3VYHB

Crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Pseudonocardia thermophila
total genus 67
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3vyhB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vyhB02
3X20B 1QP3A 2WSCE 4L6V5 3HHTB 4OB0B 3QZ5B 4OB3B 2DD5A 2ZZDB 2CZ6B 1PSFA 1AHJB 3A8LB 5L8RE 2AHJB 3X28B 1PSEA 1UGQB 4RKUE 2ZZDA 2DD4B 3QZ9B 2PU9B 2ZPFB 1UGSB 4ZGJB 1DJ7B 2WSEE 1IREB 3VYGA 3A8GB 3QYGB 2ZPGB 3A8MB 2DD4A 3A8OB 1JB0E 2WSFE 2DXCB 1GXIE 2PUKB 2D0QB 4XK8E 2ZPIB 2DPPB 4Y28E 2ZPHB 2CZ1B 3WVDB 4ZGDB 3A8HB 2DXCA 2QDYB 2CZ7B 2DXBB 2O01E 2ZPBB 2PVOB 1UGPB 2ZCFB 3WVEB 1QP2A 2CZ0B 2DD5B 4FM4B 3LW5E 3QYHB 4KT0E 3X24B 1V29B 2PVGB 3VYHB 4ZGEB 1UGRB 3X26B 2PVDB 3VYGB 2ZPEB 2PUOB 2DXBA 2CYZB 3QXEB 4OB2B 3X25B 4OB1B
chains in the Genus database with same CATH superfamily
4QVDA 1PKDB 4F7NB 2L3RA 5GAOr 4Z02A 4Z8AA 3TSZA 1ZSZA 4KH0B 2EKHA 2F2WA 5LJ5j 1KXUA 1AHJB 3VRYA 5HBEB 2BS2A 3CCUT 2V26A 5IHIA 1D1CA 4E7IA 3NMZC 4M7AD 2CT3A 1NJIC 1PRLC 4JRPA 4C8QA 5KCOA 1G5VA 4C0DC 3CQTA 1QCNA 1I0CA 4EORB 2DF6A 4L5GA 1NYFA 4LOCA 1D3UB 3OYHA 2HMAA 2PUKB 2M0YA 4J6XA 4J6YA 5FRMA 3ZL7C 4E6RA 2CZ1B 3VUBA 1VQPQ 4AT1B 3PIOA 4LUEA 2DBKA 3A8HB 3LX7A 3EG9A 4M6VA 3M0QA 3URGA 2MF2A 2X4XA 3JCMf 3P8DA 3MEUA 1JQQA 2F5KA 4LN2A 2AKKA 3I5RA 2R5AA 1OX9A 1AOJA 2QDJA 3WVEB 2QF7A 1PNJA 1FINB 2LNVA 2YDLA 5GANj 5KYNA 4F7JB 4DA4A 2KYMA 3JCMg 1OPKA 4MFEA 2NUZA 2EAYA 2LQWA 1MV0B 1TSFA 3FC3A 4N0AA 3D7SB 1Y7XA 1OIYB 3CCLT 1Y96A 2BZ8A 4M78F 5KYWA 2GTJA 1Q81C 2PUOB 2FRYA 3VS2A 1PM3A 2MK5A 4C8QD 1VQ9A 1VIEA 2GTOA 1QKXA 3POMA 2E64A 4EOMB 5AT1B 1S1NA 2K5IA 5FGKB 4DOVA 4DEXA 4OB0B 1KC8C 2COZA 2ZZDB 1X6OA 4FT4A 3ME9A 2ROTA 3DDPB 4P5NA 5L8RE 4BBRM 1N27A 1K8AR 4E7LA 3RIRA 4IKFA 1GBQA 2RK2A 1OKVB 3QHWB 2LTOA 3JCMV 3JCMX 4OMQA 3VS7A 2X9HA 4A63B 3CXCA 4F16A 2YXYA 1XJWB 3EFRA 4PL6A 2X1NB 1OI9B 4MIMA 2K5LA 1M1GA 2P0KA 2UUEB 4OMNA 1JJ2P 3TQ7P 5EJCA 4VUBA 2GCXA 1N9RA 3EAEA 4Y92A 3RKXA 1QVGP 2VC8A 4KUDK 2D0QB 1ZA1B 9ATCB 2RHUA 4JX4A 1CKBA 2OJ2A 2DERA 3FJPA 2DK3A 2EGEA 2F69A 2QEXT 1D1BA 3OW2P 2LP5A 2RF0A 3G1JA 1WHJA 2CZ7B 2C06A 1K9MC 3CCJA 3OYKA 4F7UG 5A0GA 1VQ9Q 3NTHA 1M3CA 2VB6A 1YNZA 2QFZA 1WHHA 4J9HA 2RM4A 2CCIB 4JJNK 4LDXA 1VA7A 3HO8A 2A36A 3CC7T 1GL5A 4A4HA 4AFUC 1WHGA 4QQ6A 3CPWS 1YJ9Q 2W2HA 5FWBA 3CEYA 1HJDA 1VQ7T 2JJ9A 3G71T 2EQKA 3CMEA 1GY3B 3DL1A 3BLQB 3H41A 2QI2A 3EH1A 2LJ1A 3OS0A 2YSQA 1TH7A 4M78A 1VOLA 2J6KA 4M77C 2LJ3A 2E12A 4JJCA 1H1SB 1BCMA 5GAOm 1AWWA 1XNIA 2JXBA 3MP8A 4XU1A 2XG8D 3EGDA 3QYBA 4PJOC 5LJ5d 1B3QA 4JLIA 1W2BP 3CMAA 4AG1C 3C4SA 2CYZB 5HBHB 1UFFA 2W99A 1WYXA 4J9FA 3ULRB 2PZ1A 1YJNA 5HVYB 1K76A 5LJ5e 5GAMj 3E9FA 2RJEA 2MIOA 3EGUA 4FW1A 1KHIA 5DLQE 1X6BA 2JNGA 1JSUB 2R57A 1VYTA 1S72Q 2CZ6B 3MKDA 3PT9A 2IW8B 1D0YA 2J05A 4RG2A 3CCJQ 4J5YA 2DE0X 1WGSA 2FHDA 2KEAA 2X4WA 2C0IA 1C6VX 2QTXA 1K8AC 2PU9B 4OMFB 1BI2A 4PLIA 4K11A 3HKSA 2K6DA 4EDUA 4A4GA 2JUFA 3CMEQ 4BCGB 5LJ3j 1GFDA 2X51A 2M9UA 5KYUB 2K9GA 4BI8B 1QCOA 1EX4A 1XOVA 2EVRA 2FPFA 3K7AM 4JLGA 4HVWA 2IW6B 1WXBA 1WNLA 4M78G 4FCYA 4J9IA 5IHYA 3R6NA 4C5GA 5CKBA 4M77E 2MPXC 1OX8A 2R58A 3QJ6A 4IURA 5GANe 3BDLA 4AKIA 4PJOE 2K4YA 2L3SA 3I56A 2QQAA 4C92B 3DB3A 2Y4YA 2ATCB 4M4ZA 2KRNA 1RABB 3TW7A 4V2SA 3PGGA 4FYWB 3QWXX 2VUBA 3ZBDA 2OTLA 3QHSA 1TG0A 1YIJQ 1M1KR 2YHTA 3OYFA 2KRMA 2ROLA 2JN0A 3HL8A 3SDZA 5KYXA 4IMYB 4M77D 1H4LD 4MZMA 3V7CA 2EYXA 2ZGWA 1BIBA 4PJOD 2EBPA 1W70A 1R8OB 1VQ6T 3CBOA 3OS5A 1NLPC 4N4GA 4BCQB 2HZYA 1TFBA 2HBWA 2QYZA 3SHWA 1Q82U 3RNJA 3A8LB 2G6FX 1OPLA 1J3TA 1FX7A 2DBMA 3LQ5B 3M53A 2K2VA 3JCMd 2PK9B 3I56Q 2R5MA 1RADB 4EMKC 5CQYA 2LMJA 3TN8B 2DL3A 2K5FA 3B57A 4Z89A 3CPWP 4XTUA 4L59A 4ATOA 3A8MB 2DYBA 5D7UA 4OVAA 1WFWA 1GXIE 1BCOA 4XK8E 4DBHA 2DPPB 2L2PA 4HNUA 3C95A 4BB7A 3VV0A 2HSEB 4IUVA 4HKEA 1E9HB 2D1XA 2KE9A 1VQNT 2M1HA 2E3IA 5KE3A 1R77A 4BY6B 3QDFA 1M9SA 3CCUQ 1GCQA 3TVTA 1W1FA 2KY9A 5FROA 3CCLA 2K2MA 1U06A 1NG2A 1LCKA 1FKMA 2JM8A 4JRIA 1QP2A 2EYQA 2QTVA 1N8RR 4XTXA 2CP2A 1WDXA 1OU9A 3TNIB 4RMOA 2YT6A 2XK0A 1UDLA 4BY6C 2IVWA 1LOJA 3G4SA 1Q7YR 2NUPB 1AVZC 4QT7A 3TNWB 3J7AF 3LYIA 1ZBXA 1UGRB 4OF1A 3V7SA 1KFZA 3MPUB 1M1KC 1NBEB 2SEMA 1ABQA 4CC2A 3LH0A 4BCKB 1WX6A 3AHUA 2C5OB 2E1HA 3MIAB 1C1AA 2DXBA 2ESWA 2X3XD 5GAMe 3X20B 4ROEA 2QASA 1NEGA 2R7GA 2DNUA 1OYXA 5IF1B 3MY1B 2BPMB 1VIFA 3EFOA 2RQRA 1ZSGA 4I3ZB 2UZLB 4KUIA 1N4MA 1KK7A 2YUNA 1WXTA 1KQSS 1BI1A 4AFQC 1PKSA 3SWNB 3FRNA 5IXBA 2RI5A 5LJ3d 1H641 2E5KA 4NC6A 3F70A 4C5HA 4OGRB 1HXDA 4J9BA 1H27B 3CCLQ 2C5VB 2KXCA 3HSBA 4JX5A 1VQ5A 4M7AB 2D9TA 5LQFB 5LJ3e 4NSTB 1H3ZA 1YCSB 4QSHA 4M7DG 4UN0A 3MI9B 4BY1X 3MEWA 3A8GB 1X2QA 4IIMA 2KSSA 2J6OA 5CVIA 3CCEA 3JCMJ 4FYVB 2DXCB 4XAXB 2OI3A 2E4HA 2LT4A 3CMAT 1UUEA 1QVFA 1BB9A 5IN1A 4QW2A 1Y57A 3FIFA 1VQOA 2RA2A 4M7AC 4X9CA 1YJNT 1Q95G 3OYDA 4J7IA 3QBYA 4YTLA 1UGPB 2DVEA 1U1TA 1WJSA 3TW6A 2E3HA 3DLLA 4CRLB 2UZEB 4FM4B 2EYZA 3HRUA 3OYLA 5D6YA 3G6EA 1V29B 2IIMA 1N8RC 1T0HA 4BCJB 4C0GA 2GQIA 1GFCA 4TVRA 1ZP2A 4ME7A 1U5SA 2RI3A 2RMOA 3DLMA 2Z0WA 4BDZA 2QEXQ 1ZSZC 2F5TX 3CBMA 1Q7YC 2CREA 1YHQT 1YI2T 5I5ZB 2DXUA 4C8QB 2B9RA 1PD1A 1JOWA 3CCEQ 3OYNA 1TUDA 1H3HA 3LLRA 3QJYA 5IDPB 2HKNA 4BCMD 2WSCE 2FZCB 3UF4A 3OSSC 1FVVB 2BKDN 5LL6S 3OYIA 3CC7Q 1RAFB 3GIBA 1IO6A 3VS4A 1W98B 4AMCA 2FRWA 1VQMT 4MDXA 4KRCB 1VQ7Q 3G71Q 3EG9B 1PG5B 2RHZA 3P8BB 4JRKA 2DRMA 2DEQA 4C8QC 4M7AE 3EHQA 1M1FA 2XIDA 4E47A 4F7UF 2LT1A 2MWPA 2V22B 1Q86R 2OTLT 2EJ9A 4ORZA 4YOOA 2L0AA 2KDSA 4CFMB 1G83A 4A4FA 4ELZC 2DKGA 4LDYA 5GAN5 1K73U 2ZPGB 2YUOA 4M75G 3MHXA 2D0NA 8AT1B 4C0DB 3JV3A 1UEBA 1WHKA 1RLQC 3RR6A 5ACBA 3OS1A 1ZX6A 1Y96B 2W0ZA 2XDDA 1XTDA 4DEYA 5KYWB 1YWPA 1PHTA 3I55T 3L2QA 3CXCS 3OYGA 4Y91A 1C9BA 4HLQA 4BACA 2YLBA 2QK0A 4RTZA 4FL6A 4N0AC 1RAAB 1ZBJA 1E7OA 2FZGB 2CP3A 2HD0A 1FMWA 1ARKA 2LNHB 2XI9A 4BCOB 2KRSA 5IXFA 4A4KA 5HKCA 1VYVA 1FYNA 2JM9A 4NL2A 5LMKB 4HCZA 2K3BA 5DLOA 1KQSP 5CKDA 4II5B 1PKTA 3CBPA 1VQ6A 5I11A 5ECAA 3VYHB 2PQWA 2O2OA 5IT9E 4HT8A 1JXOA 4D8KA 4C8QE 5CQXA 4IUQA 2QQSA 2JGZB 4FSSA 4C5IA 2V8KA 4B9WA 2F2XA 4XQ3A 2W96A 4D6WA 1MMGA 1KD1R 2DTOA 4PFOA 4QKUA 1KG1A 3VKIA 4OB1B 3I5SA 3NTKA 4C0FA 1O75A 2RO0A 1KSWA 1ZA2B 3H8ZA 1FMVA 2A0FB 2O88A 2VGNA 2DJQA 3RDVA 1RI0A 2JTMA 2FZKB 3JB9G 1JJ2A 2C0OA 4RUGA 4F7UA 4F6SB 2L5QA 3JCMc 1OL1B 5HCKA 4CFNB 3EJ1B 3OYBA 3L2WA 3GNFB 1PWTA 1QVGA 2DD4B 1VQKT 1SSFA 3BLHB 3QZ9B 2DJZA 2LCLA 2F2CA 1WA7A 4C5EA 1M90U 3G4ST 1ABOA 1UGVA 3OW2A 1X69A 3EIDB 1Q86C 3QYGB 1VQNA 2XDPA 2RN8A 2CH4A 4B6MA 3META 5GAN6 1VQ6Q 1AT1B 4QVZA 2JMAA 5CCAA 2ZPIB 2YUQA 2VGMA 3VUZA 3VKHA 4BCIB 5GJVB 3EGDB 2K7AA 2KQWA 3DB4A 2DMEA 1D3BA 3BY7A 2VWFA 4X34A 1XQHA 3S3NA 4HNTA 3L42A 4PFZA 4M78C 1WI7A 1NJIU 2GF7A 1UNGD 4JJDA 4J83A 3CCMT 4EPCA 2W9ZA 4BUGA 1IZ6A 1VQ5T 1YBYA 1W2BA 3M0UA 1WPYA 4RTUA 1G3WA 3VKGA 2EYWA 4RODA 5GAMg 3CCET 4ZGEB 3E19A 4M77B 2AT1B 1BIAA 1VQ4T 4LD9K 2WXVB 4FYYB 4J8OA 3OQ5A 1VQOT 1M2VB 4PJOB 2HBPA 1VQNQ 3CPFA 1K9AA 4EC8B 2DYIA 1KD1C 4NOYA 2EKOA 2L3QA 3O8VA 2K3YA 2UZDB 1H24B 2MI6A 4KGXB 4EMHA 5DY9A 3ZFJA 1SKUB 1YITT 4LDUA 5GANh 3RKWA 1E6GA 2LX9A 5FU7B 1UGQB 1VOMA 4ZTFA 2ZZDA 3G6ET 1GBRA 4CFWB 2DETA 3H0IA 2E65A 4PKCC 1DJ7B 1IRXA 3VS3A 2K3XA 1IREB 2CUBA 1Q81U 1WJQA 3UA7A 4JX6A 3E9GA 2G3RA 1AD5A 2J7IA 4M78E 1JB0E 1TXQA 2EQIA 4XU3A 2V8JA 1FWZA 2MAMA 5FU7C 1KC8U 3TREA 1M3AA 2NUTA 4BXXX 2P0QA 2AZVA 4PK4A 2E6NA 4QQGA 4DBQA 3CCQT 5I2MA 3TU4K 4NS5A 1AZGB 2KVQG 2DO3A 2DL5A 2LZ6B 5J39A 3L2ZA 2BS4A 1TS9A 5HBJB 1I5LA 1LPLA 4BI3A 1I5OB 4F7LB 3NGPA 3DJBA 3A98A 2YLCA 4ESRA 3OA6A 1UJ0A 3FJ5A 2CSQA 4F14A 4M78D 1YHQA 1YI2A 3TEEA 3JCMQ 2QA4T 4G6LB 4ELJA 3X24B 3A1PA 3BHTB 2KYBA 1YCYA 3CMAQ 1GRIA 4C92F 2H3JA 2DTIA 3WXMB 3J80E 5CYIB 2E10A 2CP7A 1UHFA 2W10A 4MMLA 1VQMA 1SRLA 1NEBA 2LCSA 4E7HA 1YJNQ 1QKWA 1K9MU 4FYXB 4EC9B 4M7DF 6AT1B 1PCXA 4OMMA 2X3WD 1Z9ZA 3LW5E 4WTOB 5CO7A 4AFSC 1QWFA 3CC4A 1UNHD 1G3NC 1OOTA 3JSCA 2DRKA 2KMGA 4EOIB 4Z6YA 3UPUA 3SD4A 2NWMA 3UA6A 3BLRB 4YC3B 3HFNA 2D8JA 2BS3A 2OX7A 3QHRB 1U8RA 1GCPA 1B34A 1IGQA 1VINA 4EMKB 4ZTJA 2GNCA 5EC7A 3PE0A 3TCJA 3I55A 1X2KA 1T3LA 3EG1A 1H8KA 4XTWA 1X27A 1YI2Q 1YHQQ 4QQDA 1HSQA 1BKBA 1GUXA 3PMTA 1UTIA 5KCHA 1GCQC 2JTEA 4M77G 2EGCA 5GMKh 2L3PA 5GAN7 2VVKA 1VQMQ 1QCFA 4HXJA 4PJOG 2DILA 5C6SA 4DBRA 1B7TA 4WCIA 5GAMh 3CCVA 2DXBB 3E2UA 2QQ9A 5KYYB 1KJWA 1K8AU 2EJFA 3JCMe 5CKEA 1QWEA 2DL7A 1URCB 2ZCFB 1QQJA 4OMLA 2CJMB 2OTLQ 2O9SA 3EFOB 1M5Q1 2IVXA 5DM7R 2CP6A 3CCSA 2BE9B 1R0BG 1UJYA 4OMPA 2KNBB 3JCMW 1QVFS 2VXFA 4E7SA 4HNVA 1NYGA 5IDNB 4CFVB 4CXAB 4R0KA 4C92A 2CSIA 4PNOA 3DKMA 4X1VA 5GJWB 3DDQB 3KUFA 3QUIA 3MY5B 2DIGA 4BE1A 4E7ZA 3PNWC 4M7DA 1TU0B 2O4XA 2DFUA 3I55Q 5GAOq 3OYCA 4JRQA 1G3SA 3QIIA 2ZPEB 4EOQB 3M58A 3VS0A 3BG5A 2C5NB 4BCMB 4AFZC 3X25B 3MP6A 4M75F 1VQKA 1K4US 1H25B 1BYMA 2FVUA 4CC3A 1MNEA 1UE9A 3HTRA 3V8JA 2IPOB 3JCMb 1D1AA 2FG0A 2XICA 2DMOA 2NLUA 4FT2A 1H28B 3N5BB 1M8VA 4ELLA 2WIHB 1TUCA 1YWOA 1W6XA 1UHCA 1LNXA 3RMQA 4OR5B 3BG3A 2LDMA 4O6JA 3M0TA 1O9KB 3ASKA 2PK2A 1TUGB 2I53A 4FX3B 2JT4A 2O31A 3EHRA 2RI2A 2O9VA 2QQBA 3A8OB 4LXCA 2WSFE 4AI6A 5IHNA 2I2LA 4JS4A 3UWNA 1XO2A 4GY5A 3CC2A 1UECA 1HD3A 2JW4A 4AKHA 4C92G 4PJMA 3CCMA 4WF2A 2GQVA 3VS6A 1UB4A 4M7DD 1TTHB 1RL2A 4MZPA 4AKGA 2FEIA 3LGLA 1IXDA 3C0CA 2RQVA 2I40B 4XU0A 1VQKQ 1D09B 2CKKA 5FW9A 2BTTA 2RQTA 3SEMA 1BU2A 2WIPB 5GMKm 3OMCA 3QSUA 4IIOA 3G4SQ 1VQ4A 2V8IA 2KR3A 3M55A 4GLKA 3BHVB 1SEMA 3M5AA 5C0MA 2QQRA 3EGXA 4JJBA 4F17A 1AWXA 3JB9F 2RK1A 3VS5A 4KBMB 4EOPB 2D8HA 2VASA 5CK9A 4B9XA 2HDAA 2HKQB 2COYA 2PHGA 4EOLB 1ZSZB 1F1BB 2KT8A 1YITA 2RNAA 4E7JA 4BCHB 4M75A 3TSWA 3KHIA 3QXEB 5LJ5f 3H4CA 3BE3A 1MNDA 2EUFA 3S3MA 1MGQA 3REAB 1M3BA 2VKNA 5IH2A 2A37A 3M0RA 1JEGA 2B86A 4DOWA 3CCMQ 4FU6A 2PJQA 1VQ5Q 3M9QA 1PSFA 5LJ5g 1WQ7A 1BBZA 2QGFB 2RPNA 2FL7A 1MMAA 2COWA 3JRZA 1AWJA 1NM7A 1UNLD 2VYTA 1CKAA 2KI7A 2CP5A 5J26A 1N5ZA 4J6WA 2KAFA 1M1KU 4ZGJB 4KULA 4BCFB 1QMZB 3SWNA 3OYEA 4BE0A 1QVPA 1JKWA 1VQ4Q 1I81A 3CCQA 1VQOQ 3LWHA 2FB7A 2EFIA 3IQLA 2LCCA 3INZA 4KRTA 2OAWA 3GLXA 3EG2A 1QLBA 3OYYA 2OTJT 1JJ2S 1K0XA 2LRQA 1YJWT 2I0NA 3CC4T 1QVGS 1NPRA 1RACB 2DXCA 3MEAA 2LJ0A 1YITQ 5GANf 4PFPA 2QA4A 2DAQA 1WIEA 2WMBB 3PMIA 1X01A 3PVLA 2ZPBB 4M75D 1OGUB 3NTIA 3OW2S 2LW4A 1VQPA 1Q81R 2RD1A 2CS7A 3G6EQ 4E2FB 2M51A 4QVCA 2KXDA 3L2VA 2ENMA 1BI0A 2DLPA 2LX7A 4IUTA 3HFOA 5GANg 1OULA 1SHFA 1KC8R 3L2RA 5KE2A 2DL4A 3RMSA 4RTVA 4OMOA 4CFUD 1NE8A 4F7UB 1LVKA 2PVGB 4OGEA 1H1PB 5GMKl 2L8DA 3CCRT 2J06A 5DQVA 2D6FA 4CI0C 5FRNA 1G2BA 4DQ2A 2BUDA 1JBMA 4KH1B 3CCQQ 1FXXA 5D6XA 1AEYA 3VJPA 3RGFB 3OB9A 5GAN4 2GFAA 1QW1A 4F70B 2YRDA 1M30A 1W2BS 3JB9I 4J9GA 3CCVT 4R56A 1JU5C 3QZ5B 5CAIA 1MMDA 4M7AG 1Y71A 2DD5A 2JOYA 3M4YA 2GGRA 1WLPB 4MFDA 2C0TA 3H0HA 1D3BB 2QA4Q 1N8RU 3H0FA 3CCST 3LGFA 2AHJB 3GOXA 2KBTA 1PSEA 3EOCB 3C12A 4RKUE 4XU2A 1K9MR 4MMKA 3I9QA 2RHYA 5HY6A 4F6UB 1OZ3A 3I35A 4OGCA 1Q7YU 1JSTB 3BW1A 3VYGA 1QMCA 1KIKA 3GTMS 1VQ8T 4N4IA 4A54A 3JB9D 2DXTA 1G8XA 1IHVA 2HL5C 1N6AA 4J9DA 1VUBA 5A0LA 1ZUUA 2Y4XA 2HSPA 2E5QA 1RAGB 1SPKA 5I21A 4CRIA 3NHNA 3WVDB 1M2OA 1R0CB 1VYWB 3O5ZA 5A0DA 2QDYB 4LDVA 3GPLA 2QGSA 5D6WA 2EW3A 2P84A 1PD0A 2JTFA 3FB9A 2HL3A 1RAHB 3QKJA 4RTTA 3F5XB 4ZNXA 1Q82R 2LQ8A 2CZ0B 4ZN1A 5GMKi 4F7UE 4M78B 2OAUA 3TNHB 5I22A 1VQLT 3PO3S 2XMFA 4C8QG 2DZ9A 3O0GD 5EFQB 3HB9A 2DTHA 3J81E 2M16A 2EWNA 1YJ9A 2IN3A 4BCND 2ECZA 4IUPA 5LJ5h 2PVDB 3CC2T 3A5ZB 1U1SA 4XTYA 2V1QA 4D8DA 2RQWA 1Y0MA 3QG1A 5GAMf 4X9DA 5CIUA 4A53A 2BKZB 3ER0A 1SSHA 4OB2B 1QP3A 3Q1JA 4LNPA 3CD6T 1KHCA 2NUTB 1ACMB 4ELYC 4HL4A 1ZQ1A 4M77F 4OB3B 1P92A 1OEBA 2EJGA 2C4GB 3AT1B 1T3SA 3EFSA 4PJOF 2DVJA 5FU6B 4ZN3A 3BFMA 2E41A 2ABLA 2C6TB 4BBSM 3PVQA 2K79A 2RJCA 5LJ3f 1TOVA 2CDTA 4E7KA 2ZPFB 1S72A 4PJNA 2MYSA 3HBLA 4LD6A 2UZBB 2RB6A 2WSEE 3QYEA 3RESA 1AZEA 4J7FA 2PMIB 3OS2A 2EQJA 3ZEHA 1MMNA 4YOSA 3GF5A 3R6OA 2DD4A 2CCHB 5FU6C 5LJ3g 2YUPA 2WHBB 1E6HA 2WMAB 1AWOA 3CXCP 4GLMA 2KROA 4XTVA 1Y07A 4HCCA 4BI4A 4ROCA 2FPEA 4ZGDB 3V8LA 2LQKA 1H1RB 5DQWA 2PVOB 2MOXA 2H3EB 2E6ZA 5IAYA 1OU8A 3M56A 4CFXB 4BY7X 1YN8A 5GMKj 1Q86U 1ZUKA 2VV5A 4N4HA 2KGTA 1NZ9A 5GAN2 3QYHB 1EIFA 1YP5A 4KT0E 1Q82C 2P4RA 3JB9H 3L1AA 2DIQA 5KYXB 2DA9A 2XKOC 3EG0A 2XD0A 4PLLA 1ENWA 2RJFA 1B34B 2ED1A 3OBWA 1X6GA 2X4YA 2JS2A 4EIKA 1YIJA 4BCPB 3M0PA 2AKLA 4EOSB 1HK9A 2KMTA 3V8KA 1GUXB 2BIVA 4PJLA 4M77A 3L2UA 3QDRB 1D0XA 1OKWB 1OI1A 3HP9A 3SFMA 3HPWA 3JCMP 5J3BA 1VQPT 1M2VA 5GAOn 4PJOA 1BU1A 1WQWA 5GAN8 2KR6A 1MV3A 3P8HA 2DX1A 2L89A 3GP8A 4CC4B 3X28B 3JCMh 4JZ4A 5GANd 2CH4W 4EOJB 3HRTA 2OTJA 1T0JA 1X75C 3JB9J 3FLGA 2E70A 2RH2A 2K57A 1JO8A 1YJWA 1N9SA 2WJ9A 1YFNA 3EG3A 1VYUA 3OYMA 2BZXA 4EMGA 2DEUA 1KD1U 2B8AA 2J6FA 3CPWA 4LDWA 8ATCB 3RERA 4XTZA 4DBFA 2X35A 4M7DB 2O4XB 3VU3C 1HYOA 1OQKA 4C0ZA 5L2WB 2QQ8A 2QDLA 2LQNA 1RUWA 2CT4A 1LJOA 2WEVB 4C92C 3CCRA 5KH6A 1IB8A 3RUXA 1RAIB 2QAZA 4FSXA 4Q5WA 1ZUYA 3U23A 3OYJA 1OL2B 2MWOA 4M7DC 2RHXA 3CCUA 1SHGA 3M0SA 5CKFA 3C94A 3VS1A 1WJRA 2V1RA 5GAOl 5KYUA 2P4TA 4LUDA 2XU8A 1NLOC 2OTJQ 4O5VA 3QWLA 2KK4A 4R55A 4JS5A 4LE9A 2DL8A 4KGZB 5FWCA 2C5XB 4BDYA 1YJWQ 2A28A 3CC4Q 1K73R 2FO0A 1AD6A 3LH5A 4RG8A 2ED0A 1RAEB 2M02A 4JPBW 3E1SA 4MDWA 4AG2C 2EIFA 3HHTB 3SB2A 1KQ1A 1GH6B 1SF9A 2MMPA 2MCNA 1V76A 5LJ3h 3OMGA 3DTOA 1VQ8A 1EFNA 2VXEA 2IG0A 3DOGB 7AT1B 1TD6A 1M27C 2JZ2A 3UDCA 1VQ9T 3OSVA 2FYKA 4Z88A 2WPAB 1I8FA 1UGSB 3CCRQ 2CGHA 2KT1A 1YJ9T 2XHCA 1NPPA 1V1CA 4C92E 2H8HA 4RTXA 3KFVA 3EGXB 1ZLMA 1TWBA 2F1LA 4HCBA 5CKHA 5HQ0B 2GBQA 2LVMA 4HA8A 2X4JA 4EMKA 4M7DE 1I1JA 1EZZB 3CCVQ 2BE7D 1RLPC 1ZHIA 2ZPHB 2P0PA 3RKYA 3LWIA 2HQHA 3EH2A 2HQXA 4EOOB 5L23A 4RTYA 2NYSA 1VQLA 4UC4A 1D0ZA 3MCAB 3CCSQ 2DZCA 1BK2A 4M75B 4II1A 2O01E 4MZTA 1FMKA 4GBQA 3KBGA 2A7YA 2RJDA 2PTKA 5GAMd 5GMKe 5IHKA 1H92A 2AZSA 2JMCA 1K0SA 1BI3A 2WFYB 5M9OA 1C0MA 3BDUA 2WACA 4IUUA 4J9EA 2EGAA 2QGGA 2QXFA 4C92D 2XDBA 1IHWA 4M7AF 3THKA 4CFUB 5KYYA 1S72T 1VQ8Q 1A0NB 1JRIA 3REBB 4RCCA 3OBYA 3CCJT 2W9FA 1E7PA 4M75C 4F7SB 3NFCA 3CD6A 4HT9A 5I2SA 3QWYA 1M90R 1I07A 3MP1A 1OV3A 2ZAEA 1F5QB 2HEQA 5GAN3 3GNGA 2GFUA 3UATA 1KQ2A 3QPHA 5AYFA 3BHUB 3M4GA 1X43A 3CMET 1MUZA 2G77A 3M54A 4PJJA 1K73C 2A08A 5CR2A 2CUDA 4L6V5 2QEXA 4OP0A 3G7ZA 3MEVA 2LC4A 3FDRA 2PNIA 4J9CA 3PIPA 2A3LA 4BCQD 1G3YA 5HK3A 1SG5A 4FIBA 4HVUA 3SWNC 5BNJB 1O9SA 1VQLQ 3G33B 1PC0A 1PRMC 1H26B 5HK0A 2FPDA 3VRZA 3CC7A 4Y72B 2HAXA 4F04B 3OY9A 1OZ2A 1NJIR 3HRSA 2HCKA 3MJXA 5CEIB 3T9NA 3OYAA 2NUPA 1IGUA 1M4ZA 1VQ7A 3G71A 1H1QB 4CC7A 3M03A 1WHMA 1WXUA 3CC2Q 3JAME 2HNIA 2Y90A 5GAOp 3PFSA 1P5EB 4JDSA 1WHLA 1UG1A 3FEOA 2RHIA 1K1ZA 1WZOA 2JS0A 2SRCA 3H6ZA 1W4SA 3M59A 1O9KA 4C8QF 4NL3A 1YIJT 4HVVA 3CD6Q 3RBBB 4ANJA 4JZ3A 4Y28E 2EQUA 4KGVB 1RI9A 3H9NA 2JVVA 4M75E 4TTHA 3S6WA 1B07A 2YRCA 2CP0A 2YWWA 2QG9B 5HNBB 1AISB 1I4K1 3V7RA 3NPFA 1QVFP 4F6WB 2RQUA 3S3OA 4M7AA 2AK5A 5EG2A 4YOZA 4RCBA 1G3TA 1M8MA 4A4EA 1QLYA 2DD5B 1MHNA 2AIRB 4BE2A 2DM1A 1SRMA 2M0OA 4EONB 3UT1A 3GBQA 4FW2A 1CSKA 1U3OA 4RTWA 2F2VA 5A2QE 2IW9B 3PTAA 3KXTA 4EOKB 4JUVA 2YRVA 4HCKA 2EPDA 2EQMA 3QO3A 3BG9A 4BCNB 4BD3A 4KRDB 3M57A 3I56T 1KQSA 5ICPB 1OIUB 3X26B 2BZYA 2G9XB 3VYGB 3HZJA 2EYYA 1M90C 1Z9QA 3NDQA 5FLXE 3MO8A 1JXMA 2HQEA
chains in the Genus database with same CATH topology
3X20B 1QP3A 4QVDA 2L3RA 3Q1JA 5CO7A 4Z02A 5GAOr 3CD6T 1KHCA 3CC4A 1OYXA 3JSCA 2KMGA 1VIFA 4ELYC 4Z6YA 4HL4A 1ZQ1A 3UPUA 4M77F 3SD4A 4OB3B 1P92A 4KUIA 2EJGA 5LJ5j 1KQSS 1BI1A 3EFSA 4PJOF 1AHJB 5FU6B 3SWNB 3FRNA 4ZN3A 3HFNA 2RI5A 5LJ3d 1H641 2BS3A 4NC6A 3F70A 4C5HA 2BS2A 3BFMA 2E41A 1HXDA 3CCUT 4BBSM 1U8RA 2RJCA 4E7IA 5LJ3f 4E7KA 1B34A 2ZPFB 3HSBA 4JX5A 1VQ5A 4M7AB 2D9TA 1S72A 4EMKB 5LJ3e 3HBLA 4ZTJA 1H3ZA 4M7AD 4QSHA 4LD6A 2RB6A 2WSEE 3TCJA 4M7DG 3QYEA 3RESA 3I55A 1NJIC 4J7FA 3OS2A 4XTWA 4JRPA 2EQJA 3ZEHA 3GF5A 4C8QA 3R6OA 5KCOA 3MEWA 3A8GB 1G5VA 4C0DC 2DD4A 2KSSA 4QQDA 5CVIA 1BKBA 5FU6C 4L5GA 5LJ3g 3CCEA 4LOCA 3JCMJ 4XAXB 2DXCB 3PMTA 3OYHA 2LT4A 3CMAT 2PUKB 5KCHA 4J6XA 4J6YA 4M77G 5FRMA 1QVFA 5IN1A 5GMKh 4XTVA 4QW2A 2CZ1B 3VUBA 3FIFA 1Y07A 5GAN7 1VQOA 4HCCA 2RA2A 4BI4A 4M7AC 4PJOG 4X9CA 3PIOA 1YJNT 4ZGDB 5C6SA 3A8HB 3LX7A 3OYDA 4M6VA 3URGA 2MF2A 2X4XA 4J7IA 5GAMh 3JCMf 3CCVA 3QBYA 2DXBB 3P8DA 4YTLA 2LQKA 3V8LA 2QQ9A 3MEUA 1K8AU 2EJFA 2F5KA 3JCMe 5CKEA 2PVOB 2R5AA 1UGPB 2DVEA 2ZCFB 2QDJA 3WVEB 2QF7A 1U1TA 2E6ZA 5IAYA 2LNVA 1WJSA 1M5Q1 3M56A 5GANj 3TW6A 5DM7R 3DLLA 5GMKj 3CCSA 1Q86U 4DA4A 4N4HA 2VV5A 4FM4B 3JCMg 3HRUA 3JCMW 1NZ9A 5GAN2 1QVFS 2VXFA 3QYHB 1EIFA 4MFEA 3OYLA 4KT0E 2EAYA 1Q82C 3JB9H 3L1AA 5D6YA 3G6EA 4HNVA 1V29B 2DIQA 3FC3A 1N8RC 4N0AA 4C92A 2XKOC 1Y7XA 4PNOA 4C0GA 3DKMA 2XD0A 4PLLA 4TVRA 3CCLT 3KUFA 3QUIA 2RJFA 4ME7A 1B34B 1Y96A 3OBWA 2RI3A 2DIGA 4BE1A 3DLMA 3PNWC 4M78F 4M7DA 2O4XA 4BDZA 2F5TX 5GAOq 2X4YA 3CBMA 3OYCA 4JRQA 1Q7YC 1YHQT 1G3SA 1YI2T 3QIIA 2ZPEB 2DXUA 2PUOB 4C8QB 1YIJA 1Q81C 3M58A 3BG5A 1HK9A 2KMTA 4C8QD 3V8KA 3OYNA 1VQ9A 1VIEA 3LLRA 3QJYA 2BIVA 3X25B 3MP6A 4M75F 2E64A 2WSCE 4M77A 1VQKA 3OSSC 3OYIA 2BKDN 3QDRB 5LL6S 2K5IA 3L2UA 1OI1A 3HP9A 4DOVA 2FVUA 3SFMA 3GIBA 1BYMA 4OB0B 3HPWA 3JCMP 5J3BA 1VQPT 1KC8C 5GAOn 1VQMT 4PJOA 2ZZDB 1X6OA 1WQWA 4FT4A 5GAN8 4MDXA 3V8JA 3ME9A 3JCMb 2XICA 2KR6A 4P5NA 3P8HA 2RHZA 2L89A 3P8BB 2NLUA 4BBRM 1N27A 4FT2A 5L8RE 4JRKA 3RIRA 4E7LA 3GP8A 3N5BB 4IKFA 1M8VA 3X28B 2DEQA 2LTOA 2RK2A 4C8QC 4M7AE 3JCMh 3JCMV 1M1FA 2XIDA 4E47A 3JCMX 5GANd 4F7UF 2LT1A 1LNXA 3HRTA 2OTJA 2MWPA 1X75C 3RMQA 3JB9J 3CXCA 3BG3A 2LDMA 3FLGA 4O6JA 2OTLT 3EFRA 2E70A 2EJ9A 2RH2A 3ASKA 4PL6A 2K57A 1YJWA 2KDSA 1VQPA 1N9SA 2WJ9A 4MIMA 2K5LA 3OYMA 1M1GA 2P0KA 2DKGA 4A4FA 4LDYA 4EMGA 4ELZC 5GAN5 5EJCA 1K73U 2ZPGB 2RI2A 4VUBA 2QQBA 3A8OB 2GCXA 1N9RA 4M75G 3MHXA 2WSFE 4C0DB 3EAEA 1KD1U 1UEBA 4AI6A 3RKXA 2B8AA 2I2LA 4KUDK 2VC8A 3CPWA 4JS4A 4LDWA 2D0QB 3UWNA 3OS1A 4GY5A 3CC2A 2RHUA 1Y96B 4JX4A 3RERA 4AKHA 4C92G 4XTZA 1XTDA 2XDDA 3CCMA 2X35A 3FJPA 4M7DB 4WF2A 2O4XB 2DK3A 5GANe 2F69A 2GQVA 3VU3C 2QEXT 1UB4A 3I55T 5GANf 4M7DD 3L2QA 1RL2A 3CXCS 4C0ZA 4MZPA 4AKGA 3OYGA 2CZ7B 2QQ8A 4Y91A 2C06A 1K9MC 4HLQA 3LGLA 3CCJA 4BACA 3OYKA 4F7UG 2YLBA 5A0GA 3NTHA 2QFZA 4XU0A 4FL6A 1LJOA 2RM4A 4N0AC 4C92C 2CKKA 4JJNK 4LDXA 3HO8A 3CCRA 3CC7T 5KH6A 3RUXA 4A4HA 2HD0A 5GMKm 3OMCA 4QQ6A 3QSUA 4FSXA 4Q5WA 3CPWS 1VQ4A 2V8IA 3OYJA 3CEYA 3M55A 2MWOA 2XI9A 4GLKA 1VQ7T 2RHXA 4M7DC 3G71T 2EQKA 3M5AA 5C0MA 3CCUA 3CMEA 5CKFA 4A4KA 5HKCA 3DL1A 3C94A 2QQRA 4NL2A 1WJRA 4HCZA 5DLOA 5GAOl 5CKDA 3JB9F 2QI2A 2P4TA 2RK1A 3CBPA 1VQ6A 4KBMB 3OS0A 2XU8A 1TH7A 3VYHB 2PQWA 3QWLA 2KK4A 4M78A 4O5VA 4R55A 4JS5A 4M77C 5IT9E 4HT8A 2E12A 5CK9A 4C8QE 5CQXA 4IUQA 2QQSA 4BDYA 4B9XA 5GAOm 1XNIA 3MP8A 4C5IA 2V8KA 4XU1A 2XG8D 4PJOC 3QYBA 4B9WA 4XQ3A 5LJ5d 4D6WA 1YITA 4JLIA 3CMAA 4E7JA 4M75A 3KHIA 2DTOA 3C4SA 2CYZB 1KG1A 3QXEB 3VKIA 4RG8A 5LJ5f 4OB1B 3NTKA 4C0FA 3H4CA 1O75A 3S3MA 1MGQA 3E1SA 2RO0A 4MDWA 1YJNA 3H8ZA 2EIFA 5LJ5e 3HHTB 5GAMj 3E9FA 3SB2A 2RJEA 1KQ1A 4DOWA 2MMPA 1KHIA 5DLQE 4FU6A 2JNGA 2R57A 2VGNA 5LJ3h 3OMGA 3M9QA 2CZ6B 1VQ8A 2VXEA 1RI0A 1PSFA 2IG0A 2JTMA 3PT9A 5LJ5g 1WQ7A 3JB9G 1JJ2A 4F7UA 4RG2A 2L5QA 2FL7A 3JCMc 3JRZA 2JZ2A 4J5YA 3UDCA 3OYBA 1VQ9T 2VYTA 3L2WA 3OSVA 1WGSA 3GNFB 2FYKA 2FHDA 5J26A 2X4WA 1I8FA 1QVGA 2DD4B 1VQKT 1SSFA 2QTXA 4J6WA 1K8AC 3QZ9B 2PU9B 1UGSB 2DJZA 2KAFA 2CGHA 4OMFB 1M1KU 4ZGJB 1BI2A 4KULA 4PLIA 2LCLA 3SWNA 4C5EA 3OYEA 3HKSA 4BE0A 1QVPA 1M90U 1YJ9T 1I81A 2XHCA 3G4ST 4EDUA 3OW2A 1NPPA 4C92E 4A4GA 3CCQA 1Q86C 3LWHA 2FB7A 2JUFA 2EFIA 3QYGB 1VQNA 2LCCA 3INZA 5LJ3j 2M9UA 2XDPA 4HCBA 5CKHA 3META 5GAN6 3GLXA 2LVMA 1QLBA 3OYYA 4HA8A 2X4JA 4EMKA 4M7DE 4QVZA 4BI8B 5CCAA 2OTJT 2ZPIB 1JJ2S 1ZHIA 2ZPHB 2VGMA 3VUZA 2P0PA 3RKYA 1XOVA 2LRQA 4JLGA 3VKHA 3LWIA 1YJWT 3CC4T 1QVGS 1WNLA 4M78G 2HQXA 1NPRA 3DB4A 2KQWA 2QA4A 2DXCA 3MEAA 1VQLA 1D3BA 4UC4A 4M77E 2DAQA 3MCAB 5CKBA 4C5GA 2DZCA 3PMIA 3BY7A 4M75B 4II1A 1X01A 2R58A 2O01E 3QJ6A 4IURA 4MZTA 2ZPBB 4M75D 3NTIA 4X34A 3KBGA 2A7YA 1XQHA 2RJDA 2RD1A 4AKIA 3BDLA 2CS7A 2K4YA 5GMKe 5GAMd 3S3NA 4PJOE 4HNTA 3I56A 1BI3A 3L42A 5M9OA 2QQAA 4C92B 4QVCA 3BDUA 2WACA 3DB3A 4IUUA 1BI0A 4M78C 3L2VA 2GF7A 2Y4YA 1NJIU 2QXFA 4J83A 4C92D 3CCMT 2XDBA 4IUTA 3HFOA 4EPCA 5GANg 4M7AF 3TW7A 4BUGA 4V2SA 1IZ6A 3L2RA 1VQ5T 3PGGA 5KE2A 1YBYA 1S72T 1W2BA 3RMSA 1JRIA 2VUBA 3ZBDA 4RCCA 1NE8A 1WPYA 4F7UB 3OBYA 3CCJT 2PVGB 2OTLA 1E7PA 1G3WA 3VKGA 3QHSA 4M75C 4OGEA 3NFCA 3CD6A 4HT9A 5GMKl 5GAMg 2YHTA 3OYFA 1KD1C 5I2SA 3CCET 2L8DA 3CCRT 2JN0A 3MP1A 4ZGEB 3E19A 3HL8A 5GAN3 2D6FA 4M77B 3GNGA 4CI0C 5FRNA 2GFUA 1BIAA 3SDZA 4DQ2A 1VQ4T 2BUDA 4LD9K 1JBMA 4M77D 4J8OA 3QPHA 1KQ2A 5AYFA 3OQ5A 3M4GA 4MZMA 3V7CA 1VQOT 4PJOB 3CMET 1FXXA 2HBPA 2ZGWA 1BIBA 5D6XA 3VJPA 2G77A 4PJOD 3M54A 1K73C 3OB9A 3CPFA 5GAN4 2GFAA 1R8OB 1VQ6T 3CBOA 5CR2A 1QW1A 4L6V5 2QEXA 3JB9I 1W2BS 3OS5A 4NOYA 4OP0A 3G7ZA 3CCVT 3MEVA 2EKOA 2LC4A 3O8VA 4R56A 3FDRA 2K3YA 4N4GA 3QZ5B 5CAIA 4M7AG 1Y71A 2MI6A 3PIPA 2A3LA 2DD5A 4EMHA 1G3YA 5DY9A 3ZFJA 5HK3A 4FIBA 2JOYA 1Q82U 3SWNC 3M4YA 4MFDA 1O9SA 1YITT 3A8LB 1D3BB 1N8RU 5HK0A 3CCST 4LDUA 3LGFA 5GANh 2AHJB 3CC7A 3GOXA 3RKWA 1FX7A 2LX9A 1PSEA 2HAXA 5FU7B 1UGQB 3C12A 4RKUE 4XU2A 3OY9A 1OZ2A 4ZTFA 2ZZDA 4MMKA 3HRSA 3M53A 2K2VA 2RHYA 5HY6A 3T9NA 3JCMd 3OYAA 2R5MA 3G6ET 1M4ZA 4EMKC 5CQYA 1VQ7A 3G71A 1OZ3A 4OGCA 2E65A 4PKCC 1Q7YU 1DJ7B 3BW1A 2K5FA 2K3XA 1IREB 3VYGA 2HNIA 2Y90A 5GAOp 3PFSA 1WJQA 4JDSA 3JAME 1Q81U 3FEOA 2RHIA 1VQ8T 4JX6A 4XTUA 4L59A 4N4IA 4ATOA 3A8MB 2G3RA 3E9GA 4M78E 4A54A 3JB9D 1JB0E 2DXTA 4OVAA 3H6ZA 1W4SA 3M59A 4C8QF 1N6AA 4XU3A 1GXIE 2V8JA 1VUBA 4NL3A 1FWZA 1YIJT 2MAMA 5A0LA 5FU7C 1KC8U 2Y4XA 4XK8E 3TREA 2E5QA 2DPPB 4HNUA 4Y28E 2EQUA 3C95A 4BB7A 3VV0A 2P0QA 4IUVA 5I21A 2JVVA 4M75E 4CRIA 2E6NA 3S6WA 3WVDB 4QQGA 3CCQT 5I2MA 3TU4K 4NS5A 4HKEA 5A0DA 2QDYB 2KVQG 1VQNT 2DO3A 2M1HA 4LDVA 3GPLA 5KE3A 4BY6B 1M9SA 5D6WA 5J39A 3L2ZA 2KY9A 1I4K1 5FROA 2BS4A 3V7RA 3CCLA 1I5LA 2JTFA 3FB9A 4BI3A 3QKJA 3S3OA 1FKMA 4M7AA 5EG2A 4JRIA 4RCBA 1G3TA 1QP2A 2CZ0B 2LQ8A 2EYQA 4A4EA 2DD5B 1MHNA 4ZN1A 5GMKi 4F7UE 2YLCA 4M78B 4BE2A 2OAUA 4XTXA 2M0OA 3OA6A 3UT1A 4M78D 1YHQA 1YI2A 3TEEA 3JCMQ 4RMOA 1VQLT 3PTAA 5A2QE 2QA4T 4C8QG 4ELJA 3X24B 2DZ9A 3OW2S 3KXTA 2XK0A 3HB9A 2YRVA 2DTHA 4JUVA 2EQMA 1YCYA 3QO3A 3BG9A 4BY6C 2IVWA 2M16A 1LOJA 2EWNA 4BD3A 3J81E 3M57A 3I56T 3G4SA 4C92F 1YJ9A 2H3JA 1KQSA 2DTIA 3WXMB 3J80E 3J7AF 2E10A 3LYIA 1ZBXA 1UGRB 4IUPA 3X26B 4MMLA 4OF1A 3V7SA 5LJ5h 1VQMA 2PVDB 1M1KC 4E7HA 3VYGB 3CC2T 3HZJA 3A5ZB 1U1SA 4XTYA 3LH0A 1K9MU 4M7DF 1M90C 3QG1A 5GAMf 3AHUA 4X9DA 5CIUA 4A53A 5FLXE 2E1HA 3ER0A 2DXBA 3MO8A 5GAMe 4OB2B 2HQEA 3LW5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X20 B;  1QP3 A;  2WSC E;  4L6V 5;  3HHT B;  4OB0 B;  3QZ5 B;  4OB3 B;  2DD5 A;  2ZZD B;  2CZ6 B;  1PSF A;  1AHJ B;  3A8L B;  5L8R E;  2AHJ B;  3X28 B;  1PSE A;  1UGQ B;  4RKU E;  2ZZD A;  2DD4 B;  3QZ9 B;  2PU9 B;  2ZPF B;  1UGS B;  4ZGJ B;  1DJ7 B;  2WSE E;  1IRE B;  3VYG A;  3A8G B;  3QYG B;  2ZPG B;  3A8M B;  2DD4 A;  3A8O B;  1JB0 E;  2WSF E;  2DXC B;  1GXI E;  2PUK B;  2D0Q B;  4XK8 E;  2ZPI B;  2DPP B;  4Y28 E;  2ZPH B;  2CZ1 B;  3WVD B;  4ZGD B;  3A8H B;  2DXC A;  2QDY B;  2CZ7 B;  2DXB B;  2O01 E;  2ZPB B;  2PVO B;  1UGP B;  2ZCF B;  3WVE B;  1QP2 A;  2CZ0 B;  2DD5 B;  4FM4 B;  3LW5 E;  3QYH B;  4KT0 E;  3X24 B;  1V29 B;  2PVG B;  3VYH B;  4ZGE B;  1UGR B;  3X26 B;  2PVD B;  3VYG B;  2ZPE B;  2PUO B;  2DXB A;  2CYZ B;  3QXE B;  4OB2 B;  3X25 B;  4OB1 B; 
#chains in the Genus database with same CATH topology
 4QVD A;  1PKD B;  4F7N B;  2L3R A;  5GAO r;  4Z02 A;  4Z8A A;  3TSZ A;  1ZSZ A;  4KH0 B;  2EKH A;  2F2W A;  5LJ5 j;  1KXU A;  1AHJ B;  3VRY A;  5HBE B;  2BS2 A;  3CCU T;  2V26 A;  5IHI A;  1D1C A;  4E7I A;  3NMZ C;  4M7A D;  2CT3 A;  1NJI C;  1PRL C;  4JRP A;  4C8Q A;  5KCO A;  1G5V A;  4C0D C;  3CQT A;  1QCN A;  1I0C A;  4EOR B;  2DF6 A;  4L5G A;  1NYF A;  4LOC A;  1D3U B;  3OYH A;  2HMA A;  2PUK B;  2M0Y A;  4J6X A;  4J6Y A;  5FRM A;  3ZL7 C;  4E6R A;  2CZ1 B;  3VUB A;  1VQP Q;  4AT1 B;  3PIO A;  4LUE A;  2DBK A;  3A8H B;  3LX7 A;  3EG9 A;  4M6V A;  3M0Q A;  3URG A;  2MF2 A;  2X4X A;  3JCM f;  3P8D A;  3MEU A;  1JQQ A;  2F5K A;  4LN2 A;  2AKK A;  3I5R A;  2R5A A;  1OX9 A;  1AOJ A;  2QDJ A;  3WVE B;  2QF7 A;  1PNJ A;  1FIN B;  2LNV A;  2YDL A;  5GAN j;  5KYN A;  4F7J B;  4DA4 A;  2KYM A;  3JCM g;  1OPK A;  4MFE A;  2NUZ A;  2EAY A;  2LQW A;  1MV0 B;  1TSF A;  3FC3 A;  4N0A A;  3D7S B;  1Y7X A;  1OIY B;  3CCL T;  1Y96 A;  2BZ8 A;  4M78 F;  5KYW A;  2GTJ A;  1Q81 C;  2PUO B;  2FRY A;  3VS2 A;  1PM3 A;  2MK5 A;  4C8Q D;  1VQ9 A;  1VIE A;  2GTO A;  1QKX A;  3POM A;  2E64 A;  4EOM B;  5AT1 B;  1S1N A;  2K5I A;  5FGK B;  4DOV A;  4DEX A;  4OB0 B;  1KC8 C;  2COZ A;  2ZZD B;  1X6O A;  4FT4 A;  3ME9 A;  2ROT A;  3DDP B;  4P5N A;  5L8R E;  4BBR M;  1N27 A;  1K8A R;  4E7L A;  3RIR A;  4IKF A;  1GBQ A;  2RK2 A;  1OKV B;  3QHW B;  2LTO A;  3JCM V;  3JCM X;  4OMQ A;  3VS7 A;  2X9H A;  4A63 B;  3CXC A;  4F16 A;  2YXY A;  1XJW B;  3EFR A;  4PL6 A;  2X1N B;  1OI9 B;  4MIM A;  2K5L A;  1M1G A;  2P0K A;  2UUE B;  4OMN A;  1JJ2 P;  3TQ7 P;  5EJC A;  4VUB A;  2GCX A;  1N9R A;  3EAE A;  4Y92 A;  3RKX A;  1QVG P;  2VC8 A;  4KUD K;  2D0Q B;  1ZA1 B;  9ATC B;  2RHU A;  4JX4 A;  1CKB A;  2OJ2 A;  2DER A;  3FJP A;  2DK3 A;  2EGE A;  2F69 A;  2QEX T;  1D1B A;  3OW2 P;  2LP5 A;  2RF0 A;  3G1J A;  1WHJ A;  2CZ7 B;  2C06 A;  1K9M C;  3CCJ A;  3OYK A;  4F7U G;  5A0G A;  1VQ9 Q;  3NTH A;  1M3C A;  2VB6 A;  1YNZ A;  2QFZ A;  1WHH A;  4J9H A;  2RM4 A;  2CCI B;  4JJN K;  4LDX A;  1VA7 A;  3HO8 A;  2A36 A;  3CC7 T;  1GL5 A;  4A4H A;  4AFU C;  1WHG A;  4QQ6 A;  3CPW S;  1YJ9 Q;  2W2H A;  5FWB A;  3CEY A;  1HJD A;  1VQ7 T;  2JJ9 A;  3G71 T;  2EQK A;  3CME A;  1GY3 B;  3DL1 A;  3BLQ B;  3H41 A;  2QI2 A;  3EH1 A;  2LJ1 A;  3OS0 A;  2YSQ A;  1TH7 A;  4M78 A;  1VOL A;  2J6K A;  4M77 C;  2LJ3 A;  2E12 A;  4JJC A;  1H1S B;  1BCM A;  5GAO m;  1AWW A;  1XNI A;  2JXB A;  3MP8 A;  4XU1 A;  2XG8 D;  3EGD A;  3QYB A;  4PJO C;  5LJ5 d;  1B3Q A;  4JLI A;  1W2B P;  3CMA A;  4AG1 C;  3C4S A;  2CYZ B;  5HBH B;  1UFF A;  2W99 A;  1WYX A;  4J9F A;  3ULR B;  2PZ1 A;  1YJN A;  5HVY B;  1K76 A;  5LJ5 e;  5GAM j;  3E9F A;  2RJE A;  2MIO A;  3EGU A;  4FW1 A;  1KHI A;  5DLQ E;  1X6B A;  2JNG A;  1JSU B;  2R57 A;  1VYT A;  1S72 Q;  2CZ6 B;  3MKD A;  3PT9 A;  2IW8 B;  1D0Y A;  2J05 A;  4RG2 A;  3CCJ Q;  4J5Y A;  2DE0 X;  1WGS A;  2FHD A;  2KEA A;  2X4W A;  2C0I A;  1C6V X;  2QTX A;  1K8A C;  2PU9 B;  4OMF B;  1BI2 A;  4PLI A;  4K11 A;  3HKS A;  2K6D A;  4EDU A;  4A4G A;  2JUF A;  3CME Q;  4BCG B;  5LJ3 j;  1GFD A;  2X51 A;  2M9U A;  5KYU B;  2K9G A;  4BI8 B;  1QCO A;  1EX4 A;  1XOV A;  2EVR A;  2FPF A;  3K7A M;  4JLG A;  4HVW A;  2IW6 B;  1WXB A;  1WNL A;  4M78 G;  4FCY A;  4J9I A;  5IHY A;  3R6N A;  4C5G A;  5CKB A;  4M77 E;  2MPX C;  1OX8 A;  2R58 A;  3QJ6 A;  4IUR A;  5GAN e;  3BDL A;  4AKI A;  4PJO E;  2K4Y A;  2L3S A;  3I56 A;  2QQA A;  4C92 B;  3DB3 A;  2Y4Y A;  2ATC B;  4M4Z A;  2KRN A;  1RAB B;  3TW7 A;  4V2S A;  3PGG A;  4FYW B;  3QWX X;  2VUB A;  3ZBD A;  2OTL A;  3QHS A;  1TG0 A;  1YIJ Q;  1M1K R;  2YHT A;  3OYF A;  2KRM A;  2ROL A;  2JN0 A;  3HL8 A;  3SDZ A;  5KYX A;  4IMY B;  4M77 D;  1H4L D;  4MZM A;  3V7C A;  2EYX A;  2ZGW A;  1BIB A;  4PJO D;  2EBP A;  1W70 A;  1R8O B;  1VQ6 T;  3CBO A;  3OS5 A;  1NLP C;  4N4G A;  4BCQ B;  2HZY A;  1TFB A;  2HBW A;  2QYZ A;  3SHW A;  1Q82 U;  3RNJ A;  3A8L B;  2G6F X;  1OPL A;  1J3T A;  1FX7 A;  2DBM A;  3LQ5 B;  3M53 A;  2K2V A;  3JCM d;  2PK9 B;  3I56 Q;  2R5M A;  1RAD B;  4EMK C;  5CQY A;  2LMJ A;  3TN8 B;  2DL3 A;  2K5F A;  3B57 A;  4Z89 A;  3CPW P;  4XTU A;  4L59 A;  4ATO A;  3A8M B;  2DYB A;  5D7U A;  4OVA A;  1WFW A;  1GXI E;  1BCO A;  4XK8 E;  4DBH A;  2DPP B;  2L2P A;  4HNU A;  3C95 A;  4BB7 A;  3VV0 A;  2HSE B;  4IUV A;  4HKE A;  1E9H B;  2D1X A;  2KE9 A;  1VQN T;  2M1H A;  2E3I A;  5KE3 A;  1R77 A;  4BY6 B;  3QDF A;  1M9S A;  3CCU Q;  1GCQ A;  3TVT A;  1W1F A;  2KY9 A;  5FRO A;  3CCL A;  2K2M A;  1U06 A;  1NG2 A;  1LCK A;  1FKM A;  2JM8 A;  4JRI A;  1QP2 A;  2EYQ A;  2QTV A;  1N8R R;  4XTX A;  2CP2 A;  1WDX A;  1OU9 A;  3TNI B;  4RMO A;  2YT6 A;  2XK0 A;  1UDL A;  4BY6 C;  2IVW A;  1LOJ A;  3G4S A;  1Q7Y R;  2NUP B;  1AVZ C;  4QT7 A;  3TNW B;  3J7A F;  3LYI A;  1ZBX A;  1UGR B;  4OF1 A;  3V7S A;  1KFZ A;  3MPU B;  1M1K C;  1NBE B;  2SEM A;  1ABQ A;  4CC2 A;  3LH0 A;  4BCK B;  1WX6 A;  3AHU A;  2C5O B;  2E1H A;  3MIA B;  1C1A A;  2DXB A;  2ESW A;  2X3X D;  5GAM e;  3X20 B;  4ROE A;  2QAS A;  1NEG A;  2R7G A;  2DNU A;  1OYX A;  5IF1 B;  3MY1 B;  2BPM B;  1VIF A;  3EFO A;  2RQR A;  1ZSG A;  4I3Z B;  2UZL B;  4KUI A;  1N4M A;  1KK7 A;  2YUN A;  1WXT A;  1KQS S;  1BI1 A;  4AFQ C;  1PKS A;  3SWN B;  3FRN A;  5IXB A;  2RI5 A;  5LJ3 d;  1H64 1;  2E5K A;  4NC6 A;  3F70 A;  4C5H A;  4OGR B;  1HXD A;  4J9B A;  1H27 B;  3CCL Q;  2C5V B;  2KXC A;  3HSB A;  4JX5 A;  1VQ5 A;  4M7A B;  2D9T A;  5LQF B;  5LJ3 e;  4NST B;  1H3Z A;  1YCS B;  4QSH A;  4M7D G;  4UN0 A;  3MI9 B;  4BY1 X;  3MEW A;  3A8G B;  1X2Q A;  4IIM A;  2KSS A;  2J6O A;  5CVI A;  3CCE A;  3JCM J;  4FYV B;  2DXC B;  4XAX B;  2OI3 A;  2E4H A;  2LT4 A;  3CMA T;  1UUE A;  1QVF A;  1BB9 A;  5IN1 A;  4QW2 A;  1Y57 A;  3FIF A;  1VQO A;  2RA2 A;  4M7A C;  4X9C A;  1YJN T;  1Q95 G;  3OYD A;  4J7I A;  3QBY A;  4YTL A;  1UGP B;  2DVE A;  1U1T A;  1WJS A;  3TW6 A;  2E3H A;  3DLL A;  4CRL B;  2UZE B;  4FM4 B;  2EYZ A;  3HRU A;  3OYL A;  5D6Y A;  3G6E A;  1V29 B;  2IIM A;  1N8R C;  1T0H A;  4BCJ B;  4C0G A;  2GQI A;  1GFC A;  4TVR A;  1ZP2 A;  4ME7 A;  1U5S A;  2RI3 A;  2RMO A;  3DLM A;  2Z0W A;  4BDZ A;  2QEX Q;  1ZSZ C;  2F5T X;  3CBM A;  1Q7Y C;  2CRE A;  1YHQ T;  1YI2 T;  5I5Z B;  2DXU A;  4C8Q B;  2B9R A;  1PD1 A;  1JOW A;  3CCE Q;  3OYN A;  1TUD A;  1H3H A;  3LLR A;  3QJY A;  5IDP B;  2HKN A;  4BCM D;  2WSC E;  2FZC B;  3UF4 A;  3OSS C;  1FVV B;  2BKD N;  5LL6 S;  3OYI A;  3CC7 Q;  1RAF B;  3GIB A;  1IO6 A;  3VS4 A;  1W98 B;  4AMC A;  2FRW A;  1VQM T;  4MDX A;  4KRC B;  1VQ7 Q;  3G71 Q;  3EG9 B;  1PG5 B;  2RHZ A;  3P8B B;  4JRK A;  2DRM A;  2DEQ A;  4C8Q C;  4M7A E;  3EHQ A;  1M1F A;  2XID A;  4E47 A;  4F7U F;  2LT1 A;  2MWP A;  2V22 B;  1Q86 R;  2OTL T;  2EJ9 A;  4ORZ A;  4YOO A;  2L0A A;  2KDS A;  4CFM B;  1G83 A;  4A4F A;  4ELZ C;  2DKG A;  4LDY A;  5GAN 5;  1K73 U;  2ZPG B;  2YUO A;  4M75 G;  3MHX A;  2D0N A;  8AT1 B;  4C0D B;  3JV3 A;  1UEB A;  1WHK A;  1RLQ C;  3RR6 A;  5ACB A;  3OS1 A;  1ZX6 A;  1Y96 B;  2W0Z A;  2XDD A;  1XTD A;  4DEY A;  5KYW B;  1YWP A;  1PHT A;  3I55 T;  3L2Q A;  3CXC S;  3OYG A;  4Y91 A;  1C9B A;  4HLQ A;  4BAC A;  2YLB A;  2QK0 A;  4RTZ A;  4FL6 A;  4N0A C;  1RAA B;  1ZBJ A;  1E7O A;  2FZG B;  2CP3 A;  2HD0 A;  1FMW A;  1ARK A;  2LNH B;  2XI9 A;  4BCO B;  2KRS A;  5IXF A;  4A4K A;  5HKC A;  1VYV A;  1FYN A;  2JM9 A;  4NL2 A;  5LMK B;  4HCZ A;  2K3B A;  5DLO A;  1KQS P;  5CKD A;  4II5 B;  1PKT A;  3CBP A;  1VQ6 A;  5I11 A;  5ECA A;  3VYH B;  2PQW A;  2O2O A;  5IT9 E;  4HT8 A;  1JXO A;  4D8K A;  4C8Q E;  5CQX A;  4IUQ A;  2QQS A;  2JGZ B;  4FSS A;  4C5I A;  2V8K A;  4B9W A;  2F2X A;  4XQ3 A;  2W96 A;  4D6W A;  1MMG A;  1KD1 R;  2DTO A;  4PFO A;  4QKU A;  1KG1 A;  3VKI A;  4OB1 B;  3I5S A;  3NTK A;  4C0F A;  1O75 A;  2RO0 A;  1KSW A;  1ZA2 B;  3H8Z A;  1FMV A;  2A0F B;  2O88 A;  2VGN A;  2DJQ A;  3RDV A;  1RI0 A;  2JTM A;  2FZK B;  3JB9 G;  1JJ2 A;  2C0O A;  4RUG A;  4F7U A;  4F6S B;  2L5Q A;  3JCM c;  1OL1 B;  5HCK A;  4CFN B;  3EJ1 B;  3OYB A;  3L2W A;  3GNF B;  1PWT A;  1QVG A;  2DD4 B;  1VQK T;  1SSF A;  3BLH B;  3QZ9 B;  2DJZ A;  2LCL A;  2F2C A;  1WA7 A;  4C5E A;  1M90 U;  3G4S T;  1ABO A;  1UGV A;  3OW2 A;  1X69 A;  3EID B;  1Q86 C;  3QYG B;  1VQN A;  2XDP A;  2RN8 A;  2CH4 A;  4B6M A;  3MET A;  5GAN 6;  1VQ6 Q;  1AT1 B;  4QVZ A;  2JMA A;  5CCA A;  2ZPI B;  2YUQ A;  2VGM A;  3VUZ A;  3VKH A;  4BCI B;  5GJV B;  3EGD B;  2K7A A;  2KQW A;  3DB4 A;  2DME A;  1D3B A;  3BY7 A;  2VWF A;  4X34 A;  1XQH A;  3S3N A;  4HNT A;  3L42 A;  4PFZ A;  4M78 C;  1WI7 A;  1NJI U;  2GF7 A;  1UNG D;  4JJD A;  4J83 A;  3CCM T;  4EPC A;  2W9Z A;  4BUG A;  1IZ6 A;  1VQ5 T;  1YBY A;  1W2B A;  3M0U A;  1WPY A;  4RTU A;  1G3W A;  3VKG A;  2EYW A;  4ROD A;  5GAM g;  3CCE T;  4ZGE B;  3E19 A;  4M77 B;  2AT1 B;  1BIA A;  1VQ4 T;  4LD9 K;  2WXV B;  4FYY B;  4J8O A;  3OQ5 A;  1VQO T;  1M2V B;  4PJO B;  2HBP A;  1VQN Q;  3CPF A;  1K9A A;  4EC8 B;  2DYI A;  1KD1 C;  4NOY A;  2EKO A;  2L3Q A;  3O8V A;  2K3Y A;  2UZD B;  1H24 B;  2MI6 A;  4KGX B;  4EMH A;  5DY9 A;  3ZFJ A;  1SKU B;  1YIT T;  4LDU A;  5GAN h;  3RKW A;  1E6G A;  2LX9 A;  5FU7 B;  1UGQ B;  1VOM A;  4ZTF A;  2ZZD A;  3G6E T;  1GBR A;  4CFW B;  2DET A;  3H0I A;  2E65 A;  4PKC C;  1DJ7 B;  1IRX A;  3VS3 A;  2K3X A;  1IRE B;  2CUB A;  1Q81 U;  1WJQ A;  3UA7 A;  4JX6 A;  3E9G A;  2G3R A;  1AD5 A;  2J7I A;  4M78 E;  1JB0 E;  1TXQ A;  2EQI A;  4XU3 A;  2V8J A;  1FWZ A;  2MAM A;  5FU7 C;  1KC8 U;  3TRE A;  1M3A A;  2NUT A;  4BXX X;  2P0Q A;  2AZV A;  4PK4 A;  2E6N A;  4QQG A;  4DBQ A;  3CCQ T;  5I2M A;  3TU4 K;  4NS5 A;  1AZG B;  2KVQ G;  2DO3 A;  2DL5 A;  2LZ6 B;  5J39 A;  3L2Z A;  2BS4 A;  1TS9 A;  5HBJ B;  1I5L A;  1LPL A;  4BI3 A;  1I5O B;  4F7L B;  3NGP A;  3DJB A;  3A98 A;  2YLC A;  4ESR A;  3OA6 A;  1UJ0 A;  3FJ5 A;  2CSQ A;  4F14 A;  4M78 D;  1YHQ A;  1YI2 A;  3TEE A;  3JCM Q;  2QA4 T;  4G6L B;  4ELJ A;  3X24 B;  3A1P A;  3BHT B;  2KYB A;  1YCY A;  3CMA Q;  1GRI A;  4C92 F;  2H3J A;  2DTI A;  3WXM B;  3J80 E;  5CYI B;  2E10 A;  2CP7 A;  1UHF A;  2W10 A;  4MML A;  1VQM A;  1SRL A;  1NEB A;  2LCS A;  4E7H A;  1YJN Q;  1QKW A;  1K9M U;  4FYX B;  4EC9 B;  4M7D F;  6AT1 B;  1PCX A;  4OMM A;  2X3W D;  1Z9Z A;  3LW5 E;  4WTO B;  5CO7 A;  4AFS C;  1QWF A;  3CC4 A;  1UNH D;  1G3N C;  1OOT A;  3JSC A;  2DRK A;  2KMG A;  4EOI B;  4Z6Y A;  3UPU A;  3SD4 A;  2NWM A;  3UA6 A;  3BLR B;  4YC3 B;  3HFN A;  2D8J A;  2BS3 A;  2OX7 A;  3QHR B;  1U8R A;  1GCP A;  1B34 A;  1IGQ A;  1VIN A;  4EMK B;  4ZTJ A;  2GNC A;  5EC7 A;  3PE0 A;  3TCJ A;  3I55 A;  1X2K A;  1T3L A;  3EG1 A;  1H8K A;  4XTW A;  1X27 A;  1YI2 Q;  1YHQ Q;  4QQD A;  1HSQ A;  1BKB A;  1GUX A;  3PMT A;  1UTI A;  5KCH A;  1GCQ C;  2JTE A;  4M77 G;  2EGC A;  5GMK h;  2L3P A;  5GAN 7;  2VVK A;  1VQM Q;  1QCF A;  4HXJ A;  4PJO G;  2DIL A;  5C6S A;  4DBR A;  1B7T A;  4WCI A;  5GAM h;  3CCV A;  2DXB B;  3E2U A;  2QQ9 A;  5KYY B;  1KJW A;  1K8A U;  2EJF A;  3JCM e;  5CKE A;  1QWE A;  2DL7 A;  1URC B;  2ZCF B;  1QQJ A;  4OML A;  2CJM B;  2OTL Q;  2O9S A;  3EFO B;  1M5Q 1;  2IVX A;  5DM7 R;  2CP6 A;  3CCS A;  2BE9 B;  1R0B G;  1UJY A;  4OMP A;  2KNB B;  3JCM W;  1QVF S;  2VXF A;  4E7S A;  4HNV A;  1NYG A;  5IDN B;  4CFV B;  4CXA B;  4R0K A;  4C92 A;  2CSI A;  4PNO A;  3DKM A;  4X1V A;  5GJW B;  3DDQ B;  3KUF A;  3QUI A;  3MY5 B;  2DIG A;  4BE1 A;  4E7Z A;  3PNW C;  4M7D A;  1TU0 B;  2O4X A;  2DFU A;  3I55 Q;  5GAO q;  3OYC A;  4JRQ A;  1G3S A;  3QII A;  2ZPE B;  4EOQ B;  3M58 A;  3VS0 A;  3BG5 A;  2C5N B;  4BCM B;  4AFZ C;  3X25 B;  3MP6 A;  4M75 F;  1VQK A;  1K4U S;  1H25 B;  1BYM A;  2FVU A;  4CC3 A;  1MNE A;  1UE9 A;  3HTR A;  3V8J A;  2IPO B;  3JCM b;  1D1A A;  2FG0 A;  2XIC A;  2DMO A;  2NLU A;  4FT2 A;  1H28 B;  3N5B B;  1M8V A;  4ELL A;  2WIH B;  1TUC A;  1YWO A;  1W6X A;  1UHC A;  1LNX A;  3RMQ A;  4OR5 B;  3BG3 A;  2LDM A;  4O6J A;  3M0T A;  1O9K B;  3ASK A;  2PK2 A;  1TUG B;  2I53 A;  4FX3 B;  2JT4 A;  2O31 A;  3EHR A;  2RI2 A;  2O9V A;  2QQB A;  3A8O B;  4LXC A;  2WSF E;  4AI6 A;  5IHN A;  2I2L A;  4JS4 A;  3UWN A;  1XO2 A;  4GY5 A;  3CC2 A;  1UEC A;  1HD3 A;  2JW4 A;  4AKH A;  4C92 G;  4PJM A;  3CCM A;  4WF2 A;  2GQV A;  3VS6 A;  1UB4 A;  4M7D D;  1TTH B;  1RL2 A;  4MZP A;  4AKG A;  2FEI A;  3LGL A;  1IXD A;  3C0C A;  2RQV A;  2I40 B;  4XU0 A;  1VQK Q;  1D09 B;  2CKK A;  5FW9 A;  2BTT A;  2RQT A;  3SEM A;  1BU2 A;  2WIP B;  5GMK m;  3OMC A;  3QSU A;  4IIO A;  3G4S Q;  1VQ4 A;  2V8I A;  2KR3 A;  3M55 A;  4GLK A;  3BHV B;  1SEM A;  3M5A A;  5C0M A;  2QQR A;  3EGX A;  4JJB A;  4F17 A;  1AWX A;  3JB9 F;  2RK1 A;  3VS5 A;  4KBM B;  4EOP B;  2D8H A;  2VAS A;  5CK9 A;  4B9X A;  2HDA A;  2HKQ B;  2COY A;  2PHG A;  4EOL B;  1ZSZ B;  1F1B B;  2KT8 A;  1YIT A;  2RNA A;  4E7J A;  4BCH B;  4M75 A;  3TSW A;  3KHI A;  3QXE B;  5LJ5 f;  3H4C A;  3BE3 A;  1MND A;  2EUF A;  3S3M A;  1MGQ A;  3REA B;  1M3B A;  2VKN A;  5IH2 A;  2A37 A;  3M0R A;  1JEG A;  2B86 A;  4DOW A;  3CCM Q;  4FU6 A;  2PJQ A;  1VQ5 Q;  3M9Q A;  1PSF A;  5LJ5 g;  1WQ7 A;  1BBZ A;  2QGF B;  2RPN A;  2FL7 A;  1MMA A;  2COW A;  3JRZ A;  1AWJ A;  1NM7 A;  1UNL D;  2VYT A;  1CKA A;  2KI7 A;  2CP5 A;  5J26 A;  1N5Z A;  4J6W A;  2KAF A;  1M1K U;  4ZGJ B;  4KUL A;  4BCF B;  1QMZ B;  3SWN A;  3OYE A;  4BE0 A;  1QVP A;  1JKW A;  1VQ4 Q;  1I81 A;  3CCQ A;  1VQO Q;  3LWH A;  2FB7 A;  2EFI A;  3IQL A;  2LCC A;  3INZ A;  4KRT A;  2OAW A;  3GLX A;  3EG2 A;  1QLB A;  3OYY A;  2OTJ T;  1JJ2 S;  1K0X A;  2LRQ A;  1YJW T;  2I0N A;  3CC4 T;  1QVG S;  1NPR A;  1RAC B;  2DXC A;  3MEA A;  2LJ0 A;  1YIT Q;  5GAN f;  4PFP A;  2QA4 A;  2DAQ A;  1WIE A;  2WMB B;  3PMI A;  1X01 A;  3PVL A;  2ZPB B;  4M75 D;  1OGU B;  3NTI A;  3OW2 S;  2LW4 A;  1VQP A;  1Q81 R;  2RD1 A;  2CS7 A;  3G6E Q;  4E2F B;  2M51 A;  4QVC A;  2KXD A;  3L2V A;  2ENM A;  1BI0 A;  2DLP A;  2LX7 A;  4IUT A;  3HFO A;  5GAN g;  1OUL A;  1SHF A;  1KC8 R;  3L2R A;  5KE2 A;  2DL4 A;  3RMS A;  4RTV A;  4OMO A;  4CFU D;  1NE8 A;  4F7U B;  1LVK A;  2PVG B;  4OGE A;  1H1P B;  5GMK l;  2L8D A;  3CCR T;  2J06 A;  5DQV A;  2D6F A;  4CI0 C;  5FRN A;  1G2B A;  4DQ2 A;  2BUD A;  1JBM A;  4KH1 B;  3CCQ Q;  1FXX A;  5D6X A;  1AEY A;  3VJP A;  3RGF B;  3OB9 A;  5GAN 4;  2GFA A;  1QW1 A;  4F70 B;  2YRD A;  1M30 A;  1W2B S;  3JB9 I;  4J9G A;  3CCV T;  4R56 A;  1JU5 C;  3QZ5 B;  5CAI A;  1MMD A;  4M7A G;  1Y71 A;  2DD5 A;  2JOY A;  3M4Y A;  2GGR A;  1WLP B;  4MFD A;  2C0T A;  3H0H A;  1D3B B;  2QA4 Q;  1N8R U;  3H0F A;  3CCS T;  3LGF A;  2AHJ B;  3GOX A;  2KBT A;  1PSE A;  3EOC B;  3C12 A;  4RKU E;  4XU2 A;  1K9M R;  4MMK A;  3I9Q A;  2RHY A;  5HY6 A;  4F6U B;  1OZ3 A;  3I35 A;  4OGC A;  1Q7Y U;  1JST B;  3BW1 A;  3VYG A;  1QMC A;  1KIK A;  3GTM S;  1VQ8 T;  4N4I A;  4A54 A;  3JB9 D;  2DXT A;  1G8X A;  1IHV A;  2HL5 C;  1N6A A;  4J9D A;  1VUB A;  5A0L A;  1ZUU A;  2Y4X A;  2HSP A;  2E5Q A;  1RAG B;  1SPK A;  5I21 A;  4CRI A;  3NHN A;  3WVD B;  1M2O A;  1R0C B;  1VYW B;  3O5Z A;  5A0D A;  2QDY B;  4LDV A;  3GPL A;  2QGS A;  5D6W A;  2EW3 A;  2P84 A;  1PD0 A;  2JTF A;  3FB9 A;  2HL3 A;  1RAH B;  3QKJ A;  4RTT A;  3F5X B;  4ZNX A;  1Q82 R;  2LQ8 A;  2CZ0 B;  4ZN1 A;  5GMK i;  4F7U E;  4M78 B;  2OAU A;  3TNH B;  5I22 A;  1VQL T;  3PO3 S;  2XMF A;  4C8Q G;  2DZ9 A;  3O0G D;  5EFQ B;  3HB9 A;  2DTH A;  3J81 E;  2M16 A;  2EWN A;  1YJ9 A;  2IN3 A;  4BCN D;  2ECZ A;  4IUP A;  5LJ5 h;  2PVD B;  3CC2 T;  3A5Z B;  1U1S A;  4XTY A;  2V1Q A;  4D8D A;  2RQW A;  1Y0M A;  3QG1 A;  5GAM f;  4X9D A;  5CIU A;  4A53 A;  2BKZ B;  3ER0 A;  1SSH A;  4OB2 B;  1QP3 A;  3Q1J A;  4LNP A;  3CD6 T;  1KHC A;  2NUT B;  1ACM B;  4ELY C;  4HL4 A;  1ZQ1 A;  4M77 F;  4OB3 B;  1P92 A;  1OEB A;  2EJG A;  2C4G B;  3AT1 B;  1T3S A;  3EFS A;  4PJO F;  2DVJ A;  5FU6 B;  4ZN3 A;  3BFM A;  2E41 A;  2ABL A;  2C6T B;  4BBS M;  3PVQ A;  2K79 A;  2RJC A;  5LJ3 f;  1TOV A;  2CDT A;  4E7K A;  2ZPF B;  1S72 A;  4PJN A;  2MYS A;  3HBL A;  4LD6 A;  2UZB B;  2RB6 A;  2WSE E;  3QYE A;  3RES A;  1AZE A;  4J7F A;  2PMI B;  3OS2 A;  2EQJ A;  3ZEH A;  1MMN A;  4YOS A;  3GF5 A;  3R6O A;  2DD4 A;  2CCH B;  5FU6 C;  5LJ3 g;  2YUP A;  2WHB B;  1E6H A;  2WMA B;  1AWO A;  3CXC P;  4GLM A;  2KRO A;  4XTV A;  1Y07 A;  4HCC A;  4BI4 A;  4ROC A;  2FPE A;  4ZGD B;  3V8L A;  2LQK A;  1H1R B;  5DQW A;  2PVO B;  2MOX A;  2H3E B;  2E6Z A;  5IAY A;  1OU8 A;  3M56 A;  4CFX B;  4BY7 X;  1YN8 A;  5GMK j;  1Q86 U;  1ZUK A;  2VV5 A;  4N4H A;  2KGT A;  1NZ9 A;  5GAN 2;  3QYH B;  1EIF A;  1YP5 A;  4KT0 E;  1Q82 C;  2P4R A;  3JB9 H;  3L1A A;  2DIQ A;  5KYX B;  2DA9 A;  2XKO C;  3EG0 A;  2XD0 A;  4PLL A;  1ENW A;  2RJF A;  1B34 B;  2ED1 A;  3OBW A;  1X6G A;  2X4Y A;  2JS2 A;  4EIK A;  1YIJ A;  4BCP B;  3M0P A;  2AKL A;  4EOS B;  1HK9 A;  2KMT A;  3V8K A;  1GUX B;  2BIV A;  4PJL A;  4M77 A;  3L2U A;  3QDR B;  1D0X A;  1OKW B;  1OI1 A;  3HP9 A;  3SFM A;  3HPW A;  3JCM P;  5J3B A;  1VQP T;  1M2V A;  5GAO n;  4PJO A;  1BU1 A;  1WQW A;  5GAN 8;  2KR6 A;  1MV3 A;  3P8H A;  2DX1 A;  2L89 A;  3GP8 A;  4CC4 B;  3X28 B;  3JCM h;  4JZ4 A;  5GAN d;  2CH4 W;  4EOJ B;  3HRT A;  2OTJ A;  1T0J A;  1X75 C;  3JB9 J;  3FLG A;  2E70 A;  2RH2 A;  2K57 A;  1JO8 A;  1YJW A;  1N9S A;  2WJ9 A;  1YFN A;  3EG3 A;  1VYU A;  3OYM A;  2BZX A;  4EMG A;  2DEU A;  1KD1 U;  2B8A A;  2J6F A;  3CPW A;  4LDW A;  8ATC B;  3RER A;  4XTZ A;  4DBF A;  2X35 A;  4M7D B;  2O4X B;  3VU3 C;  1HYO A;  1OQK A;  4C0Z A;  5L2W B;  2QQ8 A;  2QDL A;  2LQN A;  1RUW A;  2CT4 A;  1LJO A;  2WEV B;  4C92 C;  3CCR A;  5KH6 A;  1IB8 A;  3RUX A;  1RAI B;  2QAZ A;  4FSX A;  4Q5W A;  1ZUY A;  3U23 A;  3OYJ A;  1OL2 B;  2MWO A;  4M7D C;  2RHX A;  3CCU A;  1SHG A;  3M0S A;  5CKF A;  3C94 A;  3VS1 A;  1WJR A;  2V1R A;  5GAO l;  5KYU A;  2P4T A;  4LUD A;  2XU8 A;  1NLO C;  2OTJ Q;  4O5V A;  3QWL A;  2KK4 A;  4R55 A;  4JS5 A;  4LE9 A;  2DL8 A;  4KGZ B;  5FWC A;  2C5X B;  4BDY A;  1YJW Q;  2A28 A;  3CC4 Q;  1K73 R;  2FO0 A;  1AD6 A;  3LH5 A;  4RG8 A;  2ED0 A;  1RAE B;  2M02 A;  4JPB W;  3E1S A;  4MDW A;  4AG2 C;  2EIF A;  3HHT B;  3SB2 A;  1KQ1 A;  1GH6 B;  1SF9 A;  2MMP A;  2MCN A;  1V76 A;  5LJ3 h;  3OMG A;  3DTO A;  1VQ8 A;  1EFN A;  2VXE A;  2IG0 A;  3DOG B;  7AT1 B;  1TD6 A;  1M27 C;  2JZ2 A;  3UDC A;  1VQ9 T;  3OSV A;  2FYK A;  4Z88 A;  2WPA B;  1I8F A;  1UGS B;  3CCR Q;  2CGH A;  2KT1 A;  1YJ9 T;  2XHC A;  1NPP A;  1V1C A;  4C92 E;  2H8H A;  4RTX A;  3KFV A;  3EGX B;  1ZLM A;  1TWB A;  2F1L A;  4HCB A;  5CKH A;  5HQ0 B;  2GBQ A;  2LVM A;  4HA8 A;  2X4J A;  4EMK A;  4M7D E;  1I1J A;  1EZZ B;  3CCV Q;  2BE7 D;  1RLP C;  1ZHI A;  2ZPH B;  2P0P A;  3RKY A;  3LWI A;  2HQH A;  3EH2 A;  2HQX A;  4EOO B;  5L23 A;  4RTY A;  2NYS A;  1VQL A;  4UC4 A;  1D0Z A;  3MCA B;  3CCS Q;  2DZC A;  1BK2 A;  4M75 B;  4II1 A;  2O01 E;  4MZT A;  1FMK A;  4GBQ A;  3KBG A;  2A7Y A;  2RJD A;  2PTK A;  5GAM d;  5GMK e;  5IHK A;  1H92 A;  2AZS A;  2JMC A;  1K0S A;  1BI3 A;  2WFY B;  5M9O A;  1C0M A;  3BDU A;  2WAC A;  4IUU A;  4J9E A;  2EGA A;  2QGG A;  2QXF A;  4C92 D;  2XDB A;  1IHW A;  4M7A F;  3THK A;  4CFU B;  5KYY A;  1S72 T;  1VQ8 Q;  1A0N B;  1JRI A;  3REB B;  4RCC A;  3OBY A;  3CCJ T;  2W9F A;  1E7P A;  4M75 C;  4F7S B;  3NFC A;  3CD6 A;  4HT9 A;  5I2S A;  3QWY A;  1M90 R;  1I07 A;  3MP1 A;  1OV3 A;  2ZAE A;  1F5Q B;  2HEQ A;  5GAN 3;  3GNG A;  2GFU A;  3UAT A;  1KQ2 A;  3QPH A;  5AYF A;  3BHU B;  3M4G A;  1X43 A;  3CME T;  1MUZ A;  2G77 A;  3M54 A;  4PJJ A;  1K73 C;  2A08 A;  5CR2 A;  2CUD A;  4L6V 5;  2QEX A;  4OP0 A;  3G7Z A;  3MEV A;  2LC4 A;  3FDR A;  2PNI A;  4J9C A;  3PIP A;  2A3L A;  4BCQ D;  1G3Y A;  5HK3 A;  1SG5 A;  4FIB A;  4HVU A;  3SWN C;  5BNJ B;  1O9S A;  1VQL Q;  3G33 B;  1PC0 A;  1PRM C;  1H26 B;  5HK0 A;  2FPD A;  3VRZ A;  3CC7 A;  4Y72 B;  2HAX A;  4F04 B;  3OY9 A;  1OZ2 A;  1NJI R;  3HRS A;  2HCK A;  3MJX A;  5CEI B;  3T9N A;  3OYA A;  2NUP A;  1IGU A;  1M4Z A;  1VQ7 A;  3G71 A;  1H1Q B;  4CC7 A;  3M03 A;  1WHM A;  1WXU A;  3CC2 Q;  3JAM E;  2HNI A;  2Y90 A;  5GAO p;  3PFS A;  1P5E B;  4JDS A;  1WHL A;  1UG1 A;  3FEO A;  2RHI A;  1K1Z A;  1WZO A;  2JS0 A;  2SRC A;  3H6Z A;  1W4S A;  3M59 A;  1O9K A;  4C8Q F;  4NL3 A;  1YIJ T;  4HVV A;  3CD6 Q;  3RBB B;  4ANJ A;  4JZ3 A;  4Y28 E;  2EQU A;  4KGV B;  1RI9 A;  3H9N A;  2JVV A;  4M75 E;  4TTH A;  3S6W A;  1B07 A;  2YRC A;  2CP0 A;  2YWW A;  2QG9 B;  5HNB B;  1AIS B;  1I4K 1;  3V7R A;  3NPF A;  1QVF P;  4F6W B;  2RQU A;  3S3O A;  4M7A A;  2AK5 A;  5EG2 A;  4YOZ A;  4RCB A;  1G3T A;  1M8M A;  4A4E A;  1QLY A;  2DD5 B;  1MHN A;  2AIR B;  4BE2 A;  2DM1 A;  1SRM A;  2M0O A;  4EON B;  3UT1 A;  3GBQ A;  4FW2 A;  1CSK A;  1U3O A;  4RTW A;  2F2V A;  5A2Q E;  2IW9 B;  3PTA A;  3KXT A;  4EOK B;  4JUV A;  2YRV A;  4HCK A;  2EPD A;  2EQM A;  3QO3 A;  3BG9 A;  4BCN B;  4BD3 A;  4KRD B;  3M57 A;  3I56 T;  1KQS A;  5ICP B;  1OIU B;  3X26 B;  2BZY A;  2G9X B;  3VYG B;  3HZJ A;  2EYY A;  1M90 C;  1Z9Q A;  3NDQ A;  5FLX E;  3MO8 A;  1JXM A;  2HQE A; 
#chains in the Genus database with same CATH homology
 3X20 B;  1QP3 A;  4QVD A;  2L3R A;  3Q1J A;  5CO7 A;  4Z02 A;  5GAO r;  3CD6 T;  1KHC A;  3CC4 A;  1OYX A;  3JSC A;  2KMG A;  1VIF A;  4ELY C;  4Z6Y A;  4HL4 A;  1ZQ1 A;  3UPU A;  4M77 F;  3SD4 A;  4OB3 B;  1P92 A;  4KUI A;  2EJG A;  5LJ5 j;  1KQS S;  1BI1 A;  3EFS A;  4PJO F;  1AHJ B;  5FU6 B;  3SWN B;  3FRN A;  4ZN3 A;  3HFN A;  2RI5 A;  5LJ3 d;  1H64 1;  2BS3 A;  4NC6 A;  3F70 A;  4C5H A;  2BS2 A;  3BFM A;  2E41 A;  1HXD A;  3CCU T;  4BBS M;  1U8R A;  2RJC A;  4E7I A;  5LJ3 f;  4E7K A;  1B34 A;  2ZPF B;  3HSB A;  4JX5 A;  1VQ5 A;  4M7A B;  2D9T A;  1S72 A;  4EMK B;  5LJ3 e;  3HBL A;  4ZTJ A;  1H3Z A;  4M7A D;  4QSH A;  4LD6 A;  2RB6 A;  2WSE E;  3TCJ A;  4M7D G;  3QYE A;  3RES A;  3I55 A;  1NJI C;  4J7F A;  3OS2 A;  4XTW A;  4JRP A;  2EQJ A;  3ZEH A;  3GF5 A;  4C8Q A;  3R6O A;  5KCO A;  3MEW A;  3A8G B;  1G5V A;  4C0D C;  2DD4 A;  2KSS A;  4QQD A;  5CVI A;  1BKB A;  5FU6 C;  4L5G A;  5LJ3 g;  3CCE A;  4LOC A;  3JCM J;  4XAX B;  2DXC B;  3PMT A;  3OYH A;  2LT4 A;  3CMA T;  2PUK B;  5KCH A;  4J6X A;  4J6Y A;  4M77 G;  5FRM A;  1QVF A;  5IN1 A;  5GMK h;  4XTV A;  4QW2 A;  2CZ1 B;  3VUB A;  3FIF A;  1Y07 A;  5GAN 7;  1VQO A;  4HCC A;  2RA2 A;  4BI4 A;  4M7A C;  4PJO G;  4X9C A;  3PIO A;  1YJN T;  4ZGD B;  5C6S A;  3A8H B;  3LX7 A;  3OYD A;  4M6V A;  3URG A;  2MF2 A;  2X4X A;  4J7I A;  5GAM h;  3JCM f;  3CCV A;  3QBY A;  2DXB B;  3P8D A;  4YTL A;  2LQK A;  3V8L A;  2QQ9 A;  3MEU A;  1K8A U;  2EJF A;  2F5K A;  3JCM e;  5CKE A;  2PVO B;  2R5A A;  1UGP B;  2DVE A;  2ZCF B;  2QDJ A;  3WVE B;  2QF7 A;  1U1T A;  2E6Z A;  5IAY A;  2LNV A;  1WJS A;  1M5Q 1;  3M56 A;  5GAN j;  3TW6 A;  5DM7 R;  3DLL A;  5GMK j;  3CCS A;  1Q86 U;  4DA4 A;  4N4H A;  2VV5 A;  4FM4 B;  3JCM g;  3HRU A;  3JCM W;  1NZ9 A;  5GAN 2;  1QVF S;  2VXF A;  3QYH B;  1EIF A;  4MFE A;  3OYL A;  4KT0 E;  2EAY A;  1Q82 C;  3JB9 H;  3L1A A;  5D6Y A;  3G6E A;  4HNV A;  1V29 B;  2DIQ A;  3FC3 A;  1N8R C;  4N0A A;  4C92 A;  2XKO C;  1Y7X A;  4PNO A;  4C0G A;  3DKM A;  2XD0 A;  4PLL A;  4TVR A;  3CCL T;  3KUF A;  3QUI A;  2RJF A;  4ME7 A;  1B34 B;  1Y96 A;  3OBW A;  2RI3 A;  2DIG A;  4BE1 A;  3DLM A;  3PNW C;  4M78 F;  4M7D A;  2O4X A;  4BDZ A;  2F5T X;  5GAO q;  2X4Y A;  3CBM A;  3OYC A;  4JRQ A;  1Q7Y C;  1YHQ T;  1G3S A;  1YI2 T;  3QII A;  2ZPE B;  2DXU A;  2PUO B;  4C8Q B;  1YIJ A;  1Q81 C;  3M58 A;  3BG5 A;  1HK9 A;  2KMT A;  4C8Q D;  3V8K A;  3OYN A;  1VQ9 A;  1VIE A;  3LLR A;  3QJY A;  2BIV A;  3X25 B;  3MP6 A;  4M75 F;  2E64 A;  2WSC E;  4M77 A;  1VQK A;  3OSS C;  3OYI A;  2BKD N;  3QDR B;  5LL6 S;  2K5I A;  3L2U A;  1OI1 A;  3HP9 A;  4DOV A;  2FVU A;  3SFM A;  3GIB A;  1BYM A;  4OB0 B;  3HPW A;  3JCM P;  5J3B A;  1VQP T;  1KC8 C;  5GAO n;  1VQM T;  4PJO A;  2ZZD B;  1X6O A;  1WQW A;  4FT4 A;  5GAN 8;  4MDX A;  3V8J A;  3ME9 A;  3JCM b;  2XIC A;  2KR6 A;  4P5N A;  3P8H A;  2RHZ A;  2L89 A;  3P8B B;  2NLU A;  4BBR M;  1N27 A;  4FT2 A;  5L8R E;  4JRK A;  3RIR A;  4E7L A;  3GP8 A;  3N5B B;  4IKF A;  1M8V A;  3X28 B;  2DEQ A;  2LTO A;  2RK2 A;  4C8Q C;  4M7A E;  3JCM h;  3JCM V;  1M1F A;  2XID A;  4E47 A;  3JCM X;  5GAN d;  4F7U F;  2LT1 A;  1LNX A;  3HRT A;  2OTJ A;  2MWP A;  1X75 C;  3RMQ A;  3JB9 J;  3CXC A;  3BG3 A;  2LDM A;  3FLG A;  4O6J A;  2OTL T;  3EFR A;  2E70 A;  2EJ9 A;  2RH2 A;  3ASK A;  4PL6 A;  2K57 A;  1YJW A;  2KDS A;  1VQP A;  1N9S A;  2WJ9 A;  4MIM A;  2K5L A;  3OYM A;  1M1G A;  2P0K A;  2DKG A;  4A4F A;  4LDY A;  4EMG A;  4ELZ C;  5GAN 5;  5EJC A;  1K73 U;  2ZPG B;  2RI2 A;  4VUB A;  2QQB A;  3A8O B;  2GCX A;  1N9R A;  4M75 G;  3MHX A;  2WSF E;  4C0D B;  3EAE A;  1KD1 U;  1UEB A;  4AI6 A;  3RKX A;  2B8A A;  2I2L A;  4KUD K;  2VC8 A;  3CPW A;  4JS4 A;  4LDW A;  2D0Q B;  3UWN A;  3OS1 A;  4GY5 A;  3CC2 A;  2RHU A;  1Y96 B;  4JX4 A;  3RER A;  4AKH A;  4C92 G;  4XTZ A;  1XTD A;  2XDD A;  3CCM A;  2X35 A;  3FJP A;  4M7D B;  4WF2 A;  2O4X B;  2DK3 A;  5GAN e;  2F69 A;  2GQV A;  3VU3 C;  2QEX T;  1UB4 A;  3I55 T;  5GAN f;  4M7D D;  3L2Q A;  1RL2 A;  3CXC S;  4C0Z A;  4MZP A;  4AKG A;  3OYG A;  2CZ7 B;  2QQ8 A;  4Y91 A;  2C06 A;  1K9M C;  4HLQ A;  3LGL A;  3CCJ A;  4BAC A;  3OYK A;  4F7U G;  2YLB A;  5A0G A;  3NTH A;  2QFZ A;  4XU0 A;  4FL6 A;  1LJO A;  2RM4 A;  4N0A C;  4C92 C;  2CKK A;  4JJN K;  4LDX A;  3HO8 A;  3CCR A;  3CC7 T;  5KH6 A;  3RUX A;  4A4H A;  2HD0 A;  5GMK m;  3OMC A;  4QQ6 A;  3QSU A;  4FSX A;  4Q5W A;  3CPW S;  1VQ4 A;  2V8I A;  3OYJ A;  3CEY A;  3M55 A;  2MWO A;  2XI9 A;  4GLK A;  1VQ7 T;  2RHX A;  4M7D C;  3G71 T;  2EQK A;  3M5A A;  5C0M A;  3CCU A;  3CME A;  5CKF A;  4A4K A;  5HKC A;  3DL1 A;  3C94 A;  2QQR A;  4NL2 A;  1WJR A;  4HCZ A;  5DLO A;  5GAO l;  5CKD A;  3JB9 F;  2QI2 A;  2P4T A;  2RK1 A;  3CBP A;  1VQ6 A;  4KBM B;  3OS0 A;  2XU8 A;  1TH7 A;  3VYH B;  2PQW A;  3QWL A;  2KK4 A;  4M78 A;  4O5V A;  4R55 A;  4JS5 A;  4M77 C;  5IT9 E;  4HT8 A;  2E12 A;  5CK9 A;  4C8Q E;  5CQX A;  4IUQ A;  2QQS A;  4BDY A;  4B9X A;  5GAO m;  1XNI A;  3MP8 A;  4C5I A;  2V8K A;  4XU1 A;  2XG8 D;  4PJO C;  3QYB A;  4B9W A;  4XQ3 A;  5LJ5 d;  4D6W A;  1YIT A;  4JLI A;  3CMA A;  4E7J A;  4M75 A;  3KHI A;  2DTO A;  3C4S A;  2CYZ B;  1KG1 A;  3QXE B;  3VKI A;  4RG8 A;  5LJ5 f;  4OB1 B;  3NTK A;  4C0F A;  3H4C A;  1O75 A;  3S3M A;  1MGQ A;  3E1S A;  2RO0 A;  4MDW A;  1YJN A;  3H8Z A;  2EIF A;  5LJ5 e;  3HHT B;  5GAM j;  3E9F A;  3SB2 A;  2RJE A;  1KQ1 A;  4DOW A;  2MMP A;  1KHI A;  5DLQ E;  4FU6 A;  2JNG A;  2R57 A;  2VGN A;  5LJ3 h;  3OMG A;  3M9Q A;  2CZ6 B;  1VQ8 A;  2VXE A;  1RI0 A;  1PSF A;  2IG0 A;  2JTM A;  3PT9 A;  5LJ5 g;  1WQ7 A;  3JB9 G;  1JJ2 A;  4F7U A;  4RG2 A;  2L5Q A;  2FL7 A;  3JCM c;  3JRZ A;  2JZ2 A;  4J5Y A;  3UDC A;  3OYB A;  1VQ9 T;  2VYT A;  3L2W A;  3OSV A;  1WGS A;  3GNF B;  2FYK A;  2FHD A;  5J26 A;  2X4W A;  1I8F A;  1QVG A;  2DD4 B;  1VQK T;  1SSF A;  2QTX A;  4J6W A;  1K8A C;  3QZ9 B;  2PU9 B;  1UGS B;  2DJZ A;  2KAF A;  2CGH A;  4OMF B;  1M1K U;  4ZGJ B;  1BI2 A;  4KUL A;  4PLI A;  2LCL A;  3SWN A;  4C5E A;  3OYE A;  3HKS A;  4BE0 A;  1QVP A;  1M90 U;  1YJ9 T;  1I81 A;  2XHC A;  3G4S T;  4EDU A;  3OW2 A;  1NPP A;  4C92 E;  4A4G A;  3CCQ A;  1Q86 C;  3LWH A;  2FB7 A;  2JUF A;  2EFI A;  3QYG B;  1VQN A;  2LCC A;  3INZ A;  5LJ3 j;  2M9U A;  2XDP A;  4HCB A;  5CKH A;  3MET A;  5GAN 6;  3GLX A;  2LVM A;  1QLB A;  3OYY A;  4HA8 A;  2X4J A;  4EMK A;  4M7D E;  4QVZ A;  4BI8 B;  5CCA A;  2OTJ T;  2ZPI B;  1JJ2 S;  1ZHI A;  2ZPH B;  2VGM A;  3VUZ A;  2P0P A;  3RKY A;  1XOV A;  2LRQ A;  4JLG A;  3VKH A;  3LWI A;  1YJW T;  3CC4 T;  1QVG S;  1WNL A;  4M78 G;  2HQX A;  1NPR A;  3DB4 A;  2KQW A;  2QA4 A;  2DXC A;  3MEA A;  1VQL A;  1D3B A;  4UC4 A;  4M77 E;  2DAQ A;  3MCA B;  5CKB A;  4C5G A;  2DZC A;  3PMI A;  3BY7 A;  4M75 B;  4II1 A;  1X01 A;  2R58 A;  2O01 E;  3QJ6 A;  4IUR A;  4MZT A;  2ZPB B;  4M75 D;  3NTI A;  4X34 A;  3KBG A;  2A7Y A;  1XQH A;  2RJD A;  2RD1 A;  4AKI A;  3BDL A;  2CS7 A;  2K4Y A;  5GMK e;  5GAM d;  3S3N A;  4PJO E;  4HNT A;  3I56 A;  1BI3 A;  3L42 A;  5M9O A;  2QQA A;  4C92 B;  4QVC A;  3BDU A;  2WAC A;  3DB3 A;  4IUU A;  1BI0 A;  4M78 C;  3L2V A;  2GF7 A;  2Y4Y A;  1NJI U;  2QXF A;  4J83 A;  4C92 D;  3CCM T;  2XDB A;  4IUT A;  3HFO A;  4EPC A;  5GAN g;  4M7A F;  3TW7 A;  4BUG A;  4V2S A;  1IZ6 A;  3L2R A;  1VQ5 T;  3PGG A;  5KE2 A;  1YBY A;  1S72 T;  1W2B A;  3RMS A;  1JRI A;  2VUB A;  3ZBD A;  4RCC A;  1NE8 A;  1WPY A;  4F7U B;  3OBY A;  3CCJ T;  2PVG B;  2OTL A;  1E7P A;  1G3W A;  3VKG A;  3QHS A;  4M75 C;  4OGE A;  3NFC A;  3CD6 A;  4HT9 A;  5GMK l;  5GAM g;  2YHT A;  3OYF A;  1KD1 C;  5I2S A;  3CCE T;  2L8D A;  3CCR T;  2JN0 A;  3MP1 A;  4ZGE B;  3E19 A;  3HL8 A;  5GAN 3;  2D6F A;  4M77 B;  3GNG A;  4CI0 C;  5FRN A;  2GFU A;  1BIA A;  3SDZ A;  4DQ2 A;  1VQ4 T;  2BUD A;  4LD9 K;  1JBM A;  4M77 D;  4J8O A;  3QPH A;  1KQ2 A;  5AYF A;  3OQ5 A;  3M4G A;  4MZM A;  3V7C A;  1VQO T;  4PJO B;  3CME T;  1FXX A;  2HBP A;  2ZGW A;  1BIB A;  5D6X A;  3VJP A;  2G77 A;  4PJO D;  3M54 A;  1K73 C;  3OB9 A;  3CPF A;  5GAN 4;  2GFA A;  1R8O B;  1VQ6 T;  3CBO A;  5CR2 A;  1QW1 A;  4L6V 5;  2QEX A;  3JB9 I;  1W2B S;  3OS5 A;  4NOY A;  4OP0 A;  3G7Z A;  3CCV T;  3MEV A;  2EKO A;  2LC4 A;  3O8V A;  4R56 A;  3FDR A;  2K3Y A;  4N4G A;  3QZ5 B;  5CAI A;  4M7A G;  1Y71 A;  2MI6 A;  3PIP A;  2A3L A;  2DD5 A;  4EMH A;  1G3Y A;  5DY9 A;  3ZFJ A;  5HK3 A;  4FIB A;  2JOY A;  1Q82 U;  3SWN C;  3M4Y A;  4MFD A;  1O9S A;  1YIT T;  3A8L B;  1D3B B;  1N8R U;  5HK0 A;  3CCS T;  4LDU A;  3LGF A;  5GAN h;  2AHJ B;  3CC7 A;  3GOX A;  3RKW A;  1FX7 A;  2LX9 A;  1PSE A;  2HAX A;  5FU7 B;  1UGQ B;  3C12 A;  4RKU E;  4XU2 A;  3OY9 A;  1OZ2 A;  4ZTF A;  2ZZD A;  4MMK A;  3HRS A;  3M53 A;  2K2V A;  2RHY A;  5HY6 A;  3T9N A;  3JCM d;  3OYA A;  2R5M A;  3G6E T;  1M4Z A;  4EMK C;  5CQY A;  1VQ7 A;  3G71 A;  1OZ3 A;  4OGC A;  2E65 A;  4PKC C;  1Q7Y U;  1DJ7 B;  3BW1 A;  2K5F A;  2K3X A;  1IRE B;  3VYG A;  2HNI A;  2Y90 A;  5GAO p;  3PFS A;  1WJQ A;  4JDS A;  3JAM E;  1Q81 U;  3FEO A;  2RHI A;  1VQ8 T;  4JX6 A;  4XTU A;  4L59 A;  4N4I A;  4ATO A;  3A8M B;  2G3R A;  3E9G A;  4M78 E;  4A54 A;  3JB9 D;  1JB0 E;  2DXT A;  4OVA A;  3H6Z A;  1W4S A;  3M59 A;  4C8Q F;  1N6A A;  4XU3 A;  1GXI E;  2V8J A;  1VUB A;  4NL3 A;  1FWZ A;  1YIJ T;  2MAM A;  5A0L A;  5FU7 C;  1KC8 U;  2Y4X A;  4XK8 E;  3TRE A;  2E5Q A;  2DPP B;  4HNU A;  4Y28 E;  2EQU A;  3C95 A;  4BB7 A;  3VV0 A;  2P0Q A;  4IUV A;  5I21 A;  2JVV A;  4M75 E;  4CRI A;  2E6N A;  3S6W A;  3WVD B;  4QQG A;  3CCQ T;  5I2M A;  3TU4 K;  4NS5 A;  4HKE A;  5A0D A;  2QDY B;  2KVQ G;  1VQN T;  2DO3 A;  2M1H A;  4LDV A;  3GPL A;  5KE3 A;  4BY6 B;  1M9S A;  5D6W A;  5J39 A;  3L2Z A;  2KY9 A;  1I4K 1;  5FRO A;  2BS4 A;  3V7R A;  3CCL A;  1I5L A;  2JTF A;  3FB9 A;  4BI3 A;  3QKJ A;  3S3O A;  1FKM A;  4M7A A;  5EG2 A;  4JRI A;  4RCB A;  1G3T A;  1QP2 A;  2CZ0 B;  2LQ8 A;  2EYQ A;  4A4E A;  2DD5 B;  1MHN A;  4ZN1 A;  5GMK i;  4F7U E;  2YLC A;  4M78 B;  4BE2 A;  2OAU A;  4XTX A;  2M0O A;  3OA6 A;  3UT1 A;  4M78 D;  1YHQ A;  1YI2 A;  3TEE A;  3JCM Q;  4RMO A;  1VQL T;  3PTA A;  5A2Q E;  2QA4 T;  4C8Q G;  4ELJ A;  3X24 B;  2DZ9 A;  3OW2 S;  3KXT A;  2XK0 A;  3HB9 A;  2YRV A;  2DTH A;  4JUV A;  2EQM A;  1YCY A;  3QO3 A;  3BG9 A;  4BY6 C;  2IVW A;  2M16 A;  1LOJ A;  2EWN A;  4BD3 A;  3J81 E;  3M57 A;  3I56 T;  3G4S A;  4C92 F;  1YJ9 A;  2H3J A;  1KQS A;  2DTI A;  3WXM B;  3J80 E;  3J7A F;  2E10 A;  3LYI A;  1ZBX A;  1UGR B;  4IUP A;  3X26 B;  4MML A;  4OF1 A;  3V7S A;  5LJ5 h;  1VQM A;  2PVD B;  1M1K C;  4E7H A;  3VYG B;  3CC2 T;  3HZJ A;  3A5Z B;  1U1S A;  4XTY A;  3LH0 A;  1K9M U;  4M7D F;  1M90 C;  3QG1 A;  5GAM f;  3AHU A;  4X9D A;  5CIU A;  4A53 A;  5FLX E;  2E1H A;  3ER0 A;  2DXB A;  3MO8 A;  5GAM e;  4OB2 B;  2HQE A;  3LW5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...