3VYHB

Crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 67
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3vyhB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vyhB02
2DXCB 3WVEB 1UGSB 2O01E 2PUKB 2CZ1B 2ZPIB 4ZGJB 1DJ7B 3LW5E 2DXBA 2PUOB 2ZZDB 2ZPEB 2ZPBB 3QYGB 2ZPFB 2CZ6B 1JB0E 2D0QB 4RKUE 1UGRB 1QP2A 1V29B 5L8RE 2DPPB 3A8OB 2ZCFB 3X24B 4L6V5 2QDYB 3X28B 2DXCA 1PSFA 1UGPB 4ZGEB 4ZGDB 3X25B 2PVDB 2WSEE 2ZZDA 4KT0E 3X20B 2CYZB 4Y28E 2WSFE 3A8HB 4OB0B 1QP3A 4OB1B 3QYHB 2DD4A 4OB3B 2CZ0B 3WVDB 3HHTB 3A8MB 2DD5A 4OB2B 2AHJB 2DD4B 3A8LB 2PVGB 1IREB 2PVOB 4XK8E 2CZ7B 1GXIE 2WSCE 4FM4B 1UGQB 3VYGB 1PSEA 2DD5B 3VYGA 3X26B 2ZPGB 3A8GB 3VYHB 1AHJB 2DXBB 3QXEB 2ZPHB 3QZ9B 2PU9B 3QZ5B
chains in the Genus database with same CATH superfamily
4EOLB 1Y0MA 1E7PA 2CSQA 2KQWA 3CCQA 1K73U 1D0YA 2QQ8A 1UDLA 4AFUC 1BI1A 3CPWP 3QBYA 1ZUKA 3G4SQ 4OGRB 2DKGA 4BCMB 1D0XA 1YI2A 2KSSA 2I40B 5IXBA 3VS2A 1SRLA 1QVFA 3H0FA 3VU3C 4EMKA 1TWBA 4AFSC 1YCYA 4ZN3A 5CR2A 2DX1A 1MNDA 1OPLA 4G6LB 1PKSA 3JCMf 1D1BA 5CCAA 1VQLA 1P92A 3PTAA 2PZ1A 2L8DA 5IHKA 1W98B 4M7DC 4YOSA 2W2HA 1LCKA 1XJWB 2JMCA 3PMTA 2R7GA 2DVJA 4Y72B 4PJOD 2DXTA 1FXXA 2RHXA 3FRNA 1VQ4Q 2DIGA 3CD6Q 4M75A 1GFCA 3H41A 4LOCA 3CBMA 2PJQA 4F70B 1UHFA 3BHUB 3X20B 1H641 4CC4B 3JB9J 3MEWA 1OKWB 1KQSS 2GFUA 1ZSZA 4M78E 4PJJA 3VS3A 1BIBA 4OGCA 2FVUA 2RN8A 4M7DD 2XKOC 4FX3B 5IHIA 1VQ4A 4R55A 3FLGA 5EJCA 4V2SA 4MFEA 4PLIA 4FCYA 1U3OA 5GAMd 4F7SB 5IHYA 4KGZB 2YLCA 2MAMA 2W10A 1QVGA 2V1QA 4J9BA 3GNGA 1WQWA 5D7UA 5HK3A 2VYTA 4OMPA 1W70A 2DXCB 1QVFS 2RD1A 3EHRA 3FC3A 1OOTA 2DL3A 2RJFA 1QCNA 3CD6T 5HBJB 2VC8A 3H9NA 2E65A 2C5NB 2MWOA 1WI7A 5LJ5g 3AT1B 4DBFA 4CC3A 1JJ2A 1Q7YU 1FKMA 4C92F 2ZPBB 1KHIA 4RG8A 3VS1A 2DO3A 1VQ5Q 4A53A 2QA4Q 1H1RB 4KRCB 4VUBA 5J39A 4BD3A 1VQMT 3EG3A 1QMCA 2LCLA 5IT9E 1YJ9Q 3OYBA 2DL8A 2E4HA 4F7NB 1D3BA 2PTKA 5FU7B 1RAFB 1M1KC 2DE0X 1OU9A 4M77E 3M0RA 3JCMX 2HQXA 3OS0A 2DZ9A 1PC0A 2EIFA 5KCHA 1VQ5A 3ZL7C 2KRMA 4BCGB 4ZGDB 1LNXA 2RJEA 5FU6B 1D0ZA 1U5SA 4BY6B 2I0NA 4IIOA 4RG2A 1NZ9A 5HKCA 4LD9K 3RBBB 3JCMe 3UA7A 8AT1B 3UPUA 2DNUA 1QP3A 2DYIA 3CCLA 1TS9A 2MPXC 3RMSA 2FEIA 5FWBA 5GANj 4C92G 4Z8AA 1PNJA 2JMAA 2XU8A 4R56A 2X4WA 3OSVA 3DTOA 2HEQA 4E7SA 3G6EQ 1K9MR 3KXTA 1MNEA 4OGEA 2LJ0A 4NOYA 1ZQ1A 2A37A 4PK4A 4M75E 2E12A 1VQ5T 5GANd 5IN1A 3JCMP 1R0CB 3QYEA 3FJPA 4YOOA 2K79A 3LYIA 4F7UA 2O9SA 3OYLA 3QIIA 4M77C 1UGQB 5LJ5e 7AT1B 1WGSA 4XTVA 1G3YA 1OX9A 3RR6A 4IURA 1D1CA 1ZHIA 4M7AE 2PU9B 3SEMA 1Y57A 3JCMg 4YOZA 3CXCP 2X9HA 3EFRA 1J3TA 4JJDA 4JLIA 3ZEHA 1MMAA 3CCRT 2QEXA 1H3ZA 3CCMQ 1XO2A 1W6XA 4LDYA 3P8DA 2R57A 2RQTA 5IHNA 2WMAB 4M77D 2BE9B 2V1RA 3MP6A 1SPKA 1VYUA 3RKXA 5ACBA 5ICPB 2DMEA 3CMEQ 1UNGD 4BCJB 3PNWC 5A0GA 5GAN8 1Q81R 2DFUA 2DXUA 5KYWA 5CVIA 2DZCA 1H27B 1JU5C 2FZCB 2AZSA 3EG9A 2KXCA 4L6V5 5LQFB 5EFQB 2OTLQ 1QW1A 3CCRA 3X28B 5IXFA 1Y96B 2E10A 1YJWA 4N0AC 4DEXA 3H0HA 3RNJA 5EC7A 1BKBA 2B8AA 2LP5A 3JB9F 5KYUA 2E6NA 4PKCC 3OYHA 4IMYB 2KVQG 1RI0A 4QT7A 4ESRA 2GTJA 1U8RA 1HSQA 2EQKA 4GBQA 2KBTA 2W96A 3WVDB 3CC2Q 4OB2B 2QI2A 2RNAA 2CP5A 3OYNA 3CCQQ 3UF4A 2WMBB 1U1SA 3A5ZB 1M3BA 4AG1C 3QHWB 4RTXA 1NG2A 2CZ7B 3E9FA 3VKGA 5LJ3d 5KYXA 1GXIE 4EOQB 2AK5A 4EOSB 2FPEA 2EGAA 2IW6B 5GAOr 4M7AG 1K1ZA 3ZBDA 4M75B 1A0NB 1OX8A 1D1AA 2ZPGB 2XDPA 5CAIA 3VRYA 2RI5A 3BDUA 3G71T 2J6FA 4OR5B 2D0NA 2WIPB 2HQHA 2RO0A 3EGXA 1KIKA 3GP8A 2LCSA 1G83A 1AD5A 4EIKA 1UUEA 2LRQA 1AWXA 2XIDA 2WFYB 2QGGA 3JCMb 1Z9ZA 1TU0B 4CFXB 2P0QA 5A0DA 1IHWA 1P5EB 3CC7T 4MIMA 1EZZB 4BY1X 4D8KA 4CC7A 2ED0A 4C5IA 4AKHA 2EYZA 1VQOQ 2RQVA 2QQSA 4F7LB 4FT4A 2PK2A 4FYVB 3UDCA 3MY5B 4CC2A 2KROA 1G3TA 1X43A 2E6ZA 5J3BA 2WXVB 3M57A 2COWA 4DBRA 3TSWA 2FHDA 4ELJA 3CMEA 3OS5A 2A36A 1K8AR 3OYYA 3A1PA 3ASKA 4C8QA 2DXCA 4LE9A 4NSTB 2QQ9A 3S3MA 4F04B 2WHBB 2ZGWA 4PJNA 2WACA 1RACB 2QQRA 1YNZA 4EOOB 4RTVA 2WSEE 4C5EA 4WCIA 4C92A 3B57A 2RM4A 3MP1A 4LDVA 3EG9B 4C8QC 4BCNB 2LX7A 5GAN3 3VKIA 3M53A 2HQEA 1ZA2B 1UGVA 2QA4T 1IXDA 2LCCA 4F6WB 3M03A 2VASA 3DLLA 1NEBA 2DL7A 1VIFA 2G6FX 3G7ZA 1QWEA 2MCNA 1MUZA 3HBLA 1Y07A 2DYBA 1D09B 5IDPB 2F5TX 1VQ7Q 2RQWA 5FLXE 2SEMA 3C4SA 1QWFA 5I2MA 1FMKA 2MI6A 1BBZA 1H28B 3KFVA 4KUIA 4A4FA 4M77G 3META 2PNIA 1V76A 2QYZA 2PMIB 2X4YA 3QYBA 1ZUUA 4C0FA 1WHLA 1M1KR 1Q86R 4HKEA 1VQKA 3TNHB 3OS2A 3OYAA 3P8HA 5M9OA 3QJYA 4BCPB 4CFUD 4F14A 4C8QG 1UG1A 4PJOB 1M30A 4IKFA 4BB7A 1WLPB 1FMWA 5GMKm 2RHZA 4C92E 4EC8B 1ZP2A 2LT1A 2XICA 1Q82U 2DETA 1BI3A 2EYWA 2E64A 2ZZDB 2KNBB 5EG2A 1Q86U 3M9QA 3S3OA 1OYXA 5IAYA 2D9TA 2X51A 1VQ6A 1VA7A 5FU7C 5LJ3g 5I5ZB 4JZ4A 2EPDA 2PQWA 2JTFA 1GCPA 3I55T 3I56T 5GMKi 4I3ZB 4EMHA 4CFMB 2CCIB 1M2OA 1KJWA 1ZA1B 3QO3A 4NL3A 4LXCA 2FZKB 2CCHB 5HBEB 1NYFA 1YJWT 4EOIB 5GAOp 1AT1B 1Y71A 2FPFA 2X4JA 3CXCA 3OSSC 1AWOA 2D1XA 1ZUYA 4EOKB 1UB4A 3EGDA 2K5LA 4C0GA 3PFSA 5AT1B 3ULRB 2CT4A 2LC4A 3SFMA 4UN0A 1X2QA 4FYYB 2KYMA 3MKDA 3CMAA 3C95A 3S6WA 5GMKe 1XOVA 2IVXA 2NYSA 2FL7A 4RTYA 1OL2B 5GAOm 1VQ9Q 2RI2A 1K4US 3E9GA 1RLQC 3GOXA 4M7AC 1BB9A 2WSCE 4A63B 1KHCA 1G8XA 1WNLA 4RTUA 4JLGA 5FRNA 4BY7X 3BG3A 3GLXA 3H0IA 5GAMe 2NUPA 3RKWA 2X3WD 3GIBA 4IIMA 4M77A 4HA8A 3I56Q 3OMGA 2Y90A 1ABOA 3I35A 3RERA 4QW2A 1PG5B 2OAUA 4JS4A 3TN8B 5GMKj 4A4GA 1WJQA 4BCQD 1G3WA 3LGLA 2CZ1B 3O5ZA 4DQ2A 1I81A 1N6AA 3CCQT 4BCHB 3CCEA 3M54A 5GAN2 4B9WA 8ATCB 2ZPFB 1TXQA 4JJCA 1JEGA 1F5QB 4AFZC 2DERA 2EQUA 1M1KU 1MMGA 1QP2A 1H3HA 1HD3A 2KEAA 2RH2A 2RQRA 4CRIA 3E1SA 4BCND 4EMGA 1SSHA 2O88A 2LQ8A 3J81E 2LNVA 2CKKA 2JTEA 1KQ2A 2COZA 2C6TB 1M8VA 2K3BA 4M75G 2UZEB 2NUPB 3KBGA 3OB9A 1WHJA 3BW1A 4KT0E 1I1JA 2QQAA 4KBMB 4Y28E 4EOJB 1RLPC 4LUEA 3CC4Q 2GF7A 3V7RA 5HQ0B 3EGUA 3VS4A 4OB1B 2CT3A 3OBWA 3QYHB 3I5SA 4M78A 3VS7A 4ME7A 4AG2C 4IUTA 4HVVA 2KT8A 3G1JA 3EJ1B 1QCOA 4ELYC 2HBWA 2MIOA 3U23A 2EJ9A 5CIUA 4BXXX 2EVRA 2PVOB 4Z02A 4BCOB 3QWLA 4AKIA 1C9BA 1W4SA 2LQKA 3PIPA 2QEXQ 1HYOA 2KY9A 5HVYB 5L23A 3RUXA 2EYQA 4MZTA 1KC8R 2ENMA 4HCCA 4GY5A 3CC7A 5KYUB 2QK0A 1OEBA 1BI0A 3VKHA 2FZGB 1UEBA 2JW4A 2EQIA 2HNIA 1SRMA 4J9GA 1JSTB 1BU1A 2O01E 5LJ5h 1B07A 1X2KA 2LW4A 3JSCA 1AD6A 3INZA 2H8HA 4NC6A 1X6GA 4R0KA 5GMKh 3F70A 3I5RA 3PO3S 1AZEA 3CC2A 2QF7A 1QCFA 1H25B 1KSWA 4BUGA 3MEAA 4PJOF 2C0OA 1YP5A 1RUWA 2I2LA 4JPBW 1FVVB 3QHRB 3UATA 3M4YA 4X9DA 2W0ZA 1X6OA 3EH1A 3EGXB 1WX6A 2JTMA 3NTKA 1TOVA 4ZNXA 4C0DB 1VQ6T 4HNTA 5GMKl 3BHVB 3PE0A 1K9AA 5KYYA 1NPRA 2EYYA 3DDPB 5I11A 4C8QE 1WHMA 1N4MA 4DBQA 2DL5A 4M7DA 2IVWA 3SDZA 5FWCA 4QKUA 2A28A 1UE9A 4BDYA 4HLQA 3DB4A 4EONB 3QKJA 1I5OB 2F5KA 2C5XB 1M1FA 2UZBB 4C92C 2XDBA 3A8MB 1VQKT 2DD5A 5LJ3f 2L3QA 1YHQA 4E2FB 4II5B 2QFZA 2V8JA 3L1AA 2PVGB 3FJ5A 2VGNA 2EQJA 2HZYA 3I55Q 3L42A 2WEVB 1IZ6A 2FO0A 2C5OB 3S3NA 4UC4A 5HNBB 2YT6A 3V8JA 1TD6A 2WJ9A 5GJVB 3OS1A 3ME9A 5KE2A 4C92B 1VQNT 1H92A 2ROLA 4JRIA 1W2BS 4AFQC 1YJWQ 4PJOE 1PD1A 4MZPA 1QKWA 2DL4A 2YRVA 2XHCA 2YUOA 2J06A 1QVGP 2PK9B 3WVEB 4F16A 2I53A 4PNOA 1UECA 2LVMA 3CCSA 1WFWA 4NL2A 3TSZA 1KD1R 3M5AA 2K7AA 2E3HA 1RL2A 1IB8A 2JS0A 3FEOA 2ZPEB 3CPWA 1K8AU 2DM1A 4C0ZA 2HD0A 1YIJT 2L2PA 1VQ8A 1JJ2P 1M90U 3MPUB 1W2BA 2DILA 5KH6A 2B9RA 1WXTA 1K73R 2EGEA 1B3QA 3RKYA 4DEYA 3G6ET 1K73C 1M90C 4MFDA 1C0MA 1QVPA 4E7JA 2O4XA 4TTHA 1F1BB 3G33B 2CH4A 2JOYA 4KRDB 1CSKA 1W1FA 2HCKA 3O0GD 1R8OB 4J9IA 4BACA 1SF9A 2ZZDA 3G6EA 3CPWS 1GBQA 3EAEA 5CO7A 3HB9A 1JKWA 1PKDB 3QUIA 1GRIA 2F69A 1VQ9A 2AKLA 4OB3B 3J80E 4PJOA 3L2RA 5GAMj 3L2WA 2XG8D 3THKA 4BE0A 1WJSA 1VQ8Q 4J6YA 1AZGB 4RTTA 3MP8A 2COYA 4CFVB 4PJOC 4HCKA 2D8JA 1OULA 3AHUA 3CMET 5GAN5 4CI0C 4BCFB 4MMKA 5CQXA 5CKBA 2V22B 3JB9H 5GJWB 3A8GB 2RHIA 3QPHA 3GPLA 5D6YA 3QZ5B 3E2UA 1Q82R 2KRNA 3QHSA 1BIAA 4CXAB 1LJOA 1OGUB 4M6VA 1WZOA 1GBRA 3HFOA 2A7YA 1MV0B 1FX7A 4WTOB 2OX7A 2XI9A 1UTIA 1VQNA 2QGSA 3FB9A 4BCQB 1BCOA 4NS5A 4LNPA 4BCKB 1VQ7A 2DXBA 2M9UA 2IW9B 2CUBA 3QJ6A 2EBPA 4EORB 5GAN4 1WQ7A 2JJ9A 2BS2A 1QLYA 4RKUE 5I2SA 4XAXB 1H26B 3TW6A 1LPLA 2F2WA 4FU6A 4J6WA 4QVZA 3CC2T 2LX9A 3EGDB 5L8RE 3CCUT 3QWYA 3V8LA 3GF5A 3PGGA 1NYGA 4BI3A 1H1PB 1E6HA 2GQIA 2QXFA 5GAMh 2BZXA 4M77B 1SHGA 2H3JA 4X9CA 2YXYA 4MZMA 3JB9I 4ZGEB 3MJXA 1QVGS 2E5KA 3N5BB 4F6SB 2CP2A 4M4ZA 2M1HA 1ARKA 1FYNA 2CYZB 3G71Q 4ZN1A 3I55A 4E7IA 4EOMB 2DF6A 5KYNA 3CBOA 1S1NA 2X35A 2Y4YA 2RJDA 2P84A 3HRTA 1AWJA 1ZBXA 4XU2A 2DTHA 2VKNA 5DY9A 3URGA 4ZTFA 1N8RR 3OYGA 4B6MA 4E7KA 5A2QE 3G4ST 3IQLA 1YJ9T 2KRSA 1FMVA 3TCJA 4AMCA 5KCOA 5DQWA 2C0TA 4K11A 1FINB 4DOVA 1VQPQ 1AVZC 2RQUA 1QLBA 1PHTA 4FM4B 5GAOn 1ZSZC 1N9RA 2F2CA 1M2VA 5C0MA 4ROCA 1OU8A 3D7SB 1WHHA 3CCJA 3QXEB 3QZ9B 1N5ZA 1ZSZB 4OF1A 2Z0WA 4MDXA 2RJCA 2OI3A 3TEEA 2X4XA 2VXFA 3BG9A 4MMLA 3GBQA 1HXDA 1YITQ 2HKQB 3JCMV 1HJDA 2VV5A 3H8ZA 1SHFA 3HRSA 2QTXA 1YJ9A 4FYWB 4CFNB 2MK5A 1UNHD 4HCBA 4F7JB 1EFNA 1GY3B 2ZPIB 3HSBA 1NLPC 2D8HA 1JO8A 3CCSQ 3VS5A 5BNJB 2YRCA 2GNCA 2AKKA 3JCMW 1OZ3A 3MY1B 2G77A 1N8RU 3QDFA 3HZJA 2D0QB 4J9FA 3EG2A 2MF2A 3P8BB 2YSQA 1K0XA 1D3BB 2UUEB 3K7AM 2GQVA 2HAXA 4Q5WA 2HL3A 1G3NC 4JRQA 5CKEA 4M78C 1VQPT 3NTHA 4BCMD 3H6ZA 2P0KA 4HT9A 4M7AA 2CP0A 1RABB 4C8QD 2BS3A 2JZ2A 2DJQA 3QDRB 4J9DA 2PVDB 2JXBA 4D6WA 2RHYA 2EJFA 1GUXA 5DLOA 3C94A 2E3IA 2LQWA 3M4GA 2NWMA 4HCZA 5FW9A 1M4ZA 1WXUA 2M16A 4CFUB 1YWOA 3NGPA 2J7IA 4M7DF 1RAGB 4XTWA 1AWWA 3V8KA 1GCQA 3TVTA 2O9VA 4M78B 3SHWA 4EDUA 3OYKA 1S72Q 1PRLC 2LTOA 2G3RA 1TFBA 2EFIA 4C5HA 3CCST 5LJ3e 2M0OA 1K9MC 2O31A 2C06A 1TH7A 1IGQA 1GCQC 1G2BA 2D6FA 3CCVA 4JRPA 1EIFA 1VQMQ 2CJMB 2HL5C 4OMOA 3VYGB 2DEQA 1PSEA 2RF0A 1RAIB 1H1QB 5LJ5f 2O2OA 3OYFA 4A4EA 1AHJB 2DXBB 1T3LA 2W9ZA 1RAAB 3EHQA 1WHGA 2OTLA 1TG0A 4N4GA 3MO8A 4RTWA 2KR3A 3LWHA 2VB6A 3MI9B 3JCMQ 2EJGA 9ATCB 2LNHB 4N0AA 3OYCA 1CKAA 4ZGJB 3EH2A 1I8FA 4BCIB 2ECZA 3GNFB 4J8OA 1KQSA 2GGRA 2CH4W 4AT1B 2IIMA 2F1LA 3QYGB 4XU0A 2JNGA 2OJ2A 2E70A 3JCMJ 2YDLA 4E47A 2DJZA 1JB0E 2DTOA 2KDSA 4DA4A 3OMCA 3EFOB 5I21A 2L89A 4LN2A 1JSUB 2YRDA 2R5AA 4HT8A 4LDXA 5GAMg 1NLOC 3HO8A 2WIHB 4Z89A 3CD6A 3CBPA 3JV3A 2DK3A 4XTUA 3OYEA 4N4IA 2LJ3A 1I07A 1IGUA 2EW3A 2LJ1A 1T3SA 4X1VA 4OMQA 4BI8B 3CXCS 3KUFA 4ZTJA 4D8DA 2AT1B 4OVAA 2ABLA 2CDTA 2K3XA 1I4K1 2K2MA 3JAME 1B7TA 2R58A 3HHTB 2DD4B 2FYKA 2CP3A 4KRTA 3SWNA 4PLLA 3L2UA 4ORZA 3T9NA 1IRXA 1UJ0A 2NLUA 5GAN6 2QQBA 2MYSA 1RADB 4XTZA 3L2ZA 3M55A 2YWWA 3BFMA 2IPOB 5C6SA 1YIJA 2K3YA 1O9KB 1WDXA 1NM7A 3EFSA 2ZPHB 2MMPA 3FDRA 4J7IA 2KE9A 2BIVA 4YC3B 4JS5A 1B34B 2LMJA 5IH2A 4RODA 1TUGB 1YI2T 4BE1A 4KULA 3BLHB 2M02A 3BHTB 1JXOA 4J9HA 4XTXA 1ABQA 1H24B 4FT2A 5CKHA 4PFPA 1DJ7B 3LWIA 2PUOB 2P4TA 2Y4XA 1VQMA 1MHNA 1YHQT 2BS4A 2LQNA 1M1GA 5L2WB 3CC4T 2UZLB 2A0FB 3EIDB 1JBMA 3J7AF 2K5IA 1NJIR 1G3SA 1KQSP 2XMFA 1JOWA 4E7HA 2DRMA 4YTLA 4BDZA 4DOWA 3A8OB 1M90R 2JM9A 5HCKA 2JM8A 3OYMA 2JS2A 4PFOA 2EWNA 2C0IA 4Y91A 4ELLA 1RAEB 1YITT 2QEXT 5DLQE 4CFWB 2RPNA 3UA6A 2ESWA 2ZAEA 4BBRM 3DL1A 5KYXB 5I22A 3X25B 1N9SA 5IF1B 4O5VA 1WIEA 5GAOl 1UNLD 2KXDA 4C8QF 3CC4A 2VGMA 3CQTA 1PKTA 3BG5A 3OYDA 3CEYA 3TU4K 2AZVA 1LVKA 1YI2Q 3H4CA 5CQYA 3SD4A 3NMZC 1TUDA 2JUFA 4A4KA 4GLMA 4F7UF 2GBQA 1Q7YC 2DA9A 1M27C 1VYWB 2F2VA 3SB2A 3OBYA 2W9FA 4BY6C 2O4XB 3R6OA 1X27A 1WXBA 2XDDA 5GAN7 2RHUA 3VS0A 3MEVA 1VQOT 1OI1A 2EAYA 4PL6A 1AEYA 4JX6A 2X3XD 2CP7A 1R0BG 2GFAA 3V7CA 2K57A 2QTVA 5LJ3j 1AISB 2FRYA 2CREA 2J6KA 4FW2A 2BTTA 3FIFA 3C0CA 2HDAA 2PHGA 4FSXA 2FPDA 4ATOA 4IUUA 2L3SA 4XTYA 3VJPA 5DQVA 1ZBJA 2B86A 2KK4A 1IO6A 1KC8U 1T0HA 4JZ3A 2CS7A 4QSHA 1VQLQ 5D6XA 2PUKB 3E19A 1M5Q1 1PCXA 1TUCA 3KHIA 1O9KA 3NFCA 3DDQB 4LD6A 3MIAB 1YN8A 5CEIB 3QSUA 1VOLA 3REAB 1M3AA 2QG9B 3DJBA 3ZFJA 2KGTA 3A98A 2QA4A 3NTIA 2K5FA 3OY9A 3LQ5B 5LJ5d 4P5NA 4QVCA 2VUBA 4E7LA 2P0PA 2RI3A 2L3PA 5KE3A 4IUVA 2C5VB 1H4LD 4O6JA 1VQ7T 2HSEB 2KR6A 2ZCFB 2K2VA 2JN0A 3POMA 1OKVB 1OIUB 2RB6A 4J83A 1EX4A 1OZ2A 1PSFA 2DVEA 2VXEA 3CCRQ 2JVVA 2LZ6B 2GTOA 2EUFA 1OPKA 2VWFA 2A3LA 1OIYB 4QVDA 1NEGA 1VUBA 4II1A 4C92D 2L0AA 4OMMA 3O8VA 4OB0B 1UHCA 2M51A 1H1SB 1O9SA 2R5MA 4GLKA 1YITA 1K76A 2BZ8A 1VQLT 2BKDN 2CZ0B 1U06A 1C1AA 3BE3A 4JRKA 1M3CA 4KGXB 3VUBA 4M75C 1WPYA 1X69A 2FB7A 4ROEA 2NUTA 4E6RA 1IREB 2JT4A 1GL5A 4XU3A 4F7UE 2OTLT 5CK9A 2CP6A 2FRWA 2DAQA 2KYBA 4M7AF 5AYFA 4XU1A 3BDLA 5HY6A 4ANJA 2DD5B 2OTJQ 1K8AC 4M7DE 4M78G 3VYGA 5GANg 4M7DB 1Q82C 1E7OA 2HBPA 4EMKC 3JCMh 4LUDA 1LOJA 3DLMA 2IG0A 5FRMA 2G9XB 1SG5A 2IN3A 4EPCA 1X75C 2EQMA 1UGSB 1VQPA 4C0DC 4M75F 4J7FA 3BLRB 3HL8A 1JQQA 4FL6A 3DB3A 3OW2A 1OV3A 3LW5E 3TQ7P 1YCSB 2QDJA 4KH0B 2E41A 2BE7D 1X6BA 3VUZA 2KT1A 4C5GA 1NPPA 1JRIA 2L3RA 4F17A 3G4SA 1XTDA 1UGRB 5LL6S 4HVWA 1KD1U 1ENWA 4JDSA 1ZLMA 2DPPB 4F6UB 3Q1JA 1VQ8T 3X24B 2DRKA 2VVKA 1MGQA 5GANe 3JCMc 3WXMB 3QG1A 4BE2A 1Q86C 2XK0A 3LLRA 3DKMA 3NDQA 4M7AD 3CCLT 4DBHA 2WPAB 3PT9A 2HSPA 3CCJQ 2P4RA 4IUQA 3CCVT 3TNIB 2DTIA 3DOGB 4OMFB 1KXUA 3R6NA 3VRZA 1O75A 4F7UB 1YJNT 3I56A 2J05A 1E6GA 1XNIA 4BI4A 2YUNA 3EG1A 2CUDA 3HFNA 3CC7Q 5HBHB 5FGKB 1YHQQ 5CKDA 3CCMA 2CGHA 3L2VA 1IHVA 3A8HB 3M59A 5LJ5j 1KD1C 3RGFB 2MWPA 1NJIU 3HKSA 4FYXB 3JRZA 1QQJA 2BZYA 2UZDB 2YLBA 3ER0A 4RTZA 4JJBA 3GTMS 3LH0A 1YJNA 2QASA 3UT1A 3LX7A 2E1HA 5LMKB 4F7UG 5J26A 5D6WA 5ECAA 4KGVB 1YBYA 2EYXA 3QWXX 1V1CA 4HNUA 1RAHB 2L5QA 4Y92A 4ELZC 1VINA 1M8MA 3I9QA 4PJMA 1UJYA 4AKGA 3G71A 1TSFA 1M2VB 3BY7A 1QMZB 1URCB 4N4HA 4TVRA 5A0LA 4J9CA 3MHXA 3NPFA 4M75D 1D3UB 3C12A 1KQ1A 2YHTA 3EFOA 2H3EB 1WHKA 1TTHB 3EOCB 1BK2A 2LDMA 3L2QA 2DEUA 3JCMd 4M78D 2X1NB 2EKOA 4EMKB 3CCLQ 3CMAQ 1SEMA 5DM7R 1ZX6A 3CCJT 1VQ4T 5KYYB 4J6XA 3CCVQ 4FW1A 5IDNB 1K0SA 1YJNQ 1OL1B 1PWTA 5GANf 1VQKQ 4MDWA 4M77F 6AT1B 1YFNA 2JGZB 1VOMA 4LDWA 1E9HB 4PJLA 5LJ3h 2AIRB 3M58A 2DBMA 2CZ6B 2YUQA 2V8IA 4C8QB 1Q81C 4RCBA 1I0CA 3M0SA 2BPMB 4QQGA 5FROA 2DMOA 5KYWB 1C6VX 1VQNQ 1H8KA 3PIOA 1Q95G 1JJ2S 2OAWA 3HPWA 2ED1A 1B34A 3MCAB 4WF2A 2W99A 3M0UA 1W2BP 2KMGA 2RK1A 2ATCB 1Y96A 2QDYB 3MEUA 1WYXA 3CCUA 1MMNA 1UGPB 1AOJA 1FWZA 4OP0A 1WJRA 4X34A 3OW2P 2QDLA 3CCET 4BBSM 4XQ3A 2F2XA 2XD0A 1JXMA 2K4YA 2HMAA 2WSFE 4HL4A 1Q81U 2MOXA 5GAOq 3UWNA 3CMAT 1YIJQ 4M7AB 4A4HA 2RA2A 2DIQA 1CKBA 3LGFA 2DD4A 2QAZA 1N27A 1K9MU 2K9GA 4FSSA 3TW7A 1VIEA 1VYVA 4OMNA 3A8LB 3HRUA 1GUXB 2EKHA 5CKFA 2GCXA 4A54A 3RMQA 2CSIA 4HNVA 2DLPA 4KH1B 3JB9D 4JUVA 1QVFP 1KC8C 2QGFB 4CRLB 1MMDA 4JJNK 1OI9B 2A08A 1RI9A 2NUTB 4RCCA 1VYTA 5FU6C 3TNWB 3BLQB 2K6DA 1VQ6Q 3HTRA 2KAFA 1Y7XA 2C4GB 4PFZA 1BYMA 2OTJA 3CCEQ 3V7SA 1XQHA 3REBB 2ROTA 4LDUA 1VQ9T 5GANh 2V8KA 1PD0A 3PMIA 1N8RC 1NJIC 1G5VA 4JX5A 3M0TA 4J5YA 4Z88A 2EGCA 2J6OA 3PVQA 2OTJT 1V29B 3VS6A 3OA6A 4QQDA 1S72T 4M7DG 2LT4A 2SRCA 2M0YA 2DBKA 1KFZA 1Z9QA 4HXJA 1GFDA 3F5XB 1OQKA 1VQOA 4OMLA 1MV3A 4Z6YA 3SWNC 1KK7A 4E7ZA 1R77A 1SSFA 1T0JA 3OYJA 4KUDK 2BKZB 2V26A 4J9EA 1U1TA 4FIBA 2RMOA 4M78F 2HKNA 1BU2A 4L59A 2E5QA 1WA7A 1HK9A 3CPFA 4HVUA 1KG1A 1NE8A 4RMOA 1QKXA 2KMTA 2KI7A 4PJOG 3M0PA 3JB9G 3RIRA 5CYIB 4B9XA 4QQ6A 3LH5A 1S72A 1M9SA 4EOPB 3RESA 3OYIA 3HP9A 3CCMT 2AHJB 3SWNB 3CCUQ 2BUDA 1PM3A 1BI2A 1Q7YR 3OQ5A 4RUGA 4IUPA 4EC9B 1SKUB 4XK8E 1X01A 1BCMA 2IW8B 3M56A 1PRMC 1I5LA 3M0QA 5HK0A 4AI6A 3RDVA 2FG0A 3NHNA 3VV0A 1NBEB 1YWPA 3TREA 5GAMf 1ACMB 3X26B 1ZSGA 3PVLA 3OW2S 2YUPA 3VYHB 4L5GA 1GH6B 1UFFA 4JX4A 2NUZA 2RK2A 3EG0A
chains in the Genus database with same CATH topology
3QHSA 1BIAA 1LJOA 2KK4A 4M6VA 1E7PA 4C8QG 2KQWA 3CCQA 1K73U 3HFOA 1KC8U 4PJOB 2QQ8A 2A7YA 4BE2A 4BB7A 4IKFA 1FX7A 2CS7A 5GMKm 4QSHA 2XI9A 1BI1A 2RHZA 2PUKB 3E19A 1M5Q1 5D6XA 4C92E 2LT1A 3QBYA 2XICA 1VQNA 3KHIA 3NFCA 3FB9A 4LD6A 4NS5A 1Q82U 2DKGA 1YI2A 1VQ7A 2DXBA 2KSSA 2M9UA 1BI3A 3QSUA 2E64A 2ZZDB 3ZFJA 2QA4A 3NTIA 3QJ6A 2K5FA 3OY9A 5EG2A 5LJ5d 1QVFA 3VU3C 5GAN4 4P5NA 3M9QA 4EMKA 1Q86U 4QVCA 2VUBA 1WQ7A 4E7LA 2P0PA 2RI3A 1YCYA 2BS2A 4ZN3A 5CR2A 3S3OA 1OYXA 4RKUE 5I2SA 4XAXB 5KE3A 4QVZA 3TW6A 2D9TA 4FU6A 4J6WA 5IAYA 3CC2T 1VQ6A 3JCMf 5CCAA 2LX9A 4IUVA 5FU7C 5L8RE 5LJ3g 3CCUT 1VQLA 1P92A 4O6JA 1VQ7T 3V8LA 3PTAA 2KR6A 2ZCFB 2L8DA 3GF5A 3PGGA 2K2VA 4M7DC 2JN0A 2PQWA 2JTFA 4BI3A 2QXFA 3I55T 3PMTA 5GAMh 3I56T 4M77B 5GMKi 4PJOD 2H3JA 2DXTA 2RB6A 4X9CA 1FXXA 4EMHA 2RHXA 4MZMA 3FRNA 1YJNT 4J83A 1OZ2A 1PSFA 3JB9I 2DVEA 4ZGEB 2DIGA 2VXEA 1QVGS 2JVVA 3N5BB 4M75A 4NL3A 3QO3A 4LOCA 2A3LA 3CBMA 2M1HA 4QVDA 3X20B 2CYZB 1H641 1YJWT 1VUBA 4II1A 4ZN1A 4C92D 5GAOp 3JB9J 1Y71A 3MEWA 1KQSS 2X4JA 3CXCA 3I55A 3O8VA 3OSSC 4E7IA 2GFUA 4M78E 4OB0B 2R5MA 4GLKA 1YITA 1O9SA 3CBOA 1BIBA 2Y4YA 2X35A 4OGCA 2FVUA 2RJDA 3HRTA 1UB4A 4M7DD 2XKOC 1ZBXA 1VQLT 2BKDN 2CZ0B 2K5LA 4C0GA 4XU2A 2DTHA 3PFSA 5DY9A 3URGA 4ZTFA 3OYGA 2LC4A 3SFMA 4JRKA 1VQ4A 4R55A 3FLGA 4E7KA 5A2QE 3VUBA 3G4ST 1YJ9T 4M75C 5EJCA 1WPYA 3CMAA 4MFEA 3C95A 3S6WA 5GMKe 1XOVA 4V2SA 2FB7A 3TCJA 2FL7A 5KCOA 4PLIA 1IREB 5GAOm 5GAMd 2RI2A 4XU3A 4F7UE 2OTLT 3E9GA 5CK9A 4DOVA 3GOXA 4M7AC 2YLCA 2WSCE 1QLBA 2MAMA 1KHCA 2DAQA 1WNLA 4JLGA 4M7AF 4FM4B 5GAOn 5AYFA 4XU1A 1QVGA 1N9RA 5FRNA 3CC7T 3BDLA 3BG3A 5HY6A 2DD5B 1K8AC 3GLXA 4M7DE 3GNGA 1WQWA 4M78G 3VYGA 5C0MA 5GANg 4M7DB 5GAMe 5HK3A 2VYTA 3RKWA 3CCJA 3QXEB 3QZ9B 1Q82C 4OF1A 3GIBA 4MDXA 2HBPA 2RJCA 3TEEA 2X4XA 2VXFA 3BG9A 4MMLA 3JCMh 4EMKC 4M77A 4HA8A 1HXDA 1LOJA 3DLMA 3OMGA 2Y90A 3JCMV 2DXCB 2IG0A 2VV5A 2RD1A 4JS4A 5FRMA 1QVFS 3H8ZA 3FC3A 3RERA 4QW2A 1X75C 2EQMA 2OAUA 1UGSB 2RJFA 3HRSA 4C0DC 2QTXA 4EPCA 4M75F 5GMKj 2VC8A 1VQPA 2E65A 4J7FA 1WJQA 2MWOA 4A4GA 1G3WA 3LGLA 2CZ1B 4HCBA 5LJ5g 3HL8A 4FL6A 4DQ2A 2ZPIB 3DB3A 3OW2A 1I81A 1Q7YU 1N6AA 3LW5E 3CCQT 3HSBA 4M7AD 3T9NA 1FKMA 3CCEA 2QDJA 2E41A 3M54A 5GAN2 4C92F 2ZPBB 1KHIA 4RG8A 4B9WA 2DO3A 2ZPFB 3JCMW 1OZ3A 4A53A 3VUZA 2G77A 1N8RU 4C5GA 1NPPA 4VUBA 1VQMT 3HZJA 5J39A 4BD3A 2D0QB 1JRIA 2L3RA 3G4SA 1XTDA 1UGRB 2EQUA 5LL6S 2MF2A 3P8BB 1KD1U 2LCLA 1QP2A 1M1KU 4JDSA 5IT9E 1D3BB 3OYBA 2DPPB 2RH2A 2GQVA 3Q1JA 2HAXA 1D3BA 1VQ8T 3X24B 4CRIA 4Q5WA 5FU7B 3E1SA 1M1KC 1MGQA 4JRQA 4EMGA 5GANe 3JCMc 5CKEA 3WXMB 4M77E 3QG1A 4M78C 2LQ8A 2XK0A 3LLRA 3DKMA 3JCMX 2HQXA 2CKKA 2LNVA 3NTHA 3J81E 2DZ9A 2EIFA 3H6ZA 2P0KA 3PT9A 3OS0A 3CCLT 5KCHA 1VQ5A 1KQ2A 4HT9A 4M7AA 4C8QD 4IUQA 4ZGDB 2BS3A 1LNXA 2JZ2A 3CCVT 1M8VA 2DTIA 3QDRB 4M75G 2PVDB 4OMFB 4F7UB 1O75A 2RJEA 5FU6B 3I56A 3KBGA 3OB9A 3BW1A 4KT0E 4BY6B 2RHYA 4D6WA 1XNIA 2EJFA 4RG2A 1NZ9A 2QQAA 3HFNA 4KBMB 4BI4A 5HKCA 3C94A 5DLOA 4LD9K 4Y28E 3JCMe 5CKDA 3CCMA 3M4GA 2CGHA 4HCZA 1M4ZA 3L2VA 5LJ5j 3A8HB 2GF7A 3M59A 3UPUA 1KD1C 1QP3A 2MWPA 2M16A 3V7RA 1NJIU 4M7DF 3HKSA 3CCLA 3JRZA 4OB1B 3OBWA 3QYHB 4M78A 2YLBA 4XTWA 3ER0A 4ME7A 3RMSA 5GANj 3V8KA 4C92G 3LH0A 4IUTA 2XU8A 4M78B 4R56A 1YJNA 3UT1A 4EDUA 2X4WA 3LX7A 3OSVA 2E1HA 4F7UG 3OYKA 5J26A 2LTOA 4ELYC 2G3RA 2EFIA 5D6WA 4C5HA 1YBYA 2EJ9A 5CIUA 3KXTA 4OGEA 3CCST 5LJ3e 2M0OA 2PVOB 1K9MC 4NOYA 1ZQ1A 4Z02A 3QWLA 4HNUA 4AKIA 2E12A 2L5QA 4M75E 1TH7A 1VQ5T 4ELZC 2C06A 1W4SA 5GANd 2D6FA 2LQKA 3PIPA 3CCVA 4AKGA 5IN1A 4JRPA 3JCMP 1EIFA 2KY9A 3QYEA 3FJPA 3LYIA 4F7UA 3G71A 3OYLA 3RUXA 3QIIA 4M77C 2EYQA 1UGQB 3VYGB 2DEQA 5LJ5e 4MZTA 1PSEA 1WGSA 3BY7A 1G3YA 4XTVA 4N4HA 4TVRA 5LJ5f 5A0LA 4IURA 4M75D 3MHXA 3OYFA 1ZHIA 4A4EA 4HCCA 1AHJB 2DXBB 3C12A 4GY5A 2PU9B 3CC7A 4M7AE 1KQ1A 3JCMg 2YHTA 1BI0A 3VKHA 2OTLA 3L2QA 2LDMA 4N4GA 1UEBA 3EFRA 3MO8A 3JCMd 4M78D 2EKOA 3LWHA 4EMKB 5DM7R 3JCMQ 2HNIA 3CCJT 1VQ4T 2EJGA 4JLIA 3ZEHA 3CCRT 4J6XA 2QEXA 2O01E 5LJ5h 1H3ZA 4N0AA 5GANf 3JSCA 3INZA 4LDYA 4MDWA 3OYCA 4NC6A 4M77F 3P8DA 2R57A 5GMKh 4ZGJB 1I8FA 4J8OA 3GNFB 3F70A 4M77D 1KQSA 3MP6A 4LDWA 3CC2A 5LJ3h 3QYGB 2QF7A 3M58A 4XU0A 2JNGA 3RKXA 2CZ6B 2E70A 4BUGA 3JCMJ 3MEAA 4PJOF 2V8IA 4E47A 2DJZA 4C8QB 1JB0E 1Q81C 2DTOA 3PNWC 5A0GA 2I2LA 4RCBA 5GAN8 4QQGA 4ATOA 5FROA 2KDSA 3M4YA 4DA4A 3PIOA 2DXUA 4X9DA 1JJ2S 3OMCA 5I21A 2L89A 5CVIA 2DZCA 3HPWA 1X6OA 1B34A 3MCAB 2JTMA 2R5AA 4L6V5 3NTKA 4WF2A 5GAMg 4HT8A 4LDXA 2KMGA 2RK1A 3HO8A 4C0DB 4HNTA 1VQ6T 3MEUA 1QW1A 2QDYB 1Y96A 5GMKl 3CCUA 3CCRA 1NPRA 3CD6A 3X28B 3CBPA 1Y96B 2E10A 4C8QE 1YJWA 2DK3A 1UGPB 4XTUA 3OYEA 1FWZA 4OP0A 4N0AC 1WJRA 4N4IA 4X34A 4M7DA 2IVWA 3SDZA 3CCET 1BKBA 2B8AA 4BI8B 4BBSM 3JB9F 4XQ3A 3CXCS 2E6NA 2XD0A 2K4YA 4PKCC 2WSFE 4HL4A 4HLQA 3OYHA 4BDYA 1Q81U 2KVQG 3DB4A 3QKJA 3KUFA 1RI0A 4ZTJA 2F5KA 5GAOq 1M1FA 3UWNA 4OVAA 3CMAT 1U8RA 4M7AB 2EQKA 4A4HA 2RA2A 2DIQA 2K3XA 3LGFA 1I4K1 2DD4A 4C92C 1N27A 3JAME 1K9MU 2XDBA 3WVDB 3HHTB 3A8MB 2R58A 1VQKT 4OB2B 2DD5A 2DD4B 3TW7A 1VIEA 2FYKA 5LJ3f 1YHQA 2QI2A 1JJ2A 3A8LB 3OYNA 3HRUA 4PLLA 3SWNA 3L2UA 5CKFA 2QFZA 2V8JA 3L1AA 1U1SA 2GCXA 2NLUA 2PVGB 2EQJA 2VGNA 3A5ZB 2QQBA 3RMQA 4A54A 5GAN6 4HNVA 4XTZA 3L2ZA 3M55A 2CZ7B 3E9FA 3VKGA 3L42A 3BFMA 5LJ3d 1IZ6A 1GXIE 3S3NA 4XTYA 4UC4A 3JB9D 4JUVA 3V8JA 3OS1A 2WJ9A 5GAOr 1KC8C 4M7AG 5C6SA 1YIJA 3ME9A 5KE2A 3ZBDA 4C92B 4M75B 1VQNT 2K3YA 4JJNK 2ZPGB 2XDPA 5CAIA 4JRIA 2RI5A 4RCCA 1W2BS 3EFSA 3BDUA 3G71T 2ZPHB 2MMPA 3FDRA 5FU6C 4J7IA 4PJOE 4MZPA 2RO0A 2BIVA 2YRVA 2XHCA 4JS5A 2KAFA 1B34B 1Y7XA 3GP8A 2LRQA 1YI2T 3WVEB 4BE1A 2XIDA 4KULA 4PNOA 3JCMb 2LVMA 4XTXA 1BYMA 2OTJA 4FT2A 3V7SA 3CCSA 2P0QA 5CKHA 4NL2A 1XQHA 5A0DA 1DJ7B 3LWIA 2PUOB 4MIMA 2P4TA 3M5AA 2Y4XA 4LDUA 1MHNA 1YHQT 2BS4A 1VQMA 1RL2A 3FEOA 1M1GA 1VQ9T 2ZPEB 4C5IA 5GANh 3CPWA 3CC4T 4AKHA 1K8AU 2V8KA 3PMIA 1N8RC 1NJIC 1G5VA 4C0ZA 1JBMA 2HD0A 1YIJT 3J7AF 4JX5A 2K5IA 4J5YA 1G3SA 2QQSA 4FT4A 1VQ8A 3UDCA 1M90U 4E7HA 1W2BA 4YTLA 5KH6A 4BDZA 2OTJT 1V29B 3OA6A 4QQDA 1S72T 1G3TA 4DOWA 3A8OB 4M7DG 3RKYA 3VJPA 3G6ET 2E6ZA 1K73C 5J3BA 1M90C 3OYMA 3M57A 4MFDA 1QVPA 2LT4A 2EWNA 2FHDA 4E7JA 4Y91A 4ELJA 2O4XA 3OS5A 3CMEA 1YITT 2QEXT 5DLQE 3OYYA 1VQPT 3ASKA 4C8QA 2DXCA 3CD6T 1VQOA 4BBRM 3DL1A 2JOYA 4Z6YA 2QQ9A 3S3MA 3SWNC 3OYJA 1SSFA 3X25B 4KUDK 2ZGWA 1N9SA 2QQRA 1R8OB 2WACA 4BACA 1U1TA 4FIBA 4M78F 4O5VA 2WSEE 2ZZDA 4C5EA 5GAOl 3CC4A 4L59A 2E5QA 4C8QF 4C92A 3G6EA 2VGMA 2RM4A 3MP1A 4LDVA 3CPWS 3BG5A 1Q86C 3OYDA 4C8QC 1HK9A 3CEYA 3CPFA 3EAEA 5CO7A 3HB9A 5GAN3 3TU4K 3VKIA 1KG1A 1NE8A 2HQEA 3M53A 4RMOA 2KMTA 3QUIA 2QA4T 2F69A 1VQ9A 4PJOG 3JB9G 3H4CA 2LCCA 3RIRA 4B9XA 5CQYA 4QQ6A 3SD4A 3DLLA 1S72A 4OB3B 1M9SA 3RESA 3J80E 3HP9A 1VIFA 2JUFA 3G7ZA 4A4KA 3OYIA 3L2RA 3CCMT 4PJOA 2AHJB 3SWNB 4F7UF 5GAMj 1YJ9A 1Q7YC 3L2WA 2BUDA 3HBLA 1Y07A 2XG8D 4BE0A 1BI2A 3SB2A 3OQ5A 3OBYA 2F5TX 4IUPA 4BY6C 1WJSA 2O4XB 3R6OA 5FLXE 4J6YA 3C4SA 4XK8E 5I2MA 1X01A 3M56A 2XDDA 2MI6A 3MP8A 2RHUA 5GAN7 1I5LA 3MEVA 5HK0A 4AI6A 1VQOT 1OI1A 2EAYA 4KUIA 4A4FA 4PL6A 4PJOC 4M77G 3META 2X4YA 3QYBA 3AHUA 4JX6A 3VV0A 5GAN5 3CMET 4CI0C 2GFAA 3V7CA 4MMKA 4C0FA 5CQXA 2K57A 3TREA 5GAMf 5LJ3j 4HKEA 1VQKA 5CKBA 3X26B 3OS2A 3OYAA 3P8HA 5M9OA 3JB9H 3OW2S 3QJYA 3A8GB 3VYHB 2RHIA 3QPHA 4L5GA 3FIFA 3GPLA 4JX4A 4FSXA 3QZ5B 5D6YA 4IUUA 2RK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC B;  3WVE B;  1UGS B;  2O01 E;  2PUK B;  2CZ1 B;  2ZPI B;  4ZGJ B;  1DJ7 B;  3LW5 E;  2DXB A;  2PUO B;  2ZZD B;  2ZPE B;  2ZPB B;  3QYG B;  2ZPF B;  2CZ6 B;  1JB0 E;  2D0Q B;  4RKU E;  1UGR B;  1QP2 A;  1V29 B;  5L8R E;  2DPP B;  3A8O B;  2ZCF B;  3X24 B;  4L6V 5;  2QDY B;  3X28 B;  2DXC A;  1PSF A;  1UGP B;  4ZGE B;  4ZGD B;  3X25 B;  2PVD B;  2WSE E;  2ZZD A;  4KT0 E;  3X20 B;  2CYZ B;  4Y28 E;  2WSF E;  3A8H B;  4OB0 B;  1QP3 A;  4OB1 B;  3QYH B;  2DD4 A;  4OB3 B;  2CZ0 B;  3WVD B;  3HHT B;  3A8M B;  2DD5 A;  4OB2 B;  2AHJ B;  2DD4 B;  3A8L B;  2PVG B;  1IRE B;  2PVO B;  4XK8 E;  2CZ7 B;  1GXI E;  2WSC E;  4FM4 B;  1UGQ B;  3VYG B;  1PSE A;  2DD5 B;  3VYG A;  3X26 B;  2ZPG B;  3A8G B;  3VYH B;  1AHJ B;  2DXB B;  3QXE B;  2ZPH B;  3QZ9 B;  2PU9 B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 4EOL B;  1Y0M A;  1E7P A;  2CSQ A;  2KQW A;  3CCQ A;  1K73 U;  1D0Y A;  2QQ8 A;  1UDL A;  4AFU C;  1BI1 A;  3CPW P;  3QBY A;  1ZUK A;  3G4S Q;  4OGR B;  2DKG A;  4BCM B;  1D0X A;  1YI2 A;  2KSS A;  2I40 B;  5IXB A;  3VS2 A;  1SRL A;  1QVF A;  3H0F A;  3VU3 C;  4EMK A;  1TWB A;  4AFS C;  1YCY A;  4ZN3 A;  5CR2 A;  2DX1 A;  1MND A;  1OPL A;  4G6L B;  1PKS A;  3JCM f;  1D1B A;  5CCA A;  1VQL A;  1P92 A;  3PTA A;  2PZ1 A;  2L8D A;  5IHK A;  1W98 B;  4M7D C;  4YOS A;  2W2H A;  1LCK A;  1XJW B;  2JMC A;  3PMT A;  2R7G A;  2DVJ A;  4Y72 B;  4PJO D;  2DXT A;  1FXX A;  2RHX A;  3FRN A;  1VQ4 Q;  2DIG A;  3CD6 Q;  4M75 A;  1GFC A;  3H41 A;  4LOC A;  3CBM A;  2PJQ A;  4F70 B;  1UHF A;  3BHU B;  3X20 B;  1H64 1;  4CC4 B;  3JB9 J;  3MEW A;  1OKW B;  1KQS S;  2GFU A;  1ZSZ A;  4M78 E;  4PJJ A;  3VS3 A;  1BIB A;  4OGC A;  2FVU A;  2RN8 A;  4M7D D;  2XKO C;  4FX3 B;  5IHI A;  1VQ4 A;  4R55 A;  3FLG A;  5EJC A;  4V2S A;  4MFE A;  4PLI A;  4FCY A;  1U3O A;  5GAM d;  4F7S B;  5IHY A;  4KGZ B;  2YLC A;  2MAM A;  2W10 A;  1QVG A;  2V1Q A;  4J9B A;  3GNG A;  1WQW A;  5D7U A;  5HK3 A;  2VYT A;  4OMP A;  1W70 A;  2DXC B;  1QVF S;  2RD1 A;  3EHR A;  3FC3 A;  1OOT A;  2DL3 A;  2RJF A;  1QCN A;  3CD6 T;  5HBJ B;  2VC8 A;  3H9N A;  2E65 A;  2C5N B;  2MWO A;  1WI7 A;  5LJ5 g;  3AT1 B;  4DBF A;  4CC3 A;  1JJ2 A;  1Q7Y U;  1FKM A;  4C92 F;  2ZPB B;  1KHI A;  4RG8 A;  3VS1 A;  2DO3 A;  1VQ5 Q;  4A53 A;  2QA4 Q;  1H1R B;  4KRC B;  4VUB A;  5J39 A;  4BD3 A;  1VQM T;  3EG3 A;  1QMC A;  2LCL A;  5IT9 E;  1YJ9 Q;  3OYB A;  2DL8 A;  2E4H A;  4F7N B;  1D3B A;  2PTK A;  5FU7 B;  1RAF B;  1M1K C;  2DE0 X;  1OU9 A;  4M77 E;  3M0R A;  3JCM X;  2HQX A;  3OS0 A;  2DZ9 A;  1PC0 A;  2EIF A;  5KCH A;  1VQ5 A;  3ZL7 C;  2KRM A;  4BCG B;  4ZGD B;  1LNX A;  2RJE A;  5FU6 B;  1D0Z A;  1U5S A;  4BY6 B;  2I0N A;  4IIO A;  4RG2 A;  1NZ9 A;  5HKC A;  4LD9 K;  3RBB B;  3JCM e;  3UA7 A;  8AT1 B;  3UPU A;  2DNU A;  1QP3 A;  2DYI A;  3CCL A;  1TS9 A;  2MPX C;  3RMS A;  2FEI A;  5FWB A;  5GAN j;  4C92 G;  4Z8A A;  1PNJ A;  2JMA A;  2XU8 A;  4R56 A;  2X4W A;  3OSV A;  3DTO A;  2HEQ A;  4E7S A;  3G6E Q;  1K9M R;  3KXT A;  1MNE A;  4OGE A;  2LJ0 A;  4NOY A;  1ZQ1 A;  2A37 A;  4PK4 A;  4M75 E;  2E12 A;  1VQ5 T;  5GAN d;  5IN1 A;  3JCM P;  1R0C B;  3QYE A;  3FJP A;  4YOO A;  2K79 A;  3LYI A;  4F7U A;  2O9S A;  3OYL A;  3QII A;  4M77 C;  1UGQ B;  5LJ5 e;  7AT1 B;  1WGS A;  4XTV A;  1G3Y A;  1OX9 A;  3RR6 A;  4IUR A;  1D1C A;  1ZHI A;  4M7A E;  2PU9 B;  3SEM A;  1Y57 A;  3JCM g;  4YOZ A;  3CXC P;  2X9H A;  3EFR A;  1J3T A;  4JJD A;  4JLI A;  3ZEH A;  1MMA A;  3CCR T;  2QEX A;  1H3Z A;  3CCM Q;  1XO2 A;  1W6X A;  4LDY A;  3P8D A;  2R57 A;  2RQT A;  5IHN A;  2WMA B;  4M77 D;  2BE9 B;  2V1R A;  3MP6 A;  1SPK A;  1VYU A;  3RKX A;  5ACB A;  5ICP B;  2DME A;  3CME Q;  1UNG D;  4BCJ B;  3PNW C;  5A0G A;  5GAN 8;  1Q81 R;  2DFU A;  2DXU A;  5KYW A;  5CVI A;  2DZC A;  1H27 B;  1JU5 C;  2FZC B;  2AZS A;  3EG9 A;  2KXC A;  4L6V 5;  5LQF B;  5EFQ B;  2OTL Q;  1QW1 A;  3CCR A;  3X28 B;  5IXF A;  1Y96 B;  2E10 A;  1YJW A;  4N0A C;  4DEX A;  3H0H A;  3RNJ A;  5EC7 A;  1BKB A;  2B8A A;  2LP5 A;  3JB9 F;  5KYU A;  2E6N A;  4PKC C;  3OYH A;  4IMY B;  2KVQ G;  1RI0 A;  4QT7 A;  4ESR A;  2GTJ A;  1U8R A;  1HSQ A;  2EQK A;  4GBQ A;  2KBT A;  2W96 A;  3WVD B;  3CC2 Q;  4OB2 B;  2QI2 A;  2RNA A;  2CP5 A;  3OYN A;  3CCQ Q;  3UF4 A;  2WMB B;  1U1S A;  3A5Z B;  1M3B A;  4AG1 C;  3QHW B;  4RTX A;  1NG2 A;  2CZ7 B;  3E9F A;  3VKG A;  5LJ3 d;  5KYX A;  1GXI E;  4EOQ B;  2AK5 A;  4EOS B;  2FPE A;  2EGA A;  2IW6 B;  5GAO r;  4M7A G;  1K1Z A;  3ZBD A;  4M75 B;  1A0N B;  1OX8 A;  1D1A A;  2ZPG B;  2XDP A;  5CAI A;  3VRY A;  2RI5 A;  3BDU A;  3G71 T;  2J6F A;  4OR5 B;  2D0N A;  2WIP B;  2HQH A;  2RO0 A;  3EGX A;  1KIK A;  3GP8 A;  2LCS A;  1G83 A;  1AD5 A;  4EIK A;  1UUE A;  2LRQ A;  1AWX A;  2XID A;  2WFY B;  2QGG A;  3JCM b;  1Z9Z A;  1TU0 B;  4CFX B;  2P0Q A;  5A0D A;  1IHW A;  1P5E B;  3CC7 T;  4MIM A;  1EZZ B;  4BY1 X;  4D8K A;  4CC7 A;  2ED0 A;  4C5I A;  4AKH A;  2EYZ A;  1VQO Q;  2RQV A;  2QQS A;  4F7L B;  4FT4 A;  2PK2 A;  4FYV B;  3UDC A;  3MY5 B;  4CC2 A;  2KRO A;  1G3T A;  1X43 A;  2E6Z A;  5J3B A;  2WXV B;  3M57 A;  2COW A;  4DBR A;  3TSW A;  2FHD A;  4ELJ A;  3CME A;  3OS5 A;  2A36 A;  1K8A R;  3OYY A;  3A1P A;  3ASK A;  4C8Q A;  2DXC A;  4LE9 A;  4NST B;  2QQ9 A;  3S3M A;  4F04 B;  2WHB B;  2ZGW A;  4PJN A;  2WAC A;  1RAC B;  2QQR A;  1YNZ A;  4EOO B;  4RTV A;  2WSE E;  4C5E A;  4WCI A;  4C92 A;  3B57 A;  2RM4 A;  3MP1 A;  4LDV A;  3EG9 B;  4C8Q C;  4BCN B;  2LX7 A;  5GAN 3;  3VKI A;  3M53 A;  2HQE A;  1ZA2 B;  1UGV A;  2QA4 T;  1IXD A;  2LCC A;  4F6W B;  3M03 A;  2VAS A;  3DLL A;  1NEB A;  2DL7 A;  1VIF A;  2G6F X;  3G7Z A;  1QWE A;  2MCN A;  1MUZ A;  3HBL A;  1Y07 A;  2DYB A;  1D09 B;  5IDP B;  2F5T X;  1VQ7 Q;  2RQW A;  5FLX E;  2SEM A;  3C4S A;  1QWF A;  5I2M A;  1FMK A;  2MI6 A;  1BBZ A;  1H28 B;  3KFV A;  4KUI A;  4A4F A;  4M77 G;  3MET A;  2PNI A;  1V76 A;  2QYZ A;  2PMI B;  2X4Y A;  3QYB A;  1ZUU A;  4C0F A;  1WHL A;  1M1K R;  1Q86 R;  4HKE A;  1VQK A;  3TNH B;  3OS2 A;  3OYA A;  3P8H A;  5M9O A;  3QJY A;  4BCP B;  4CFU D;  4F14 A;  4C8Q G;  1UG1 A;  4PJO B;  1M30 A;  4IKF A;  4BB7 A;  1WLP B;  1FMW A;  5GMK m;  2RHZ A;  4C92 E;  4EC8 B;  1ZP2 A;  2LT1 A;  2XIC A;  1Q82 U;  2DET A;  1BI3 A;  2EYW A;  2E64 A;  2ZZD B;  2KNB B;  5EG2 A;  1Q86 U;  3M9Q A;  3S3O A;  1OYX A;  5IAY A;  2D9T A;  2X51 A;  1VQ6 A;  1VA7 A;  5FU7 C;  5LJ3 g;  5I5Z B;  4JZ4 A;  2EPD A;  2PQW A;  2JTF A;  1GCP A;  3I55 T;  3I56 T;  5GMK i;  4I3Z B;  4EMH A;  4CFM B;  2CCI B;  1M2O A;  1KJW A;  1ZA1 B;  3QO3 A;  4NL3 A;  4LXC A;  2FZK B;  2CCH B;  5HBE B;  1NYF A;  1YJW T;  4EOI B;  5GAO p;  1AT1 B;  1Y71 A;  2FPF A;  2X4J A;  3CXC A;  3OSS C;  1AWO A;  2D1X A;  1ZUY A;  4EOK B;  1UB4 A;  3EGD A;  2K5L A;  4C0G A;  3PFS A;  5AT1 B;  3ULR B;  2CT4 A;  2LC4 A;  3SFM A;  4UN0 A;  1X2Q A;  4FYY B;  2KYM A;  3MKD A;  3CMA A;  3C95 A;  3S6W A;  5GMK e;  1XOV A;  2IVX A;  2NYS A;  2FL7 A;  4RTY A;  1OL2 B;  5GAO m;  1VQ9 Q;  2RI2 A;  1K4U S;  3E9G A;  1RLQ C;  3GOX A;  4M7A C;  1BB9 A;  2WSC E;  4A63 B;  1KHC A;  1G8X A;  1WNL A;  4RTU A;  4JLG A;  5FRN A;  4BY7 X;  3BG3 A;  3GLX A;  3H0I A;  5GAM e;  2NUP A;  3RKW A;  2X3W D;  3GIB A;  4IIM A;  4M77 A;  4HA8 A;  3I56 Q;  3OMG A;  2Y90 A;  1ABO A;  3I35 A;  3RER A;  4QW2 A;  1PG5 B;  2OAU A;  4JS4 A;  3TN8 B;  5GMK j;  4A4G A;  1WJQ A;  4BCQ D;  1G3W A;  3LGL A;  2CZ1 B;  3O5Z A;  4DQ2 A;  1I81 A;  1N6A A;  3CCQ T;  4BCH B;  3CCE A;  3M54 A;  5GAN 2;  4B9W A;  8ATC B;  2ZPF B;  1TXQ A;  4JJC A;  1JEG A;  1F5Q B;  4AFZ C;  2DER A;  2EQU A;  1M1K U;  1MMG A;  1QP2 A;  1H3H A;  1HD3 A;  2KEA A;  2RH2 A;  2RQR A;  4CRI A;  3E1S A;  4BCN D;  4EMG A;  1SSH A;  2O88 A;  2LQ8 A;  3J81 E;  2LNV A;  2CKK A;  2JTE A;  1KQ2 A;  2COZ A;  2C6T B;  1M8V A;  2K3B A;  4M75 G;  2UZE B;  2NUP B;  3KBG A;  3OB9 A;  1WHJ A;  3BW1 A;  4KT0 E;  1I1J A;  2QQA A;  4KBM B;  4Y28 E;  4EOJ B;  1RLP C;  4LUE A;  3CC4 Q;  2GF7 A;  3V7R A;  5HQ0 B;  3EGU A;  3VS4 A;  4OB1 B;  2CT3 A;  3OBW A;  3QYH B;  3I5S A;  4M78 A;  3VS7 A;  4ME7 A;  4AG2 C;  4IUT A;  4HVV A;  2KT8 A;  3G1J A;  3EJ1 B;  1QCO A;  4ELY C;  2HBW A;  2MIO A;  3U23 A;  2EJ9 A;  5CIU A;  4BXX X;  2EVR A;  2PVO B;  4Z02 A;  4BCO B;  3QWL A;  4AKI A;  1C9B A;  1W4S A;  2LQK A;  3PIP A;  2QEX Q;  1HYO A;  2KY9 A;  5HVY B;  5L23 A;  3RUX A;  2EYQ A;  4MZT A;  1KC8 R;  2ENM A;  4HCC A;  4GY5 A;  3CC7 A;  5KYU B;  2QK0 A;  1OEB A;  1BI0 A;  3VKH A;  2FZG B;  1UEB A;  2JW4 A;  2EQI A;  2HNI A;  1SRM A;  4J9G A;  1JST B;  1BU1 A;  2O01 E;  5LJ5 h;  1B07 A;  1X2K A;  2LW4 A;  3JSC A;  1AD6 A;  3INZ A;  2H8H A;  4NC6 A;  1X6G A;  4R0K A;  5GMK h;  3F70 A;  3I5R A;  3PO3 S;  1AZE A;  3CC2 A;  2QF7 A;  1QCF A;  1H25 B;  1KSW A;  4BUG A;  3MEA A;  4PJO F;  2C0O A;  1YP5 A;  1RUW A;  2I2L A;  4JPB W;  1FVV B;  3QHR B;  3UAT A;  3M4Y A;  4X9D A;  2W0Z A;  1X6O A;  3EH1 A;  3EGX B;  1WX6 A;  2JTM A;  3NTK A;  1TOV A;  4ZNX A;  4C0D B;  1VQ6 T;  4HNT A;  5GMK l;  3BHV B;  3PE0 A;  1K9A A;  5KYY A;  1NPR A;  2EYY A;  3DDP B;  5I11 A;  4C8Q E;  1WHM A;  1N4M A;  4DBQ A;  2DL5 A;  4M7D A;  2IVW A;  3SDZ A;  5FWC A;  4QKU A;  2A28 A;  1UE9 A;  4BDY A;  4HLQ A;  3DB4 A;  4EON B;  3QKJ A;  1I5O B;  2F5K A;  2C5X B;  1M1F A;  2UZB B;  4C92 C;  2XDB A;  3A8M B;  1VQK T;  2DD5 A;  5LJ3 f;  2L3Q A;  1YHQ A;  4E2F B;  4II5 B;  2QFZ A;  2V8J A;  3L1A A;  2PVG B;  3FJ5 A;  2VGN A;  2EQJ A;  2HZY A;  3I55 Q;  3L42 A;  2WEV B;  1IZ6 A;  2FO0 A;  2C5O B;  3S3N A;  4UC4 A;  5HNB B;  2YT6 A;  3V8J A;  1TD6 A;  2WJ9 A;  5GJV B;  3OS1 A;  3ME9 A;  5KE2 A;  4C92 B;  1VQN T;  1H92 A;  2ROL A;  4JRI A;  1W2B S;  4AFQ C;  1YJW Q;  4PJO E;  1PD1 A;  4MZP A;  1QKW A;  2DL4 A;  2YRV A;  2XHC A;  2YUO A;  2J06 A;  1QVG P;  2PK9 B;  3WVE B;  4F16 A;  2I53 A;  4PNO A;  1UEC A;  2LVM A;  3CCS A;  1WFW A;  4NL2 A;  3TSZ A;  1KD1 R;  3M5A A;  2K7A A;  2E3H A;  1RL2 A;  1IB8 A;  2JS0 A;  3FEO A;  2ZPE B;  3CPW A;  1K8A U;  2DM1 A;  4C0Z A;  2HD0 A;  1YIJ T;  2L2P A;  1VQ8 A;  1JJ2 P;  1M90 U;  3MPU B;  1W2B A;  2DIL A;  5KH6 A;  2B9R A;  1WXT A;  1K73 R;  2EGE A;  1B3Q A;  3RKY A;  4DEY A;  3G6E T;  1K73 C;  1M90 C;  4MFD A;  1C0M A;  1QVP A;  4E7J A;  2O4X A;  4TTH A;  1F1B B;  3G33 B;  2CH4 A;  2JOY A;  4KRD B;  1CSK A;  1W1F A;  2HCK A;  3O0G D;  1R8O B;  4J9I A;  4BAC A;  1SF9 A;  2ZZD A;  3G6E A;  3CPW S;  1GBQ A;  3EAE A;  5CO7 A;  3HB9 A;  1JKW A;  1PKD B;  3QUI A;  1GRI A;  2F69 A;  1VQ9 A;  2AKL A;  4OB3 B;  3J80 E;  4PJO A;  3L2R A;  5GAM j;  3L2W A;  2XG8 D;  3THK A;  4BE0 A;  1WJS A;  1VQ8 Q;  4J6Y A;  1AZG B;  4RTT A;  3MP8 A;  2COY A;  4CFV B;  4PJO C;  4HCK A;  2D8J A;  1OUL A;  3AHU A;  3CME T;  5GAN 5;  4CI0 C;  4BCF B;  4MMK A;  5CQX A;  5CKB A;  2V22 B;  3JB9 H;  5GJW B;  3A8G B;  2RHI A;  3QPH A;  3GPL A;  5D6Y A;  3QZ5 B;  3E2U A;  1Q82 R;  2KRN A;  3QHS A;  1BIA A;  4CXA B;  1LJO A;  1OGU B;  4M6V A;  1WZO A;  1GBR A;  3HFO A;  2A7Y A;  1MV0 B;  1FX7 A;  4WTO B;  2OX7 A;  2XI9 A;  1UTI A;  1VQN A;  2QGS A;  3FB9 A;  4BCQ B;  1BCO A;  4NS5 A;  4LNP A;  4BCK B;  1VQ7 A;  2DXB A;  2M9U A;  2IW9 B;  2CUB A;  3QJ6 A;  2EBP A;  4EOR B;  5GAN 4;  1WQ7 A;  2JJ9 A;  2BS2 A;  1QLY A;  4RKU E;  5I2S A;  4XAX B;  1H26 B;  3TW6 A;  1LPL A;  2F2W A;  4FU6 A;  4J6W A;  4QVZ A;  3CC2 T;  2LX9 A;  3EGD B;  5L8R E;  3CCU T;  3QWY A;  3V8L A;  3GF5 A;  3PGG A;  1NYG A;  4BI3 A;  1H1P B;  1E6H A;  2GQI A;  2QXF A;  5GAM h;  2BZX A;  4M77 B;  1SHG A;  2H3J A;  4X9C A;  2YXY A;  4MZM A;  3JB9 I;  4ZGE B;  3MJX A;  1QVG S;  2E5K A;  3N5B B;  4F6S B;  2CP2 A;  4M4Z A;  2M1H A;  1ARK A;  1FYN A;  2CYZ B;  3G71 Q;  4ZN1 A;  3I55 A;  4E7I A;  4EOM B;  2DF6 A;  5KYN A;  3CBO A;  1S1N A;  2X35 A;  2Y4Y A;  2RJD A;  2P84 A;  3HRT A;  1AWJ A;  1ZBX A;  4XU2 A;  2DTH A;  2VKN A;  5DY9 A;  3URG A;  4ZTF A;  1N8R R;  3OYG A;  4B6M A;  4E7K A;  5A2Q E;  3G4S T;  3IQL A;  1YJ9 T;  2KRS A;  1FMV A;  3TCJ A;  4AMC A;  5KCO A;  5DQW A;  2C0T A;  4K11 A;  1FIN B;  4DOV A;  1VQP Q;  1AVZ C;  2RQU A;  1QLB A;  1PHT A;  4FM4 B;  5GAO n;  1ZSZ C;  1N9R A;  2F2C A;  1M2V A;  5C0M A;  4ROC A;  1OU8 A;  3D7S B;  1WHH A;  3CCJ A;  3QXE B;  3QZ9 B;  1N5Z A;  1ZSZ B;  4OF1 A;  2Z0W A;  4MDX A;  2RJC A;  2OI3 A;  3TEE A;  2X4X A;  2VXF A;  3BG9 A;  4MML A;  3GBQ A;  1HXD A;  1YIT Q;  2HKQ B;  3JCM V;  1HJD A;  2VV5 A;  3H8Z A;  1SHF A;  3HRS A;  2QTX A;  1YJ9 A;  4FYW B;  4CFN B;  2MK5 A;  1UNH D;  4HCB A;  4F7J B;  1EFN A;  1GY3 B;  2ZPI B;  3HSB A;  1NLP C;  2D8H A;  1JO8 A;  3CCS Q;  3VS5 A;  5BNJ B;  2YRC A;  2GNC A;  2AKK A;  3JCM W;  1OZ3 A;  3MY1 B;  2G77 A;  1N8R U;  3QDF A;  3HZJ A;  2D0Q B;  4J9F A;  3EG2 A;  2MF2 A;  3P8B B;  2YSQ A;  1K0X A;  1D3B B;  2UUE B;  3K7A M;  2GQV A;  2HAX A;  4Q5W A;  2HL3 A;  1G3N C;  4JRQ A;  5CKE A;  4M78 C;  1VQP T;  3NTH A;  4BCM D;  3H6Z A;  2P0K A;  4HT9 A;  4M7A A;  2CP0 A;  1RAB B;  4C8Q D;  2BS3 A;  2JZ2 A;  2DJQ A;  3QDR B;  4J9D A;  2PVD B;  2JXB A;  4D6W A;  2RHY A;  2EJF A;  1GUX A;  5DLO A;  3C94 A;  2E3I A;  2LQW A;  3M4G A;  2NWM A;  4HCZ A;  5FW9 A;  1M4Z A;  1WXU A;  2M16 A;  4CFU B;  1YWO A;  3NGP A;  2J7I A;  4M7D F;  1RAG B;  4XTW A;  1AWW A;  3V8K A;  1GCQ A;  3TVT A;  2O9V A;  4M78 B;  3SHW A;  4EDU A;  3OYK A;  1S72 Q;  1PRL C;  2LTO A;  2G3R A;  1TFB A;  2EFI A;  4C5H A;  3CCS T;  5LJ3 e;  2M0O A;  1K9M C;  2O31 A;  2C06 A;  1TH7 A;  1IGQ A;  1GCQ C;  1G2B A;  2D6F A;  3CCV A;  4JRP A;  1EIF A;  1VQM Q;  2CJM B;  2HL5 C;  4OMO A;  3VYG B;  2DEQ A;  1PSE A;  2RF0 A;  1RAI B;  1H1Q B;  5LJ5 f;  2O2O A;  3OYF A;  4A4E A;  1AHJ B;  2DXB B;  1T3L A;  2W9Z A;  1RAA B;  3EHQ A;  1WHG A;  2OTL A;  1TG0 A;  4N4G A;  3MO8 A;  4RTW A;  2KR3 A;  3LWH A;  2VB6 A;  3MI9 B;  3JCM Q;  2EJG A;  9ATC B;  2LNH B;  4N0A A;  3OYC A;  1CKA A;  4ZGJ B;  3EH2 A;  1I8F A;  4BCI B;  2ECZ A;  3GNF B;  4J8O A;  1KQS A;  2GGR A;  2CH4 W;  4AT1 B;  2IIM A;  2F1L A;  3QYG B;  4XU0 A;  2JNG A;  2OJ2 A;  2E70 A;  3JCM J;  2YDL A;  4E47 A;  2DJZ A;  1JB0 E;  2DTO A;  2KDS A;  4DA4 A;  3OMC A;  3EFO B;  5I21 A;  2L89 A;  4LN2 A;  1JSU B;  2YRD A;  2R5A A;  4HT8 A;  4LDX A;  5GAM g;  1NLO C;  3HO8 A;  2WIH B;  4Z89 A;  3CD6 A;  3CBP A;  3JV3 A;  2DK3 A;  4XTU A;  3OYE A;  4N4I A;  2LJ3 A;  1I07 A;  1IGU A;  2EW3 A;  2LJ1 A;  1T3S A;  4X1V A;  4OMQ A;  4BI8 B;  3CXC S;  3KUF A;  4ZTJ A;  4D8D A;  2AT1 B;  4OVA A;  2ABL A;  2CDT A;  2K3X A;  1I4K 1;  2K2M A;  3JAM E;  1B7T A;  2R58 A;  3HHT B;  2DD4 B;  2FYK A;  2CP3 A;  4KRT A;  3SWN A;  4PLL A;  3L2U A;  4ORZ A;  3T9N A;  1IRX A;  1UJ0 A;  2NLU A;  5GAN 6;  2QQB A;  2MYS A;  1RAD B;  4XTZ A;  3L2Z A;  3M55 A;  2YWW A;  3BFM A;  2IPO B;  5C6S A;  1YIJ A;  2K3Y A;  1O9K B;  1WDX A;  1NM7 A;  3EFS A;  2ZPH B;  2MMP A;  3FDR A;  4J7I A;  2KE9 A;  2BIV A;  4YC3 B;  4JS5 A;  1B34 B;  2LMJ A;  5IH2 A;  4ROD A;  1TUG B;  1YI2 T;  4BE1 A;  4KUL A;  3BLH B;  2M02 A;  3BHT B;  1JXO A;  4J9H A;  4XTX A;  1ABQ A;  1H24 B;  4FT2 A;  5CKH A;  4PFP A;  1DJ7 B;  3LWI A;  2PUO B;  2P4T A;  2Y4X A;  1VQM A;  1MHN A;  1YHQ T;  2BS4 A;  2LQN A;  1M1G A;  5L2W B;  3CC4 T;  2UZL B;  2A0F B;  3EID B;  1JBM A;  3J7A F;  2K5I A;  1NJI R;  1G3S A;  1KQS P;  2XMF A;  1JOW A;  4E7H A;  2DRM A;  4YTL A;  4BDZ A;  4DOW A;  3A8O B;  1M90 R;  2JM9 A;  5HCK A;  2JM8 A;  3OYM A;  2JS2 A;  4PFO A;  2EWN A;  2C0I A;  4Y91 A;  4ELL A;  1RAE B;  1YIT T;  2QEX T;  5DLQ E;  4CFW B;  2RPN A;  3UA6 A;  2ESW A;  2ZAE A;  4BBR M;  3DL1 A;  5KYX B;  5I22 A;  3X25 B;  1N9S A;  5IF1 B;  4O5V A;  1WIE A;  5GAO l;  1UNL D;  2KXD A;  4C8Q F;  3CC4 A;  2VGM A;  3CQT A;  1PKT A;  3BG5 A;  3OYD A;  3CEY A;  3TU4 K;  2AZV A;  1LVK A;  1YI2 Q;  3H4C A;  5CQY A;  3SD4 A;  3NMZ C;  1TUD A;  2JUF A;  4A4K A;  4GLM A;  4F7U F;  2GBQ A;  1Q7Y C;  2DA9 A;  1M27 C;  1VYW B;  2F2V A;  3SB2 A;  3OBY A;  2W9F A;  4BY6 C;  2O4X B;  3R6O A;  1X27 A;  1WXB A;  2XDD A;  5GAN 7;  2RHU A;  3VS0 A;  3MEV A;  1VQO T;  1OI1 A;  2EAY A;  4PL6 A;  1AEY A;  4JX6 A;  2X3X D;  2CP7 A;  1R0B G;  2GFA A;  3V7C A;  2K57 A;  2QTV A;  5LJ3 j;  1AIS B;  2FRY A;  2CRE A;  2J6K A;  4FW2 A;  2BTT A;  3FIF A;  3C0C A;  2HDA A;  2PHG A;  4FSX A;  2FPD A;  4ATO A;  4IUU A;  2L3S A;  4XTY A;  3VJP A;  5DQV A;  1ZBJ A;  2B86 A;  2KK4 A;  1IO6 A;  1KC8 U;  1T0H A;  4JZ3 A;  2CS7 A;  4QSH A;  1VQL Q;  5D6X A;  2PUK B;  3E19 A;  1M5Q 1;  1PCX A;  1TUC A;  3KHI A;  1O9K A;  3NFC A;  3DDQ B;  4LD6 A;  3MIA B;  1YN8 A;  5CEI B;  3QSU A;  1VOL A;  3REA B;  1M3A A;  2QG9 B;  3DJB A;  3ZFJ A;  2KGT A;  3A98 A;  2QA4 A;  3NTI A;  2K5F A;  3OY9 A;  3LQ5 B;  5LJ5 d;  4P5N A;  4QVC A;  2VUB A;  4E7L A;  2P0P A;  2RI3 A;  2L3P A;  5KE3 A;  4IUV A;  2C5V B;  1H4L D;  4O6J A;  1VQ7 T;  2HSE B;  2KR6 A;  2ZCF B;  2K2V A;  2JN0 A;  3POM A;  1OKV B;  1OIU B;  2RB6 A;  4J83 A;  1EX4 A;  1OZ2 A;  1PSF A;  2DVE A;  2VXE A;  3CCR Q;  2JVV A;  2LZ6 B;  2GTO A;  2EUF A;  1OPK A;  2VWF A;  2A3L A;  1OIY B;  4QVD A;  1NEG A;  1VUB A;  4II1 A;  4C92 D;  2L0A A;  4OMM A;  3O8V A;  4OB0 B;  1UHC A;  2M51 A;  1H1S B;  1O9S A;  2R5M A;  4GLK A;  1YIT A;  1K76 A;  2BZ8 A;  1VQL T;  2BKD N;  2CZ0 B;  1U06 A;  1C1A A;  3BE3 A;  4JRK A;  1M3C A;  4KGX B;  3VUB A;  4M75 C;  1WPY A;  1X69 A;  2FB7 A;  4ROE A;  2NUT A;  4E6R A;  1IRE B;  2JT4 A;  1GL5 A;  4XU3 A;  4F7U E;  2OTL T;  5CK9 A;  2CP6 A;  2FRW A;  2DAQ A;  2KYB A;  4M7A F;  5AYF A;  4XU1 A;  3BDL A;  5HY6 A;  4ANJ A;  2DD5 B;  2OTJ Q;  1K8A C;  4M7D E;  4M78 G;  3VYG A;  5GAN g;  4M7D B;  1Q82 C;  1E7O A;  2HBP A;  4EMK C;  3JCM h;  4LUD A;  1LOJ A;  3DLM A;  2IG0 A;  5FRM A;  2G9X B;  1SG5 A;  2IN3 A;  4EPC A;  1X75 C;  2EQM A;  1UGS B;  1VQP A;  4C0D C;  4M75 F;  4J7F A;  3BLR B;  3HL8 A;  1JQQ A;  4FL6 A;  3DB3 A;  3OW2 A;  1OV3 A;  3LW5 E;  3TQ7 P;  1YCS B;  2QDJ A;  4KH0 B;  2E41 A;  2BE7 D;  1X6B A;  3VUZ A;  2KT1 A;  4C5G A;  1NPP A;  1JRI A;  2L3R A;  4F17 A;  3G4S A;  1XTD A;  1UGR B;  5LL6 S;  4HVW A;  1KD1 U;  1ENW A;  4JDS A;  1ZLM A;  2DPP B;  4F6U B;  3Q1J A;  1VQ8 T;  3X24 B;  2DRK A;  2VVK A;  1MGQ A;  5GAN e;  3JCM c;  3WXM B;  3QG1 A;  4BE2 A;  1Q86 C;  2XK0 A;  3LLR A;  3DKM A;  3NDQ A;  4M7A D;  3CCL T;  4DBH A;  2WPA B;  3PT9 A;  2HSP A;  3CCJ Q;  2P4R A;  4IUQ A;  3CCV T;  3TNI B;  2DTI A;  3DOG B;  4OMF B;  1KXU A;  3R6N A;  3VRZ A;  1O75 A;  4F7U B;  1YJN T;  3I56 A;  2J05 A;  1E6G A;  1XNI A;  4BI4 A;  2YUN A;  3EG1 A;  2CUD A;  3HFN A;  3CC7 Q;  5HBH B;  5FGK B;  1YHQ Q;  5CKD A;  3CCM A;  2CGH A;  3L2V A;  1IHV A;  3A8H B;  3M59 A;  5LJ5 j;  1KD1 C;  3RGF B;  2MWP A;  1NJI U;  3HKS A;  4FYX B;  3JRZ A;  1QQJ A;  2BZY A;  2UZD B;  2YLB A;  3ER0 A;  4RTZ A;  4JJB A;  3GTM S;  3LH0 A;  1YJN A;  2QAS A;  3UT1 A;  3LX7 A;  2E1H A;  5LMK B;  4F7U G;  5J26 A;  5D6W A;  5ECA A;  4KGV B;  1YBY A;  2EYX A;  3QWX X;  1V1C A;  4HNU A;  1RAH B;  2L5Q A;  4Y92 A;  4ELZ C;  1VIN A;  1M8M A;  3I9Q A;  4PJM A;  1UJY A;  4AKG A;  3G71 A;  1TSF A;  1M2V B;  3BY7 A;  1QMZ B;  1URC B;  4N4H A;  4TVR A;  5A0L A;  4J9C A;  3MHX A;  3NPF A;  4M75 D;  1D3U B;  3C12 A;  1KQ1 A;  2YHT A;  3EFO A;  2H3E B;  1WHK A;  1TTH B;  3EOC B;  1BK2 A;  2LDM A;  3L2Q A;  2DEU A;  3JCM d;  4M78 D;  2X1N B;  2EKO A;  4EMK B;  3CCL Q;  3CMA Q;  1SEM A;  5DM7 R;  1ZX6 A;  3CCJ T;  1VQ4 T;  5KYY B;  4J6X A;  3CCV Q;  4FW1 A;  5IDN B;  1K0S A;  1YJN Q;  1OL1 B;  1PWT A;  5GAN f;  1VQK Q;  4MDW A;  4M77 F;  6AT1 B;  1YFN A;  2JGZ B;  1VOM A;  4LDW A;  1E9H B;  4PJL A;  5LJ3 h;  2AIR B;  3M58 A;  2DBM A;  2CZ6 B;  2YUQ A;  2V8I A;  4C8Q B;  1Q81 C;  4RCB A;  1I0C A;  3M0S A;  2BPM B;  4QQG A;  5FRO A;  2DMO A;  5KYW B;  1C6V X;  1VQN Q;  1H8K A;  3PIO A;  1Q95 G;  1JJ2 S;  2OAW A;  3HPW A;  2ED1 A;  1B34 A;  3MCA B;  4WF2 A;  2W99 A;  3M0U A;  1W2B P;  2KMG A;  2RK1 A;  2ATC B;  1Y96 A;  2QDY B;  3MEU A;  1WYX A;  3CCU A;  1MMN A;  1UGP B;  1AOJ A;  1FWZ A;  4OP0 A;  1WJR A;  4X34 A;  3OW2 P;  2QDL A;  3CCE T;  4BBS M;  4XQ3 A;  2F2X A;  2XD0 A;  1JXM A;  2K4Y A;  2HMA A;  2WSF E;  4HL4 A;  1Q81 U;  2MOX A;  5GAO q;  3UWN A;  3CMA T;  1YIJ Q;  4M7A B;  4A4H A;  2RA2 A;  2DIQ A;  1CKB A;  3LGF A;  2DD4 A;  2QAZ A;  1N27 A;  1K9M U;  2K9G A;  4FSS A;  3TW7 A;  1VIE A;  1VYV A;  4OMN A;  3A8L B;  3HRU A;  1GUX B;  2EKH A;  5CKF A;  2GCX A;  4A54 A;  3RMQ A;  2CSI A;  4HNV A;  2DLP A;  4KH1 B;  3JB9 D;  4JUV A;  1QVF P;  1KC8 C;  2QGF B;  4CRL B;  1MMD A;  4JJN K;  1OI9 B;  2A08 A;  1RI9 A;  2NUT B;  4RCC A;  1VYT A;  5FU6 C;  3TNW B;  3BLQ B;  2K6D A;  1VQ6 Q;  3HTR A;  2KAF A;  1Y7X A;  2C4G B;  4PFZ A;  1BYM A;  2OTJ A;  3CCE Q;  3V7S A;  1XQH A;  3REB B;  2ROT A;  4LDU A;  1VQ9 T;  5GAN h;  2V8K A;  1PD0 A;  3PMI A;  1N8R C;  1NJI C;  1G5V A;  4JX5 A;  3M0T A;  4J5Y A;  4Z88 A;  2EGC A;  2J6O A;  3PVQ A;  2OTJ T;  1V29 B;  3VS6 A;  3OA6 A;  4QQD A;  1S72 T;  4M7D G;  2LT4 A;  2SRC A;  2M0Y A;  2DBK A;  1KFZ A;  1Z9Q A;  4HXJ A;  1GFD A;  3F5X B;  1OQK A;  1VQO A;  4OML A;  1MV3 A;  4Z6Y A;  3SWN C;  1KK7 A;  4E7Z A;  1R77 A;  1SSF A;  1T0J A;  3OYJ A;  4KUD K;  2BKZ B;  2V26 A;  4J9E A;  1U1T A;  4FIB A;  2RMO A;  4M78 F;  2HKN A;  1BU2 A;  4L59 A;  2E5Q A;  1WA7 A;  1HK9 A;  3CPF A;  4HVU A;  1KG1 A;  1NE8 A;  4RMO A;  1QKX A;  2KMT A;  2KI7 A;  4PJO G;  3M0P A;  3JB9 G;  3RIR A;  5CYI B;  4B9X A;  4QQ6 A;  3LH5 A;  1S72 A;  1M9S A;  4EOP B;  3RES A;  3OYI A;  3HP9 A;  3CCM T;  2AHJ B;  3SWN B;  3CCU Q;  2BUD A;  1PM3 A;  1BI2 A;  1Q7Y R;  3OQ5 A;  4RUG A;  4IUP A;  4EC9 B;  1SKU B;  4XK8 E;  1X01 A;  1BCM A;  2IW8 B;  3M56 A;  1PRM C;  1I5L A;  3M0Q A;  5HK0 A;  4AI6 A;  3RDV A;  2FG0 A;  3NHN A;  3VV0 A;  1NBE B;  1YWP A;  3TRE A;  5GAM f;  1ACM B;  3X26 B;  1ZSG A;  3PVL A;  3OW2 S;  2YUP A;  3VYH B;  4L5G A;  1GH6 B;  1UFF A;  4JX4 A;  2NUZ A;  2RK2 A;  3EG0 A; 
#chains in the Genus database with same CATH homology
 3QHS A;  1BIA A;  1LJO A;  2KK4 A;  4M6V A;  1E7P A;  4C8Q G;  2KQW A;  3CCQ A;  1K73 U;  3HFO A;  1KC8 U;  4PJO B;  2QQ8 A;  2A7Y A;  4BE2 A;  4BB7 A;  4IKF A;  1FX7 A;  2CS7 A;  5GMK m;  4QSH A;  2XI9 A;  1BI1 A;  2RHZ A;  2PUK B;  3E19 A;  1M5Q 1;  5D6X A;  4C92 E;  2LT1 A;  3QBY A;  2XIC A;  1VQN A;  3KHI A;  3NFC A;  3FB9 A;  4LD6 A;  4NS5 A;  1Q82 U;  2DKG A;  1YI2 A;  1VQ7 A;  2DXB A;  2KSS A;  2M9U A;  1BI3 A;  3QSU A;  2E64 A;  2ZZD B;  3ZFJ A;  2QA4 A;  3NTI A;  3QJ6 A;  2K5F A;  3OY9 A;  5EG2 A;  5LJ5 d;  1QVF A;  3VU3 C;  5GAN 4;  4P5N A;  3M9Q A;  4EMK A;  1Q86 U;  4QVC A;  2VUB A;  1WQ7 A;  4E7L A;  2P0P A;  2RI3 A;  1YCY A;  2BS2 A;  4ZN3 A;  5CR2 A;  3S3O A;  1OYX A;  4RKU E;  5I2S A;  4XAX B;  5KE3 A;  4QVZ A;  3TW6 A;  2D9T A;  4FU6 A;  4J6W A;  5IAY A;  3CC2 T;  1VQ6 A;  3JCM f;  5CCA A;  2LX9 A;  4IUV A;  5FU7 C;  5L8R E;  5LJ3 g;  3CCU T;  1VQL A;  1P92 A;  4O6J A;  1VQ7 T;  3V8L A;  3PTA A;  2KR6 A;  2ZCF B;  2L8D A;  3GF5 A;  3PGG A;  2K2V A;  4M7D C;  2JN0 A;  2PQW A;  2JTF A;  4BI3 A;  2QXF A;  3I55 T;  3PMT A;  5GAM h;  3I56 T;  4M77 B;  5GMK i;  4PJO D;  2H3J A;  2DXT A;  2RB6 A;  4X9C A;  1FXX A;  4EMH A;  2RHX A;  4MZM A;  3FRN A;  1YJN T;  4J83 A;  1OZ2 A;  1PSF A;  3JB9 I;  2DVE A;  4ZGE B;  2DIG A;  2VXE A;  1QVG S;  2JVV A;  3N5B B;  4M75 A;  4NL3 A;  3QO3 A;  4LOC A;  2A3L A;  3CBM A;  2M1H A;  4QVD A;  3X20 B;  2CYZ B;  1H64 1;  1YJW T;  1VUB A;  4II1 A;  4ZN1 A;  4C92 D;  5GAO p;  3JB9 J;  1Y71 A;  3MEW A;  1KQS S;  2X4J A;  3CXC A;  3I55 A;  3O8V A;  3OSS C;  4E7I A;  2GFU A;  4M78 E;  4OB0 B;  2R5M A;  4GLK A;  1YIT A;  1O9S A;  3CBO A;  1BIB A;  2Y4Y A;  2X35 A;  4OGC A;  2FVU A;  2RJD A;  3HRT A;  1UB4 A;  4M7D D;  2XKO C;  1ZBX A;  1VQL T;  2BKD N;  2CZ0 B;  2K5L A;  4C0G A;  4XU2 A;  2DTH A;  3PFS A;  5DY9 A;  3URG A;  4ZTF A;  3OYG A;  2LC4 A;  3SFM A;  4JRK A;  1VQ4 A;  4R55 A;  3FLG A;  4E7K A;  5A2Q E;  3VUB A;  3G4S T;  1YJ9 T;  4M75 C;  5EJC A;  1WPY A;  3CMA A;  4MFE A;  3C95 A;  3S6W A;  5GMK e;  1XOV A;  4V2S A;  2FB7 A;  3TCJ A;  2FL7 A;  5KCO A;  4PLI A;  1IRE B;  5GAO m;  5GAM d;  2RI2 A;  4XU3 A;  4F7U E;  2OTL T;  3E9G A;  5CK9 A;  4DOV A;  3GOX A;  4M7A C;  2YLC A;  2WSC E;  1QLB A;  2MAM A;  1KHC A;  2DAQ A;  1WNL A;  4JLG A;  4M7A F;  4FM4 B;  5GAO n;  5AYF A;  4XU1 A;  1QVG A;  1N9R A;  5FRN A;  3CC7 T;  3BDL A;  3BG3 A;  5HY6 A;  2DD5 B;  1K8A C;  3GLX A;  4M7D E;  3GNG A;  1WQW A;  4M78 G;  3VYG A;  5C0M A;  5GAN g;  4M7D B;  5GAM e;  5HK3 A;  2VYT A;  3RKW A;  3CCJ A;  3QXE B;  3QZ9 B;  1Q82 C;  4OF1 A;  3GIB A;  4MDX A;  2HBP A;  2RJC A;  3TEE A;  2X4X A;  2VXF A;  3BG9 A;  4MML A;  3JCM h;  4EMK C;  4M77 A;  4HA8 A;  1HXD A;  1LOJ A;  3DLM A;  3OMG A;  2Y90 A;  3JCM V;  2DXC B;  2IG0 A;  2VV5 A;  2RD1 A;  4JS4 A;  5FRM A;  1QVF S;  3H8Z A;  3FC3 A;  3RER A;  4QW2 A;  1X75 C;  2EQM A;  2OAU A;  1UGS B;  2RJF A;  3HRS A;  4C0D C;  2QTX A;  4EPC A;  4M75 F;  5GMK j;  2VC8 A;  1VQP A;  2E65 A;  4J7F A;  1WJQ A;  2MWO A;  4A4G A;  1G3W A;  3LGL A;  2CZ1 B;  4HCB A;  5LJ5 g;  3HL8 A;  4FL6 A;  4DQ2 A;  2ZPI B;  3DB3 A;  3OW2 A;  1I81 A;  1Q7Y U;  1N6A A;  3LW5 E;  3CCQ T;  3HSB A;  4M7A D;  3T9N A;  1FKM A;  3CCE A;  2QDJ A;  2E41 A;  3M54 A;  5GAN 2;  4C92 F;  2ZPB B;  1KHI A;  4RG8 A;  4B9W A;  2DO3 A;  2ZPF B;  3JCM W;  1OZ3 A;  4A53 A;  3VUZ A;  2G77 A;  1N8R U;  4C5G A;  1NPP A;  4VUB A;  1VQM T;  3HZJ A;  5J39 A;  4BD3 A;  2D0Q B;  1JRI A;  2L3R A;  3G4S A;  1XTD A;  1UGR B;  2EQU A;  5LL6 S;  2MF2 A;  3P8B B;  1KD1 U;  2LCL A;  1QP2 A;  1M1K U;  4JDS A;  5IT9 E;  1D3B B;  3OYB A;  2DPP B;  2RH2 A;  2GQV A;  3Q1J A;  2HAX A;  1D3B A;  1VQ8 T;  3X24 B;  4CRI A;  4Q5W A;  5FU7 B;  3E1S A;  1M1K C;  1MGQ A;  4JRQ A;  4EMG A;  5GAN e;  3JCM c;  5CKE A;  3WXM B;  4M77 E;  3QG1 A;  4M78 C;  2LQ8 A;  2XK0 A;  3LLR A;  3DKM A;  3JCM X;  2HQX A;  2CKK A;  2LNV A;  3NTH A;  3J81 E;  2DZ9 A;  2EIF A;  3H6Z A;  2P0K A;  3PT9 A;  3OS0 A;  3CCL T;  5KCH A;  1VQ5 A;  1KQ2 A;  4HT9 A;  4M7A A;  4C8Q D;  4IUQ A;  4ZGD B;  2BS3 A;  1LNX A;  2JZ2 A;  3CCV T;  1M8V A;  2DTI A;  3QDR B;  4M75 G;  2PVD B;  4OMF B;  4F7U B;  1O75 A;  2RJE A;  5FU6 B;  3I56 A;  3KBG A;  3OB9 A;  3BW1 A;  4KT0 E;  4BY6 B;  2RHY A;  4D6W A;  1XNI A;  2EJF A;  4RG2 A;  1NZ9 A;  2QQA A;  3HFN A;  4KBM B;  4BI4 A;  5HKC A;  3C94 A;  5DLO A;  4LD9 K;  4Y28 E;  3JCM e;  5CKD A;  3CCM A;  3M4G A;  2CGH A;  4HCZ A;  1M4Z A;  3L2V A;  5LJ5 j;  3A8H B;  2GF7 A;  3M59 A;  3UPU A;  1KD1 C;  1QP3 A;  2MWP A;  2M16 A;  3V7R A;  1NJI U;  4M7D F;  3HKS A;  3CCL A;  3JRZ A;  4OB1 B;  3OBW A;  3QYH B;  4M78 A;  2YLB A;  4XTW A;  3ER0 A;  4ME7 A;  3RMS A;  5GAN j;  3V8K A;  4C92 G;  3LH0 A;  4IUT A;  2XU8 A;  4M78 B;  4R56 A;  1YJN A;  3UT1 A;  4EDU A;  2X4W A;  3LX7 A;  3OSV A;  2E1H A;  4F7U G;  3OYK A;  5J26 A;  2LTO A;  4ELY C;  2G3R A;  2EFI A;  5D6W A;  4C5H A;  1YBY A;  2EJ9 A;  5CIU A;  3KXT A;  4OGE A;  3CCS T;  5LJ3 e;  2M0O A;  2PVO B;  1K9M C;  4NOY A;  1ZQ1 A;  4Z02 A;  3QWL A;  4HNU A;  4AKI A;  2E12 A;  2L5Q A;  4M75 E;  1TH7 A;  1VQ5 T;  4ELZ C;  2C06 A;  1W4S A;  5GAN d;  2D6F A;  2LQK A;  3PIP A;  3CCV A;  4AKG A;  5IN1 A;  4JRP A;  3JCM P;  1EIF A;  2KY9 A;  3QYE A;  3FJP A;  3LYI A;  4F7U A;  3G71 A;  3OYL A;  3RUX A;  3QII A;  4M77 C;  2EYQ A;  1UGQ B;  3VYG B;  2DEQ A;  5LJ5 e;  4MZT A;  1PSE A;  1WGS A;  3BY7 A;  1G3Y A;  4XTV A;  4N4H A;  4TVR A;  5LJ5 f;  5A0L A;  4IUR A;  4M75 D;  3MHX A;  3OYF A;  1ZHI A;  4A4E A;  4HCC A;  1AHJ B;  2DXB B;  3C12 A;  4GY5 A;  2PU9 B;  3CC7 A;  4M7A E;  1KQ1 A;  3JCM g;  2YHT A;  1BI0 A;  3VKH A;  2OTL A;  3L2Q A;  2LDM A;  4N4G A;  1UEB A;  3EFR A;  3MO8 A;  3JCM d;  4M78 D;  2EKO A;  3LWH A;  4EMK B;  5DM7 R;  3JCM Q;  2HNI A;  3CCJ T;  1VQ4 T;  2EJG A;  4JLI A;  3ZEH A;  3CCR T;  4J6X A;  2QEX A;  2O01 E;  5LJ5 h;  1H3Z A;  4N0A A;  5GAN f;  3JSC A;  3INZ A;  4LDY A;  4MDW A;  3OYC A;  4NC6 A;  4M77 F;  3P8D A;  2R57 A;  5GMK h;  4ZGJ B;  1I8F A;  4J8O A;  3GNF B;  3F70 A;  4M77 D;  1KQS A;  3MP6 A;  4LDW A;  3CC2 A;  5LJ3 h;  3QYG B;  2QF7 A;  3M58 A;  4XU0 A;  2JNG A;  3RKX A;  2CZ6 B;  2E70 A;  4BUG A;  3JCM J;  3MEA A;  4PJO F;  2V8I A;  4E47 A;  2DJZ A;  4C8Q B;  1JB0 E;  1Q81 C;  2DTO A;  3PNW C;  5A0G A;  2I2L A;  4RCB A;  5GAN 8;  4QQG A;  4ATO A;  5FRO A;  2KDS A;  3M4Y A;  4DA4 A;  3PIO A;  2DXU A;  4X9D A;  1JJ2 S;  3OMC A;  5I21 A;  2L89 A;  5CVI A;  2DZC A;  3HPW A;  1X6O A;  1B34 A;  3MCA B;  2JTM A;  2R5A A;  4L6V 5;  3NTK A;  4WF2 A;  5GAM g;  4HT8 A;  4LDX A;  2KMG A;  2RK1 A;  3HO8 A;  4C0D B;  4HNT A;  1VQ6 T;  3MEU A;  1QW1 A;  2QDY B;  1Y96 A;  5GMK l;  3CCU A;  3CCR A;  1NPR A;  3CD6 A;  3X28 B;  3CBP A;  1Y96 B;  2E10 A;  4C8Q E;  1YJW A;  2DK3 A;  1UGP B;  4XTU A;  3OYE A;  1FWZ A;  4OP0 A;  4N0A C;  1WJR A;  4N4I A;  4X34 A;  4M7D A;  2IVW A;  3SDZ A;  3CCE T;  1BKB A;  2B8A A;  4BI8 B;  4BBS M;  3JB9 F;  4XQ3 A;  3CXC S;  2E6N A;  2XD0 A;  2K4Y A;  4PKC C;  2WSF E;  4HL4 A;  4HLQ A;  3OYH A;  4BDY A;  1Q81 U;  2KVQ G;  3DB4 A;  3QKJ A;  3KUF A;  1RI0 A;  4ZTJ A;  2F5K A;  5GAO q;  1M1F A;  3UWN A;  4OVA A;  3CMA T;  1U8R A;  4M7A B;  2EQK A;  4A4H A;  2RA2 A;  2DIQ A;  2K3X A;  3LGF A;  1I4K 1;  2DD4 A;  4C92 C;  1N27 A;  3JAM E;  1K9M U;  2XDB A;  3WVD B;  3HHT B;  3A8M B;  2R58 A;  1VQK T;  4OB2 B;  2DD5 A;  2DD4 B;  3TW7 A;  1VIE A;  2FYK A;  5LJ3 f;  1YHQ A;  2QI2 A;  1JJ2 A;  3A8L B;  3OYN A;  3HRU A;  4PLL A;  3SWN A;  3L2U A;  5CKF A;  2QFZ A;  2V8J A;  3L1A A;  1U1S A;  2GCX A;  2NLU A;  2PVG B;  2EQJ A;  2VGN A;  3A5Z B;  2QQB A;  3RMQ A;  4A54 A;  5GAN 6;  4HNV A;  4XTZ A;  3L2Z A;  3M55 A;  2CZ7 B;  3E9F A;  3VKG A;  3L42 A;  3BFM A;  5LJ3 d;  1IZ6 A;  1GXI E;  3S3N A;  4XTY A;  4UC4 A;  3JB9 D;  4JUV A;  3V8J A;  3OS1 A;  2WJ9 A;  5GAO r;  1KC8 C;  4M7A G;  5C6S A;  1YIJ A;  3ME9 A;  5KE2 A;  3ZBD A;  4C92 B;  4M75 B;  1VQN T;  2K3Y A;  4JJN K;  2ZPG B;  2XDP A;  5CAI A;  4JRI A;  2RI5 A;  4RCC A;  1W2B S;  3EFS A;  3BDU A;  3G71 T;  2ZPH B;  2MMP A;  3FDR A;  5FU6 C;  4J7I A;  4PJO E;  4MZP A;  2RO0 A;  2BIV A;  2YRV A;  2XHC A;  4JS5 A;  2KAF A;  1B34 B;  1Y7X A;  3GP8 A;  2LRQ A;  1YI2 T;  3WVE B;  4BE1 A;  2XID A;  4KUL A;  4PNO A;  3JCM b;  2LVM A;  4XTX A;  1BYM A;  2OTJ A;  4FT2 A;  3V7S A;  3CCS A;  2P0Q A;  5CKH A;  4NL2 A;  1XQH A;  5A0D A;  1DJ7 B;  3LWI A;  2PUO B;  4MIM A;  2P4T A;  3M5A A;  2Y4X A;  4LDU A;  1MHN A;  1YHQ T;  2BS4 A;  1VQM A;  1RL2 A;  3FEO A;  1M1G A;  1VQ9 T;  2ZPE B;  4C5I A;  5GAN h;  3CPW A;  3CC4 T;  4AKH A;  1K8A U;  2V8K A;  3PMI A;  1N8R C;  1NJI C;  1G5V A;  4C0Z A;  1JBM A;  2HD0 A;  1YIJ T;  3J7A F;  4JX5 A;  2K5I A;  4J5Y A;  1G3S A;  2QQS A;  4FT4 A;  1VQ8 A;  3UDC A;  1M90 U;  4E7H A;  1W2B A;  4YTL A;  5KH6 A;  4BDZ A;  2OTJ T;  1V29 B;  3OA6 A;  4QQD A;  1S72 T;  1G3T A;  4DOW A;  3A8O B;  4M7D G;  3RKY A;  3VJP A;  3G6E T;  2E6Z A;  1K73 C;  5J3B A;  1M90 C;  3OYM A;  3M57 A;  4MFD A;  1QVP A;  2LT4 A;  2EWN A;  2FHD A;  4E7J A;  4Y91 A;  4ELJ A;  2O4X A;  3OS5 A;  3CME A;  1YIT T;  2QEX T;  5DLQ E;  3OYY A;  1VQP T;  3ASK A;  4C8Q A;  2DXC A;  3CD6 T;  1VQO A;  4BBR M;  3DL1 A;  2JOY A;  4Z6Y A;  2QQ9 A;  3S3M A;  3SWN C;  3OYJ A;  1SSF A;  3X25 B;  4KUD K;  2ZGW A;  1N9S A;  2QQR A;  1R8O B;  2WAC A;  4BAC A;  1U1T A;  4FIB A;  4M78 F;  4O5V A;  2WSE E;  2ZZD A;  4C5E A;  5GAO l;  3CC4 A;  4L59 A;  2E5Q A;  4C8Q F;  4C92 A;  3G6E A;  2VGM A;  2RM4 A;  3MP1 A;  4LDV A;  3CPW S;  3BG5 A;  1Q86 C;  3OYD A;  4C8Q C;  1HK9 A;  3CEY A;  3CPF A;  3EAE A;  5CO7 A;  3HB9 A;  5GAN 3;  3TU4 K;  3VKI A;  1KG1 A;  1NE8 A;  2HQE A;  3M53 A;  4RMO A;  2KMT A;  3QUI A;  2QA4 T;  2F69 A;  1VQ9 A;  4PJO G;  3JB9 G;  3H4C A;  2LCC A;  3RIR A;  4B9X A;  5CQY A;  4QQ6 A;  3SD4 A;  3DLL A;  1S72 A;  4OB3 B;  1M9S A;  3RES A;  3J80 E;  3HP9 A;  1VIF A;  2JUF A;  3G7Z A;  4A4K A;  3OYI A;  3L2R A;  3CCM T;  4PJO A;  2AHJ B;  3SWN B;  4F7U F;  5GAM j;  1YJ9 A;  1Q7Y C;  3L2W A;  2BUD A;  3HBL A;  1Y07 A;  2XG8 D;  4BE0 A;  1BI2 A;  3SB2 A;  3OQ5 A;  3OBY A;  2F5T X;  4IUP A;  4BY6 C;  1WJS A;  2O4X B;  3R6O A;  5FLX E;  4J6Y A;  3C4S A;  4XK8 E;  5I2M A;  1X01 A;  3M56 A;  2XDD A;  2MI6 A;  3MP8 A;  2RHU A;  5GAN 7;  1I5L A;  3MEV A;  5HK0 A;  4AI6 A;  1VQO T;  1OI1 A;  2EAY A;  4KUI A;  4A4F A;  4PL6 A;  4PJO C;  4M77 G;  3MET A;  2X4Y A;  3QYB A;  3AHU A;  4JX6 A;  3VV0 A;  5GAN 5;  3CME T;  4CI0 C;  2GFA A;  3V7C A;  4MMK A;  4C0F A;  5CQX A;  2K57 A;  3TRE A;  5GAM f;  5LJ3 j;  4HKE A;  1VQK A;  5CKB A;  3X26 B;  3OS2 A;  3OYA A;  3P8H A;  5M9O A;  3JB9 H;  3OW2 S;  3QJY A;  3A8G B;  3VYH B;  2RHI A;  3QPH A;  4L5G A;  3FIF A;  3GPL A;  4JX4 A;  4FSX A;  3QZ5 B;  5D6Y A;  4IUU A;  2RK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...