5HVYB

Cdk8/cycc in complex with compound 20
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
267
structure length
267
Chain Sequence
DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords Cyclin-dependent kinase 8
publication title Design and Development of a Series of Potent and Selective Type II Inhibitors of CDK8.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2016-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hvyB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hvyB01
1VOLA 3RGFB 1VYWB 4NSTB 3TNWB 3POMA 2C5VB 4IMYB 1OI9B 4BCGB 4ROEA 4EORB 3MI9B 2UZLB 2BKZB 2IVXA 4BCMB 3EIDB 3DDPB 2IW8B 4F6WB 1PKDB 1O9KB 1H24B 1UNHD 2I40B 4BCIB 5HVYB 5HNBB 1VINA 3F5XB 1C9BA 3DOGB 4BCKB 1JKWA 5LMKB 2G9XB 1OKWB 3TNHB 1H1SB 4EOSB 2WHBB 1D3UB 4BCND 1G3NC 1ZP2A 1KXUA 4OR5B 3EOCB 3BHUB 2V22B 4EONB 4CFUB 3QHWB 5L2WB 2C5NB 2UZDB 2WPAB 4BCQD 4CFXB 5ICPB 1OKVB 2QDJA 2WMAB 4KRDB 4BCPB 1W98B 2B9RA 3TNIB 1JSTB 4CFWB 4EOPB 3MY1B 2UZEB 4ELJA 5IDPB 3QHRB 1H1QB 4EC9B 4BCHB 1UNGD 1GUXB 4F7JB 4F7NB 4KRCB 3BHVB 5ACBA 1P5EB 1QMZB 4CRLB 1OL2B 4EOKB 1OGUB 1E9HB 4BCMD 3DDQB 1H1PB 1OL1B 1GH6B 4EOIB 3EJ1B 4EOJB 4EOMB 4CFMB 2CCIB 1H25B 2W2HA 2WEVB 2WIPB 5HBJB 2WXVB 1F5QB 4EOOB 1H4LD 1H28B 1AD6A 2EUFA 3TN8B 4ELLA 2I53A 1BU2A 1OIUB 4BCOB 4ROCA 2W9ZA 4UN0A 4F7SB 3G33B 4RODA 4F7LB 3LQ5B 5EFQB 5IDNB 1UNLD 1H27B 2W9FA 1JOWA 1O9KA 2W96A 4F70B 1H1RB 4F6UB 1OIYB 4F6SB 2WFYB 2UZBB 4CFUD 5HBEB 4G6LB 1URCB 1GUXA 3BLQB 4BCJB 2BPMB 3K7AM 1H26B 1AISB 2C5XB 2CCHB 3MY5B 3H4CA 2R7GA 2PK9B 4CFNB 2IW9B 2X1NB 2JGZB 3MIAB 2C5OB 3BLRB 4EOLB 5CYIB 4CXAB 5IF1B 4YOOA 2WMBB 4YC3B 4YOZA 2PK2A 1FINB 3O0GD 5BNJB 4BCNB 1GY3B 1TFBA 5CEIB 2UUEB 2PHGA 4FX3B 4EC8B 4CFVB 2F2CA 2WIHB 1XO2A 2CJMB 4II5B 5I5ZB 1JSUB 2IW6B 2PMIB 5LQFB 4TTHA 1FVVB 4I3ZB 2C6TB 4BCFB 4Y72B 3M03A 4BCQB 5HQ0B 2C4GB 4OGRB 5HBHB 1N4MA 2W99A 4EOQB 3BLHB 3BHTB 5FGKB 4YOSA
chains in the Genus database with same CATH superfamily
1VOLA 3POMA 1OI9B 2CZ7B 2IVXA 2LW4A 3EIDB 2CZ1B 1PKDB 1H24B 3B57A 3F5XB 3TNHB 2ZPGB 2PJQA 1D3UB 4BCND 2CYZB 2BS4A 5L2WB 2C5NB 3TW6A 2DPPB 2QF7A 3TNIB 1JSTB 4CFWB 4ELJA 1H1QB 1QMZB 4CRLB 3DDQB 2WIPB 4EOOB 1H4LD 1H28B 2I53A 1BU2A 4NC6A 4JX6A 1E7PA 4RODA 4F7LB 5EFQB 5DQVA 1H27B 2ZPIB 2BS3A 4ZGDB 3QYGB 2KR6A 1GUXA 1AISB 3MY5B 2R7GA 2IW9B 2X1NB 3MIAB 3QYBA 4HNUA 3A8OB 5IF1B 4HNVA 2WMBB 4LOCA 2PK2A 4JX5A 1GY3B 5CEIB 1JSUB 2ZPEB 4ZGEB 5LQFB 4I3ZB 2C6TB 4OB1B 1IREB 4MFEA 4EOQB 3DL1A 4NSTB 2C5VB 4IMYB 2KMGA 2UZLB 2BKZB 2WJ9A 3X25B 2IW8B 1H1SB 1TD6A 1ZP2A 3WVEB 1KXUA 2V22B 4EONB 3A8GB 4CFXB 5ICPB 1OKVB 3VYHB 2QDJA 2WMAB 3HHTB 3MY1B 5IDPB 4Z6YA 4F7NB 1P5EB 1OGUB 1OL1B 2CCIB 2WEVB 1F5QB 1QLBA 3TN8B 2EUFA 3A8HB 2W9ZA 4F7SB 3A8LB 3WVDB 1UNLD 2D0QB 1O9KA 4F70B 3VYGB 1H1RB 3NDQA 4F6UB 1OIYB 2WFYB 2UZBB 5DQWA 3BLQB 2BPMB 3K7AM 1H26B 2C5XB 2DMEA 4BBRM 4CFNB 2C5OB 4AKGA 3X24B 4M6VA 4YOOA 4YC3B 4BY1X 1AHJB 3O0GD 2ZZDB 5BNJB 3X28B 4CFVB 1XO2A 2CJMB 5I5ZB 2PMIB 4AKIA 4TTHA 4BCQB 3BG5A 3QZ5B 4HL4A 5HBHB 2DXCB 2W99A 2DXBB 4FM4B 3BG9A 5FGKB 4YOSA 3RGFB 3DJBA 4BCGB 2QFZA 1FKMA 4BCMB 3X26B 3DDPB 3TW7A 1UNHD 5HNBB 2DD5B 4BCKB 4EOSB 2ZPBB 1G3NC 4OR5B 1UGPB 3BHUB 4CFUB 2UZDB 3QWLA 2WPAB 4BCQD 3HO8A 3A8MB 4BCPB 1W98B 2B9RA 2UZEB 4BCHB 1UNGD 4KRCB 3DTOA 1OL2B 4BCMD 1UGQB 1H1PB 4EOJB 4EOMB 4CFMB 2W2HA 1AD6A 4ELLA 4BCOB 4UN0A 3G33B 4MIMA 3VKHA 3LQ5B 5IDNB 3HB9A 1UGSB 3QYHB 2W96A 4CFUD 4OB3B 2BS2A 2ZPHB 2QDYB 2CCHB 2PK9B 2JGZB 4EOLB 3BLRB 3BG3A 2UUEB 2G77A 4EC8B 2PHGA 3X20B 2F2CA 2WIHB 1ENWA 4II5B 4ZGJB 1FVVB 4BCFB 4Y72B 3M03A 2IN3A 4OB0B 2C4GB 4OGRB 1V29B 1N4MA 3BLHB 3BHTB 1VYWB 3TNWB 4ROEA 4BXXX 4EORB 3MI9B 4AI6A 3VKGA 4F6WB 1O9KB 4BCIB 2I40B 5HVYB 1VINA 1C9BA 3HBLA 3DOGB 1JKWA 5LMKB 2G9XB 1OKWB 2WHBB 3EOCB 2QQ8A 3QHWB 3QXEB 3QZ9B 4KRDB 4EOPB 3QHRB 2CZ6B 4QSHA 4EC9B 1GUXB 4MFDA 4F7JB 5ACBA 3BHVB 5IHYA 4EOKB 1E9HB 1GH6B 4EOIB 3EJ1B 1H25B 5HBJB 2WXVB 4HNTA 1OIUB 4ROCA 3PO3S 5EJCA 2W9FA 4AKHA 1JOWA 2AHJB 1UGRB 4OB2B 4F6SB 5HBEB 1URCB 3KHIA 4BCJB 3HZJA 3H4CA 3QYEA 2CZ0B 5CYIB 4CXAB 4YOZA 4BY7X 1FINB 2QGSA 4BCNB 1TFBA 4BBSM 2ZCFB 4FX3B 4HLQA 2IW6B 2ZPFB 5HQ0B 3GTMS 2DD4B 4G6LB 4JX4A
chains in the Genus database with same CATH topology
1VOLA 3RGFB 1VYWB 4NSTB 3TNWB 3POMA 2C5VB 4IMYB 1OI9B 4BCGB 4ROEA 4EORB 3MI9B 2UZLB 2BKZB 2IVXA 4BCMB 3EIDB 3DDPB 2IW8B 4F6WB 1PKDB 1O9KB 1H24B 1UNHD 2I40B 4BCIB 5HVYB 5HNBB 1VINA 3F5XB 1C9BA 3DOGB 4BCKB 1JKWA 5LMKB 2G9XB 1OKWB 3TNHB 1H1SB 4EOSB 2WHBB 1D3UB 4BCND 1G3NC 1ZP2A 1KXUA 4OR5B 3EOCB 3BHUB 2V22B 4EONB 4CFUB 3QHWB 5L2WB 2C5NB 2UZDB 2WPAB 4BCQD 4CFXB 5ICPB 1OKVB 2QDJA 2WMAB 4KRDB 4BCPB 1W98B 2B9RA 3TNIB 1JSTB 4CFWB 4EOPB 3MY1B 2UZEB 4ELJA 5IDPB 3QHRB 1H1QB 4EC9B 4BCHB 1UNGD 1GUXB 4F7JB 4F7NB 4KRCB 3BHVB 5ACBA 1P5EB 1QMZB 4CRLB 1OL2B 4EOKB 1OGUB 1E9HB 4BCMD 3DDQB 1H1PB 1OL1B 1GH6B 4EOIB 3EJ1B 4EOJB 4EOMB 4CFMB 2CCIB 1H25B 2W2HA 2WEVB 2WIPB 5HBJB 2WXVB 1F5QB 4EOOB 1H4LD 1H28B 1AD6A 2EUFA 3TN8B 4ELLA 2I53A 1BU2A 1OIUB 4BCOB 4ROCA 2W9ZA 4UN0A 4F7SB 3G33B 4RODA 4F7LB 3LQ5B 5EFQB 5IDNB 1UNLD 1H27B 2W9FA 1JOWA 1O9KA 2W96A 4F70B 1H1RB 4F6UB 1OIYB 4F6SB 2WFYB 2UZBB 4CFUD 5HBEB 4G6LB 1URCB 1GUXA 3BLQB 4BCJB 2BPMB 3K7AM 1H26B 1AISB 2C5XB 2CCHB 3MY5B 3H4CA 2R7GA 2PK9B 4CFNB 2IW9B 2X1NB 2JGZB 3MIAB 2C5OB 3BLRB 4EOLB 5CYIB 4CXAB 5IF1B 4YOOA 2WMBB 4YC3B 4YOZA 2PK2A 1FINB 3O0GD 5BNJB 4BCNB 1GY3B 1TFBA 5CEIB 2UUEB 2PHGA 4FX3B 4EC8B 4CFVB 2F2CA 2WIHB 1XO2A 2CJMB 4II5B 5I5ZB 1JSUB 2IW6B 2PMIB 5LQFB 4TTHA 1FVVB 4I3ZB 2C6TB 4BCFB 4Y72B 3M03A 4BCQB 5HQ0B 2C4GB 4OGRB 5HBHB 1N4MA 2W99A 4EOQB 3BLHB 3BHTB 5FGKB 4YOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOL A;  3RGF B;  1VYW B;  4NST B;  3TNW B;  3POM A;  2C5V B;  4IMY B;  1OI9 B;  4BCG B;  4ROE A;  4EOR B;  3MI9 B;  2UZL B;  2BKZ B;  2IVX A;  4BCM B;  3EID B;  3DDP B;  2IW8 B;  4F6W B;  1PKD B;  1O9K B;  1H24 B;  1UNH D;  2I40 B;  4BCI B;  5HVY B;  5HNB B;  1VIN A;  3F5X B;  1C9B A;  3DOG B;  4BCK B;  1JKW A;  5LMK B;  2G9X B;  1OKW B;  3TNH B;  1H1S B;  4EOS B;  2WHB B;  1D3U B;  4BCN D;  1G3N C;  1ZP2 A;  1KXU A;  4OR5 B;  3EOC B;  3BHU B;  2V22 B;  4EON B;  4CFU B;  3QHW B;  5L2W B;  2C5N B;  2UZD B;  2WPA B;  4BCQ D;  4CFX B;  5ICP B;  1OKV B;  2QDJ A;  2WMA B;  4KRD B;  4BCP B;  1W98 B;  2B9R A;  3TNI B;  1JST B;  4CFW B;  4EOP B;  3MY1 B;  2UZE B;  4ELJ A;  5IDP B;  3QHR B;  1H1Q B;  4EC9 B;  4BCH B;  1UNG D;  1GUX B;  4F7J B;  4F7N B;  4KRC B;  3BHV B;  5ACB A;  1P5E B;  1QMZ B;  4CRL B;  1OL2 B;  4EOK B;  1OGU B;  1E9H B;  4BCM D;  3DDQ B;  1H1P B;  1OL1 B;  1GH6 B;  4EOI B;  3EJ1 B;  4EOJ B;  4EOM B;  4CFM B;  2CCI B;  1H25 B;  2W2H A;  2WEV B;  2WIP B;  5HBJ B;  2WXV B;  1F5Q B;  4EOO B;  1H4L D;  1H28 B;  1AD6 A;  2EUF A;  3TN8 B;  4ELL A;  2I53 A;  1BU2 A;  1OIU B;  4BCO B;  4ROC A;  2W9Z A;  4UN0 A;  4F7S B;  3G33 B;  4ROD A;  4F7L B;  3LQ5 B;  5EFQ B;  5IDN B;  1UNL D;  1H27 B;  2W9F A;  1JOW A;  1O9K A;  2W96 A;  4F70 B;  1H1R B;  4F6U B;  1OIY B;  4F6S B;  2WFY B;  2UZB B;  4CFU D;  5HBE B;  4G6L B;  1URC B;  1GUX A;  3BLQ B;  4BCJ B;  2BPM B;  3K7A M;  1H26 B;  1AIS B;  2C5X B;  2CCH B;  3MY5 B;  3H4C A;  2R7G A;  2PK9 B;  4CFN B;  2IW9 B;  2X1N B;  2JGZ B;  3MIA B;  2C5O B;  3BLR B;  4EOL B;  5CYI B;  4CXA B;  5IF1 B;  4YOO A;  2WMB B;  4YC3 B;  4YOZ A;  2PK2 A;  1FIN B;  3O0G D;  5BNJ B;  4BCN B;  1GY3 B;  1TFB A;  5CEI B;  2UUE B;  2PHG A;  4FX3 B;  4EC8 B;  4CFV B;  2F2C A;  2WIH B;  1XO2 A;  2CJM B;  4II5 B;  5I5Z B;  1JSU B;  2IW6 B;  2PMI B;  5LQF B;  4TTH A;  1FVV B;  4I3Z B;  2C6T B;  4BCF B;  4Y72 B;  3M03 A;  4BCQ B;  5HQ0 B;  2C4G B;  4OGR B;  5HBH B;  1N4M A;  2W99 A;  4EOQ B;  3BLH B;  3BHT B;  5FGK B;  4YOS A; 
#chains in the Genus database with same CATH topology
 1VOL A;  3POM A;  1OI9 B;  2CZ7 B;  2IVX A;  2LW4 A;  3EID B;  2CZ1 B;  1PKD B;  1H24 B;  3B57 A;  3F5X B;  3TNH B;  2ZPG B;  2PJQ A;  1D3U B;  4BCN D;  2CYZ B;  2BS4 A;  5L2W B;  2C5N B;  3TW6 A;  2DPP B;  2QF7 A;  3TNI B;  1JST B;  4CFW B;  4ELJ A;  1H1Q B;  1QMZ B;  4CRL B;  3DDQ B;  2WIP B;  4EOO B;  1H4L D;  1H28 B;  2I53 A;  1BU2 A;  4NC6 A;  4JX6 A;  1E7P A;  4ROD A;  4F7L B;  5EFQ B;  5DQV A;  1H27 B;  2ZPI B;  2BS3 A;  4ZGD B;  3QYG B;  2KR6 A;  1GUX A;  1AIS B;  3MY5 B;  2R7G A;  2IW9 B;  2X1N B;  3MIA B;  3QYB A;  4HNU A;  3A8O B;  5IF1 B;  4HNV A;  2WMB B;  4LOC A;  2PK2 A;  4JX5 A;  1GY3 B;  5CEI B;  1JSU B;  2ZPE B;  4ZGE B;  5LQF B;  4I3Z B;  2C6T B;  4OB1 B;  1IRE B;  4MFE A;  4EOQ B;  3DL1 A;  4NST B;  2C5V B;  4IMY B;  2KMG A;  2UZL B;  2BKZ B;  2WJ9 A;  3X25 B;  2IW8 B;  1H1S B;  1TD6 A;  1ZP2 A;  3WVE B;  1KXU A;  2V22 B;  4EON B;  3A8G B;  4CFX B;  5ICP B;  1OKV B;  3VYH B;  2QDJ A;  2WMA B;  3HHT B;  3MY1 B;  5IDP B;  4Z6Y A;  4F7N B;  1P5E B;  1OGU B;  1OL1 B;  2CCI B;  2WEV B;  1F5Q B;  1QLB A;  3TN8 B;  2EUF A;  3A8H B;  2W9Z A;  4F7S B;  3A8L B;  3WVD B;  1UNL D;  2D0Q B;  1O9K A;  4F70 B;  3VYG B;  1H1R B;  3NDQ A;  4F6U B;  1OIY B;  2WFY B;  2UZB B;  5DQW A;  3BLQ B;  2BPM B;  3K7A M;  1H26 B;  2C5X B;  2DME A;  4BBR M;  4CFN B;  2C5O B;  4AKG A;  3X24 B;  4M6V A;  4YOO A;  4YC3 B;  4BY1 X;  1AHJ B;  3O0G D;  2ZZD B;  5BNJ B;  3X28 B;  4CFV B;  1XO2 A;  2CJM B;  5I5Z B;  2PMI B;  4AKI A;  4TTH A;  4BCQ B;  3BG5 A;  3QZ5 B;  4HL4 A;  5HBH B;  2DXC B;  2W99 A;  2DXB B;  4FM4 B;  3BG9 A;  5FGK B;  4YOS A;  3RGF B;  3DJB A;  4BCG B;  2QFZ A;  1FKM A;  4BCM B;  3X26 B;  3DDP B;  3TW7 A;  1UNH D;  5HNB B;  2DD5 B;  4BCK B;  4EOS B;  2ZPB B;  1G3N C;  4OR5 B;  1UGP B;  3BHU B;  4CFU B;  2UZD B;  3QWL A;  2WPA B;  4BCQ D;  3HO8 A;  3A8M B;  4BCP B;  1W98 B;  2B9R A;  2UZE B;  4BCH B;  1UNG D;  4KRC B;  3DTO A;  1OL2 B;  4BCM D;  1UGQ B;  1H1P B;  4EOJ B;  4EOM B;  4CFM B;  2W2H A;  1AD6 A;  4ELL A;  4BCO B;  4UN0 A;  3G33 B;  4MIM A;  3VKH A;  3LQ5 B;  5IDN B;  3HB9 A;  1UGS B;  3QYH B;  2W96 A;  4CFU D;  4OB3 B;  2BS2 A;  2ZPH B;  2QDY B;  2CCH B;  2PK9 B;  2JGZ B;  4EOL B;  3BLR B;  3BG3 A;  2UUE B;  2G77 A;  4EC8 B;  2PHG A;  3X20 B;  2F2C A;  2WIH B;  1ENW A;  4II5 B;  4ZGJ B;  1FVV B;  4BCF B;  4Y72 B;  3M03 A;  2IN3 A;  4OB0 B;  2C4G B;  4OGR B;  1V29 B;  1N4M A;  3BLH B;  3BHT B;  1VYW B;  3TNW B;  4ROE A;  4BXX X;  4EOR B;  3MI9 B;  4AI6 A;  3VKG A;  4F6W B;  1O9K B;  4BCI B;  2I40 B;  5HVY B;  1VIN A;  1C9B A;  3HBL A;  3DOG B;  1JKW A;  5LMK B;  2G9X B;  1OKW B;  2WHB B;  3EOC B;  2QQ8 A;  3QHW B;  3QXE B;  3QZ9 B;  4KRD B;  4EOP B;  3QHR B;  2CZ6 B;  4QSH A;  4EC9 B;  1GUX B;  4MFD A;  4F7J B;  5ACB A;  3BHV B;  5IHY A;  4EOK B;  1E9H B;  1GH6 B;  4EOI B;  3EJ1 B;  1H25 B;  5HBJ B;  2WXV B;  4HNT A;  1OIU B;  4ROC A;  3PO3 S;  5EJC A;  2W9F A;  4AKH A;  1JOW A;  2AHJ B;  1UGR B;  4OB2 B;  4F6S B;  5HBE B;  1URC B;  3KHI A;  4BCJ B;  3HZJ A;  3H4C A;  3QYE A;  2CZ0 B;  5CYI B;  4CXA B;  4YOZ A;  4BY7 X;  1FIN B;  2QGS A;  4BCN B;  1TFB A;  4BBS M;  2ZCF B;  4FX3 B;  4HLQ A;  2IW6 B;  2ZPF B;  5HQ0 B;  3GTM S;  2DD4 B;  4G6L B;  4JX4 A; 
#chains in the Genus database with same CATH homology
 1VOL A;  3RGF B;  1VYW B;  4NST B;  3TNW B;  3POM A;  2C5V B;  4IMY B;  1OI9 B;  4BCG B;  4ROE A;  4EOR B;  3MI9 B;  2UZL B;  2BKZ B;  2IVX A;  4BCM B;  3EID B;  3DDP B;  2IW8 B;  4F6W B;  1PKD B;  1O9K B;  1H24 B;  1UNH D;  2I40 B;  4BCI B;  5HVY B;  5HNB B;  1VIN A;  3F5X B;  1C9B A;  3DOG B;  4BCK B;  1JKW A;  5LMK B;  2G9X B;  1OKW B;  3TNH B;  1H1S B;  4EOS B;  2WHB B;  1D3U B;  4BCN D;  1G3N C;  1ZP2 A;  1KXU A;  4OR5 B;  3EOC B;  3BHU B;  2V22 B;  4EON B;  4CFU B;  3QHW B;  5L2W B;  2C5N B;  2UZD B;  2WPA B;  4BCQ D;  4CFX B;  5ICP B;  1OKV B;  2QDJ A;  2WMA B;  4KRD B;  4BCP B;  1W98 B;  2B9R A;  3TNI B;  1JST B;  4CFW B;  4EOP B;  3MY1 B;  2UZE B;  4ELJ A;  5IDP B;  3QHR B;  1H1Q B;  4EC9 B;  4BCH B;  1UNG D;  1GUX B;  4F7J B;  4F7N B;  4KRC B;  3BHV B;  5ACB A;  1P5E B;  1QMZ B;  4CRL B;  1OL2 B;  4EOK B;  1OGU B;  1E9H B;  4BCM D;  3DDQ B;  1H1P B;  1OL1 B;  1GH6 B;  4EOI B;  3EJ1 B;  4EOJ B;  4EOM B;  4CFM B;  2CCI B;  1H25 B;  2W2H A;  2WEV B;  2WIP B;  5HBJ B;  2WXV B;  1F5Q B;  4EOO B;  1H4L D;  1H28 B;  1AD6 A;  2EUF A;  3TN8 B;  4ELL A;  2I53 A;  1BU2 A;  1OIU B;  4BCO B;  4ROC A;  2W9Z A;  4UN0 A;  4F7S B;  3G33 B;  4ROD A;  4F7L B;  3LQ5 B;  5EFQ B;  5IDN B;  1UNL D;  1H27 B;  2W9F A;  1JOW A;  1O9K A;  2W96 A;  4F70 B;  1H1R B;  4F6U B;  1OIY B;  4F6S B;  2WFY B;  2UZB B;  4CFU D;  5HBE B;  4G6L B;  1URC B;  1GUX A;  3BLQ B;  4BCJ B;  2BPM B;  3K7A M;  1H26 B;  1AIS B;  2C5X B;  2CCH B;  3MY5 B;  3H4C A;  2R7G A;  2PK9 B;  4CFN B;  2IW9 B;  2X1N B;  2JGZ B;  3MIA B;  2C5O B;  3BLR B;  4EOL B;  5CYI B;  4CXA B;  5IF1 B;  4YOO A;  2WMB B;  4YC3 B;  4YOZ A;  2PK2 A;  1FIN B;  3O0G D;  5BNJ B;  4BCN B;  1GY3 B;  1TFB A;  5CEI B;  2UUE B;  2PHG A;  4FX3 B;  4EC8 B;  4CFV B;  2F2C A;  2WIH B;  1XO2 A;  2CJM B;  4II5 B;  5I5Z B;  1JSU B;  2IW6 B;  2PMI B;  5LQF B;  4TTH A;  1FVV B;  4I3Z B;  2C6T B;  4BCF B;  4Y72 B;  3M03 A;  4BCQ B;  5HQ0 B;  2C4G B;  4OGR B;  5HBH B;  1N4M A;  2W99 A;  4EOQ B;  3BLH B;  3BHT B;  5FGK B;  4YOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...