3VYHB

Crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 67
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3vyhB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vyhB02
2ZPGB 4ZGEB 1QP2A 4XK8E 2DPPB 1AHJB 2DD5B 2CZ1B 1UGSB 3VYHB 2PU9B 1PSEA 3X26B 3QZ5B 2DXCB 4OB3B 1GXIE 2ZCFB 4FM4B 3QYHB 5L8RE 4ZGDB 4KT0E 3A8LB 2DD5A 1UGPB 1IREB 1UGQB 2ZPHB 4OB0B 1V29B 2DXCA 3WVEB 2QDYB 2CYZB 2CZ6B 2PVDB 2WSFE 3QXEB 2DXBB 2D0QB 4Y28E 3A8GB 2WSCE 2PUKB 2WSEE 2ZPBB 2CZ7B 3LW5E 3A8OB 4L6V5 3QZ9B 1DJ7B 3WVDB 2ZZDB 4ZGJB 1PSFA 2DD4B 1QP3A 2DXBA 2PVOB 2CZ0B 3VYGB 3A8MB 2ZPEB 3X24B 2ZPFB 4RKUE 2AHJB 3X20B 2O01E 3A8HB 2PUOB 2PVGB 3HHTB 1JB0E 4OB2B 2ZZDA 4OB1B 2DD4A 3X25B 2ZPIB 3QYGB 1UGRB 3X28B 3VYGA
chains in the Genus database with same CATH superfamily
2HAXA 2YLBA 4J7IA 3META 1AWOA 1P92A 4HKEA 2RQTA 1WFWA 1FMVA 3C4SA 4JJBA 3NHNA 3L2WA 2JMAA 1LJOA 1ZSZA 4C0DC 1GFCA 2IW6B 4MMKA 3CC4A 5GAMj 4XTZA 1K73C 2DILA 1GUXA 1VQMQ 3L2UA 4RG8A 2OTLA 4A54A 1OULA 2K2MA 5I22A 1EX4A 1IO6A 3CCEQ 3J81E 2F2WA 2AK5A 2BKDN 3M57A 3CEYA 1GFDA 5FWBA 1UJ0A 3RDVA 1OPLA 1K9MC 4KRTA 5EJCA 4AFSC 3VS4A 5HBEB 3JCMX 1KQSA 4PKCC 3M4GA 2K3BA 2LJ1A 1VQ6T 2J6OA 1RUWA 1YWOA 1I07A 1B34A 4F6UB 1YJNT 1G83A 3EG0A 2ENMA 4Q5WA 2RN8A 3CPWP 1KD1R 3OY9A 4N4HA 1MV3A 4JX4A 3OYYA 5LMKB 1Z9QA 2BZXA 1KK7A 2RK1A 1WJRA 2VUBA 4EOLB 3WVDB 3JB9J 4D8KA 2XI9A 3I5SA 4IUVA 3L2VA 2DRMA 1VQ7T 3M53A 4C5HA 3H0HA 4IMYB 1QCFA 3DOGB 1Y7XA 1B07A 2JNGA 4YOSA 3OBYA 5D6WA 4EONB 3EG2A 2L0AA 4RG2A 2D1XA 2QGFB 4BE0A 2KE9A 1NYGA 4OMFB 1UNLD 2DL4A 3TQ7P 1IXDA 2YXYA 2GFUA 3OYFA 1YCYA 2GQVA 4ZN3A 4OB1B 1VQMA 5CEIB 4EMKA 3CXCS 1H3ZA 1OV3A 4J6YA 1GL5A 2DBKA 4PJLA 1TWBA 2DZ9A 4E7ZA 4QSHA 1HSQA 2LC4A 4M78B 5GAOq 3EFOA 4M7AA 3CCEA 4XTYA 3M0PA 3M58A 5KYUB 1KQ1A 2W9FA 1JXOA 1G3TA 2LVMA 4PJOC 4C8QG 1KQSS 3CCUT 2NUTA 2F2CA 3X26B 3VKGA 1WYXA 3H4CA 3JCMW 2JUFA 4OB3B 1X27A 3G71Q 1T3SA 3HZJA 2HL3A 3U23A 2L8DA 4ORZA 2DL8A 3VS5A 3BW1A 1VQPT 1VQ8A 1RAHB 1GCQC 1OU9A 3CCMT 4KUIA 4DBQA 1KFZA 3EGDA 2VV5A 2QDYB 1F1BB 5GAOn 1GCPA 2PVDB 2WSFE 3QXEB 1JSUB 1WGSA 2DM1A 3CQTA 4J6WA 2EGEA 3CCRQ 2YUPA 4MMLA 3JCMe 2KNBB 3PO3S 2YHTA 2KYMA 4II5B 2FYKA 1K9AA 1YJ9T 3ER0A 4Z6YA 1Q82U 1U3OA 1MHNA 4M75C 4EOQB 2EGCA 3CCLA 2KK4A 4CXAB 3PE0A 4J9DA 4L59A 2WMBB 3BHUB 1YHQQ 3T9NA 1YI2T 4BCQD 4J9GA 4M77D 3BHTB 2KDSA 2VYTA 3VS1A 3CCSQ 4DOWA 3UA6A 2VASA 2CZ0B 5FU7C 3I56T 3VS6A 5KE2A 1TUGB 1OGUB 3HTRA 1VYUA 2WXVB 4QQDA 2QGGA 2E3IA 2FPEA 4X9CA 4RTTA 2C5VB 1VQLT 2NUPA 1ABOA 3M5AA 4BDZA 2PZ1A 4J9IA 4XU1A 5M9OA 3G71A 1WXBA 4J83A 4OMMA 3PTAA 3H9NA 3NPFA 1RACB 1FYNA 2D9TA 1YCSB 4AG2C 2MI6A 2F2XA 3FDRA 4HNUA 3M03A 3PMTA 4M77C 2E1HA 2COYA 1VUBA 2C5NB 3QYBA 1D09B 4F16A 1N9RA 5KH6A 4Y72B 3ULRB 3EG9A 3QHRB 2LTOA 1U06A 3CBOA 1ZQ1A 4BI8B 4EIKA 3CCRA 1SRLA 2QG9B 1WZOA 1Q82C 1P5EB 3RKWA 4YTLA 3G7ZA 4M7DG 3EGXA 1UGQB 1AWXA 4QVDA 4M7AF 1LOJA 1YNZA 2QFZA 2K2VA 1M90C 2JW4A 2QTVA 2RA2A 1YHQA 3EH1A 2WJ9A 4C8QD 3CCSA 3DLMA 3FEOA 2QA4T 2RI3A 1HYOA 3TNWB 1NJIU 4PNOA 3VS0A 1AEYA 2XDBA 4R0KA 1PRLC 3S3MA 2H3JA 3BFMA 1CKAA 2QGSA 1BK2A 4OMQA 3TU4K 3FRNA 1VQ5Q 3H6ZA 2L2PA 1I81A 5LJ5f 2OTJQ 4M75B 3E19A 1TG0A 4RODA 4IUPA 1N6AA 1TOVA 5GMKm 2HBWA 1SSHA 2KXDA 1WIEA 2HDAA 2O9VA 4ZTFA 4LDWA 1H1PB 4HVVA 4QW2A 1Q7YC 3JB9H 1PNJA 2ZGWA 1QMZB 3INZA 5LJ3f 2PUOB 2JJ9A 2BIVA 5FU7B 3GP8A 2X3WD 5GAN5 1VQNT 4C92G 2BPMB 4PJMA 4BCMB 3M0QA 2DTIA 3KXTA 4F14A 1GUXB 2RMOA 4R56A 2E6NA 4KUDK 5CQXA 3L2RA 4RTZA 1MMAA 1C6VX 4E7LA 3P8DA 5GAOp 5DLOA 3CPWA 3PGGA 1GRIA 2XG8D 1UGSB 5FRNA 3I9QA 1PC0A 2QTXA 3BDLA 3OYMA 1K0SA 4EDUA 3QZ5B 3NTKA 2MF2A 1PD0A 5A0LA 2ED1A 1KD1U 2BKZB 2ESWA 2H3EB 5FLXE 1Y96A 2LP5A 1B34B 2VGMA 1W1FA 1VQOQ 4IUUA 2XMFA 2DTHA 2GF7A 3SWNA 1N9SA 1M3AA 2HBPA 1JQQA 4OP0A 4BB7A 1W4SA 5CKEA 4J7FA 4NL2A 1VQ5A 2OTJA 3QO3A 2RH2A 1I4K1 1BU1A 1OZ2A 2LRQA 3M54A 4NS5A 4CC4B 2SRCA 1YITQ 3A98A 4KULA 5GAMd 2DX1A 1MMNA 4KGXB 1Y57A 4C5EA 3MP1A 4A4KA 4Y28E 2X1NB 3Q1JA 4MDWA 4PLLA 1UUEA 2DERA 1WHHA 2BE9B 2OAUA 1WQWA 4WF2A 3CC2A 1O9KB 3LLRA 4BD3A 1U8RA 4M7DD 1RI9A 4BCGB 1OIUB 5FGKB 2E64A 2XDPA 1JEGA 4M78G 3F5XB 4XU3A 1M1FA 4HCBA 4IIMA 3OA6A 5AYFA 1PHTA 1WJSA 1K8AR 2VXFA 2DKGA 4LNPA 2WEVB 3A8MB 3X24B 1N5ZA 2QQ8A 1OOTA 3EFOB 2DFUA 4M7AB 1SHGA 2A0FB 4O6JA 2UZDB 4EOJB 2JVVA 4A63B 1MV0B 1UNGD 1YJWT 1KD1C 3GIBA 3O8VA 3OSSC 2BUDA 5D6YA 2P0KA 4F7UA 4BY6C 2KRMA 1Z9ZA 5C0MA 1VQOA 4F7JB 4WCIA 2ROTA 4CC3A 4UN0A 3O0GD 1FINB 1ZBXA 3V8JA 5IHKA 4HNTA 2JTEA 2J06A 2PTKA 4PLIA 3DB3A 2UZBB 2D0NA 4A4FA 4BY7X 3VUZA 1S72T 1PSEA 1TH7A 2EVRA 2I40B 1B7TA 4JZ3A 2AIRB 4JS5A 2R5MA 4C92D 2VXEA 8ATCB 2J6KA 4MZTA 1M90R 4V2SA 2V26A 5GAMf 4EOPB 1IREB 2YUOA 4PFOA 3MO8A 1Q81U 4EOIB 3CC4T 2V8IA 2EW3A 4EC9B 2AKLA 1E7PA 4AT1B 1QVPA 2KT8A 1Y71A 4HVWA 3TREA 4RUGA 1ZX6A 1R0BG 2DO3A 1M3CA 2QQBA 3JCMV 2JMCA 3GOXA 2BS3A 4XAXB 3BHVB 4GBQA 1MUZA 2D6FA 1G3YA 2CSQA 3EFRA 1PWTA 4PFZA 2NLUA 4F04B 3R6NA 4PFPA 3M4YA 2KMGA 2B8AA 3J80E 1U5SA 2QEXQ 1AZEA 4PJOA 4DBRA 1VIEA 3OYDA 3ZEHA 1BI3A 2HEQA 3QIIA 1BCOA 2DXBA 4R55A 2PVOB 1Q7YR 4N4IA 3EGUA 3RKYA 1WHGA 3JCMc 4M78F 4XTUA 1SRMA 3OW2S 1R0CB 1SKUB 3RBBB 2XICA 3VRZA 2DEUA 3CC7Q 1D1CA 2DLPA 4KGVB 2QQRA 3CCQT 4DA4A 2DETA 3EG9B 2ZPGB 3UATA 2FHDA 1HXDA 2RJDA 1Q81C 1YWPA 4XK8E 3OYEA 4C8QE 3GF5A 1QVFP 3ZFJA 4EOSB 3MHXA 5A0DA 2CH4W 5GANe 1JO8A 2KI7A 2KGTA 3JB9I 1M30A 5AT1B 3NFCA 4A4HA 2BS2A 3A1PA 4KRCB 4M75A 4A53A 1FKMA 1T0JA 4BUGA 4AMCA 4VUBA 3OYGA 1QVGP 2B9RA 3LH0A 2KBTA 4UC4A 2EQMA 3CCET 4F7UF 2MCNA 5L2WB 4ZGDB 2E65A 4CFUD 1J3TA 1UGPB 2C0OA 4E7IA 3TNHB 3OYAA 4ELYC 1F5QB 2BTTA 2DXTA 1PKDB 1I0CA 2W99A 2GQIA 5GAN2 1UECA 3CD6Q 3FC3A 1D1BA 2WIPB 3TCJA 2EIFA 1K76A 5ACBA 1FX7A 1QWEA 4BY1X 4QVZA 4PL6A 1XO2A 1XTDA 1YN8A 3JAME 3GLXA 2RHUA 3V7CA 2QK0A 4IIOA 3H0FA 2L3SA 3REBB 4HT9A 4OR5B 1QWFA 1U1TA 2YRVA 2PNIA 3VRYA 2WACA 3VV0A 1VQ8T 1VQ9Q 1KHIA 5ECAA 1H92A 2GTOA 5LQFB 4L6V5 2F1LA 4OMNA 2IG0A 4C5IA 3CC7A 2DA9A 3HRSA 1WXUA 2JN0A 4DEXA 2O4XA 4M77A 4C0GA 5IDNB 2CKKA 3EHQA 2XDDA 4F7SB 5CQYA 5HBJB 1YIJQ 4CI0C 4BCKB 4EMHA 1G3NC 2C06A 2ZPEB 3CPFA 2ZPFB 3QUIA 3CCLT 2AHJB 1X6OA 2AZVA 4PK4A 2W0ZA 1HD3A 2RQWA 3PMIA 2RJCA 3OYHA 4HXJA 1OL1B 4OB2B 1BU2A 1X69A 3O5ZA 4JJDA 2QF7A 2WIHB 2G77A 3OYJA 1I8FA 2RB6A 4N4GA 4PJOF 2PK9B 3QDFA 1Y96B 2BZYA 4ZGEB 3OBWA 5GMKl 1OI9B 4EOKB 1H1SB 4OGCA 2ATCB 1NG2A 1KG1A 3C95A 1QW1A 1OPKA 3SWNB 4ESRA 1O9KA 3CD6A 3LWIA 2LCSA 1ENWA 2K5FA 3OMCA 3G71T 1OKVB 2DYBA 4E7SA 4PJNA 1MNEA 5I2MA 3LGFA 4MDXA 4FCYA 4HNVA 1VQ6Q 2FEIA 4M7DE 2WHBB 3WXMB 2QAZA 1KSWA 5A0GA 2HMAA 3CBMA 3JCMd 2DL3A 1VQ9A 4JRKA 2VB6A 2HZYA 2K5LA 3DTOA 3V8LA 3UF4A 4OB0B 2XU8A 2CH4A 1K8AU 3G6EQ 4BCPB 1JJ2P 2FPFA 3LWHA 4F6WB 4JS4A 1XOVA 3BY7A 4M7AG 2V8KA 1NEGA 3JCMg 2I53A 4M75F 3OYIA 3POMA 1YIJA 4C0DB 1VQ7Q 1O75A 3ME9A 3BG5A 1NEBA 3C12A 3MP6A 2PUKB 2IN3A 2ZPBB 1D3UB 1BB9A 3TW7A 3HPWA 1KHCA 4FW1A 2CREA 1ABQA 1HK9A 3CCST 4J8OA 4N0AA 1XNIA 4I3ZB 1NLPC 1WX6A 3H41A 2R58A 1ZLMA 4F7UB 2LNHB 3JCMh 3CCVQ 3TVTA 4FYVB 2EGAA 4AFQC 4CRIA 4C92E 1TXQA 3FIFA 4KRDB 3HHTB 2O88A 2MWPA 1N4MA 4A4GA 5ICPB 1W6XA 2MWOA 4OGEA 2KR3A 3CCUQ 1M90U 3MEAA 1Q81R 2JTMA 3VKIA 2NUZA 1D0ZA 2AKKA 4E7HA 1AD6A 4M77F 2CDTA 3DLLA 5IT9E 2KAFA 2LQKA 3D7SB 2JS2A 4HVUA 2RO0A 3GTMS 4BI4A 2C5XB 1K8AC 2EYQA 2R57A 4F70B 1NPPA 4AI6A 4NSTB 3G6EA 1YP5A 4DOVA 3PNWC 4AG1C 3M55A 2CP0A 2RHIA 2L5QA 3CCMQ 3A5ZB 2H8HA 3SFMA 1WHLA 2K4YA 2A7YA 3KBGA 4PJJA 1ZP2A 1OYXA 3RERA 3NDQA 3SHWA 1N27A 3LGLA 2DTOA 2PJQA 3HB9A 2LT1A 1JU5C 1YJ9Q 3E1SA 3VS2A 5IHYA 1UB4A 3HBLA 1V29B 5HCKA 1Q7YU 2RJEA 5DY9A 1QKXA 2CYZB 2E5QA 2CZ6B 3BLQB 3MY1B 2C6TB 5GJVB 4IUQA 1M9SA 2BS4A 1YI2Q 1PRMC 4PJOB 4JX6A 3C94A 2A37A 1BI0A 3CCVA 2DXBB 4D8DA 4RTXA 5DQVA 5IAYA 4XU2A 1QLYA 4BCHB 1QVFA 3I56Q 4GY5A 1UEBA 4JZ4A 5FU6C 7AT1B 3REAB 4OGRB 4AFUC 1ZBJA 2PQWA 1VOMA 1VQ4Q 4G6LB 1SEMA 4Y91A 1VQLQ 3OS2A 4JJNK 2CT3A 2EJGA 5CO7A 2HKNA 2O2OA 4XQ3A 4BCJB 1ZUKA 1QVGA 2W9ZA 1X6BA 3JB9F 1D1AA 2M9UA 1LPLA 2PMIB 1ZA2B 5LJ5e 1TUCA 3CC2T 4ELJA 5CYIB 5HVYB 3KHIA 3MCAB 2MYSA 2RHXA 1RAGB 3S3NA 1H8KA 2F69A 3CCMA 2QXFA 1YFNA 4EPCA 2JS0A 2LW4A 1UGRB 5LJ3e 4FL6A 4LUEA 2QQAA 3DL1A 4FT2A 2Z0WA 1T3LA 2VWFA 5IXFA 3LYIA 5GMKe 3RKXA 4JUVA 2CP7A 4EC8B 2VGNA 3MPUB 4C8QC 4F6SB 3SEMA 1WA7A 2HSPA 4QT7A 2PU9B 1B3QA 2EQUA 3M0SA 1UE9A 3BLRB 1ZHIA 3UWNA 1AT1B 5KCHA 2YDLA 5D6XA 4E2FB 5DQWA 1UNHD 2LDMA 4QQGA 3HFOA 1UJYA 3P8HA 1OQKA 4M4ZA 2X3XD 4LDUA 5I5ZB 1SG5A 4N0AC 3RR6A 3BG3A 1VQ4A 1ACMB 2L3RA 4KGZB 1VQLA 4A4EA 1QVGS 1Y07A 2O4XB 4IUTA 4F7NB 4BCQB 4M77B 3CXCP 2MPXC 2P84A 2CT4A 2MIOA 2ROLA 1NYFA 2DIQA 1T0HA 4GLMA 4OF1A 3A8GB 2FRYA 2DL5A 1BI1A 5IHNA 3OMGA 1BBZA 2C0IA 1VA7A 3OYKA 1VINA 1M3BA 3PVQA 3V8KA 5CAIA 4ZGJB 1VQNQ 4BBRM 4HCCA 5FU6B 1JRIA 4J9FA 1Q95G 3OS1A 2C5OB 4BCND 1D3BB 2FRWA 4JPBW 4E6RA 3ASKA 1K1ZA 1G3WA 2E12A 2QDLA 2DJQA 2HNIA 1OI1A 4QVCA 3CMAT 2CUDA 3NTHA 2DVEA 1PKSA 3CCJQ 2EUFA 4Z89A 4MIMA 1JJ2A 2X35A 3SD4A 2C4GB 3X25B 1W2BP 3BG9A 3H0IA 2YSQA 3M59A 1RAEB 2FB7A 1M5Q1 2EWNA 3VYGA 5GAOr 1ZUYA 2RQVA 2SEMA 3CPWS 1M8MA 4RTWA 1AHJB 2CZ1B 5EG2A 3EJ1B 1MGQA 2K7AA 1G2BA 4CFWB 3JRZA 3EHRA 2I2LA 2JOYA 1R77A 2OX7A 2EJ9A 1VQKQ 5HK3A 3L42A 4C8QB 1JBMA 4FM4B 5HNBB 1AZGB 1W70A 2B86A 2K5IA 2Y90A 2KVQG 4LXCA 5CIUA 2X51A 1M2VA 4M7DC 1NLOC 2ZPHB 3QHSA 2KEAA 3I55T 4F7UG 4FSSA 1XJWB 5L23A 3JV3A 3M0RA 2RJFA 1VQNA 3M9QA 5GAMe 1I5OB 2DZCA 2KRSA 1KC8R 1YITA 3B57A 5CKFA 3TW6A 1QCOA 1VYVA 4CFXB 2D0QB 1V1CA 2DEQA 5FRMA 4II1A 3SDZA 2R7GA 3CCJA 2D8JA 2LZ6B 2WMAB 1TFBA 1UDLA 3HFNA 5GAN7 1YJWQ 2QQSA 2IVXA 2MAMA 2OTLT 4AKHA 4NL3A 1WHMA 4EMGA 3MY5B 3AT1B 3HRTA 2X4JA 3V7RA 1OKWB 2OAWA 2IIMA 4ZNXA 2QI2A 1QLBA 1QMCA 2LNVA 3X20B 2M1HA 4GLKA 2EKOA 1H24B 5BNJB 4BI3A 1XQHA 5GANd 2GTJA 4CFVB 2DJZA 2KRNA 4C92C 1SF9A 2FO0A 1N8RR 2M16A 5FW9A 1VQKA 1KQ2A 2RHYA 1RAAB 4ROEA 2LT4A 5GANg 3URGA 3MP8A 2DPPB 1UHFA 3MEUA 1WI7A 1SSFA 1H4LD 1KJWA 5KYYA 4PJOG 3VYHB 1KIKA 3M56A 1KXUA 4TTHA 1EFNA 3KUFA 3UPUA 2DIGA 5KCOA 1IRXA 2M0YA 3BE3A 4LN2A 1FMWA 2A3LA 3OYCA 1A0NB 2GFAA 2RI2A 1GBRA 4MFEA 1IZ6A 4M78D 5KYXA 4X34A 2L89A 2JZ2A 5J26A 3A8LB 2LCCA 2A36A 1LCKA 4RCBA 5GANh 5KE3A 1QCNA 3OS5A 4BY6B 3GNFB 3VS3A 4FU6A 4P5NA 1S1NA 3RIRA 2M02A 4HA8A 1VQMT 4LD9K 4M7AE 3G4SQ 1YJWA 3WVEB 4M7DB 3V7SA 1TS9A 4Z02A 4B6MA 1ZSGA 1SPKA 3QPHA 8AT1B 5I11A 2CP2A 2HQXA 4ZTJA 1VQ9T 3EG1A 2DBMA 4L5GA 4ATOA 4LD6A 3HL8A 2OJ2A 2EPDA 4C0ZA 2GGRA 3OB9A 2HL5C 1R8OB 4M75G 3CMEQ 2M0OA 5IXBA 2EYYA 2BZ8A 4HT8A 2QEXA 3LX7A 1OEBA 5HKCA 4DBFA 3CCQQ 2RNAA 1IGUA 2RM4A 3C0CA 2LQWA 2JM8A 1C0MA 5CCAA 4RKUE 1MNDA 3KFVA 3ZBDA 3EFSA 5CKDA 2PVGB 1TU0B 2K9GA 1OU8A 3P8BB 2ZZDA 2KSSA 1H3HA 4HL4A 2EFIA 1GH6B 1I5LA 2E41A 3E9FA 1PM3A 2XD0A 1WHKA 3CXCA 2E6ZA 4C92B 2JM9A 3HO8A 2LCLA 2O31A 2KROA 4ELLA 1VOLA 2KQWA 2KT1A 4D6WA 2KXCA 4M77G 1MMDA 3G4SA 2DE0X 5LL6S 1RAFB 5HY6A 2JGZB 3BLHB 2Y4XA 1MMGA 2HKQB 4FT4A 1E9HB 1D3BA 1JOWA 3I35A 4XTXA 3ZL7C 2V22B 2KR6A 3OSVA 4KBMB 9ATCB 1BIBA 3CMEA 1AWJA 5CR2A 3G6ET 2LQ8A 2YUNA 1VQ8Q 4TVRA 2YRDA 2P0QA 2D8HA 2DXCA 3VJPA 2L3QA 4E47A 2A28A 2W2HA 4PJOD 1W2BA 1JXMA 2YT6A 2G6FX 4ROCA 3NTIA 3CCQA 2RQUA 4EOOB 2G9XB 5CKHA 2EKHA 3PVLA 1YJNQ 4LDVA 4BE1A 2WSCE 1X43A 4JRIA 3JCMb 3RMSA 3CCLQ 1HJDA 3CBPA 2F2VA 4C0FA 1TD6A 2EYWA 5D7UA 2ED0A 4Y92A 2M51A 1BKBA 4C8QA 4JLGA 3CCRT 3CCVT 2FZGB 4YOOA 3VYGB 4RTVA 2VVKA 4X1VA 5GANj 4EOMB 1EIFA 2O01E 1X75C 4LDXA 3JB9G 1YHQT 1RAIB 2K79A 4M75D 1OL2B 3RNJA 3S3OA 4LDYA 1BIAA 3BDUA 4BDYA 3TNIB 3QSUA 3M0UA 4EORB 1AVZC 3QJ6A 1Q86R 3TN8B 5CKBA 1M4ZA 2LX7A 4CFUB 1M2VB 3HKSA 1KC8U 1AWWA 1GY3B 1M1KR 4RCCA 2RI5A 2Y4YA 4QQ6A 1CKBA 1W2BS 4BCMD 3QWLA 2V1QA 2YLCA 1OZ3A 4CC7A 5HBHB 3S6WA 4AKGA 1E7OA 1NM7A 4IURA 1VQ6A 3QWYA 1YJNA 4KT0E 2DD5A 3MJXA 4F17A 5KYWA 4Z88A 3QDRB 1CSKA 2L3PA 5GAOm 3N5BB 3K7AM 3OW2P 1WNLA 5HQ0B 4NOYA 3JCMf 1OIYB 2KY9A 1RLPC 1VQPQ 3QBYA 2GNCA 3HP9A 5EC7A 1FVVB 2DAQA 2IVWA 4KH1B 1RLQC 5FWCA 2CP6A 3JCMQ 4OMOA 1NE8A 2DK3A 1H26B 1VQ7A 3TSZA 1ZSZC 1N8RU 4RTYA 2PHGA 3M0TA 1X6GA 2K3XA 1IB8A 5LJ5d 3RUXA 1ARKA 1VQ4T 2V1RA 3UT1A 2DMEA 1JSTB 3EG3A 3I5RA 1O9SA 2RQRA 3L2ZA 2DXUA 1DJ7B 2R5AA 3FJ5A 3UA7A 5FROA 3JCMJ 4RMOA 2V8JA 2P4TA 3QWXX 2QQ9A 5LJ5g 4BCOB 5LJ3d 2XHCA 2MOXA 2FG0A 2RF0A 3THKA 1KC8C 2EYZA 2NWMA 3VKHA 2IPOB 1K73R 1VQ5T 1BI2A 4M78E 2VC8A 5I21A 2OTJT 2XK0A 5KYYB 4M7DA 5CVIA 2AT1B 2DD4A 2JXBA 1LNXA 5LJ3g 3CCUA 1JKWA 2ZPIB 1WJQA 1QQJA 3QYGB 1VYTA 2CUBA 2JT4A 3GPLA 3G1JA 4C8QF 2HQHA 5KYXB 3RGFB 1URCB 4NC6A 4M7AD 5LJ5h 4KH0B 2F5KA 5J3BA 3PT9A 1K9MR 2FZCB 1H25B 2CS7A 5EFQB 3PIPA 1FMKA 2X4WA 1VQPA 1M8VA 1BCMA 1TTHB 4ZN1A 2LJ3A 2CCIB 2HCKA 3JB9D 5IF1B 1RI0A 2DMOA 4DEYA 5LJ3h 1N8RC 1H27B 1UTIA 2XKOC 3E9GA 5IN1A 3OQ5A 5GMKh 1GBQA 2J7IA 4F7UE 1YJ9A 3QJYA 4EMKC 3EAEA 5J39A 1AISB 2CGHA 1ZUUA 4J9EA 2DVJA 4XTVA 4BXXX 4M7AC 1YI2A 1OX8A 2ABLA 1VQOT 4C92A 1PKTA 2DRKA 4J6XA 2KMTA 2QA4Q 1QVFS 2C0TA 2JTFA 3JSCA 4JRQA 2CJMB 2EAYA 3I56A 4FYYB 2CP5A 3FLGA 4AFZC 5GAN6 4ME7A 2EQJA 5IDPB 2CZ7B 2RPNA 3CC2Q 4B9WA 3QZ9B 4E7KA 1PD1A 1ZSZB 1K0XA 2QYZA 1YITT 6AT1B 2ZZDB 4MZPA 3MIAB 3VU3C 3UDCA 1H1QB 5GJWB 1NBEB 1WLPB 3DDPB 3DKMA 1TUDA 4DBHA 2PK2A 2CCHB 3CCJT 3J7AF 4AKIA 1V76A 1X01A 5IH2A 2KYBA 4ELZC 4RTUA 3TEEA 3GBQA 3OYLA 4K11A 3EH2A 1NJIC 2P0PA 4LE9A 1KQSP 1G8XA 2DF6A 5DM7R 1M27C 4HCKA 4JJCA 2W96A 4J9HA 1WPYA 4FIBA 1QP2A 3NMZC 2E5KA 4PJOE 2X9HA 3QG1A 2J05A 2X4XA 2GCXA 1TSFA 1VQKT 3MKDA 2DXCB 4BCFB 4MZMA 3AHUA 4M7DF 1GXIE 2HSEB 2ZCFB 1M1GA 1RABB 4M78A 4CC2A 3QYHB 2EBPA 2QA4A 5KYUA 3LH5A 1U1SA 2DL7A 1NZ9A 1C9BA 1ZA1B 4BCIB 3TSWA 4BBSM 4CFMB 2IW9B 3PIOA 2P4RA 4J9CA 5GAMg 3QYEA 2I0NA 4JX5A 2FZKB 4FYWB 1FWZA 3IQLA 2E4HA 2UZEB 3OYBA 2GBQA 3FJPA 1X2QA 3QHWB 2UUEB 4EMKB 2LX9A 5A2QE 4IKFA 1G5VA 2NYSA 1H641 2UZLB 1SHFA 1H28B 4B9XA 5LJ5j 3G33B 3FB9A 1WHJA 4O5VA 4FYXB 4JRPA 4JLIA 4M75E 2RK2A 2F5TX 2K57A 2WSEE 1Y0MA 5I2SA 2CP3A 4E7JA 4CRLB 1W98B 2RD1A 4OMPA 2BE7D 2HQEA 3A8OB 3CMAQ 4YC3B 2K6DA 2X4YA 2NUTB 3DDQB 4XTWA 3F70A 1Q86U 5GAMh 5LJ3j 3NGPA 5HK0A 1QP3A 5GAN8 2A08A 1AD5A 4OMLA 1C1AA 1M1KU 5GMKj 2QDJA 2WFYB 4C92F 2EQIA 5KYNA 2COZA 2FL7A 1PCXA 3GNGA 3A8HB 1WQ7A 1G3SA 5IHIA 1VYWB 1IHWA 2LQNA 3OW2A 4LOCA 1JJ2S 4HCZA 2VKNA 3PFSA 2QEXT 1D0XA 2DNUA 3VUBA 1Q82R 1E6GA 1UHCA 3EGDB 5GAN4 2CSIA 3X28B 2MK5A 1E6HA 2WPAB 1D0YA 4LUDA 1LVKA 2FPDA 2IW8B 4M77E 1AOJA 2DD5B 5C6SA 1PG5B 2XIDA 1QKWA 5KYWB 1VIFA 3LQ5B 1UGVA 3CC7T 4M6VA 2E3HA 3L2QA 3SB2A 3OS0A 1H1RB 3I55Q 3MEWA 4CFNB 1S72Q 2W10A 3DJBA 2OI3A 5L8RE 3MI9B 1IGQA 2E10A 2HD0A 2FVUA 1OX9A 4FW2A 4JDSA 1UFFA 1I1JA 4BACA 1WXTA 3HSBA 3G4ST 3L1AA 1EZZB 1Q86C 1RL2A 2EQKA 2DYIA 3CMAA 2AZSA 2J6FA 3HRUA 4FSXA 3EOCB 5DLQE 5GAN3 2NUPB 1WDXA 3H8ZA 3CC4Q 1M1KC 2ECZA 4BE2A 1UG1A 3R6OA 2COWA 1K73U 2YUQA 2OTLQ 2YRCA 1IHVA 2K3YA 2RHZA 2G3RA 1X2KA 4MFDA 3DB4A 3CMET 4BCNB 4F7LB 4YOZA 4J9BA 3EIDB 4DQ2A 4C5GA 5CK9A 4Z8AA 4OVAA 3RESA 3CD6T 2O9SA 2QASA 2E70A 1RADB 3LW5E 1NPRA 4XU0A 4FX3B 4J5YA 5GAOl 4QKUA 2MMPA 3OYNA 1PSFA 2DD4B 3QKJA 1GCQA 1K9MU 3SWNC 1K4US 2YWWA 1FXXA 4HLQA 4X9DA 3MEVA 2LMJA 3EGXB 2EYXA 3VS7A 4WTOB 1NJIR 5GMKi 1YBYA 1BYMA 1JB0E 3I55A 1M2OA 3RMQA 2EJFA 4M78C 4ANJA 1S72A 2LJ0A 2ZAEA 3E2UA 5GANf 1YIJT 3JCMP
chains in the Genus database with same CATH topology
2QQAA 3DL1A 5C0MA 4FT2A 1VQOA 2HAXA 3QSUA 2YLBA 4J7IA 3META 3QJ6A 1P92A 4HKEA 3LYIA 5CKBA 5GMKe 1M4ZA 3RKXA 4JUVA 1ZBXA 3V8JA 2VGNA 3C4SA 3HKSA 4C8QC 3L2WA 4HNTA 1KC8U 4PLIA 3DB3A 4RCCA 2RI5A 2Y4YA 1LJOA 4QQ6A 4A4FA 3VUZA 4C0DC 3QWLA 1W2BS 2YLCA 2PU9B 1PSEA 2EQUA 4MMKA 1S72T 1TH7A 5GAMj 1OZ3A 3CC4A 4XTZA 3S6WA 1K73C 4AKGA 3L2UA 1ZHIA 4JS5A 4RG8A 4IURA 2R5MA 4C92D 2OTLA 4A54A 2VXEA 3UWNA 1VQ6A 5KCHA 5D6XA 1YJNA 4KT0E 4MZTA 2DD5A 2LDMA 4QQGA 4V2SA 3HFOA 5GAMf 1IREB 3QDRB 3J81E 3P8HA 3MO8A 2BKDN 1Q81U 4LDUA 3M57A 3CEYA 3N5BB 5GAOm 3CC4T 2V8IA 1WNLA 4NOYA 4N0AC 3JCMf 1K9MC 3BG3A 1VQ4A 2KY9A 1E7PA 2L3RA 3QBYA 1VQLA 5EJCA 1QVPA 1Y71A 3JCMX 1KQSA 4PKCC 4A4EA 1QVGS 1Y07A 3M4GA 3TREA 1VQ6T 2O4XB 3HP9A 2DAQA 4IUTA 2IVWA 1B34A 4M77B 2DO3A 1YJNT 3JCMQ 2QQBA 3JCMV 1NE8A 2DK3A 1VQ7A 3GOXA 2BS3A 4XAXB 2DIQA 4OF1A 4Q5WA 1N8RU 3A8GB 2D6FA 1G3YA 3OY9A 3EFRA 2K3XA 4N4HA 5LJ5d 4JX4A 3RUXA 1BI1A 3OMGA 3OYYA 1VQ4T 3UT1A 2NLUA 2RK1A 3M4YA 1O9SA 2KMGA 2B8AA 1WJRA 3L2ZA 3OYKA 2VUBA 2DXUA 1DJ7B 2R5AA 3WVDB 3J80E 3V8KA 5CAIA 3JB9J 4ZGJB 2XI9A 4BBRM 4PJOA 5FROA 3JCMJ 4RMOA 4HCCA 2V8JA 1VIEA 4IUVA 5FU6B 1BI3A 1JRIA 3ZEHA 3QIIA 2DXBA 2P4TA 3OYDA 3L2VA 3M53A 4C5HA 1VQ7T 4R55A 2PVOB 2QQ9A 4N4IA 5LJ5g 3OS1A 5LJ3d 1D3BB 1Y7XA 2XHCA 2JNGA 3OBYA 5D6WA 3RKYA 1KC8C 3ASKA 1G3WA 2E12A 3JCMc 2HNIA 1OI1A 3VKHA 4M78F 4XTUA 4RG2A 3OW2S 4BE0A 4QVCA 4OMFB 3CMAT 3NTHA 2DVEA 1BI2A 1VQ5T 4M78E 2VC8A 5I21A 2GFUA 2XICA 2OTJT 2XK0A 3OYFA 4MIMA 4M7DA 1YCYA 2GQVA 5CVIA 4ZN3A 4OB1B 2X35A 3SD4A 2DD4A 1VQMA 1LNXA 5LJ3g 3CCUA 1JJ2A 3X25B 3BG9A 2ZPIB 1WJQA 4EMKA 3CXCS 3M59A 3QYGB 1H3ZA 2QQRA 2FB7A 3GPLA 4J6YA 3CCQT 1M5Q1 2EWNA 4DA4A 3VYGA 5GAOr 4C8QF 2DZ9A 2ZPGB 4QSHA 2FHDA 1HXDA 2RJDA 3CPWS 2LC4A 1Q81C 4M78B 4NC6A 4XK8E 5GAOq 4M7AA 5LJ5h 4M7AD 3CCEA 2F5KA 4XTYA 4C8QE 3GF5A 3M58A 1AHJB 5J3BA 3PT9A 3ZFJA 3OYEA 3MHXA 5A0DA 2CZ1B 5GANe 1KQ1A 1G3TA 2CS7A 2LVMA 4PJOC 5EG2A 4C8QG 3PIPA 2X4WA 1KQSS 1MGQA 3CCUT 1VQPA 3JB9I 3X26B 3VKGA 3NFCA 4A4HA 1M8VA 2BS2A 3JRZA 4ZN1A 3H4CA 2I2LA 2JOYA 3JCMW 2JUFA 4M75A 3JB9D 2EJ9A 4OB3B 1RI0A 1FKMA 4A53A 3L42A 4BUGA 4C8QB 5HK3A 5LJ3h 4VUBA 1N8RC 1JBMA 3HZJA 3OYGA 4FM4B 2XKOC 3LH0A 4UC4A 2EQMA 2K5IA 3CCET 3E9GA 2Y90A 2KVQG 4F7UF 5CIUA 4ZGDB 2E65A 5IN1A 3OQ5A 2L8DA 5GMKh 1UGPB 4M7DC 4E7IA 3OYAA 4ELYC 2ZPHB 4F7UE 3QHSA 2DXTA 1YJ9A 3QJYA 3BW1A 1VQPT 4EMKC 3EAEA 1VQ8A 5GAN2 5J39A 3I55T 4F7UG 3CCMT 4KUIA 2CGHA 3FC3A 2RJFA 3TCJA 2EIFA 2VV5A 1VQNA 2QDYB 1FX7A 3M9QA 5GAMe 5GAOn 4XTVA 4M7AC 2DZCA 4QVZA 4PL6A 1YITA 2PVDB 2WSFE 1XTDA 1YI2A 3QXEB 4C92A 1WGSA 3GLXA 4J6WA 3JAME 5CKFA 2RHUA 3V7CA 3TW6A 4MMLA 4J6XA 2KMTA 3JCMe 1QVFS 2YHTA 2JTFA 3JSCA 4JRQA 2FYKA 1YJ9T 4HT9A 2D0QB 2EAYA 3ER0A 1U1TA 4Z6YA 2YRVA 3I56A 1Q82U 2DEQA 1MHNA 2WACA 3FLGA 3VV0A 1KHIA 5GAN6 1VQ8T 5FRMA 4M75C 4ME7A 4II1A 3CCLA 3SDZA 2EQJA 3CCJA 2CZ7B 2KK4A 4L6V5 4B9WA 3QZ9B 2IG0A 4C5IA 4L59A 3CC7A 4E7KA 3HFNA 5GAN7 3HRSA 2JN0A 3T9NA 1YITT 2O4XA 2ZZDB 2QQSA 4MZPA 2MAMA 1YI2T 4M77D 3VU3C 4M77A 4AKHA 3UDCA 2OTLT 2KDSA 2VYTA 4C0GA 4NL3A 4EMGA 2CKKA 4DOWA 2XDDA 3HRTA 2CZ0B 2X4JA 5CQYA 3DKMA 5FU7C 3V7RA 4CI0C 3I56T 4EMHA 5KE2A 2C06A 2ZPEB 2QI2A 2ZPFB 3CPFA 3QUIA 1QLBA 3CCLT 2AHJB 1X6OA 3X20B 2LNVA 2M1HA 4GLKA 4QQDA 2EKOA 4AKIA 3CCJT 1VQOT 4X9CA 4BI3A 1X01A 3PMIA 2RJCA 1XQHA 5GANd 3OYHA 4ELZC 2DJZA 3TEEA 4OB2B 4C92C 1VQLT 3OYLA 1NJIC 3M5AA 2M16A 4BDZA 2P0PA 1VQKA 2QF7A 1KQ2A 4XU1A 5M9OA 2G77A 2RHYA 3G71A 4J83A 3PTAA 3OYJA 1I8FA 2RB6A 4N4GA 4PJOF 5DM7R 1Y96B 4ZGEB 2LT4A 1WPYA 3OBWA 4FIBA 1QP2A 2D9TA 3MP8A 3URGA 5GMKl 5GANg 2DPPB 4PJOE 4OGCA 3MEUA 2MI6A 1KG1A 1SSFA 1QW1A 3C95A 3QG1A 3FDRA 3SWNB 4HNUA 3PMTA 4M77C 2E1HA 2X4XA 3VYHB 2GCXA 4PJOG 1VUBA 3M56A 3CD6A 3KUFA 3QYBA 3LWIA 3UPUA 2DIGA 5KCOA 3OMCA 2K5FA 1VQKT 1N9RA 3G71T 5KH6A 2DXCB 4M7DF 4MZMA 3AHUA 2A3LA 3OYCA 1GXIE 2LTOA 2GFAA 2ZCFB 2RI2A 3CBOA 1M1GA 1ZQ1A 5I2MA 3LGFA 4BI8B 3CCRA 4MDXA 4MFEA 4HNVA 1IZ6A 4M78D 4M78A 4X34A 2L89A 3QYHB 2QA4A 1Q82C 4M7DE 3WXMB 3RKWA 2JZ2A 5J26A 3A8LB 5A0GA 2LCCA 4YTLA 1U1SA 3G7ZA 3CBMA 3JCMd 4RCBA 1VQ9A 4M7DG 4JRKA 1NZ9A 1UGQB 5KE3A 2K5LA 4QVDA 5GANh 4M7AF 1LOJA 2K2VA 2QFZA 3OS5A 3GNFB 3V8LA 4BY6B 1M90C 4BBSM 3PIOA 4FU6A 4P5NA 2RA2A 3RIRA 4OB0B 2XU8A 4HA8A 5GAMg 3QYEA 1VQMT 4JX5A 1YHQA 1YJWA 1K8AU 3WVEB 1FWZA 4LD9K 4M7AE 4M7DB 3V7SA 2WJ9A 4C8QD 3LWHA 4JS4A 3OYBA 1XOVA 4Z02A 3FJPA 3CCSA 3BY7A 3DLMA 3FEOA 4M7AG 2V8KA 3QPHA 2LX9A 2RI3A 3JCMg 4EMKB 5A2QE 2QA4T 4IKFA 1G5VA 4M75F 3OYIA 1NJIU 2HQXA 4PNOA 1YIJA 1H641 4C0DB 4ZTJA 4B9XA 5LJ5j 1O75A 1VQ9T 3FB9A 4O5VA 3ME9A 4L5GA 4ATOA 4JRPA 4JLIA 4M75E 4LD6A 3HL8A 2XDBA 2RK2A 3S3MA 3BG5A 3C12A 3MP6A 2H3JA 4C0ZA 2PUKB 2F5TX 2K57A 3BFMA 1R8OB 3OB9A 2WSEE 2ZPBB 5I2SA 4E7JA 3TW7A 4M75G 3HPWA 1KHCA 2RD1A 2M0OA 2HQEA 3A8OB 3TU4K 3FRNA 4HT8A 2X4YA 1HK9A 3H6ZA 3CCST 1I81A 4XTWA 3F70A 5LJ5f 1Q86U 5GAMh 2QEXA 3LX7A 5LJ3j 4M75B 5HK0A 3E19A 1QP3A 4J8OA 5GAN8 4N0AA 1XNIA 4IUPA 5HKCA 1N6AA 5GMKm 2R58A 4F7UB 3JCMh 1M1KU 5GMKj 2QDJA 4C92F 2RM4A 4LDWA 4ZTFA 4QW2A 5CCAA 4RKUE 1Q7YC 2FL7A 3JB9H 4CRIA 3GNGA 3A8HB 1WQ7A 1G3SA 2ZGWA 3INZA 5LJ3f 3ZBDA 2PUOB 3EFSA 4C92E 2PVGB 3FIFA 5CKDA 3HHTB 2BIVA 3OW2A 2MWPA 5FU7B 4LOCA 4A4GA 5GAN5 3P8BB 4HCZA 3GP8A 1JJ2S 3PFSA 2QEXT 2ZZDA 2MWOA 4OGEA 4C92G 3VUBA 2KSSA 1VQNT 4HL4A 1M90U 2EFIA 2DTIA 5GAN4 3KXTA 3MEAA 1I5LA 2E41A 3E9FA 2XD0A 3X28B 2JTMA 3VKIA 4R56A 2E6NA 3CXCA 4KUDK 2E6ZA 5CQXA 3L2RA 4E7HA 4M77F 4C92B 3DLLA 5IT9E 3HO8A 2LCLA 2KAFA 2LQKA 4E7LA 3P8DA 5GAOp 5DLOA 3CPWA 3PGGA 2RO0A 4M77E 2DD5B 5C6SA 4BI4A 1K8AC 2XIDA 2XG8D 2EYQA 1UGSB 2KQWA 1VIFA 2R57A 4D6WA 5FRNA 1NPPA 4M77G 4AI6A 3CC7T 4M6VA 2QTXA 3G4SA 3BDLA 3G6EA 3OYMA 4DOVA 3L2QA 3PNWC 3SB2A 3OS0A 3M55A 4EDUA 2RHIA 3QZ5B 2L5QA 3NTKA 5LL6S 3A5ZB 2MF2A 3SFMA 5A0LA 3MEWA 1KD1U 5HY6A 2Y4XA 2K4YA 2A7YA 3KBGA 4FT4A 1Y96A 5FLXE 1D3BA 1OYXA 3RERA 1B34B 5L8RE 2VGMA 4XTXA 4IUUA 2E10A 2HD0A 2KR6A 2FVUA 3OSVA 1N27A 4JDSA 4KBMB 2DTHA 2GF7A 3SWNA 1N9SA 1BIBA 3LGLA 2DTOA 2HBPA 4BACA 3HB9A 2LT1A 4OP0A 3CMEA 5CR2A 4BB7A 3G4ST 3G6ET 1W4SA 2LQ8A 3E1SA 3L1AA 1Q86C 3HSBA 1RL2A 2EQKA 1UB4A 3CMAA 3HBLA 4TVRA 1V29B 3HRUA 4FSXA 2P0QA 4J7FA 4NL2A 5CKEA 5DLQE 2DXCA 1Q7YU 3VJPA 4E47A 1VQ5A 3QO3A 2RH2A 2RJEA 5DY9A 1I4K1 5GAN3 3H8ZA 2OTJA 4PJOD 1OZ2A 2LRQA 2CYZB 2E5QA 3M54A 2CZ6B 4NS5A 1W2BA 1M1KC 4IUQA 1M9SA 2BS4A 4BE2A 4KULA 3R6OA 4PJOB 4JX6A 3NTIA 3CCQA 5GAMd 1K73U 3C94A 1BI0A 2K3YA 2G3RA 2DXBB 2RHZA 5CKHA 3CCVA 4MFDA 3DB4A 4C5EA 3MP1A 5IAYA 4XU2A 3CMET 4A4KA 4LDVA 4Y28E 4BE1A 1QVFA 4GY5A 2WSCE 3Q1JA 4MDWA 4JRIA 4PLLA 4C5GA 4DQ2A 5CK9A 3RMSA 3JCMb 1UEBA 4OVAA 2OAUA 3RESA 1WQWA 5FU6C 3CD6T 4WF2A 2E70A 3CC2A 3LLRA 3CBPA 4BD3A 1U8RA 4M7DD 3LW5E 1NPRA 4C0FA 2E64A 4XU0A 2XDPA 4J5YA 5GAOl 2PQWA 4M78G 4Y91A 4XU3A 2MMPA 3OYNA 1PSFA 1M1FA 3OS2A 1BKBA 4C8QA 4JLGA 4JJNK 4HCBA 2DD4B 3QKJA 3CCRT 3OA6A 1K9MU 5AYFA 3SWNC 2EJGA 5CO7A 1WJSA 3CCVT 4XQ3A 1FXXA 1QVGA 4HLQA 2VXFA 2DKGA 3VYGB 4X9DA 3JB9F 3MEVA 3A8MB 2M9UA 5LJ5e 3X24B 5GANj 2QQ8A 4M7AB 1EIFA 2O01E 4ELJA 3CC2T 1X75C 4O6JA 3KHIA 5GMKi 2JVVA 1YBYA 4LDXA 3MCAB 1BYMA 3JB9G 1YHQT 1JB0E 1YJWT 1KD1C 3GIBA 3O8VA 2RHXA 3OSSC 3I55A 3RMQA 2F69A 2EJFA 2QXFA 4M78C 2BUDA 4M75D 3CCMA 3S3NA 5D6YA 4EPCA 3S3OA 1S72A 3J7AF 2P0KA 5GANf 4LDYA 1UGRB 1BIAA 4F7UA 4BY6C 5LJ3e 4FL6A 3BDUA 1YIJT 3JCMP 4BDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPG B;  4ZGE B;  1QP2 A;  4XK8 E;  2DPP B;  1AHJ B;  2DD5 B;  2CZ1 B;  1UGS B;  3VYH B;  2PU9 B;  1PSE A;  3X26 B;  3QZ5 B;  2DXC B;  4OB3 B;  1GXI E;  2ZCF B;  4FM4 B;  3QYH B;  5L8R E;  4ZGD B;  4KT0 E;  3A8L B;  2DD5 A;  1UGP B;  1IRE B;  1UGQ B;  2ZPH B;  4OB0 B;  1V29 B;  2DXC A;  3WVE B;  2QDY B;  2CYZ B;  2CZ6 B;  2PVD B;  2WSF E;  3QXE B;  2DXB B;  2D0Q B;  4Y28 E;  3A8G B;  2WSC E;  2PUK B;  2WSE E;  2ZPB B;  2CZ7 B;  3LW5 E;  3A8O B;  4L6V 5;  3QZ9 B;  1DJ7 B;  3WVD B;  2ZZD B;  4ZGJ B;  1PSF A;  2DD4 B;  1QP3 A;  2DXB A;  2PVO B;  2CZ0 B;  3VYG B;  3A8M B;  2ZPE B;  3X24 B;  2ZPF B;  4RKU E;  2AHJ B;  3X20 B;  2O01 E;  3A8H B;  2PUO B;  2PVG B;  3HHT B;  1JB0 E;  4OB2 B;  2ZZD A;  4OB1 B;  2DD4 A;  3X25 B;  2ZPI B;  3QYG B;  1UGR B;  3X28 B;  3VYG A; 
#chains in the Genus database with same CATH topology
 2HAX A;  2YLB A;  4J7I A;  3MET A;  1AWO A;  1P92 A;  4HKE A;  2RQT A;  1WFW A;  1FMV A;  3C4S A;  4JJB A;  3NHN A;  3L2W A;  2JMA A;  1LJO A;  1ZSZ A;  4C0D C;  1GFC A;  2IW6 B;  4MMK A;  3CC4 A;  5GAM j;  4XTZ A;  1K73 C;  2DIL A;  1GUX A;  1VQM Q;  3L2U A;  4RG8 A;  2OTL A;  4A54 A;  1OUL A;  2K2M A;  5I22 A;  1EX4 A;  1IO6 A;  3CCE Q;  3J81 E;  2F2W A;  2AK5 A;  2BKD N;  3M57 A;  3CEY A;  1GFD A;  5FWB A;  1UJ0 A;  3RDV A;  1OPL A;  1K9M C;  4KRT A;  5EJC A;  4AFS C;  3VS4 A;  5HBE B;  3JCM X;  1KQS A;  4PKC C;  3M4G A;  2K3B A;  2LJ1 A;  1VQ6 T;  2J6O A;  1RUW A;  1YWO A;  1I07 A;  1B34 A;  4F6U B;  1YJN T;  1G83 A;  3EG0 A;  2ENM A;  4Q5W A;  2RN8 A;  3CPW P;  1KD1 R;  3OY9 A;  4N4H A;  1MV3 A;  4JX4 A;  3OYY A;  5LMK B;  1Z9Q A;  2BZX A;  1KK7 A;  2RK1 A;  1WJR A;  2VUB A;  4EOL B;  3WVD B;  3JB9 J;  4D8K A;  2XI9 A;  3I5S A;  4IUV A;  3L2V A;  2DRM A;  1VQ7 T;  3M53 A;  4C5H A;  3H0H A;  4IMY B;  1QCF A;  3DOG B;  1Y7X A;  1B07 A;  2JNG A;  4YOS A;  3OBY A;  5D6W A;  4EON B;  3EG2 A;  2L0A A;  4RG2 A;  2D1X A;  2QGF B;  4BE0 A;  2KE9 A;  1NYG A;  4OMF B;  1UNL D;  2DL4 A;  3TQ7 P;  1IXD A;  2YXY A;  2GFU A;  3OYF A;  1YCY A;  2GQV A;  4ZN3 A;  4OB1 B;  1VQM A;  5CEI B;  4EMK A;  3CXC S;  1H3Z A;  1OV3 A;  4J6Y A;  1GL5 A;  2DBK A;  4PJL A;  1TWB A;  2DZ9 A;  4E7Z A;  4QSH A;  1HSQ A;  2LC4 A;  4M78 B;  5GAO q;  3EFO A;  4M7A A;  3CCE A;  4XTY A;  3M0P A;  3M58 A;  5KYU B;  1KQ1 A;  2W9F A;  1JXO A;  1G3T A;  2LVM A;  4PJO C;  4C8Q G;  1KQS S;  3CCU T;  2NUT A;  2F2C A;  3X26 B;  3VKG A;  1WYX A;  3H4C A;  3JCM W;  2JUF A;  4OB3 B;  1X27 A;  3G71 Q;  1T3S A;  3HZJ A;  2HL3 A;  3U23 A;  2L8D A;  4ORZ A;  2DL8 A;  3VS5 A;  3BW1 A;  1VQP T;  1VQ8 A;  1RAH B;  1GCQ C;  1OU9 A;  3CCM T;  4KUI A;  4DBQ A;  1KFZ A;  3EGD A;  2VV5 A;  2QDY B;  1F1B B;  5GAO n;  1GCP A;  2PVD B;  2WSF E;  3QXE B;  1JSU B;  1WGS A;  2DM1 A;  3CQT A;  4J6W A;  2EGE A;  3CCR Q;  2YUP A;  4MML A;  3JCM e;  2KNB B;  3PO3 S;  2YHT A;  2KYM A;  4II5 B;  2FYK A;  1K9A A;  1YJ9 T;  3ER0 A;  4Z6Y A;  1Q82 U;  1U3O A;  1MHN A;  4M75 C;  4EOQ B;  2EGC A;  3CCL A;  2KK4 A;  4CXA B;  3PE0 A;  4J9D A;  4L59 A;  2WMB B;  3BHU B;  1YHQ Q;  3T9N A;  1YI2 T;  4BCQ D;  4J9G A;  4M77 D;  3BHT B;  2KDS A;  2VYT A;  3VS1 A;  3CCS Q;  4DOW A;  3UA6 A;  2VAS A;  2CZ0 B;  5FU7 C;  3I56 T;  3VS6 A;  5KE2 A;  1TUG B;  1OGU B;  3HTR A;  1VYU A;  2WXV B;  4QQD A;  2QGG A;  2E3I A;  2FPE A;  4X9C A;  4RTT A;  2C5V B;  1VQL T;  2NUP A;  1ABO A;  3M5A A;  4BDZ A;  2PZ1 A;  4J9I A;  4XU1 A;  5M9O A;  3G71 A;  1WXB A;  4J83 A;  4OMM A;  3PTA A;  3H9N A;  3NPF A;  1RAC B;  1FYN A;  2D9T A;  1YCS B;  4AG2 C;  2MI6 A;  2F2X A;  3FDR A;  4HNU A;  3M03 A;  3PMT A;  4M77 C;  2E1H A;  2COY A;  1VUB A;  2C5N B;  3QYB A;  1D09 B;  4F16 A;  1N9R A;  5KH6 A;  4Y72 B;  3ULR B;  3EG9 A;  3QHR B;  2LTO A;  1U06 A;  3CBO A;  1ZQ1 A;  4BI8 B;  4EIK A;  3CCR A;  1SRL A;  2QG9 B;  1WZO A;  1Q82 C;  1P5E B;  3RKW A;  4YTL A;  3G7Z A;  4M7D G;  3EGX A;  1UGQ B;  1AWX A;  4QVD A;  4M7A F;  1LOJ A;  1YNZ A;  2QFZ A;  2K2V A;  1M90 C;  2JW4 A;  2QTV A;  2RA2 A;  1YHQ A;  3EH1 A;  2WJ9 A;  4C8Q D;  3CCS A;  3DLM A;  3FEO A;  2QA4 T;  2RI3 A;  1HYO A;  3TNW B;  1NJI U;  4PNO A;  3VS0 A;  1AEY A;  2XDB A;  4R0K A;  1PRL C;  3S3M A;  2H3J A;  3BFM A;  1CKA A;  2QGS A;  1BK2 A;  4OMQ A;  3TU4 K;  3FRN A;  1VQ5 Q;  3H6Z A;  2L2P A;  1I81 A;  5LJ5 f;  2OTJ Q;  4M75 B;  3E19 A;  1TG0 A;  4ROD A;  4IUP A;  1N6A A;  1TOV A;  5GMK m;  2HBW A;  1SSH A;  2KXD A;  1WIE A;  2HDA A;  2O9V A;  4ZTF A;  4LDW A;  1H1P B;  4HVV A;  4QW2 A;  1Q7Y C;  3JB9 H;  1PNJ A;  2ZGW A;  1QMZ B;  3INZ A;  5LJ3 f;  2PUO B;  2JJ9 A;  2BIV A;  5FU7 B;  3GP8 A;  2X3W D;  5GAN 5;  1VQN T;  4C92 G;  2BPM B;  4PJM A;  4BCM B;  3M0Q A;  2DTI A;  3KXT A;  4F14 A;  1GUX B;  2RMO A;  4R56 A;  2E6N A;  4KUD K;  5CQX A;  3L2R A;  4RTZ A;  1MMA A;  1C6V X;  4E7L A;  3P8D A;  5GAO p;  5DLO A;  3CPW A;  3PGG A;  1GRI A;  2XG8 D;  1UGS B;  5FRN A;  3I9Q A;  1PC0 A;  2QTX A;  3BDL A;  3OYM A;  1K0S A;  4EDU A;  3QZ5 B;  3NTK A;  2MF2 A;  1PD0 A;  5A0L A;  2ED1 A;  1KD1 U;  2BKZ B;  2ESW A;  2H3E B;  5FLX E;  1Y96 A;  2LP5 A;  1B34 B;  2VGM A;  1W1F A;  1VQO Q;  4IUU A;  2XMF A;  2DTH A;  2GF7 A;  3SWN A;  1N9S A;  1M3A A;  2HBP A;  1JQQ A;  4OP0 A;  4BB7 A;  1W4S A;  5CKE A;  4J7F A;  4NL2 A;  1VQ5 A;  2OTJ A;  3QO3 A;  2RH2 A;  1I4K 1;  1BU1 A;  1OZ2 A;  2LRQ A;  3M54 A;  4NS5 A;  4CC4 B;  2SRC A;  1YIT Q;  3A98 A;  4KUL A;  5GAM d;  2DX1 A;  1MMN A;  4KGX B;  1Y57 A;  4C5E A;  3MP1 A;  4A4K A;  4Y28 E;  2X1N B;  3Q1J A;  4MDW A;  4PLL A;  1UUE A;  2DER A;  1WHH A;  2BE9 B;  2OAU A;  1WQW A;  4WF2 A;  3CC2 A;  1O9K B;  3LLR A;  4BD3 A;  1U8R A;  4M7D D;  1RI9 A;  4BCG B;  1OIU B;  5FGK B;  2E64 A;  2XDP A;  1JEG A;  4M78 G;  3F5X B;  4XU3 A;  1M1F A;  4HCB A;  4IIM A;  3OA6 A;  5AYF A;  1PHT A;  1WJS A;  1K8A R;  2VXF A;  2DKG A;  4LNP A;  2WEV B;  3A8M B;  3X24 B;  1N5Z A;  2QQ8 A;  1OOT A;  3EFO B;  2DFU A;  4M7A B;  1SHG A;  2A0F B;  4O6J A;  2UZD B;  4EOJ B;  2JVV A;  4A63 B;  1MV0 B;  1UNG D;  1YJW T;  1KD1 C;  3GIB A;  3O8V A;  3OSS C;  2BUD A;  5D6Y A;  2P0K A;  4F7U A;  4BY6 C;  2KRM A;  1Z9Z A;  5C0M A;  1VQO A;  4F7J B;  4WCI A;  2ROT A;  4CC3 A;  4UN0 A;  3O0G D;  1FIN B;  1ZBX A;  3V8J A;  5IHK A;  4HNT A;  2JTE A;  2J06 A;  2PTK A;  4PLI A;  3DB3 A;  2UZB B;  2D0N A;  4A4F A;  4BY7 X;  3VUZ A;  1S72 T;  1PSE A;  1TH7 A;  2EVR A;  2I40 B;  1B7T A;  4JZ3 A;  2AIR B;  4JS5 A;  2R5M A;  4C92 D;  2VXE A;  8ATC B;  2J6K A;  4MZT A;  1M90 R;  4V2S A;  2V26 A;  5GAM f;  4EOP B;  1IRE B;  2YUO A;  4PFO A;  3MO8 A;  1Q81 U;  4EOI B;  3CC4 T;  2V8I A;  2EW3 A;  4EC9 B;  2AKL A;  1E7P A;  4AT1 B;  1QVP A;  2KT8 A;  1Y71 A;  4HVW A;  3TRE A;  4RUG A;  1ZX6 A;  1R0B G;  2DO3 A;  1M3C A;  2QQB A;  3JCM V;  2JMC A;  3GOX A;  2BS3 A;  4XAX B;  3BHV B;  4GBQ A;  1MUZ A;  2D6F A;  1G3Y A;  2CSQ A;  3EFR A;  1PWT A;  4PFZ A;  2NLU A;  4F04 B;  3R6N A;  4PFP A;  3M4Y A;  2KMG A;  2B8A A;  3J80 E;  1U5S A;  2QEX Q;  1AZE A;  4PJO A;  4DBR A;  1VIE A;  3OYD A;  3ZEH A;  1BI3 A;  2HEQ A;  3QII A;  1BCO A;  2DXB A;  4R55 A;  2PVO B;  1Q7Y R;  4N4I A;  3EGU A;  3RKY A;  1WHG A;  3JCM c;  4M78 F;  4XTU A;  1SRM A;  3OW2 S;  1R0C B;  1SKU B;  3RBB B;  2XIC A;  3VRZ A;  2DEU A;  3CC7 Q;  1D1C A;  2DLP A;  4KGV B;  2QQR A;  3CCQ T;  4DA4 A;  2DET A;  3EG9 B;  2ZPG B;  3UAT A;  2FHD A;  1HXD A;  2RJD A;  1Q81 C;  1YWP A;  4XK8 E;  3OYE A;  4C8Q E;  3GF5 A;  1QVF P;  3ZFJ A;  4EOS B;  3MHX A;  5A0D A;  2CH4 W;  5GAN e;  1JO8 A;  2KI7 A;  2KGT A;  3JB9 I;  1M30 A;  5AT1 B;  3NFC A;  4A4H A;  2BS2 A;  3A1P A;  4KRC B;  4M75 A;  4A53 A;  1FKM A;  1T0J A;  4BUG A;  4AMC A;  4VUB A;  3OYG A;  1QVG P;  2B9R A;  3LH0 A;  2KBT A;  4UC4 A;  2EQM A;  3CCE T;  4F7U F;  2MCN A;  5L2W B;  4ZGD B;  2E65 A;  4CFU D;  1J3T A;  1UGP B;  2C0O A;  4E7I A;  3TNH B;  3OYA A;  4ELY C;  1F5Q B;  2BTT A;  2DXT A;  1PKD B;  1I0C A;  2W99 A;  2GQI A;  5GAN 2;  1UEC A;  3CD6 Q;  3FC3 A;  1D1B A;  2WIP B;  3TCJ A;  2EIF A;  1K76 A;  5ACB A;  1FX7 A;  1QWE A;  4BY1 X;  4QVZ A;  4PL6 A;  1XO2 A;  1XTD A;  1YN8 A;  3JAM E;  3GLX A;  2RHU A;  3V7C A;  2QK0 A;  4IIO A;  3H0F A;  2L3S A;  3REB B;  4HT9 A;  4OR5 B;  1QWF A;  1U1T A;  2YRV A;  2PNI A;  3VRY A;  2WAC A;  3VV0 A;  1VQ8 T;  1VQ9 Q;  1KHI A;  5ECA A;  1H92 A;  2GTO A;  5LQF B;  4L6V 5;  2F1L A;  4OMN A;  2IG0 A;  4C5I A;  3CC7 A;  2DA9 A;  3HRS A;  1WXU A;  2JN0 A;  4DEX A;  2O4X A;  4M77 A;  4C0G A;  5IDN B;  2CKK A;  3EHQ A;  2XDD A;  4F7S B;  5CQY A;  5HBJ B;  1YIJ Q;  4CI0 C;  4BCK B;  4EMH A;  1G3N C;  2C06 A;  2ZPE B;  3CPF A;  2ZPF B;  3QUI A;  3CCL T;  2AHJ B;  1X6O A;  2AZV A;  4PK4 A;  2W0Z A;  1HD3 A;  2RQW A;  3PMI A;  2RJC A;  3OYH A;  4HXJ A;  1OL1 B;  4OB2 B;  1BU2 A;  1X69 A;  3O5Z A;  4JJD A;  2QF7 A;  2WIH B;  2G77 A;  3OYJ A;  1I8F A;  2RB6 A;  4N4G A;  4PJO F;  2PK9 B;  3QDF A;  1Y96 B;  2BZY A;  4ZGE B;  3OBW A;  5GMK l;  1OI9 B;  4EOK B;  1H1S B;  4OGC A;  2ATC B;  1NG2 A;  1KG1 A;  3C95 A;  1QW1 A;  1OPK A;  3SWN B;  4ESR A;  1O9K A;  3CD6 A;  3LWI A;  2LCS A;  1ENW A;  2K5F A;  3OMC A;  3G71 T;  1OKV B;  2DYB A;  4E7S A;  4PJN A;  1MNE A;  5I2M A;  3LGF A;  4MDX A;  4FCY A;  4HNV A;  1VQ6 Q;  2FEI A;  4M7D E;  2WHB B;  3WXM B;  2QAZ A;  1KSW A;  5A0G A;  2HMA A;  3CBM A;  3JCM d;  2DL3 A;  1VQ9 A;  4JRK A;  2VB6 A;  2HZY A;  2K5L A;  3DTO A;  3V8L A;  3UF4 A;  4OB0 B;  2XU8 A;  2CH4 A;  1K8A U;  3G6E Q;  4BCP B;  1JJ2 P;  2FPF A;  3LWH A;  4F6W B;  4JS4 A;  1XOV A;  3BY7 A;  4M7A G;  2V8K A;  1NEG A;  3JCM g;  2I53 A;  4M75 F;  3OYI A;  3POM A;  1YIJ A;  4C0D B;  1VQ7 Q;  1O75 A;  3ME9 A;  3BG5 A;  1NEB A;  3C12 A;  3MP6 A;  2PUK B;  2IN3 A;  2ZPB B;  1D3U B;  1BB9 A;  3TW7 A;  3HPW A;  1KHC A;  4FW1 A;  2CRE A;  1ABQ A;  1HK9 A;  3CCS T;  4J8O A;  4N0A A;  1XNI A;  4I3Z B;  1NLP C;  1WX6 A;  3H41 A;  2R58 A;  1ZLM A;  4F7U B;  2LNH B;  3JCM h;  3CCV Q;  3TVT A;  4FYV B;  2EGA A;  4AFQ C;  4CRI A;  4C92 E;  1TXQ A;  3FIF A;  4KRD B;  3HHT B;  2O88 A;  2MWP A;  1N4M A;  4A4G A;  5ICP B;  1W6X A;  2MWO A;  4OGE A;  2KR3 A;  3CCU Q;  1M90 U;  3MEA A;  1Q81 R;  2JTM A;  3VKI A;  2NUZ A;  1D0Z A;  2AKK A;  4E7H A;  1AD6 A;  4M77 F;  2CDT A;  3DLL A;  5IT9 E;  2KAF A;  2LQK A;  3D7S B;  2JS2 A;  4HVU A;  2RO0 A;  3GTM S;  4BI4 A;  2C5X B;  1K8A C;  2EYQ A;  2R57 A;  4F70 B;  1NPP A;  4AI6 A;  4NST B;  3G6E A;  1YP5 A;  4DOV A;  3PNW C;  4AG1 C;  3M55 A;  2CP0 A;  2RHI A;  2L5Q A;  3CCM Q;  3A5Z B;  2H8H A;  3SFM A;  1WHL A;  2K4Y A;  2A7Y A;  3KBG A;  4PJJ A;  1ZP2 A;  1OYX A;  3RER A;  3NDQ A;  3SHW A;  1N27 A;  3LGL A;  2DTO A;  2PJQ A;  3HB9 A;  2LT1 A;  1JU5 C;  1YJ9 Q;  3E1S A;  3VS2 A;  5IHY A;  1UB4 A;  3HBL A;  1V29 B;  5HCK A;  1Q7Y U;  2RJE A;  5DY9 A;  1QKX A;  2CYZ B;  2E5Q A;  2CZ6 B;  3BLQ B;  3MY1 B;  2C6T B;  5GJV B;  4IUQ A;  1M9S A;  2BS4 A;  1YI2 Q;  1PRM C;  4PJO B;  4JX6 A;  3C94 A;  2A37 A;  1BI0 A;  3CCV A;  2DXB B;  4D8D A;  4RTX A;  5DQV A;  5IAY A;  4XU2 A;  1QLY A;  4BCH B;  1QVF A;  3I56 Q;  4GY5 A;  1UEB A;  4JZ4 A;  5FU6 C;  7AT1 B;  3REA B;  4OGR B;  4AFU C;  1ZBJ A;  2PQW A;  1VOM A;  1VQ4 Q;  4G6L B;  1SEM A;  4Y91 A;  1VQL Q;  3OS2 A;  4JJN K;  2CT3 A;  2EJG A;  5CO7 A;  2HKN A;  2O2O A;  4XQ3 A;  4BCJ B;  1ZUK A;  1QVG A;  2W9Z A;  1X6B A;  3JB9 F;  1D1A A;  2M9U A;  1LPL A;  2PMI B;  1ZA2 B;  5LJ5 e;  1TUC A;  3CC2 T;  4ELJ A;  5CYI B;  5HVY B;  3KHI A;  3MCA B;  2MYS A;  2RHX A;  1RAG B;  3S3N A;  1H8K A;  2F69 A;  3CCM A;  2QXF A;  1YFN A;  4EPC A;  2JS0 A;  2LW4 A;  1UGR B;  5LJ3 e;  4FL6 A;  4LUE A;  2QQA A;  3DL1 A;  4FT2 A;  2Z0W A;  1T3L A;  2VWF A;  5IXF A;  3LYI A;  5GMK e;  3RKX A;  4JUV A;  2CP7 A;  4EC8 B;  2VGN A;  3MPU B;  4C8Q C;  4F6S B;  3SEM A;  1WA7 A;  2HSP A;  4QT7 A;  2PU9 B;  1B3Q A;  2EQU A;  3M0S A;  1UE9 A;  3BLR B;  1ZHI A;  3UWN A;  1AT1 B;  5KCH A;  2YDL A;  5D6X A;  4E2F B;  5DQW A;  1UNH D;  2LDM A;  4QQG A;  3HFO A;  1UJY A;  3P8H A;  1OQK A;  4M4Z A;  2X3X D;  4LDU A;  5I5Z B;  1SG5 A;  4N0A C;  3RR6 A;  3BG3 A;  1VQ4 A;  1ACM B;  2L3R A;  4KGZ B;  1VQL A;  4A4E A;  1QVG S;  1Y07 A;  2O4X B;  4IUT A;  4F7N B;  4BCQ B;  4M77 B;  3CXC P;  2MPX C;  2P84 A;  2CT4 A;  2MIO A;  2ROL A;  1NYF A;  2DIQ A;  1T0H A;  4GLM A;  4OF1 A;  3A8G B;  2FRY A;  2DL5 A;  1BI1 A;  5IHN A;  3OMG A;  1BBZ A;  2C0I A;  1VA7 A;  3OYK A;  1VIN A;  1M3B A;  3PVQ A;  3V8K A;  5CAI A;  4ZGJ B;  1VQN Q;  4BBR M;  4HCC A;  5FU6 B;  1JRI A;  4J9F A;  1Q95 G;  3OS1 A;  2C5O B;  4BCN D;  1D3B B;  2FRW A;  4JPB W;  4E6R A;  3ASK A;  1K1Z A;  1G3W A;  2E12 A;  2QDL A;  2DJQ A;  2HNI A;  1OI1 A;  4QVC A;  3CMA T;  2CUD A;  3NTH A;  2DVE A;  1PKS A;  3CCJ Q;  2EUF A;  4Z89 A;  4MIM A;  1JJ2 A;  2X35 A;  3SD4 A;  2C4G B;  3X25 B;  1W2B P;  3BG9 A;  3H0I A;  2YSQ A;  3M59 A;  1RAE B;  2FB7 A;  1M5Q 1;  2EWN A;  3VYG A;  5GAO r;  1ZUY A;  2RQV A;  2SEM A;  3CPW S;  1M8M A;  4RTW A;  1AHJ B;  2CZ1 B;  5EG2 A;  3EJ1 B;  1MGQ A;  2K7A A;  1G2B A;  4CFW B;  3JRZ A;  3EHR A;  2I2L A;  2JOY A;  1R77 A;  2OX7 A;  2EJ9 A;  1VQK Q;  5HK3 A;  3L42 A;  4C8Q B;  1JBM A;  4FM4 B;  5HNB B;  1AZG B;  1W70 A;  2B86 A;  2K5I A;  2Y90 A;  2KVQ G;  4LXC A;  5CIU A;  2X51 A;  1M2V A;  4M7D C;  1NLO C;  2ZPH B;  3QHS A;  2KEA A;  3I55 T;  4F7U G;  4FSS A;  1XJW B;  5L23 A;  3JV3 A;  3M0R A;  2RJF A;  1VQN A;  3M9Q A;  5GAM e;  1I5O B;  2DZC A;  2KRS A;  1KC8 R;  1YIT A;  3B57 A;  5CKF A;  3TW6 A;  1QCO A;  1VYV A;  4CFX B;  2D0Q B;  1V1C A;  2DEQ A;  5FRM A;  4II1 A;  3SDZ A;  2R7G A;  3CCJ A;  2D8J A;  2LZ6 B;  2WMA B;  1TFB A;  1UDL A;  3HFN A;  5GAN 7;  1YJW Q;  2QQS A;  2IVX A;  2MAM A;  2OTL T;  4AKH A;  4NL3 A;  1WHM A;  4EMG A;  3MY5 B;  3AT1 B;  3HRT A;  2X4J A;  3V7R A;  1OKW B;  2OAW A;  2IIM A;  4ZNX A;  2QI2 A;  1QLB A;  1QMC A;  2LNV A;  3X20 B;  2M1H A;  4GLK A;  2EKO A;  1H24 B;  5BNJ B;  4BI3 A;  1XQH A;  5GAN d;  2GTJ A;  4CFV B;  2DJZ A;  2KRN A;  4C92 C;  1SF9 A;  2FO0 A;  1N8R R;  2M16 A;  5FW9 A;  1VQK A;  1KQ2 A;  2RHY A;  1RAA B;  4ROE A;  2LT4 A;  5GAN g;  3URG A;  3MP8 A;  2DPP B;  1UHF A;  3MEU A;  1WI7 A;  1SSF A;  1H4L D;  1KJW A;  5KYY A;  4PJO G;  3VYH B;  1KIK A;  3M56 A;  1KXU A;  4TTH A;  1EFN A;  3KUF A;  3UPU A;  2DIG A;  5KCO A;  1IRX A;  2M0Y A;  3BE3 A;  4LN2 A;  1FMW A;  2A3L A;  3OYC A;  1A0N B;  2GFA A;  2RI2 A;  1GBR A;  4MFE A;  1IZ6 A;  4M78 D;  5KYX A;  4X34 A;  2L89 A;  2JZ2 A;  5J26 A;  3A8L B;  2LCC A;  2A36 A;  1LCK A;  4RCB A;  5GAN h;  5KE3 A;  1QCN A;  3OS5 A;  4BY6 B;  3GNF B;  3VS3 A;  4FU6 A;  4P5N A;  1S1N A;  3RIR A;  2M02 A;  4HA8 A;  1VQM T;  4LD9 K;  4M7A E;  3G4S Q;  1YJW A;  3WVE B;  4M7D B;  3V7S A;  1TS9 A;  4Z02 A;  4B6M A;  1ZSG A;  1SPK A;  3QPH A;  8AT1 B;  5I11 A;  2CP2 A;  2HQX A;  4ZTJ A;  1VQ9 T;  3EG1 A;  2DBM A;  4L5G A;  4ATO A;  4LD6 A;  3HL8 A;  2OJ2 A;  2EPD A;  4C0Z A;  2GGR A;  3OB9 A;  2HL5 C;  1R8O B;  4M75 G;  3CME Q;  2M0O A;  5IXB A;  2EYY A;  2BZ8 A;  4HT8 A;  2QEX A;  3LX7 A;  1OEB A;  5HKC A;  4DBF A;  3CCQ Q;  2RNA A;  1IGU A;  2RM4 A;  3C0C A;  2LQW A;  2JM8 A;  1C0M A;  5CCA A;  4RKU E;  1MND A;  3KFV A;  3ZBD A;  3EFS A;  5CKD A;  2PVG B;  1TU0 B;  2K9G A;  1OU8 A;  3P8B B;  2ZZD A;  2KSS A;  1H3H A;  4HL4 A;  2EFI A;  1GH6 B;  1I5L A;  2E41 A;  3E9F A;  1PM3 A;  2XD0 A;  1WHK A;  3CXC A;  2E6Z A;  4C92 B;  2JM9 A;  3HO8 A;  2LCL A;  2O31 A;  2KRO A;  4ELL A;  1VOL A;  2KQW A;  2KT1 A;  4D6W A;  2KXC A;  4M77 G;  1MMD A;  3G4S A;  2DE0 X;  5LL6 S;  1RAF B;  5HY6 A;  2JGZ B;  3BLH B;  2Y4X A;  1MMG A;  2HKQ B;  4FT4 A;  1E9H B;  1D3B A;  1JOW A;  3I35 A;  4XTX A;  3ZL7 C;  2V22 B;  2KR6 A;  3OSV A;  4KBM B;  9ATC B;  1BIB A;  3CME A;  1AWJ A;  5CR2 A;  3G6E T;  2LQ8 A;  2YUN A;  1VQ8 Q;  4TVR A;  2YRD A;  2P0Q A;  2D8H A;  2DXC A;  3VJP A;  2L3Q A;  4E47 A;  2A28 A;  2W2H A;  4PJO D;  1W2B A;  1JXM A;  2YT6 A;  2G6F X;  4ROC A;  3NTI A;  3CCQ A;  2RQU A;  4EOO B;  2G9X B;  5CKH A;  2EKH A;  3PVL A;  1YJN Q;  4LDV A;  4BE1 A;  2WSC E;  1X43 A;  4JRI A;  3JCM b;  3RMS A;  3CCL Q;  1HJD A;  3CBP A;  2F2V A;  4C0F A;  1TD6 A;  2EYW A;  5D7U A;  2ED0 A;  4Y92 A;  2M51 A;  1BKB A;  4C8Q A;  4JLG A;  3CCR T;  3CCV T;  2FZG B;  4YOO A;  3VYG B;  4RTV A;  2VVK A;  4X1V A;  5GAN j;  4EOM B;  1EIF A;  2O01 E;  1X75 C;  4LDX A;  3JB9 G;  1YHQ T;  1RAI B;  2K79 A;  4M75 D;  1OL2 B;  3RNJ A;  3S3O A;  4LDY A;  1BIA A;  3BDU A;  4BDY A;  3TNI B;  3QSU A;  3M0U A;  4EOR B;  1AVZ C;  3QJ6 A;  1Q86 R;  3TN8 B;  5CKB A;  1M4Z A;  2LX7 A;  4CFU B;  1M2V B;  3HKS A;  1KC8 U;  1AWW A;  1GY3 B;  1M1K R;  4RCC A;  2RI5 A;  2Y4Y A;  4QQ6 A;  1CKB A;  1W2B S;  4BCM D;  3QWL A;  2V1Q A;  2YLC A;  1OZ3 A;  4CC7 A;  5HBH B;  3S6W A;  4AKG A;  1E7O A;  1NM7 A;  4IUR A;  1VQ6 A;  3QWY A;  1YJN A;  4KT0 E;  2DD5 A;  3MJX A;  4F17 A;  5KYW A;  4Z88 A;  3QDR B;  1CSK A;  2L3P A;  5GAO m;  3N5B B;  3K7A M;  3OW2 P;  1WNL A;  5HQ0 B;  4NOY A;  3JCM f;  1OIY B;  2KY9 A;  1RLP C;  1VQP Q;  3QBY A;  2GNC A;  3HP9 A;  5EC7 A;  1FVV B;  2DAQ A;  2IVW A;  4KH1 B;  1RLQ C;  5FWC A;  2CP6 A;  3JCM Q;  4OMO A;  1NE8 A;  2DK3 A;  1H26 B;  1VQ7 A;  3TSZ A;  1ZSZ C;  1N8R U;  4RTY A;  2PHG A;  3M0T A;  1X6G A;  2K3X A;  1IB8 A;  5LJ5 d;  3RUX A;  1ARK A;  1VQ4 T;  2V1R A;  3UT1 A;  2DME A;  1JST B;  3EG3 A;  3I5R A;  1O9S A;  2RQR A;  3L2Z A;  2DXU A;  1DJ7 B;  2R5A A;  3FJ5 A;  3UA7 A;  5FRO A;  3JCM J;  4RMO A;  2V8J A;  2P4T A;  3QWX X;  2QQ9 A;  5LJ5 g;  4BCO B;  5LJ3 d;  2XHC A;  2MOX A;  2FG0 A;  2RF0 A;  3THK A;  1KC8 C;  2EYZ A;  2NWM A;  3VKH A;  2IPO B;  1K73 R;  1VQ5 T;  1BI2 A;  4M78 E;  2VC8 A;  5I21 A;  2OTJ T;  2XK0 A;  5KYY B;  4M7D A;  5CVI A;  2AT1 B;  2DD4 A;  2JXB A;  1LNX A;  5LJ3 g;  3CCU A;  1JKW A;  2ZPI B;  1WJQ A;  1QQJ A;  3QYG B;  1VYT A;  2CUB A;  2JT4 A;  3GPL A;  3G1J A;  4C8Q F;  2HQH A;  5KYX B;  3RGF B;  1URC B;  4NC6 A;  4M7A D;  5LJ5 h;  4KH0 B;  2F5K A;  5J3B A;  3PT9 A;  1K9M R;  2FZC B;  1H25 B;  2CS7 A;  5EFQ B;  3PIP A;  1FMK A;  2X4W A;  1VQP A;  1M8V A;  1BCM A;  1TTH B;  4ZN1 A;  2LJ3 A;  2CCI B;  2HCK A;  3JB9 D;  5IF1 B;  1RI0 A;  2DMO A;  4DEY A;  5LJ3 h;  1N8R C;  1H27 B;  1UTI A;  2XKO C;  3E9G A;  5IN1 A;  3OQ5 A;  5GMK h;  1GBQ A;  2J7I A;  4F7U E;  1YJ9 A;  3QJY A;  4EMK C;  3EAE A;  5J39 A;  1AIS B;  2CGH A;  1ZUU A;  4J9E A;  2DVJ A;  4XTV A;  4BXX X;  4M7A C;  1YI2 A;  1OX8 A;  2ABL A;  1VQO T;  4C92 A;  1PKT A;  2DRK A;  4J6X A;  2KMT A;  2QA4 Q;  1QVF S;  2C0T A;  2JTF A;  3JSC A;  4JRQ A;  2CJM B;  2EAY A;  3I56 A;  4FYY B;  2CP5 A;  3FLG A;  4AFZ C;  5GAN 6;  4ME7 A;  2EQJ A;  5IDP B;  2CZ7 B;  2RPN A;  3CC2 Q;  4B9W A;  3QZ9 B;  4E7K A;  1PD1 A;  1ZSZ B;  1K0X A;  2QYZ A;  1YIT T;  6AT1 B;  2ZZD B;  4MZP A;  3MIA B;  3VU3 C;  3UDC A;  1H1Q B;  5GJW B;  1NBE B;  1WLP B;  3DDP B;  3DKM A;  1TUD A;  4DBH A;  2PK2 A;  2CCH B;  3CCJ T;  3J7A F;  4AKI A;  1V76 A;  1X01 A;  5IH2 A;  2KYB A;  4ELZ C;  4RTU A;  3TEE A;  3GBQ A;  3OYL A;  4K11 A;  3EH2 A;  1NJI C;  2P0P A;  4LE9 A;  1KQS P;  1G8X A;  2DF6 A;  5DM7 R;  1M27 C;  4HCK A;  4JJC A;  2W96 A;  4J9H A;  1WPY A;  4FIB A;  1QP2 A;  3NMZ C;  2E5K A;  4PJO E;  2X9H A;  3QG1 A;  2J05 A;  2X4X A;  2GCX A;  1TSF A;  1VQK T;  3MKD A;  2DXC B;  4BCF B;  4MZM A;  3AHU A;  4M7D F;  1GXI E;  2HSE B;  2ZCF B;  1M1G A;  1RAB B;  4M78 A;  4CC2 A;  3QYH B;  2EBP A;  2QA4 A;  5KYU A;  3LH5 A;  1U1S A;  2DL7 A;  1NZ9 A;  1C9B A;  1ZA1 B;  4BCI B;  3TSW A;  4BBS M;  4CFM B;  2IW9 B;  3PIO A;  2P4R A;  4J9C A;  5GAM g;  3QYE A;  2I0N A;  4JX5 A;  2FZK B;  4FYW B;  1FWZ A;  3IQL A;  2E4H A;  2UZE B;  3OYB A;  2GBQ A;  3FJP A;  1X2Q A;  3QHW B;  2UUE B;  4EMK B;  2LX9 A;  5A2Q E;  4IKF A;  1G5V A;  2NYS A;  1H64 1;  2UZL B;  1SHF A;  1H28 B;  4B9X A;  5LJ5 j;  3G33 B;  3FB9 A;  1WHJ A;  4O5V A;  4FYX B;  4JRP A;  4JLI A;  4M75 E;  2RK2 A;  2F5T X;  2K57 A;  2WSE E;  1Y0M A;  5I2S A;  2CP3 A;  4E7J A;  4CRL B;  1W98 B;  2RD1 A;  4OMP A;  2BE7 D;  2HQE A;  3A8O B;  3CMA Q;  4YC3 B;  2K6D A;  2X4Y A;  2NUT B;  3DDQ B;  4XTW A;  3F70 A;  1Q86 U;  5GAM h;  5LJ3 j;  3NGP A;  5HK0 A;  1QP3 A;  5GAN 8;  2A08 A;  1AD5 A;  4OML A;  1C1A A;  1M1K U;  5GMK j;  2QDJ A;  2WFY B;  4C92 F;  2EQI A;  5KYN A;  2COZ A;  2FL7 A;  1PCX A;  3GNG A;  3A8H B;  1WQ7 A;  1G3S A;  5IHI A;  1VYW B;  1IHW A;  2LQN A;  3OW2 A;  4LOC A;  1JJ2 S;  4HCZ A;  2VKN A;  3PFS A;  2QEX T;  1D0X A;  2DNU A;  3VUB A;  1Q82 R;  1E6G A;  1UHC A;  3EGD B;  5GAN 4;  2CSI A;  3X28 B;  2MK5 A;  1E6H A;  2WPA B;  1D0Y A;  4LUD A;  1LVK A;  2FPD A;  2IW8 B;  4M77 E;  1AOJ A;  2DD5 B;  5C6S A;  1PG5 B;  2XID A;  1QKW A;  5KYW B;  1VIF A;  3LQ5 B;  1UGV A;  3CC7 T;  4M6V A;  2E3H A;  3L2Q A;  3SB2 A;  3OS0 A;  1H1R B;  3I55 Q;  3MEW A;  4CFN B;  1S72 Q;  2W10 A;  3DJB A;  2OI3 A;  5L8R E;  3MI9 B;  1IGQ A;  2E10 A;  2HD0 A;  2FVU A;  1OX9 A;  4FW2 A;  4JDS A;  1UFF A;  1I1J A;  4BAC A;  1WXT A;  3HSB A;  3G4S T;  3L1A A;  1EZZ B;  1Q86 C;  1RL2 A;  2EQK A;  2DYI A;  3CMA A;  2AZS A;  2J6F A;  3HRU A;  4FSX A;  3EOC B;  5DLQ E;  5GAN 3;  2NUP B;  1WDX A;  3H8Z A;  3CC4 Q;  1M1K C;  2ECZ A;  4BE2 A;  1UG1 A;  3R6O A;  2COW A;  1K73 U;  2YUQ A;  2OTL Q;  2YRC A;  1IHV A;  2K3Y A;  2RHZ A;  2G3R A;  1X2K A;  4MFD A;  3DB4 A;  3CME T;  4BCN B;  4F7L B;  4YOZ A;  4J9B A;  3EID B;  4DQ2 A;  4C5G A;  5CK9 A;  4Z8A A;  4OVA A;  3RES A;  3CD6 T;  2O9S A;  2QAS A;  2E70 A;  1RAD B;  3LW5 E;  1NPR A;  4XU0 A;  4FX3 B;  4J5Y A;  5GAO l;  4QKU A;  2MMP A;  3OYN A;  1PSF A;  2DD4 B;  3QKJ A;  1GCQ A;  1K9M U;  3SWN C;  1K4U S;  2YWW A;  1FXX A;  4HLQ A;  4X9D A;  3MEV A;  2LMJ A;  3EGX B;  2EYX A;  3VS7 A;  4WTO B;  1NJI R;  5GMK i;  1YBY A;  1BYM A;  1JB0 E;  3I55 A;  1M2O A;  3RMQ A;  2EJF A;  4M78 C;  4ANJ A;  1S72 A;  2LJ0 A;  2ZAE A;  3E2U A;  5GAN f;  1YIJ T;  3JCM P; 
#chains in the Genus database with same CATH homology
 2QQA A;  3DL1 A;  5C0M A;  4FT2 A;  1VQO A;  2HAX A;  3QSU A;  2YLB A;  4J7I A;  3MET A;  3QJ6 A;  1P92 A;  4HKE A;  3LYI A;  5CKB A;  5GMK e;  1M4Z A;  3RKX A;  4JUV A;  1ZBX A;  3V8J A;  2VGN A;  3C4S A;  3HKS A;  4C8Q C;  3L2W A;  4HNT A;  1KC8 U;  4PLI A;  3DB3 A;  4RCC A;  2RI5 A;  2Y4Y A;  1LJO A;  4QQ6 A;  4A4F A;  3VUZ A;  4C0D C;  3QWL A;  1W2B S;  2YLC A;  2PU9 B;  1PSE A;  2EQU A;  4MMK A;  1S72 T;  1TH7 A;  5GAM j;  1OZ3 A;  3CC4 A;  4XTZ A;  3S6W A;  1K73 C;  4AKG A;  3L2U A;  1ZHI A;  4JS5 A;  4RG8 A;  4IUR A;  2R5M A;  4C92 D;  2OTL A;  4A54 A;  2VXE A;  3UWN A;  1VQ6 A;  5KCH A;  5D6X A;  1YJN A;  4KT0 E;  4MZT A;  2DD5 A;  2LDM A;  4QQG A;  4V2S A;  3HFO A;  5GAM f;  1IRE B;  3QDR B;  3J81 E;  3P8H A;  3MO8 A;  2BKD N;  1Q81 U;  4LDU A;  3M57 A;  3CEY A;  3N5B B;  5GAO m;  3CC4 T;  2V8I A;  1WNL A;  4NOY A;  4N0A C;  3JCM f;  1K9M C;  3BG3 A;  1VQ4 A;  2KY9 A;  1E7P A;  2L3R A;  3QBY A;  1VQL A;  5EJC A;  1QVP A;  1Y71 A;  3JCM X;  1KQS A;  4PKC C;  4A4E A;  1QVG S;  1Y07 A;  3M4G A;  3TRE A;  1VQ6 T;  2O4X B;  3HP9 A;  2DAQ A;  4IUT A;  2IVW A;  1B34 A;  4M77 B;  2DO3 A;  1YJN T;  3JCM Q;  2QQB A;  3JCM V;  1NE8 A;  2DK3 A;  1VQ7 A;  3GOX A;  2BS3 A;  4XAX B;  2DIQ A;  4OF1 A;  4Q5W A;  1N8R U;  3A8G B;  2D6F A;  1G3Y A;  3OY9 A;  3EFR A;  2K3X A;  4N4H A;  5LJ5 d;  4JX4 A;  3RUX A;  1BI1 A;  3OMG A;  3OYY A;  1VQ4 T;  3UT1 A;  2NLU A;  2RK1 A;  3M4Y A;  1O9S A;  2KMG A;  2B8A A;  1WJR A;  3L2Z A;  3OYK A;  2VUB A;  2DXU A;  1DJ7 B;  2R5A A;  3WVD B;  3J80 E;  3V8K A;  5CAI A;  3JB9 J;  4ZGJ B;  2XI9 A;  4BBR M;  4PJO A;  5FRO A;  3JCM J;  4RMO A;  4HCC A;  2V8J A;  1VIE A;  4IUV A;  5FU6 B;  1BI3 A;  1JRI A;  3ZEH A;  3QII A;  2DXB A;  2P4T A;  3OYD A;  3L2V A;  3M53 A;  4C5H A;  1VQ7 T;  4R55 A;  2PVO B;  2QQ9 A;  4N4I A;  5LJ5 g;  3OS1 A;  5LJ3 d;  1D3B B;  1Y7X A;  2XHC A;  2JNG A;  3OBY A;  5D6W A;  3RKY A;  1KC8 C;  3ASK A;  1G3W A;  2E12 A;  3JCM c;  2HNI A;  1OI1 A;  3VKH A;  4M78 F;  4XTU A;  4RG2 A;  3OW2 S;  4BE0 A;  4QVC A;  4OMF B;  3CMA T;  3NTH A;  2DVE A;  1BI2 A;  1VQ5 T;  4M78 E;  2VC8 A;  5I21 A;  2GFU A;  2XIC A;  2OTJ T;  2XK0 A;  3OYF A;  4MIM A;  4M7D A;  1YCY A;  2GQV A;  5CVI A;  4ZN3 A;  4OB1 B;  2X35 A;  3SD4 A;  2DD4 A;  1VQM A;  1LNX A;  5LJ3 g;  3CCU A;  1JJ2 A;  3X25 B;  3BG9 A;  2ZPI B;  1WJQ A;  4EMK A;  3CXC S;  3M59 A;  3QYG B;  1H3Z A;  2QQR A;  2FB7 A;  3GPL A;  4J6Y A;  3CCQ T;  1M5Q 1;  2EWN A;  4DA4 A;  3VYG A;  5GAO r;  4C8Q F;  2DZ9 A;  2ZPG B;  4QSH A;  2FHD A;  1HXD A;  2RJD A;  3CPW S;  2LC4 A;  1Q81 C;  4M78 B;  4NC6 A;  4XK8 E;  5GAO q;  4M7A A;  5LJ5 h;  4M7A D;  3CCE A;  2F5K A;  4XTY A;  4C8Q E;  3GF5 A;  3M58 A;  1AHJ B;  5J3B A;  3PT9 A;  3ZFJ A;  3OYE A;  3MHX A;  5A0D A;  2CZ1 B;  5GAN e;  1KQ1 A;  1G3T A;  2CS7 A;  2LVM A;  4PJO C;  5EG2 A;  4C8Q G;  3PIP A;  2X4W A;  1KQS S;  1MGQ A;  3CCU T;  1VQP A;  3JB9 I;  3X26 B;  3VKG A;  3NFC A;  4A4H A;  1M8V A;  2BS2 A;  3JRZ A;  4ZN1 A;  3H4C A;  2I2L A;  2JOY A;  3JCM W;  2JUF A;  4M75 A;  3JB9 D;  2EJ9 A;  4OB3 B;  1RI0 A;  1FKM A;  4A53 A;  3L42 A;  4BUG A;  4C8Q B;  5HK3 A;  5LJ3 h;  4VUB A;  1N8R C;  1JBM A;  3HZJ A;  3OYG A;  4FM4 B;  2XKO C;  3LH0 A;  4UC4 A;  2EQM A;  2K5I A;  3CCE T;  3E9G A;  2Y90 A;  2KVQ G;  4F7U F;  5CIU A;  4ZGD B;  2E65 A;  5IN1 A;  3OQ5 A;  2L8D A;  5GMK h;  1UGP B;  4M7D C;  4E7I A;  3OYA A;  4ELY C;  2ZPH B;  4F7U E;  3QHS A;  2DXT A;  1YJ9 A;  3QJY A;  3BW1 A;  1VQP T;  4EMK C;  3EAE A;  1VQ8 A;  5GAN 2;  5J39 A;  3I55 T;  4F7U G;  3CCM T;  4KUI A;  2CGH A;  3FC3 A;  2RJF A;  3TCJ A;  2EIF A;  2VV5 A;  1VQN A;  2QDY B;  1FX7 A;  3M9Q A;  5GAM e;  5GAO n;  4XTV A;  4M7A C;  2DZC A;  4QVZ A;  4PL6 A;  1YIT A;  2PVD B;  2WSF E;  1XTD A;  1YI2 A;  3QXE B;  4C92 A;  1WGS A;  3GLX A;  4J6W A;  3JAM E;  5CKF A;  2RHU A;  3V7C A;  3TW6 A;  4MML A;  4J6X A;  2KMT A;  3JCM e;  1QVF S;  2YHT A;  2JTF A;  3JSC A;  4JRQ A;  2FYK A;  1YJ9 T;  4HT9 A;  2D0Q B;  2EAY A;  3ER0 A;  1U1T A;  4Z6Y A;  2YRV A;  3I56 A;  1Q82 U;  2DEQ A;  1MHN A;  2WAC A;  3FLG A;  3VV0 A;  1KHI A;  5GAN 6;  1VQ8 T;  5FRM A;  4M75 C;  4ME7 A;  4II1 A;  3CCL A;  3SDZ A;  2EQJ A;  3CCJ A;  2CZ7 B;  2KK4 A;  4L6V 5;  4B9W A;  3QZ9 B;  2IG0 A;  4C5I A;  4L59 A;  3CC7 A;  4E7K A;  3HFN A;  5GAN 7;  3HRS A;  2JN0 A;  3T9N A;  1YIT T;  2O4X A;  2ZZD B;  2QQS A;  4MZP A;  2MAM A;  1YI2 T;  4M77 D;  3VU3 C;  4M77 A;  4AKH A;  3UDC A;  2OTL T;  2KDS A;  2VYT A;  4C0G A;  4NL3 A;  4EMG A;  2CKK A;  4DOW A;  2XDD A;  3HRT A;  2CZ0 B;  2X4J A;  5CQY A;  3DKM A;  5FU7 C;  3V7R A;  4CI0 C;  3I56 T;  4EMH A;  5KE2 A;  2C06 A;  2ZPE B;  2QI2 A;  2ZPF B;  3CPF A;  3QUI A;  1QLB A;  3CCL T;  2AHJ B;  1X6O A;  3X20 B;  2LNV A;  2M1H A;  4GLK A;  4QQD A;  2EKO A;  4AKI A;  3CCJ T;  1VQO T;  4X9C A;  4BI3 A;  1X01 A;  3PMI A;  2RJC A;  1XQH A;  5GAN d;  3OYH A;  4ELZ C;  2DJZ A;  3TEE A;  4OB2 B;  4C92 C;  1VQL T;  3OYL A;  1NJI C;  3M5A A;  2M16 A;  4BDZ A;  2P0P A;  1VQK A;  2QF7 A;  1KQ2 A;  4XU1 A;  5M9O A;  2G77 A;  2RHY A;  3G71 A;  4J83 A;  3PTA A;  3OYJ A;  1I8F A;  2RB6 A;  4N4G A;  4PJO F;  5DM7 R;  1Y96 B;  4ZGE B;  2LT4 A;  1WPY A;  3OBW A;  4FIB A;  1QP2 A;  2D9T A;  3MP8 A;  3URG A;  5GMK l;  5GAN g;  2DPP B;  4PJO E;  4OGC A;  3MEU A;  2MI6 A;  1KG1 A;  1SSF A;  1QW1 A;  3C95 A;  3QG1 A;  3FDR A;  3SWN B;  4HNU A;  3PMT A;  4M77 C;  2E1H A;  2X4X A;  3VYH B;  2GCX A;  4PJO G;  1VUB A;  3M56 A;  3CD6 A;  3KUF A;  3QYB A;  3LWI A;  3UPU A;  2DIG A;  5KCO A;  3OMC A;  2K5F A;  1VQK T;  1N9R A;  3G71 T;  5KH6 A;  2DXC B;  4M7D F;  4MZM A;  3AHU A;  2A3L A;  3OYC A;  1GXI E;  2LTO A;  2GFA A;  2ZCF B;  2RI2 A;  3CBO A;  1M1G A;  1ZQ1 A;  5I2M A;  3LGF A;  4BI8 B;  3CCR A;  4MDX A;  4MFE A;  4HNV A;  1IZ6 A;  4M78 D;  4M78 A;  4X34 A;  2L89 A;  3QYH B;  2QA4 A;  1Q82 C;  4M7D E;  3WXM B;  3RKW A;  2JZ2 A;  5J26 A;  3A8L B;  5A0G A;  2LCC A;  4YTL A;  1U1S A;  3G7Z A;  3CBM A;  3JCM d;  4RCB A;  1VQ9 A;  4M7D G;  4JRK A;  1NZ9 A;  1UGQ B;  5KE3 A;  2K5L A;  4QVD A;  5GAN h;  4M7A F;  1LOJ A;  2K2V A;  2QFZ A;  3OS5 A;  3GNF B;  3V8L A;  4BY6 B;  1M90 C;  4BBS M;  3PIO A;  4FU6 A;  4P5N A;  2RA2 A;  3RIR A;  4OB0 B;  2XU8 A;  4HA8 A;  5GAM g;  3QYE A;  1VQM T;  4JX5 A;  1YHQ A;  1YJW A;  1K8A U;  3WVE B;  1FWZ A;  4LD9 K;  4M7A E;  4M7D B;  3V7S A;  2WJ9 A;  4C8Q D;  3LWH A;  4JS4 A;  3OYB A;  1XOV A;  4Z02 A;  3FJP A;  3CCS A;  3BY7 A;  3DLM A;  3FEO A;  4M7A G;  2V8K A;  3QPH A;  2LX9 A;  2RI3 A;  3JCM g;  4EMK B;  5A2Q E;  2QA4 T;  4IKF A;  1G5V A;  4M75 F;  3OYI A;  1NJI U;  2HQX A;  4PNO A;  1YIJ A;  1H64 1;  4C0D B;  4ZTJ A;  4B9X A;  5LJ5 j;  1O75 A;  1VQ9 T;  3FB9 A;  4O5V A;  3ME9 A;  4L5G A;  4ATO A;  4JRP A;  4JLI A;  4M75 E;  4LD6 A;  3HL8 A;  2XDB A;  2RK2 A;  3S3M A;  3BG5 A;  3C12 A;  3MP6 A;  2H3J A;  4C0Z A;  2PUK B;  2F5T X;  2K57 A;  3BFM A;  1R8O B;  3OB9 A;  2WSE E;  2ZPB B;  5I2S A;  4E7J A;  3TW7 A;  4M75 G;  3HPW A;  1KHC A;  2RD1 A;  2M0O A;  2HQE A;  3A8O B;  3TU4 K;  3FRN A;  4HT8 A;  2X4Y A;  1HK9 A;  3H6Z A;  3CCS T;  1I81 A;  4XTW A;  3F70 A;  5LJ5 f;  1Q86 U;  5GAM h;  2QEX A;  3LX7 A;  5LJ3 j;  4M75 B;  5HK0 A;  3E19 A;  1QP3 A;  4J8O A;  5GAN 8;  4N0A A;  1XNI A;  4IUP A;  5HKC A;  1N6A A;  5GMK m;  2R58 A;  4F7U B;  3JCM h;  1M1K U;  5GMK j;  2QDJ A;  4C92 F;  2RM4 A;  4LDW A;  4ZTF A;  4QW2 A;  5CCA A;  4RKU E;  1Q7Y C;  2FL7 A;  3JB9 H;  4CRI A;  3GNG A;  3A8H B;  1WQ7 A;  1G3S A;  2ZGW A;  3INZ A;  5LJ3 f;  3ZBD A;  2PUO B;  3EFS A;  4C92 E;  2PVG B;  3FIF A;  5CKD A;  3HHT B;  2BIV A;  3OW2 A;  2MWP A;  5FU7 B;  4LOC A;  4A4G A;  5GAN 5;  3P8B B;  4HCZ A;  3GP8 A;  1JJ2 S;  3PFS A;  2QEX T;  2ZZD A;  2MWO A;  4OGE A;  4C92 G;  3VUB A;  2KSS A;  1VQN T;  4HL4 A;  1M90 U;  2EFI A;  2DTI A;  5GAN 4;  3KXT A;  3MEA A;  1I5L A;  2E41 A;  3E9F A;  2XD0 A;  3X28 B;  2JTM A;  3VKI A;  4R56 A;  2E6N A;  3CXC A;  4KUD K;  2E6Z A;  5CQX A;  3L2R A;  4E7H A;  4M77 F;  4C92 B;  3DLL A;  5IT9 E;  3HO8 A;  2LCL A;  2KAF A;  2LQK A;  4E7L A;  3P8D A;  5GAO p;  5DLO A;  3CPW A;  3PGG A;  2RO0 A;  4M77 E;  2DD5 B;  5C6S A;  4BI4 A;  1K8A C;  2XID A;  2XG8 D;  2EYQ A;  1UGS B;  2KQW A;  1VIF A;  2R57 A;  4D6W A;  5FRN A;  1NPP A;  4M77 G;  4AI6 A;  3CC7 T;  4M6V A;  2QTX A;  3G4S A;  3BDL A;  3G6E A;  3OYM A;  4DOV A;  3L2Q A;  3PNW C;  3SB2 A;  3OS0 A;  3M55 A;  4EDU A;  2RHI A;  3QZ5 B;  2L5Q A;  3NTK A;  5LL6 S;  3A5Z B;  2MF2 A;  3SFM A;  5A0L A;  3MEW A;  1KD1 U;  5HY6 A;  2Y4X A;  2K4Y A;  2A7Y A;  3KBG A;  4FT4 A;  1Y96 A;  5FLX E;  1D3B A;  1OYX A;  3RER A;  1B34 B;  5L8R E;  2VGM A;  4XTX A;  4IUU A;  2E10 A;  2HD0 A;  2KR6 A;  2FVU A;  3OSV A;  1N27 A;  4JDS A;  4KBM B;  2DTH A;  2GF7 A;  3SWN A;  1N9S A;  1BIB A;  3LGL A;  2DTO A;  2HBP A;  4BAC A;  3HB9 A;  2LT1 A;  4OP0 A;  3CME A;  5CR2 A;  4BB7 A;  3G4S T;  3G6E T;  1W4S A;  2LQ8 A;  3E1S A;  3L1A A;  1Q86 C;  3HSB A;  1RL2 A;  2EQK A;  1UB4 A;  3CMA A;  3HBL A;  4TVR A;  1V29 B;  3HRU A;  4FSX A;  2P0Q A;  4J7F A;  4NL2 A;  5CKE A;  5DLQ E;  2DXC A;  1Q7Y U;  3VJP A;  4E47 A;  1VQ5 A;  3QO3 A;  2RH2 A;  2RJE A;  5DY9 A;  1I4K 1;  5GAN 3;  3H8Z A;  2OTJ A;  4PJO D;  1OZ2 A;  2LRQ A;  2CYZ B;  2E5Q A;  3M54 A;  2CZ6 B;  4NS5 A;  1W2B A;  1M1K C;  4IUQ A;  1M9S A;  2BS4 A;  4BE2 A;  4KUL A;  3R6O A;  4PJO B;  4JX6 A;  3NTI A;  3CCQ A;  5GAM d;  1K73 U;  3C94 A;  1BI0 A;  2K3Y A;  2G3R A;  2DXB B;  2RHZ A;  5CKH A;  3CCV A;  4MFD A;  3DB4 A;  4C5E A;  3MP1 A;  5IAY A;  4XU2 A;  3CME T;  4A4K A;  4LDV A;  4Y28 E;  4BE1 A;  1QVF A;  4GY5 A;  2WSC E;  3Q1J A;  4MDW A;  4JRI A;  4PLL A;  4C5G A;  4DQ2 A;  5CK9 A;  3RMS A;  3JCM b;  1UEB A;  4OVA A;  2OAU A;  3RES A;  1WQW A;  5FU6 C;  3CD6 T;  4WF2 A;  2E70 A;  3CC2 A;  3LLR A;  3CBP A;  4BD3 A;  1U8R A;  4M7D D;  3LW5 E;  1NPR A;  4C0F A;  2E64 A;  4XU0 A;  2XDP A;  4J5Y A;  5GAO l;  2PQW A;  4M78 G;  4Y91 A;  4XU3 A;  2MMP A;  3OYN A;  1PSF A;  1M1F A;  3OS2 A;  1BKB A;  4C8Q A;  4JLG A;  4JJN K;  4HCB A;  2DD4 B;  3QKJ A;  3CCR T;  3OA6 A;  1K9M U;  5AYF A;  3SWN C;  2EJG A;  5CO7 A;  1WJS A;  3CCV T;  4XQ3 A;  1FXX A;  1QVG A;  4HLQ A;  2VXF A;  2DKG A;  3VYG B;  4X9D A;  3JB9 F;  3MEV A;  3A8M B;  2M9U A;  5LJ5 e;  3X24 B;  5GAN j;  2QQ8 A;  4M7A B;  1EIF A;  2O01 E;  4ELJ A;  3CC2 T;  1X75 C;  4O6J A;  3KHI A;  5GMK i;  2JVV A;  1YBY A;  4LDX A;  3MCA B;  1BYM A;  3JB9 G;  1YHQ T;  1JB0 E;  1YJW T;  1KD1 C;  3GIB A;  3O8V A;  2RHX A;  3OSS C;  3I55 A;  3RMQ A;  2F69 A;  2EJF A;  2QXF A;  4M78 C;  2BUD A;  4M75 D;  3CCM A;  3S3N A;  5D6Y A;  4EPC A;  3S3O A;  1S72 A;  3J7A F;  2P0K A;  5GAN f;  4LDY A;  1UGR B;  1BIA A;  4F7U A;  4BY6 C;  5LJ3 e;  4FL6 A;  3BDU A;  1YIJ T;  3JCM P;  4BDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...