3A8OB

Crystal structure of nitrile hydratase complexed with trimethylacetamide
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Kinetic and structural studies on roles of the serine ligand and a strictly conserved tyrosine residue in nitrile hydratase
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 59
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2009-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3a8oB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3a8oB02
3HHTB 3QYHB 4L6V5 2ZPEB 2ZPBB 1IREB 1JB0E 4Y28E 3VYHB 3VYGA 2DD5A 2ZPGB 3A8HB 1V29B 2DXBB 2AHJB 2ZPFB 2QDYB 2PUOB 1GXIE 1UGRB 2DPPB 1PSFA 2CZ1B 2ZPHB 2PVOB 2CZ0B 2CYZB 2WSEE 2PVGB 2ZZDA 4RKUE 2CZ6B 3WVEB 2ZPIB 4OB0B 3QYGB 3A8GB 3WVDB 3X28B 1PSEA 2DD4A 3LW5E 4ZGEB 5L8RE 4OB3B 2PU9B 2DXCB 3A8OB 3VYGB 3X20B 3QZ9B 3A8MB 1QP3A 2PVDB 4OB2B 4ZGDB 4FM4B 4ZGJB 2ZCFB 2WSFE 2CZ7B 2DXBA 4KT0E 3X24B 1UGPB 1UGQB 1UGSB 1AHJB 1DJ7B 3QXEB 2ZZDB 2O01E 4XK8E 3X26B 2DXCA 2WSCE 2DD5B 3A8LB 1QP2A 2D0QB 2DD4B 2PUKB 3QZ5B 4OB1B 3X25B
chains in the Genus database with same CATH superfamily
3C94A 2JTFA 2EBPA 3RBBB 1VQ4A 3SDZA 3M59A 4JZ3A 1H3HA 2AIRB 4D6WA 2C5NB 4CFWB 1IGUA 2QEXQ 2VKNA 2R7GA 2RI5A 2OTJA 1ZUYA 1FMVA 3MKDA 4QKUA 1U06A 4BCPB 3FIFA 2DKGA 3MEVA 2DTHA 2RI3A 4DOVA 1MMNA 3F70A 2KR6A 5GAOq 1GRIA 1R0BG 2QQRA 5GAMh 1GXIE 5FU6C 2DRKA 4NOYA 3I56Q 4YOSA 4AI6A 1URCB 3CCMT 1AWOA 4J83A 5IHIA 1Z9ZA 3GOXA 4F7UE 5GAN2 2BE9B 1Y96B 1ZSZC 3JAME 2MMPA 2YUNA 3SEMA 3HPWA 1WJQA 2EYQA 4O5VA 3QYGB 5A2QE 3SWNC 4RODA 1SRMA 4A4GA 1YIJA 2QK0A 4LXCA 5EJCA 5IT9E 2C5XB 1WI7A 3GTMS 4OB3B 2EIFA 3DB3A 3LGFA 1VA7A 4OMQA 1PNJA 5GMKm 5A0DA 2HZYA 4IUPA 2EGCA 3OYLA 1VQ9Q 2X4WA 2FRYA 2QGFB 2EUFA 3PT9A 2KI7A 3BLHB 4BBSM 2FO0A 3SB2A 1UTIA 1UEBA 3RNJA 1OKVB 2FG0A 4AKIA 4CRLB 2DXBA 2XI9A 2EQJA 1WXUA 1OX8A 4RTVA 2RQUA 1VQ4T 4F7UA 4EOJB 2WEVB 3S3MA 4ZTFA 1BBZA 1X6BA 2HL3A 1KIKA 4EMKC 3FLGA 1VOMA 4TTHA 5CYIB 3GNGA 1KXUA 3THKA 2EYYA 3UPUA 3QHSA 3OYYA 5I2SA 3VS2A 3EGXB 1X2QA 2RB6A 2GNCA 1M2VB 3MEAA 4DBHA 1NPPA 4EPCA 4NSTB 5CKHA 1KQ1A 4HLQA 3CC4T 5LJ3d 1TUGB 2BPMB 2LQ8A 4PFPA 4J9CA 1VYWB 2UZBB 1M5Q1 2BZXA 1YI2A 3RIRA 2EYXA 3JB9G 2DIQA 2GGRA 1VIFA 2J6FA 2RJDA 2JZ2A 2O4XB 2KEAA 2V8IA 2YUOA 1GL5A 3QWLA 2E41A 2YRVA 4KRDB 1BIAA 2EYZA 2FZKB 5GAMg 1GH6B 2W99A 3JB9H 3CBMA 4I3ZB 2EJ9A 2CH4A 1QVGS 4C92D 5LJ3g 4MMKA 2ED1A 3SHWA 4OGCA 1SG5A 4PJLA 5CK9A 1RAHB 3QDRB 4M78E 2F69A 4UN0A 1WPYA 4JJBA 3OYJA 1VQNA 3CCVQ 3OA6A 3X28B 1W98B 3QG1A 3TN8B 2XU8A 1J3TA 2HL5C 2ABLA 3QO3A 2HQEA 4F70B 5HVYB 2CP0A 4EOSB 1VYUA 5LJ5e 4OF1A 3QJYA 1XO2A 2WIHB 2KGTA 3LX7A 2WFYB 3MIAB 3O8VA 3GPLA 5CVIA 2DRMA 4J7FA 3A8OB 4AFZC 4M78D 4M77B 1W1FA 2V22B 3FEOA 2DAQA 2PZ1A 3M03A 1BI0A 2OTLA 4C0GA 1Q86C 1Q86U 4C92B 4QSHA 2C5VB 2K5FA 1VQ8Q 1ZBJA 4M78A 4J7IA 3MJXA 1UECA 1RL2A 4BCFB 5IDNB 2J05A 2WHBB 3UA7A 1NE8A 1AD6A 3HRTA 1YI2T 3EG2A 2DFUA 2RHUA 5KYXA 1JOWA 3CXCS 4C0FA 4MMLA 4MZTA 3OSVA 2F5KA 3NHNA 3JCMe 3MEUA 3I56T 3QYHB 2CKKA 3E9FA 3CD6Q 3OYHA 5LJ5f 2C06A 3VV0A 3L2RA 1SEMA 1KD1U 1KD1C 1H26B 2HAXA 2FZGB 3LQ5B 4Y28E 2QGGA 4AFUC 3JCMP 3M4GA 3CMAQ 3PE0A 5FRMA 1PRLC 2SEMA 1OPKA 1BCOA 2CH4W 1V29B 2E6ZA 1VQNT 4M77F 3S3NA 2RQWA 1P5EB 1ACMB 2KNBB 2CSQA 1UNGD 3OW2A 1JKWA 3RESA 2E4HA 4F14A 2EJFA 2HBWA 3EHQA 4EOMB 4OMFB 5KYWA 2ENMA 1M90R 1G3WA 2NUTA 4EDUA 2BZ8A 4BY6C 1C6VX 1KQSP 3CQTA 4IUTA 2C4GB 1WGSA 3K7AM 4KH1B 5I2MA 2W10A 2OTLT 3CBPA 1GCPA 1PKSA 1RABB 5C6SA 1KJWA 1M9SA 1OL1B 1TOVA 3CBOA 1PKDB 2KBTA 5LJ5h 1O9SA 5KH6A 4BCQD 2UZEB 1Y71A 1RLPC 4JRKA 2KY9A 2NUZA 2JMCA 3TQ7P 1GCQA 2EAYA 1X01A 4E7SA 5EC7A 1OEBA 2YRDA 2K9GA 2DMOA 2M1HA 1AWXA 2RHZA 2ED0A 4MFEA 3Q1JA 4M78C 2YSQA 2LJ1A 3M58A 4PJOG 1NEGA 3C0CA 4XK8E 2KDSA 4A4HA 2KMTA 2WSCE 1TD6A 1Q82U 1Q82C 3QJ6A 4M4ZA 1MMDA 2DD4B 2CP2A 2F5TX 4OB1B 3J80E 4WF2A 3CC7A 1ZP2A 3QWXX 1RAEB 1U5SA 1W70A 3NGPA 1I8FA 4OMPA 1FMWA 3JCMh 1NYGA 4PJOF 2ZPEB 4BY7X 1M3AA 4KGXB 1GFDA 3M0QA 2RD1A 3VKIA 1JJ2A 2LT1A 1YBYA 1YCYA 4FYWB 3VYHB 1RAAB 1WJRA 4DEYA 5M9OA 2QXFA 2FZCB 5CQXA 2ZPFB 1TUDA 5A0GA 5FWBA 1M3CA 1OOTA 4M6VA 4IUQA 2M0YA 4EMHA 1K8AU 1K8AC 1WLPB 2EKHA 3OMGA 4XTXA 3EH2A 4LE9A 5KYUA 4E7JA 2CZ6B 3CCSQ 1NG2A 1GFCA 1LCKA 4ZN1A 4HCCA 2KXCA 4RTTA 1GUXA 4XU0A 1E7OA 5GANh 1YJNQ 1ENWA 1LVKA 2JOYA 4DBQA 5LJ5g 3CCEA 2DBMA 2JTEA 2P0PA 3RKYA 2A3LA 3A8MB 3HFNA 3QYBA 2EYWA 2RMOA 4FM4B 3OYAA 2YT6A 4ZGJB 5HY6A 2YRCA 4JS4A 4M7DE 4J6XA 3LH0A 4BCNB 3I55A 3PIPA 2GBQA 3TVTA 5ECAA 3LYIA 2LNVA 1I5LA 4M75B 2PK2A 3G4SA 2G77A 4Y91A 3WXMB 3M57A 2IW8B 4OMOA 3I35A 1UDLA 1JXOA 3OYEA 3CCMQ 4E47A 2L3SA 3VS6A 2KYMA 3R6NA 1U8RA 3GNFB 2QYZA 2RI2A 3PVQA 1O9KB 2EGAA 1OIYB 2HQXA 2JT4A 3KBGA 4N4GA 2V26A 2AKLA 1QVFA 2F2CA 3L2QA 2W96A 3CPWP 3MCAB 4OP0A 4J9DA 1RAGB 1K9AA 1NLOC 4AG1C 4M7DA 3JB9I 1LOJA 3OBWA 2LX7A 4M7AE 5GJWB 2DD5A 3A8HB 5CIUA 2HMAA 4OMLA 4GBQA 1PG5B 3M0RA 3OYKA 1NJIU 1NJIC 4CFUD 5HBEB 1IRXA 1D0ZA 4NS5A 2LJ3A 4RTYA 1VQ4Q 3T9NA 1QWEA 4RKUE 2MF2A 3MP6A 4QVCA 1VQLA 3WVEB 5FU7C 3OYBA 4EONB 2OTJQ 3BG9A 1YFNA 1W2BA 3VUZA 5IHYA 1M1KR 1UFFA 2M16A 4M7DG 4BCMB 1I07A 4JLIA 4BCIB 2E1HA 2F1LA 2MCNA 2O9SA 1JSUB 3KHIA 5KYYB 4EIKA 3BLRB 2ECZA 2DF6A 4DA4A 4KRTA 5LJ3e 4M7AA 4B6MA 4LDYA 4C0DC 5IF1B 3DLMA 1V76A 2J6OA 1EIFA 2V1QA 2KR3A 3UDCA 1ZSZA 4BCGB 4HCBA 2MAMA 1D09B 1JRIA 4KT0E 5FU6B 2A36A 2RJCA 2FRWA 2RPNA 1YIJQ 3QXEB 2L0AA 4LDWA 3VJPA 4R0KA 1VQOQ 3X26B 1S72A 3C4SA 1I0CA 1KQ2A 1X27A 4ELYC 4FT4A 1K9MU 1K9MC 2JMAA 3BW1A 4F7SB 3FJPA 2E10A 2BTTA 2YWWA 3SWNB 2M51A 5ACBA 2D1XA 2G3RA 2LNHB 2Y4XA 1KK7A 2CCIB 1G8XA 2IVXA 1D0XA 2RF0A 3E1SA 4FL6A 4FW1A 4C8QB 4ZTJA 3MEWA 1BB9A 5LJ3f 3H4CA 4M7DC 2V8KA 5CCAA 3EGDB 4ROEA 3BFMA 5KE3A 2K57A 2GQIA 3PGGA 1VQLT 2L5QA 2BS2A 1M1FA 3OS5A 2XD0A 3OYMA 2JM9A 5EFQB 3M4YA 4CI0C 2L3RA 3RGFB 1MV0B 1M27C 3URGA 4EOPB 1PCXA 4J9BA 2P4TA 2K2VA 4ELZC 4EMKB 2CZ0B 1LJOA 2C0IA 1JBMA 4PL6A 2CDTA 1K73U 1K73C 1O75A 1YJWA 4PJNA 2NYSA 1OKWB 1YI2Q 3SFMA 3WVDB 4HNTA 2LW4A 1U1TA 1TUCA 2K3BA 4M7AC 1MNDA 3META 2DXCB 2FL7A 1NBEB 1IB8A 3VS7A 5LJ3h 2D6FA 5KE2A 5DM7R 2LP5A 4C8QF 3QZ9B 2OX7A 1H1PB 3PNWC 2C5OB 1X2KA 4C0ZA 1OX9A 2DL5A 2RHIA 2F2VA 2FPDA 2X51A 1HSQA 1ZSGA 3DTOA 2AT1B 3OYFA 3CMEA 2SRCA 1VQNQ 3F5XB 4JRQA 1VQOA 1Q81R 3JSCA 3JB9D 2P0KA 1KC8U 1KC8C 1X6GA 1SRLA 4C5IA 1GBQA 2L3PA 1V1CA 5GAN8 2FVUA 4X9DA 5IXBA 3MP1A 1VQ7A 5IHKA 4IUVA 3G7ZA 2OTLQ 2VXFA 3DL1A 1K4US 2CUDA 1VQKA 1WDXA 4AKGA 2W2HA 1E7PA 2JGZB 3UA6A 1YP5A 1ZX6A 1QVGP 1HXDA 2OTJT 3EG9A 1U1SA 5GAN4 1YNZA 5D6YA 3PMTA 1FKMA 3UATA 2HD0A 2E5QA 4CC2A 2DXBB 3CCLA 3EGXA 4F7UB 5FW9A 5GAOm 2BS3A 3GF5A 2X4JA 2WPAB 2EVRA 2EGEA 2CP3A 2OJ2A 1G83A 5CR2A 2KE9A 5HK0A 1EZZB 3NDQA 2CYZB 3OYIA 5IH2A 1KSWA 4NC6A 3VRYA 8AT1B 1YHQA 3OYDA 1RUWA 3VS4A 2X35A 3ME9A 4GY5A 1MNEA 3EFSA 1PSEA 4VUBA 4M77E 3CEYA 4UC4A 3M5AA 2PMIB 3CMET 2DL8A 1YIJT 1D3BB 2K7AA 1VQOT 4HKEA 4F6WB 2VUBA 1JU5C 2AKKA 2IIMA 1D3UB 1KFZA 3QUIA 3TSZA 3GLXA 2FB7A 1WQ7A 4FU6A 2H8HA 4OR5B 4JUVA 2VASA 4C5GA 1UNHD 4J9GA 3CXCP 2ZCFB 1VQ7T 2KRSA 3M0SA 1H1SB 4DBRA 2F2WA 1VQKT 3ULRB 3BLQB 1BI2A 2XKOC 4PFZA 4RCCA 4ORZA 4F16A 3REAB 1F1BB 3NPFA 2CSIA 4M77A 5D6XA 1VQ5A 2CP5A 1AZGB 3FDRA 4AFSC 4RUGA 2DERA 2WMAB 1XQHA 5HNBB 1WHMA 1FVVB 2KXDA 1JQQA 1NEBA 2UZDB 2DYIA 2J7IA 2QF7A 3QKJA 1N4MA 3QPHA 2W9ZA 2JTMA 4ELLA 4BE0A 4FYXB 1MV3A 2KMGA 2BE7D 3V8KA 3JCMX 2CGHA 2YLCA 3H0FA 1YHQT 1UJ0A 4OMMA 4F6SB 5CKDA 1Y0MA 1OL2B 2DTIA 1D1CA 5L23A 1X43A 3OBYA 4M77G 4M78B 3CCQA 3HFOA 3CCUA 3CC7Q 2FHDA 4PJOE 2DPPB 1PSFA 3N5BB 1R8OB 5ICPB 1P92A 2EFIA 3OS1A 1IHWA 3E19A 1SKUB 2I0NA 4KH0B 4C92G 2ZZDA 3EG3A 3OSSC 1S1NA 4GLMA 3UT1A 3DKMA 4DBFA 4IMYB 4FX3B 2KK4A 2W9FA 2ZAEA 1VQMA 4JZ4A 4RMOA 1OPLA 4HVWA 3GIBA 4LDUA 4PJOD 1AVZC 2JS2A 2P4RA 3HO8A 1OULA 2PNIA 1OI1A 4TVRA 4C92F 4IIMA 3JCMc 4KRCB 4N4HA 3MO8A 4FW2A 2WACA 4OB2B 1JXMA 1VQ5T 1XTDA 4PJOA 1K1ZA 4CC3A 3EJ1B 2JJ9A 1B34A 5KYWB 3OW2S 1XNIA 5FWCA 2IW6B 3GP8A 2NUTB 1SSFA 4Z88A 1RI9A 2CJMB 2Y4YA 2QFZA 4HVVA 4M77C 3CCEQ 2KT1A 3LH5A 3NMZC 4BDYA 3HRSA 2DZCA 2K5LA 5HK3A 4BXXX 2JW4A 2DX1A 1UG1A 1UGVA 2LMJA 4A4FA 2L3QA 3CCRA 2RHXA 3FB9A 5KCOA 3REBB 3CCUT 3I55Q 1KQSA 3I9QA 5AT1B 3QDFA 4A4KA 5GAOl 3G4SQ 3O0GD 2B9RA 4HA8A 4CFNB 4J9IA 5DLQE 2VB6A 4BBRM 4XU1A 2MWOA 4BCQB 2QDYB 2B8AA 2XHCA 1K0SA 3P8BB 4DEXA 1UGRB 1NZ9A 4RG2A 5FGKB 1OU8A 3VS1A 1Q7YR 4C5EA 2BIVA 4BCOB 1T0HA 2GTJA 1NYFA 5IDPB 3V8LA 4EOIB 4F04B 1AZEA 1YJ9Q 4RTXA 2EQMA 1H25B 5GMKi 5GAN3 4F17A 3JCMV 1TH7A 3S3OA 4AMCA 3L1AA 4FCYA 5KYNA 2B86A 4ZNXA 3CCJA 2ESWA 3BHUB 3DB4A 3V7RA 1ZUKA 5HBJB 2X1NB 1OQKA 1QCOA 4OGEA 5GANj 4BI3A 2PK9B 2HDAA 4K11A 2D8JA 4JJNK 1JJ2S 2DBKA 3L2VA 1H8KA 2ROLA 5DQWA 4KUIA 4XTVA 1FYNA 3OQ5A 4JDSA 3G71Q 1K76A 3E2UA 4ATOA 4PJOC 1PD1A 2DJZA 3JCMW 1VQLQ 3MPUB 1IHVA 2QDJA 2E6NA 1ZA1B 1CKAA 5FLXE 4PK4A 4PKCC 4XQ3A 1N8RR 3NTKA 5FU7B 2O88A 1GUXB 2NUPA 3HP9A 2K4YA 1WHKA 2KROA 3J7AF 5CKEA 1M1GA 4BDZA 1R77A 3CC7T 1SHFA 5A0LA 1AOJA 1OU9A 5LMKB 5J3BA 4E7ZA 3OS0A 2EJGA 5GJVB 2JVVA 4QVZA 1YCSB 4EOOB 2QQAA 3C95A 2KT8A 1IREB 1PC0A 1K0XA 1VQ6A 1SHGA 4F7NB 4MIMA 2NLUA 4M7DD 1FWZA 3EH1A 1S72Q 2JS0A 5IXFA 2PTKA 2RQTA 2L89A 2L8DA 1UB4A 2AHJB 1F5QB 1M90U 1M90C 3CCJT 1B7TA 1O9KA 2G6FX 3EG0A 3SD4A 3H9NA 4PFOA 2LX9A 2DEUA 2BS4A 4PJMA 2VVKA 4X9CA 3BHTB 5GMKj 4LOCA 1YJ9A 2PVOB 1WFWA 2OAWA 3H0HA 3EFOB 2COYA 4F6UB 3G33B 1BI3A 3QWYA 1HD3A 1OGUB 2EKOA 1MGQA 4BE1A 4N0AA 4M75G 3M9QA 4IURA 4JX5A 2QI2A 4MZPA 5C0MA 2DXTA 2PJQA 1QVFS 2GF7A 3A5ZB 4O6JA 1VYTA 3HTRA 4XTWA 4A54A 3CCET 2DXUA 2IPOB 1MUZA 3G71A 4M7AD 1VINA 3BDUA 3CC2A 1Y57A 3UWNA 1FX7A 3KXTA 1HK9A 4M75F 1UE9A 5I22A 3HZJA 1IO6A 3DDPB 1YJWQ 2CS7A 2CZ7B 2LCSA 3CPWA 1VQPA 3I55T 4X34A 3M55A 2YUPA 4JS5A 3P8HA 2O01E 3G4ST 2MK5A 2RJFA 2BUDA 4Z02A 4C8QE 3H8ZA 1BKBA 3A8LB 1VQ6T 1QP2A 4CFUB 1N5ZA 2LQNA 2PUKB 4PJJA 1UUEA 4FIBA 1W2BS 3I5RA 3DDQB 4BE2A 2RA2A 3NFCA 5IAYA 4J9HA 3U23A 1BIBA 2LQKA 3L2ZA 1QKWA 3P8DA 3CMEQ 2EWNA 2QA4A 1YJ9T 2O31A 5LL6S 2CCHB 2AZVA 3PO3S 1ZSZB 3VYGA 1QLYA 3BE3A 5CAIA 1WZOA 2M0OA 3G6EA 4LN2A 2AZSA 2KQWA 1X6OA 3QHWB 2A28A 1G3TA 1VQ7Q 2KSSA 4C8QA 1VQKQ 4D8DA 3G71T 3CC2T 1UHCA 2E70A 2XK0A 3S6WA 2IW9B 2DVEA 2O9VA 4N0AC 4RTWA 2MYSA 4J8OA 3MY5B 1QCNA 1WXBA 3LW5E 1VQPT 4HCKA 3CCLQ 1BU2A 1TSFA 1WHLA 2DO3A 1MMAA 4OVAA 5AYFA 4JJDA 2MI6A 1AWWA 3JCMb 4JRIA 2LZ6B 5GAMj 1IZ6A 2CT4A 4EOLB 1E6HA 1JSTB 1YWPA 4Z6YA 2C0TA 1T3SA 4C8QG 2UUEB 1AT1B 1BI1A 2DL4A 2RN8A 4A53A 1YHQQ 3X24B 2D8HA 1E9HB 3KFVA 3R6OA 1Q86R 2PHGA 3V7SA 3BY7A 2WXVB 4XU2A 2QA4T 2DXCA 2YHTA 3TSWA 2RHYA 1S72T 4QQGA 4CRIA 1G3YA 2X4XA 1Q95G 1QKXA 1AWJA 1M30A 4Z8AA 1TXQA 2FPEA 5L2WB 2RQVA 1QQJA 1UHFA 2LCCA 9ATCB 1Y96A 5D7UA 1JO8A 3G6ET 3MHXA 3CC4A 1OV3A 1PRMC 1OI9B 5DLOA 2ZPBB 1QWFA 2D9TA 3TW7A 4BCKB 1I5OB 4ZN3A 1MMGA 2K5IA 5D6WA 3ZBDA 2RK1A 2ZPGB 1HYOA 3QIIA 3PVLA 1KD1R 3M0PA 1TG0A 4CFVB 2X4YA 4F7JB 2R5AA 3M53A 4HT9A 1VOLA 2VYTA 1VQ5Q 2VGMA 3ASKA 4EC9B 2GTOA 1VIEA 8ATCB 1A0NB 2HQHA 1OZ2A 4DQ2A 4L59A 4C8QC 4CC7A 2J6KA 3EGUA 2DETA 5HCKA 5GAN6 4BD3A 1M1KC 1M1KU 2V8JA 3ER0A 2G9XB 2WJ9A 1YJWT 5BNJB 4YOOA 3EG1A 2R57A 3L2WA 3ZEHA 2E3IA 4V2SA 4AKHA 1E6GA 1M2VA 4Y92A 5DY9A 5L8RE 4F7LB 1NM7A 3QHRB 3EG9B 3CCQQ 3CCUQ 3H41A 1WIEA 3EOCB 2K2MA 3DLLA 1ABOA 6AT1B 2LT4A 4HL4A 4ZGDB 1C1AA 1WHGA 2DNUA 1H4LD 2O2OA 2HKNA 1B3QA 5GAMd 4YOZA 2O4XA 4ELJA 4NL3A 4HCZA 2QEXA 1G3NC 2I53A 1ZQ1A 4LDVA 4FYVB 1UGSB 1VQMQ 1TTHB 1QVGA 1B07A 1D3BA 1H1RB 4JJCA 4EMGA 4OGRB 3VUBA 4EOKB 4C92E 2QQ9A 2EQKA 4F7UG 4BACA 2JN0A 2QASA 1EX4A 4RTZA 3RR6A 2D0QB 4M77D 4BCHB 3KUFA 4LNPA 3JRZA 2QTXA 3I56A 1Q82R 1W4SA 1SF9A 3MP8A 1YWOA 1QMZB 2DA9A 3JB9F 4BY6B 2M02A 1JB0E 4F7UF 2FEIA 4KULA 3JCMQ 3FJ5A 1RAFB 3LWHA 1WJSA 1FINB 1WYXA 1RADB 4JRPA 4NL2A 3CCLT 2HSPA 2P84A 3NTHA 4II1A 1OZ3A 2XICA 4IUUA 4XTUA 3V8JA 4C92A 2PUOB 4E6RA 2J06A 1VQ9A 1N6AA 2GFAA 2JXBA 4CC4B 4QQDA 2CZ1B 3CCRQ 2DZ9A 1QVPA 4MDXA 2DL3A 1D1AA 2E12A 1M4ZA 2A37A 1H92A 2ZPIB 3EFRA 3PMIA 4JLGA 3CXCA 2CP7A 1K8AR 2LCLA 1VYVA 3LWIA 2YLBA 3RERA 2Z0WA 2NWMA 4HVUA 2DEQA 4FT2A 3TNHB 2QEXT 1QMCA 3G1JA 3DOGB 1CKBA 3OW2P 2M9UA 1WNLA 3QBYA 3VRZA 4BI4A 3EIDB 4IIOA 1TU0B 1D0YA 5KYXB 2DYBA 3VS5A 2KRMA 2R5MA 3E9GA 4FYYB 1ABQA 4LDXA 3FRNA 3OMCA 1Q81U 4CFXB 1Q81C 2CP6A 4KBMB 2XDBA 5HQ0B 5DQVA 4WCIA 5EG2A 2HCKA 2QQ8A 3L42A 3CCJQ 2ZZDB 4RG8A 4E7IA 2KAFA 2DE0X 4LD6A 1M8MA 2QG9B 1M3BA 1IXDA 3AT1B 1R0CB 4J6WA 4M78G 5LJ5j 2QGSA 4MFDA 4HNUA 1MHNA 1TFBA 3MY1B 1SSHA 5FRNA 1BCMA 1IGQA 2LC4A 2I40B 1LPLA 3M0TA 4FSSA 4WTOB 3BDLA 4EC8B 4P5NA 1PHTA 4B9XA 1KHIA 2EW3A 4E2FB 1VQ9T 4BB7A 3ZL7C 2X3WD 2ROTA 4AT1B 4II5B 4X1VA 2VC8A 5CO7A 1PWTA 2H3JA 3CCVA 5I5ZB 3M0UA 4M78F 4Y72B 4PJOB 4J5YA 1PM3A 3AHUA 2QQSA 5GANe 1B34B 1YITQ 2GQVA 5GMKl 4DOWA 2C0OA 4GLKA 2COZA 3PFSA 1RI0A 4B9WA 4C92C 3JCMf 4A4EA 1BYMA 1Y7XA 1C9BA 2I2LA 2EQUA 4ANJA 1X75C 4JPBW 1XOVA 3CCQT 3RDVA 1VUBA 1EFNA 2Y90A 4QT7A 2ZPHB 4HNVA 4KGZB 1C0MA 3H0IA 1NJIR 2VWFA 1ZA2B 1JJ2P 3TNWB 3VKHA 3TU4K 3A1PA 3TNIB 2UZLB 3QYEA 1VQ8A 1VQ6Q 2A7YA 2CT3A 3BG5A 2WMBB 2LRQA 1VQMT 2DD4A 1NLPC 1CSKA 2A08A 2XG8D 3JB9J 5J26A 5GAOp 1Z9QA 4Q5WA 2RM4A 2XDDA 2RNAA 4IKFA 1KQSS 3HSBA 3IQLA 2X3XD 4J9FA 4ROCA 3PTAA 4JX6A 4YTLA 3OYCA 1QP3A 1FMKA 1XJWB 3VU3C 2IG0A 2VXEA 4BUGA 5GANf 4J6YA 5I21A 5IHNA 3CD6A 3LGLA 1TWBA 5GAOn 2WSFE 3PIOA 2IN3A 1GY3B 2HBPA 2K79A 4D8KA 5CQYA 3CPFA 4XU3A 1JEGA 2YUQA 3VS3A 3CMAA 3NTIA 2LTOA 2YDLA 3CCVT 2HEQA 3M54A 3RUXA 4AG2C 2RJEA 5GMKe 4ESRA 4G6LB 1WX6A 4M75E 2K3YA 4QW2A 3CC2Q 2LVMA 1I81A 2MIOA 1K9MR 1AISB 5FROA 1AD5A 2MWPA 5LJ5d 1ARKA 4L6V5 1RACB 3CCRT 2V1RA 2IVWA 4BCND 3OS2A 1VQPQ 2DVJA 5KYUB 2LJ0A 1N27A 3HBLA 2H3EB 2KVQG 3TCJA 4M75D 1ZBXA 1YITA 5HBHB 3MI9B 3VKGA 2FYKA 1H3ZA 1VQ8T 2FPFA 2OI3A 5KCHA 2MPXC 3HB9A 3LLRA 3DJBA 5GAOr 5J39A 3H6ZA 2RH2A 2RO0A 5LQFB 3RKWA 1I1JA 1QVFP 5CKBA 4BY1X 1WHHA 2WSEE 4C0DB 3HL8A 3J81E 2PVGB 1H641 1ZHIA 2NUPB 4J9EA 4M75A 1GCQC 2DM1A 1H28B 4MDWA 4XTYA 1I4K1 2R58A 2QA4Q 2BZYA 3O5ZA 1H1QB 1NPRA 3A8GB 2A0FB 2QDLA 3C12A 3CD6T 3JCMd 1Y07A 2HNIA 3GBQA 3OYNA 1K73R 1HJDA 1N9SA 1U3OA 1ZLMA 2KYBA 2JUFA 3L2UA 3V7CA 3G6EQ 2LDMA 1M2OA 4XTZA 3RKXA 4A63B 4C5HA 4LD9K 2BKDN 1T0JA 2CUBA 3CMAT 3INZA 1QW1A 3EHRA 2XIDA 2DJQA 4E7KA 3X20B 2E5KA 4RTUA 2DL7A 1G5VA 1KHCA 4R56A 2PVDB 3RMSA 1UJYA 1WHJA 3EFOA 3JV3A 2F2XA 4CFMB 2MOXA 3HKSA 2OAUA 2P0QA 3A98A 1YN8A 4E7HA 2E3HA 1D1BA 2GCXA 4KUDK 4EOQB 3BG3A 2PQWA 3JCMg 1W2BP 3TW6A 2E64A 4PLLA 1H27B 1DJ7B 4LUDA 2DILA 2HSEB 4BCMD 4M7DB 3EAEA 4KGVB 5GAN7 2C6TB 4YC3B 2DD5B 4ME7A 3VS0A 1TS9A 1WQWA 4QVDA 5GAN5 1YITT 4HT8A 2JM8A 1BK2A 2HKQB 2KRNA 2XDPA 5GANd 3QZ5B 1ZUUA 1W6XA 2QQBA 5GMKh 3X25B 1KC8R 2EPDA 3HHTB 1T3LA 2X9HA 2DK3A 2K3XA 5IN1A 4R55A 2VGNA 3TREA 4AFQC 4XAXB 1H24B 5KYYA 2ATCB 3CCSA 3BHVB 2DTOA 2W0ZA 1GBRA 4N4IA 4MZMA 3M56A 5HKCA 1YJNA 3TEEA 5GANg 2K6DA 1KG1A 2DIGA 1Q7YU 1Q7YC 4LUEA 2E65A 5GAMe 2JNGA 2RQRA 1G2BA 3HRUA 3CPWS 4M7AB 7AT1B 1QLBA 2QAZA 4Z89A 1QCFA 1UNLD 2QTVA 3CC4Q 3JCMJ 4M75C 4C8QD 1SPKA 3D7SB 1PD0A 1BU1A 3RMQA 1AEYA 1X69A 4PNOA 3OYGA 4M7DF 4OB0B 3UF4A 4OMNA 2D0NA 3SWNA 3OB9A 4QQ6A 3ZFJA 2CREA 4ZGEB 1OIUB 3POMA 2L2PA 4RCBA 2DMEA 2PU9B 1N9RA 3CCMA 2RK2A 2DLPA 3VYGB 3FC3A 1G3SA 4BI8B 4M7AG 2EQIA 1LNXA 2VV5A 2AK5A 4FSXA 3EGDA 2YXYA 1M8VA 1RAIB 4HXJA 4PLIA 2WIPB 1WA7A 5GAMf 4JX4A 2LQWA 1UGPB 1N8RU 1N8RC 1UGQB 5CEIB 1FXXA 1AHJB 2ZGWA 2XMFA 3QSUA 4EORB 3I5SA 4E7LA 5I11A 3CCST 3B57A 4M7AF 4EMKA 5CKFA 1WXTA 1OYXA 4CXAB 2COWA 4L5GA 1PKTA 2BKZB 3OY9A 4BCJB 2GFUA 1YJNT 5LJ3j 1RLQC
chains in the Genus database with same CATH topology
2HQXA 3JRZA 2QTXA 3KBGA 4A4FA 3I56A 4N4GA 3C94A 1W4SA 2JTFA 3CCRA 2RHXA 1QVFA 3FB9A 3MP8A 5KCOA 1VQ4A 3SDZA 3M59A 3CCUT 3L2QA 3MCAB 4OP0A 1KQSA 4D6WA 3CXCA 3JB9F 4BY6B 1JB0E 2RI5A 4M7DA 3JB9I 4F7UF 2OTJA 1LOJA 3OBWA 4A4KA 5GAOl 4KULA 4M7AE 3JCMQ 3FIFA 2DKGA 2DD5A 3MEVA 2DTHA 3LWHA 3A8HB 2RI3A 4HA8A 5CIUA 1WJSA 5DLQE 4DOVA 3F70A 2KR6A 4BBRM 4XU1A 4JRPA 4NL2A 5GAOq 3OYKA 3CCLT 3NTHA 4II1A 1OZ3A 2MWOA 2XHCA 2QDYB 2B8AA 2XICA 4IUUA 4XTUA 3V8JA 4C92A 2PUOB 2QQRA 3P8BB 5GAMh 4NS5A 1NJIU 1NJIC 1UGRB 1NZ9A 4RG2A 1VQ9A 1N6AA 5FU6C 2GFAA 4NOYA 4AI6A 4QQDA 3CCMT 2CZ1B 4J83A 4C5EA 2DZ9A 1QVPA 2BIVA 4MDXA 3CCET 3GOXA 3T9NA 2E12A 1M4ZA 4RKUE 3V8LA 2MF2A 3MP6A 4F7UE 4QVCA 2EQMA 1VQLA 5GAN2 3WVEB 1Y96B 5FU7C 5GMKi 2ZPIB 3EFRA 2MMPA 3PMIA 4JLGA 5GAN3 3HPWA 1WJQA 3JCMV 3BG9A 3OYBA 2EYQA 4O5VA 1W2BA 3QYGB 1TH7A 2LCLA 3VUZA 5A2QE 3SWNC 3S3OA 3L1AA 3LWIA 2YLBA 2M16A 3RERA 4M7DG 4A4GA 3CCJA 1YIJA 4JLIA 3DB4A 2E1HA 5EJCA 2DEQA 4FT2A 3V7RA 2QEXT 5IT9E 3KHIA 4OB3B 2M9UA 1WNLA 2EIFA 4DA4A 5LJ3e 3DB3A 4M7AA 3LGFA 4OGEA 5GANj 4BI3A 3QBYA 5GMKm 5A0DA 4IUPA 3OYLA 4LDYA 4JJNK 4C0DC 3DLMA 4BI4A 1JJ2S 2X4WA 3L2VA 4KUIA 3PT9A 4XTVA 3OQ5A 4JDSA 4BBSM 1EIFA 2R5MA 3E9GA 3SB2A 4ATOA 4PJOC 1UEBA 4LDXA 3UDCA 3FRNA 3OMCA 1Q81U 2DJZA 1Q81C 3JCMW 4KBMB 4HCBA 2XDBA 2MAMA 1JRIA 4AKIA 2DXBA 5EG2A 2XI9A 2EQJA 4KT0E 5FU6B 2QDJA 2RJCA 2E6NA 1VQ4T 2QQ8A 4F7UA 3L42A 3S3MA 3QXEB 4LDWA 2ZZDB 4ZTFA 3VJPA 4RG8A 5FLXE 4E7IA 2KAFA 4PKCC 3X26B 4LD6A 3C4SA 4EMKC 4XQ3A 1S72A 3FLGA 1KQ2A 3GNGA 4ELYC 3NTKA 4FT4A 5FU7B 1K9MU 3BW1A 1K9MC 3UPUA 3FJPA 2E10A 3QHSA 3HP9A 3OYYA 5I2SA 2K4YA 4J6WA 4M78G 3SWNB 5LJ5j 3J7AF 4MFDA 4HNUA 1MHNA 2G3RA 2RB6A 5CKEA 5FRNA 1M1GA 2Y4XA 2LC4A 3MEAA 4BDZA 1NPPA 4EPCA 3CC7T 5A0LA 5CKHA 3E1SA 4FL6A 4C8QB 4ZTJA 1KQ1A 4HLQA 3BDLA 4P5NA 4B9XA 5J3BA 3CC4T 1KHIA 5LJ3d 1VQ9T 2LQ8A 4BB7A 3MEWA 3OS0A 2EJGA 2JVVA 4QVZA 5LJ3f 3H4CA 4M7DC 2VC8A 2QQAA 3C95A 5CO7A 1IREB 2V8KA 1M5Q1 5CCAA 1YI2A 2H3JA 3CCVA 3RIRA 4M78F 3JB9G 2DIQA 1VQ6A 4MIMA 2NLUA 3BFMA 4J5YA 2K57A 1VIFA 3PGGA 2RJDA 5KE3A 1VQLT 1FWZA 3AHUA 2QQSA 2JZ2A 2L5QA 5GANe 2BS2A 2O4XB 1M1FA 1B34B 3OS5A 2XD0A 2V8IA 2GQVA 2L89A 2L8DA 4DOWA 5GMKl 3OYMA 4GLKA 1UB4A 3M4YA 2AHJB 3PFSA 1M90U 3QWLA 1RI0A 2E41A 2YRVA 3JCMf 4B9WA 1BIAA 4A4EA 4C92C 2L3RA 4CI0C 3CCJT 5GAMg 1BYMA 1Y7XA 3URGA 3SD4A 2I2LA 2EQUA 2LX9A 1X75C 3CBMA 3JB9H 1XOVA 3CCQT 2BS4A 2EJ9A 2P4TA 2K2VA 4C92D 5LJ3g 4MMKA 1QVGS 4X9CA 1VUBA 2Y90A 4ELZC 4EMKB 4LOCA 5GMKj 2ZPHB 2PVOB 1YJ9A 2CZ0B 4HNVA 1LJOA 4OGCA 5CK9A 1JBMA 4PL6A 3QDRB 1BI3A 4M78E 1K73U 1K73C 1O75A 1YJWA 2F69A 1WPYA 2EKOA 1MGQA 3OYJA 3VKHA 3TU4K 3SFMA 3WVDB 3OA6A 3X28B 3QYEA 4BE1A 3QG1A 1VQ8A 4N0AA 4HNTA 2A7YA 4M75G 3BG5A 2XU8A 3M9QA 4JX5A 1U1TA 2LRQA 2QI2A 2DD4A 4IURA 1VQMT 4MZPA 3QO3A 5C0MA 2DXTA 2HQEA 1QVFS 2XG8D 2GF7A 3A5ZB 4O6JA 5J26A 3JB9J 5LJ5e 4M7AC 4OF1A 5GAOp 3META 3QJYA 4Q5WA 2DXCB 2RM4A 3O8VA 2FL7A 3LX7A 2XDDA 1KQSS 4IKFA 3GPLA 2D6FA 5CVIA 5LJ3h 3PTAA 4J7FA 4XTWA 3A8OB 2DXUA 4M78D 4A54A 5KE2A 4M77B 4JX6A 5DM7R 3G71A 4YTLA 4M7AD 3OYCA 4C8QF 3QZ9B 1QP3A 3BDUA 3CC2A 3PNWC 3VU3C 3FEOA 2DAQA 3UWNA 1FX7A 2IG0A 3KXTA 1HK9A 1BI0A 2VXEA 4C0ZA 4M75F 4BUGA 2RHIA 5GANf 4J6YA 2OTLA 3HZJA 5I21A 4C0GA 1Q86C 1Q86U 3LGLA 4C92B 4QSHA 3CD6A 5GAOn 2WSFE 3OYFA 2CS7A 2CZ7B 3PIOA 3CMEA 2HBPA 2K5FA 3CPWA 1VQPA 5CQYA 4X34A 3I55T 3M55A 3CPFA 4JRQA 1VQOA 4PJOB 4XU3A 3JSCA 4M78A 3JB9D 4J7IA 4JS5A 3P8HA 1RL2A 3CMAA 2O01E 3NTIA 3G4ST 2P0KA 1NE8A 1KC8U 1KC8C 2LTOA 3HRTA 2RJFA 1YI2T 2BUDA 4Z02A 3CCVT 3M54A 4C5IA 3H8ZA 1BKBA 3A8LB 3RUXA 4C8QE 1VQ6T 1QP2A 2RHUA 2RJEA 3CXCS 4C0FA 5GMKe 2PUKB 4MMLA 5GAN8 2FVUA 4FIBA 4M75E 2K3YA 4QW2A 4X9DA 4MZTA 1W2BS 2LVMA 3MP1A 4BE2A 1I81A 2RA2A 3OSVA 1VQ7A 2F5KA 3NFCA 3JCMe 3MEUA 5FROA 4IUVA 5IAYA 2MWPA 3G7ZA 3QYHB 2CKKA 5LJ5d 2VXFA 3E9FA 3DL1A 3I56T 1M90C 4L6V5 1VQKA 1BIBA 3OYHA 3CCRT 4AKGA 5LJ5f 2C06A 2LQKA 2IVWA 3L2ZA 3VV0A 3P8DA 3OS2A 3L2RA 1E7PA 1KD1U 2EWNA 1KD1C 2QA4A 1YJ9T 1N27A 2HAXA 5LL6S 1HXDA 3HBLA 4Y28E 2OTJT 3JCMP 1YITA 2KVQG 3M4GA 4M75D 1ZBXA 1U1SA 3TCJA 3VYGA 5GAN4 5FRMA 4M7DD 3VKGA 5D6YA 3PMTA 1FKMA 2HD0A 5CAIA 2E5QA 1V29B 2E6ZA 2DXBB 2FYKA 3CCLA 4M77F 2M0OA 3S3NA 1VQ8T 1VQNT 1H3ZA 3G6EA 5KCHA 3OW2A 4F7UB 2KQWA 3HB9A 3RESA 5GAOm 2BS3A 1X6OA 2X4JA 3GF5A 3LLRA 5GAOr 2EJFA 1G3TA 5J39A 3H6ZA 2KSSA 2RH2A 2RO0A 4OMFB 4C8QA 3RKWA 5CR2A 5CKBA 5HK0A 1G3WA 4EDUA 2CYZB 2WSEE 4C0DB 3HL8A 3J81E 3OYIA 2PVGB 1H641 1ZHIA 4M75A 4BY6C 3G71T 4IUTA 4NC6A 4MDWA 1I4K1 2R58A 4XTYA 3CC2T 1WGSA 2E70A 2XK0A 3S6WA 1YHQA 2DVEA 3OYDA 5I2MA 4N0AC 1NPRA 3A8GB 2X35A 2OTLT 3ME9A 4GY5A 4J8OA 3C12A 3CD6T 3JCMd 3EFSA 1PSEA 1Y07A 2HNIA 3CEYA 4M77E 4UC4A 3M5AA 4VUBA 3CBPA 3LW5E 3OYNA 3CMET 5C6SA 1N9SA 1YIJT 1D3BB 1VQPT 1M9SA 2JUFA 3L2UA 3V7CA 2LDMA 3CBOA 1VQOT 4HKEA 5LJ5h 4XTZA 2VUBA 3RKXA 1O9SA 2DO3A 2BKDN 4C5HA 5KH6A 4OVAA 5AYFA 4LD9K 3CMAT 1Y71A 2MI6A 3INZA 1QW1A 3JCMb 4JRKA 2XIDA 4E7KA 3X20B 4JRIA 1G5VA 1KHCA 3QUIA 1IZ6A 2PVDB 3GLXA 2KY9A 3RMSA 5GAMj 4R56A 3HKSA 1WQ7A 2EAYA 4Z6YA 1X01A 2FB7A 2OAUA 2P0QA 4FU6A 4JUVA 4C8QG 1BI1A 4E7HA 2GCXA 4C5GA 4KUDK 3BG3A 2M1HA 2ZCFB 2PQWA 2RHZA 4A53A 1VQ7T 3JCMg 3TW6A 4MFEA 2E64A 3X24B 4PLLA 3R6OA 3Q1JA 4M78C 1VQKT 1DJ7B 1BI2A 2XKOC 3M58A 4PJOG 3V7SA 3BY7A 4M7DB 3EAEA 4XU2A 4RCCA 4XK8E 5GAN7 2KDSA 4A4HA 2KMTA 2QA4T 2DXCA 1VQNA 2YHTA 2WSCE 2RHYA 1S72T 4QQGA 4CRIA 2DD5B 1G3YA 2X4XA 4ME7A 1Q82U 4M77A 1WQWA 5D6XA 4QVDA 5GAN5 1YITT 3QJ6A 1Q82C 4HT8A 1VQ5A 2XDPA 5GANd 2DD4B 3QZ5B 2F5TX 4OB1B 2LCCA 1Y96A 2QQBA 3FDRA 3X25B 4WF2A 5GMKh 3J80E 3CC7A 3G6ET 3HHTB 1XQHA 1I8FA 3MHXA 3CC4A 3JCMh 4PJOF 2DK3A 2ZPEB 2K3XA 5IN1A 4R55A 2QF7A 5DLOA 2VGNA 2ZPBB 3QKJA 3TREA 2D9TA 3QPHA 4XAXB 3TW7A 2RD1A 3CCSA 3VKIA 1JJ2A 2DTOA 2JTMA 2LT1A 4N4IA 4ZN3A 4BE0A 1YBYA 4MZMA 1YCYA 2K5IA 3VYHB 5D6WA 3M56A 3ZBDA 2RK1A 5HKCA 2KMGA 3V8KA 1WJRA 5M9OA 2CGHA 3JCMX 1YJNA 2ZPGB 3TEEA 2QXFA 2YLCA 3QIIA 1YHQT 5GANg 3JAME 1KG1A 5CQXA 2X4YA 2R5AA 5CKDA 2DIGA 3M53A 1Q7YU 1Q7YC 4HT9A 2VYTA 2E65A 2VGMA 3ASKA 2ZPFB 2JNGA 1VIEA 2DTIA 5GAMe 5A0GA 3HRUA 3OBYA 4M77G 4M78B 1OZ2A 4DQ2A 4M7AB 3CPWS 4L59A 3CCQA 3HFOA 4C8QC 1QLBA 3CCUA 2FHDA 4PJOE 2DPPB 1PSFA 4M6VA 1R8OB 3N5BB 4IUQA 1P92A 2EFIA 3OS1A 3JCMJ 4M75C 3E19A 4EMHA 1K8AU 4C8QD 1K8AC 5GAN6 4XTXA 3OMGA 4BD3A 4C92G 2ZZDA 3OSSC 1M1KC 1M1KU 4E7JA 2V8JA 3ER0A 2CZ6B 3RMQA 3UT1A 3DKMA 4PNOA 4ZN1A 3OYGA 4HCCA 4M7DF 2WJ9A 4OB0B 1YJWT 1GXIE 2KK4A 4XU0A 1VQMA 2R57A 5GANh 4RMOA 3SWNA 3L2WA 3GIBA 3ZEHA 3OB9A 4QQ6A 4LDUA 3ZFJA 4PJOD 4V2SA 4AKHA 4ZGEB 2JOYA 3HO8A 4RCBA 5DY9A 5L8RE 5LJ5g 2PU9B 1N9RA 1OI1A 3CCMA 4TVRA 3CCEA 2RK2A 4C92F 2P0PA 3VYGB 3JCMc 4N4HA 3RKYA 3FC3A 1G3SA 2A3LA 4BI8B 3A8MB 3HFNA 3DLLA 3MO8A 3QYBA 2LT4A 4HL4A 4OB2B 2WACA 4ZGDB 4FM4B 3OYAA 4ZGJB 4M7AG 1LNXA 2VV5A 1VQ5T 5HY6A 1XTDA 4FSXA 4JS4A 4M7DE 4J6XA 4PJOA 1M8VA 5GAMd 3LH0A 4PLIA 2O4XA 3I55A 3PIPA 1B34A 4ELJA 5GAMf 4NL3A 3OW2S 4HCZA 2QEXA 4JX4A 1XNIA 1UGPB 3LYIA 3GP8A 1ZQ1A 1UGQB 2LNVA 1UGSB 4LDVA 1N8RU 1N8RC 1I5LA 1QVGA 1FXXA 1AHJB 2ZGWA 1SSFA 1D3BA 4M75B 3QSUA 3G4SA 2G77A 4Y91A 4EMGA 3WXMB 2Y4YA 4E7LA 3M57A 3VUBA 2QFZA 3CCST 4C92E 2QQ9A 2EQKA 3OYEA 4M77C 4M7AF 4EMKA 4E47A 5CKFA 3HSBA 1OYXA 4F7UG 4BDYA 4BACA 2JN0A 2DZCA 2K5LA 3HRSA 4L5GA 5HK3A 3OY9A 2GFUA 1YJNT 2D0QB 1U8RA 3GNFB 4M77D 5LJ3j 2RI2A 3KUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHT B;  3QYH B;  4L6V 5;  2ZPE B;  2ZPB B;  1IRE B;  1JB0 E;  4Y28 E;  3VYH B;  3VYG A;  2DD5 A;  2ZPG B;  3A8H B;  1V29 B;  2DXB B;  2AHJ B;  2ZPF B;  2QDY B;  2PUO B;  1GXI E;  1UGR B;  2DPP B;  1PSF A;  2CZ1 B;  2ZPH B;  2PVO B;  2CZ0 B;  2CYZ B;  2WSE E;  2PVG B;  2ZZD A;  4RKU E;  2CZ6 B;  3WVE B;  2ZPI B;  4OB0 B;  3QYG B;  3A8G B;  3WVD B;  3X28 B;  1PSE A;  2DD4 A;  3LW5 E;  4ZGE B;  5L8R E;  4OB3 B;  2PU9 B;  2DXC B;  3A8O B;  3VYG B;  3X20 B;  3QZ9 B;  3A8M B;  1QP3 A;  2PVD B;  4OB2 B;  4ZGD B;  4FM4 B;  4ZGJ B;  2ZCF B;  2WSF E;  2CZ7 B;  2DXB A;  4KT0 E;  3X24 B;  1UGP B;  1UGQ B;  1UGS B;  1AHJ B;  1DJ7 B;  3QXE B;  2ZZD B;  2O01 E;  4XK8 E;  3X26 B;  2DXC A;  2WSC E;  2DD5 B;  3A8L B;  1QP2 A;  2D0Q B;  2DD4 B;  2PUK B;  3QZ5 B;  4OB1 B;  3X25 B; 
#chains in the Genus database with same CATH topology
 3C94 A;  2JTF A;  2EBP A;  3RBB B;  1VQ4 A;  3SDZ A;  3M59 A;  4JZ3 A;  1H3H A;  2AIR B;  4D6W A;  2C5N B;  4CFW B;  1IGU A;  2QEX Q;  2VKN A;  2R7G A;  2RI5 A;  2OTJ A;  1ZUY A;  1FMV A;  3MKD A;  4QKU A;  1U06 A;  4BCP B;  3FIF A;  2DKG A;  3MEV A;  2DTH A;  2RI3 A;  4DOV A;  1MMN A;  3F70 A;  2KR6 A;  5GAO q;  1GRI A;  1R0B G;  2QQR A;  5GAM h;  1GXI E;  5FU6 C;  2DRK A;  4NOY A;  3I56 Q;  4YOS A;  4AI6 A;  1URC B;  3CCM T;  1AWO A;  4J83 A;  5IHI A;  1Z9Z A;  3GOX A;  4F7U E;  5GAN 2;  2BE9 B;  1Y96 B;  1ZSZ C;  3JAM E;  2MMP A;  2YUN A;  3SEM A;  3HPW A;  1WJQ A;  2EYQ A;  4O5V A;  3QYG B;  5A2Q E;  3SWN C;  4ROD A;  1SRM A;  4A4G A;  1YIJ A;  2QK0 A;  4LXC A;  5EJC A;  5IT9 E;  2C5X B;  1WI7 A;  3GTM S;  4OB3 B;  2EIF A;  3DB3 A;  3LGF A;  1VA7 A;  4OMQ A;  1PNJ A;  5GMK m;  5A0D A;  2HZY A;  4IUP A;  2EGC A;  3OYL A;  1VQ9 Q;  2X4W A;  2FRY A;  2QGF B;  2EUF A;  3PT9 A;  2KI7 A;  3BLH B;  4BBS M;  2FO0 A;  3SB2 A;  1UTI A;  1UEB A;  3RNJ A;  1OKV B;  2FG0 A;  4AKI A;  4CRL B;  2DXB A;  2XI9 A;  2EQJ A;  1WXU A;  1OX8 A;  4RTV A;  2RQU A;  1VQ4 T;  4F7U A;  4EOJ B;  2WEV B;  3S3M A;  4ZTF A;  1BBZ A;  1X6B A;  2HL3 A;  1KIK A;  4EMK C;  3FLG A;  1VOM A;  4TTH A;  5CYI B;  3GNG A;  1KXU A;  3THK A;  2EYY A;  3UPU A;  3QHS A;  3OYY A;  5I2S A;  3VS2 A;  3EGX B;  1X2Q A;  2RB6 A;  2GNC A;  1M2V B;  3MEA A;  4DBH A;  1NPP A;  4EPC A;  4NST B;  5CKH A;  1KQ1 A;  4HLQ A;  3CC4 T;  5LJ3 d;  1TUG B;  2BPM B;  2LQ8 A;  4PFP A;  4J9C A;  1VYW B;  2UZB B;  1M5Q 1;  2BZX A;  1YI2 A;  3RIR A;  2EYX A;  3JB9 G;  2DIQ A;  2GGR A;  1VIF A;  2J6F A;  2RJD A;  2JZ2 A;  2O4X B;  2KEA A;  2V8I A;  2YUO A;  1GL5 A;  3QWL A;  2E41 A;  2YRV A;  4KRD B;  1BIA A;  2EYZ A;  2FZK B;  5GAM g;  1GH6 B;  2W99 A;  3JB9 H;  3CBM A;  4I3Z B;  2EJ9 A;  2CH4 A;  1QVG S;  4C92 D;  5LJ3 g;  4MMK A;  2ED1 A;  3SHW A;  4OGC A;  1SG5 A;  4PJL A;  5CK9 A;  1RAH B;  3QDR B;  4M78 E;  2F69 A;  4UN0 A;  1WPY A;  4JJB A;  3OYJ A;  1VQN A;  3CCV Q;  3OA6 A;  3X28 B;  1W98 B;  3QG1 A;  3TN8 B;  2XU8 A;  1J3T A;  2HL5 C;  2ABL A;  3QO3 A;  2HQE A;  4F70 B;  5HVY B;  2CP0 A;  4EOS B;  1VYU A;  5LJ5 e;  4OF1 A;  3QJY A;  1XO2 A;  2WIH B;  2KGT A;  3LX7 A;  2WFY B;  3MIA B;  3O8V A;  3GPL A;  5CVI A;  2DRM A;  4J7F A;  3A8O B;  4AFZ C;  4M78 D;  4M77 B;  1W1F A;  2V22 B;  3FEO A;  2DAQ A;  2PZ1 A;  3M03 A;  1BI0 A;  2OTL A;  4C0G A;  1Q86 C;  1Q86 U;  4C92 B;  4QSH A;  2C5V B;  2K5F A;  1VQ8 Q;  1ZBJ A;  4M78 A;  4J7I A;  3MJX A;  1UEC A;  1RL2 A;  4BCF B;  5IDN B;  2J05 A;  2WHB B;  3UA7 A;  1NE8 A;  1AD6 A;  3HRT A;  1YI2 T;  3EG2 A;  2DFU A;  2RHU A;  5KYX A;  1JOW A;  3CXC S;  4C0F A;  4MML A;  4MZT A;  3OSV A;  2F5K A;  3NHN A;  3JCM e;  3MEU A;  3I56 T;  3QYH B;  2CKK A;  3E9F A;  3CD6 Q;  3OYH A;  5LJ5 f;  2C06 A;  3VV0 A;  3L2R A;  1SEM A;  1KD1 U;  1KD1 C;  1H26 B;  2HAX A;  2FZG B;  3LQ5 B;  4Y28 E;  2QGG A;  4AFU C;  3JCM P;  3M4G A;  3CMA Q;  3PE0 A;  5FRM A;  1PRL C;  2SEM A;  1OPK A;  1BCO A;  2CH4 W;  1V29 B;  2E6Z A;  1VQN T;  4M77 F;  3S3N A;  2RQW A;  1P5E B;  1ACM B;  2KNB B;  2CSQ A;  1UNG D;  3OW2 A;  1JKW A;  3RES A;  2E4H A;  4F14 A;  2EJF A;  2HBW A;  3EHQ A;  4EOM B;  4OMF B;  5KYW A;  2ENM A;  1M90 R;  1G3W A;  2NUT A;  4EDU A;  2BZ8 A;  4BY6 C;  1C6V X;  1KQS P;  3CQT A;  4IUT A;  2C4G B;  1WGS A;  3K7A M;  4KH1 B;  5I2M A;  2W10 A;  2OTL T;  3CBP A;  1GCP A;  1PKS A;  1RAB B;  5C6S A;  1KJW A;  1M9S A;  1OL1 B;  1TOV A;  3CBO A;  1PKD B;  2KBT A;  5LJ5 h;  1O9S A;  5KH6 A;  4BCQ D;  2UZE B;  1Y71 A;  1RLP C;  4JRK A;  2KY9 A;  2NUZ A;  2JMC A;  3TQ7 P;  1GCQ A;  2EAY A;  1X01 A;  4E7S A;  5EC7 A;  1OEB A;  2YRD A;  2K9G A;  2DMO A;  2M1H A;  1AWX A;  2RHZ A;  2ED0 A;  4MFE A;  3Q1J A;  4M78 C;  2YSQ A;  2LJ1 A;  3M58 A;  4PJO G;  1NEG A;  3C0C A;  4XK8 E;  2KDS A;  4A4H A;  2KMT A;  2WSC E;  1TD6 A;  1Q82 U;  1Q82 C;  3QJ6 A;  4M4Z A;  1MMD A;  2DD4 B;  2CP2 A;  2F5T X;  4OB1 B;  3J80 E;  4WF2 A;  3CC7 A;  1ZP2 A;  3QWX X;  1RAE B;  1U5S A;  1W70 A;  3NGP A;  1I8F A;  4OMP A;  1FMW A;  3JCM h;  1NYG A;  4PJO F;  2ZPE B;  4BY7 X;  1M3A A;  4KGX B;  1GFD A;  3M0Q A;  2RD1 A;  3VKI A;  1JJ2 A;  2LT1 A;  1YBY A;  1YCY A;  4FYW B;  3VYH B;  1RAA B;  1WJR A;  4DEY A;  5M9O A;  2QXF A;  2FZC B;  5CQX A;  2ZPF B;  1TUD A;  5A0G A;  5FWB A;  1M3C A;  1OOT A;  4M6V A;  4IUQ A;  2M0Y A;  4EMH A;  1K8A U;  1K8A C;  1WLP B;  2EKH A;  3OMG A;  4XTX A;  3EH2 A;  4LE9 A;  5KYU A;  4E7J A;  2CZ6 B;  3CCS Q;  1NG2 A;  1GFC A;  1LCK A;  4ZN1 A;  4HCC A;  2KXC A;  4RTT A;  1GUX A;  4XU0 A;  1E7O A;  5GAN h;  1YJN Q;  1ENW A;  1LVK A;  2JOY A;  4DBQ A;  5LJ5 g;  3CCE A;  2DBM A;  2JTE A;  2P0P A;  3RKY A;  2A3L A;  3A8M B;  3HFN A;  3QYB A;  2EYW A;  2RMO A;  4FM4 B;  3OYA A;  2YT6 A;  4ZGJ B;  5HY6 A;  2YRC A;  4JS4 A;  4M7D E;  4J6X A;  3LH0 A;  4BCN B;  3I55 A;  3PIP A;  2GBQ A;  3TVT A;  5ECA A;  3LYI A;  2LNV A;  1I5L A;  4M75 B;  2PK2 A;  3G4S A;  2G77 A;  4Y91 A;  3WXM B;  3M57 A;  2IW8 B;  4OMO A;  3I35 A;  1UDL A;  1JXO A;  3OYE A;  3CCM Q;  4E47 A;  2L3S A;  3VS6 A;  2KYM A;  3R6N A;  1U8R A;  3GNF B;  2QYZ A;  2RI2 A;  3PVQ A;  1O9K B;  2EGA A;  1OIY B;  2HQX A;  2JT4 A;  3KBG A;  4N4G A;  2V26 A;  2AKL A;  1QVF A;  2F2C A;  3L2Q A;  2W96 A;  3CPW P;  3MCA B;  4OP0 A;  4J9D A;  1RAG B;  1K9A A;  1NLO C;  4AG1 C;  4M7D A;  3JB9 I;  1LOJ A;  3OBW A;  2LX7 A;  4M7A E;  5GJW B;  2DD5 A;  3A8H B;  5CIU A;  2HMA A;  4OML A;  4GBQ A;  1PG5 B;  3M0R A;  3OYK A;  1NJI U;  1NJI C;  4CFU D;  5HBE B;  1IRX A;  1D0Z A;  4NS5 A;  2LJ3 A;  4RTY A;  1VQ4 Q;  3T9N A;  1QWE A;  4RKU E;  2MF2 A;  3MP6 A;  4QVC A;  1VQL A;  3WVE B;  5FU7 C;  3OYB A;  4EON B;  2OTJ Q;  3BG9 A;  1YFN A;  1W2B A;  3VUZ A;  5IHY A;  1M1K R;  1UFF A;  2M16 A;  4M7D G;  4BCM B;  1I07 A;  4JLI A;  4BCI B;  2E1H A;  2F1L A;  2MCN A;  2O9S A;  1JSU B;  3KHI A;  5KYY B;  4EIK A;  3BLR B;  2ECZ A;  2DF6 A;  4DA4 A;  4KRT A;  5LJ3 e;  4M7A A;  4B6M A;  4LDY A;  4C0D C;  5IF1 B;  3DLM A;  1V76 A;  2J6O A;  1EIF A;  2V1Q A;  2KR3 A;  3UDC A;  1ZSZ A;  4BCG B;  4HCB A;  2MAM A;  1D09 B;  1JRI A;  4KT0 E;  5FU6 B;  2A36 A;  2RJC A;  2FRW A;  2RPN A;  1YIJ Q;  3QXE B;  2L0A A;  4LDW A;  3VJP A;  4R0K A;  1VQO Q;  3X26 B;  1S72 A;  3C4S A;  1I0C A;  1KQ2 A;  1X27 A;  4ELY C;  4FT4 A;  1K9M U;  1K9M C;  2JMA A;  3BW1 A;  4F7S B;  3FJP A;  2E10 A;  2BTT A;  2YWW A;  3SWN B;  2M51 A;  5ACB A;  2D1X A;  2G3R A;  2LNH B;  2Y4X A;  1KK7 A;  2CCI B;  1G8X A;  2IVX A;  1D0X A;  2RF0 A;  3E1S A;  4FL6 A;  4FW1 A;  4C8Q B;  4ZTJ A;  3MEW A;  1BB9 A;  5LJ3 f;  3H4C A;  4M7D C;  2V8K A;  5CCA A;  3EGD B;  4ROE A;  3BFM A;  5KE3 A;  2K57 A;  2GQI A;  3PGG A;  1VQL T;  2L5Q A;  2BS2 A;  1M1F A;  3OS5 A;  2XD0 A;  3OYM A;  2JM9 A;  5EFQ B;  3M4Y A;  4CI0 C;  2L3R A;  3RGF B;  1MV0 B;  1M27 C;  3URG A;  4EOP B;  1PCX A;  4J9B A;  2P4T A;  2K2V A;  4ELZ C;  4EMK B;  2CZ0 B;  1LJO A;  2C0I A;  1JBM A;  4PL6 A;  2CDT A;  1K73 U;  1K73 C;  1O75 A;  1YJW A;  4PJN A;  2NYS A;  1OKW B;  1YI2 Q;  3SFM A;  3WVD B;  4HNT A;  2LW4 A;  1U1T A;  1TUC A;  2K3B A;  4M7A C;  1MND A;  3MET A;  2DXC B;  2FL7 A;  1NBE B;  1IB8 A;  3VS7 A;  5LJ3 h;  2D6F A;  5KE2 A;  5DM7 R;  2LP5 A;  4C8Q F;  3QZ9 B;  2OX7 A;  1H1P B;  3PNW C;  2C5O B;  1X2K A;  4C0Z A;  1OX9 A;  2DL5 A;  2RHI A;  2F2V A;  2FPD A;  2X51 A;  1HSQ A;  1ZSG A;  3DTO A;  2AT1 B;  3OYF A;  3CME A;  2SRC A;  1VQN Q;  3F5X B;  4JRQ A;  1VQO A;  1Q81 R;  3JSC A;  3JB9 D;  2P0K A;  1KC8 U;  1KC8 C;  1X6G A;  1SRL A;  4C5I A;  1GBQ A;  2L3P A;  1V1C A;  5GAN 8;  2FVU A;  4X9D A;  5IXB A;  3MP1 A;  1VQ7 A;  5IHK A;  4IUV A;  3G7Z A;  2OTL Q;  2VXF A;  3DL1 A;  1K4U S;  2CUD A;  1VQK A;  1WDX A;  4AKG A;  2W2H A;  1E7P A;  2JGZ B;  3UA6 A;  1YP5 A;  1ZX6 A;  1QVG P;  1HXD A;  2OTJ T;  3EG9 A;  1U1S A;  5GAN 4;  1YNZ A;  5D6Y A;  3PMT A;  1FKM A;  3UAT A;  2HD0 A;  2E5Q A;  4CC2 A;  2DXB B;  3CCL A;  3EGX A;  4F7U B;  5FW9 A;  5GAO m;  2BS3 A;  3GF5 A;  2X4J A;  2WPA B;  2EVR A;  2EGE A;  2CP3 A;  2OJ2 A;  1G83 A;  5CR2 A;  2KE9 A;  5HK0 A;  1EZZ B;  3NDQ A;  2CYZ B;  3OYI A;  5IH2 A;  1KSW A;  4NC6 A;  3VRY A;  8AT1 B;  1YHQ A;  3OYD A;  1RUW A;  3VS4 A;  2X35 A;  3ME9 A;  4GY5 A;  1MNE A;  3EFS A;  1PSE A;  4VUB A;  4M77 E;  3CEY A;  4UC4 A;  3M5A A;  2PMI B;  3CME T;  2DL8 A;  1YIJ T;  1D3B B;  2K7A A;  1VQO T;  4HKE A;  4F6W B;  2VUB A;  1JU5 C;  2AKK A;  2IIM A;  1D3U B;  1KFZ A;  3QUI A;  3TSZ A;  3GLX A;  2FB7 A;  1WQ7 A;  4FU6 A;  2H8H A;  4OR5 B;  4JUV A;  2VAS A;  4C5G A;  1UNH D;  4J9G A;  3CXC P;  2ZCF B;  1VQ7 T;  2KRS A;  3M0S A;  1H1S B;  4DBR A;  2F2W A;  1VQK T;  3ULR B;  3BLQ B;  1BI2 A;  2XKO C;  4PFZ A;  4RCC A;  4ORZ A;  4F16 A;  3REA B;  1F1B B;  3NPF A;  2CSI A;  4M77 A;  5D6X A;  1VQ5 A;  2CP5 A;  1AZG B;  3FDR A;  4AFS C;  4RUG A;  2DER A;  2WMA B;  1XQH A;  5HNB B;  1WHM A;  1FVV B;  2KXD A;  1JQQ A;  1NEB A;  2UZD B;  2DYI A;  2J7I A;  2QF7 A;  3QKJ A;  1N4M A;  3QPH A;  2W9Z A;  2JTM A;  4ELL A;  4BE0 A;  4FYX B;  1MV3 A;  2KMG A;  2BE7 D;  3V8K A;  3JCM X;  2CGH A;  2YLC A;  3H0F A;  1YHQ T;  1UJ0 A;  4OMM A;  4F6S B;  5CKD A;  1Y0M A;  1OL2 B;  2DTI A;  1D1C A;  5L23 A;  1X43 A;  3OBY A;  4M77 G;  4M78 B;  3CCQ A;  3HFO A;  3CCU A;  3CC7 Q;  2FHD A;  4PJO E;  2DPP B;  1PSF A;  3N5B B;  1R8O B;  5ICP B;  1P92 A;  2EFI A;  3OS1 A;  1IHW A;  3E19 A;  1SKU B;  2I0N A;  4KH0 B;  4C92 G;  2ZZD A;  3EG3 A;  3OSS C;  1S1N A;  4GLM A;  3UT1 A;  3DKM A;  4DBF A;  4IMY B;  4FX3 B;  2KK4 A;  2W9F A;  2ZAE A;  1VQM A;  4JZ4 A;  4RMO A;  1OPL A;  4HVW A;  3GIB A;  4LDU A;  4PJO D;  1AVZ C;  2JS2 A;  2P4R A;  3HO8 A;  1OUL A;  2PNI A;  1OI1 A;  4TVR A;  4C92 F;  4IIM A;  3JCM c;  4KRC B;  4N4H A;  3MO8 A;  4FW2 A;  2WAC A;  4OB2 B;  1JXM A;  1VQ5 T;  1XTD A;  4PJO A;  1K1Z A;  4CC3 A;  3EJ1 B;  2JJ9 A;  1B34 A;  5KYW B;  3OW2 S;  1XNI A;  5FWC A;  2IW6 B;  3GP8 A;  2NUT B;  1SSF A;  4Z88 A;  1RI9 A;  2CJM B;  2Y4Y A;  2QFZ A;  4HVV A;  4M77 C;  3CCE Q;  2KT1 A;  3LH5 A;  3NMZ C;  4BDY A;  3HRS A;  2DZC A;  2K5L A;  5HK3 A;  4BXX X;  2JW4 A;  2DX1 A;  1UG1 A;  1UGV A;  2LMJ A;  4A4F A;  2L3Q A;  3CCR A;  2RHX A;  3FB9 A;  5KCO A;  3REB B;  3CCU T;  3I55 Q;  1KQS A;  3I9Q A;  5AT1 B;  3QDF A;  4A4K A;  5GAO l;  3G4S Q;  3O0G D;  2B9R A;  4HA8 A;  4CFN B;  4J9I A;  5DLQ E;  2VB6 A;  4BBR M;  4XU1 A;  2MWO A;  4BCQ B;  2QDY B;  2B8A A;  2XHC A;  1K0S A;  3P8B B;  4DEX A;  1UGR B;  1NZ9 A;  4RG2 A;  5FGK B;  1OU8 A;  3VS1 A;  1Q7Y R;  4C5E A;  2BIV A;  4BCO B;  1T0H A;  2GTJ A;  1NYF A;  5IDP B;  3V8L A;  4EOI B;  4F04 B;  1AZE A;  1YJ9 Q;  4RTX A;  2EQM A;  1H25 B;  5GMK i;  5GAN 3;  4F17 A;  3JCM V;  1TH7 A;  3S3O A;  4AMC A;  3L1A A;  4FCY A;  5KYN A;  2B86 A;  4ZNX A;  3CCJ A;  2ESW A;  3BHU B;  3DB4 A;  3V7R A;  1ZUK A;  5HBJ B;  2X1N B;  1OQK A;  1QCO A;  4OGE A;  5GAN j;  4BI3 A;  2PK9 B;  2HDA A;  4K11 A;  2D8J A;  4JJN K;  1JJ2 S;  2DBK A;  3L2V A;  1H8K A;  2ROL A;  5DQW A;  4KUI A;  4XTV A;  1FYN A;  3OQ5 A;  4JDS A;  3G71 Q;  1K76 A;  3E2U A;  4ATO A;  4PJO C;  1PD1 A;  2DJZ A;  3JCM W;  1VQL Q;  3MPU B;  1IHV A;  2QDJ A;  2E6N A;  1ZA1 B;  1CKA A;  5FLX E;  4PK4 A;  4PKC C;  4XQ3 A;  1N8R R;  3NTK A;  5FU7 B;  2O88 A;  1GUX B;  2NUP A;  3HP9 A;  2K4Y A;  1WHK A;  2KRO A;  3J7A F;  5CKE A;  1M1G A;  4BDZ A;  1R77 A;  3CC7 T;  1SHF A;  5A0L A;  1AOJ A;  1OU9 A;  5LMK B;  5J3B A;  4E7Z A;  3OS0 A;  2EJG A;  5GJV B;  2JVV A;  4QVZ A;  1YCS B;  4EOO B;  2QQA A;  3C95 A;  2KT8 A;  1IRE B;  1PC0 A;  1K0X A;  1VQ6 A;  1SHG A;  4F7N B;  4MIM A;  2NLU A;  4M7D D;  1FWZ A;  3EH1 A;  1S72 Q;  2JS0 A;  5IXF A;  2PTK A;  2RQT A;  2L89 A;  2L8D A;  1UB4 A;  2AHJ B;  1F5Q B;  1M90 U;  1M90 C;  3CCJ T;  1B7T A;  1O9K A;  2G6F X;  3EG0 A;  3SD4 A;  3H9N A;  4PFO A;  2LX9 A;  2DEU A;  2BS4 A;  4PJM A;  2VVK A;  4X9C A;  3BHT B;  5GMK j;  4LOC A;  1YJ9 A;  2PVO B;  1WFW A;  2OAW A;  3H0H A;  3EFO B;  2COY A;  4F6U B;  3G33 B;  1BI3 A;  3QWY A;  1HD3 A;  1OGU B;  2EKO A;  1MGQ A;  4BE1 A;  4N0A A;  4M75 G;  3M9Q A;  4IUR A;  4JX5 A;  2QI2 A;  4MZP A;  5C0M A;  2DXT A;  2PJQ A;  1QVF S;  2GF7 A;  3A5Z B;  4O6J A;  1VYT A;  3HTR A;  4XTW A;  4A54 A;  3CCE T;  2DXU A;  2IPO B;  1MUZ A;  3G71 A;  4M7A D;  1VIN A;  3BDU A;  3CC2 A;  1Y57 A;  3UWN A;  1FX7 A;  3KXT A;  1HK9 A;  4M75 F;  1UE9 A;  5I22 A;  3HZJ A;  1IO6 A;  3DDP B;  1YJW Q;  2CS7 A;  2CZ7 B;  2LCS A;  3CPW A;  1VQP A;  3I55 T;  4X34 A;  3M55 A;  2YUP A;  4JS5 A;  3P8H A;  2O01 E;  3G4S T;  2MK5 A;  2RJF A;  2BUD A;  4Z02 A;  4C8Q E;  3H8Z A;  1BKB A;  3A8L B;  1VQ6 T;  1QP2 A;  4CFU B;  1N5Z A;  2LQN A;  2PUK B;  4PJJ A;  1UUE A;  4FIB A;  1W2B S;  3I5R A;  3DDQ B;  4BE2 A;  2RA2 A;  3NFC A;  5IAY A;  4J9H A;  3U23 A;  1BIB A;  2LQK A;  3L2Z A;  1QKW A;  3P8D A;  3CME Q;  2EWN A;  2QA4 A;  1YJ9 T;  2O31 A;  5LL6 S;  2CCH B;  2AZV A;  3PO3 S;  1ZSZ B;  3VYG A;  1QLY A;  3BE3 A;  5CAI A;  1WZO A;  2M0O A;  3G6E A;  4LN2 A;  2AZS A;  2KQW A;  1X6O A;  3QHW B;  2A28 A;  1G3T A;  1VQ7 Q;  2KSS A;  4C8Q A;  1VQK Q;  4D8D A;  3G71 T;  3CC2 T;  1UHC A;  2E70 A;  2XK0 A;  3S6W A;  2IW9 B;  2DVE A;  2O9V A;  4N0A C;  4RTW A;  2MYS A;  4J8O A;  3MY5 B;  1QCN A;  1WXB A;  3LW5 E;  1VQP T;  4HCK A;  3CCL Q;  1BU2 A;  1TSF A;  1WHL A;  2DO3 A;  1MMA A;  4OVA A;  5AYF A;  4JJD A;  2MI6 A;  1AWW A;  3JCM b;  4JRI A;  2LZ6 B;  5GAM j;  1IZ6 A;  2CT4 A;  4EOL B;  1E6H A;  1JST B;  1YWP A;  4Z6Y A;  2C0T A;  1T3S A;  4C8Q G;  2UUE B;  1AT1 B;  1BI1 A;  2DL4 A;  2RN8 A;  4A53 A;  1YHQ Q;  3X24 B;  2D8H A;  1E9H B;  3KFV A;  3R6O A;  1Q86 R;  2PHG A;  3V7S A;  3BY7 A;  2WXV B;  4XU2 A;  2QA4 T;  2DXC A;  2YHT A;  3TSW A;  2RHY A;  1S72 T;  4QQG A;  4CRI A;  1G3Y A;  2X4X A;  1Q95 G;  1QKX A;  1AWJ A;  1M30 A;  4Z8A A;  1TXQ A;  2FPE A;  5L2W B;  2RQV A;  1QQJ A;  1UHF A;  2LCC A;  9ATC B;  1Y96 A;  5D7U A;  1JO8 A;  3G6E T;  3MHX A;  3CC4 A;  1OV3 A;  1PRM C;  1OI9 B;  5DLO A;  2ZPB B;  1QWF A;  2D9T A;  3TW7 A;  4BCK B;  1I5O B;  4ZN3 A;  1MMG A;  2K5I A;  5D6W A;  3ZBD A;  2RK1 A;  2ZPG B;  1HYO A;  3QII A;  3PVL A;  1KD1 R;  3M0P A;  1TG0 A;  4CFV B;  2X4Y A;  4F7J B;  2R5A A;  3M53 A;  4HT9 A;  1VOL A;  2VYT A;  1VQ5 Q;  2VGM A;  3ASK A;  4EC9 B;  2GTO A;  1VIE A;  8ATC B;  1A0N B;  2HQH A;  1OZ2 A;  4DQ2 A;  4L59 A;  4C8Q C;  4CC7 A;  2J6K A;  3EGU A;  2DET A;  5HCK A;  5GAN 6;  4BD3 A;  1M1K C;  1M1K U;  2V8J A;  3ER0 A;  2G9X B;  2WJ9 A;  1YJW T;  5BNJ B;  4YOO A;  3EG1 A;  2R57 A;  3L2W A;  3ZEH A;  2E3I A;  4V2S A;  4AKH A;  1E6G A;  1M2V A;  4Y92 A;  5DY9 A;  5L8R E;  4F7L B;  1NM7 A;  3QHR B;  3EG9 B;  3CCQ Q;  3CCU Q;  3H41 A;  1WIE A;  3EOC B;  2K2M A;  3DLL A;  1ABO A;  6AT1 B;  2LT4 A;  4HL4 A;  4ZGD B;  1C1A A;  1WHG A;  2DNU A;  1H4L D;  2O2O A;  2HKN A;  1B3Q A;  5GAM d;  4YOZ A;  2O4X A;  4ELJ A;  4NL3 A;  4HCZ A;  2QEX A;  1G3N C;  2I53 A;  1ZQ1 A;  4LDV A;  4FYV B;  1UGS B;  1VQM Q;  1TTH B;  1QVG A;  1B07 A;  1D3B A;  1H1R B;  4JJC A;  4EMG A;  4OGR B;  3VUB A;  4EOK B;  4C92 E;  2QQ9 A;  2EQK A;  4F7U G;  4BAC A;  2JN0 A;  2QAS A;  1EX4 A;  4RTZ A;  3RR6 A;  2D0Q B;  4M77 D;  4BCH B;  3KUF A;  4LNP A;  3JRZ A;  2QTX A;  3I56 A;  1Q82 R;  1W4S A;  1SF9 A;  3MP8 A;  1YWO A;  1QMZ B;  2DA9 A;  3JB9 F;  4BY6 B;  2M02 A;  1JB0 E;  4F7U F;  2FEI A;  4KUL A;  3JCM Q;  3FJ5 A;  1RAF B;  3LWH A;  1WJS A;  1FIN B;  1WYX A;  1RAD B;  4JRP A;  4NL2 A;  3CCL T;  2HSP A;  2P84 A;  3NTH A;  4II1 A;  1OZ3 A;  2XIC A;  4IUU A;  4XTU A;  3V8J A;  4C92 A;  2PUO B;  4E6R A;  2J06 A;  1VQ9 A;  1N6A A;  2GFA A;  2JXB A;  4CC4 B;  4QQD A;  2CZ1 B;  3CCR Q;  2DZ9 A;  1QVP A;  4MDX A;  2DL3 A;  1D1A A;  2E12 A;  1M4Z A;  2A37 A;  1H92 A;  2ZPI B;  3EFR A;  3PMI A;  4JLG A;  3CXC A;  2CP7 A;  1K8A R;  2LCL A;  1VYV A;  3LWI A;  2YLB A;  3RER A;  2Z0W A;  2NWM A;  4HVU A;  2DEQ A;  4FT2 A;  3TNH B;  2QEX T;  1QMC A;  3G1J A;  3DOG B;  1CKB A;  3OW2 P;  2M9U A;  1WNL A;  3QBY A;  3VRZ A;  4BI4 A;  3EID B;  4IIO A;  1TU0 B;  1D0Y A;  5KYX B;  2DYB A;  3VS5 A;  2KRM A;  2R5M A;  3E9G A;  4FYY B;  1ABQ A;  4LDX A;  3FRN A;  3OMC A;  1Q81 U;  4CFX B;  1Q81 C;  2CP6 A;  4KBM B;  2XDB A;  5HQ0 B;  5DQV A;  4WCI A;  5EG2 A;  2HCK A;  2QQ8 A;  3L42 A;  3CCJ Q;  2ZZD B;  4RG8 A;  4E7I A;  2KAF A;  2DE0 X;  4LD6 A;  1M8M A;  2QG9 B;  1M3B A;  1IXD A;  3AT1 B;  1R0C B;  4J6W A;  4M78 G;  5LJ5 j;  2QGS A;  4MFD A;  4HNU A;  1MHN A;  1TFB A;  3MY1 B;  1SSH A;  5FRN A;  1BCM A;  1IGQ A;  2LC4 A;  2I40 B;  1LPL A;  3M0T A;  4FSS A;  4WTO B;  3BDL A;  4EC8 B;  4P5N A;  1PHT A;  4B9X A;  1KHI A;  2EW3 A;  4E2F B;  1VQ9 T;  4BB7 A;  3ZL7 C;  2X3W D;  2ROT A;  4AT1 B;  4II5 B;  4X1V A;  2VC8 A;  5CO7 A;  1PWT A;  2H3J A;  3CCV A;  5I5Z B;  3M0U A;  4M78 F;  4Y72 B;  4PJO B;  4J5Y A;  1PM3 A;  3AHU A;  2QQS A;  5GAN e;  1B34 B;  1YIT Q;  2GQV A;  5GMK l;  4DOW A;  2C0O A;  4GLK A;  2COZ A;  3PFS A;  1RI0 A;  4B9W A;  4C92 C;  3JCM f;  4A4E A;  1BYM A;  1Y7X A;  1C9B A;  2I2L A;  2EQU A;  4ANJ A;  1X75 C;  4JPB W;  1XOV A;  3CCQ T;  3RDV A;  1VUB A;  1EFN A;  2Y90 A;  4QT7 A;  2ZPH B;  4HNV A;  4KGZ B;  1C0M A;  3H0I A;  1NJI R;  2VWF A;  1ZA2 B;  1JJ2 P;  3TNW B;  3VKH A;  3TU4 K;  3A1P A;  3TNI B;  2UZL B;  3QYE A;  1VQ8 A;  1VQ6 Q;  2A7Y A;  2CT3 A;  3BG5 A;  2WMB B;  2LRQ A;  1VQM T;  2DD4 A;  1NLP C;  1CSK A;  2A08 A;  2XG8 D;  3JB9 J;  5J26 A;  5GAO p;  1Z9Q A;  4Q5W A;  2RM4 A;  2XDD A;  2RNA A;  4IKF A;  1KQS S;  3HSB A;  3IQL A;  2X3X D;  4J9F A;  4ROC A;  3PTA A;  4JX6 A;  4YTL A;  3OYC A;  1QP3 A;  1FMK A;  1XJW B;  3VU3 C;  2IG0 A;  2VXE A;  4BUG A;  5GAN f;  4J6Y A;  5I21 A;  5IHN A;  3CD6 A;  3LGL A;  1TWB A;  5GAO n;  2WSF E;  3PIO A;  2IN3 A;  1GY3 B;  2HBP A;  2K79 A;  4D8K A;  5CQY A;  3CPF A;  4XU3 A;  1JEG A;  2YUQ A;  3VS3 A;  3CMA A;  3NTI A;  2LTO A;  2YDL A;  3CCV T;  2HEQ A;  3M54 A;  3RUX A;  4AG2 C;  2RJE A;  5GMK e;  4ESR A;  4G6L B;  1WX6 A;  4M75 E;  2K3Y A;  4QW2 A;  3CC2 Q;  2LVM A;  1I81 A;  2MIO A;  1K9M R;  1AIS B;  5FRO A;  1AD5 A;  2MWP A;  5LJ5 d;  1ARK A;  4L6V 5;  1RAC B;  3CCR T;  2V1R A;  2IVW A;  4BCN D;  3OS2 A;  1VQP Q;  2DVJ A;  5KYU B;  2LJ0 A;  1N27 A;  3HBL A;  2H3E B;  2KVQ G;  3TCJ A;  4M75 D;  1ZBX A;  1YIT A;  5HBH B;  3MI9 B;  3VKG A;  2FYK A;  1H3Z A;  1VQ8 T;  2FPF A;  2OI3 A;  5KCH A;  2MPX C;  3HB9 A;  3LLR A;  3DJB A;  5GAO r;  5J39 A;  3H6Z A;  2RH2 A;  2RO0 A;  5LQF B;  3RKW A;  1I1J A;  1QVF P;  5CKB A;  4BY1 X;  1WHH A;  2WSE E;  4C0D B;  3HL8 A;  3J81 E;  2PVG B;  1H64 1;  1ZHI A;  2NUP B;  4J9E A;  4M75 A;  1GCQ C;  2DM1 A;  1H28 B;  4MDW A;  4XTY A;  1I4K 1;  2R58 A;  2QA4 Q;  2BZY A;  3O5Z A;  1H1Q B;  1NPR A;  3A8G B;  2A0F B;  2QDL A;  3C12 A;  3CD6 T;  3JCM d;  1Y07 A;  2HNI A;  3GBQ A;  3OYN A;  1K73 R;  1HJD A;  1N9S A;  1U3O A;  1ZLM A;  2KYB A;  2JUF A;  3L2U A;  3V7C A;  3G6E Q;  2LDM A;  1M2O A;  4XTZ A;  3RKX A;  4A63 B;  4C5H A;  4LD9 K;  2BKD N;  1T0J A;  2CUB A;  3CMA T;  3INZ A;  1QW1 A;  3EHR A;  2XID A;  2DJQ A;  4E7K A;  3X20 B;  2E5K A;  4RTU A;  2DL7 A;  1G5V A;  1KHC A;  4R56 A;  2PVD B;  3RMS A;  1UJY A;  1WHJ A;  3EFO A;  3JV3 A;  2F2X A;  4CFM B;  2MOX A;  3HKS A;  2OAU A;  2P0Q A;  3A98 A;  1YN8 A;  4E7H A;  2E3H A;  1D1B A;  2GCX A;  4KUD K;  4EOQ B;  3BG3 A;  2PQW A;  3JCM g;  1W2B P;  3TW6 A;  2E64 A;  4PLL A;  1H27 B;  1DJ7 B;  4LUD A;  2DIL A;  2HSE B;  4BCM D;  4M7D B;  3EAE A;  4KGV B;  5GAN 7;  2C6T B;  4YC3 B;  2DD5 B;  4ME7 A;  3VS0 A;  1TS9 A;  1WQW A;  4QVD A;  5GAN 5;  1YIT T;  4HT8 A;  2JM8 A;  1BK2 A;  2HKQ B;  2KRN A;  2XDP A;  5GAN d;  3QZ5 B;  1ZUU A;  1W6X A;  2QQB A;  5GMK h;  3X25 B;  1KC8 R;  2EPD A;  3HHT B;  1T3L A;  2X9H A;  2DK3 A;  2K3X A;  5IN1 A;  4R55 A;  2VGN A;  3TRE A;  4AFQ C;  4XAX B;  1H24 B;  5KYY A;  2ATC B;  3CCS A;  3BHV B;  2DTO A;  2W0Z A;  1GBR A;  4N4I A;  4MZM A;  3M56 A;  5HKC A;  1YJN A;  3TEE A;  5GAN g;  2K6D A;  1KG1 A;  2DIG A;  1Q7Y U;  1Q7Y C;  4LUE A;  2E65 A;  5GAM e;  2JNG A;  2RQR A;  1G2B A;  3HRU A;  3CPW S;  4M7A B;  7AT1 B;  1QLB A;  2QAZ A;  4Z89 A;  1QCF A;  1UNL D;  2QTV A;  3CC4 Q;  3JCM J;  4M75 C;  4C8Q D;  1SPK A;  3D7S B;  1PD0 A;  1BU1 A;  3RMQ A;  1AEY A;  1X69 A;  4PNO A;  3OYG A;  4M7D F;  4OB0 B;  3UF4 A;  4OMN A;  2D0N A;  3SWN A;  3OB9 A;  4QQ6 A;  3ZFJ A;  2CRE A;  4ZGE B;  1OIU B;  3POM A;  2L2P A;  4RCB A;  2DME A;  2PU9 B;  1N9R A;  3CCM A;  2RK2 A;  2DLP A;  3VYG B;  3FC3 A;  1G3S A;  4BI8 B;  4M7A G;  2EQI A;  1LNX A;  2VV5 A;  2AK5 A;  4FSX A;  3EGD A;  2YXY A;  1M8V A;  1RAI B;  4HXJ A;  4PLI A;  2WIP B;  1WA7 A;  5GAM f;  4JX4 A;  2LQW A;  1UGP B;  1N8R U;  1N8R C;  1UGQ B;  5CEI B;  1FXX A;  1AHJ B;  2ZGW A;  2XMF A;  3QSU A;  4EOR B;  3I5S A;  4E7L A;  5I11 A;  3CCS T;  3B57 A;  4M7A F;  4EMK A;  5CKF A;  1WXT A;  1OYX A;  4CXA B;  2COW A;  4L5G A;  1PKT A;  2BKZ B;  3OY9 A;  4BCJ B;  2GFU A;  1YJN T;  5LJ3 j;  1RLQ C; 
#chains in the Genus database with same CATH homology
 2HQX A;  3JRZ A;  2QTX A;  3KBG A;  4A4F A;  3I56 A;  4N4G A;  3C94 A;  1W4S A;  2JTF A;  3CCR A;  2RHX A;  1QVF A;  3FB9 A;  3MP8 A;  5KCO A;  1VQ4 A;  3SDZ A;  3M59 A;  3CCU T;  3L2Q A;  3MCA B;  4OP0 A;  1KQS A;  4D6W A;  3CXC A;  3JB9 F;  4BY6 B;  1JB0 E;  2RI5 A;  4M7D A;  3JB9 I;  4F7U F;  2OTJ A;  1LOJ A;  3OBW A;  4A4K A;  5GAO l;  4KUL A;  4M7A E;  3JCM Q;  3FIF A;  2DKG A;  2DD5 A;  3MEV A;  2DTH A;  3LWH A;  3A8H B;  2RI3 A;  4HA8 A;  5CIU A;  1WJS A;  5DLQ E;  4DOV A;  3F70 A;  2KR6 A;  4BBR M;  4XU1 A;  4JRP A;  4NL2 A;  5GAO q;  3OYK A;  3CCL T;  3NTH A;  4II1 A;  1OZ3 A;  2MWO A;  2XHC A;  2QDY B;  2B8A A;  2XIC A;  4IUU A;  4XTU A;  3V8J A;  4C92 A;  2PUO B;  2QQR A;  3P8B B;  5GAM h;  4NS5 A;  1NJI U;  1NJI C;  1UGR B;  1NZ9 A;  4RG2 A;  1VQ9 A;  1N6A A;  5FU6 C;  2GFA A;  4NOY A;  4AI6 A;  4QQD A;  3CCM T;  2CZ1 B;  4J83 A;  4C5E A;  2DZ9 A;  1QVP A;  2BIV A;  4MDX A;  3CCE T;  3GOX A;  3T9N A;  2E12 A;  1M4Z A;  4RKU E;  3V8L A;  2MF2 A;  3MP6 A;  4F7U E;  4QVC A;  2EQM A;  1VQL A;  5GAN 2;  3WVE B;  1Y96 B;  5FU7 C;  5GMK i;  2ZPI B;  3EFR A;  2MMP A;  3PMI A;  4JLG A;  5GAN 3;  3HPW A;  1WJQ A;  3JCM V;  3BG9 A;  3OYB A;  2EYQ A;  4O5V A;  1W2B A;  3QYG B;  1TH7 A;  2LCL A;  3VUZ A;  5A2Q E;  3SWN C;  3S3O A;  3L1A A;  3LWI A;  2YLB A;  2M16 A;  3RER A;  4M7D G;  4A4G A;  3CCJ A;  1YIJ A;  4JLI A;  3DB4 A;  2E1H A;  5EJC A;  2DEQ A;  4FT2 A;  3V7R A;  2QEX T;  5IT9 E;  3KHI A;  4OB3 B;  2M9U A;  1WNL A;  2EIF A;  4DA4 A;  5LJ3 e;  3DB3 A;  4M7A A;  3LGF A;  4OGE A;  5GAN j;  4BI3 A;  3QBY A;  5GMK m;  5A0D A;  4IUP A;  3OYL A;  4LDY A;  4JJN K;  4C0D C;  3DLM A;  4BI4 A;  1JJ2 S;  2X4W A;  3L2V A;  4KUI A;  3PT9 A;  4XTV A;  3OQ5 A;  4JDS A;  4BBS M;  1EIF A;  2R5M A;  3E9G A;  3SB2 A;  4ATO A;  4PJO C;  1UEB A;  4LDX A;  3UDC A;  3FRN A;  3OMC A;  1Q81 U;  2DJZ A;  1Q81 C;  3JCM W;  4KBM B;  4HCB A;  2XDB A;  2MAM A;  1JRI A;  4AKI A;  2DXB A;  5EG2 A;  2XI9 A;  2EQJ A;  4KT0 E;  5FU6 B;  2QDJ A;  2RJC A;  2E6N A;  1VQ4 T;  2QQ8 A;  4F7U A;  3L42 A;  3S3M A;  3QXE B;  4LDW A;  2ZZD B;  4ZTF A;  3VJP A;  4RG8 A;  5FLX E;  4E7I A;  2KAF A;  4PKC C;  3X26 B;  4LD6 A;  3C4S A;  4EMK C;  4XQ3 A;  1S72 A;  3FLG A;  1KQ2 A;  3GNG A;  4ELY C;  3NTK A;  4FT4 A;  5FU7 B;  1K9M U;  3BW1 A;  1K9M C;  3UPU A;  3FJP A;  2E10 A;  3QHS A;  3HP9 A;  3OYY A;  5I2S A;  2K4Y A;  4J6W A;  4M78 G;  3SWN B;  5LJ5 j;  3J7A F;  4MFD A;  4HNU A;  1MHN A;  2G3R A;  2RB6 A;  5CKE A;  5FRN A;  1M1G A;  2Y4X A;  2LC4 A;  3MEA A;  4BDZ A;  1NPP A;  4EPC A;  3CC7 T;  5A0L A;  5CKH A;  3E1S A;  4FL6 A;  4C8Q B;  4ZTJ A;  1KQ1 A;  4HLQ A;  3BDL A;  4P5N A;  4B9X A;  5J3B A;  3CC4 T;  1KHI A;  5LJ3 d;  1VQ9 T;  2LQ8 A;  4BB7 A;  3MEW A;  3OS0 A;  2EJG A;  2JVV A;  4QVZ A;  5LJ3 f;  3H4C A;  4M7D C;  2VC8 A;  2QQA A;  3C95 A;  5CO7 A;  1IRE B;  2V8K A;  1M5Q 1;  5CCA A;  1YI2 A;  2H3J A;  3CCV A;  3RIR A;  4M78 F;  3JB9 G;  2DIQ A;  1VQ6 A;  4MIM A;  2NLU A;  3BFM A;  4J5Y A;  2K57 A;  1VIF A;  3PGG A;  2RJD A;  5KE3 A;  1VQL T;  1FWZ A;  3AHU A;  2QQS A;  2JZ2 A;  2L5Q A;  5GAN e;  2BS2 A;  2O4X B;  1M1F A;  1B34 B;  3OS5 A;  2XD0 A;  2V8I A;  2GQV A;  2L89 A;  2L8D A;  4DOW A;  5GMK l;  3OYM A;  4GLK A;  1UB4 A;  3M4Y A;  2AHJ B;  3PFS A;  1M90 U;  3QWL A;  1RI0 A;  2E41 A;  2YRV A;  3JCM f;  4B9W A;  1BIA A;  4A4E A;  4C92 C;  2L3R A;  4CI0 C;  3CCJ T;  5GAM g;  1BYM A;  1Y7X A;  3URG A;  3SD4 A;  2I2L A;  2EQU A;  2LX9 A;  1X75 C;  3CBM A;  3JB9 H;  1XOV A;  3CCQ T;  2BS4 A;  2EJ9 A;  2P4T A;  2K2V A;  4C92 D;  5LJ3 g;  4MMK A;  1QVG S;  4X9C A;  1VUB A;  2Y90 A;  4ELZ C;  4EMK B;  4LOC A;  5GMK j;  2ZPH B;  2PVO B;  1YJ9 A;  2CZ0 B;  4HNV A;  1LJO A;  4OGC A;  5CK9 A;  1JBM A;  4PL6 A;  3QDR B;  1BI3 A;  4M78 E;  1K73 U;  1K73 C;  1O75 A;  1YJW A;  2F69 A;  1WPY A;  2EKO A;  1MGQ A;  3OYJ A;  3VKH A;  3TU4 K;  3SFM A;  3WVD B;  3OA6 A;  3X28 B;  3QYE A;  4BE1 A;  3QG1 A;  1VQ8 A;  4N0A A;  4HNT A;  2A7Y A;  4M75 G;  3BG5 A;  2XU8 A;  3M9Q A;  4JX5 A;  1U1T A;  2LRQ A;  2QI2 A;  2DD4 A;  4IUR A;  1VQM T;  4MZP A;  3QO3 A;  5C0M A;  2DXT A;  2HQE A;  1QVF S;  2XG8 D;  2GF7 A;  3A5Z B;  4O6J A;  5J26 A;  3JB9 J;  5LJ5 e;  4M7A C;  4OF1 A;  5GAO p;  3MET A;  3QJY A;  4Q5W A;  2DXC B;  2RM4 A;  3O8V A;  2FL7 A;  3LX7 A;  2XDD A;  1KQS S;  4IKF A;  3GPL A;  2D6F A;  5CVI A;  5LJ3 h;  3PTA A;  4J7F A;  4XTW A;  3A8O B;  2DXU A;  4M78 D;  4A54 A;  5KE2 A;  4M77 B;  4JX6 A;  5DM7 R;  3G71 A;  4YTL A;  4M7A D;  3OYC A;  4C8Q F;  3QZ9 B;  1QP3 A;  3BDU A;  3CC2 A;  3PNW C;  3VU3 C;  3FEO A;  2DAQ A;  3UWN A;  1FX7 A;  2IG0 A;  3KXT A;  1HK9 A;  1BI0 A;  2VXE A;  4C0Z A;  4M75 F;  4BUG A;  2RHI A;  5GAN f;  4J6Y A;  2OTL A;  3HZJ A;  5I21 A;  4C0G A;  1Q86 C;  1Q86 U;  3LGL A;  4C92 B;  4QSH A;  3CD6 A;  5GAO n;  2WSF E;  3OYF A;  2CS7 A;  2CZ7 B;  3PIO A;  3CME A;  2HBP A;  2K5F A;  3CPW A;  1VQP A;  5CQY A;  4X34 A;  3I55 T;  3M55 A;  3CPF A;  4JRQ A;  1VQO A;  4PJO B;  4XU3 A;  3JSC A;  4M78 A;  3JB9 D;  4J7I A;  4JS5 A;  3P8H A;  1RL2 A;  3CMA A;  2O01 E;  3NTI A;  3G4S T;  2P0K A;  1NE8 A;  1KC8 U;  1KC8 C;  2LTO A;  3HRT A;  2RJF A;  1YI2 T;  2BUD A;  4Z02 A;  3CCV T;  3M54 A;  4C5I A;  3H8Z A;  1BKB A;  3A8L B;  3RUX A;  4C8Q E;  1VQ6 T;  1QP2 A;  2RHU A;  2RJE A;  3CXC S;  4C0F A;  5GMK e;  2PUK B;  4MML A;  5GAN 8;  2FVU A;  4FIB A;  4M75 E;  2K3Y A;  4QW2 A;  4X9D A;  4MZT A;  1W2B S;  2LVM A;  3MP1 A;  4BE2 A;  1I81 A;  2RA2 A;  3OSV A;  1VQ7 A;  2F5K A;  3NFC A;  3JCM e;  3MEU A;  5FRO A;  4IUV A;  5IAY A;  2MWP A;  3G7Z A;  3QYH B;  2CKK A;  5LJ5 d;  2VXF A;  3E9F A;  3DL1 A;  3I56 T;  1M90 C;  4L6V 5;  1VQK A;  1BIB A;  3OYH A;  3CCR T;  4AKG A;  5LJ5 f;  2C06 A;  2LQK A;  2IVW A;  3L2Z A;  3VV0 A;  3P8D A;  3OS2 A;  3L2R A;  1E7P A;  1KD1 U;  2EWN A;  1KD1 C;  2QA4 A;  1YJ9 T;  1N27 A;  2HAX A;  5LL6 S;  1HXD A;  3HBL A;  4Y28 E;  2OTJ T;  3JCM P;  1YIT A;  2KVQ G;  3M4G A;  4M75 D;  1ZBX A;  1U1S A;  3TCJ A;  3VYG A;  5GAN 4;  5FRM A;  4M7D D;  3VKG A;  5D6Y A;  3PMT A;  1FKM A;  2HD0 A;  5CAI A;  2E5Q A;  1V29 B;  2E6Z A;  2DXB B;  2FYK A;  3CCL A;  4M77 F;  2M0O A;  3S3N A;  1VQ8 T;  1VQN T;  1H3Z A;  3G6E A;  5KCH A;  3OW2 A;  4F7U B;  2KQW A;  3HB9 A;  3RES A;  5GAO m;  2BS3 A;  1X6O A;  2X4J A;  3GF5 A;  3LLR A;  5GAO r;  2EJF A;  1G3T A;  5J39 A;  3H6Z A;  2KSS A;  2RH2 A;  2RO0 A;  4OMF B;  4C8Q A;  3RKW A;  5CR2 A;  5CKB A;  5HK0 A;  1G3W A;  4EDU A;  2CYZ B;  2WSE E;  4C0D B;  3HL8 A;  3J81 E;  3OYI A;  2PVG B;  1H64 1;  1ZHI A;  4M75 A;  4BY6 C;  3G71 T;  4IUT A;  4NC6 A;  4MDW A;  1I4K 1;  2R58 A;  4XTY A;  3CC2 T;  1WGS A;  2E70 A;  2XK0 A;  3S6W A;  1YHQ A;  2DVE A;  3OYD A;  5I2M A;  4N0A C;  1NPR A;  3A8G B;  2X35 A;  2OTL T;  3ME9 A;  4GY5 A;  4J8O A;  3C12 A;  3CD6 T;  3JCM d;  3EFS A;  1PSE A;  1Y07 A;  2HNI A;  3CEY A;  4M77 E;  4UC4 A;  3M5A A;  4VUB A;  3CBP A;  3LW5 E;  3OYN A;  3CME T;  5C6S A;  1N9S A;  1YIJ T;  1D3B B;  1VQP T;  1M9S A;  2JUF A;  3L2U A;  3V7C A;  2LDM A;  3CBO A;  1VQO T;  4HKE A;  5LJ5 h;  4XTZ A;  2VUB A;  3RKX A;  1O9S A;  2DO3 A;  2BKD N;  4C5H A;  5KH6 A;  4OVA A;  5AYF A;  4LD9 K;  3CMA T;  1Y71 A;  2MI6 A;  3INZ A;  1QW1 A;  3JCM b;  4JRK A;  2XID A;  4E7K A;  3X20 B;  4JRI A;  1G5V A;  1KHC A;  3QUI A;  1IZ6 A;  2PVD B;  3GLX A;  2KY9 A;  3RMS A;  5GAM j;  4R56 A;  3HKS A;  1WQ7 A;  2EAY A;  4Z6Y A;  1X01 A;  2FB7 A;  2OAU A;  2P0Q A;  4FU6 A;  4JUV A;  4C8Q G;  1BI1 A;  4E7H A;  2GCX A;  4C5G A;  4KUD K;  3BG3 A;  2M1H A;  2ZCF B;  2PQW A;  2RHZ A;  4A53 A;  1VQ7 T;  3JCM g;  3TW6 A;  4MFE A;  2E64 A;  3X24 B;  4PLL A;  3R6O A;  3Q1J A;  4M78 C;  1VQK T;  1DJ7 B;  1BI2 A;  2XKO C;  3M58 A;  4PJO G;  3V7S A;  3BY7 A;  4M7D B;  3EAE A;  4XU2 A;  4RCC A;  4XK8 E;  5GAN 7;  2KDS A;  4A4H A;  2KMT A;  2QA4 T;  2DXC A;  1VQN A;  2YHT A;  2WSC E;  2RHY A;  1S72 T;  4QQG A;  4CRI A;  2DD5 B;  1G3Y A;  2X4X A;  4ME7 A;  1Q82 U;  4M77 A;  1WQW A;  5D6X A;  4QVD A;  5GAN 5;  1YIT T;  3QJ6 A;  1Q82 C;  4HT8 A;  1VQ5 A;  2XDP A;  5GAN d;  2DD4 B;  3QZ5 B;  2F5T X;  4OB1 B;  2LCC A;  1Y96 A;  2QQB A;  3FDR A;  3X25 B;  4WF2 A;  5GMK h;  3J80 E;  3CC7 A;  3G6E T;  3HHT B;  1XQH A;  1I8F A;  3MHX A;  3CC4 A;  3JCM h;  4PJO F;  2DK3 A;  2ZPE B;  2K3X A;  5IN1 A;  4R55 A;  2QF7 A;  5DLO A;  2VGN A;  2ZPB B;  3QKJ A;  3TRE A;  2D9T A;  3QPH A;  4XAX B;  3TW7 A;  2RD1 A;  3CCS A;  3VKI A;  1JJ2 A;  2DTO A;  2JTM A;  2LT1 A;  4N4I A;  4ZN3 A;  4BE0 A;  1YBY A;  4MZM A;  1YCY A;  2K5I A;  3VYH B;  5D6W A;  3M56 A;  3ZBD A;  2RK1 A;  5HKC A;  2KMG A;  3V8K A;  1WJR A;  5M9O A;  2CGH A;  3JCM X;  1YJN A;  2ZPG B;  3TEE A;  2QXF A;  2YLC A;  3QII A;  1YHQ T;  5GAN g;  3JAM E;  1KG1 A;  5CQX A;  2X4Y A;  2R5A A;  5CKD A;  2DIG A;  3M53 A;  1Q7Y U;  1Q7Y C;  4HT9 A;  2VYT A;  2E65 A;  2VGM A;  3ASK A;  2ZPF B;  2JNG A;  1VIE A;  2DTI A;  5GAM e;  5A0G A;  3HRU A;  3OBY A;  4M77 G;  4M78 B;  1OZ2 A;  4DQ2 A;  4M7A B;  3CPW S;  4L59 A;  3CCQ A;  3HFO A;  4C8Q C;  1QLB A;  3CCU A;  2FHD A;  4PJO E;  2DPP B;  1PSF A;  4M6V A;  1R8O B;  3N5B B;  4IUQ A;  1P92 A;  2EFI A;  3OS1 A;  3JCM J;  4M75 C;  3E19 A;  4EMH A;  1K8A U;  4C8Q D;  1K8A C;  5GAN 6;  4XTX A;  3OMG A;  4BD3 A;  4C92 G;  2ZZD A;  3OSS C;  1M1K C;  1M1K U;  4E7J A;  2V8J A;  3ER0 A;  2CZ6 B;  3RMQ A;  3UT1 A;  3DKM A;  4PNO A;  4ZN1 A;  3OYG A;  4HCC A;  4M7D F;  2WJ9 A;  4OB0 B;  1YJW T;  1GXI E;  2KK4 A;  4XU0 A;  1VQM A;  2R57 A;  5GAN h;  4RMO A;  3SWN A;  3L2W A;  3GIB A;  3ZEH A;  3OB9 A;  4QQ6 A;  4LDU A;  3ZFJ A;  4PJO D;  4V2S A;  4AKH A;  4ZGE B;  2JOY A;  3HO8 A;  4RCB A;  5DY9 A;  5L8R E;  5LJ5 g;  2PU9 B;  1N9R A;  1OI1 A;  3CCM A;  4TVR A;  3CCE A;  2RK2 A;  4C92 F;  2P0P A;  3VYG B;  3JCM c;  4N4H A;  3RKY A;  3FC3 A;  1G3S A;  2A3L A;  4BI8 B;  3A8M B;  3HFN A;  3DLL A;  3MO8 A;  3QYB A;  2LT4 A;  4HL4 A;  4OB2 B;  2WAC A;  4ZGD B;  4FM4 B;  3OYA A;  4ZGJ B;  4M7A G;  1LNX A;  2VV5 A;  1VQ5 T;  5HY6 A;  1XTD A;  4FSX A;  4JS4 A;  4M7D E;  4J6X A;  4PJO A;  1M8V A;  5GAM d;  3LH0 A;  4PLI A;  2O4X A;  3I55 A;  3PIP A;  1B34 A;  4ELJ A;  5GAM f;  4NL3 A;  3OW2 S;  4HCZ A;  2QEX A;  4JX4 A;  1XNI A;  1UGP B;  3LYI A;  3GP8 A;  1ZQ1 A;  1UGQ B;  2LNV A;  1UGS B;  4LDV A;  1N8R U;  1N8R C;  1I5L A;  1QVG A;  1FXX A;  1AHJ B;  2ZGW A;  1SSF A;  1D3B A;  4M75 B;  3QSU A;  3G4S A;  2G77 A;  4Y91 A;  4EMG A;  3WXM B;  2Y4Y A;  4E7L A;  3M57 A;  3VUB A;  2QFZ A;  3CCS T;  4C92 E;  2QQ9 A;  2EQK A;  3OYE A;  4M77 C;  4M7A F;  4EMK A;  4E47 A;  5CKF A;  3HSB A;  1OYX A;  4F7U G;  4BDY A;  4BAC A;  2JN0 A;  2DZC A;  2K5L A;  3HRS A;  4L5G A;  5HK3 A;  3OY9 A;  2GFU A;  1YJN T;  2D0Q B;  1U8R A;  3GNF B;  4M77 D;  5LJ3 j;  2RI2 A;  3KUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...