3VYHB

Crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 67
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3vyhB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vyhB02
2ZCFB 1QP2A 2DD4B 2DXBA 1PSEA 3X28B 4OB2B 3VYGA 1AHJB 3WVEB 2PU9B 2CYZB 3X20B 1V29B 2CZ7B 4XK8E 2ZZDB 3QYHB 2ZPGB 2DXCB 4RKUE 1DJ7B 1IREB 2DD5B 2ZPFB 3QYGB 2ZPBB 3QZ9B 2WSEE 2CZ1B 2DD4A 2CZ6B 2AHJB 3A8LB 3VYGB 3X25B 2DPPB 2PVGB 3A8GB 4ZGDB 2ZZDA 4L6V5 1JB0E 2ZPHB 1PSFA 2WSCE 2ZPEB 4OB1B 1UGQB 4KT0E 2PUKB 3A8OB 4ZGEB 3LW5E 3WVDB 1UGRB 2WSFE 2O01E 2PUOB 1QP3A 5L8RE 2PVDB 1UGPB 3A8HB 2DXBB 3QXEB 3HHTB 4FM4B 2ZPIB 3X24B 4ZGJB 3VYHB 3A8MB 1UGSB 2PVOB 4OB0B 3X26B 4Y28E 3QZ5B 1GXIE 2CZ0B 2DXCA 2D0QB 2QDYB 4OB3B 2DD5A
chains in the Genus database with same CATH superfamily
3NDQA 4M78C 5FROA 2DD4B 2FPDA 3OYFA 1H3ZA 1VQLQ 1R0CB 1E9HB 3KHIA 3VYGA 2RMOA 1ARKA 1WIEA 3NFCA 2XD0A 3R6NA 2CZ7B 4BCFB 2LZ6B 3J7AF 2R5MA 3QYHB 4EDUA 1UNLD 1WXBA 1VQ8Q 2COWA 3BDLA 5GAOn 1UJ0A 4FIBA 1MV0B 2HSPA 2ZPBB 5I5ZB 5KYWB 2X35A 4F7NB 3QDRB 2X3WD 4JS4A 4DA4A 4FW1A 1M5Q1 3CC2T 4EMGA 1ZSZC 4C8QC 1TH7A 2WJ9A 3M4YA 3A8LB 4RG2A 3M03A 2LX7A 3M0SA 3K7AM 4OMMA 2LNVA 4ELJA 1ZQ1A 3OA6A 4KULA 3OQ5A 1VYVA 1SSFA 4YOZA 2X1NB 5IN1A 4HCZA 2EFIA 2LDMA 3CCRT 1I8FA 5FU6B 2KAFA 1VYWB 2RK2A 1AWOA 2BTTA 3J80E 3CMEA 4QSHA 2W0ZA 3EFOA 1JJ2P 2BPMB 1NLOC 2MPXC 2E5QA 2PUOB 4LOCA 4HCBA 5GANe 4F6WB 2A7YA 1VQMA 2CUBA 4M77A 2LCLA 4F16A 4QVZA 4DBHA 3OBYA 1JKWA 4FSSA 3CCLT 4E6RA 4RCBA 3RMSA 1ZHIA 3JCMQ 3QPHA 2JM8A 3JCMJ 2DTIA 1IHWA 1QCNA 1WI7A 2PVOB 2QFZA 3OS0A 3M55A 2SEMA 2XKOC 3HPWA 2QDYB 4ZTJA 1N5ZA 2RA2A 2D1XA 5KCOA 3PO3S 3I56A 2DKGA 2D8HA 4YC3B 2EQUA 4FL6A 3M4GA 2DBKA 3GOXA 4LDUA 4WTOB 3GTMS 4IUVA 3HZJA 2WMAB 3CCRA 1QVFS 4MIMA 2CGHA 3U23A 1BCMA 2RNAA 3CXCS 2E1HA 4JJBA 2COZA 5LJ3e 1N8RR 3QHRB 1KC8C 1VQ9A 2CSIA 3EIDB 2WACA 3HO8A 4M7AC 3E19A 2WEVB 2DL7A 1VQMT 2AHJB 2FRWA 2BE7D 1YJNQ 3RR6A 2F2VA 1G5VA 2P4TA 3CCJQ 2HQHA 2PVGB 4M78B 5FRMA 1PG5B 2QEXA 1I1JA 4XQ3A 3M5AA 1Y96A 1C1AA 5KYWA 2D9TA 1SRLA 2DEQA 1SRMA 2C0IA 1N27A 2L3PA 3EG9A 2JXBA 4CFWB 3I55A 4M75A 4A4FA 3CCVQ 1VYUA 4E7JA 1KG1A 2QQ9A 1NJIC 1ABQA 2KMGA 2WFYB 3C12A 1GCQA 3ER0A 4Y91A 5L8RE 1FWZA 3M0UA 4J5YA 4EMHA 3C94A 1Y7XA 1QMZB 3TSZA 5KYNA 1S72T 3ME9A 1HYOA 2MIOA 4RTWA 1SF9A 3EG9B 5HK0A 2ZPIB 1OKVB 2QGGA 1TSFA 5FU7B 4FT4A 2GBQA 3LYIA 3M57A 2XICA 3S6WA 3CPWA 4LUEA 1D3BB 2UZLB 3OYCA 2ROTA 2KK4A 2WIHB 4R0KA 2KXCA 4MFEA 3GF5A 1G3WA 4M7AG 2O4XB 2B8AA 1JU5C 2QA4T 4KH0B 1FKMA 4ROEA 1RAAB 2VB6A 1H1PB 4PJOG 4LDYA 4QT7A 1VA7A 2FB7A 5FU7C 2P0QA 4HT8A 5CO7A 5GJVB 1PKSA 4F7UA 1X43A 3CBOA 4IIOA 1OI1A 2M1HA 4BCMB 4II1A 5L23A 4ATOA 1IGQA 4OMLA 2EKHA 4WF2A 3QZ9B 2M0OA 1QQJA 2E6NA 5GAN4 4PJNA 1P5EB 2XG8D 2VVKA 1AD6A 2YRVA 3RDVA 1W2BS 2OTLQ 3PTAA 5A0GA 2KE9A 2X9HA 1YI2Q 3JB9D 1WHMA 3A8GB 2EPDA 4OGCA 5CIUA 1D1AA 3JCMg 1S72A 3RGFB 4J7FA 1NYFA 3PMTA 1MMDA 2HCKA 1KFZA 1PSFA 2DRKA 2GQIA 3RKYA 4ZN3A 2G9XB 2VYTA 1NPPA 2YLBA 2RHUA 4DBQA 1W6XA 4UN0A 3FLGA 1WZOA 2P0KA 2EJGA 2E3HA 2QYZA 4JRKA 1VQ9Q 1Y0MA 1XQHA 2DLPA 4LDXA 5LJ5f 4N4IA 3PVQA 3EGDA 3M54A 4KUIA 2DL4A 1X6OA 2PVDB 1QCOA 1GBRA 1G3YA 5C0MA 2FPEA 4C8QF 2DZ9A 3CCJA 5A0DA 4BY6B 3URGA 1M4ZA 3RERA 4FT2A 1VOLA 1RAGB 4FM4B 1Q86U 3DOGB 1RLPC 2KDSA 4ZGJB 4ORZA 4E7KA 1D1CA 1CKAA 4RTVA 2IVWA 2J05A 3EH2A 4JPBW 2K7AA 1V1CA 2DXCA 1HJDA 1K4US 5DQWA 3OMGA 1YCSB 3VKHA 1TG0A 1GUXB 4OGEA 1OU9A 3CXCP 1JOWA 1QP2A 3X28B 4OB2B 5FGKB 1NM7A 5C6SA 2HAXA 2CYZB 3OYAA 2BS3A 4BACA 1SKUB 4CFVB 5LJ5h 2RO0A 3HSBA 3V7SA 4PFZA 4K11A 1NBEB 2P4RA 1QVGA 4DOVA 3TNHB 2NWMA 2V8IA 3CXCA 3UT1A 2JJ9A 1EFNA 1TTHB 3CCJT 2K5IA 1YFNA 5FU6C 1KSWA 3CD6A 1C0MA 3QUIA 3QYEA 3DDPB 3R6OA 5IAYA 3M59A 1VIFA 3DJBA 4GLKA 3E9FA 4FYVB 4C8QA 5LJ5d 1K8AC 2JMAA 4IUTA 2V8KA 1IXDA 2K3YA 1TWBA 3EG1A 4BXXX 3PFSA 2O01E 1I5OB 2YRDA 4PJOF 3ASKA 1MGQA 2DA9A 2FZKB 1VQOT 1VQ6T 2CSQA 4QQDA 1QVFP 4HKEA 3DB4A 2J7IA 2DF6A 2YDLA 3OYBA 4BE2A 4EOJB 2ECZA 1M90R 4C8QB 4RODA 1RABB 2RPNA 2NUTB 1W70A 2OTJA 2DIQA 3VS7A 5GMKh 2RH2A 3AT1B 3MEVA 3TNIB 1FMWA 2L0AA 2YT6A 4M4ZA 1I4K1 3QO3A 1B34A 3G1JA 2RI3A 2LX9A 4C92B 1VIEA 2QGFB 4BCPB 5LMKB 3DB3A 1GFCA 4EIKA 1C9BA 3OS5A 4FX3B 2AK5A 1NG2A 4XAXB 2EUFA 5GMKm 2KRSA 1B07A 4RTXA 1VQLT 3CD6T 4OVAA 1NEGA 5A0LA 2FEIA 5DM7R 2F69A 1I07A 1PRLC 2DILA 2KI7A 3G33B 1MMGA 1O9KA 4NOYA 1H641 2E41A 1ZUYA 2GF7A 1K73C 2EJFA 2W99A 3O0GD 2L3SA 5IHNA 1YJWT 5GANh 1I5LA 1JJ2S 5CYIB 1C6VX 4M77G 1GUXA 3ZL7C 1VQ4A 4LDWA 1M9SA 5KYYB 1D0ZA 4JJDA 1VYTA 3E1SA 1MMAA 2YLCA 4GLMA 3QG1A 4DQ2A 1JXOA 1KC8U 2DX1A 1E6GA 2PK2A 2MAMA 4LN2A 2Y4YA 2A3LA 1LPLA 4MFDA 3CMEQ 3JB9H 3G6EA 2LTOA 4M75E 2MI6A 4JRPA 4HVUA 4BY7X 3NHNA 4IKFA 2HNIA 5KYYA 2RM4A 1PM3A 2WIPB 4Y72B 3NPFA 3BLQB 4ROCA 2JNGA 1X2QA 1PKTA 5LJ3d 1AT1B 2WXVB 2I53A 1IRXA 5LJ5j 1VQLA 2NYSA 5CKBA 1I0CA 4FYYB 5CVIA 2YUNA 3TREA 3VRZA 3TN8B 4L59A 1UGPB 2NUPA 4FSXA 5D6XA 2QQRA 4C92G 3G7ZA 2DXBB 1WJRA 2DERA 2CUDA 4PLIA 5HVYB 4RMOA 4M7AA 3VYHB 4M77D 1Q82C 3I56Q 3LGFA 1Q95G 4QQ6A 1ENWA 2K2MA 4N0AA 2KYBA 1FMVA 2PMIB 4F7UE 4FCYA 2JGZB 2JTEA 1BU2A 3RIRA 2M16A 4HVWA 1Z9QA 5HKCA 1FMKA 3PMIA 1ZA2B 3OYEA 3FEOA 2HSEB 1MNEA 4EONB 2JZ2A 4XTXA 2F5TX 3H0HA 3CCUA 5D7UA 3BLHB 2BS2A 3ULRB 3VS6A 3PNWC 3H6ZA 4FYWB 4RTYA 4C92A 4PFPA 5I11A 4RKUE 4BI3A 1VQ5A 2OTJQ 3OW2A 4C0FA 3JCMX 3QYGB 5KYUB 2H3JA 2WSEE 5GMKj 1GFDA 2LW4A 2W2HA 3SWNA 1TOVA 1SG5A 4ZN1A 4KGZB 2DPPB 5IDNB 3DLMA 1X01A 3C0CA 1KQSA 2D6FA 2X3XD 4L6V5 3QWLA 4CFNB 3LX7A 2O31A 1ZUUA 5AT1B 5HBJB 1YJ9T 2PUKB 3JCMV 2OAWA 1TS9A 3UA7A 5DLOA 1OX9A 4OMOA 3CD6Q 2V26A 2K79A 1RLQC 3RNJA 4ELZC 2P84A 4HA8A 3JB9I 4M7AD 1I81A 2DTOA 3RKWA 1RI9A 2GCXA 3OSSC 5GAOl 4JUVA 1WDXA 2OTLA 4AMCA 1H25B 2FYKA 2AIRB 4BY1X 1YITQ 1WYXA 2PNIA 3HFOA 3L42A 3M0QA 4C5HA 4CRIA 3OW2P 2KMTA 2VASA 3IQLA 1HD3A 1M90U 3UATA 2JW4A 5LJ5g 1TFBA 1G3NC 1IGUA 4V2SA 3QKJA 1OIUB 2EW3A 4M77B 4M7DF 3MY1B 2ATCB 4PJLA 1WHLA 2FG0A 4OMQA 2QA4Q 1UHCA 3M53A 2OJ2A 4N4GA 1W1FA 1YJNT 3GIBA 3G4SA 3RESA 4C0ZA 4M78E 1PD1A 1D0YA 4Z8AA 2CS7A 2JVVA 3CCQA 1KD1C 2EGAA 2KGTA 4CRLB 4PJOC 2QAZA 2RQVA 3KBGA 2O4XA 2RJFA 2LNHB 2LQKA 3EOCB 4E7SA 1JSTB 1M2VA 3B57A 1YIJA 1QMCA 2HL3A 2DJQA 4PJOB 2K6DA 2FL7A 3OYNA 2RB6A 4C5GA 5CKHA 3CCVT 4KRCB 2AZVA 1N8RC 3QDFA 2GTOA 4EOQB 5EC7A 2ZGWA 1SSHA 2ZZDA 3TCJA 5IHIA 1JB0E 2R7GA 3EGDB 3QJ6A 3FRNA 4F14A 2DZCA 4OB1B 1WFWA 2HL5C 3M0PA 4XU1A 3VS1A 3H41A 4PJOE 3BHTB 1S72Q 4HXJA 2XMFA 2C0TA 5KE3A 1KD1U 4ANJA 5HNBB 2L89A 2IW9B 3CC4A 1VQ7T 2C6TB 2A28A 4CC7A 4LUDA 4BCND 4E7IA 1M1FA 2EQJA 2ED0A 4C0DC 2F2CA 4ZNXA 2DL8A 3CCQT 1N6AA 5EFQB 2E6ZA 4JS5A 4KUDK 3TQ7P 1NJIR 2MMPA 5GAOq 1VQPA 1TD6A 3E9GA 2DTHA 4C0DB 1UHFA 4OB0B 3X26B 1GXIE 3FDRA 4NL2A 2HQXA 3N5BB 3MKDA 1OI9B 2HBWA 2OX7A 3VU3C 1UB4A 4AFUC 5IDPB 4PL6A 2FPFA 2K4YA 1K9MC 3HFNA 3TW7A 1WX6A 5GAMj 4D8DA 4EC9B 4F17A 3L2RA 3OYHA 1WQWA 4KH1B 4B9XA 1HK9A 2I40B 3MJXA 1YITA 1P92A 2LQNA 5HY6A 3BG9A 4CFUD 1SPKA 4F7LB 3CCUQ 3SB2A 2XHCA 3QHWB 2L3RA 4J9FA 3CCEA 1MUZA 3CPWP 1UGVA 1AEYA 2DIGA 2B86A 2WHBB 3OB9A 4VUBA 3EFOB 4IUPA 1UTIA 5GAOp 4C8QD 3EG0A 1H8KA 2F5KA 1LJOA 1R0BG 3E2UA 4XTZA 4BCJB 5DY9A 5LL6S 1AOJA 1JSUB 3OMCA 1OX8A 4A53A 2EIFA 1BI0A 1WHHA 2RHIA 1AZGB 2DBMA 4QQGA 2HD0A 2ZPEB 3NTHA 2NUPB 1YJ9Q 4J6WA 4KT0E 1K9MU 4M7DG 2QASA 1RADB 4C5IA 1OV3A 5CQYA 5CCAA 1ZX6A 1QKWA 3JB9F 4PJOA 1M27C 1XJWB 3OS2A 4AKIA 4E2FB 2AT1B 5GAOr 3OYKA 5GMKi 1B34B 2QQBA 2IW8B 2ROLA 3SEMA 1Q82R 4R55A 3H0FA 2C5XB 4OMPA 4JDSA 1SHGA 2RHZA 4PJMA 4CC2A 1M3BA 3I9QA 2AZSA 2V1RA 1D1BA 4NL3A 3QHSA 4BCHB 2AKKA 3OS1A 3QSUA 1H27B 1YITT 1X69A 3OYDA 2DRMA 3JCMc 4JLGA 1Q81R 2EBPA 2HMAA 3C4SA 1JRIA 4Z88A 4LDVA 1UDLA 3JCMf 2YXYA 3KUFA 4XU2A 3MI9B 3THKA 5I21A 4EMKB 4C8QG 2UZBB 2J6KA 4PJJA 2EYZA 3OYGA 2C5OB 3MHXA 5GMKl 2CP3A 1MMNA 4J9DA 1WHGA 1AHJB 3WVEB 2CH4A 2DMEA 4AG2C 1MHNA 3CCMQ 1OULA 4EOSB 3VS5A 3EGUA 2VKNA 4M78A 1TUGB 3TSWA 2VWFA 4AFQC 5M9OA 1YJWQ 3ZBDA 1A0NB 5LJ3j 2DXCB 4EMKA 1IREB 2HQEA 1Y96B 3REBB 4PJOD 2R5AA 1TXQA 3C95A 3OW2S 3RUXA 4NS5A 6AT1B 1O75A 2PHGA 2QI2A 9ATCB 3J81E 3X25B 1X6GA 1GCPA 4C92D 4ELLA 3OSVA 3V7RA 1N8RU 1VQ4Q 1VQOQ 1YWOA 2RI2A 1M30A 3TU4K 2VV5A 3S3OA 2DM1A 4N0AC 4J9CA 2PZ1A 3CPWS 2G3RA 2XI9A 3MEUA 2DL3A 2IG0A 4ZGEB 1JO8A 3Q1JA 3META 1RL2A 3QBYA 1X2KA 2WSFE 3CQTA 3NMZC 1VUBA 3RMQA 4RUGA 2DXTA 1YWPA 1ACMB 5IHYA 4LXCA 4J83A 3QWYA 2QK0A 1GY3B 1Q82U 1ZLMA 2K2VA 4QW2A 1YHQT 2LVMA 3NGPA 3A8HB 1E7OA 4HCKA 2W10A 4TVRA 2IW6B 4EC8B 3LGLA 2F2XA 4F6UB 4HT9A 4M77C 2PJQA 4J8OA 5J3BA 1M8VA 5ACBA 5FW9A 4LD6A 5CKFA 5KE2A 3CC2A 3QZ5B 2X51A 4E7HA 1WXTA 1Q7YC 1QVGS 2X4YA 1M1KU 3JCMh 1M90C 1ZA1B 2HDAA 2BKZB 4IIMA 4MMKA 2C5VB 1M2VB 3A1PA 4CC4B 2DXBA 3MY5B 5GMKe 1H3HA 4BDZA 1PNJA 2HZYA 3SWNB 4BE0A 4CFUB 3VS0A 3OY9A 1WHKA 1KHIA 1ZBJA 2CREA 5IT9E 1T0JA 1QLBA 4F7SB 1E6HA 4RTTA 4XK8E 4A4HA 3CMET 4M7DA 2ZPGB 4NSTB 1UFFA 4BDYA 1H24B 4M7DE 3JB9J 1X27A 3EFRA 3UDCA 3JCMd 3QJYA 4M75D 2L5QA 3I5RA 4JJCA 2W9ZA 3VYGB 1JQQA 1BI1A 4DEYA 2CT4A 2RHXA 1YHQA 4M75B 1VQNT 1BK2A 3CCLA 2QA4A 2FHDA 2YUQA 2FO0A 3CCEQ 2GGRA 4M77F 4M7DB 4BUGA 2WSCE 4QKUA 2H8HA 1K8AR 2XIDA 5HBEB 3OYJA 4GY5A 3P8BB 4BI4A 2YHTA 1AWJA 2BZXA 2YUOA 5CKDA 2QDLA 1GCQC 2XK0A 1LOJA 3MO8A 1LNXA 2GTJA 1UGRB 4EMKC 4KGVB 3CBPA 4JX6A 3I56T 2MWPA 2VXEA 1BCOA 4C0GA 4DBFA 3JCMP 3POMA 2JUFA 4XTVA 1HSQA 4RG8A 3F5XB 3H0IA 1NE8A 4J6XA 4M78F 1KK7A 2V1QA 4MZTA 4HNTA 2CP2A 2DE0X 2LJ0A 1QCFA 5GAOm 3OYYA 2EYYA 2FRYA 4NC6A 5LQFB 1K1ZA 5FLXE 3EGXB 4JRIA 2RN8A 2RF0A 4R56A 3PGGA 1VQ9T 4A4EA 3MP8A 3V8KA 2CP6A 1UGSB 1Q81C 1EIFA 3JAME 3HRTA 1BB9A 4C92F 1VQNA 2D8JA 4J9HA 4J9EA 3MPUB 1Z9ZA 1OOTA 1H4LD 2ED1A 5GANd 2QEXT 1D09B 1T3LA 1U5SA 4RTZA 4M7AB 1K73R 1VQMQ 4BCQD 2E10A 2HKQB 2K9GA 1GL5A 1M3CA 1D3BA 1O9SA 2CP7A 5HBHB 5EG2A 2ZZDB 3EAEA 1X75C 3L2QA 2K3XA 3FJ5A 1LCKA 3RKXA 3I55T 1DJ7B 2JS2A 2EQKA 2LQ8A 1N4MA 5FWCA 2ZPFB 1PRMC 3G4SQ 4MDWA 3ZEHA 4E47A 2K3BA 2CZ1B 5LJ5e 2X4WA 2CCHB 5J26A 2VGMA 3M56A 5CK9A 4AKGA 1OQKA 3NTIA 1UNGD 5L2WB 3H9NA 1OL1B 4E7ZA 3VRYA 2YRCA 1CSKA 3BHUB 1YN8A 2SRCA 3GNFB 1WHJA 1W2BA 5J39A 1U1SA 2J6FA 4D8KA 1BI3A 1WNLA 2GFUA 2KXDA 1M8MA 2DO3A 4M7DC 3S3NA 3L2WA 2L2PA 2MOXA 2R57A 3EG2A 4JX5A 1WGSA 1VOMA 2HKNA 4N4HA 4A63B 2BS4A 4MMLA 4OMNA 3GNGA 4EOIB 4CFXB 2E64A 2DAQA 2EKOA 3A98A 1PHTA 1QW1A 5KYXA 3QYBA 1UJYA 1H1QB 1WXUA 1OPLA 2XDDA 3MIAB 4II5B 4WCIA 3H8ZA 3V7CA 2KT1A 3REAB 1Y07A 3OYLA 4F7UF 4OGRB 1VQKQ 2CJMB 2F1LA 3LWHA 1VQ6Q 2KBTA 1U3OA 3MCAB 1URCB 2NUZA 1F5QB 2GNCA 2CZ0B 2K5FA 4BCGB 4EOKB 3MEWA 3OBWA 1EZZB 2DD5A 3P8DA 4I3ZB 1JJ2A 2ZCFB 3KFVA 1XO2A 4AI6A 3JRZA 5CQXA 3VJPA 2IVXA 2E4HA 2M9UA 2K57A 1VQ5Q 2VXFA 2ABLA 1Y57A 2E3IA 2JTFA 3I35A 4X1VA 1K0SA 1W98B 5GAMe 1KIKA 2B9RA 1VQ7Q 2HEQA 2CCIB 2C06A 1WLPB 5ECAA 1HXDA 3I5SA 1KXUA 2LT1A 2JOYA 3LWIA 2O9VA 2KEAA 4AKHA 1BBZA 1J3TA 4M78G 5GAN6 3CC4Q 2KRNA 2XDBA 2EGEA 1FXXA 3ZFJA 1N9SA 1KJWA 2Y90A 2RQWA 2VUBA 4M6VA 3BG5A 4M75F 1E7PA 4F7UB 1KD1R 2KVQG 2PTKA 3DTOA 4JZ4A 4PFOA 1AWWA 7AT1B 2O88A 4O6JA 4RCCA 4ZGDB 4TTHA 1T3SA 2LC4A 1JXMA 4Z89A 1G2BA 1UEBA 4HNUA 2UZEB 4FW2A 5GAN7 1FINB 3HP9A 1RACB 1YJWA 5GAN3 2EVRA 2QQ8A 4CI0C 2DVJA 1G3TA 3L1AA 4E7LA 2V22B 3EJ1B 1BIBA 2GQVA 5I2MA 3SHWA 2KROA 3I55Q 4IMYB 1OYXA 2JT4A 3GPLA 1LVKA 2JMCA 3H4CA 3G6ET 5ICPB 4BCOB 4BCQB 4YTLA 2KR6A 4YOOA 3VV0A 1M1KC 1WJSA 2BKDN 1O9KB 3A8MB 5GAN5 1Q7YU 2UZDB 1RAEB 5HCKA 2QGSA 1NPRA 2YUPA 1QVGP 1NJIU 3V8JA 2RQTA 3MP1A 4O5VA 3L2VA 2O9SA 1IB8A 5DLQE 4RTUA 4LD9K 1Q86C 5EJCA 4OMFB 4BB7A 3VUZA 3CCQQ 3BG3A 1OGUB 2EQMA 4A54A 4BCMD 2MK5A 4IUUA 5KH6A 2NUTA 1UE9A 3EHQA 1YCYA 2LRQA 1PKDB 1V76A 3BE3A 4UC4A 3G71T 4J9BA 3CC7A 3TVTA 3UF4A 1V29B 2L3QA 5CEIB 1QWFA 4J9GA 3L2UA 2OAUA 1GRIA 4CXAB 4EOOB 2KRMA 3CCMA 2QG9B 4KGXB 1VQOA 1FX7A 1VQ6A 4AFSC 3LH5A 2G77A 3LLRA 1UG1A 4ELYC 1GH6B 4DBRA 1N9RA 4F7UG 2RQUA 3DDQB 1JEGA 2OTJT 4PK4A 1BYMA 4A4KA 4KRTA 2DNUA 3CCUT 1UNHD 2VC8A 1BI2A 4A4GA 3CEYA 1YI2A 4BD3A 5GAMd 4EORB 3UPUA 2PQWA 5CR2A 3HRUA 1WJQA 2W9FA 3EGXA 2Z0WA 3JCMb 3LW5E 3DLLA 4BI8B 1ZUKA 4MZMA 1VQ5T 3OYMA 2G6FX 4HLQA 2EYXA 1RAIB 2X4JA 4AG1C 3HKSA 1QP3A 1XTDA 4IUQA 2QXFA 1RI0A 4F6SB 2EJ9A 1G83A 3CMAQ 3G71A 5FWBA 3CC7T 2MYSA 4QVCA 4M7AF 1G3SA 3JB9G 3M0TA 2MCNA 2DETA 2GFAA 2IIMA 3BFMA 3X24B 2BE9B 1OL2B 3CCMT 5GAMh 1VQ4T 1Q81U 3GP8A 4M75G 2EGCA 3VKIA 4DEXA 5GAN8 4JJNK 3PVLA 3GBQA 3INZA 2PK9B 4AFZC 1K9MR 1TUDA 4Z02A 2WPAB 5KYUA 2DMOA 2QQSA 4QVDA 4J6YA 3FJPA 4P5NA 5GAN2 1PSEA 4B6MA 1YBYA 3M0RA 4B9WA 1ZSZA 2BZYA 3EFSA 3EG3A 5DQVA 1PWTA 2PU9B 4M7DD 1YI2T 2FVUA 2EYQA 3M58A 4D6WA 3QIIA 1UUEA 4Q5WA 3DKMA 2H3EB 2JM9A 3NTKA 1RAHB 2I2LA 1YHQQ 3SDZA 2HBPA 4OF1A 3PIPA 1NZ9A 3CBMA 1VINA 5I2SA 2QF7A 2KSSA 2VGNA 2DVEA 1K76A 2QQAA 2DD4A 3PE0A 2CZ6B 3JV3A 1AISB 5D6WA 1ZSZB 4C92C 2IN3A 1U8RA 1MV3A 2KYMA 1M3AA 2CP0A 1AZEA 1IO6A 2M0YA 1T0HA 4HVVA 4BY6C 4C8QE 4Y92A 3TEEA 3AHUA 3HTRA 3BLRB 3EH1A 3UWNA 1VQPQ 1AWXA 1YJNA 3SWNC 4OP0A 2R58A 2XU8A 3CC2Q 1UGQB 1PCXA 4X9CA 3V8LA 3SFMA 2C4GB 5AYFA 3WVDB 3BHVB 1QVPA 2E5KA 2RJEA 2YSQA 3A5ZB 3FIFA 5IHKA 3CCSQ 1K73U 5IF1B 5GANj 1YIJT 3OYIA 5IXFA 1H26B 4YOSA 2FZCB 4G6LB 2KR3A 1AVZC 1KHCA 2J6OA 4AT1B 1YNZA 3QWXX 1ZSGA 2BUDA 3CCVA 2QTXA 5GANg 3HBLA 1PC0A 2QTVA 1VQNQ 2E65A 3G6EQ 3JSCA 2A37A 4JX4A 5CKEA 3D7SB 1R8OB 4HNVA 1RUWA 2LJ1A 4Y28E 2L8DA 2CDTA 1M1KR 3TW6A 1BU1A 4XTUA 1H28B 1ZP2A 3O8VA 2D0NA 2KNBB 2DXUA 2WMBB 1Y71A 2DEUA 3S3MA 1IHVA 2W96A 1WPYA 2LCSA 1H92A 2JS0A 3CC4T 4J9IA 1VQ8A 5BNJB 1Q86R 2M51A 5HK3A 8AT1B 2O2OA 1BKBA 3VKGA 2DFUA 1QVFA 5CAIA 1YJ9A 4L5GA 3CMAA 2V8JA 2LQWA 3MEAA 3G71Q 5KCHA 4X34A 2RI5A 2LP5A 5A2QE 1OZ2A 1OPKA 3FB9A 2UUEB 3VUBA 1JBMA 4JZ3A 3M9QA 1BIAA 3CPFA 1K8AU 2E70A 1EX4A 2YWWA 2CH4W 4PNOA 3VS3A 2CT3A 1IZ6A 5I22A 1D0XA 3EHRA 2C0OA 2MF2A 4IURA 5LJ3g 2OTLT 2M02A 5GJWB 2DYIA 1OIYB 5D6YA 1U1TA 8ATCB 4M75C 2AKLA 3UA6A 1KC8R 2LJ3A 4LNPA 2ZPHB 1H1SB 4EOPB 3T9NA 4XTWA 3HL8A 5KYXB 1OZ3A 2X4XA 1SHFA 1B3QA 2JN0A 4C5EA 3BDUA 4ME7A 2NLUA 1KQ2A 2QDJA 4KBMB 2BIVA 1VQ8T 3CCET 1K0XA 1OEBA 4XTYA 1WQ7A 4BBSM 3HRSA 1W2BP 2CKKA 4X9DA 3G4ST 3CMAT 1AD5A 2RK1A 5LJ3h 3FC3A 1GBQA 4M7AE 1WA7A 1D3UB 3P8HA 3HHTB 4HCCA 4KRDB 1KQSS 4BCIB 1X6BA 1Q7YR 2I0NA 1PD0A 1B7TA 3HB9A 1MNDA 4BBRM 4M78D 4PLLA 2ENMA 3PT9A 2BZ8A 2D0QB 2COYA 3CCRQ 2F2WA 3TNWB 4Z6YA 3BY7A 4EOMB 1VQKA 4EOLB 1NYGA 3GLXA 3LQ5B 1TUCA 4EPCA 2C5NB 3CCSA 1M1GA 3MP6A 5IH2A 1NLPC 2OI3A 5LJ3f 1M2OA 1NEBA 2K5LA 2XDPA 1XNIA 3X20B 5FRNA 3DL1A 4FU6A 2A08A 5GAMf 3L2ZA 1UECA 4J7IA 1S1NA 1H1RB 2Y4XA 3O5ZA 2E12A 2DD5B 4C92E 4ESRA 2EAYA 3CCLQ 2RQRA 4DOWA 3RBBB 4MZPA 4OR5B 1VQ7A 2KQWA 2QEXQ 5IXBA 4CC3A 1G8XA 3PIOA 2RHYA 1W4SA 4BE1A 2A36A 3VS2A 4XU0A 1KQ1A 1OU8A 2DK3A 1VQPT 4JLIA 1K9AA 3BW1A 2CP5A 5GAMg 4XU3A 1FVVB 3JCMW 2EWNA 2DYBA 3SD4A 3A8OB 1U06A 3JCMe 4HL4A 3CC7Q 1ZBXA 2A0FB 1SEMA 2KT8A 2MWOA 2ZAEA 5HQ0B 2ESWA 2EQIA 4JRQA 3F70A 2LCCA 1VQKT 2JTMA 1CKBA 5GANf 1QLYA 3CCST 4ZTFA 4GBQA 1QWEA 1OKWB 2RJDA 3WXMB 2J06A 1YIJQ 4CFMB 2IPOB 1R77A 3KXTA 2RD1A 4M77E 2P0PA 1TU0B 2RJCA 1RAFB 3QXEB 2LT4A 1QKXA 4PKCC 2DL5A 2EYWA 2KY9A 2FZGB 1ABOA 4LE9A 4BCKB 3VS4A 4F7JB 4F70B 3LH0A 4MDXA 1F1BB 2DJZA 1XOVA 4OB3B 4F04B 4BCNB 1FYNA 2LMJA 4FYXB 1YP5A 1KQSP
chains in the Genus database with same CATH topology
3VUZA 5FROA 4M78C 3OYGA 3BG3A 3MHXA 5GMKl 2DD4B 2EQMA 4A54A 3OYFA 4OVAA 1VQLT 3CD6T 1H3ZA 4IUUA 5A0LA 5KH6A 5DM7R 3KHIA 1YCYA 2F69A 2LRQA 3VYGA 1AHJB 3WVEB 1MHNA 4UC4A 4NOYA 3G71T 1H641 3NFCA 2E41A 2XD0A 3CC7A 2GF7A 1K73C 1V29B 2CZ7B 2EJFA 4M78A 3J7AF 2R5MA 3QYHB 3L2UA 4EDUA 2OAUA 5M9OA 3ZBDA 5LJ3j 1YJWT 2DXCB 4EMKA 5GANh 1IREB 2HQEA 1Y96B 3BDLA 5GAOn 2R5AA 1I5LA 1JJ2S 4PJOD 4FIBA 4M77G 3C95A 2ZPBB 2X35A 3CCMA 1VQ4A 3OW2S 1VQOA 1FX7A 3QDRB 4LDWA 1M9SA 3RUXA 1M5Q1 4NS5A 4JS4A 4DA4A 3CC2T 4EMGA 3E1SA 1VQ6A 2YLCA 1O75A 2G77A 3LLRA 1TH7A 3QG1A 4C8QC 4DQ2A 2WJ9A 3M4YA 3A8LB 2QI2A 4RG2A 1KC8U 3J81E 4ELYC 3X25B 2MAMA 4C92D 2Y4YA 2A3LA 2LNVA 4ELJA 1ZQ1A 3OSVA 3OA6A 3V7RA 4KULA 1N8RU 3OQ5A 4MFDA 1N9RA 4F7UG 3JB9H 1SSFA 2RI2A 3S3OA 3TU4K 2VV5A 3G6EA 2OTJT 4N0AC 1BYMA 4A4KA 3CCUT 2LTOA 4M75E 2MI6A 3CPWS 4JRPA 2VC8A 1BI2A 4HCZA 5IN1A 4A4GA 2EFIA 3CEYA 2LDMA 3CCRT 4IKFA 2G3RA 1I8FA 2XI9A 2KAFA 3MEUA 5FU6B 2HNIA 4BD3A 5GAMd 1YI2A 3UPUA 2RK2A 2PQWA 2RM4A 5CR2A 2IG0A 4ZGEB 3HRUA 1WJQA 3J80E 3Q1JA 3JCMb 3LW5E 3CMEA 3META 1RL2A 3QBYA 3DLLA 4QSHA 2WSFE 2JNGA 4BI8B 4MZMA 5LJ3d 1VQ5T 3OYMA 1VUBA 4HLQA 3RMQA 5LJ5j 2X4JA 1VQLA 2DXTA 2E5QA 2PUOB 4LOCA 1QP3A 1XTDA 3HKSA 2QXFA 1RI0A 4IUQA 5CKBA 5GANe 2EJ9A 2A7YA 1VQMA 4M77A 2LCLA 4J83A 5CVIA 1Q82U 3TREA 4QVZA 4L59A 3G71A 2K2VA 4QW2A 1YHQT 1UGPB 3OBYA 4FSXA 5D6XA 3CC7T 2QQRA 4C92G 2LVMA 3CCLT 3A8HB 3G7ZA 4RCBA 2DXBB 1G3SA 4QVCA 3JB9G 4M7AF 4TVRA 3RMSA 1WJRA 1ZHIA 4RMOA 2GFAA 4PLIA 4M7AA 3JCMQ 3BFMA 3LGLA 3X24B 3QPHA 4HT9A 3VYHB 4M77D 4M77C 1Q82C 4J8OA 5J3BA 3CCMT 5GAMh 3LGFA 3JCMJ 2DTIA 1VQ4T 1M8VA 4QQ6A 1Q81U 2PVOB 3GP8A 2QFZA 4LD6A 4M75G 5CKFA 5KE2A 3QZ5B 3M55A 4N0AA 3OS0A 4E7HA 3VKIA 1Q7YC 1QVGS 2XKOC 2X4YA 1M1KU 5GAN8 3JCMh 4JJNK 4F7UE 1M90C 3HPWA 3INZA 2QDYB 4ZTJA 3RIRA 2RA2A 4Z02A 2M16A 5KCOA 4MMKA 5HKCA 3I56A 3PMIA 2QQSA 4QVDA 2DKGA 3OYEA 4J6YA 2EQUA 3FEOA 3FJPA 4P5NA 5GAN2 2DXBA 1PSEA 3M4GA 4FL6A 1YBYA 5GMKe 4BDZA 2JZ2A 4LDUA 4B9WA 3GOXA 4XTXA 2F5TX 3EFSA 3CCUA 3SWNB 4BE0A 2BS2A 4IUVA 3HZJA 2PU9B 4M7DD 3CCRA 3OY9A 1YI2T 2FVUA 1QVFS 1KHIA 2EYQA 4MIMA 3PNWC 3H6ZA 2CGHA 3M58A 4D6WA 1VQKT 5IT9E 1QLBA 4XK8E 3QIIA 4Q5WA 4A4HA 3DKMA 4C92A 3CMET 3NTKA 3CXCS 4M7DA 2E1HA 2ZPGB 2I2LA 4RKUE 4BI3A 5LJ3e 3SDZA 2HBPA 4OF1A 3PIPA 4BDYA 1NZ9A 4C0FA 3OW2A 1KC8C 3JCMX 1VQ5A 3QYGB 2WACA 3JB9J 3CBMA 4M7DE 2H3JA 2WSEE 2QF7A 2KSSA 3EFRA 5I2SA 2VGNA 2DVEA 3HO8A 2QQAA 5GMKj 2DD4A 3UDCA 3JCMd 3QJYA 4M7AC 3E19A 4M75D 2CZ6B 1VQMT 5D6WA 2L5QA 2AHJB 4C92C 3VYGB 1U8RA 1BI1A 3SWNA 1G5VA 4ZN1A 2RHXA 1YHQA 4M75B 1VQNT 2P4TA 2DPPB 3CCLA 3DLMA 2PVGB 2QA4A 1X01A 4BY6C 1KQSA 4C8QE 2FHDA 3TEEA 2D6FA 4M78B 3AHUA 4L6V5 3QWLA 5FRMA 4M77F 4M7DB 3UWNA 4BUGA 2QEXA 3LX7A 2WSCE 4XQ3A 3M5AA 1Y96A 1YJNA 2XIDA 3SWNC 4OP0A 2R58A 2XU8A 3OYJA 4GY5A 3P8BB 4BI4A 2YHTA 1YJ9T 1UGQB 2D9TA 2PUKB 4X9CA 3JCMV 3V8LA 5CKDA 2DEQA 3SFMA 1N27A 5DLOA 2XK0A 1LOJA 3MO8A 1LNXA 3WVDB 5AYFA 4EMKC 1UGRB 3A5ZB 1QVPA 2RJEA 3FIFA 4ELZC 3I55A 3CBPA 4M75A 4A4FA 4HA8A 4JX6A 3I56T 2MWPA 2VXEA 3JB9I 4E7JA 1I81A 4C0GA 3JCMP 4M7AD 1K73U 2DTOA 2JUFA 1KG1A 4XTVA 2QQ9A 3RKWA 4RG8A 2GCXA 5GANj 1NJIC 3OSSC 2KMGA 1NE8A 4J6XA 1YIJT 5GAOl 4M78F 4JUVA 3C12A 4MZTA 4HNTA 3ER0A 3OYIA 4Y91A 5L8RE 1FWZA 2OTLA 4J5YA 4EMHA 5GAOm 3OYYA 3C94A 1KHCA 1Y7XA 2BUDA 2FYKA 3CCVA 4NC6A 3CC2A 2QTXA 5GANg 3HFOA 3L42A 3ME9A 5FLXE 3HBLA 4C5HA 1S72T 4CRIA 4JRIA 5HK0A 4M7AE 2E65A 2ZPIB 4R56A 2KMTA 3PGGA 1VQ9T 3JSCA 4A4EA 1M90U 4JX4A 3MP8A 5FU7B 3V8KA 5CKEA 4FT4A 3LYIA 1R8OB 1UGSB 4HNVA 2XICA 3M57A 3S6WA 3CPWA 1D3BB 5LJ5g 1Q81C 1EIFA 4Y28E 2L8DA 3OYCA 4V2SA 3JAME 3HRTA 3QKJA 2KK4A 3TW6A 4XTUA 4M77B 4M7DF 4MFEA 3GF5A 4C92F 1G3WA 1VQNA 3O8VA 4M7AG 2O4XB 2B8AA 2DXUA 1Y71A 3S3MA 2QA4T 1WPYA 1FKMA 3CC4T 1VQ8A 3M53A 4PJOG 4LDYA 5HK3A 5GANd 2QEXT 5FU7C 2FB7A 4N4GA 2P0QA 4M7AB 1BKBA 4HT8A 3VKGA 5CO7A 1YJNT 4F7UA 1QVFA 3GIBA 2E10A 5CAIA 1YJ9A 3G4SA 4L5GA 3CBOA 4M78E 2V8JA 3RESA 4C0ZA 3CMAA 1OI1A 2M1HA 3MEAA 1D3BA 5KCHA 2CS7A 1O9SA 2JVVA 4X34A 2RI5A 2ZZDB 5EG2A 3CCQA 5A2QE 1KD1C 1OZ2A 3EAEA 1X75C 3FB9A 4II1A 2K3XA 3L2QA 4ATOA 3VUBA 3RKXA 3I55T 1JBMA 1DJ7B 1BIAA 2EQKA 2LQ8A 3CPFA 3M9QA 3KBGA 4PJOC 2ZPFB 2O4XA 4WF2A 2E70A 2RJFA 1K8AU 2LQKA 3QZ9B 2M0OA 4MDWA 3ZEHA 2E6NA 4E47A 2CZ1B 4PNOA 2X4WA 5LJ5e 5GAN4 1YIJA 1IZ6A 2XG8D 5J26A 2VGMA 2MF2A 3M56A 2YRVA 1W2BS 3PTAA 5CK9A 4IURA 4AKGA 5A0GA 5LJ3g 2OTLT 3NTIA 4PJOB 2FL7A 5D6YA 3OYNA 2RB6A 1U1TA 4M75C 5CKHA 4C5GA 3JB9D 3CCVT 1N8RC 3A8GB 5CIUA 4OGCA 3JCMg 2ZGWA 3TCJA 2ZZDA 1S72A 4J7FA 1JB0E 2ZPHB 3PMTA 3QJ6A 3FRNA 1PSFA 3GNFB 2DZCA 3T9NA 1W2BA 4OB1B 3RKYA 4ZN3A 5J39A 2VYTA 4XTWA 1NPPA 3HL8A 1U1SA 2YLBA 2RHUA 1BI3A 1OZ3A 1WNLA 2GFUA 2X4XA 4XU1A 4PJOE 2DO3A 4M7DC 3S3NA 3FLGA 3L2WA 2JN0A 4C5EA 5KE3A 2P0KA 2EJGA 3BDUA 4ME7A 2R57A 2NLUA 1KD1U 1KQ2A 4JRKA 2QDJA 4JX5A 1WGSA 1XQHA 4LDXA 2L89A 4N4HA 5LJ5f 3CC4A 4KBMB 2BIVA 4N4IA 1VQ7T 1VQ8T 3CCET 2BS4A 1VQ9A 4XTYA 4MMLA 4E7IA 1M1FA 3GNGA 1WQ7A 4BBSM 3HRSA 2EQJA 3M54A 4KUIA 1X6OA 2CKKA 4X9DA 3G4ST 2E64A 3CMAT 2PVDB 2DAQA 1G3YA 4C0DC 5C0MA 2EKOA 2RK1A 5LJ3h 4C8QF 1QW1A 2DZ9A 3FC3A 1N6AA 3CCJA 3QYBA 4BY6B 5A0DA 3URGA 1M4ZA 3CCQT 3RERA 4FT2A 2E6ZA 3P8HA 2XDDA 3HHTB 4JS5A 4HCCA 4FM4B 4HCBA 1Q86U 1KQSS 3H8ZA 3V7CA 4KUDK 3OYLA 1Y07A 2KDSA 4ZGJB 2MMPA 5GAOq 4E7KA 4F7UF 1VQPA 3E9GA 2DTHA 4C0DB 3HB9A 3LWHA 2IVWA 4BBRM 4M78D 4OB0B 3X26B 3MCAB 1GXIE 3FDRA 4NL2A 2CZ0B 2K5FA 4PLLA 2HQXA 3N5BB 3PT9A 3MEWA 3OBWA 2DXCA 3OMGA 2D0QB 3VU3C 3VKHA 1UB4A 2DD5A 3P8DA 4OGEA 4Z6YA 3BY7A 4PL6A 1JJ2A 2ZCFB 1QP2A 1VQKA 3GLXA 4EPCA 3CCSA 2K4YA 4AI6A 1M1GA 3JRZA 3MP6A 5CQXA 3HFNA 3TW7A 3X28B 3VJPA 5GAMj 1K9MC 2M9UA 2K57A 4OB2B 2VXFA 2JTFA 5C6SA 5LJ3f 2HAXA 5GAMe 2CYZB 2K5LA 2XDPA 3OYAA 2BS3A 1XNIA 3X20B 3L2RA 2C06A 3OYHA 3DL1A 5FRNA 1WQWA 4B9XA 1HXDA 4FU6A 4BACA 1HK9A 5GAMf 1YITA 3L2ZA 2LT1A 2JOYA 4J7IA 2Y4XA 1P92A 5HY6A 2RO0A 5LJ5h 3BG9A 3LWIA 2E12A 2DD5B 4AKHA 4C92E 2EAYA 4DOWA 3SB2A 3HSBA 4M78G 4MZPA 5GAN6 3V7SA 2XHCA 2XDBA 2L3RA 1FXXA 3ZFJA 3CCEA 1N9SA 1VQ7A 2Y90A 2KQWA 2VUBA 2DIGA 4M6VA 1QVGA 4DOVA 3BG5A 4M75F 3OB9A 4VUBA 1E7PA 4F7UB 2V8IA 4IUPA 3CXCA 5GAOp 4C8QD 2KVQG 3UT1A 3PIOA 2RHYA 2F5KA 1LJOA 4XTZA 1W4SA 5DY9A 5LL6S 3CCJT 2K5IA 4BE1A 4O6JA 4RCCA 4ZGDB 5FU6C 3CD6A 3OMCA 4A53A 3QUIA 2EIFA 3QYEA 1BI0A 2RHIA 3R6OA 4XU0A 1KQ1A 5IAYA 2DK3A 1VQPT 4JLIA 4QQGA 2HD0A 3BW1A 3M59A 2LC4A 5GAMg 2ZPEB 4XU3A 3NTHA 3JCMW 2EWNA 4J6WA 4KT0E 1VIFA 1K9MU 3SD4A 4M7DG 3A8OB 4GLKA 4C5IA 3JCMe 4HL4A 1UEBA 3E9FA 4HNUA 5CQYA 4C8QA 1ZBXA 5CCAA 5LJ5d 1K8AC 4IUTA 5GAN7 2V8KA 2K3YA 3HP9A 1YJWA 2MWOA 2O01E 3PFSA 5GAN3 3JB9F 4PJOA 2QQ8A 3OS2A 4AKIA 4JRQA 3F70A 2LCCA 4PJOF 5GAOr 2JTMA 3ASKA 4CI0C 3OYKA 1MGQA 5GANf 4ZTFA 5GMKi 3CCST 1G3TA 1B34B 2QQBA 1VQOT 3L1AA 4E7LA 4R55A 1VQ6T 4QQDA 1BIBA 2RJDA 3WXMB 4HKEA 3DB4A 4JDSA 2GQVA 5I2MA 2RHZA 3KXTA 3OYBA 2RD1A 4M77E 2P0PA 4NL3A 3QHSA 2RJCA 4BE2A 1OYXA 3GPLA 3OS1A 3QSUA 3QXEB 2LT4A 4PKCC 1YITT 4C8QB 3H4CA 3OYDA 3JCMc 4JLGA 2KY9A 3G6ET 2OTJA 2DIQA 5GMKh 2RH2A 4YTLA 2KR6A 3C4SA 3MEVA 1JRIA 3VV0A 1WJSA 2BKDN 1M1KC 3A8MB 4LDVA 5GAN5 1Q7YU 1I4K1 3QO3A 3LH0A 1B34A 1NPRA 1NJIU 2RI3A 3V8JA 2LX9A 3MP1A 3KUFA 4O5VA 3JCMf 4MDXA 4C92B 1VIEA 3L2VA 4XU2A 3DB3A 2DJZA 5DLQE 5I21A 4LD9K 4EMKB 1XOVA 4C8QG 4OB3B 1Q86C 5EJCA 3OS5A 4OMFB 4XAXB 5GMKm 4BB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  1QP2 A;  2DD4 B;  2DXB A;  1PSE A;  3X28 B;  4OB2 B;  3VYG A;  1AHJ B;  3WVE B;  2PU9 B;  2CYZ B;  3X20 B;  1V29 B;  2CZ7 B;  4XK8 E;  2ZZD B;  3QYH B;  2ZPG B;  2DXC B;  4RKU E;  1DJ7 B;  1IRE B;  2DD5 B;  2ZPF B;  3QYG B;  2ZPB B;  3QZ9 B;  2WSE E;  2CZ1 B;  2DD4 A;  2CZ6 B;  2AHJ B;  3A8L B;  3VYG B;  3X25 B;  2DPP B;  2PVG B;  3A8G B;  4ZGD B;  2ZZD A;  4L6V 5;  1JB0 E;  2ZPH B;  1PSF A;  2WSC E;  2ZPE B;  4OB1 B;  1UGQ B;  4KT0 E;  2PUK B;  3A8O B;  4ZGE B;  3LW5 E;  3WVD B;  1UGR B;  2WSF E;  2O01 E;  2PUO B;  1QP3 A;  5L8R E;  2PVD B;  1UGP B;  3A8H B;  2DXB B;  3QXE B;  3HHT B;  4FM4 B;  2ZPI B;  3X24 B;  4ZGJ B;  3VYH B;  3A8M B;  1UGS B;  2PVO B;  4OB0 B;  3X26 B;  4Y28 E;  3QZ5 B;  1GXI E;  2CZ0 B;  2DXC A;  2D0Q B;  2QDY B;  4OB3 B;  2DD5 A; 
#chains in the Genus database with same CATH topology
 3NDQ A;  4M78 C;  5FRO A;  2DD4 B;  2FPD A;  3OYF A;  1H3Z A;  1VQL Q;  1R0C B;  1E9H B;  3KHI A;  3VYG A;  2RMO A;  1ARK A;  1WIE A;  3NFC A;  2XD0 A;  3R6N A;  2CZ7 B;  4BCF B;  2LZ6 B;  3J7A F;  2R5M A;  3QYH B;  4EDU A;  1UNL D;  1WXB A;  1VQ8 Q;  2COW A;  3BDL A;  5GAO n;  1UJ0 A;  4FIB A;  1MV0 B;  2HSP A;  2ZPB B;  5I5Z B;  5KYW B;  2X35 A;  4F7N B;  3QDR B;  2X3W D;  4JS4 A;  4DA4 A;  4FW1 A;  1M5Q 1;  3CC2 T;  4EMG A;  1ZSZ C;  4C8Q C;  1TH7 A;  2WJ9 A;  3M4Y A;  3A8L B;  4RG2 A;  3M03 A;  2LX7 A;  3M0S A;  3K7A M;  4OMM A;  2LNV A;  4ELJ A;  1ZQ1 A;  3OA6 A;  4KUL A;  3OQ5 A;  1VYV A;  1SSF A;  4YOZ A;  2X1N B;  5IN1 A;  4HCZ A;  2EFI A;  2LDM A;  3CCR T;  1I8F A;  5FU6 B;  2KAF A;  1VYW B;  2RK2 A;  1AWO A;  2BTT A;  3J80 E;  3CME A;  4QSH A;  2W0Z A;  3EFO A;  1JJ2 P;  2BPM B;  1NLO C;  2MPX C;  2E5Q A;  2PUO B;  4LOC A;  4HCB A;  5GAN e;  4F6W B;  2A7Y A;  1VQM A;  2CUB A;  4M77 A;  2LCL A;  4F16 A;  4QVZ A;  4DBH A;  3OBY A;  1JKW A;  4FSS A;  3CCL T;  4E6R A;  4RCB A;  3RMS A;  1ZHI A;  3JCM Q;  3QPH A;  2JM8 A;  3JCM J;  2DTI A;  1IHW A;  1QCN A;  1WI7 A;  2PVO B;  2QFZ A;  3OS0 A;  3M55 A;  2SEM A;  2XKO C;  3HPW A;  2QDY B;  4ZTJ A;  1N5Z A;  2RA2 A;  2D1X A;  5KCO A;  3PO3 S;  3I56 A;  2DKG A;  2D8H A;  4YC3 B;  2EQU A;  4FL6 A;  3M4G A;  2DBK A;  3GOX A;  4LDU A;  4WTO B;  3GTM S;  4IUV A;  3HZJ A;  2WMA B;  3CCR A;  1QVF S;  4MIM A;  2CGH A;  3U23 A;  1BCM A;  2RNA A;  3CXC S;  2E1H A;  4JJB A;  2COZ A;  5LJ3 e;  1N8R R;  3QHR B;  1KC8 C;  1VQ9 A;  2CSI A;  3EID B;  2WAC A;  3HO8 A;  4M7A C;  3E19 A;  2WEV B;  2DL7 A;  1VQM T;  2AHJ B;  2FRW A;  2BE7 D;  1YJN Q;  3RR6 A;  2F2V A;  1G5V A;  2P4T A;  3CCJ Q;  2HQH A;  2PVG B;  4M78 B;  5FRM A;  1PG5 B;  2QEX A;  1I1J A;  4XQ3 A;  3M5A A;  1Y96 A;  1C1A A;  5KYW A;  2D9T A;  1SRL A;  2DEQ A;  1SRM A;  2C0I A;  1N27 A;  2L3P A;  3EG9 A;  2JXB A;  4CFW B;  3I55 A;  4M75 A;  4A4F A;  3CCV Q;  1VYU A;  4E7J A;  1KG1 A;  2QQ9 A;  1NJI C;  1ABQ A;  2KMG A;  2WFY B;  3C12 A;  1GCQ A;  3ER0 A;  4Y91 A;  5L8R E;  1FWZ A;  3M0U A;  4J5Y A;  4EMH A;  3C94 A;  1Y7X A;  1QMZ B;  3TSZ A;  5KYN A;  1S72 T;  3ME9 A;  1HYO A;  2MIO A;  4RTW A;  1SF9 A;  3EG9 B;  5HK0 A;  2ZPI B;  1OKV B;  2QGG A;  1TSF A;  5FU7 B;  4FT4 A;  2GBQ A;  3LYI A;  3M57 A;  2XIC A;  3S6W A;  3CPW A;  4LUE A;  1D3B B;  2UZL B;  3OYC A;  2ROT A;  2KK4 A;  2WIH B;  4R0K A;  2KXC A;  4MFE A;  3GF5 A;  1G3W A;  4M7A G;  2O4X B;  2B8A A;  1JU5 C;  2QA4 T;  4KH0 B;  1FKM A;  4ROE A;  1RAA B;  2VB6 A;  1H1P B;  4PJO G;  4LDY A;  4QT7 A;  1VA7 A;  2FB7 A;  5FU7 C;  2P0Q A;  4HT8 A;  5CO7 A;  5GJV B;  1PKS A;  4F7U A;  1X43 A;  3CBO A;  4IIO A;  1OI1 A;  2M1H A;  4BCM B;  4II1 A;  5L23 A;  4ATO A;  1IGQ A;  4OML A;  2EKH A;  4WF2 A;  3QZ9 B;  2M0O A;  1QQJ A;  2E6N A;  5GAN 4;  4PJN A;  1P5E B;  2XG8 D;  2VVK A;  1AD6 A;  2YRV A;  3RDV A;  1W2B S;  2OTL Q;  3PTA A;  5A0G A;  2KE9 A;  2X9H A;  1YI2 Q;  3JB9 D;  1WHM A;  3A8G B;  2EPD A;  4OGC A;  5CIU A;  1D1A A;  3JCM g;  1S72 A;  3RGF B;  4J7F A;  1NYF A;  3PMT A;  1MMD A;  2HCK A;  1KFZ A;  1PSF A;  2DRK A;  2GQI A;  3RKY A;  4ZN3 A;  2G9X B;  2VYT A;  1NPP A;  2YLB A;  2RHU A;  4DBQ A;  1W6X A;  4UN0 A;  3FLG A;  1WZO A;  2P0K A;  2EJG A;  2E3H A;  2QYZ A;  4JRK A;  1VQ9 Q;  1Y0M A;  1XQH A;  2DLP A;  4LDX A;  5LJ5 f;  4N4I A;  3PVQ A;  3EGD A;  3M54 A;  4KUI A;  2DL4 A;  1X6O A;  2PVD B;  1QCO A;  1GBR A;  1G3Y A;  5C0M A;  2FPE A;  4C8Q F;  2DZ9 A;  3CCJ A;  5A0D A;  4BY6 B;  3URG A;  1M4Z A;  3RER A;  4FT2 A;  1VOL A;  1RAG B;  4FM4 B;  1Q86 U;  3DOG B;  1RLP C;  2KDS A;  4ZGJ B;  4ORZ A;  4E7K A;  1D1C A;  1CKA A;  4RTV A;  2IVW A;  2J05 A;  3EH2 A;  4JPB W;  2K7A A;  1V1C A;  2DXC A;  1HJD A;  1K4U S;  5DQW A;  3OMG A;  1YCS B;  3VKH A;  1TG0 A;  1GUX B;  4OGE A;  1OU9 A;  3CXC P;  1JOW A;  1QP2 A;  3X28 B;  4OB2 B;  5FGK B;  1NM7 A;  5C6S A;  2HAX A;  2CYZ B;  3OYA A;  2BS3 A;  4BAC A;  1SKU B;  4CFV B;  5LJ5 h;  2RO0 A;  3HSB A;  3V7S A;  4PFZ A;  4K11 A;  1NBE B;  2P4R A;  1QVG A;  4DOV A;  3TNH B;  2NWM A;  2V8I A;  3CXC A;  3UT1 A;  2JJ9 A;  1EFN A;  1TTH B;  3CCJ T;  2K5I A;  1YFN A;  5FU6 C;  1KSW A;  3CD6 A;  1C0M A;  3QUI A;  3QYE A;  3DDP B;  3R6O A;  5IAY A;  3M59 A;  1VIF A;  3DJB A;  4GLK A;  3E9F A;  4FYV B;  4C8Q A;  5LJ5 d;  1K8A C;  2JMA A;  4IUT A;  2V8K A;  1IXD A;  2K3Y A;  1TWB A;  3EG1 A;  4BXX X;  3PFS A;  2O01 E;  1I5O B;  2YRD A;  4PJO F;  3ASK A;  1MGQ A;  2DA9 A;  2FZK B;  1VQO T;  1VQ6 T;  2CSQ A;  4QQD A;  1QVF P;  4HKE A;  3DB4 A;  2J7I A;  2DF6 A;  2YDL A;  3OYB A;  4BE2 A;  4EOJ B;  2ECZ A;  1M90 R;  4C8Q B;  4ROD A;  1RAB B;  2RPN A;  2NUT B;  1W70 A;  2OTJ A;  2DIQ A;  3VS7 A;  5GMK h;  2RH2 A;  3AT1 B;  3MEV A;  3TNI B;  1FMW A;  2L0A A;  2YT6 A;  4M4Z A;  1I4K 1;  3QO3 A;  1B34 A;  3G1J A;  2RI3 A;  2LX9 A;  4C92 B;  1VIE A;  2QGF B;  4BCP B;  5LMK B;  3DB3 A;  1GFC A;  4EIK A;  1C9B A;  3OS5 A;  4FX3 B;  2AK5 A;  1NG2 A;  4XAX B;  2EUF A;  5GMK m;  2KRS A;  1B07 A;  4RTX A;  1VQL T;  3CD6 T;  4OVA A;  1NEG A;  5A0L A;  2FEI A;  5DM7 R;  2F69 A;  1I07 A;  1PRL C;  2DIL A;  2KI7 A;  3G33 B;  1MMG A;  1O9K A;  4NOY A;  1H64 1;  2E41 A;  1ZUY A;  2GF7 A;  1K73 C;  2EJF A;  2W99 A;  3O0G D;  2L3S A;  5IHN A;  1YJW T;  5GAN h;  1I5L A;  1JJ2 S;  5CYI B;  1C6V X;  4M77 G;  1GUX A;  3ZL7 C;  1VQ4 A;  4LDW A;  1M9S A;  5KYY B;  1D0Z A;  4JJD A;  1VYT A;  3E1S A;  1MMA A;  2YLC A;  4GLM A;  3QG1 A;  4DQ2 A;  1JXO A;  1KC8 U;  2DX1 A;  1E6G A;  2PK2 A;  2MAM A;  4LN2 A;  2Y4Y A;  2A3L A;  1LPL A;  4MFD A;  3CME Q;  3JB9 H;  3G6E A;  2LTO A;  4M75 E;  2MI6 A;  4JRP A;  4HVU A;  4BY7 X;  3NHN A;  4IKF A;  2HNI A;  5KYY A;  2RM4 A;  1PM3 A;  2WIP B;  4Y72 B;  3NPF A;  3BLQ B;  4ROC A;  2JNG A;  1X2Q A;  1PKT A;  5LJ3 d;  1AT1 B;  2WXV B;  2I53 A;  1IRX A;  5LJ5 j;  1VQL A;  2NYS A;  5CKB A;  1I0C A;  4FYY B;  5CVI A;  2YUN A;  3TRE A;  3VRZ A;  3TN8 B;  4L59 A;  1UGP B;  2NUP A;  4FSX A;  5D6X A;  2QQR A;  4C92 G;  3G7Z A;  2DXB B;  1WJR A;  2DER A;  2CUD A;  4PLI A;  5HVY B;  4RMO A;  4M7A A;  3VYH B;  4M77 D;  1Q82 C;  3I56 Q;  3LGF A;  1Q95 G;  4QQ6 A;  1ENW A;  2K2M A;  4N0A A;  2KYB A;  1FMV A;  2PMI B;  4F7U E;  4FCY A;  2JGZ B;  2JTE A;  1BU2 A;  3RIR A;  2M16 A;  4HVW A;  1Z9Q A;  5HKC A;  1FMK A;  3PMI A;  1ZA2 B;  3OYE A;  3FEO A;  2HSE B;  1MNE A;  4EON B;  2JZ2 A;  4XTX A;  2F5T X;  3H0H A;  3CCU A;  5D7U A;  3BLH B;  2BS2 A;  3ULR B;  3VS6 A;  3PNW C;  3H6Z A;  4FYW B;  4RTY A;  4C92 A;  4PFP A;  5I11 A;  4RKU E;  4BI3 A;  1VQ5 A;  2OTJ Q;  3OW2 A;  4C0F A;  3JCM X;  3QYG B;  5KYU B;  2H3J A;  2WSE E;  5GMK j;  1GFD A;  2LW4 A;  2W2H A;  3SWN A;  1TOV A;  1SG5 A;  4ZN1 A;  4KGZ B;  2DPP B;  5IDN B;  3DLM A;  1X01 A;  3C0C A;  1KQS A;  2D6F A;  2X3X D;  4L6V 5;  3QWL A;  4CFN B;  3LX7 A;  2O31 A;  1ZUU A;  5AT1 B;  5HBJ B;  1YJ9 T;  2PUK B;  3JCM V;  2OAW A;  1TS9 A;  3UA7 A;  5DLO A;  1OX9 A;  4OMO A;  3CD6 Q;  2V26 A;  2K79 A;  1RLQ C;  3RNJ A;  4ELZ C;  2P84 A;  4HA8 A;  3JB9 I;  4M7A D;  1I81 A;  2DTO A;  3RKW A;  1RI9 A;  2GCX A;  3OSS C;  5GAO l;  4JUV A;  1WDX A;  2OTL A;  4AMC A;  1H25 B;  2FYK A;  2AIR B;  4BY1 X;  1YIT Q;  1WYX A;  2PNI A;  3HFO A;  3L42 A;  3M0Q A;  4C5H A;  4CRI A;  3OW2 P;  2KMT A;  2VAS A;  3IQL A;  1HD3 A;  1M90 U;  3UAT A;  2JW4 A;  5LJ5 g;  1TFB A;  1G3N C;  1IGU A;  4V2S A;  3QKJ A;  1OIU B;  2EW3 A;  4M77 B;  4M7D F;  3MY1 B;  2ATC B;  4PJL A;  1WHL A;  2FG0 A;  4OMQ A;  2QA4 Q;  1UHC A;  3M53 A;  2OJ2 A;  4N4G A;  1W1F A;  1YJN T;  3GIB A;  3G4S A;  3RES A;  4C0Z A;  4M78 E;  1PD1 A;  1D0Y A;  4Z8A A;  2CS7 A;  2JVV A;  3CCQ A;  1KD1 C;  2EGA A;  2KGT A;  4CRL B;  4PJO C;  2QAZ A;  2RQV A;  3KBG A;  2O4X A;  2RJF A;  2LNH B;  2LQK A;  3EOC B;  4E7S A;  1JST B;  1M2V A;  3B57 A;  1YIJ A;  1QMC A;  2HL3 A;  2DJQ A;  4PJO B;  2K6D A;  2FL7 A;  3OYN A;  2RB6 A;  4C5G A;  5CKH A;  3CCV T;  4KRC B;  2AZV A;  1N8R C;  3QDF A;  2GTO A;  4EOQ B;  5EC7 A;  2ZGW A;  1SSH A;  2ZZD A;  3TCJ A;  5IHI A;  1JB0 E;  2R7G A;  3EGD B;  3QJ6 A;  3FRN A;  4F14 A;  2DZC A;  4OB1 B;  1WFW A;  2HL5 C;  3M0P A;  4XU1 A;  3VS1 A;  3H41 A;  4PJO E;  3BHT B;  1S72 Q;  4HXJ A;  2XMF A;  2C0T A;  5KE3 A;  1KD1 U;  4ANJ A;  5HNB B;  2L89 A;  2IW9 B;  3CC4 A;  1VQ7 T;  2C6T B;  2A28 A;  4CC7 A;  4LUD A;  4BCN D;  4E7I A;  1M1F A;  2EQJ A;  2ED0 A;  4C0D C;  2F2C A;  4ZNX A;  2DL8 A;  3CCQ T;  1N6A A;  5EFQ B;  2E6Z A;  4JS5 A;  4KUD K;  3TQ7 P;  1NJI R;  2MMP A;  5GAO q;  1VQP A;  1TD6 A;  3E9G A;  2DTH A;  4C0D B;  1UHF A;  4OB0 B;  3X26 B;  1GXI E;  3FDR A;  4NL2 A;  2HQX A;  3N5B B;  3MKD A;  1OI9 B;  2HBW A;  2OX7 A;  3VU3 C;  1UB4 A;  4AFU C;  5IDP B;  4PL6 A;  2FPF A;  2K4Y A;  1K9M C;  3HFN A;  3TW7 A;  1WX6 A;  5GAM j;  4D8D A;  4EC9 B;  4F17 A;  3L2R A;  3OYH A;  1WQW A;  4KH1 B;  4B9X A;  1HK9 A;  2I40 B;  3MJX A;  1YIT A;  1P92 A;  2LQN A;  5HY6 A;  3BG9 A;  4CFU D;  1SPK A;  4F7L B;  3CCU Q;  3SB2 A;  2XHC A;  3QHW B;  2L3R A;  4J9F A;  3CCE A;  1MUZ A;  3CPW P;  1UGV A;  1AEY A;  2DIG A;  2B86 A;  2WHB B;  3OB9 A;  4VUB A;  3EFO B;  4IUP A;  1UTI A;  5GAO p;  4C8Q D;  3EG0 A;  1H8K A;  2F5K A;  1LJO A;  1R0B G;  3E2U A;  4XTZ A;  4BCJ B;  5DY9 A;  5LL6 S;  1AOJ A;  1JSU B;  3OMC A;  1OX8 A;  4A53 A;  2EIF A;  1BI0 A;  1WHH A;  2RHI A;  1AZG B;  2DBM A;  4QQG A;  2HD0 A;  2ZPE B;  3NTH A;  2NUP B;  1YJ9 Q;  4J6W A;  4KT0 E;  1K9M U;  4M7D G;  2QAS A;  1RAD B;  4C5I A;  1OV3 A;  5CQY A;  5CCA A;  1ZX6 A;  1QKW A;  3JB9 F;  4PJO A;  1M27 C;  1XJW B;  3OS2 A;  4AKI A;  4E2F B;  2AT1 B;  5GAO r;  3OYK A;  5GMK i;  1B34 B;  2QQB A;  2IW8 B;  2ROL A;  3SEM A;  1Q82 R;  4R55 A;  3H0F A;  2C5X B;  4OMP A;  4JDS A;  1SHG A;  2RHZ A;  4PJM A;  4CC2 A;  1M3B A;  3I9Q A;  2AZS A;  2V1R A;  1D1B A;  4NL3 A;  3QHS A;  4BCH B;  2AKK A;  3OS1 A;  3QSU A;  1H27 B;  1YIT T;  1X69 A;  3OYD A;  2DRM A;  3JCM c;  4JLG A;  1Q81 R;  2EBP A;  2HMA A;  3C4S A;  1JRI A;  4Z88 A;  4LDV A;  1UDL A;  3JCM f;  2YXY A;  3KUF A;  4XU2 A;  3MI9 B;  3THK A;  5I21 A;  4EMK B;  4C8Q G;  2UZB B;  2J6K A;  4PJJ A;  2EYZ A;  3OYG A;  2C5O B;  3MHX A;  5GMK l;  2CP3 A;  1MMN A;  4J9D A;  1WHG A;  1AHJ B;  3WVE B;  2CH4 A;  2DME A;  4AG2 C;  1MHN A;  3CCM Q;  1OUL A;  4EOS B;  3VS5 A;  3EGU A;  2VKN A;  4M78 A;  1TUG B;  3TSW A;  2VWF A;  4AFQ C;  5M9O A;  1YJW Q;  3ZBD A;  1A0N B;  5LJ3 j;  2DXC B;  4EMK A;  1IRE B;  2HQE A;  1Y96 B;  3REB B;  4PJO D;  2R5A A;  1TXQ A;  3C95 A;  3OW2 S;  3RUX A;  4NS5 A;  6AT1 B;  1O75 A;  2PHG A;  2QI2 A;  9ATC B;  3J81 E;  3X25 B;  1X6G A;  1GCP A;  4C92 D;  4ELL A;  3OSV A;  3V7R A;  1N8R U;  1VQ4 Q;  1VQO Q;  1YWO A;  2RI2 A;  1M30 A;  3TU4 K;  2VV5 A;  3S3O A;  2DM1 A;  4N0A C;  4J9C A;  2PZ1 A;  3CPW S;  2G3R A;  2XI9 A;  3MEU A;  2DL3 A;  2IG0 A;  4ZGE B;  1JO8 A;  3Q1J A;  3MET A;  1RL2 A;  3QBY A;  1X2K A;  2WSF E;  3CQT A;  3NMZ C;  1VUB A;  3RMQ A;  4RUG A;  2DXT A;  1YWP A;  1ACM B;  5IHY A;  4LXC A;  4J83 A;  3QWY A;  2QK0 A;  1GY3 B;  1Q82 U;  1ZLM A;  2K2V A;  4QW2 A;  1YHQ T;  2LVM A;  3NGP A;  3A8H B;  1E7O A;  4HCK A;  2W10 A;  4TVR A;  2IW6 B;  4EC8 B;  3LGL A;  2F2X A;  4F6U B;  4HT9 A;  4M77 C;  2PJQ A;  4J8O A;  5J3B A;  1M8V A;  5ACB A;  5FW9 A;  4LD6 A;  5CKF A;  5KE2 A;  3CC2 A;  3QZ5 B;  2X51 A;  4E7H A;  1WXT A;  1Q7Y C;  1QVG S;  2X4Y A;  1M1K U;  3JCM h;  1M90 C;  1ZA1 B;  2HDA A;  2BKZ B;  4IIM A;  4MMK A;  2C5V B;  1M2V B;  3A1P A;  4CC4 B;  2DXB A;  3MY5 B;  5GMK e;  1H3H A;  4BDZ A;  1PNJ A;  2HZY A;  3SWN B;  4BE0 A;  4CFU B;  3VS0 A;  3OY9 A;  1WHK A;  1KHI A;  1ZBJ A;  2CRE A;  5IT9 E;  1T0J A;  1QLB A;  4F7S B;  1E6H A;  4RTT A;  4XK8 E;  4A4H A;  3CME T;  4M7D A;  2ZPG B;  4NST B;  1UFF A;  4BDY A;  1H24 B;  4M7D E;  3JB9 J;  1X27 A;  3EFR A;  3UDC A;  3JCM d;  3QJY A;  4M75 D;  2L5Q A;  3I5R A;  4JJC A;  2W9Z A;  3VYG B;  1JQQ A;  1BI1 A;  4DEY A;  2CT4 A;  2RHX A;  1YHQ A;  4M75 B;  1VQN T;  1BK2 A;  3CCL A;  2QA4 A;  2FHD A;  2YUQ A;  2FO0 A;  3CCE Q;  2GGR A;  4M77 F;  4M7D B;  4BUG A;  2WSC E;  4QKU A;  2H8H A;  1K8A R;  2XID A;  5HBE B;  3OYJ A;  4GY5 A;  3P8B B;  4BI4 A;  2YHT A;  1AWJ A;  2BZX A;  2YUO A;  5CKD A;  2QDL A;  1GCQ C;  2XK0 A;  1LOJ A;  3MO8 A;  1LNX A;  2GTJ A;  1UGR B;  4EMK C;  4KGV B;  3CBP A;  4JX6 A;  3I56 T;  2MWP A;  2VXE A;  1BCO A;  4C0G A;  4DBF A;  3JCM P;  3POM A;  2JUF A;  4XTV A;  1HSQ A;  4RG8 A;  3F5X B;  3H0I A;  1NE8 A;  4J6X A;  4M78 F;  1KK7 A;  2V1Q A;  4MZT A;  4HNT A;  2CP2 A;  2DE0 X;  2LJ0 A;  1QCF A;  5GAO m;  3OYY A;  2EYY A;  2FRY A;  4NC6 A;  5LQF B;  1K1Z A;  5FLX E;  3EGX B;  4JRI A;  2RN8 A;  2RF0 A;  4R56 A;  3PGG A;  1VQ9 T;  4A4E A;  3MP8 A;  3V8K A;  2CP6 A;  1UGS B;  1Q81 C;  1EIF A;  3JAM E;  3HRT A;  1BB9 A;  4C92 F;  1VQN A;  2D8J A;  4J9H A;  4J9E A;  3MPU B;  1Z9Z A;  1OOT A;  1H4L D;  2ED1 A;  5GAN d;  2QEX T;  1D09 B;  1T3L A;  1U5S A;  4RTZ A;  4M7A B;  1K73 R;  1VQM Q;  4BCQ D;  2E10 A;  2HKQ B;  2K9G A;  1GL5 A;  1M3C A;  1D3B A;  1O9S A;  2CP7 A;  5HBH B;  5EG2 A;  2ZZD B;  3EAE A;  1X75 C;  3L2Q A;  2K3X A;  3FJ5 A;  1LCK A;  3RKX A;  3I55 T;  1DJ7 B;  2JS2 A;  2EQK A;  2LQ8 A;  1N4M A;  5FWC A;  2ZPF B;  1PRM C;  3G4S Q;  4MDW A;  3ZEH A;  4E47 A;  2K3B A;  2CZ1 B;  5LJ5 e;  2X4W A;  2CCH B;  5J26 A;  2VGM A;  3M56 A;  5CK9 A;  4AKG A;  1OQK A;  3NTI A;  1UNG D;  5L2W B;  3H9N A;  1OL1 B;  4E7Z A;  3VRY A;  2YRC A;  1CSK A;  3BHU B;  1YN8 A;  2SRC A;  3GNF B;  1WHJ A;  1W2B A;  5J39 A;  1U1S A;  2J6F A;  4D8K A;  1BI3 A;  1WNL A;  2GFU A;  2KXD A;  1M8M A;  2DO3 A;  4M7D C;  3S3N A;  3L2W A;  2L2P A;  2MOX A;  2R57 A;  3EG2 A;  4JX5 A;  1WGS A;  1VOM A;  2HKN A;  4N4H A;  4A63 B;  2BS4 A;  4MML A;  4OMN A;  3GNG A;  4EOI B;  4CFX B;  2E64 A;  2DAQ A;  2EKO A;  3A98 A;  1PHT A;  1QW1 A;  5KYX A;  3QYB A;  1UJY A;  1H1Q B;  1WXU A;  1OPL A;  2XDD A;  3MIA B;  4II5 B;  4WCI A;  3H8Z A;  3V7C A;  2KT1 A;  3REA B;  1Y07 A;  3OYL A;  4F7U F;  4OGR B;  1VQK Q;  2CJM B;  2F1L A;  3LWH A;  1VQ6 Q;  2KBT A;  1U3O A;  3MCA B;  1URC B;  2NUZ A;  1F5Q B;  2GNC A;  2CZ0 B;  2K5F A;  4BCG B;  4EOK B;  3MEW A;  3OBW A;  1EZZ B;  2DD5 A;  3P8D A;  4I3Z B;  1JJ2 A;  2ZCF B;  3KFV A;  1XO2 A;  4AI6 A;  3JRZ A;  5CQX A;  3VJP A;  2IVX A;  2E4H A;  2M9U A;  2K57 A;  1VQ5 Q;  2VXF A;  2ABL A;  1Y57 A;  2E3I A;  2JTF A;  3I35 A;  4X1V A;  1K0S A;  1W98 B;  5GAM e;  1KIK A;  2B9R A;  1VQ7 Q;  2HEQ A;  2CCI B;  2C06 A;  1WLP B;  5ECA A;  1HXD A;  3I5S A;  1KXU A;  2LT1 A;  2JOY A;  3LWI A;  2O9V A;  2KEA A;  4AKH A;  1BBZ A;  1J3T A;  4M78 G;  5GAN 6;  3CC4 Q;  2KRN A;  2XDB A;  2EGE A;  1FXX A;  3ZFJ A;  1N9S A;  1KJW A;  2Y90 A;  2RQW A;  2VUB A;  4M6V A;  3BG5 A;  4M75 F;  1E7P A;  4F7U B;  1KD1 R;  2KVQ G;  2PTK A;  3DTO A;  4JZ4 A;  4PFO A;  1AWW A;  7AT1 B;  2O88 A;  4O6J A;  4RCC A;  4ZGD B;  4TTH A;  1T3S A;  2LC4 A;  1JXM A;  4Z89 A;  1G2B A;  1UEB A;  4HNU A;  2UZE B;  4FW2 A;  5GAN 7;  1FIN B;  3HP9 A;  1RAC B;  1YJW A;  5GAN 3;  2EVR A;  2QQ8 A;  4CI0 C;  2DVJ A;  1G3T A;  3L1A A;  4E7L A;  2V22 B;  3EJ1 B;  1BIB A;  2GQV A;  5I2M A;  3SHW A;  2KRO A;  3I55 Q;  4IMY B;  1OYX A;  2JT4 A;  3GPL A;  1LVK A;  2JMC A;  3H4C A;  3G6E T;  5ICP B;  4BCO B;  4BCQ B;  4YTL A;  2KR6 A;  4YOO A;  3VV0 A;  1M1K C;  1WJS A;  2BKD N;  1O9K B;  3A8M B;  5GAN 5;  1Q7Y U;  2UZD B;  1RAE B;  5HCK A;  2QGS A;  1NPR A;  2YUP A;  1QVG P;  1NJI U;  3V8J A;  2RQT A;  3MP1 A;  4O5V A;  3L2V A;  2O9S A;  1IB8 A;  5DLQ E;  4RTU A;  4LD9 K;  1Q86 C;  5EJC A;  4OMF B;  4BB7 A;  3VUZ A;  3CCQ Q;  3BG3 A;  1OGU B;  2EQM A;  4A54 A;  4BCM D;  2MK5 A;  4IUU A;  5KH6 A;  2NUT A;  1UE9 A;  3EHQ A;  1YCY A;  2LRQ A;  1PKD B;  1V76 A;  3BE3 A;  4UC4 A;  3G71 T;  4J9B A;  3CC7 A;  3TVT A;  3UF4 A;  1V29 B;  2L3Q A;  5CEI B;  1QWF A;  4J9G A;  3L2U A;  2OAU A;  1GRI A;  4CXA B;  4EOO B;  2KRM A;  3CCM A;  2QG9 B;  4KGX B;  1VQO A;  1FX7 A;  1VQ6 A;  4AFS C;  3LH5 A;  2G77 A;  3LLR A;  1UG1 A;  4ELY C;  1GH6 B;  4DBR A;  1N9R A;  4F7U G;  2RQU A;  3DDQ B;  1JEG A;  2OTJ T;  4PK4 A;  1BYM A;  4A4K A;  4KRT A;  2DNU A;  3CCU T;  1UNH D;  2VC8 A;  1BI2 A;  4A4G A;  3CEY A;  1YI2 A;  4BD3 A;  5GAM d;  4EOR B;  3UPU A;  2PQW A;  5CR2 A;  3HRU A;  1WJQ A;  2W9F A;  3EGX A;  2Z0W A;  3JCM b;  3LW5 E;  3DLL A;  4BI8 B;  1ZUK A;  4MZM A;  1VQ5 T;  3OYM A;  2G6F X;  4HLQ A;  2EYX A;  1RAI B;  2X4J A;  4AG1 C;  3HKS A;  1QP3 A;  1XTD A;  4IUQ A;  2QXF A;  1RI0 A;  4F6S B;  2EJ9 A;  1G83 A;  3CMA Q;  3G71 A;  5FWB A;  3CC7 T;  2MYS A;  4QVC A;  4M7A F;  1G3S A;  3JB9 G;  3M0T A;  2MCN A;  2DET A;  2GFA A;  2IIM A;  3BFM A;  3X24 B;  2BE9 B;  1OL2 B;  3CCM T;  5GAM h;  1VQ4 T;  1Q81 U;  3GP8 A;  4M75 G;  2EGC A;  3VKI A;  4DEX A;  5GAN 8;  4JJN K;  3PVL A;  3GBQ A;  3INZ A;  2PK9 B;  4AFZ C;  1K9M R;  1TUD A;  4Z02 A;  2WPA B;  5KYU A;  2DMO A;  2QQS A;  4QVD A;  4J6Y A;  3FJP A;  4P5N A;  5GAN 2;  1PSE A;  4B6M A;  1YBY A;  3M0R A;  4B9W A;  1ZSZ A;  2BZY A;  3EFS A;  3EG3 A;  5DQV A;  1PWT A;  2PU9 B;  4M7D D;  1YI2 T;  2FVU A;  2EYQ A;  3M58 A;  4D6W A;  3QII A;  1UUE A;  4Q5W A;  3DKM A;  2H3E B;  2JM9 A;  3NTK A;  1RAH B;  2I2L A;  1YHQ Q;  3SDZ A;  2HBP A;  4OF1 A;  3PIP A;  1NZ9 A;  3CBM A;  1VIN A;  5I2S A;  2QF7 A;  2KSS A;  2VGN A;  2DVE A;  1K76 A;  2QQA A;  2DD4 A;  3PE0 A;  2CZ6 B;  3JV3 A;  1AIS B;  5D6W A;  1ZSZ B;  4C92 C;  2IN3 A;  1U8R A;  1MV3 A;  2KYM A;  1M3A A;  2CP0 A;  1AZE A;  1IO6 A;  2M0Y A;  1T0H A;  4HVV A;  4BY6 C;  4C8Q E;  4Y92 A;  3TEE A;  3AHU A;  3HTR A;  3BLR B;  3EH1 A;  3UWN A;  1VQP Q;  1AWX A;  1YJN A;  3SWN C;  4OP0 A;  2R58 A;  2XU8 A;  3CC2 Q;  1UGQ B;  1PCX A;  4X9C A;  3V8L A;  3SFM A;  2C4G B;  5AYF A;  3WVD B;  3BHV B;  1QVP A;  2E5K A;  2RJE A;  2YSQ A;  3A5Z B;  3FIF A;  5IHK A;  3CCS Q;  1K73 U;  5IF1 B;  5GAN j;  1YIJ T;  3OYI A;  5IXF A;  1H26 B;  4YOS A;  2FZC B;  4G6L B;  2KR3 A;  1AVZ C;  1KHC A;  2J6O A;  4AT1 B;  1YNZ A;  3QWX X;  1ZSG A;  2BUD A;  3CCV A;  2QTX A;  5GAN g;  3HBL A;  1PC0 A;  2QTV A;  1VQN Q;  2E65 A;  3G6E Q;  3JSC A;  2A37 A;  4JX4 A;  5CKE A;  3D7S B;  1R8O B;  4HNV A;  1RUW A;  2LJ1 A;  4Y28 E;  2L8D A;  2CDT A;  1M1K R;  3TW6 A;  1BU1 A;  4XTU A;  1H28 B;  1ZP2 A;  3O8V A;  2D0N A;  2KNB B;  2DXU A;  2WMB B;  1Y71 A;  2DEU A;  3S3M A;  1IHV A;  2W96 A;  1WPY A;  2LCS A;  1H92 A;  2JS0 A;  3CC4 T;  4J9I A;  1VQ8 A;  5BNJ B;  1Q86 R;  2M51 A;  5HK3 A;  8AT1 B;  2O2O A;  1BKB A;  3VKG A;  2DFU A;  1QVF A;  5CAI A;  1YJ9 A;  4L5G A;  3CMA A;  2V8J A;  2LQW A;  3MEA A;  3G71 Q;  5KCH A;  4X34 A;  2RI5 A;  2LP5 A;  5A2Q E;  1OZ2 A;  1OPK A;  3FB9 A;  2UUE B;  3VUB A;  1JBM A;  4JZ3 A;  3M9Q A;  1BIA A;  3CPF A;  1K8A U;  2E70 A;  1EX4 A;  2YWW A;  2CH4 W;  4PNO A;  3VS3 A;  2CT3 A;  1IZ6 A;  5I22 A;  1D0X A;  3EHR A;  2C0O A;  2MF2 A;  4IUR A;  5LJ3 g;  2OTL T;  2M02 A;  5GJW B;  2DYI A;  1OIY B;  5D6Y A;  1U1T A;  8ATC B;  4M75 C;  2AKL A;  3UA6 A;  1KC8 R;  2LJ3 A;  4LNP A;  2ZPH B;  1H1S B;  4EOP B;  3T9N A;  4XTW A;  3HL8 A;  5KYX B;  1OZ3 A;  2X4X A;  1SHF A;  1B3Q A;  2JN0 A;  4C5E A;  3BDU A;  4ME7 A;  2NLU A;  1KQ2 A;  2QDJ A;  4KBM B;  2BIV A;  1VQ8 T;  3CCE T;  1K0X A;  1OEB A;  4XTY A;  1WQ7 A;  4BBS M;  3HRS A;  1W2B P;  2CKK A;  4X9D A;  3G4S T;  3CMA T;  1AD5 A;  2RK1 A;  5LJ3 h;  3FC3 A;  1GBQ A;  4M7A E;  1WA7 A;  1D3U B;  3P8H A;  3HHT B;  4HCC A;  4KRD B;  1KQS S;  4BCI B;  1X6B A;  1Q7Y R;  2I0N A;  1PD0 A;  1B7T A;  3HB9 A;  1MND A;  4BBR M;  4M78 D;  4PLL A;  2ENM A;  3PT9 A;  2BZ8 A;  2D0Q B;  2COY A;  3CCR Q;  2F2W A;  3TNW B;  4Z6Y A;  3BY7 A;  4EOM B;  1VQK A;  4EOL B;  1NYG A;  3GLX A;  3LQ5 B;  1TUC A;  4EPC A;  2C5N B;  3CCS A;  1M1G A;  3MP6 A;  5IH2 A;  1NLP C;  2OI3 A;  5LJ3 f;  1M2O A;  1NEB A;  2K5L A;  2XDP A;  1XNI A;  3X20 B;  5FRN A;  3DL1 A;  4FU6 A;  2A08 A;  5GAM f;  3L2Z A;  1UEC A;  4J7I A;  1S1N A;  1H1R B;  2Y4X A;  3O5Z A;  2E12 A;  2DD5 B;  4C92 E;  4ESR A;  2EAY A;  3CCL Q;  2RQR A;  4DOW A;  3RBB B;  4MZP A;  4OR5 B;  1VQ7 A;  2KQW A;  2QEX Q;  5IXB A;  4CC3 A;  1G8X A;  3PIO A;  2RHY A;  1W4S A;  4BE1 A;  2A36 A;  3VS2 A;  4XU0 A;  1KQ1 A;  1OU8 A;  2DK3 A;  1VQP T;  4JLI A;  1K9A A;  3BW1 A;  2CP5 A;  5GAM g;  4XU3 A;  1FVV B;  3JCM W;  2EWN A;  2DYB A;  3SD4 A;  3A8O B;  1U06 A;  3JCM e;  4HL4 A;  3CC7 Q;  1ZBX A;  2A0F B;  1SEM A;  2KT8 A;  2MWO A;  2ZAE A;  5HQ0 B;  2ESW A;  2EQI A;  4JRQ A;  3F70 A;  2LCC A;  1VQK T;  2JTM A;  1CKB A;  5GAN f;  1QLY A;  3CCS T;  4ZTF A;  4GBQ A;  1QWE A;  1OKW B;  2RJD A;  3WXM B;  2J06 A;  1YIJ Q;  4CFM B;  2IPO B;  1R77 A;  3KXT A;  2RD1 A;  4M77 E;  2P0P A;  1TU0 B;  2RJC A;  1RAF B;  3QXE B;  2LT4 A;  1QKX A;  4PKC C;  2DL5 A;  2EYW A;  2KY9 A;  2FZG B;  1ABO A;  4LE9 A;  4BCK B;  3VS4 A;  4F7J B;  4F70 B;  3LH0 A;  4MDX A;  1F1B B;  2DJZ A;  1XOV A;  4OB3 B;  4F04 B;  4BCN B;  1FYN A;  2LMJ A;  4FYX B;  1YP5 A;  1KQS P; 
#chains in the Genus database with same CATH homology
 3VUZ A;  5FRO A;  4M78 C;  3OYG A;  3BG3 A;  3MHX A;  5GMK l;  2DD4 B;  2EQM A;  4A54 A;  3OYF A;  4OVA A;  1VQL T;  3CD6 T;  1H3Z A;  4IUU A;  5A0L A;  5KH6 A;  5DM7 R;  3KHI A;  1YCY A;  2F69 A;  2LRQ A;  3VYG A;  1AHJ B;  3WVE B;  1MHN A;  4UC4 A;  4NOY A;  3G71 T;  1H64 1;  3NFC A;  2E41 A;  2XD0 A;  3CC7 A;  2GF7 A;  1K73 C;  1V29 B;  2CZ7 B;  2EJF A;  4M78 A;  3J7A F;  2R5M A;  3QYH B;  3L2U A;  4EDU A;  2OAU A;  5M9O A;  3ZBD A;  5LJ3 j;  1YJW T;  2DXC B;  4EMK A;  5GAN h;  1IRE B;  2HQE A;  1Y96 B;  3BDL A;  5GAO n;  2R5A A;  1I5L A;  1JJ2 S;  4PJO D;  4FIB A;  4M77 G;  3C95 A;  2ZPB B;  2X35 A;  3CCM A;  1VQ4 A;  3OW2 S;  1VQO A;  1FX7 A;  3QDR B;  4LDW A;  1M9S A;  3RUX A;  1M5Q 1;  4NS5 A;  4JS4 A;  4DA4 A;  3CC2 T;  4EMG A;  3E1S A;  1VQ6 A;  2YLC A;  1O75 A;  2G77 A;  3LLR A;  1TH7 A;  3QG1 A;  4C8Q C;  4DQ2 A;  2WJ9 A;  3M4Y A;  3A8L B;  2QI2 A;  4RG2 A;  1KC8 U;  3J81 E;  4ELY C;  3X25 B;  2MAM A;  4C92 D;  2Y4Y A;  2A3L A;  2LNV A;  4ELJ A;  1ZQ1 A;  3OSV A;  3OA6 A;  3V7R A;  4KUL A;  1N8R U;  3OQ5 A;  4MFD A;  1N9R A;  4F7U G;  3JB9 H;  1SSF A;  2RI2 A;  3S3O A;  3TU4 K;  2VV5 A;  3G6E A;  2OTJ T;  4N0A C;  1BYM A;  4A4K A;  3CCU T;  2LTO A;  4M75 E;  2MI6 A;  3CPW S;  4JRP A;  2VC8 A;  1BI2 A;  4HCZ A;  5IN1 A;  4A4G A;  2EFI A;  3CEY A;  2LDM A;  3CCR T;  4IKF A;  2G3R A;  1I8F A;  2XI9 A;  2KAF A;  3MEU A;  5FU6 B;  2HNI A;  4BD3 A;  5GAM d;  1YI2 A;  3UPU A;  2RK2 A;  2PQW A;  2RM4 A;  5CR2 A;  2IG0 A;  4ZGE B;  3HRU A;  1WJQ A;  3J80 E;  3Q1J A;  3JCM b;  3LW5 E;  3CME A;  3MET A;  1RL2 A;  3QBY A;  3DLL A;  4QSH A;  2WSF E;  2JNG A;  4BI8 B;  4MZM A;  5LJ3 d;  1VQ5 T;  3OYM A;  1VUB A;  4HLQ A;  3RMQ A;  5LJ5 j;  2X4J A;  1VQL A;  2DXT A;  2E5Q A;  2PUO B;  4LOC A;  1QP3 A;  1XTD A;  3HKS A;  2QXF A;  1RI0 A;  4IUQ A;  5CKB A;  5GAN e;  2EJ9 A;  2A7Y A;  1VQM A;  4M77 A;  2LCL A;  4J83 A;  5CVI A;  1Q82 U;  3TRE A;  4QVZ A;  4L59 A;  3G71 A;  2K2V A;  4QW2 A;  1YHQ T;  1UGP B;  3OBY A;  4FSX A;  5D6X A;  3CC7 T;  2QQR A;  4C92 G;  2LVM A;  3CCL T;  3A8H B;  3G7Z A;  4RCB A;  2DXB B;  1G3S A;  4QVC A;  3JB9 G;  4M7A F;  4TVR A;  3RMS A;  1WJR A;  1ZHI A;  4RMO A;  2GFA A;  4PLI A;  4M7A A;  3JCM Q;  3BFM A;  3LGL A;  3X24 B;  3QPH A;  4HT9 A;  3VYH B;  4M77 D;  4M77 C;  1Q82 C;  4J8O A;  5J3B A;  3CCM T;  5GAM h;  3LGF A;  3JCM J;  2DTI A;  1VQ4 T;  1M8V A;  4QQ6 A;  1Q81 U;  2PVO B;  3GP8 A;  2QFZ A;  4LD6 A;  4M75 G;  5CKF A;  5KE2 A;  3QZ5 B;  3M55 A;  4N0A A;  3OS0 A;  4E7H A;  3VKI A;  1Q7Y C;  1QVG S;  2XKO C;  2X4Y A;  1M1K U;  5GAN 8;  3JCM h;  4JJN K;  4F7U E;  1M90 C;  3HPW A;  3INZ A;  2QDY B;  4ZTJ A;  3RIR A;  2RA2 A;  4Z02 A;  2M16 A;  5KCO A;  4MMK A;  5HKC A;  3I56 A;  3PMI A;  2QQS A;  4QVD A;  2DKG A;  3OYE A;  4J6Y A;  2EQU A;  3FEO A;  3FJP A;  4P5N A;  5GAN 2;  2DXB A;  1PSE A;  3M4G A;  4FL6 A;  1YBY A;  5GMK e;  4BDZ A;  2JZ2 A;  4LDU A;  4B9W A;  3GOX A;  4XTX A;  2F5T X;  3EFS A;  3CCU A;  3SWN B;  4BE0 A;  2BS2 A;  4IUV A;  3HZJ A;  2PU9 B;  4M7D D;  3CCR A;  3OY9 A;  1YI2 T;  2FVU A;  1QVF S;  1KHI A;  2EYQ A;  4MIM A;  3PNW C;  3H6Z A;  2CGH A;  3M58 A;  4D6W A;  1VQK T;  5IT9 E;  1QLB A;  4XK8 E;  3QII A;  4Q5W A;  4A4H A;  3DKM A;  4C92 A;  3CME T;  3NTK A;  3CXC S;  4M7D A;  2E1H A;  2ZPG B;  2I2L A;  4RKU E;  4BI3 A;  5LJ3 e;  3SDZ A;  2HBP A;  4OF1 A;  3PIP A;  4BDY A;  1NZ9 A;  4C0F A;  3OW2 A;  1KC8 C;  3JCM X;  1VQ5 A;  3QYG B;  2WAC A;  3JB9 J;  3CBM A;  4M7D E;  2H3J A;  2WSE E;  2QF7 A;  2KSS A;  3EFR A;  5I2S A;  2VGN A;  2DVE A;  3HO8 A;  2QQA A;  5GMK j;  2DD4 A;  3UDC A;  3JCM d;  3QJY A;  4M7A C;  3E19 A;  4M75 D;  2CZ6 B;  1VQM T;  5D6W A;  2L5Q A;  2AHJ B;  4C92 C;  3VYG B;  1U8R A;  1BI1 A;  3SWN A;  1G5V A;  4ZN1 A;  2RHX A;  1YHQ A;  4M75 B;  1VQN T;  2P4T A;  2DPP B;  3CCL A;  3DLM A;  2PVG B;  2QA4 A;  1X01 A;  4BY6 C;  1KQS A;  4C8Q E;  2FHD A;  3TEE A;  2D6F A;  4M78 B;  3AHU A;  4L6V 5;  3QWL A;  5FRM A;  4M77 F;  4M7D B;  3UWN A;  4BUG A;  2QEX A;  3LX7 A;  2WSC E;  4XQ3 A;  3M5A A;  1Y96 A;  1YJN A;  2XID A;  3SWN C;  4OP0 A;  2R58 A;  2XU8 A;  3OYJ A;  4GY5 A;  3P8B B;  4BI4 A;  2YHT A;  1YJ9 T;  1UGQ B;  2D9T A;  2PUK B;  4X9C A;  3JCM V;  3V8L A;  5CKD A;  2DEQ A;  3SFM A;  1N27 A;  5DLO A;  2XK0 A;  1LOJ A;  3MO8 A;  1LNX A;  3WVD B;  5AYF A;  4EMK C;  1UGR B;  3A5Z B;  1QVP A;  2RJE A;  3FIF A;  4ELZ C;  3I55 A;  3CBP A;  4M75 A;  4A4F A;  4HA8 A;  4JX6 A;  3I56 T;  2MWP A;  2VXE A;  3JB9 I;  4E7J A;  1I81 A;  4C0G A;  3JCM P;  4M7A D;  1K73 U;  2DTO A;  2JUF A;  1KG1 A;  4XTV A;  2QQ9 A;  3RKW A;  4RG8 A;  2GCX A;  5GAN j;  1NJI C;  3OSS C;  2KMG A;  1NE8 A;  4J6X A;  1YIJ T;  5GAO l;  4M78 F;  4JUV A;  3C12 A;  4MZT A;  4HNT A;  3ER0 A;  3OYI A;  4Y91 A;  5L8R E;  1FWZ A;  2OTL A;  4J5Y A;  4EMH A;  5GAO m;  3OYY A;  3C94 A;  1KHC A;  1Y7X A;  2BUD A;  2FYK A;  3CCV A;  4NC6 A;  3CC2 A;  2QTX A;  5GAN g;  3HFO A;  3L42 A;  3ME9 A;  5FLX E;  3HBL A;  4C5H A;  1S72 T;  4CRI A;  4JRI A;  5HK0 A;  4M7A E;  2E65 A;  2ZPI B;  4R56 A;  2KMT A;  3PGG A;  1VQ9 T;  3JSC A;  4A4E A;  1M90 U;  4JX4 A;  3MP8 A;  5FU7 B;  3V8K A;  5CKE A;  4FT4 A;  3LYI A;  1R8O B;  1UGS B;  4HNV A;  2XIC A;  3M57 A;  3S6W A;  3CPW A;  1D3B B;  5LJ5 g;  1Q81 C;  1EIF A;  4Y28 E;  2L8D A;  3OYC A;  4V2S A;  3JAM E;  3HRT A;  3QKJ A;  2KK4 A;  3TW6 A;  4XTU A;  4M77 B;  4M7D F;  4MFE A;  3GF5 A;  4C92 F;  1G3W A;  1VQN A;  3O8V A;  4M7A G;  2O4X B;  2B8A A;  2DXU A;  1Y71 A;  3S3M A;  2QA4 T;  1WPY A;  1FKM A;  3CC4 T;  1VQ8 A;  3M53 A;  4PJO G;  4LDY A;  5HK3 A;  5GAN d;  2QEX T;  5FU7 C;  2FB7 A;  4N4G A;  2P0Q A;  4M7A B;  1BKB A;  4HT8 A;  3VKG A;  5CO7 A;  1YJN T;  4F7U A;  1QVF A;  3GIB A;  2E10 A;  5CAI A;  1YJ9 A;  3G4S A;  4L5G A;  3CBO A;  4M78 E;  2V8J A;  3RES A;  4C0Z A;  3CMA A;  1OI1 A;  2M1H A;  3MEA A;  1D3B A;  5KCH A;  2CS7 A;  1O9S A;  2JVV A;  4X34 A;  2RI5 A;  2ZZD B;  5EG2 A;  3CCQ A;  5A2Q E;  1KD1 C;  1OZ2 A;  3EAE A;  1X75 C;  3FB9 A;  4II1 A;  2K3X A;  3L2Q A;  4ATO A;  3VUB A;  3RKX A;  3I55 T;  1JBM A;  1DJ7 B;  1BIA A;  2EQK A;  2LQ8 A;  3CPF A;  3M9Q A;  3KBG A;  4PJO C;  2ZPF B;  2O4X A;  4WF2 A;  2E70 A;  2RJF A;  1K8A U;  2LQK A;  3QZ9 B;  2M0O A;  4MDW A;  3ZEH A;  2E6N A;  4E47 A;  2CZ1 B;  4PNO A;  2X4W A;  5LJ5 e;  5GAN 4;  1YIJ A;  1IZ6 A;  2XG8 D;  5J26 A;  2VGM A;  2MF2 A;  3M56 A;  2YRV A;  1W2B S;  3PTA A;  5CK9 A;  4IUR A;  4AKG A;  5A0G A;  5LJ3 g;  2OTL T;  3NTI A;  4PJO B;  2FL7 A;  5D6Y A;  3OYN A;  2RB6 A;  1U1T A;  4M75 C;  5CKH A;  4C5G A;  3JB9 D;  3CCV T;  1N8R C;  3A8G B;  5CIU A;  4OGC A;  3JCM g;  2ZGW A;  3TCJ A;  2ZZD A;  1S72 A;  4J7F A;  1JB0 E;  2ZPH B;  3PMT A;  3QJ6 A;  3FRN A;  1PSF A;  3GNF B;  2DZC A;  3T9N A;  1W2B A;  4OB1 B;  3RKY A;  4ZN3 A;  5J39 A;  2VYT A;  4XTW A;  1NPP A;  3HL8 A;  1U1S A;  2YLB A;  2RHU A;  1BI3 A;  1OZ3 A;  1WNL A;  2GFU A;  2X4X A;  4XU1 A;  4PJO E;  2DO3 A;  4M7D C;  3S3N A;  3FLG A;  3L2W A;  2JN0 A;  4C5E A;  5KE3 A;  2P0K A;  2EJG A;  3BDU A;  4ME7 A;  2R57 A;  2NLU A;  1KD1 U;  1KQ2 A;  4JRK A;  2QDJ A;  4JX5 A;  1WGS A;  1XQH A;  4LDX A;  2L89 A;  4N4H A;  5LJ5 f;  3CC4 A;  4KBM B;  2BIV A;  4N4I A;  1VQ7 T;  1VQ8 T;  3CCE T;  2BS4 A;  1VQ9 A;  4XTY A;  4MML A;  4E7I A;  1M1F A;  3GNG A;  1WQ7 A;  4BBS M;  3HRS A;  2EQJ A;  3M54 A;  4KUI A;  1X6O A;  2CKK A;  4X9D A;  3G4S T;  2E64 A;  3CMA T;  2PVD B;  2DAQ A;  1G3Y A;  4C0D C;  5C0M A;  2EKO A;  2RK1 A;  5LJ3 h;  4C8Q F;  1QW1 A;  2DZ9 A;  3FC3 A;  1N6A A;  3CCJ A;  3QYB A;  4BY6 B;  5A0D A;  3URG A;  1M4Z A;  3CCQ T;  3RER A;  4FT2 A;  2E6Z A;  3P8H A;  2XDD A;  3HHT B;  4JS5 A;  4HCC A;  4FM4 B;  4HCB A;  1Q86 U;  1KQS S;  3H8Z A;  3V7C A;  4KUD K;  3OYL A;  1Y07 A;  2KDS A;  4ZGJ B;  2MMP A;  5GAO q;  4E7K A;  4F7U F;  1VQP A;  3E9G A;  2DTH A;  4C0D B;  3HB9 A;  3LWH A;  2IVW A;  4BBR M;  4M78 D;  4OB0 B;  3X26 B;  3MCA B;  1GXI E;  3FDR A;  4NL2 A;  2CZ0 B;  2K5F A;  4PLL A;  2HQX A;  3N5B B;  3PT9 A;  3MEW A;  3OBW A;  2DXC A;  3OMG A;  2D0Q B;  3VU3 C;  3VKH A;  1UB4 A;  2DD5 A;  3P8D A;  4OGE A;  4Z6Y A;  3BY7 A;  4PL6 A;  1JJ2 A;  2ZCF B;  1QP2 A;  1VQK A;  3GLX A;  4EPC A;  3CCS A;  2K4Y A;  4AI6 A;  1M1G A;  3JRZ A;  3MP6 A;  5CQX A;  3HFN A;  3TW7 A;  3X28 B;  3VJP A;  5GAM j;  1K9M C;  2M9U A;  2K57 A;  4OB2 B;  2VXF A;  2JTF A;  5C6S A;  5LJ3 f;  2HAX A;  5GAM e;  2CYZ B;  2K5L A;  2XDP A;  3OYA A;  2BS3 A;  1XNI A;  3X20 B;  3L2R A;  2C06 A;  3OYH A;  3DL1 A;  5FRN A;  1WQW A;  4B9X A;  1HXD A;  4FU6 A;  4BAC A;  1HK9 A;  5GAM f;  1YIT A;  3L2Z A;  2LT1 A;  2JOY A;  4J7I A;  2Y4X A;  1P92 A;  5HY6 A;  2RO0 A;  5LJ5 h;  3BG9 A;  3LWI A;  2E12 A;  2DD5 B;  4AKH A;  4C92 E;  2EAY A;  4DOW A;  3SB2 A;  3HSB A;  4M78 G;  4MZP A;  5GAN 6;  3V7S A;  2XHC A;  2XDB A;  2L3R A;  1FXX A;  3ZFJ A;  3CCE A;  1N9S A;  1VQ7 A;  2Y90 A;  2KQW A;  2VUB A;  2DIG A;  4M6V A;  1QVG A;  4DOV A;  3BG5 A;  4M75 F;  3OB9 A;  4VUB A;  1E7P A;  4F7U B;  2V8I A;  4IUP A;  3CXC A;  5GAO p;  4C8Q D;  2KVQ G;  3UT1 A;  3PIO A;  2RHY A;  2F5K A;  1LJO A;  4XTZ A;  1W4S A;  5DY9 A;  5LL6 S;  3CCJ T;  2K5I A;  4BE1 A;  4O6J A;  4RCC A;  4ZGD B;  5FU6 C;  3CD6 A;  3OMC A;  4A53 A;  3QUI A;  2EIF A;  3QYE A;  1BI0 A;  2RHI A;  3R6O A;  4XU0 A;  1KQ1 A;  5IAY A;  2DK3 A;  1VQP T;  4JLI A;  4QQG A;  2HD0 A;  3BW1 A;  3M59 A;  2LC4 A;  5GAM g;  2ZPE B;  4XU3 A;  3NTH A;  3JCM W;  2EWN A;  4J6W A;  4KT0 E;  1VIF A;  1K9M U;  3SD4 A;  4M7D G;  3A8O B;  4GLK A;  4C5I A;  3JCM e;  4HL4 A;  1UEB A;  3E9F A;  4HNU A;  5CQY A;  4C8Q A;  1ZBX A;  5CCA A;  5LJ5 d;  1K8A C;  4IUT A;  5GAN 7;  2V8K A;  2K3Y A;  3HP9 A;  1YJW A;  2MWO A;  2O01 E;  3PFS A;  5GAN 3;  3JB9 F;  4PJO A;  2QQ8 A;  3OS2 A;  4AKI A;  4JRQ A;  3F70 A;  2LCC A;  4PJO F;  5GAO r;  2JTM A;  3ASK A;  4CI0 C;  3OYK A;  1MGQ A;  5GAN f;  4ZTF A;  5GMK i;  3CCS T;  1G3T A;  1B34 B;  2QQB A;  1VQO T;  3L1A A;  4E7L A;  4R55 A;  1VQ6 T;  4QQD A;  1BIB A;  2RJD A;  3WXM B;  4HKE A;  3DB4 A;  4JDS A;  2GQV A;  5I2M A;  2RHZ A;  3KXT A;  3OYB A;  2RD1 A;  4M77 E;  2P0P A;  4NL3 A;  3QHS A;  2RJC A;  4BE2 A;  1OYX A;  3GPL A;  3OS1 A;  3QSU A;  3QXE B;  2LT4 A;  4PKC C;  1YIT T;  4C8Q B;  3H4C A;  3OYD A;  3JCM c;  4JLG A;  2KY9 A;  3G6E T;  2OTJ A;  2DIQ A;  5GMK h;  2RH2 A;  4YTL A;  2KR6 A;  3C4S A;  3MEV A;  1JRI A;  3VV0 A;  1WJS A;  2BKD N;  1M1K C;  3A8M B;  4LDV A;  5GAN 5;  1Q7Y U;  1I4K 1;  3QO3 A;  3LH0 A;  1B34 A;  1NPR A;  1NJI U;  2RI3 A;  3V8J A;  2LX9 A;  3MP1 A;  3KUF A;  4O5V A;  3JCM f;  4MDX A;  4C92 B;  1VIE A;  3L2V A;  4XU2 A;  3DB3 A;  2DJZ A;  5DLQ E;  5I21 A;  4LD9 K;  4EMK B;  1XOV A;  4C8Q G;  4OB3 B;  1Q86 C;  5EJC A;  3OS5 A;  4OMF B;  4XAX B;  5GMK m;  4BB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...