 T;  1VQP A;  4PLL A;  3BY7 A;  1YJW A;  4DBF A;  2A0F B;  2PVO B;  2NUP A;  5LJ5 e;  4BCN D;  5J3B A;  1O9K B;  1N8R U;  5FWC A;  2O88 A;  3M4Y A;  2KQW A;  2CGH A;  1MMG A;  4Z88 A;  4BCQ B;  4FM4 B;  1E6G A;  4M75 G;  3JCM e;  4L6V 5;  3KBG A;  2JW4 A;  1N4M A;  2DTH A;  2R7G A;  2PU9 B;  4RTV A;  1Y0M A;  3M4G A;  3G71 Q;  1H1S B;  1EX4 A;  4NOY A;  4BCN B;  2PUK B;  2LJ1 A;  2DM1 A;  3OB9 A;  3L2U A;  1K0X A;  2YLB A;  2EYY A;  2KVQ G;  4XTU A;  3GIB A;  5LJ3 j;  1RLQ C;  2K5F A;  3POM A;  1UFF A;  2EYX A;  2UZB B;  1AHJ B;  1P92 A;  3M57 A;  5HKC A;  3J7A F;  1FXX A;  4C92 A;  1GCQ C;  1K9M R;  3ZBD A;  1K8A U;  3BG9 A;  4BB7 A;  1LCK A;  3OSS C;  2XG8 D;  5GAM j;  2J6O A;  5HBE B;  2G9X B;  2BKD N;  4M7A F;  5EJC A;  2DEU A;  3VV0 A;  2C5X B;  1VQK T;  3RKX A;  3EGX B;  2HAX A;  2RQU A;  4C92 G;  1VQP Q;  3TRE A;  4Y91 A;  1QLB A;  1HXD A;  4Q5W A;  3REA B;  2DME A;  1YJN A;  1H8K A;  3UA6 A;  1OX8 A;  1OV3 A;  1YI2 T;  1KC8 R;  4BBR M;  2QTV A;  2AZV A;  3A8O B;  2WSE E;  3QBY A;  4JX6 A;  4XU3 A;  2EWN A;  3EGD A;  3SB2 A;  3QDR B;  3CME T;  4KUI A;  2RB6 A;  2Z0W A;  4M7A A;  1X2K A;  1M2V A;  3E19 A;  1TH7 A;  4KGX B;  5CAI A;  3THK A;  4X9C A;  3CC7 T;  4L59 A;  2XMF A;  4JRI A;  3VRY A;  2JN0 A;  2PVD B;  2HZY A;  3KHI A;  2VGN A;  1N8R C;  4YC3 B;  1X6G A;  2DFU A;  3FJP A;  1S72 T;  3R6O A;  2M16 A;  2BS2 A;  4A53 A;  2RQV A;  4M75 E;  8AT1 B;  3H0H A;  2DIL A;  2JS0 A;  5A0L A;  4EOS B;  1WGS A;  2K57 A;  4EMG A;  1M8V A;  1Z9Z A;  3C95 A;  2BZX A;  4EOO B;  3BHV B;  2EYW A;  3JB9 G;  1D1A A;  1WIE A;  3HFO A;  1OKW B;  3G71 T;  2LCS A;  2PMI B;  1M9S A;  2RQT A;  2HQE A;  3TNW B;  2VYT A;  2RN8 A;  4C8Q C;  1WA7 A;  2WXV B;  1YWP A;  4XU0 A;  2EBP A;  4GLK A;  1VQ4 T;  2DD4 A;  5CR2 A;  4ELY C;  2A37 A;  2FVU A;  2B86 A;  2QXF A;  1TWB A;  4AFS C;  2DTO A;  3JCM b;  5GAN g;  1N9R A;  2MWP A;  1K9M U;  1OX9 A;  1K8A C;  2E3I A;  4NC6 A;  3O5Z A;  2IIM A;  4A63 B;  3M0R A;  2MCN A;  3C12 A;  4ROD A;  1RL2 A;  2LRQ A;  1IXD A;  4QT7 A;  4UC4 A;  4QQG A;  1TUD A;  3OYI A;  2ENM A;  4CFN B;  3OYC A;  1W4S A;  3H0F A;  2MI6 A;  1IRX A;  4JRK A;  1M90 R;  1TXQ A;  4BCH B;  2HSP A;  1HK9 A;  4ZGD B;  4C92 E;  4CXA B;  3CCE A;  1Q82 R;  3QHW B;  1A0N B;  3RES A;  1UHC A;  5LJ3 d;  1PKS A;  2C6T B;  1VQ6 A;  1CKB A;  5KYU A;  1Y07 A;  2FPD A;  2G6F X;  4MZP A;  1ZUK A;  2RO0 A;  4E47 A;  4FIB A;  4RTZ A;  2E3H A;  3SEM A;  5GAN 5;  5M9O A;  4XU2 A;  2F5K A;  1SPK A;  1LNX A;  4OMM A;  1QVF P;  2KDS A;  3CPW P;  1G2B A;  2D8J A;  3FDR A;  2EPD A;  3CD6 A;  2HKN A;  3M58 A;  1YCS B;  3PGG A;  1NEG A;  3EFO B;  3VKI A;  3BDL A;  3NTK A;  1JB0 E;  1GUX A;  3WVD B;  2MIO A;  1RAI B;  2DL4 A;  3OQ5 A;  4BCM D;  1Q81 R;  4F6S B;  2D8H A;  4PL6 A;  3BG3 A;  3I35 A;  5FWB A;  2VV5 A;  3UDC A;  2J05 A;  1WDX A;  3QWX X;  3M55 A;  1AVZ C;  4MDX A;  4EOK B;  3JAM E;  3EJ1 B;  2CZ7 B;  1I5L A;  4YOZ A;  3TN8 B;  4MMK A;  2JS2 A;  4ELZ C;  2BE7 D;  1KHI A;  4PFZ A;  1Y71 A;  1H1Q B;  5CK9 A;  5CKF A;  1YBY A;  4A4F A;  4BCM B;  1CSK A;  2BS4 A;  1Q86 R;  5ICP B;  2DJQ A;  3JCM Q;  1WNL A;  1OI9 B;  1NBE B;  2ZGW A;  2CT4 A;  2EIF A;  3MEV A;  2EQU A;  3H4C A;  4CFU D;  3CCE Q;  3SFM A;  1BB9 A;  4XU1 A;  4GY5 A;  3CBP A;  4ZGJ B;  1SF9 A;  2YXY A;  1GH6 B;  2DKG A;  1RAE B;  1VQ6 Q;  3VS7 A;  2ZPH B;  6AT1 B;  4M78 F;  2RI3 A;  4PJO F;  3LWI A;  2W96 A;  3A1P A;  1NE8 A;  1K9M C;  2QEX A;  1JRI A;  1QW1 A;  4JDS A;  3EAE A;  2JZ2 A;  4J7F A;  2V22 B;  4ZTJ A;  2QI2 A;  4CFU B;  2CZ6 B;  2H3E B;  2ZZD B;  2K9G A;  5DQV A;  2WIP B;  1YJ9 Q;  1QKX A;  3J80 E;  3TNH B;  1WXU A;  2F2X A;  4C8Q D;  4J9D A;  1Q82 U;  3UPU A;  4R56 A;  2DZC A;  4V2S A;  1HD3 A;  2MK5 A;  2PHG A;  3M56 A;  3EID B;  2OJ2 A;  1K1Z A;  3M9Q A;  1QP3 A;  5CEI B;  1RAF B;  3RBB B;  4DEY A;  4M78 A;  2DJZ A;  4FW1 A;  1VQM T;  5A0D A;  2UUE B;  2GFU A;  1ZSZ A;  5GAO n;  2AT1 B;  4LDY A;  3JCM g;  4EON B;  3CQT A;  3PIO A;  2DD5 B;  3HSB A;  1SEM A;  1OL1 B;  3RNJ A;  2KBT A;  3EFR A;  3A8H B;  2K3B A;  4D8K A;  4C8Q B;  2RA2 A;  3VS3 A;  3H8Z A;  1MV0 B;  4E2F B;  2C5V B;  3HO8 A;  3VYG B;  1KQ1 A;  4X1V A;  2QF7 A;  1RAD B;  1U1T A;  2RNA A;  1VQO T;  1Q81 U;  5FGK B;  4M78 G;  1M3C A;  5IXF A;  2M1H A;  1F1B B;  1BI3 A;  4ATO A;  2KR3 A;  4ESR A;  1JU5 C;  1M4Z A;  5HNB B;  2RQR A;  2QEX Q;  4CFV B;  5IAY A;  1TU0 B;  3VJP A;  3VUB A;  1W6X A;  1M1K R;  2CRE A;  2DVE A;  1I81 A;  2X1N B;  2X35 A;  3P8B B;  4B9X A;  1ZSG A;  2PNI A;  5GAM g;  1LOJ A;  2VVK A;  3VYH B;  4EC8 B;  2K5L A;  2VKN A;  1WHK A;  5KYX A;  2EQI A;  4EOR B;  5GAO q;  2VUB A;  3BE3 A;  5LJ3 f;  4KGV B;  2DET A;  1PM3 A;  1SSF A;  1XTD A;  1WQW A;  3ZEH A;  5CO7 A;  1H24 B;  1EIF A;  2GQV A;  2LCC A;  2JVV A;  3I5S A;  2KY9 A;  1UE9 A;  3QPH A;  4JJB A;  4NST B;  1D3B B;  5GAM h;  1JST B;  2KMT A;  1I07 A;  4M77 F;  3BHT B;  4C0F A;  5GAN 2;  3CCJ T;  5LQF B;  4LDX A;  3GPL A;  4D6W A;  1RAA B;  2HCK A;  4C5I A;  3OS0 A;  4OR5 B;  1J3T A;  3CCS A;  2I0N A;  4XAX B;  2CP5 A;  3N5B B;  3BG5 A;  1Y7X A;  2C0T A;  2COW A;  5IXB A;  2W99 A;  2XD0 A;  4HCK A;  1YJ9 T;  1WLP B;  5LL6 S;  3A8G B;  5EC7 A;  4EMH A;  2FG0 A;  5AYF A;  1FMW A;  2IW8 B;  2XU8 A;  1R8O B;  1W2B A;  3F5X B;  1YHQ T;  4M77 A;  3LW5 E;  5CKB A;  4LE9 A;  3V7C A;  2KT1 A;  2X4W A;  3QO3 A;  2NWM A;  5CKH A;  2LNV A;  3CCU Q;  1BU2 A;  1K76 A;  3LLR A;  1VYV A;  4PK4 A;  3EG9 B;  2CUD A;  4JX5 A;  2R5A A;  1VQ5 A;  3Q1J A;  4CFM B;  3QYH B;  3I56 A;  3LWH A;  4M78 E;  1Q81 C;  3OYF A;  1O9K A;  4M77 G;  1VQ7 A;  1YFN A;  4Y72 B;  3V8L A;  2KXC A;  3L1A A;  2C06 A;  2QDY B;  3FRN A;  3I55 A;  3G6E Q;  1B3Q A;  3CXC S;  5IHY A;  2I2L A;  1C9B A;  4XTV A;  3QG1 A;  1X2Q A;  4PNO A;  2QEX T;  1SRM A;  1BI0 A;  3T9N A;  1C0M A;  3PNW C;  4AKG A;  4PKC C;  1PRL C;  3CCS Q;  1SHG A;  1IHW A;  1AWW A;  3SD4 A;  4CFX B;  2FYK A;  3GLX A;  2P0Q A;  1T3S A;  2QQ9 A;  4BE2 A;  3UWN A;  1TUG B;  3ER0 A;  2QQA A;  3NDQ A;  2CP0 A;  1WHJ A;  4Y92 A;  2RK1 A;  1M8M A;  1N6A A;  4EOJ B;  1MND A;  4OB1 B;  4HLQ A;  5C6S A;  4X9D A;  4EOI B;  3OS2 A;  2DBM A;  2V26 A;  3R6N A;  1LVK A;  3V8J A;  2MAM A;  4BCJ B;  3EGX A;  1JJ2 S;  4LXC A;  3CMA A;  2RD1 A;  2WJ9 A;  5CKD A;  2F69 A;  2M51 A;  4EOQ B;  2E70 A;  3JV3 A;  3TSZ A;  2JTE A;  2RH2 A;  1VQ5 Q;  3I56 Q;  4HNT A;  3FLG A;  3X24 B;  1M5Q 1;  1VQ7 Q;  3P8D A;  1OIU B;  3S3O A;  4YTL A;  3L2V A;  1YWO A;  2CYZ B;  1FIN B;  1PCX A;  2K2M A;  3DDP B;  4JX4 A;  2K79 A;  2D9T A;  3I55 Q;  4F6W B;  3MO8 A;  4WCI A;  3FEO A;  3RR6 A;  1YN8 A;  3QJ6 A;  3OBY A;  3OW2 P;  2C4G B;  2OTJ A;  2COZ A;  3QYG B;  4HVV A;  2CS7 A;  1GBQ A;  1FMV A;  3EH2 A;  1KQ2 A;  3L42 A;  2V1R A;  5BNJ B;  3CCU T;  3M0U A;  3FC3 A;  3H9N A;  3IQL A;  2LQW A;  3PIP A;  4M77 E;  4C92 F;  1PKT A;  4XTX A;  3OYD A;  1SRL A;  2DXC B;  4JZ4 A;  2QQS A;  1UDL A;  5CYI B;  1VQN A;  2KEA A;  1YIJ Q;  1G3S A;  3MJX A;  2VXF A;  3QKJ A;  5IT9 E;  4HL4 A;  1UUE A;  2LT1 A;  3G6E T;  1ZP2 A;  2CZ1 B;  1AIS B;  2JUF A;  2DIQ A;  2KRN A;  1QLY A;  2CSQ A;  4OMO A;  3CCS T;  1WHH A;  4J6X A;  4EC9 B;  5A0G A;  1VOL A;  2F1L A;  2ZPB B;  1W1F A;  2FZG B;  5GAN 6;  2VGM A;  3V8K A;  1H3H A;  4BXX X;  3RMS A;  2B8A A;  5KYY A;  1ENW A;  1XJW B;  4N4G A;  2COY A;  2XK0 A;  4MZM A;  2OI3 A;  3C94 A;  3ULR B;  4FW2 A;  1G3T A;  2X4J A;  1GCP A;  1EFN A;  3MEU A;  2X51 A;  5GAM e;  2BTT A;  4M7A C;  2X3X D;  1Z9Q A;  4IMY B;  1W70 A;  4JJN K;  1GL5 A;  1IHV A;  1X27 A;  4Z6Y A;  3J81 E;  4IUU A;  4F04 B;  3DDQ B;  2D0N A;  2QDJ A;  4MFE A;  2Y4X A;  3VS1 A;  3JB9 F;  1QKW A;  1YJW Q;  4F7U B;  4D8D A;  4AI6 A;  2M02 A;  2JNG A;  1VQ5 T;  5DLQ E;  1ZX6 A;  4OMF B;  3L2Z A;  1K0S A;  1SG5 A;  1VQ7 T;  2RHI A;  4DBR A;  1UGS B;  2QFZ A;  5IDN B;  4BUG A;  1BCM A;  5CIU A;  1VQN Q;  3GOX A;  1BYM A;  4ORZ A;  2L3R A;  3OBW A;  4C0Z A;  1H28 B;  1TOV A;  1Y96 B;  1U1S A;  2FRY A;  4BY7 X;  4E7K A;  3BLH B;  4P5N A;  5GMK m;  4HA8 A;  3EFO A;  1D0Y A;  2ZPF B;  3DB4 A;  1D1C A;  4M75 D;  4MIM A;  3LGL A;  4ELJ A;  5GJW B;  1O75 A;  2O9S A;  1YIT A;  3QUI A;  1GCQ A;  4JS5 A;  1OI1 A;  1K73 R;  1WYX A;  4FSS A;  1H64 1;  5GAN 8;  4R55 A;  1FYN A;  3QYE A;  2NUT A;  1PD0 A;  4AKI A;  3NMZ C;  2M0O A;  1NZ9 A;  5FU7 C;  3X20 B;  4CC7 A;  2CP3 A;  4OP0 A;  2P0P A;  4AFQ C;  1YIJ T;  2FO0 A;  2NUZ A;  1BI2 A;  4J9B A;  5C0M A;  2F2V A;  3CC2 A;  1M2O A;  3BHU B;  2YUN A;  1VQ8 A;  3TEE A;  4J9I A;  1QWF A;  2JT4 A;  3QSU A;  2JXB A;  2L3S A;  4II5 B;  1BBZ A;  2XI9 A;  1I4K 1;  1VYU A;  2YRC A;  1T3L A;  3M54 A;  4J83 A;  4JJC A;  5L23 A;  1YJN Q;  3C0C A;  2E6Z A;  2BIV A;  2ED0 A;  2KRS A;  1W2B S;  2LQ8 A;  3OYE A;  1VQ9 A;  4DA4 A;  2LC4 A;  4RTW A;  2FHD A;  3CXC A;  3HTR A;  1N5Z A;  3PT9 A;  3G1J A;  5LJ5 d;  4J6Y A;  2ZZD A;  4TTH A;  5FRM A;  3DL1 A;  1ZBJ A;  4RKU E;  4F16 A;  5IN1 A;  3MKD A;  1QVG P;  1YIT Q;  3DLM A;  4IUV A;  3OYM A; 
#chains in the Genus database with same CATH homology
 4RCC A;  1VQP T;  1X01 A;  3A8H B;  3EFR A;  3H6Z A;  3RUX A;  1YJW T;  4BE0 A;  5D6Y A;  5GMK i;  4MZT A;  4C8Q B;  2RA2 A;  2X4Y A;  4LD6 A;  4B9W A;  2RHZ A;  3H8Z A;  3CPW A;  5KE3 A;  3VYG B;  3HO8 A;  1KQ1 A;  1KC8 U;  1G3Y A;  2QF7 A;  3OA6 A;  4M7D C;  1U1T A;  1NPR A;  4C0D B;  3JCM X;  2EJG A;  5L8R E;  1VQO T;  1RI0 A;  3CME A;  3ME9 A;  2DXU A;  4M78 G;  1Q81 U;  1VQN T;  4KUD K;  4NL3 A;  5FRO A;  3MET A;  5J39 A;  2M1H A;  2AHJ B;  3PMI A;  4HKE A;  3JCM W;  2DD5 A;  2KK4 A;  2LTO A;  1BI3 A;  2ZPI B;  3AHU A;  4ATO A;  3CBO A;  1FKM A;  3CCR T;  4E7J A;  3OYJ A;  1M4Z A;  5GAO p;  4M7A D;  5J26 A;  2E10 A;  3I56 T;  3CCV A;  4PJO D;  3G7Z A;  1UGR B;  3CCQ A;  2ZCF B;  4J5Y A;  3BDU A;  3VYG A;  3HB9 A;  3INZ A;  3O8V A;  5IAY A;  1JJ2 A;  2HQX A;  3L2W A;  1E7P A;  3VJP A;  3CCM A;  3HSB A;  3VUB A;  1M1F A;  2RM4 A;  2DVE A;  5KH6 A;  3I55 T;  1I81 A;  1BI1 A;  2X35 A;  4OVA A;  3P8B B;  4B9X A;  5GAM g;  1K73 U;  1LOJ A;  3OYA A;  1YIJ A;  1G5V A;  4F7U E;  3VYH B;  2K5L A;  1X75 C;  4QVC A;  3LX7 A;  4XTW A;  4EMK B;  5GAO q;  5KCH A;  2PQW A;  2VUB A;  1V29 B;  1UEB A;  4N4I A;  4C8Q G;  4E7H A;  3OW2 A;  2JOY A;  2A3L A;  5LJ3 f;  2K3Y A;  5GMK l;  2RJE A;  5GMK j;  1SSF A;  1XTD A;  2H3J A;  3HFN A;  4IUQ A;  4M7A B;  3OY9 A;  1WQW A;  2E64 A;  1I8F A;  5CO7 A;  3ZEH A;  1EIF A;  2GQV A;  2E41 A;  3MEA A;  3QHS A;  4M75 F;  5I2S A;  2LCC A;  3G71 A;  3TU4 K;  4OGE A;  2JVV A;  2KY9 A;  4FT4 A;  2OTL A;  2L8D A;  5GAO m;  2M9U A;  1VUB A;  2EJ9 A;  4MDW A;  5DM7 R;  3KUF A;  3QPH A;  1D3B B;  5GAM h;  5CCA A;  1N9S A;  2KMT A;  5GAO l;  4EMK A;  4M77 F;  4C0F A;  5GAN 2;  3CCJ T;  3S3O A;  3KXT A;  4EDU A;  4LDX A;  3GPL A;  4BI3 A;  2HD0 A;  4XK8 E;  4BDY A;  4D6W A;  2DXB B;  2DTI A;  3C4S A;  2XID A;  2P0K A;  4A54 A;  5I2M A;  4C5I A;  3CC4 T;  3LYI A;  2MWO A;  4BBS M;  3L2Q A;  3OS0 A;  2PUO B;  2YLC A;  4XTY A;  5KE2 A;  3BFM A;  3DB3 A;  2LT4 A;  3CCS A;  4KBM B;  4M75 B;  2GF7 A;  2DIG A;  4XAX B;  2FL7 A;  2IVW A;  3N5B B;  4CI0 C;  3BG5 A;  1Y7X A;  1YJN T;  1D3B A;  3E9F A;  3TW7 A;  3HKS A;  2XDP A;  1VQ5 A;  4KUL A;  2XD0 A;  2V8J A;  4L5G A;  5EG2 A;  3PIO A;  3G4S A;  1YJ9 T;  2XDB A;  2XKO C;  4M77 B;  4PJO C;  3QYB A;  2DXB A;  2YRV A;  3E9G A;  2G3R A;  5LL6 S;  5HK3 A;  3A8G B;  3RMQ A;  4JRP A;  2NLU A;  2E65 A;  3HRU A;  4HCZ A;  3HRT A;  3NFC A;  4NS5 A;  5FU6 B;  4EMH A;  4IUR A;  5AYF A;  2O01 E;  4M7A G;  2VC8 A;  1VQM A;  3EFS A;  2D6F A;  2F5T X;  4M7D A;  4N0A A;  4M75 A;  3FB9 A;  2XU8 A;  3A8L B;  1PSE A;  3HHT B;  1M1G A;  5CQY A;  3RIR A;  4C0G A;  2QA4 T;  1OZ3 A;  1XQH A;  1VQP A;  1VQL A;  4PLL A;  1PSF A;  1R8O B;  3BY7 A;  2G77 A;  4C92 D;  5DLO A;  4QQD A;  1YJW A;  1W2B A;  1NPP A;  2PVO B;  5LJ5 e;  4LDW A;  5J3B A;  1YHQ T;  4M77 A;  3LW5 E;  1N8R U;  5CKB A;  2XHC A;  3V7C A;  3M4Y A;  2KQW A;  1YCY A;  2X4W A;  2CGH A;  5FU7 B;  1YIT T;  3QO3 A;  1WJS A;  2RJD A;  2LX9 A;  1QVG A;  5CKH A;  1VQO A;  2LNV A;  4C8Q F;  4LDV A;  4Y28 E;  4BDZ A;  4FM4 B;  1KD1 U;  3SWN C;  5HK0 A;  3LLR A;  2OTJ T;  4M75 G;  5GAN 3;  3JCM e;  3OYK A;  4L6V 5;  4PLI A;  3KBG A;  4JX5 A;  3CCR A;  1KC8 C;  3MP8 A;  3UT1 A;  5DY9 A;  4C0D C;  2EQJ A;  2R5A A;  2DTH A;  3OMC A;  2DZ9 A;  2RJC A;  3Q1J A;  3QYH B;  3I56 A;  1KQS A;  2PU9 B;  4M78 E;  3LWH A;  2R57 A;  3OYF A;  1Q81 C;  3M4G A;  4M77 G;  1VQ7 A;  3V8L A;  4BI8 B;  4NOY A;  4C92 B;  3NTH A;  3L1A A;  3JCM d;  2PUK B;  2C06 A;  2QDY B;  4JRQ A;  3OB9 A;  3PMT A;  3L2U A;  3CC2 T;  2YLB A;  4HCB A;  2KVQ G;  3FRN A;  3I55 A;  4XTU A;  3GIB A;  5LJ3 j;  3CXC S;  1QVF A;  2I2L A;  4HT9 A;  1XNI A;  2K5F A;  3OS1 A;  2EFI A;  4XTV A;  3QG1 A;  2RHU A;  4PNO A;  2QEX T;  4C5E A;  3OS5 A;  1BI0 A;  3T9N A;  3PNW C;  1AHJ B;  1P92 A;  2Y4Y A;  3M57 A;  5HKC A;  4AKG A;  4PKC C;  1FXX A;  5GAN h;  3J7A F;  4C92 A;  1ZQ1 A;  3ZBD A;  1K8A U;  3BG9 A;  1MHN A;  1N27 A;  2O4X B;  2ZPE B;  4QVZ A;  4BB7 A;  1K73 C;  3OSS C;  5GAN f;  3OYN A;  3SD4 A;  2FYK A;  2MMP A;  3GLX A;  5LJ3 g;  2XG8 D;  2P0Q A;  3M59 A;  4C8Q A;  5GAM j;  2QQ9 A;  2BKD N;  4M7D D;  4C8Q E;  3X25 B;  4BE2 A;  3CBM A;  3UWN A;  4M7A F;  3ER0 A;  3JCM P;  5EJC A;  4M7D F;  3VV0 A;  2QQA A;  4JUV A;  3CCJ A;  4OB3 B;  1UB4 A;  4QVD A;  4OB0 B;  1VQK T;  3RKX A;  2HAX A;  3M5A A;  1NJI U;  2RI5 A;  2RK1 A;  2OAU A;  3JB9 D;  2O4X A;  3JRZ A;  1N6A A;  4C92 G;  4BE1 A;  2DXT A;  4WF2 A;  4OB1 B;  5GAM d;  4HLQ A;  1XOV A;  5C6S A;  5LJ3 h;  4X9D A;  4Y91 A;  2KR6 A;  3TRE A;  3ZFJ A;  3OS2 A;  1Q86 U;  1QLB A;  1HXD A;  4FSX A;  2XIC A;  4Q5W A;  3QJY A;  1H3Z A;  3OYG A;  1YJN A;  3V8J A;  2K3X A;  3F70 A;  2MAM A;  3OYH A;  5CKE A;  2QTX A;  1YI2 T;  3X28 B;  4BBR M;  4M7D B;  1YJ9 A;  1QP2 A;  3OMG A;  2E5Q A;  4TVR A;  5GMK e;  1JJ2 S;  3RKY A;  3CMA A;  3CCE T;  2QQ8 A;  2RD1 A;  2WJ9 A;  5CKD A;  2F69 A;  4BAC A;  3A8O B;  2E70 A;  2EYQ A;  4HNU A;  1VQ6 T;  2RH2 A;  2E6N A;  4Z02 A;  2WSE E;  3QBY A;  1FWZ A;  3CPF A;  4MFD A;  4JX6 A;  4XU3 A;  4JLG A;  4HNT A;  2EWN A;  3FLG A;  3SB2 A;  3QDR B;  3X24 B;  4ZN3 A;  3CME T;  1M5Q 1;  3V7S A;  4KUI A;  3P8D A;  2RB6 A;  4M7A A;  2MF2 A;  3OW2 S;  2RHX A;  3GNG A;  3MCA B;  4YTL A;  2QQR A;  3S6W A;  4A4K A;  4RMO A;  3OYM A;  2CYZ B;  1TH7 A;  2DEQ A;  3E19 A;  5CAI A;  3L2V A;  4E7I A;  2RK2 A;  1YHQ A;  4BD3 A;  1M8V A;  4X9C A;  4JX4 A;  2D9T A;  2L89 A;  3CC7 T;  2DK3 A;  3CD6 T;  5FLX E;  3MO8 A;  4XQ3 A;  4L59 A;  4FT2 A;  3CCV T;  4O6J A;  3E1S A;  3TW6 A;  2LCL A;  3FEO A;  4JRI A;  2LVM A;  3TCJ A;  1M90 C;  3QJ6 A;  3OBY A;  2JN0 A;  4M78 C;  5GAN 4;  2PVD B;  4OGC A;  3CCL A;  2OTJ A;  3QYG B;  3KHI A;  2VGN A;  2CS7 A;  1N8R C;  1FX7 A;  3CCM T;  4QSH A;  3JCM V;  4RG2 A;  4QQ6 A;  1MGQ A;  3FJP A;  3L42 A;  1S72 T;  1Q82 C;  1KQ2 A;  1BKB A;  2XDD A;  2RHY A;  3R6O A;  4M7D G;  2M16 A;  4C5G A;  1WQ7 A;  2DO3 A;  3CCU T;  2RJF A;  2BS2 A;  2JTM A;  4A53 A;  1KD1 C;  4M75 E;  4M78 D;  5A0L A;  4BY6 C;  2GCX A;  3HZJ A;  1IZ6 A;  1WGS A;  2DD4 B;  2K57 A;  2DAQ A;  4EMG A;  1ZBX A;  3C95 A;  3FC3 A;  1G3W A;  2GFA A;  2PVG B;  3MEW A;  2YHT A;  1WJQ A;  2IG0 A;  4RG8 A;  3PIP A;  4M77 E;  4C92 F;  3JB9 G;  4XTX A;  3OYD A;  3HFO A;  2KSS A;  3G71 T;  2DXC B;  2QQS A;  1M9S A;  5GAO r;  2OTL T;  5GAN j;  2HQE A;  1VQN A;  3CEY A;  3A8M B;  1G3S A;  2VYT A;  2L5Q A;  3A5Z B;  2VXF A;  4C8Q C;  4KT0 E;  3QKJ A;  1BIB A;  2DPP B;  4HL4 A;  2LT1 A;  3G6E T;  4XU0 A;  5IT9 E;  1GXI E;  4GLK A;  1VQ4 T;  2EAY A;  1LJO A;  2DD4 A;  3OYL A;  5CR2 A;  4ELY C;  4X34 A;  2FVU A;  4J6W A;  2QXF A;  2HNI A;  2CZ1 B;  3VU3 C;  2DTO A;  2DIQ A;  2JUF A;  3JCM b;  5GAN g;  4XTZ A;  1N9R A;  2DXC A;  4PJO B;  2MWP A;  1K9M U;  3CCS T;  4A4G A;  4J6X A;  1K8A C;  4NC6 A;  5A0G A;  1VQK A;  2QQB A;  3OSV A;  2EQK A;  3GP8 A;  3HPW A;  3C12 A;  2ZPB B;  1RL2 A;  4ZN1 A;  5LJ5 g;  2LRQ A;  3VKH A;  4UC4 A;  4QQG A;  5GAN 6;  3M53 A;  3OYI A;  3G4S T;  1VQ8 T;  3OYC A;  5GAN 7;  4A4H A;  1W4S A;  2VGM A;  3LGF A;  2MI6 A;  4JRK A;  3RKW A;  2B8A A;  3RMS A;  3V8K A;  5KCO A;  3QZ5 B;  3P8H A;  1M1K U;  4N4G A;  4PJO A;  1HK9 A;  4ZGD B;  5A2Q E;  2XK0 A;  1NJI C;  4MZM A;  1YI2 A;  1VIF A;  3QZ9 B;  3V7R A;  5D6W A;  4C92 E;  4HT8 A;  3C94 A;  4F7U F;  3CCE A;  1G3T A;  1VQL T;  4EMK C;  2X4J A;  2Y90 A;  3RES A;  1Q86 C;  4VUB A;  5LJ3 d;  5LJ5 h;  1DJ7 B;  3SWN B;  3JSC A;  3MEU A;  3HL8 A;  4FU6 A;  5GAM e;  1VQ6 A;  1QVF S;  4M7A C;  3CPW S;  1Y07 A;  4JJN K;  3CMA T;  5LJ5 f;  4MZP A;  1VQ9 T;  2RO0 A;  4A4E A;  4IKF A;  1U8R A;  4E47 A;  4FIB A;  4Z6Y A;  3JB9 I;  3J81 E;  4IUU A;  4PJO G;  5GAN 5;  5M9O A;  4ZTF A;  3CC4 A;  2QDJ A;  4MFE A;  4XU2 A;  3JB9 J;  4LD9 K;  3JCM h;  2F5K A;  2Y4X A;  1UGP B;  1LNX A;  3VUZ A;  1Q7Y U;  1M90 U;  3JB9 F;  2KDS A;  3FDR A;  4F7U B;  5HY6 A;  4AI6 A;  3GF5 A;  3CC7 A;  2JNG A;  3CD6 A;  3JCM f;  1VQ5 T;  3M58 A;  5DLQ E;  3SWN A;  3PGG A;  3URG A;  4OMF B;  5D6X A;  1KHC A;  3VKI A;  3L2Z A;  4RCB A;  4FL6 A;  2KAF A;  5CQX A;  1WPY A;  4C5H A;  1BIA A;  1O9S A;  2R5M A;  3BDL A;  1VQ7 T;  2RHI A;  1JB0 E;  3NTK A;  1UGS B;  2QFZ A;  3GNF B;  3WVD B;  4BUG A;  2WAC A;  5CIU A;  3HRS A;  4II1 A;  3QWL A;  3OQ5 A;  3GOX A;  1BYM A;  4N0A C;  2L3R A;  1VIE A;  4M75 C;  4IUP A;  2CKK A;  4MML A;  4QW2 A;  3OYB A;  2FB7 A;  3OBW A;  4JLI A;  4C0Z A;  1S72 A;  3S3M A;  4DQ2 A;  4PL6 A;  3BG3 A;  2LDM A;  2BUD A;  4F7U A;  1Y96 B;  3CCU A;  2VV5 A;  3UDC A;  1U1S A;  4E7K A;  2R58 A;  4P5N A;  4M77 C;  5GMK m;  2KMG A;  3M55 A;  1OZ2 A;  4HA8 A;  2HBP A;  2K5I A;  2QA4 A;  2VXE A;  2ZPF B;  3WVE B;  3HBL A;  5FU6 C;  4MDX A;  3DB4 A;  3JAM E;  2BS3 A;  4M75 D;  3HP9 A;  4AKH A;  2JTF A;  4MIM A;  3LGL A;  2CZ7 B;  4M7D E;  4ELJ A;  1I5L A;  1UGQ B;  3QXE B;  1O75 A;  2WSF E;  4MMK A;  3QUI A;  4ELZ C;  3L2R A;  1YIT A;  1KHI A;  5CK9 A;  1Y71 A;  4JS5 A;  3CCQ T;  5CKF A;  1YBY A;  4M77 D;  5FRN A;  3VKG A;  1OI1 A;  4A4F A;  1Y96 A;  4CRI A;  1H64 1;  2WSC E;  5GAN 8;  3PFS A;  2LQK A;  3QYE A;  4R55 A;  4F7U G;  2BS4 A;  4AKI A;  3G6E A;  2M0O A;  4O5V A;  4LDU A;  1NZ9 A;  1WNL A;  4ME7 A;  5GAM f;  3JCM Q;  1VQ4 A;  4DOW A;  3FIF A;  5FU7 C;  3S3N A;  5CVI A;  2ZGW A;  2V8K A;  2EIF A;  3MEV A;  3X20 B;  2P4T A;  2EJF A;  2EQU A;  3H4C A;  3MP6 A;  4J8O A;  4OP0 A;  2CZ0 B;  2D0Q B;  3SFM A;  2P0P A;  1YIJ T;  4HNV A;  4XU1 A;  4GY5 A;  1KG1 A;  3CBP A;  4ZGJ B;  1BI2 A;  2DKG A;  2E1H A;  5C0M A;  2EQM A;  4NL2 A;  3JCM J;  2ZPH B;  3CC2 A;  4M78 F;  3SDZ A;  2RI3 A;  2X4X A;  4DOV A;  4N4H A;  3DKM A;  2ZPG B;  4PJO F;  3LWI A;  1VQ8 A;  4E7L A;  4J7I A;  1NE8 A;  5GMK h;  4C92 C;  3TEE A;  1K9M C;  3RER A;  3X26 B;  3MP1 A;  4OF1 A;  2QEX A;  1JRI A;  1QW1 A;  3PTA A;  3QSU A;  1B34 B;  2E12 A;  4JDS A;  1WJR A;  2XI9 A;  1I4K 1;  3EAE A;  2JZ2 A;  5GAN e;  4J7F A;  2V8I A;  3ASK A;  4ZTJ A;  3M54 A;  4J83 A;  2QI2 A;  3WXM B;  3MHX A;  3QII A;  2CZ6 B;  5LJ5 j;  3JB9 H;  3OYY A;  2E6Z A;  2BIV A;  2ZZD B;  1W2B S;  2LQ8 A;  4M78 B;  1M1K C;  3OYE A;  3J80 E;  5GAN d;  1IRE B;  1VQ9 A;  4DA4 A;  1B34 A;  2LC4 A;  4C8Q D;  3DLL A;  1JBM A;  4ZGE B;  1Q82 U;  4JS4 A;  1QVG S;  2FHD A;  1OYX A;  2A7Y A;  4OB2 B;  3UPU A;  1ZHI A;  2DZC A;  4R56 A;  3CXC A;  4V2S A;  1QVP A;  3CCL T;  2K2V A;  3PT9 A;  5LJ5 d;  4J6Y A;  3JCM c;  3M56 A;  2RI2 A;  4M6V A;  4BY6 B;  4M7A E;  5LJ3 e;  3M9Q A;  1QP3 A;  2ZZD A;  3BW1 A;  5FRM A;  3DL1 A;  3NTI A;  4M78 A;  5I21 A;  2DJZ A;  4RKU E;  1KQS S;  5IN1 A;  1VQM T;  5A0D A;  2GFU A;  4LOC A;  4IUT A;  4PJO E;  3LH0 A;  5GAO n;  4EPC A;  4HCC A;  3DLM A;  2EKO A;  4LDY A;  3JCM g;  4BI4 A;  2K4Y A;  4IUV A;  1X6O A;  2DD5 B;  1Q7Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...