3VYHB

Crystal structure of aw116r mutant of nitrile hydratase from pseudonocardia thermophilla
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title Effects of argnine residue around the substrate pocket on the substrate specificity of thiocyanate hydrolase
rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 67
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 3vyhB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vyhB02
3A8HB 1UGRB 3WVEB 4OB0B 5L8RE 1V29B 3A8MB 3X25B 2PVGB 2WSFE 2DXBA 2DXCA 4KT0E 3WVDB 3QXEB 2DXCB 2CZ0B 2WSEE 2DD5B 1JB0E 4ZGJB 3QZ9B 3X24B 2PUOB 2O01E 2AHJB 4OB3B 2ZZDA 2CYZB 3QYGB 2ZPBB 2ZZDB 2PU9B 2ZPGB 3A8LB 2DD5A 4ZGDB 1GXIE 3X28B 1UGQB 4ZGEB 2DD4A 2WSCE 2CZ1B 1DJ7B 4Y28E 4FM4B 2DD4B 2ZPFB 4XK8E 2ZPIB 4L6V5 1UGSB 3HHTB 3A8OB 1PSFA 2PVDB 3QYHB 1QP3A 3X26B 2ZPEB 1IREB 3LW5E 2CZ6B 1QP2A 2QDYB 3A8GB 3VYHB 2ZPHB 2D0QB 3VYGA 2DPPB 3X20B 2CZ7B 1UGPB 1PSEA 4OB1B 4OB2B 3VYGB 2PVOB 4RKUE 3QZ5B 2DXBB 1AHJB 2PUKB 2ZCFB
chains in the Genus database with same CATH superfamily
4PJOC 3CXCA 4Z88A 2JTMA 1RAAB 4QVZA 3A8MB 5GAOm 4OVAA 1K73R 1H27B 1QCOA 4C0ZA 5IDNB 2QEXQ 2I2LA 2D6FA 4RTXA 4LDUA 1BIBA 4BI8B 3EIDB 3JAME 2DJQA 5FRNA 4PJOE 3OYIA 4M7AG 1HJDA 2DAQA 4PL6A 4MDXA 3TU4K 3G6ET 1MV0B 2O88A 3GBQA 4M4ZA 2O31A 1OI9B 3LGLA 5GANj 3BG5A 1NEBA 1EZZB 1OV3A 2P4TA 3CPFA 1VYTA 2CYZB 5GANd 3NPFA 3EHRA 1RABB 5GAOp 1VQ7A 2ZZDB 2KK4A 2BS3A 2RJEA 3HPWA 2FRYA 2MCNA 2EQKA 4XTWA 4FW2A 2I53A 1VQ9Q 3JCMf 1M30A 3TNWB 3SWNC 5GAN5 3QYEA 5FU6C 1JQQA 2JMAA 4HA8A 2BKDN 1IREB 2VKNA 5KYUB 2FPFA 3QDFA 3CC7T 4M7DC 1NYFA 3RKYA 2WJ9A 2YUPA 2NWMA 4IIOA 3OYKA 4J9CA 4J9EA 3TQ7P 4AKIA 4L5GA 4PJNA 4LDXA 1N27A 1YCYA 3F5XB 2MMPA 2QA4T 3AT1B 2CH4W 3ULRB 2C5VB 1ZUUA 4YOOA 2PVOB 2FVUA 3GF5A 4M7DE 1FVVB 4N0AA 1LPLA 2JS0A 5GMKl 4CC3A 2KMTA 4RCBA 1B3QA 4HT9A 4F14A 5CCAA 3F70A 1HK9A 2A3LA 1FMWA 1AWXA 2DEQA 3OBWA 4M78B 2JTEA 1WHLA 3CCLQ 1X6GA 2WFYB 4X9CA 1QVPA 3M57A 5LJ3d 1OGUB 1LCKA 2LT4A 1M8VA 4C8QB 1VQ6T 1K73C 1URCB 2R57A 4N4HA 3I56A 4C0GA 3MEVA 3OYJA 2EYZA 4J5YA 2R5MA 3PIOA 2PK9B 2DL7A 1MHNA 1ZUKA 3POMA 5EC7A 3LWIA 4AKHA 3BDLA 4DA4A 3G71A 1U06A 1NLPC 2DNUA 1S72A 4C92C 3EGDA 4RTUA 2DD5A 3CD6T 1M2OA 2YHTA 3EOCB 4F7UG 4ZGDB 1OOTA 4CFUB 3VUZA 4MZPA 3VRZA 4EOLB 4LDYA 2CZ1B 3V7CA 1D3UB 5FWCA 2K9GA 4C92E 1UE9A 2FZCB 2OAUA 3V8LA 1G5VA 2J06A 1TG0A 1VUBA 1G83A 4J9FA 1HSQA 3JCMc 3I5SA 3JB9J 2KMGA 4M7AF 3CBMA 2X3XD 2K7AA 1OKWB 4F7SB 1BB9A 3VS3A 2OTLA 2AT1B 2C0IA 3PVQA 4M75B 3REAB 2M02A 2NUZA 4RG2A 1N6AA 4J83A 3BFMA 1YP5A 3CC2A 1ZUYA 2LJ1A 2R58A 1M90R 5FROA 4IKFA 1FYNA 2EBPA 1KQ2A 3OW2P 4ELJA 2K3XA 1K9MU 5GJVB 2COWA 2WEVB 3HRUA 4BCKB 2LX7A 2CT3A 1UG1A 3OS2A 3HBLA 1AWOA 1Y07A 2GQIA 1YBYA 1XO2A 1CSKA 4KT0E 1JSTB 2X4XA 1G2BA 3DKMA 1H92A 3H0IA 2CGHA 2KSSA 4CC7A 2VGMA 1CKBA 1K8AR 2J6KA 3BDUA 1YWPA 3CCST 1NZ9A 2X4YA 2X51A 3FDRA 3CC7Q 3CBOA 3DDQB 2JVVA 2ZZDA 2LNHB 1I0CA 2X35A 4PJOB 1KSWA 3TEEA 4KH1B 1H4LD 1H25B 3PE0A 2G3RA 2QA4Q 4FU6A 1KJWA 3C95A 4BB7A 1KHCA 1GCQA 2F2VA 3OYNA 1H3HA 3BG9A 2C6TB 5GAMg 1GXIE 3CC7A 2VUBA 1MGQA 3X28B 1WIEA 4BCGB 4ELZC 1WQWA 1UTIA 1M4ZA 2FZGB 5FU7B 5KYUA 3E9FA 2ED1A 2RMOA 4LD9K 1IGQA 3J81E 3EG1A 2O2OA 3VRYA 1VQ6Q 4C0DC 2E5KA 1IGUA 1MV3A 4XTXA 3VKHA 3VYHB 4E7IA 1ZA1B 1R77A 2DVJA 3U23A 2MIOA 5GMKj 1MUZA 4XU1A 1KQSP 2DA9A 5D6YA 5IT9E 1QCNA 2HDAA 2C06A 5BNJB 4K11A 3RIRA 2K3BA 1T0JA 3JCMQ 2ECZA 1S1NA 4IMYB 2HQEA 1JJ2P 3CMET 4CC2A 5CKHA 1O9KA 4F7UF 2HNIA 3CD6Q 3EAEA 4AG1C 1VQNA 2RQVA 2W99A 3CCJT 2LVMA 4M78A 1XOVA 3A8HB 4OB0B 2GQVA 2KXDA 4M7DB 4BCMD 2C5XB 5DLOA 3CMAA 3IQLA 5HNBB 3WXMB 3CCUA 3OY9A 2FZKB 5HY6A 2IW9B 3Q1JA 4IUVA 3JRZA 5IXBA 2DXCB 4EMKB 4M7DD 4BCIB 1TS9A 2QI2A 2DYBA 3V8JA 3X24B 3V7SA 4CFWB 3VV0A 1SEMA 2XDDA 1VQOT 1ABOA 5GAMh 3LX7A 3VU3C 3A8LB 1MMGA 1R0BG 2EPDA 1UGVA 1GCQC 4AFQC 4XQ3A 1LVKA 2OJ2A 2FHDA 3I56Q 1K9MC 1RADB 2DM1A 2BIVA 1PC0A 1TUGB 1U1TA 4Y28E 4OP0A 3N5BB 4AMCA 2RI2A 3OYAA 2ROLA 3LH5A 2AZVA 2FEIA 5KE3A 2PVDB 4BY6B 2AZSA 1D0XA 4M75A 2IW6B 3H0FA 4BUGA 1WLPB 5GANf 4ZTFA 1YIJT 1W4SA 1QP2A 2B9RA 2MYSA 1GRIA 4DEYA 2QG9B 1PWTA 2JMCA 1H1QB 2ZPHB 3BHUB 1R0CB 2JM9A 5L2WB 1XJWB 4FT2A 2QEXT 4ZN1A 3CCUT 3J80E 3OSVA 1OIUB 4C92D 3G4SA 1X43A 4LDVA 2UZLB 2UUEB 2OX7A 4A4FA 4E7HA 3BE3A 1VQMA 3L1AA 1UFFA 4WF2A 4OGEA 1Q95G 1Z9ZA 2V1QA 1XTDA 2AKLA 2D8JA 2LQWA 1JEGA 3G33B 3L42A 3MP6A 2DX1A 3MEWA 4FYVB 2PTKA 2XICA 2A28A 2EYWA 3PNWC 2OTLQ 3AHUA 4M78C 4Q5WA 1F5QB 3CCMA 5LJ3g 1GY3B 3X25B 1M2VB 3O0GD 3CC2Q 1YJWA 2ED0A 3HTRA 4C8QC 4M7AB 1C0MA 2XD0A 4GLMA 3QXEB 4AG2C 4F7JB 4CRLB 4BY7X 2E4HA 5GANh 2F2CA 1RAHB 4WTOB 4JS4A 2MF2A 2O4XA 4M78E 3GP8A 4A4GA 4PJOA 1JBMA 3CCEA 4FSSA 8ATCB 1WFWA 1SPKA 2GFUA 4XU2A 4QQGA 3R6NA 4JLIA 4C8QE 3EJ1B 1WNLA 1WI7A 1M3AA 4EOJB 3NTHA 1I8FA 5AYFA 4RUGA 4M77G 5EJCA 3M0RA 2GGRA 3VKIA 4JLGA 2BTTA 5I11A 3CCQA 2E6NA 1YHQA 5D6WA 4F6WB 2IPOB 2J7IA 2JXBA 1NYGA 3OW2S 4DEXA 5LJ5d 1W1FA 4B9WA 3THKA 2J6OA 3EGXA 5KH6A 4ROCA 4OMOA 4F6SB 1GUXA 4C5GA 2H3JA 4R55A 4P5NA 3QBYA 4J9HA 1VQ4A 1D09B 1K76A 2Y4XA 2RPNA 1VOLA 1H641 2KT8A 4LE9A 5KYYB 2CZ6B 5GAMj 2QDYB 4EOMB 4Z6YA 2L3RA 2YUNA 2D0QB 2KRMA 4F17A 1WXTA 1Y57A 1K0XA 3CCLT 1YWOA 3MY1B 2M51A 2EJGA 3EFOB 4FCYA 4ZNXA 2CH4A 1VQOQ 3VYGB 1VQ5A 1PHTA 4EORB 2F69A 2DMOA 4JRQA 1O75A 4M7DA 2OTJT 1TU0B 2VXEA 2EGEA 5LJ3h 1B7TA 2V22B 1J3TA 2XG8D 3BG3A 5CR2A 2D0NA 3MHXA 1BIAA 4OMQA 2DERA 3QHSA 2DKGA 2DXCA 4EMKA 1SRMA 5I2MA 3MKDA 1P5EB 3FIFA 4D8KA 4B6MA 4IUTA 3K7AM 3RESA 2FB7A 1TOVA 2DVEA 1YJ9T 4CFNB 3M54A 2C0TA 1VQNQ 1YIJQ 4KUDK 3VJPA 2RK1A 3OMGA 3CCVA 2DE0X 2FPEA 1YITA 4E7ZA 2P4RA 4UC4A 4C5IA 1ZX6A 4KGVB 2KE9A 5IHYA 3UPUA 1Y7XA 3CMAQ 3L2WA 4F7UB 2ZPBB 1QWFA 1KQSS 1ZSZC 2DJZA 4LXCA 2PU9B 3CCUQ 3MJXA 4BBRM 1EX4A 4OMMA 4JRKA 3GNFB 2EAYA 3ASKA 2PK2A 4J6YA 1JJ2S 5CKBA 4X9DA 4OMLA 2KQWA 2QQAA 3VS7A 3JCMV 2DLPA 1G3WA 1TXQA 1NPRA 5AT1B 4F7LB 2A7YA 2J05A 2VYTA 5FU7C 3QG1A 1YN8A 4XU3A 1GH6B 4KULA 2K79A 4C92A 1YI2T 2HZYA 2YDLA 2DRKA 4QVCA 5C0MA 5ACBA 3E19A 3L2ZA 3VKGA 3QSUA 2RJDA 3L2RA 2BZ8A 3L2UA 3KHIA 3NTIA 2OI3A 2EJ9A 3EH2A 4ZN3A 2CREA 1N4MA 2D9TA 2K3YA 1N9RA 1TSFA 4OF1A 3S3OA 2EWNA 4EOPB 3HP9A 1IXDA 1NJIU 4M77F 3M0SA 2XIDA 3OYMA 2EYYA 2KBTA 2EQMA 2MWOA 1AOJA 1WJQA 3RERA 5J39A 5KCOA 2IIMA 3FLGA 3M59A 2DEUA 1X6BA 1H1SB 2FL7A 2ROTA 3JCMJ 3HL8A 1VQKA 3E1SA 3CEYA 5ICPB 5L8RE 3OYGA 1JXMA 5GAN8 2M0YA 1H3ZA 1D1BA 1BU1A 4ORZA 1G8XA 3G4SQ 2MPXC 3EG0A 4ME7A 4EMKC 1OL1B 1ZBXA 2ZAEA 1VQMQ 2CUBA 2RHUA 4PJLA 4BCPB 2A0FB 5J26A 2WMBB 2B86A 3PIPA 2RO0A 5GAMe 1NJIR 1KIKA 2K57A 4MFDA 3OW2A 1QKXA 3H8ZA 4II1A 2IN3A 3CCMQ 5LJ3j 3RMSA 5GAN2 3V8KA 2AK5A 4EC9B 4I3ZB 2RI5A 1VQ7T 2EYXA 4JJDA 2EIFA 2K5IA 1OKVB 4Y92A 1Y0MA 3CCRA 1WYXA 4FT4A 1OIYB 4CFVB 4J9BA 3MI9B 4Y72B 2JGZB 3MO8A 4TVRA 4BD3A 1U3OA 2OTJQ 4M78D 4J7FA 5J3BA 1H28B 3GTMS 3CCEQ 1SF9A 4O6JA 2CS7A 1G3SA 2DD4B 2KRSA 4PFZA 4O5VA 3ZL7C 4BY6C 1M5Q1 4C8QD 3CC4A 3SDZA 1BI3A 2KY9A 5HQ0B 2AKKA 1BBZA 2QFZA 1AVZC 2RJCA 1D3BB 2V1RA 5GMKh 2NLUA 2P0QA 3CCQQ 4FW1A 1E7OA 4PK4A 1VQKT 2E6ZA 1AZEA 1NM7A 1WPYA 4R56A 1YJ9Q 2KYMA 3VS0A 2RB6A 4KH0B 1OYXA 3VYGA 3X20B 2X9HA 4PJJA 1KD1U 4J8OA 2I0NA 1M3CA 2A37A 1NG2A 5IN1A 2CP5A 2QQSA 4OB2B 3NHNA 1FINB 4CFMB 3HB9A 4CFUD 4VUBA 1IHWA 1KK7A 3KFVA 4MMKA 2CUDA 3RMQA 3VS1A 2LDMA 1TWBA 4ESRA 1G3TA 1WA7A 4OMFB 3JCMP 3HSBA 1UGRB 3SB2A 4DBQA 2HQXA 1HD3A 2LQNA 1UJYA 3NTKA 1YJNA 1ENWA 4JDSA 4YC3B 2VC8A 5GANe 4M7AC 2WSFE 1KC8U 3I35A 1KFZA 2YWWA 4NS5A 5KYWA 2G6FX 4II5B 5IH2A 1YI2Q 3TREA 4A63B 2YXYA 4M75D 3HFNA 2WSEE 3I56T 2JM8A 1KD1R 1I81A 3H6ZA 1GL5A 1JJ2A 3URGA 1RL2A 1N5ZA 2PUOB 2O01E 4XTVA 4M7AE 1M3BA 1E9HB 1VIFA 4EPCA 4F70B 4OB3B 1WHGA 2CP3A 5HBJB 3OS1A 1YFNA 3TCJA 4WCIA 2IG0A 1TH7A 4IUQA 3OYDA 3I55A 2RHYA 2Y4YA 3G71T 1VQLA 3QYGB 1S72T 1NJIC 1HYOA 2DBKA 2DL5A 1M9SA 1UHCA 4PNOA 4RODA 4AI6A 3ZBDA 3L2VA 2HSPA 2RH2A 2C4GB 4M6VA 1ZP2A 2EGAA 5LJ5g 4JJBA 4EOQB 3OYEA 1WQ7A 3NGPA 3GNGA 1KC8R 3M4GA 3O5ZA 3CCVQ 2K6DA 2LRQA 2E1HA 2ZPFB 5GJWB 3BHTB 2JT4A 1QW1A 2LCLA 1K9MR 2EVRA 4XTZA 1QP3A 3X26B 9ATCB 1ZSZB 1OL2B 2ZPEB 1C9BA 5IXFA 2HCKA 2KYBA 2OTLT 4PJOD 2LW4A 2YRCA 1YJNT 4A4KA 2WIPB 2QQBA 1VYUA 3CC2T 1UGPB 5A0LA 3QWXX 2DETA 5LJ3e 1I5OB 4BI3A 3M55A 4M78G 2CCIB 2E65A 3RGFB 3JCMd 4RTWA 1VQ7Q 4X34A 2W9FA 2DXBB 2K4YA 2QDLA 1SHGA 3TVTA 5GAOl 4TTHA 3TW7A 1M27C 2ZCFB 2CSIA 3NMZC 3RKWA 2F5KA 4FYXB 3SFMA 1AD6A 2LTOA 1H24B 1UNLD 2A08A 2H8HA 1OX9A 1N8RU 2BPMB 3EG9B 1D1AA 2IW8B 4YOZA 5EG2A 4JS5A 5GAMf 1UHFA 4FL6A 4MFEA 2V8JA 4AFUC 5HK0A 5FRMA 8AT1B 2HBPA 1N9SA 2XKOC 1M1GA 4RTZA 2QTXA 2CZ0B 4AKGA 1W70A 2R5AA 4BCNB 1BYMA 2RNAA 3M0QA 2C5NB 5HCKA 2C5OB 2EUFA 2KI7A 2SEMA 4L59A 2QK0A 1BU2A 4N4GA 1VQKQ 5GAN6 4M77B 3EG3A 1IZ6A 1E6HA 3LQ5B 4BCFB 3FRNA 2W96A 4EONB 1B07A 2RQWA 4JRPA 1KD1C 4C8QA 1PRLC 2RD1A 5LJ5h 1XNIA 5L23A 2CJMB 4NC6A 2WXVB 2M16A 3FB9A 2FO0A 2NYSA 1BI2A 2DBMA 4UN0A 1VQPA 2ZGWA 3MPUB 2DYIA 4J9IA 1N8RR 2KVQG 3H4CA 2DD4A 4A4HA 2COZA 2NUPB 4F7UE 2Y90A 1RAEB 1BKBA 2PMIB 1JSUB 2UZBB 5D7UA 1GBQA 3S3NA 3M9QA 2W0ZA 2W9ZA 4M75G 4E7KA 1WHMA 2EGCA 2DZCA 1OX8A 4GBQA 2Z0WA 4L6V5 2EYQA 1KC8C 4BDZA 4JX4A 1QLBA 3QYHB 1OPLA 4KUIA 3BHVB 3CCRQ 4JJNK 1VQ8A 1BCMA 1M1KU 3H9NA 1SSHA 3PFSA 2HAXA 4MMLA 1W2BP 2E5QA 1H1RB 1ZA2B 2DPPB 1B34B 4FYWB 1WXUA 3OA6A 1WHHA 3MEAA 4HCZA 1VINA 2EW3A 4N4IA 1YCSB 1BK2A 1W6XA 2DZ9A 4HNTA 1V1CA 3G1JA 2RHXA 3M4YA 4DOVA 3G71Q 2G9XB 1AWJA 3PMTA 3QYBA 1S72Q 1QVFP 3MY5B 4OGCA 1AHJB 1VQNT 4ZTJA 1VQ9A 4J6XA 2VV5A 3C4SA 4J9GA 2WPAB 1FXXA 2EQUA 6AT1B 3WVEB 5CQYA 2EFIA 3M56A 2DL3A 2K2VA 3CMAT 4BCQB 4ANJA 5GMKm 4DBHA 1NLOC 3TNHB 1M1KR 1QLYA 4PJOG 4RG8A 1T3SA 3H41A 3QHRB 4HVUA 3UATA 2CSQA 3D7SB 2JOYA 2XDBA 5I22A 1IO6A 4ZGJB 4QT7A 4LUDA 3GLXA 3TW6A 4PLLA 1IRXA 2AHJB 2YUOA 4JPBW 3SD4A 4YTLA 1BCOA 5HBEB 3OQ5A 1HXDA 2R7GA 1YJNQ 3CQTA 3CPWP 4GY5A 4DQ2A 4M78F 3C94A 1NPPA 2GNCA 2VXFA 2K5LA 4BCHB 1AWWA 3TSWA 2IVWA 4CFXB 5CIUA 4OGRB 1F1BB 4BXXX 2WHBB 4M7AD 3JV3A 2RN8A 5GMKe 4ATOA 3OMCA 5KCHA 4D8DA 1ZSZA 2QQ9A 1N8RC 1ZQ1A 4QQ6A 4CXAB 2ATCB 4QW2A 4FYYB 2QF7A 4EOIB 3DDPB 2DK3A 4OR5B 3H0HA 5M9OA 1MMNA 2LT1A 5LJ5j 4R0KA 4E7LA 2CP6A 3NFCA 5I5ZB 5LJ3f 1PCXA 3QDRB 1C1AA 2EQIA 2DL8A 1SG5A 3I9QA 4KGXB 1X69A 2V8KA 1C6VX 1G3YA 2HL5C 2MAMA 4E7JA 1AEYA 1ZHIA 2XI9A 4AFZC 4M7DG 2WACA 4J9DA 3G4ST 4BE1A 4DBRA 1VQMT 4Y91A 5GMKi 2RQRA 2HKNA 3QKJA 4HVWA 1U5SA 1JO8A 3QJ6A 3DB3A 1UNHD 3GOXA 1D1CA 2A36A 5CAIA 2PQWA 2YUQA 3CCMT 5A2QE 4ELLA 4M75F 4KBMB 1UUEA 2QGSA 1RI0A 1YJWT 2YRDA 4J6WA 2JS2A 1G3NC 4PJMA 2FYKA 4QSHA 3RKXA 4MZMA 4MIMA 2HBWA 4KRDB 3FEOA 3QWYA 5C6SA 1I07A 2L3QA 2LCSA 4LDWA 1UNGD 2YT6A 3EGDB 4HCKA 4M77A 1AD5A 2DD5B 1M1KC 5CKDA 3CCET 3G6EA 3PGGA 4AFSC 4Z8AA 2M1HA 1M1FA 5A0DA 2ZPGB 2F5TX 1U8RA 3KXTA 4HNUA 3UT1A 4MDWA 3BW1A 2MWPA 3CCQT 1YHQT 2D8HA 1MMAA 5DQWA 2LCCA 3QJYA 5KYXB 2YLBA 3JSCA 4C92G 3JB9D 4NSTB 4HLQA 2F1LA 3UF4A 3M0TA 3PT9A 4EOKB 3UWNA 1WJSA 1QWEA 1UECA 3VUBA 4LOCA 1AZGB 3G7ZA 1VQ4T 4F16A 2DTOA 4PJOF 2M0OA 3QUIA 5IHIA 3JCMX 5FGKB 1VQPQ 4FSXA 2PHGA 1ARKA 3QWLA 5GAOn 3A8GB 1KXUA 2DIGA 2D1XA 2KR6A 4IIMA 4QQDA 1FWZA 5HBHB 1X75C 3JCMg 2QA4A 1PSEA 3EFSA 1BI1A 1VQ5T 2NUTB 5CEIB 1OEBA 1WHKA 2P0KA 4JUVA 3UDCA 1K0SA 3QZ5B 2LMJA 4OMNA 4LUEA 1OPKA 1SSFA 2PUKB 3LH0A 1WJRA 1FMKA 1VQ8Q 2E12A 2MK5A 1ZSGA 4JZ4A 1UDLA 1EIFA 1WX6A 1PD0A 1VOMA 1I4K1 4JRIA 3BY7A 3DTOA 2C0OA 3BLRB 3A98A 1TD6A 1LJOA 5GAOr 4B9XA 3OYFA 1QKWA 2RHIA 1NBEB 1KQ1A 2GTOA 4A4EA 2QDJA 2WMAB 1VQ6A 2RK2A 1QVGP 3RR6A 2LQ8A 5LJ5e 1K1ZA 4M77C 1M2VA 3RNJA 1SKUB 3CCVT 3OYBA 2E3HA 3KUFA 1YITT 2JW4A 4M7AA 1W2BS 1JKWA 4M7DF 4LNPA 3DLMA 2VASA 4NOYA 4BCJB 4XU0A 3P8BB 2LC4A 1E7PA 4EMHA 3R6OA 2LJ3A 1Q81U 1IHVA 3CD6A 1KHIA 4MZTA 4M77E 1VYVA 4DOWA 2L5QA 4BY1X 1QVFS 4OMPA 1WDXA 3HZJA 1NEGA 1OQKA 4XAXB 2BZYA 1H8KA 1W98B 3DB4A 2YSQA 1FMVA 4HNVA 1YJWQ 2EKOA 5I2SA 3QHWB 5IDPB 4C0FA 5ECAA 1O9SA 3CXCP 3PVLA 1Y71A 4BACA 2WIHB 1X01A 2DFUA 2HSEB 1PKDB 5CK9A 3ER0A 1MNDA 2HD0A 4EIKA 3OYLA 1O9KB 3JCMh 3M58A 3J7AF 3GPLA 2DRMA 1K4US 1Q81R 5DM7R 5KYYA 1A0NB 3CPWS 1TTHB 3JB9G 4EOOB 1I1JA 1PKSA 4HCCA 4EC8B 3EG2A 4F6UB 2X4WA 3OSSC 2H3EB 2J6FA 3RDVA 2X1NB 2LZ6B 4CI0C 4JJCA 1YHQQ 4C92F 3EFOA 1QQJA 1NE8A 1ZLMA 4HT8A 4DBFA 2B8AA 3EH1A 2QAZA 1M8MA 4GLKA 3LGFA 1JXOA 2E41A 3P8HA 4PFPA 1VQ4Q 4Z02A 2BUDA 1AISB 1UEBA 3A1PA 3QPHA 4HKEA 5HKCA 1M90U 1JB0E 2KT1A 3CCSA 5IHKA 1PRMC 2L3SA 3QIIA 1UJ0A 2DILA 1VA7A 2QGGA 4CRIA 3ZEHA 2O9SA 1ACMB 1Q86U 2CT4A 5KYXA 1WHJA 2K2MA 1KQSA 4ROEA 1VQ5Q 3QO3A 3CCRT 5I21A 1PNJA 1WZOA 5IF1B 1GBRA 1QMCA 4J7IA 1AT1B 5DQVA 4C5HA 1UGQB 5FWBA 5GAN4 1PM3A 3G6EQ 3HRSA 3SHWA 1Q82U 2QXFA 4HXJA 4F7UA 2DF6A 1K8AU 1PG5B 2LJ0A 4XTUA 3JCMW 3CC4T 2JTFA 1X2QA 4XK8E 2VWFA 4F04B 3HHTB 2YRVA 5KE2A 2QTVA 2BS2A 3DLLA 5A0GA 5GAN3 4N0AC 3BLQB 3CBPA 4XTYA 3OBYA 1Q86R 1SHFA 3I5RA 2V8IA 3M0UA 2NUTA 3FJPA 1Y96B 3VS2A 3DL1A 4KRTA 1YITQ 4NL3A 2DO3A 1H1PB 2PJQA 3META 3OS0A 2W10A 3T9NA 2XK0A 3CMEA 2P0PA 1Q82R 1Q81C 1TFBA 2DIQA 4BCOB 2OAWA 3CCJA 2HQHA 4V2SA 3JB9H 3M03A 4KGZB 4E47A 2O4XB 4ELYC 1EFNA 3MP8A 4IUUA 2FPDA 1W2BA 3ZFJA 3P8DA 2PNIA 3PTAA 4D6WA 1ZBJA 1Z9QA 2GFAA 5LJ5f 2UZDB 2L0AA 2L2PA 2O9VA 2EJFA 1LOJA 4JZ3A 2PZ1A 3QZ9B 4C8QG 1QVFA 3O8VA 3M5AA 1VQOA 1IB8A 3L2QA 3I55T 1VQLT 2RI3A 2ESWA 3HO8A 3EGXB 2DTHA 3JB9F 1GUXB 5IAYA 1U1SA 2E10A 1OZ2A 2DXUA 2ABLA 2DTIA 2JN0A 1RAIB 2KDSA 2XHCA 2JJ9A 3VS6A 1X6OA 1JU5C 2F2XA 5D6XA 1GFCA 3B57A 4C5EA 3GIBA 7AT1B 2X3WD 4EOSB 2XDPA 3SWNB 2ZPIB 4BCMB 1UGSB 3JB9I 4AT1B 2VVKA 2CP7A 4BCND 5FU6B 2CDTA 3CPWA 2CP2A 2KEAA 2E64A 2YLCA 4LD6A 1Q7YU 3HKSA 3S6WA 2MOXA 2RM4A 4BI4A 1YIJA 4M77D 1RACB 1M90C 2RA2A 1QVGS 4E2FB 5CO7A 3OYYA 1I5LA 1TUCA 2CZ7B 5EFQB 2QEXA 4OB1B 1D3BA 3MIAB 1WGSA 1Q86C 4RCCA 4FIBA 3TSZA 2LNVA 4YOSA 5HVYB 3RUXA 4RTVA 2GCXA 5IHNA 3C0CA 3DOGB 4HCBA 4CC4B 5GANg 3REBB 4BDYA 1Q82C 1V29B 4RTTA 4NL2A 2GTJA 1H26B 1K8AC 3EHQA 1Q7YR 5DLQE 5HK3A 1RAFB 3WVDB 2RHZA 3CC4Q 3OS5A 2QASA 4QKUA 2RQTA 2BE7D 1X27A 5CKFA 3CXCS 1PKTA 4X1VA 2L8DA 3FJ5A 2E70A 1GCPA 3EGUA 1E6GA 3JCMb 3OYCA 2COYA 2RJFA 4A54A 2CKKA 2W2HA 2ENMA 3LWHA 4EMGA 2CP0A 2RF0A 4PLIA 1GFDA 1RLQC 3HRTA 1VQPT 1WXBA 1UB4A 3PMIA 4C92B 4IUPA 2KGTA 5CQXA 1TUDA 3C12A 1R8OB 2LX9A 1ABQA 4BE2A 4KRCB 3E2UA 2BS4A 2WSCE 4BCQD 3CCSQ 2MI6A 2L3PA 5FLXE 1DJ7B 5CVIA 1JOWA 5CKEA 2LQKA 3M53A 4FM4B 3RBBB 2KROA 3TNIB 3DJBA 4JX6A 3JCMe 1PSFA 2I40B 4IURA 4PKCC 3UA7A 2BE9B 3BLHB 4E6RA 1VQ8T 4BBSM 3TN8B 1Y96A 2AIRB 4C8QF 3E9GA 2HKQB 5CYIB 3MP1A 3KBGA 2BKZB 3CCLA 2GF7A 5FW9A 3FC3A 1XQHA 2IVXA 1OU9A 1FKMA 2QGFB 3MCAB 3I55Q 1VQLQ 2EKHA 2JUFA 4RKUE 1SRLA 4HVVA 1D0YA 2E3IA 2QYZA 1VIEA 1OZ3A 3SEMA 3NDQA 4RTYA 2UZEB 4HL4A 1OI1A 2OTJA 1VQ9T 2XU8A 3OYHA 2HL3A 3UA6A 1D0ZA 1RAGB 1RI9A 1RLPC 2SRCA 2PVGB 5GAN7 1T3LA 2DXBA 3EFRA 3CMEQ 1K9AA 3VS4A 4PFOA 2QQ8A 1Q7YC 2K5FA 5LMKB 3LLRA 1YJ9A 2V26A 2P84A 2F2WA 3EG9A 3CCJQ 3VS5A 2LP5A 2GBQA 2VB6A 4F7NB 1MNEA 3V7RA 2JNGA 2KAFA 3LYIA 2RQUA 1KG1A 3OB9A 1MMDA 2DXTA 4G6LB 4BE0A 2XMFA 1T0HA 3PO3S 4M75C 2BZXA 4ZGEB 1X2KA 5GAMd 3SWNA 2HMAA 1BI0A 2M9UA 1QVGA 2CCHB 4QVDA 5LQFB 2KRNA 2QQRA 1YNZA 2KXCA 2DMEA 1CKAA 5DY9A 5LL6S 1YI2A 3A8OB 4M75E 1VYWB 1V76A 1K73U 2DL4A 2L89A 3ME9A 2NUPA 4Z89A 3HFOA 1LNXA 3LW5E 3M0PA 3A5ZB 4A53A 2EQJA 4C0DB 2X4JA 4FX3B 2JZ2A 2G77A 4RMOA 5KYNA 2FRWA 4JX5A 2HEQA 1PD1A 1FX7A 3S3MA 1QMZB 4EDUA 5GAOq 4LN2A 1RUWA 1QCFA 2KNBB 1OU8A 1JRIA 2FG0A 5KYWB 2KR3A 4E7SA 1P92A 1B34A 3MEUA 1OULA 3INZA 2VGNA
chains in the Genus database with same CATH topology
2XICA 4PJOC 3CXCA 1NE8A 3RKWA 3PNWC 3AHUA 2F5KA 3SFMA 2JTMA 4M78C 4HT8A 2LTOA 4QVZA 4Q5WA 3CCMA 3A8MB 5GAOm 2B8AA 4OVAA 5LJ3g 4C0ZA 3X25B 1N8RU 2I2LA 4GLKA 3LGFA 2E41A 3P8HA 5EG2A 4C8QC 4JS5A 1YJWA 4M7AB 2D6FA 5GAMf 4Z02A 4FL6A 4LDUA 4MFEA 1BIBA 2V8JA 4BI8B 2BUDA 5HK0A 5FRMA 2XD0A 1UEBA 3JAME 3QXEB 2HBPA 1N9SA 2XKOC 1M1GA 5FRNA 3QPHA 2QTXA 4PJOE 4HKEA 3OYIA 5GANh 2CZ0B 4AKGA 4JS4A 5HKCA 1M90U 2MF2A 2O4XA 2DAQA 2R5AA 4M78E 4PL6A 3GP8A 1JB0E 4A4GA 4MDXA 4PJOA 1JBMA 1BYMA 3TU4K 3G6ET 3CCSA 3CCEA 4L59A 4N4GA 2GFUA 4XU2A 3QIIA 3LGLA 5GANj 3BG5A 5GAN6 4QQGA 4M77B 4CRIA 4JLIA 3ZEHA 4C8QE 1IZ6A 2P4TA 1WNLA 3FRNA 3CPFA 4JRPA 1KD1C 1Q86U 2CYZB 4C8QA 3NTHA 1I8FA 5AYFA 5GANd 2RD1A 5LJ5h 1XNIA 5GAOp 4M77G 1VQ7A 4NC6A 2ZZDB 2M16A 3FB9A 5EJCA 2KK4A 1KQSA 1BI2A 3QO3A 3VKIA 5I21A 2BS3A 3CCRT 4JLGA 2RJEA 3HPWA 1VQPA 2ZGWA 3CCQA 2E6NA 2EQKA 1YHQA 4J7IA 5D6WA 4C5HA 3OW2S 1UGQB 3H4CA 2KVQG 2DD4A 4XTWA 4A4HA 5GAN4 4F7UE 5LJ5d 2Y90A 4B9WA 1BKBA 3HRSA 3JCMf 2QXFA 1Q82U 4F7UA 3SWNC 5KH6A 3QYEA 5GAN5 3M9QA 3S3NA 1K8AU 4C5GA 4XTUA 4M75G 3JCMW 2H3JA 4R55A 4E7KA 3CC4T 2DZCA 4P5NA 3QBYA 5FU6C 1VQ4A 2JTFA 4XK8E 4L6V5 3HHTB 2EYQA 1KC8C 2YRVA 4BDZA 5KE2A 2Y4XA 4HA8A 4JX4A 1QLBA 3QYHB 1H641 2BS2A 4KUIA 2BKDN 3DLLA 4JJNK 1IREB 5A0GA 5GAN3 1VQ8A 4N0AC 1M1KU 2CZ6B 5GAMj 3CC7T 3CBPA 4XTYA 2QDYB 4M7DC 3PFSA 3RKYA 2WJ9A 3OBYA 2HAXA 4Z6YA 4MMLA 3OYKA 2E5QA 2L3RA 2V8IA 4AKIA 2D0QB 2DPPB 1B34B 3FJPA 1Y96B 3CCLT 4L5GA 3DL1A 4LDXA 1N27A 1YCYA 2EJGA 2MMPA 3OA6A 2QA4T 4M7AG 4NL3A 3MEAA 2DO3A 4HCZA 3META 4N4IA 3VYGB 2DZ9A 1VQ5A 4HNTA 3M4YA 4DOVA 2PVOB 2RHXA 3OS0A 2F69A 2FVUA 3GF5A 3T9NA 2XK0A 3PMTA 3QYBA 3CMEA 4M7DE 2P0PA 4JRQA 4N0AA 4OGCA 1AHJB 1Q81C 1O75A 2DIQA 4M7DA 2OTJT 1VQNT 2VXEA 3JB9H 5LJ3h 4ZTJA 1VQ9A 4J6XA 2VV5A 5GMKl 3CCJA 3C4SA 4V2SA 1FXXA 2EQUA 3BG3A 2KMTA 2XG8D 4RCBA 5CR2A 3WVEB 5CQYA 4E47A 2EFIA 2O4XB 3M56A 3F70A 4ELYC 5CCAA 3MP8A 4IUUA 1HK9A 2A3LA 2DEQA 3OBWA 2K2VA 1BIAA 3MHXA 3P8DA 4M78B 3ZFJA 5GMKm 1W2BA 3QHSA 3CMAT 2DKGA 2DXCA 4EMKA 4X9CA 1QVPA 3M57A 5I2MA 4D6WA 3PTAA 4PJOG 2GFAA 5LJ3d 5LJ5f 3FIFA 4RG8A 2LT4A 1M8VA 4IUTA 4C8QB 1VQ6T 3RESA 1K73C 2EJFA 2FB7A 1LOJA 2JOYA 2DVEA 2XDBA 2R57A 4N4HA 3I56A 4C0GA 1YJ9T 3MEVA 4ZGJB 3M54A 3OYJA 3QZ9B 4C8QG 1QVFA 4J5YA 3GLXA 2R5MA 3O8VA 3TW6A 4PLLA 3PIOA 3M5AA 4KUDK 2AHJB 3VJPA 2RK1A 3OMGA 3CCVA 3SD4A 4YTLA 3OQ5A 1YITA 1HXDA 1MHNA 4UC4A 4C5IA 3LWIA 4AKHA 3BDLA 4DA4A 1VQOA 3L2QA 3I55T 1VQLT 2RI3A 3UPUA 1Y7XA 4GY5A 3L2WA 3G71A 4F7UB 2ZPBB 3HO8A 4DQ2A 4M78F 1KQSS 2DTHA 2DJZA 3C94A 4C92C 2PU9B 1NPPA 5IAYA 1U1SA 1S72A 3JB9F 2E10A 4BBRM 2DD5A 3CD6T 2YHTA 1OZ2A 4JRKA 2VXFA 2DXUA 3GNFB 4ZGDB 4F7UG 2EAYA 2DTIA 3ASKA 4J6YA 2K5LA 1JJ2S 2JN0A 5CKBA 3VUZA 2KDSA 2XHCA 4MZPA 2IVWA 1X6OA 4X9DA 5CIUA 5D6XA 4LDYA 2CZ1B 2KQWA 3V7CA 2QQAA 3JCMV 4C5EA 3GIBA 1G3WA 1NPRA 4M7AD 2A7YA 2VYTA 5FU7C 4C92E 2XDPA 3QG1A 5GMKe 4ATOA 3OMCA 2OAUA 3V8LA 4XU3A 5KCHA 4KULA 3SWNB 1G5VA 2QQ9A 1N8RC 4C92A 2ZPIB 1VUBA 1UGSB 3JB9I 1ZQ1A 4QQ6A 1YI2T 4QW2A 4QVCA 2QF7A 5C0MA 5FU6B 3JCMc 3CPWA 2DK3A 3E19A 3JB9J 3L2ZA 3VKGA 2KMGA 2E64A 2RJDA 2YLCA 3L2RA 3L2UA 3QSUA 3KHIA 4LD6A 5M9OA 4M7AF 1Q7YU 2LT1A 3HKSA 3NTIA 3CBMA 3S6WA 2RM4A 5LJ5j 2EJ9A 4BI4A 4ZN3A 1YIJA 4M77D 4E7LA 1M90C 2RA2A 3NFCA 5LJ3f 2OTLA 3QDRB 2D9TA 2K3YA 1QVGS 1N9RA 4M75B 4OF1A 5CO7A 2EWNA 3OYYA 3S3OA 4RG2A 1I5LA 1N6AA 2V8KA 1G3YA 2CZ7B 2MAMA 3BFMA 3HP9A 4J83A 4E7JA 2QEXA 1ZHIA 3CC2A 2XI9A 1NJIU 4M7DG 2WACA 3G4ST 4OB1B 1D3BA 4BE1A 4M77F 1WGSA 2R58A 1Q86C 4RCCA 5FROA 1VQMT 2XIDA 4FIBA 4Y91A 5GMKi 3OYMA 2LNVA 3QKJA 4IKFA 2EQMA 2MWOA 1KQ2A 4ELJA 1WJQA 2K3XA 3RERA 3RUXA 3QJ6A 3DB3A 5J39A 5KCOA 1K9MU 3FLGA 2GCXA 3M59A 3HRUA 3GOXA 4HCBA 2FL7A 5CAIA 3JCMJ 3HL8A 1VQKA 2PQWA 5GANg 3E1SA 3OS2A 3CEYA 4BDYA 3CCMT 3HBLA 5L8RE 1Q82C 1V29B 1Y07A 5A2QE 4NL2A 3OYGA 4M75F 1YBYA 5GAN8 4KBMB 1K8AC 1H3ZA 1RI0A 5DLQE 4KT0E 1YJWT 5HK3A 4J6WA 3WVDB 2RHZA 2X4XA 3OS5A 2FYKA 4ME7A 4QSHA 4EMKC 1ZBXA 3RKXA 4MZMA 4MIMA 2RHUA 5C6SA 3FEOA 3DKMA 5J26A 2CGHA 4LDWA 2KSSA 2VGMA 4M77A 2DD5B 3BDUA 1M1KC 3CCST 5CKFA 5CKDA 3PIPA 2RO0A 5GAMe 3CXCS 3CCET 1NZ9A 4MFDA 2K57A 2X4YA 2L8DA 3FDRA 3G6EA 3OW2A 2E70A 3CBOA 3PGGA 3H8ZA 2JVVA 3JCMb 2ZZDA 3OYCA 4II1A 2RJFA 4A54A 2M1HA 2X35A 4PJOB 2CKKA 3LWHA 5LJ3j 3RMSA 3TEEA 5GAN2 3V8KA 2RI5A 2G3RA 4EMGA 1VQ7T 4FU6A 2K5IA 2EIFA 1M1FA 5A0DA 4PLIA 2ZPGB 3C95A 4BB7A 1KHCA 2F5TX 3HRTA 1U8RA 3KXTA 1VQPT 3CCRA 4HNUA 3OYNA 4C92B 1UB4A 3PMIA 3BG9A 3BW1A 2MWPA 4FT4A 4IUPA 4MDWA 3UT1A 5GAMg 5CQXA 3CC7A 3CCQT 1YHQT 1GXIE 3C12A 1R8OB 2LX9A 3QJYA 2LCCA 2VUBA 3MO8A 1MGQA 2YLBA 3X28B 4TVRA 4BD3A 4BE2A 3JSCA 2BS4A 4M78D 2WSCE 4J7FA 4C92G 3JB9D 5J3BA 4HLQA 4ELZC 2MI6A 3PT9A 3UWNA 5FLXE 1DJ7B 1WJSA 5CVIA 4O6JA 1WQWA 2CS7A 5CKEA 2LQKA 3M53A 1G3SA 4FM4B 2DD4B 3VUBA 4LOCA 3G7ZA 4O5VA 4BY6C 4C8QD 1M5Q1 1M4ZA 1VQ4T 3CC4A 2DTOA 4PJOF 5FU7B 4JX6A 3SDZA 1BI3A 2KY9A 3E9FA 1PSFA 2M0OA 3QUIA 3JCMe 4IURA 2QFZA 4PKCC 4LD9K 3JCMX 2RJCA 1D3BB 3J81E 1VQ8T 4BBSM 5GMKh 4FSXA 2NLUA 2P0QA 1Y96A 4C0DC 3QWLA 4C8QF 3A8GB 3E9GA 4XTXA 2E6ZA 3VKHA 2DIGA 5GAOn 3VYHB 4E7IA 1VQKT 1WPYA 4R56A 2KR6A 3MP1A 5GMKj 2RB6A 3KBGA 4QQDA 1OYXA 3VYGA 3X20B 4XU1A 5D6YA 1KD1U 4J8OA 1FWZA 2GF7A 3CCLA 5IT9E 1X75C 3JCMg 3FC3A 5IN1A 2QA4A 1PSEA 3EFSA 2C06A 1XQHA 2QQSA 4OB2B 3RIRA 3JCMQ 1BI1A 1VQ5T 1FKMA 3HB9A 3MCAB 2JUFA 2HQEA 2P0KA 4JUVA 4RKUE 4VUBA 3UDCA 3QZ5B 3CMET 5CKHA 1VIEA 1OZ3A 4F7UF 1SSFA 2HNIA 2PUKB 3LH0A 1WJRA 4MMKA 3EAEA 4HL4A 3RMQA 1OI1A 2OTJA 2E12A 2LDMA 1VQ9T 1VQNA 1G3TA 2XU8A 3OYHA 2LVMA 4M78A 3CCJT 1XOVA 3A8HB 4OMFB 1EIFA 3JCMP 1UGRB 3HSBA 3SB2A 1I4K1 4OB0B 2GQVA 2HQXA 4JRIA 3BY7A 4M7DB 3NTKA 1YJNA 4JDSA 2VC8A 1LJOA 2PVGB 5GANe 2WSFE 4B9XA 5DLOA 5GAN7 3CMAA 2DXBA 5GAOr 4M7AC 3WXMB 3OYFA 1KC8U 3CCUA 3EFRA 4NS5A 3OY9A 2RHIA 1KQ1A 3TREA 4A4EA 5HY6A 3Q1JA 2QDJA 4IUVA 3JRZA 2DXCB 1VQ6A 2RK2A 4M75D 4EMKB 4M7DD 3HFNA 2WSEE 3I56T 2QQ8A 1I81A 2LQ8A 3H6ZA 1Q7YC 2K5FA 1JJ2A 3URGA 1RL2A 2QI2A 3LLRA 5LJ5e 1YJ9A 3V8JA 3X24B 4M77C 2PUOB 2O01E 4XTVA 3V7SA 4M7AE 3CCVT 1VIFA 3VV0A 4EPCA 3OYBA 4OB3B 3KUFA 1YITT 4M7AA 1W2BS 2XDDA 3V7RA 3OS1A 3TCJA 1VQOT 2JNGA 2IG0A 1TH7A 4IUQA 4M7DF 3OYDA 3I55A 2RHYA 2Y4YA 2KAFA 3DLMA 3LYIA 3G71T 3QYGB 5GAMh 1VQLA 3LX7A 1S72T 1NJIC 4NOYA 3VU3C 4XU0A 1KG1A 3P8BB 2LC4A 1E7PA 1M9SA 3OB9A 3A8LB 4EMHA 4PNOA 4AI6A 3R6OA 1Q81U 3ZBDA 3L2VA 2DXTA 3CD6A 2RH2A 1KHIA 4M6VA 4MZTA 4M77E 4BE0A 5LJ5g 4DOWA 4M75C 4XQ3A 3OYEA 1WQ7A 2L5QA 1QVFS 2FHDA 4ZGEB 1K9MC 3HZJA 3GNGA 3M4GA 5GAMd 3SWNA 2M9UA 1BI0A 1QVGA 2BIVA 4XAXB 4QVDA 1U1TA 4Y28E 4OP0A 3N5BB 2QQRA 2RI2A 3OYAA 5DY9A 5LL6S 3DB4A 2LRQA 2E1HA 2ZPFB 1QW1A 2LCLA 1YI2A 3A8OB 5KE3A 2PVDB 4HNVA 4M75E 4BY6B 2EKOA 4XTZA 5I2SA 4HT9A 1K73U 4C0FA 2L89A 1O9SA 3ME9A 4M75A 1QP3A 3X26B 3HFOA 2ZPEB 1Y71A 1LNXA 4BACA 4BUGA 1X01A 5GANf 3LW5E 4ZTFA 1YIJT 3A5ZB 1W4SA 4A53A 5CK9A 1QP2A 3ER0A 2EQJA 2OTLT 2HD0A 3OYLA 4PJOD 3JCMh 3M58A 4C0DB 3J7AF 2ZPHB 1YJNT 3GPLA 2X4JA 2JZ2A 4A4KA 2QQBA 2G77A 4RMOA 4FT2A 2QEXT 4ZN1A 3CC2T 1UGPB 5A0LA 4JX5A 5DM7R 3J80E 3OSVA 3CCUT 4C92D 5LJ3e 4BI3A 3G4SA 1FX7A 4LDVA 3S3MA 3M55A 4A4FA 4M78G 3CPWS 2E65A 4E7HA 3JB9G 3JCMd 3L1AA 4EDUA 1VQMA 5GAOq 4WF2A 4X34A 4OGEA 2DXBB 4HCCA 1XTDA 2K4YA 2X4WA 1JRIA 3OSSC 3L42A 3MP6A 5GAOl 3TW7A 1P92A 1B34A 4CI0C 3MEWA 3MEUA 2ZCFB 3INZA 4C92F 2VGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8H B;  1UGR B;  3WVE B;  4OB0 B;  5L8R E;  1V29 B;  3A8M B;  3X25 B;  2PVG B;  2WSF E;  2DXB A;  2DXC A;  4KT0 E;  3WVD B;  3QXE B;  2DXC B;  2CZ0 B;  2WSE E;  2DD5 B;  1JB0 E;  4ZGJ B;  3QZ9 B;  3X24 B;  2PUO B;  2O01 E;  2AHJ B;  4OB3 B;  2ZZD A;  2CYZ B;  3QYG B;  2ZPB B;  2ZZD B;  2PU9 B;  2ZPG B;  3A8L B;  2DD5 A;  4ZGD B;  1GXI E;  3X28 B;  1UGQ B;  4ZGE B;  2DD4 A;  2WSC E;  2CZ1 B;  1DJ7 B;  4Y28 E;  4FM4 B;  2DD4 B;  2ZPF B;  4XK8 E;  2ZPI B;  4L6V 5;  1UGS B;  3HHT B;  3A8O B;  1PSF A;  2PVD B;  3QYH B;  1QP3 A;  3X26 B;  2ZPE B;  1IRE B;  3LW5 E;  2CZ6 B;  1QP2 A;  2QDY B;  3A8G B;  3VYH B;  2ZPH B;  2D0Q B;  3VYG A;  2DPP B;  3X20 B;  2CZ7 B;  1UGP B;  1PSE A;  4OB1 B;  4OB2 B;  3VYG B;  2PVO B;  4RKU E;  3QZ5 B;  2DXB B;  1AHJ B;  2PUK B;  2ZCF B; 
#chains in the Genus database with same CATH topology
 4PJO C;  3CXC A;  4Z88 A;  2JTM A;  1RAA B;  4QVZ A;  3A8M B;  5GAO m;  4OVA A;  1K73 R;  1H27 B;  1QCO A;  4C0Z A;  5IDN B;  2QEX Q;  2I2L A;  2D6F A;  4RTX A;  4LDU A;  1BIB A;  4BI8 B;  3EID B;  3JAM E;  2DJQ A;  5FRN A;  4PJO E;  3OYI A;  4M7A G;  1HJD A;  2DAQ A;  4PL6 A;  4MDX A;  3TU4 K;  3G6E T;  1MV0 B;  2O88 A;  3GBQ A;  4M4Z A;  2O31 A;  1OI9 B;  3LGL A;  5GAN j;  3BG5 A;  1NEB A;  1EZZ B;  1OV3 A;  2P4T A;  3CPF A;  1VYT A;  2CYZ B;  5GAN d;  3NPF A;  3EHR A;  1RAB B;  5GAO p;  1VQ7 A;  2ZZD B;  2KK4 A;  2BS3 A;  2RJE A;  3HPW A;  2FRY A;  2MCN A;  2EQK A;  4XTW A;  4FW2 A;  2I53 A;  1VQ9 Q;  3JCM f;  1M30 A;  3TNW B;  3SWN C;  5GAN 5;  3QYE A;  5FU6 C;  1JQQ A;  2JMA A;  4HA8 A;  2BKD N;  1IRE B;  2VKN A;  5KYU B;  2FPF A;  3QDF A;  3CC7 T;  4M7D C;  1NYF A;  3RKY A;  2WJ9 A;  2YUP A;  2NWM A;  4IIO A;  3OYK A;  4J9C A;  4J9E A;  3TQ7 P;  4AKI A;  4L5G A;  4PJN A;  4LDX A;  1N27 A;  1YCY A;  3F5X B;  2MMP A;  2QA4 T;  3AT1 B;  2CH4 W;  3ULR B;  2C5V B;  1ZUU A;  4YOO A;  2PVO B;  2FVU A;  3GF5 A;  4M7D E;  1FVV B;  4N0A A;  1LPL A;  2JS0 A;  5GMK l;  4CC3 A;  2KMT A;  4RCB A;  1B3Q A;  4HT9 A;  4F14 A;  5CCA A;  3F70 A;  1HK9 A;  2A3L A;  1FMW A;  1AWX A;  2DEQ A;  3OBW A;  4M78 B;  2JTE A;  1WHL A;  3CCL Q;  1X6G A;  2WFY B;  4X9C A;  1QVP A;  3M57 A;  5LJ3 d;  1OGU B;  1LCK A;  2LT4 A;  1M8V A;  4C8Q B;  1VQ6 T;  1K73 C;  1URC B;  2R57 A;  4N4H A;  3I56 A;  4C0G A;  3MEV A;  3OYJ A;  2EYZ A;  4J5Y A;  2R5M A;  3PIO A;  2PK9 B;  2DL7 A;  1MHN A;  1ZUK A;  3POM A;  5EC7 A;  3LWI A;  4AKH A;  3BDL A;  4DA4 A;  3G71 A;  1U06 A;  1NLP C;  2DNU A;  1S72 A;  4C92 C;  3EGD A;  4RTU A;  2DD5 A;  3CD6 T;  1M2O A;  2YHT A;  3EOC B;  4F7U G;  4ZGD B;  1OOT A;  4CFU B;  3VUZ A;  4MZP A;  3VRZ A;  4EOL B;  4LDY A;  2CZ1 B;  3V7C A;  1D3U B;  5FWC A;  2K9G A;  4C92 E;  1UE9 A;  2FZC B;  2OAU A;  3V8L A;  1G5V A;  2J06 A;  1TG0 A;  1VUB A;  1G83 A;  4J9F A;  1HSQ A;  3JCM c;  3I5S A;  3JB9 J;  2KMG A;  4M7A F;  3CBM A;  2X3X D;  2K7A A;  1OKW B;  4F7S B;  1BB9 A;  3VS3 A;  2OTL A;  2AT1 B;  2C0I A;  3PVQ A;  4M75 B;  3REA B;  2M02 A;  2NUZ A;  4RG2 A;  1N6A A;  4J83 A;  3BFM A;  1YP5 A;  3CC2 A;  1ZUY A;  2LJ1 A;  2R58 A;  1M90 R;  5FRO A;  4IKF A;  1FYN A;  2EBP A;  1KQ2 A;  3OW2 P;  4ELJ A;  2K3X A;  1K9M U;  5GJV B;  2COW A;  2WEV B;  3HRU A;  4BCK B;  2LX7 A;  2CT3 A;  1UG1 A;  3OS2 A;  3HBL A;  1AWO A;  1Y07 A;  2GQI A;  1YBY A;  1XO2 A;  1CSK A;  4KT0 E;  1JST B;  2X4X A;  1G2B A;  3DKM A;  1H92 A;  3H0I A;  2CGH A;  2KSS A;  4CC7 A;  2VGM A;  1CKB A;  1K8A R;  2J6K A;  3BDU A;  1YWP A;  3CCS T;  1NZ9 A;  2X4Y A;  2X51 A;  3FDR A;  3CC7 Q;  3CBO A;  3DDQ B;  2JVV A;  2ZZD A;  2LNH B;  1I0C A;  2X35 A;  4PJO B;  1KSW A;  3TEE A;  4KH1 B;  1H4L D;  1H25 B;  3PE0 A;  2G3R A;  2QA4 Q;  4FU6 A;  1KJW A;  3C95 A;  4BB7 A;  1KHC A;  1GCQ A;  2F2V A;  3OYN A;  1H3H A;  3BG9 A;  2C6T B;  5GAM g;  1GXI E;  3CC7 A;  2VUB A;  1MGQ A;  3X28 B;  1WIE A;  4BCG B;  4ELZ C;  1WQW A;  1UTI A;  1M4Z A;  2FZG B;  5FU7 B;  5KYU A;  3E9F A;  2ED1 A;  2RMO A;  4LD9 K;  1IGQ A;  3J81 E;  3EG1 A;  2O2O A;  3VRY A;  1VQ6 Q;  4C0D C;  2E5K A;  1IGU A;  1MV3 A;  4XTX A;  3VKH A;  3VYH B;  4E7I A;  1ZA1 B;  1R77 A;  2DVJ A;  3U23 A;  2MIO A;  5GMK j;  1MUZ A;  4XU1 A;  1KQS P;  2DA9 A;  5D6Y A;  5IT9 E;  1QCN A;  2HDA A;  2C06 A;  5BNJ B;  4K11 A;  3RIR A;  2K3B A;  1T0J A;  3JCM Q;  2ECZ A;  1S1N A;  4IMY B;  2HQE A;  1JJ2 P;  3CME T;  4CC2 A;  5CKH A;  1O9K A;  4F7U F;  2HNI A;  3CD6 Q;  3EAE A;  4AG1 C;  1VQN A;  2RQV A;  2W99 A;  3CCJ T;  2LVM A;  4M78 A;  1XOV A;  3A8H B;  4OB0 B;  2GQV A;  2KXD A;  4M7D B;  4BCM D;  2C5X B;  5DLO A;  3CMA A;  3IQL A;  5HNB B;  3WXM B;  3CCU A;  3OY9 A;  2FZK B;  5HY6 A;  2IW9 B;  3Q1J A;  4IUV A;  3JRZ A;  5IXB A;  2DXC B;  4EMK B;  4M7D D;  4BCI B;  1TS9 A;  2QI2 A;  2DYB A;  3V8J A;  3X24 B;  3V7S A;  4CFW B;  3VV0 A;  1SEM A;  2XDD A;  1VQO T;  1ABO A;  5GAM h;  3LX7 A;  3VU3 C;  3A8L B;  1MMG A;  1R0B G;  2EPD A;  1UGV A;  1GCQ C;  4AFQ C;  4XQ3 A;  1LVK A;  2OJ2 A;  2FHD A;  3I56 Q;  1K9M C;  1RAD B;  2DM1 A;  2BIV A;  1PC0 A;  1TUG B;  1U1T A;  4Y28 E;  4OP0 A;  3N5B B;  4AMC A;  2RI2 A;  3OYA A;  2ROL A;  3LH5 A;  2AZV A;  2FEI A;  5KE3 A;  2PVD B;  4BY6 B;  2AZS A;  1D0X A;  4M75 A;  2IW6 B;  3H0F A;  4BUG A;  1WLP B;  5GAN f;  4ZTF A;  1YIJ T;  1W4S A;  1QP2 A;  2B9R A;  2MYS A;  1GRI A;  4DEY A;  2QG9 B;  1PWT A;  2JMC A;  1H1Q B;  2ZPH B;  3BHU B;  1R0C B;  2JM9 A;  5L2W B;  1XJW B;  4FT2 A;  2QEX T;  4ZN1 A;  3CCU T;  3J80 E;  3OSV A;  1OIU B;  4C92 D;  3G4S A;  1X43 A;  4LDV A;  2UZL B;  2UUE B;  2OX7 A;  4A4F A;  4E7H A;  3BE3 A;  1VQM A;  3L1A A;  1UFF A;  4WF2 A;  4OGE A;  1Q95 G;  1Z9Z A;  2V1Q A;  1XTD A;  2AKL A;  2D8J A;  2LQW A;  1JEG A;  3G33 B;  3L42 A;  3MP6 A;  2DX1 A;  3MEW A;  4FYV B;  2PTK A;  2XIC A;  2A28 A;  2EYW A;  3PNW C;  2OTL Q;  3AHU A;  4M78 C;  4Q5W A;  1F5Q B;  3CCM A;  5LJ3 g;  1GY3 B;  3X25 B;  1M2V B;  3O0G D;  3CC2 Q;  1YJW A;  2ED0 A;  3HTR A;  4C8Q C;  4M7A B;  1C0M A;  2XD0 A;  4GLM A;  3QXE B;  4AG2 C;  4F7J B;  4CRL B;  4BY7 X;  2E4H A;  5GAN h;  2F2C A;  1RAH B;  4WTO B;  4JS4 A;  2MF2 A;  2O4X A;  4M78 E;  3GP8 A;  4A4G A;  4PJO A;  1JBM A;  3CCE A;  4FSS A;  8ATC B;  1WFW A;  1SPK A;  2GFU A;  4XU2 A;  4QQG A;  3R6N A;  4JLI A;  4C8Q E;  3EJ1 B;  1WNL A;  1WI7 A;  1M3A A;  4EOJ B;  3NTH A;  1I8F A;  5AYF A;  4RUG A;  4M77 G;  5EJC A;  3M0R A;  2GGR A;  3VKI A;  4JLG A;  2BTT A;  5I11 A;  3CCQ A;  2E6N A;  1YHQ A;  5D6W A;  4F6W B;  2IPO B;  2J7I A;  2JXB A;  1NYG A;  3OW2 S;  4DEX A;  5LJ5 d;  1W1F A;  4B9W A;  3THK A;  2J6O A;  3EGX A;  5KH6 A;  4ROC A;  4OMO A;  4F6S B;  1GUX A;  4C5G A;  2H3J A;  4R55 A;  4P5N A;  3QBY A;  4J9H A;  1VQ4 A;  1D09 B;  1K76 A;  2Y4X A;  2RPN A;  1VOL A;  1H64 1;  2KT8 A;  4LE9 A;  5KYY B;  2CZ6 B;  5GAM j;  2QDY B;  4EOM B;  4Z6Y A;  2L3R A;  2YUN A;  2D0Q B;  2KRM A;  4F17 A;  1WXT A;  1Y57 A;  1K0X A;  3CCL T;  1YWO A;  3MY1 B;  2M51 A;  2EJG A;  3EFO B;  4FCY A;  4ZNX A;  2CH4 A;  1VQO Q;  3VYG B;  1VQ5 A;  1PHT A;  4EOR B;  2F69 A;  2DMO A;  4JRQ A;  1O75 A;  4M7D A;  2OTJ T;  1TU0 B;  2VXE A;  2EGE A;  5LJ3 h;  1B7T A;  2V22 B;  1J3T A;  2XG8 D;  3BG3 A;  5CR2 A;  2D0N A;  3MHX A;  1BIA A;  4OMQ A;  2DER A;  3QHS A;  2DKG A;  2DXC A;  4EMK A;  1SRM A;  5I2M A;  3MKD A;  1P5E B;  3FIF A;  4D8K A;  4B6M A;  4IUT A;  3K7A M;  3RES A;  2FB7 A;  1TOV A;  2DVE A;  1YJ9 T;  4CFN B;  3M54 A;  2C0T A;  1VQN Q;  1YIJ Q;  4KUD K;  3VJP A;  2RK1 A;  3OMG A;  3CCV A;  2DE0 X;  2FPE A;  1YIT A;  4E7Z A;  2P4R A;  4UC4 A;  4C5I A;  1ZX6 A;  4KGV B;  2KE9 A;  5IHY A;  3UPU A;  1Y7X A;  3CMA Q;  3L2W A;  4F7U B;  2ZPB B;  1QWF A;  1KQS S;  1ZSZ C;  2DJZ A;  4LXC A;  2PU9 B;  3CCU Q;  3MJX A;  4BBR M;  1EX4 A;  4OMM A;  4JRK A;  3GNF B;  2EAY A;  3ASK A;  2PK2 A;  4J6Y A;  1JJ2 S;  5CKB A;  4X9D A;  4OML A;  2KQW A;  2QQA A;  3VS7 A;  3JCM V;  2DLP A;  1G3W A;  1TXQ A;  1NPR A;  5AT1 B;  4F7L B;  2A7Y A;  2J05 A;  2VYT A;  5FU7 C;  3QG1 A;  1YN8 A;  4XU3 A;  1GH6 B;  4KUL A;  2K79 A;  4C92 A;  1YI2 T;  2HZY A;  2YDL A;  2DRK A;  4QVC A;  5C0M A;  5ACB A;  3E19 A;  3L2Z A;  3VKG A;  3QSU A;  2RJD A;  3L2R A;  2BZ8 A;  3L2U A;  3KHI A;  3NTI A;  2OI3 A;  2EJ9 A;  3EH2 A;  4ZN3 A;  2CRE A;  1N4M A;  2D9T A;  2K3Y A;  1N9R A;  1TSF A;  4OF1 A;  3S3O A;  2EWN A;  4EOP B;  3HP9 A;  1IXD A;  1NJI U;  4M77 F;  3M0S A;  2XID A;  3OYM A;  2EYY A;  2KBT A;  2EQM A;  2MWO A;  1AOJ A;  1WJQ A;  3RER A;  5J39 A;  5KCO A;  2IIM A;  3FLG A;  3M59 A;  2DEU A;  1X6B A;  1H1S B;  2FL7 A;  2ROT A;  3JCM J;  3HL8 A;  1VQK A;  3E1S A;  3CEY A;  5ICP B;  5L8R E;  3OYG A;  1JXM A;  5GAN 8;  2M0Y A;  1H3Z A;  1D1B A;  1BU1 A;  4ORZ A;  1G8X A;  3G4S Q;  2MPX C;  3EG0 A;  4ME7 A;  4EMK C;  1OL1 B;  1ZBX A;  2ZAE A;  1VQM Q;  2CUB A;  2RHU A;  4PJL A;  4BCP B;  2A0F B;  5J26 A;  2WMB B;  2B86 A;  3PIP A;  2RO0 A;  5GAM e;  1NJI R;  1KIK A;  2K57 A;  4MFD A;  3OW2 A;  1QKX A;  3H8Z A;  4II1 A;  2IN3 A;  3CCM Q;  5LJ3 j;  3RMS A;  5GAN 2;  3V8K A;  2AK5 A;  4EC9 B;  4I3Z B;  2RI5 A;  1VQ7 T;  2EYX A;  4JJD A;  2EIF A;  2K5I A;  1OKV B;  4Y92 A;  1Y0M A;  3CCR A;  1WYX A;  4FT4 A;  1OIY B;  4CFV B;  4J9B A;  3MI9 B;  4Y72 B;  2JGZ B;  3MO8 A;  4TVR A;  4BD3 A;  1U3O A;  2OTJ Q;  4M78 D;  4J7F A;  5J3B A;  1H28 B;  3GTM S;  3CCE Q;  1SF9 A;  4O6J A;  2CS7 A;  1G3S A;  2DD4 B;  2KRS A;  4PFZ A;  4O5V A;  3ZL7 C;  4BY6 C;  1M5Q 1;  4C8Q D;  3CC4 A;  3SDZ A;  1BI3 A;  2KY9 A;  5HQ0 B;  2AKK A;  1BBZ A;  2QFZ A;  1AVZ C;  2RJC A;  1D3B B;  2V1R A;  5GMK h;  2NLU A;  2P0Q A;  3CCQ Q;  4FW1 A;  1E7O A;  4PK4 A;  1VQK T;  2E6Z A;  1AZE A;  1NM7 A;  1WPY A;  4R56 A;  1YJ9 Q;  2KYM A;  3VS0 A;  2RB6 A;  4KH0 B;  1OYX A;  3VYG A;  3X20 B;  2X9H A;  4PJJ A;  1KD1 U;  4J8O A;  2I0N A;  1M3C A;  2A37 A;  1NG2 A;  5IN1 A;  2CP5 A;  2QQS A;  4OB2 B;  3NHN A;  1FIN B;  4CFM B;  3HB9 A;  4CFU D;  4VUB A;  1IHW A;  1KK7 A;  3KFV A;  4MMK A;  2CUD A;  3RMQ A;  3VS1 A;  2LDM A;  1TWB A;  4ESR A;  1G3T A;  1WA7 A;  4OMF B;  3JCM P;  3HSB A;  1UGR B;  3SB2 A;  4DBQ A;  2HQX A;  1HD3 A;  2LQN A;  1UJY A;  3NTK A;  1YJN A;  1ENW A;  4JDS A;  4YC3 B;  2VC8 A;  5GAN e;  4M7A C;  2WSF E;  1KC8 U;  3I35 A;  1KFZ A;  2YWW A;  4NS5 A;  5KYW A;  2G6F X;  4II5 B;  5IH2 A;  1YI2 Q;  3TRE A;  4A63 B;  2YXY A;  4M75 D;  3HFN A;  2WSE E;  3I56 T;  2JM8 A;  1KD1 R;  1I81 A;  3H6Z A;  1GL5 A;  1JJ2 A;  3URG A;  1RL2 A;  1N5Z A;  2PUO B;  2O01 E;  4XTV A;  4M7A E;  1M3B A;  1E9H B;  1VIF A;  4EPC A;  4F70 B;  4OB3 B;  1WHG A;  2CP3 A;  5HBJ B;  3OS1 A;  1YFN A;  3TCJ A;  4WCI A;  2IG0 A;  1TH7 A;  4IUQ A;  3OYD A;  3I55 A;  2RHY A;  2Y4Y A;  3G71 T;  1VQL A;  3QYG B;  1S72 T;  1NJI C;  1HYO A;  2DBK A;  2DL5 A;  1M9S A;  1UHC A;  4PNO A;  4ROD A;  4AI6 A;  3ZBD A;  3L2V A;  2HSP A;  2RH2 A;  2C4G B;  4M6V A;  1ZP2 A;  2EGA A;  5LJ5 g;  4JJB A;  4EOQ B;  3OYE A;  1WQ7 A;  3NGP A;  3GNG A;  1KC8 R;  3M4G A;  3O5Z A;  3CCV Q;  2K6D A;  2LRQ A;  2E1H A;  2ZPF B;  5GJW B;  3BHT B;  2JT4 A;  1QW1 A;  2LCL A;  1K9M R;  2EVR A;  4XTZ A;  1QP3 A;  3X26 B;  9ATC B;  1ZSZ B;  1OL2 B;  2ZPE B;  1C9B A;  5IXF A;  2HCK A;  2KYB A;  2OTL T;  4PJO D;  2LW4 A;  2YRC A;  1YJN T;  4A4K A;  2WIP B;  2QQB A;  1VYU A;  3CC2 T;  1UGP B;  5A0L A;  3QWX X;  2DET A;  5LJ3 e;  1I5O B;  4BI3 A;  3M55 A;  4M78 G;  2CCI B;  2E65 A;  3RGF B;  3JCM d;  4RTW A;  1VQ7 Q;  4X34 A;  2W9F A;  2DXB B;  2K4Y A;  2QDL A;  1SHG A;  3TVT A;  5GAO l;  4TTH A;  3TW7 A;  1M27 C;  2ZCF B;  2CSI A;  3NMZ C;  3RKW A;  2F5K A;  4FYX B;  3SFM A;  1AD6 A;  2LTO A;  1H24 B;  1UNL D;  2A08 A;  2H8H A;  1OX9 A;  1N8R U;  2BPM B;  3EG9 B;  1D1A A;  2IW8 B;  4YOZ A;  5EG2 A;  4JS5 A;  5GAM f;  1UHF A;  4FL6 A;  4MFE A;  2V8J A;  4AFU C;  5HK0 A;  5FRM A;  8AT1 B;  2HBP A;  1N9S A;  2XKO C;  1M1G A;  4RTZ A;  2QTX A;  2CZ0 B;  4AKG A;  1W70 A;  2R5A A;  4BCN B;  1BYM A;  2RNA A;  3M0Q A;  2C5N B;  5HCK A;  2C5O B;  2EUF A;  2KI7 A;  2SEM A;  4L59 A;  2QK0 A;  1BU2 A;  4N4G A;  1VQK Q;  5GAN 6;  4M77 B;  3EG3 A;  1IZ6 A;  1E6H A;  3LQ5 B;  4BCF B;  3FRN A;  2W96 A;  4EON B;  1B07 A;  2RQW A;  4JRP A;  1KD1 C;  4C8Q A;  1PRL C;  2RD1 A;  5LJ5 h;  1XNI A;  5L23 A;  2CJM B;  4NC6 A;  2WXV B;  2M16 A;  3FB9 A;  2FO0 A;  2NYS A;  1BI2 A;  2DBM A;  4UN0 A;  1VQP A;  2ZGW A;  3MPU B;  2DYI A;  4J9I A;  1N8R R;  2KVQ G;  3H4C A;  2DD4 A;  4A4H A;  2COZ A;  2NUP B;  4F7U E;  2Y90 A;  1RAE B;  1BKB A;  2PMI B;  1JSU B;  2UZB B;  5D7U A;  1GBQ A;  3S3N A;  3M9Q A;  2W0Z A;  2W9Z A;  4M75 G;  4E7K A;  1WHM A;  2EGC A;  2DZC A;  1OX8 A;  4GBQ A;  2Z0W A;  4L6V 5;  2EYQ A;  1KC8 C;  4BDZ A;  4JX4 A;  1QLB A;  3QYH B;  1OPL A;  4KUI A;  3BHV B;  3CCR Q;  4JJN K;  1VQ8 A;  1BCM A;  1M1K U;  3H9N A;  1SSH A;  3PFS A;  2HAX A;  4MML A;  1W2B P;  2E5Q A;  1H1R B;  1ZA2 B;  2DPP B;  1B34 B;  4FYW B;  1WXU A;  3OA6 A;  1WHH A;  3MEA A;  4HCZ A;  1VIN A;  2EW3 A;  4N4I A;  1YCS B;  1BK2 A;  1W6X A;  2DZ9 A;  4HNT A;  1V1C A;  3G1J A;  2RHX A;  3M4Y A;  4DOV A;  3G71 Q;  2G9X B;  1AWJ A;  3PMT A;  3QYB A;  1S72 Q;  1QVF P;  3MY5 B;  4OGC A;  1AHJ B;  1VQN T;  4ZTJ A;  1VQ9 A;  4J6X A;  2VV5 A;  3C4S A;  4J9G A;  2WPA B;  1FXX A;  2EQU A;  6AT1 B;  3WVE B;  5CQY A;  2EFI A;  3M56 A;  2DL3 A;  2K2V A;  3CMA T;  4BCQ B;  4ANJ A;  5GMK m;  4DBH A;  1NLO C;  3TNH B;  1M1K R;  1QLY A;  4PJO G;  4RG8 A;  1T3S A;  3H41 A;  3QHR B;  4HVU A;  3UAT A;  2CSQ A;  3D7S B;  2JOY A;  2XDB A;  5I22 A;  1IO6 A;  4ZGJ B;  4QT7 A;  4LUD A;  3GLX A;  3TW6 A;  4PLL A;  1IRX A;  2AHJ B;  2YUO A;  4JPB W;  3SD4 A;  4YTL A;  1BCO A;  5HBE B;  3OQ5 A;  1HXD A;  2R7G A;  1YJN Q;  3CQT A;  3CPW P;  4GY5 A;  4DQ2 A;  4M78 F;  3C94 A;  1NPP A;  2GNC A;  2VXF A;  2K5L A;  4BCH B;  1AWW A;  3TSW A;  2IVW A;  4CFX B;  5CIU A;  4OGR B;  1F1B B;  4BXX X;  2WHB B;  4M7A D;  3JV3 A;  2RN8 A;  5GMK e;  4ATO A;  3OMC A;  5KCH A;  4D8D A;  1ZSZ A;  2QQ9 A;  1N8R C;  1ZQ1 A;  4QQ6 A;  4CXA B;  2ATC B;  4QW2 A;  4FYY B;  2QF7 A;  4EOI B;  3DDP B;  2DK3 A;  4OR5 B;  3H0H A;  5M9O A;  1MMN A;  2LT1 A;  5LJ5 j;  4R0K A;  4E7L A;  2CP6 A;  3NFC A;  5I5Z B;  5LJ3 f;  1PCX A;  3QDR B;  1C1A A;  2EQI A;  2DL8 A;  1SG5 A;  3I9Q A;  4KGX B;  1X69 A;  2V8K A;  1C6V X;  1G3Y A;  2HL5 C;  2MAM A;  4E7J A;  1AEY A;  1ZHI A;  2XI9 A;  4AFZ C;  4M7D G;  2WAC A;  4J9D A;  3G4S T;  4BE1 A;  4DBR A;  1VQM T;  4Y91 A;  5GMK i;  2RQR A;  2HKN A;  3QKJ A;  4HVW A;  1U5S A;  1JO8 A;  3QJ6 A;  3DB3 A;  1UNH D;  3GOX A;  1D1C A;  2A36 A;  5CAI A;  2PQW A;  2YUQ A;  3CCM T;  5A2Q E;  4ELL A;  4M75 F;  4KBM B;  1UUE A;  2QGS A;  1RI0 A;  1YJW T;  2YRD A;  4J6W A;  2JS2 A;  1G3N C;  4PJM A;  2FYK A;  4QSH A;  3RKX A;  4MZM A;  4MIM A;  2HBW A;  4KRD B;  3FEO A;  3QWY A;  5C6S A;  1I07 A;  2L3Q A;  2LCS A;  4LDW A;  1UNG D;  2YT6 A;  3EGD B;  4HCK A;  4M77 A;  1AD5 A;  2DD5 B;  1M1K C;  5CKD A;  3CCE T;  3G6E A;  3PGG A;  4AFS C;  4Z8A A;  2M1H A;  1M1F A;  5A0D A;  2ZPG B;  2F5T X;  1U8R A;  3KXT A;  4HNU A;  3UT1 A;  4MDW A;  3BW1 A;  2MWP A;  3CCQ T;  1YHQ T;  2D8H A;  1MMA A;  5DQW A;  2LCC A;  3QJY A;  5KYX B;  2YLB A;  3JSC A;  4C92 G;  3JB9 D;  4NST B;  4HLQ A;  2F1L A;  3UF4 A;  3M0T A;  3PT9 A;  4EOK B;  3UWN A;  1WJS A;  1QWE A;  1UEC A;  3VUB A;  4LOC A;  1AZG B;  3G7Z A;  1VQ4 T;  4F16 A;  2DTO A;  4PJO F;  2M0O A;  3QUI A;  5IHI A;  3JCM X;  5FGK B;  1VQP Q;  4FSX A;  2PHG A;  1ARK A;  3QWL A;  5GAO n;  3A8G B;  1KXU A;  2DIG A;  2D1X A;  2KR6 A;  4IIM A;  4QQD A;  1FWZ A;  5HBH B;  1X75 C;  3JCM g;  2QA4 A;  1PSE A;  3EFS A;  1BI1 A;  1VQ5 T;  2NUT B;  5CEI B;  1OEB A;  1WHK A;  2P0K A;  4JUV A;  3UDC A;  1K0S A;  3QZ5 B;  2LMJ A;  4OMN A;  4LUE A;  1OPK A;  1SSF A;  2PUK B;  3LH0 A;  1WJR A;  1FMK A;  1VQ8 Q;  2E12 A;  2MK5 A;  1ZSG A;  4JZ4 A;  1UDL A;  1EIF A;  1WX6 A;  1PD0 A;  1VOM A;  1I4K 1;  4JRI A;  3BY7 A;  3DTO A;  2C0O A;  3BLR B;  3A98 A;  1TD6 A;  1LJO A;  5GAO r;  4B9X A;  3OYF A;  1QKW A;  2RHI A;  1NBE B;  1KQ1 A;  2GTO A;  4A4E A;  2QDJ A;  2WMA B;  1VQ6 A;  2RK2 A;  1QVG P;  3RR6 A;  2LQ8 A;  5LJ5 e;  1K1Z A;  4M77 C;  1M2V A;  3RNJ A;  1SKU B;  3CCV T;  3OYB A;  2E3H A;  3KUF A;  1YIT T;  2JW4 A;  4M7A A;  1W2B S;  1JKW A;  4M7D F;  4LNP A;  3DLM A;  2VAS A;  4NOY A;  4BCJ B;  4XU0 A;  3P8B B;  2LC4 A;  1E7P A;  4EMH A;  3R6O A;  2LJ3 A;  1Q81 U;  1IHV A;  3CD6 A;  1KHI A;  4MZT A;  4M77 E;  1VYV A;  4DOW A;  2L5Q A;  4BY1 X;  1QVF S;  4OMP A;  1WDX A;  3HZJ A;  1NEG A;  1OQK A;  4XAX B;  2BZY A;  1H8K A;  1W98 B;  3DB4 A;  2YSQ A;  1FMV A;  4HNV A;  1YJW Q;  2EKO A;  5I2S A;  3QHW B;  5IDP B;  4C0F A;  5ECA A;  1O9S A;  3CXC P;  3PVL A;  1Y71 A;  4BAC A;  2WIH B;  1X01 A;  2DFU A;  2HSE B;  1PKD B;  5CK9 A;  3ER0 A;  1MND A;  2HD0 A;  4EIK A;  3OYL A;  1O9K B;  3JCM h;  3M58 A;  3J7A F;  3GPL A;  2DRM A;  1K4U S;  1Q81 R;  5DM7 R;  5KYY A;  1A0N B;  3CPW S;  1TTH B;  3JB9 G;  4EOO B;  1I1J A;  1PKS A;  4HCC A;  4EC8 B;  3EG2 A;  4F6U B;  2X4W A;  3OSS C;  2H3E B;  2J6F A;  3RDV A;  2X1N B;  2LZ6 B;  4CI0 C;  4JJC A;  1YHQ Q;  4C92 F;  3EFO A;  1QQJ A;  1NE8 A;  1ZLM A;  4HT8 A;  4DBF A;  2B8A A;  3EH1 A;  2QAZ A;  1M8M A;  4GLK A;  3LGF A;  1JXO A;  2E41 A;  3P8H A;  4PFP A;  1VQ4 Q;  4Z02 A;  2BUD A;  1AIS B;  1UEB A;  3A1P A;  3QPH A;  4HKE A;  5HKC A;  1M90 U;  1JB0 E;  2KT1 A;  3CCS A;  5IHK A;  1PRM C;  2L3S A;  3QII A;  1UJ0 A;  2DIL A;  1VA7 A;  2QGG A;  4CRI A;  3ZEH A;  2O9S A;  1ACM B;  1Q86 U;  2CT4 A;  5KYX A;  1WHJ A;  2K2M A;  1KQS A;  4ROE A;  1VQ5 Q;  3QO3 A;  3CCR T;  5I21 A;  1PNJ A;  1WZO A;  5IF1 B;  1GBR A;  1QMC A;  4J7I A;  1AT1 B;  5DQV A;  4C5H A;  1UGQ B;  5FWB A;  5GAN 4;  1PM3 A;  3G6E Q;  3HRS A;  3SHW A;  1Q82 U;  2QXF A;  4HXJ A;  4F7U A;  2DF6 A;  1K8A U;  1PG5 B;  2LJ0 A;  4XTU A;  3JCM W;  3CC4 T;  2JTF A;  1X2Q A;  4XK8 E;  2VWF A;  4F04 B;  3HHT B;  2YRV A;  5KE2 A;  2QTV A;  2BS2 A;  3DLL A;  5A0G A;  5GAN 3;  4N0A C;  3BLQ B;  3CBP A;  4XTY A;  3OBY A;  1Q86 R;  1SHF A;  3I5R A;  2V8I A;  3M0U A;  2NUT A;  3FJP A;  1Y96 B;  3VS2 A;  3DL1 A;  4KRT A;  1YIT Q;  4NL3 A;  2DO3 A;  1H1P B;  2PJQ A;  3MET A;  3OS0 A;  2W10 A;  3T9N A;  2XK0 A;  3CME A;  2P0P A;  1Q82 R;  1Q81 C;  1TFB A;  2DIQ A;  4BCO B;  2OAW A;  3CCJ A;  2HQH A;  4V2S A;  3JB9 H;  3M03 A;  4KGZ B;  4E47 A;  2O4X B;  4ELY C;  1EFN A;  3MP8 A;  4IUU A;  2FPD A;  1W2B A;  3ZFJ A;  3P8D A;  2PNI A;  3PTA A;  4D6W A;  1ZBJ A;  1Z9Q A;  2GFA A;  5LJ5 f;  2UZD B;  2L0A A;  2L2P A;  2O9V A;  2EJF A;  1LOJ A;  4JZ3 A;  2PZ1 A;  3QZ9 B;  4C8Q G;  1QVF A;  3O8V A;  3M5A A;  1VQO A;  1IB8 A;  3L2Q A;  3I55 T;  1VQL T;  2RI3 A;  2ESW A;  3HO8 A;  3EGX B;  2DTH A;  3JB9 F;  1GUX B;  5IAY A;  1U1S A;  2E10 A;  1OZ2 A;  2DXU A;  2ABL A;  2DTI A;  2JN0 A;  1RAI B;  2KDS A;  2XHC A;  2JJ9 A;  3VS6 A;  1X6O A;  1JU5 C;  2F2X A;  5D6X A;  1GFC A;  3B57 A;  4C5E A;  3GIB A;  7AT1 B;  2X3W D;  4EOS B;  2XDP A;  3SWN B;  2ZPI B;  4BCM B;  1UGS B;  3JB9 I;  4AT1 B;  2VVK A;  2CP7 A;  4BCN D;  5FU6 B;  2CDT A;  3CPW A;  2CP2 A;  2KEA A;  2E64 A;  2YLC A;  4LD6 A;  1Q7Y U;  3HKS A;  3S6W A;  2MOX A;  2RM4 A;  4BI4 A;  1YIJ A;  4M77 D;  1RAC B;  1M90 C;  2RA2 A;  1QVG S;  4E2F B;  5CO7 A;  3OYY A;  1I5L A;  1TUC A;  2CZ7 B;  5EFQ B;  2QEX A;  4OB1 B;  1D3B A;  3MIA B;  1WGS A;  1Q86 C;  4RCC A;  4FIB A;  3TSZ A;  2LNV A;  4YOS A;  5HVY B;  3RUX A;  4RTV A;  2GCX A;  5IHN A;  3C0C A;  3DOG B;  4HCB A;  4CC4 B;  5GAN g;  3REB B;  4BDY A;  1Q82 C;  1V29 B;  4RTT A;  4NL2 A;  2GTJ A;  1H26 B;  1K8A C;  3EHQ A;  1Q7Y R;  5DLQ E;  5HK3 A;  1RAF B;  3WVD B;  2RHZ A;  3CC4 Q;  3OS5 A;  2QAS A;  4QKU A;  2RQT A;  2BE7 D;  1X27 A;  5CKF A;  3CXC S;  1PKT A;  4X1V A;  2L8D A;  3FJ5 A;  2E70 A;  1GCP A;  3EGU A;  1E6G A;  3JCM b;  3OYC A;  2COY A;  2RJF A;  4A54 A;  2CKK A;  2W2H A;  2ENM A;  3LWH A;  4EMG A;  2CP0 A;  2RF0 A;  4PLI A;  1GFD A;  1RLQ C;  3HRT A;  1VQP T;  1WXB A;  1UB4 A;  3PMI A;  4C92 B;  4IUP A;  2KGT A;  5CQX A;  1TUD A;  3C12 A;  1R8O B;  2LX9 A;  1ABQ A;  4BE2 A;  4KRC B;  3E2U A;  2BS4 A;  2WSC E;  4BCQ D;  3CCS Q;  2MI6 A;  2L3P A;  5FLX E;  1DJ7 B;  5CVI A;  1JOW A;  5CKE A;  2LQK A;  3M53 A;  4FM4 B;  3RBB B;  2KRO A;  3TNI B;  3DJB A;  4JX6 A;  3JCM e;  1PSF A;  2I40 B;  4IUR A;  4PKC C;  3UA7 A;  2BE9 B;  3BLH B;  4E6R A;  1VQ8 T;  4BBS M;  3TN8 B;  1Y96 A;  2AIR B;  4C8Q F;  3E9G A;  2HKQ B;  5CYI B;  3MP1 A;  3KBG A;  2BKZ B;  3CCL A;  2GF7 A;  5FW9 A;  3FC3 A;  1XQH A;  2IVX A;  1OU9 A;  1FKM A;  2QGF B;  3MCA B;  3I55 Q;  1VQL Q;  2EKH A;  2JUF A;  4RKU E;  1SRL A;  4HVV A;  1D0Y A;  2E3I A;  2QYZ A;  1VIE A;  1OZ3 A;  3SEM A;  3NDQ A;  4RTY A;  2UZE B;  4HL4 A;  1OI1 A;  2OTJ A;  1VQ9 T;  2XU8 A;  3OYH A;  2HL3 A;  3UA6 A;  1D0Z A;  1RAG B;  1RI9 A;  1RLP C;  2SRC A;  2PVG B;  5GAN 7;  1T3L A;  2DXB A;  3EFR A;  3CME Q;  1K9A A;  3VS4 A;  4PFO A;  2QQ8 A;  1Q7Y C;  2K5F A;  5LMK B;  3LLR A;  1YJ9 A;  2V26 A;  2P84 A;  2F2W A;  3EG9 A;  3CCJ Q;  3VS5 A;  2LP5 A;  2GBQ A;  2VB6 A;  4F7N B;  1MNE A;  3V7R A;  2JNG A;  2KAF A;  3LYI A;  2RQU A;  1KG1 A;  3OB9 A;  1MMD A;  2DXT A;  4G6L B;  4BE0 A;  2XMF A;  1T0H A;  3PO3 S;  4M75 C;  2BZX A;  4ZGE B;  1X2K A;  5GAM d;  3SWN A;  2HMA A;  1BI0 A;  2M9U A;  1QVG A;  2CCH B;  4QVD A;  5LQF B;  2KRN A;  2QQR A;  1YNZ A;  2KXC A;  2DME A;  1CKA A;  5DY9 A;  5LL6 S;  1YI2 A;  3A8O B;  4M75 E;  1VYW B;  1V76 A;  1K73 U;  2DL4 A;  2L89 A;  3ME9 A;  2NUP A;  4Z89 A;  3HFO A;  1LNX A;  3LW5 E;  3M0P A;  3A5Z B;  4A53 A;  2EQJ A;  4C0D B;  2X4J A;  4FX3 B;  2JZ2 A;  2G77 A;  4RMO A;  5KYN A;  2FRW A;  4JX5 A;  2HEQ A;  1PD1 A;  1FX7 A;  3S3M A;  1QMZ B;  4EDU A;  5GAO q;  4LN2 A;  1RUW A;  1QCF A;  2KNB B;  1OU8 A;  1JRI A;  2FG0 A;  5KYW B;  2KR3 A;  4E7S A;  1P92 A;  1B34 A;  3MEU A;  1OUL A;  3INZ A;  2VGN A; 
#chains in the Genus database with same CATH homology
 2XIC A;  4PJO C;  3CXC A;  1NE8 A;  3RKW A;  3PNW C;  3AHU A;  2F5K A;  3SFM A;  2JTM A;  4M78 C;  4HT8 A;  2LTO A;  4QVZ A;  4Q5W A;  3CCM A;  3A8M B;  5GAO m;  2B8A A;  4OVA A;  5LJ3 g;  4C0Z A;  3X25 B;  1N8R U;  2I2L A;  4GLK A;  3LGF A;  2E41 A;  3P8H A;  5EG2 A;  4C8Q C;  4JS5 A;  1YJW A;  4M7A B;  2D6F A;  5GAM f;  4Z02 A;  4FL6 A;  4LDU A;  4MFE A;  1BIB A;  2V8J A;  4BI8 B;  2BUD A;  5HK0 A;  5FRM A;  2XD0 A;  1UEB A;  3JAM E;  3QXE B;  2HBP A;  1N9S A;  2XKO C;  1M1G A;  5FRN A;  3QPH A;  2QTX A;  4PJO E;  4HKE A;  3OYI A;  5GAN h;  2CZ0 B;  4AKG A;  4JS4 A;  5HKC A;  1M90 U;  2MF2 A;  2O4X A;  2DAQ A;  2R5A A;  4M78 E;  4PL6 A;  3GP8 A;  1JB0 E;  4A4G A;  4MDX A;  4PJO A;  1JBM A;  1BYM A;  3TU4 K;  3G6E T;  3CCS A;  3CCE A;  4L59 A;  4N4G A;  2GFU A;  4XU2 A;  3QII A;  3LGL A;  5GAN j;  3BG5 A;  5GAN 6;  4QQG A;  4M77 B;  4CRI A;  4JLI A;  3ZEH A;  4C8Q E;  1IZ6 A;  2P4T A;  1WNL A;  3FRN A;  3CPF A;  4JRP A;  1KD1 C;  1Q86 U;  2CYZ B;  4C8Q A;  3NTH A;  1I8F A;  5AYF A;  5GAN d;  2RD1 A;  5LJ5 h;  1XNI A;  5GAO p;  4M77 G;  1VQ7 A;  4NC6 A;  2ZZD B;  2M16 A;  3FB9 A;  5EJC A;  2KK4 A;  1KQS A;  1BI2 A;  3QO3 A;  3VKI A;  5I21 A;  2BS3 A;  3CCR T;  4JLG A;  2RJE A;  3HPW A;  1VQP A;  2ZGW A;  3CCQ A;  2E6N A;  2EQK A;  1YHQ A;  4J7I A;  5D6W A;  4C5H A;  3OW2 S;  1UGQ B;  3H4C A;  2KVQ G;  2DD4 A;  4XTW A;  4A4H A;  5GAN 4;  4F7U E;  5LJ5 d;  2Y90 A;  4B9W A;  1BKB A;  3HRS A;  3JCM f;  2QXF A;  1Q82 U;  4F7U A;  3SWN C;  5KH6 A;  3QYE A;  5GAN 5;  3M9Q A;  3S3N A;  1K8A U;  4C5G A;  4XTU A;  4M75 G;  3JCM W;  2H3J A;  4R55 A;  4E7K A;  3CC4 T;  2DZC A;  4P5N A;  3QBY A;  5FU6 C;  1VQ4 A;  2JTF A;  4XK8 E;  4L6V 5;  3HHT B;  2EYQ A;  1KC8 C;  2YRV A;  4BDZ A;  5KE2 A;  2Y4X A;  4HA8 A;  4JX4 A;  1QLB A;  3QYH B;  1H64 1;  2BS2 A;  4KUI A;  2BKD N;  3DLL A;  4JJN K;  1IRE B;  5A0G A;  5GAN 3;  1VQ8 A;  4N0A C;  1M1K U;  2CZ6 B;  5GAM j;  3CC7 T;  3CBP A;  4XTY A;  2QDY B;  4M7D C;  3PFS A;  3RKY A;  2WJ9 A;  3OBY A;  2HAX A;  4Z6Y A;  4MML A;  3OYK A;  2E5Q A;  2L3R A;  2V8I A;  4AKI A;  2D0Q B;  2DPP B;  1B34 B;  3FJP A;  1Y96 B;  3CCL T;  4L5G A;  3DL1 A;  4LDX A;  1N27 A;  1YCY A;  2EJG A;  2MMP A;  3OA6 A;  2QA4 T;  4M7A G;  4NL3 A;  3MEA A;  2DO3 A;  4HCZ A;  3MET A;  4N4I A;  3VYG B;  2DZ9 A;  1VQ5 A;  4HNT A;  3M4Y A;  4DOV A;  2PVO B;  2RHX A;  3OS0 A;  2F69 A;  2FVU A;  3GF5 A;  3T9N A;  2XK0 A;  3PMT A;  3QYB A;  3CME A;  4M7D E;  2P0P A;  4JRQ A;  4N0A A;  4OGC A;  1AHJ B;  1Q81 C;  1O75 A;  2DIQ A;  4M7D A;  2OTJ T;  1VQN T;  2VXE A;  3JB9 H;  5LJ3 h;  4ZTJ A;  1VQ9 A;  4J6X A;  2VV5 A;  5GMK l;  3CCJ A;  3C4S A;  4V2S A;  1FXX A;  2EQU A;  3BG3 A;  2KMT A;  2XG8 D;  4RCB A;  5CR2 A;  3WVE B;  5CQY A;  4E47 A;  2EFI A;  2O4X B;  3M56 A;  3F70 A;  4ELY C;  5CCA A;  3MP8 A;  4IUU A;  1HK9 A;  2A3L A;  2DEQ A;  3OBW A;  2K2V A;  1BIA A;  3MHX A;  3P8D A;  4M78 B;  3ZFJ A;  5GMK m;  1W2B A;  3QHS A;  3CMA T;  2DKG A;  2DXC A;  4EMK A;  4X9C A;  1QVP A;  3M57 A;  5I2M A;  4D6W A;  3PTA A;  4PJO G;  2GFA A;  5LJ3 d;  5LJ5 f;  3FIF A;  4RG8 A;  2LT4 A;  1M8V A;  4IUT A;  4C8Q B;  1VQ6 T;  3RES A;  1K73 C;  2EJF A;  2FB7 A;  1LOJ A;  2JOY A;  2DVE A;  2XDB A;  2R57 A;  4N4H A;  3I56 A;  4C0G A;  1YJ9 T;  3MEV A;  4ZGJ B;  3M54 A;  3OYJ A;  3QZ9 B;  4C8Q G;  1QVF A;  4J5Y A;  3GLX A;  2R5M A;  3O8V A;  3TW6 A;  4PLL A;  3PIO A;  3M5A A;  4KUD K;  2AHJ B;  3VJP A;  2RK1 A;  3OMG A;  3CCV A;  3SD4 A;  4YTL A;  3OQ5 A;  1YIT A;  1HXD A;  1MHN A;  4UC4 A;  4C5I A;  3LWI A;  4AKH A;  3BDL A;  4DA4 A;  1VQO A;  3L2Q A;  3I55 T;  1VQL T;  2RI3 A;  3UPU A;  1Y7X A;  4GY5 A;  3L2W A;  3G71 A;  4F7U B;  2ZPB B;  3HO8 A;  4DQ2 A;  4M78 F;  1KQS S;  2DTH A;  2DJZ A;  3C94 A;  4C92 C;  2PU9 B;  1NPP A;  5IAY A;  1U1S A;  1S72 A;  3JB9 F;  2E10 A;  4BBR M;  2DD5 A;  3CD6 T;  2YHT A;  1OZ2 A;  4JRK A;  2VXF A;  2DXU A;  3GNF B;  4ZGD B;  4F7U G;  2EAY A;  2DTI A;  3ASK A;  4J6Y A;  2K5L A;  1JJ2 S;  2JN0 A;  5CKB A;  3VUZ A;  2KDS A;  2XHC A;  4MZP A;  2IVW A;  1X6O A;  4X9D A;  5CIU A;  5D6X A;  4LDY A;  2CZ1 B;  2KQW A;  3V7C A;  2QQA A;  3JCM V;  4C5E A;  3GIB A;  1G3W A;  1NPR A;  4M7A D;  2A7Y A;  2VYT A;  5FU7 C;  4C92 E;  2XDP A;  3QG1 A;  5GMK e;  4ATO A;  3OMC A;  2OAU A;  3V8L A;  4XU3 A;  5KCH A;  4KUL A;  3SWN B;  1G5V A;  2QQ9 A;  1N8R C;  4C92 A;  2ZPI B;  1VUB A;  1UGS B;  3JB9 I;  1ZQ1 A;  4QQ6 A;  1YI2 T;  4QW2 A;  4QVC A;  2QF7 A;  5C0M A;  5FU6 B;  3JCM c;  3CPW A;  2DK3 A;  3E19 A;  3JB9 J;  3L2Z A;  3VKG A;  2KMG A;  2E64 A;  2RJD A;  2YLC A;  3L2R A;  3L2U A;  3QSU A;  3KHI A;  4LD6 A;  5M9O A;  4M7A F;  1Q7Y U;  2LT1 A;  3HKS A;  3NTI A;  3CBM A;  3S6W A;  2RM4 A;  5LJ5 j;  2EJ9 A;  4BI4 A;  4ZN3 A;  1YIJ A;  4M77 D;  4E7L A;  1M90 C;  2RA2 A;  3NFC A;  5LJ3 f;  2OTL A;  3QDR B;  2D9T A;  2K3Y A;  1QVG S;  1N9R A;  4M75 B;  4OF1 A;  5CO7 A;  2EWN A;  3OYY A;  3S3O A;  4RG2 A;  1I5L A;  1N6A A;  2V8K A;  1G3Y A;  2CZ7 B;  2MAM A;  3BFM A;  3HP9 A;  4J83 A;  4E7J A;  2QEX A;  1ZHI A;  3CC2 A;  2XI9 A;  1NJI U;  4M7D G;  2WAC A;  3G4S T;  4OB1 B;  1D3B A;  4BE1 A;  4M77 F;  1WGS A;  2R58 A;  1Q86 C;  4RCC A;  5FRO A;  1VQM T;  2XID A;  4FIB A;  4Y91 A;  5GMK i;  3OYM A;  2LNV A;  3QKJ A;  4IKF A;  2EQM A;  2MWO A;  1KQ2 A;  4ELJ A;  1WJQ A;  2K3X A;  3RER A;  3RUX A;  3QJ6 A;  3DB3 A;  5J39 A;  5KCO A;  1K9M U;  3FLG A;  2GCX A;  3M59 A;  3HRU A;  3GOX A;  4HCB A;  2FL7 A;  5CAI A;  3JCM J;  3HL8 A;  1VQK A;  2PQW A;  5GAN g;  3E1S A;  3OS2 A;  3CEY A;  4BDY A;  3CCM T;  3HBL A;  5L8R E;  1Q82 C;  1V29 B;  1Y07 A;  5A2Q E;  4NL2 A;  3OYG A;  4M75 F;  1YBY A;  5GAN 8;  4KBM B;  1K8A C;  1H3Z A;  1RI0 A;  5DLQ E;  4KT0 E;  1YJW T;  5HK3 A;  4J6W A;  3WVD B;  2RHZ A;  2X4X A;  3OS5 A;  2FYK A;  4ME7 A;  4QSH A;  4EMK C;  1ZBX A;  3RKX A;  4MZM A;  4MIM A;  2RHU A;  5C6S A;  3FEO A;  3DKM A;  5J26 A;  2CGH A;  4LDW A;  2KSS A;  2VGM A;  4M77 A;  2DD5 B;  3BDU A;  1M1K C;  3CCS T;  5CKF A;  5CKD A;  3PIP A;  2RO0 A;  5GAM e;  3CXC S;  3CCE T;  1NZ9 A;  4MFD A;  2K57 A;  2X4Y A;  2L8D A;  3FDR A;  3G6E A;  3OW2 A;  2E70 A;  3CBO A;  3PGG A;  3H8Z A;  2JVV A;  3JCM b;  2ZZD A;  3OYC A;  4II1 A;  2RJF A;  4A54 A;  2M1H A;  2X35 A;  4PJO B;  2CKK A;  3LWH A;  5LJ3 j;  3RMS A;  3TEE A;  5GAN 2;  3V8K A;  2RI5 A;  2G3R A;  4EMG A;  1VQ7 T;  4FU6 A;  2K5I A;  2EIF A;  1M1F A;  5A0D A;  4PLI A;  2ZPG B;  3C95 A;  4BB7 A;  1KHC A;  2F5T X;  3HRT A;  1U8R A;  3KXT A;  1VQP T;  3CCR A;  4HNU A;  3OYN A;  4C92 B;  1UB4 A;  3PMI A;  3BG9 A;  3BW1 A;  2MWP A;  4FT4 A;  4IUP A;  4MDW A;  3UT1 A;  5GAM g;  5CQX A;  3CC7 A;  3CCQ T;  1YHQ T;  1GXI E;  3C12 A;  1R8O B;  2LX9 A;  3QJY A;  2LCC A;  2VUB A;  3MO8 A;  1MGQ A;  2YLB A;  3X28 B;  4TVR A;  4BD3 A;  4BE2 A;  3JSC A;  2BS4 A;  4M78 D;  2WSC E;  4J7F A;  4C92 G;  3JB9 D;  5J3B A;  4HLQ A;  4ELZ C;  2MI6 A;  3PT9 A;  3UWN A;  5FLX E;  1DJ7 B;  1WJS A;  5CVI A;  4O6J A;  1WQW A;  2CS7 A;  5CKE A;  2LQK A;  3M53 A;  1G3S A;  4FM4 B;  2DD4 B;  3VUB A;  4LOC A;  3G7Z A;  4O5V A;  4BY6 C;  4C8Q D;  1M5Q 1;  1M4Z A;  1VQ4 T;  3CC4 A;  2DTO A;  4PJO F;  5FU7 B;  4JX6 A;  3SDZ A;  1BI3 A;  2KY9 A;  3E9F A;  1PSF A;  2M0O A;  3QUI A;  3JCM e;  4IUR A;  2QFZ A;  4PKC C;  4LD9 K;  3JCM X;  2RJC A;  1D3B B;  3J81 E;  1VQ8 T;  4BBS M;  5GMK h;  4FSX A;  2NLU A;  2P0Q A;  1Y96 A;  4C0D C;  3QWL A;  4C8Q F;  3A8G B;  3E9G A;  4XTX A;  2E6Z A;  3VKH A;  2DIG A;  5GAO n;  3VYH B;  4E7I A;  1VQK T;  1WPY A;  4R56 A;  2KR6 A;  3MP1 A;  5GMK j;  2RB6 A;  3KBG A;  4QQD A;  1OYX A;  3VYG A;  3X20 B;  4XU1 A;  5D6Y A;  1KD1 U;  4J8O A;  1FWZ A;  2GF7 A;  3CCL A;  5IT9 E;  1X75 C;  3JCM g;  3FC3 A;  5IN1 A;  2QA4 A;  1PSE A;  3EFS A;  2C06 A;  1XQH A;  2QQS A;  4OB2 B;  3RIR A;  3JCM Q;  1BI1 A;  1VQ5 T;  1FKM A;  3HB9 A;  3MCA B;  2JUF A;  2HQE A;  2P0K A;  4JUV A;  4RKU E;  4VUB A;  3UDC A;  3QZ5 B;  3CME T;  5CKH A;  1VIE A;  1OZ3 A;  4F7U F;  1SSF A;  2HNI A;  2PUK B;  3LH0 A;  1WJR A;  4MMK A;  3EAE A;  4HL4 A;  3RMQ A;  1OI1 A;  2OTJ A;  2E12 A;  2LDM A;  1VQ9 T;  1VQN A;  1G3T A;  2XU8 A;  3OYH A;  2LVM A;  4M78 A;  3CCJ T;  1XOV A;  3A8H B;  4OMF B;  1EIF A;  3JCM P;  1UGR B;  3HSB A;  3SB2 A;  1I4K 1;  4OB0 B;  2GQV A;  2HQX A;  4JRI A;  3BY7 A;  4M7D B;  3NTK A;  1YJN A;  4JDS A;  2VC8 A;  1LJO A;  2PVG B;  5GAN e;  2WSF E;  4B9X A;  5DLO A;  5GAN 7;  3CMA A;  2DXB A;  5GAO r;  4M7A C;  3WXM B;  3OYF A;  1KC8 U;  3CCU A;  3EFR A;  4NS5 A;  3OY9 A;  2RHI A;  1KQ1 A;  3TRE A;  4A4E A;  5HY6 A;  3Q1J A;  2QDJ A;  4IUV A;  3JRZ A;  2DXC B;  1VQ6 A;  2RK2 A;  4M75 D;  4EMK B;  4M7D D;  3HFN A;  2WSE E;  3I56 T;  2QQ8 A;  1I81 A;  2LQ8 A;  3H6Z A;  1Q7Y C;  2K5F A;  1JJ2 A;  3URG A;  1RL2 A;  2QI2 A;  3LLR A;  5LJ5 e;  1YJ9 A;  3V8J A;  3X24 B;  4M77 C;  2PUO B;  2O01 E;  4XTV A;  3V7S A;  4M7A E;  3CCV T;  1VIF A;  3VV0 A;  4EPC A;  3OYB A;  4OB3 B;  3KUF A;  1YIT T;  4M7A A;  1W2B S;  2XDD A;  3V7R A;  3OS1 A;  3TCJ A;  1VQO T;  2JNG A;  2IG0 A;  1TH7 A;  4IUQ A;  4M7D F;  3OYD A;  3I55 A;  2RHY A;  2Y4Y A;  2KAF A;  3DLM A;  3LYI A;  3G71 T;  3QYG B;  5GAM h;  1VQL A;  3LX7 A;  1S72 T;  1NJI C;  4NOY A;  3VU3 C;  4XU0 A;  1KG1 A;  3P8B B;  2LC4 A;  1E7P A;  1M9S A;  3OB9 A;  3A8L B;  4EMH A;  4PNO A;  4AI6 A;  3R6O A;  1Q81 U;  3ZBD A;  3L2V A;  2DXT A;  3CD6 A;  2RH2 A;  1KHI A;  4M6V A;  4MZT A;  4M77 E;  4BE0 A;  5LJ5 g;  4DOW A;  4M75 C;  4XQ3 A;  3OYE A;  1WQ7 A;  2L5Q A;  1QVF S;  2FHD A;  4ZGE B;  1K9M C;  3HZJ A;  3GNG A;  3M4G A;  5GAM d;  3SWN A;  2M9U A;  1BI0 A;  1QVG A;  2BIV A;  4XAX B;  4QVD A;  1U1T A;  4Y28 E;  4OP0 A;  3N5B B;  2QQR A;  2RI2 A;  3OYA A;  5DY9 A;  5LL6 S;  3DB4 A;  2LRQ A;  2E1H A;  2ZPF B;  1QW1 A;  2LCL A;  1YI2 A;  3A8O B;  5KE3 A;  2PVD B;  4HNV A;  4M75 E;  4BY6 B;  2EKO A;  4XTZ A;  5I2S A;  4HT9 A;  1K73 U;  4C0F A;  2L89 A;  1O9S A;  3ME9 A;  4M75 A;  1QP3 A;  3X26 B;  3HFO A;  2ZPE B;  1Y71 A;  1LNX A;  4BAC A;  4BUG A;  1X01 A;  5GAN f;  3LW5 E;  4ZTF A;  1YIJ T;  3A5Z B;  1W4S A;  4A53 A;  5CK9 A;  1QP2 A;  3ER0 A;  2EQJ A;  2OTL T;  2HD0 A;  3OYL A;  4PJO D;  3JCM h;  3M58 A;  4C0D B;  3J7A F;  2ZPH B;  1YJN T;  3GPL A;  2X4J A;  2JZ2 A;  4A4K A;  2QQB A;  2G77 A;  4RMO A;  4FT2 A;  2QEX T;  4ZN1 A;  3CC2 T;  1UGP B;  5A0L A;  4JX5 A;  5DM7 R;  3J80 E;  3OSV A;  3CCU T;  4C92 D;  5LJ3 e;  4BI3 A;  3G4S A;  1FX7 A;  4LDV A;  3S3M A;  3M55 A;  4A4F A;  4M78 G;  3CPW S;  2E65 A;  4E7H A;  3JB9 G;  3JCM d;  3L1A A;  4EDU A;  1VQM A;  5GAO q;  4WF2 A;  4X34 A;  4OGE A;  2DXB B;  4HCC A;  1XTD A;  2K4Y A;  2X4W A;  1JRI A;  3OSS C;  3L42 A;  3MP6 A;  5GAO l;  3TW7 A;  1P92 A;  1B34 A;  4CI0 C;  3MEW A;  3MEU A;  2ZCF B;  3INZ A;  4C92 F;  2VGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...