3EOCB

Cdk2/cyclina complexed with a imidazo triazin-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Imidazo[5,1-f][1,2,4]triazin-2-amines as novel inhibitors of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 93
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB02
2IW9B 5BNJB 2WMAB 5EFQB 4BCMB 1E9HB 4OR5B 4Y72B 1VOLA 4F6UB 4NSTB 5HVYB 4EOQB 5HBHB 3MI9B 4KRCB 4YC3B 4CRLB 5I5ZB 1N4MA 1H28B 4CXAB 1TFBA 4EOMB 1H25B 1XO2A 2WIHB 1H1RB 1URCB 4BCQD 2UUEB 1VYWB 5L2WB 2V22B 4YOOA 3TNIB 3MIAB 1OI9B 4EOLB 2PHGA 1P5EB 1H1QB 1UNLD 3DDQB 1KXUA 1FVVB 2B9RA 2IVXA 1OL1B 2PK9B 3DDPB 3QHRB 4BCND 2I53A 1GUXA 4EORB 4BCQB 1JKWA 2WIPB 5FGKB 1GH6B 3BLHB 4F7NB 4BCKB 1OIUB 5LMKB 3EIDB 1C9BA 2PK2A 2WPAB 1BU2A 5HBJB 1QMZB 4F6WB 4BCNB 2W2HA 2UZBB 2C4GB 2WEVB 2IW8B 2C5OB 1H24B 5HQ0B 4BCFB 3LQ5B 1JOWA 2I40B 4EOJB 4F7LB 2WMBB 1O9KA 3TN8B 4EOIB 1H1SB 4BCOB 4F7JB 1H27B 5ICPB 4BCPB 1G3NC 2CJMB 1AISB 4ROCA 2EUFA 4CFNB 4EC8B 4F70B 1GUXB 4UN0A 4YOZA 4F7SB 5CYIB 2R7GA 4G6LB 2JGZB 3G33B 1FINB 1OKWB 1H1PB 2G9XB 2C5NB 1W98B 1OKVB 2W96A 2WHBB 5HNBB 4ELLA 4CFWB 1OIYB 2CCHB 2BKZB 2UZEB 4RODA 4EOPB 4KRDB 4TTHA 3BHTB 1OGUB 3EJ1B 4F6SB 4EOOB 5LQFB 4I3ZB 4ELJA 2UZDB 4CFUD 4CFVB 1PKDB 2WXVB 3MY5B 3RGFB 4OGRB 5IDNB 4BCHB 2CCIB 1H26B 2WFYB 4EONB 2C5XB 2C5VB 1D3UB 3F5XB 1JSTB 3BLRB 2PMIB 3K7AM 4BCIB 3BLQB 2UZLB 3EOCB 4BCJB 2W9ZA 3TNHB 5HBEB 4CFUB 3O0GD 3H4CA 2IW6B 5IF1B 2F2CA 3M03A 1UNHD 5ACBA 1ZP2A 2W9FA 3DOGB 1OL2B 4FX3B 4YOSA 1GY3B 1VINA 3QHWB 1JSUB 1F5QB 4BCMD 4CFMB 2QDJA 4EOKB 5IDPB 1H4LD 4EOSB 4BCGB 2C6TB 3POMA 2BPMB 1AD6A 4EC9B 2X1NB 3BHVB 1UNGD 4II5B 4IMYB 2W99A 4ROEA 5CEIB 3TNWB 4CFXB 3BHUB 1O9KB 3MY1B
chains in the Genus database with same CATH superfamily
5BNJB 1VOLA 5HVYB 4JX4A 3A8MB 5HBHB 2KMGA 2CZ0B 2QDYB 4KRCB 5DQWA 1H28B 3PO3S 1TFBA 2WIHB 1H1RB 1UGRB 1URCB 4BCQD 4JX6A 3TNIB 3MIAB 1OI9B 4LOCA 2PHGA 4JX5A 1KXUA 4AKGA 2IVXA 2DD4B 3QHRB 4BCND 2CZ6B 1GUXA 1JKWA 3BLHB 5LMKB 3EIDB 1C9BA 2WPAB 2UZBB 2IN3A 4MIMA 3X28B 4BY7X 2KR6A 5HQ0B 4BCFB 3LQ5B 4F7JB 3A8LB 3HB9A 4AI6A 4EC8B 4CFNB 1GUXB 4YOZA 3G33B 3HBLA 2ZPEB 4CFWB 1OIYB 3BG9A 4RODA 4EOPB 4F6SB 2UZDB 3MY5B 3VKHA 5IDNB 2WFYB 3VKGA 1JSTB 4QSHA 2UZLB 3EOCB 4BCJB 2W9ZA 2LW4A 3QYBA 3X20B 3H4CA 2F2CA 1UNHD 5ACBA 4AKHA 1ZP2A 4FX3B 1JSUB 1F5QB 2QDJA 2DPPB 4BCGB 2C6TB 1AD6A 2CZ7B 4HLQA 4IMYB 2DD5B 3BHUB 1E9HB 4Y72B 5I5ZB 1N4MA 1UGSB 1VYWB 2V22B 2ZCFB 3DDQB 1H1QB 1OL1B 3DDPB 4F7NB 3HZJA 4HNVA 2ZZDB 4MFDA 1BU2A 1QMZB 4Z6YA 2W2HA 1H24B 4OB0B 4OB1B 3WVEB 2WMBB 4EOIB 4BCOB 2ZPBB 1H27B 2AHJB 1G3NC 4ROCA 2BS4A 4F70B 4HL4A 2JGZB 3X26B 1FINB 1H1PB 2G9XB 3X25B 1W98B 1OKVB 5HNBB 4ELLA 2BKZB 4TTHA 3BHTB 4I3ZB 5IHYA 3TW6A 4CFUD 1PKDB 2WXVB 2CCIB 1H26B 2C5XB 3F5XB 3K7AM 3BLQB 4BBRM 3QWLA 1QLBA 5HBEB 1OL2B 1VINA 3QHWB 5IDPB 4EOKB 1H4LD 4EOSB 4ROEA 3TNWB 2PJQA 2WMAB 5EFQB 4BCMB 4MFEA 3VYGB 4CRLB 4YC3B 3DJBA 4EOMB 1H25B 5L2WB 4YOOA 4EOLB 1P5EB 1FVVB 2B9RA 2PK9B 4EORB 4BCQB 2WIPB 3QYGB 1GH6B 3DL1A 4BCKB 1OIUB 5EJCA 1IREB 2PK2A 5HBJB 4F6WB 4BCNB 2C4GB 1E7PA 2WEVB 2IW8B 2ZPGB 2I40B 4EOJB 1O9KA 3TN8B 3A8OB 2DXCB 4UN0A 5CYIB 2R7GA 4HNUA 2BS3A 1OKWB 1FKMA 2W96A 2CCHB 4KRDB 1OGUB 2DMEA 3EJ1B 4EOOB 5LQFB 4ELJA 2QFZA 3TW7A 3GTMS 3RGFB 4OGRB 3BG5A 3X24B 1ENWA 3BLRB 2ZPFB 2IW6B 2CYZB 5IF1B 3M03A 2W9FA 2ZPIB 4YOSA 3POMA 1UNGD 5CEIB 4CFXB 3VYHB 2WJ9A 3MY1B 1AHJB 3QYHB 2IW9B 4ZGEB 4M6VA 4OR5B 4F6UB 4NSTB 4ZGDB 4EOQB 3WVDB 3MI9B 4CXAB 1XO2A 2UUEB 3KHIA 3QZ5B 3A8GB 4OB3B 1UNLD 2I53A 3DTOA 5FGKB 4BY1X 2QQ8A 4NC6A 4BBSM 3BG3A 2QF7A 3B57A 3QZ9B 2C5OB 4HNTA 1JOWA 3NDQA 3QYEA 4BXXX 4F7LB 1H1SB 2QGSA 5ICPB 4BCPB 2CJMB 4AKIA 1AISB 1TD6A 2EUFA 4F7SB 4G6LB 4OB2B 1UGQB 2C5NB 2G77A 2WHBB 2UZEB 2BS2A 2CZ1B 4ZGJB 4CFVB 1V29B 4BCHB 3QXEB 4EONB 2C5VB 1D3UB 2DXBB 2PMIB 4BCIB 4FM4B 5DQVA 1UGPB 3TNHB 4CFUB 3O0GD 2D0QB 3A8HB 3DOGB 4CFMB 1GY3B 4BCMD 2BPMB 4EC9B 2X1NB 2ZPHB 3BHVB 4II5B 2W99A 3HO8A 1O9KB 3HHTB
chains in the Genus database with same CATH topology
2IW9B 5BNJB 2WMAB 5EFQB 4BCMB 1E9HB 4OR5B 4Y72B 1VOLA 4F6UB 4NSTB 5HVYB 4EOQB 5HBHB 3MI9B 4KRCB 4YC3B 4CRLB 5I5ZB 1N4MA 1H28B 4CXAB 1TFBA 4EOMB 1H25B 1XO2A 2WIHB 1H1RB 1URCB 4BCQD 2UUEB 1VYWB 5L2WB 2V22B 4YOOA 3TNIB 3MIAB 1OI9B 4EOLB 2PHGA 1P5EB 1H1QB 1UNLD 3DDQB 1KXUA 1FVVB 2B9RA 2IVXA 1OL1B 2PK9B 3DDPB 3QHRB 4BCND 2I53A 1GUXA 4EORB 4BCQB 1JKWA 2WIPB 5FGKB 1GH6B 3BLHB 4F7NB 4BCKB 1OIUB 5LMKB 3EIDB 1C9BA 2PK2A 2WPAB 1BU2A 5HBJB 1QMZB 4F6WB 4BCNB 2W2HA 2UZBB 2C4GB 2WEVB 2IW8B 2C5OB 1H24B 5HQ0B 4BCFB 3LQ5B 1JOWA 2I40B 4EOJB 4F7LB 2WMBB 1O9KA 3TN8B 4EOIB 1H1SB 4BCOB 4F7JB 1H27B 5ICPB 4BCPB 1G3NC 2CJMB 1AISB 4ROCA 2EUFA 4CFNB 4EC8B 4F70B 1GUXB 4UN0A 4YOZA 4F7SB 5CYIB 2R7GA 4G6LB 2JGZB 3G33B 1FINB 1OKWB 1H1PB 2G9XB 2C5NB 1W98B 1OKVB 2W96A 2WHBB 5HNBB 4ELLA 4CFWB 1OIYB 2CCHB 2BKZB 2UZEB 4RODA 4EOPB 4KRDB 4TTHA 3BHTB 1OGUB 3EJ1B 4F6SB 4EOOB 5LQFB 4I3ZB 4ELJA 2UZDB 4CFUD 4CFVB 1PKDB 2WXVB 3MY5B 3RGFB 4OGRB 5IDNB 4BCHB 2CCIB 1H26B 2WFYB 4EONB 2C5XB 2C5VB 1D3UB 3F5XB 1JSTB 3BLRB 2PMIB 3K7AM 4BCIB 3BLQB 2UZLB 3EOCB 4BCJB 2W9ZA 3TNHB 5HBEB 4CFUB 3O0GD 3H4CA 2IW6B 5IF1B 2F2CA 3M03A 1UNHD 5ACBA 1ZP2A 2W9FA 3DOGB 1OL2B 4FX3B 4YOSA 1GY3B 1VINA 3QHWB 1JSUB 1F5QB 4BCMD 4CFMB 2QDJA 4EOKB 5IDPB 1H4LD 4EOSB 4BCGB 2C6TB 3POMA 2BPMB 1AD6A 4EC9B 2X1NB 3BHVB 1UNGD 4II5B 4IMYB 2W99A 4ROEA 5CEIB 3TNWB 4CFXB 3BHUB 1O9KB 3MY1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW9 B;  5BNJ B;  2WMA B;  5EFQ B;  4BCM B;  1E9H B;  4OR5 B;  4Y72 B;  1VOL A;  4F6U B;  4NST B;  5HVY B;  4EOQ B;  5HBH B;  3MI9 B;  4KRC B;  4YC3 B;  4CRL B;  5I5Z B;  1N4M A;  1H28 B;  4CXA B;  1TFB A;  4EOM B;  1H25 B;  1XO2 A;  2WIH B;  1H1R B;  1URC B;  4BCQ D;  2UUE B;  1VYW B;  5L2W B;  2V22 B;  4YOO A;  3TNI B;  3MIA B;  1OI9 B;  4EOL B;  2PHG A;  1P5E B;  1H1Q B;  1UNL D;  3DDQ B;  1KXU A;  1FVV B;  2B9R A;  2IVX A;  1OL1 B;  2PK9 B;  3DDP B;  3QHR B;  4BCN D;  2I53 A;  1GUX A;  4EOR B;  4BCQ B;  1JKW A;  2WIP B;  5FGK B;  1GH6 B;  3BLH B;  4F7N B;  4BCK B;  1OIU B;  5LMK B;  3EID B;  1C9B A;  2PK2 A;  2WPA B;  1BU2 A;  5HBJ B;  1QMZ B;  4F6W B;  4BCN B;  2W2H A;  2UZB B;  2C4G B;  2WEV B;  2IW8 B;  2C5O B;  1H24 B;  5HQ0 B;  4BCF B;  3LQ5 B;  1JOW A;  2I40 B;  4EOJ B;  4F7L B;  2WMB B;  1O9K A;  3TN8 B;  4EOI B;  1H1S B;  4BCO B;  4F7J B;  1H27 B;  5ICP B;  4BCP B;  1G3N C;  2CJM B;  1AIS B;  4ROC A;  2EUF A;  4CFN B;  4EC8 B;  4F70 B;  1GUX B;  4UN0 A;  4YOZ A;  4F7S B;  5CYI B;  2R7G A;  4G6L B;  2JGZ B;  3G33 B;  1FIN B;  1OKW B;  1H1P B;  2G9X B;  2C5N B;  1W98 B;  1OKV B;  2W96 A;  2WHB B;  5HNB B;  4ELL A;  4CFW B;  1OIY B;  2CCH B;  2BKZ B;  2UZE B;  4ROD A;  4EOP B;  4KRD B;  4TTH A;  3BHT B;  1OGU B;  3EJ1 B;  4F6S B;  4EOO B;  5LQF B;  4I3Z B;  4ELJ A;  2UZD B;  4CFU D;  4CFV B;  1PKD B;  2WXV B;  3MY5 B;  3RGF B;  4OGR B;  5IDN B;  4BCH B;  2CCI B;  1H26 B;  2WFY B;  4EON B;  2C5X B;  2C5V B;  1D3U B;  3F5X B;  1JST B;  3BLR B;  2PMI B;  3K7A M;  4BCI B;  3BLQ B;  2UZL B;  3EOC B;  4BCJ B;  2W9Z A;  3TNH B;  5HBE B;  4CFU B;  3O0G D;  3H4C A;  2IW6 B;  5IF1 B;  2F2C A;  3M03 A;  1UNH D;  5ACB A;  1ZP2 A;  2W9F A;  3DOG B;  1OL2 B;  4FX3 B;  4YOS A;  1GY3 B;  1VIN A;  3QHW B;  1JSU B;  1F5Q B;  4BCM D;  4CFM B;  2QDJ A;  4EOK B;  5IDP B;  1H4L D;  4EOS B;  4BCG B;  2C6T B;  3POM A;  2BPM B;  1AD6 A;  4EC9 B;  2X1N B;  3BHV B;  1UNG D;  4II5 B;  4IMY B;  2W99 A;  4ROE A;  5CEI B;  3TNW B;  4CFX B;  3BHU B;  1O9K B;  3MY1 B; 
#chains in the Genus database with same CATH topology
 5BNJ B;  1VOL A;  5HVY B;  4JX4 A;  3A8M B;  5HBH B;  2KMG A;  2CZ0 B;  2QDY B;  4KRC B;  5DQW A;  1H28 B;  3PO3 S;  1TFB A;  2WIH B;  1H1R B;  1UGR B;  1URC B;  4BCQ D;  4JX6 A;  3TNI B;  3MIA B;  1OI9 B;  4LOC A;  2PHG A;  4JX5 A;  1KXU A;  4AKG A;  2IVX A;  2DD4 B;  3QHR B;  4BCN D;  2CZ6 B;  1GUX A;  1JKW A;  3BLH B;  5LMK B;  3EID B;  1C9B A;  2WPA B;  2UZB B;  2IN3 A;  4MIM A;  3X28 B;  4BY7 X;  2KR6 A;  5HQ0 B;  4BCF B;  3LQ5 B;  4F7J B;  3A8L B;  3HB9 A;  4AI6 A;  4EC8 B;  4CFN B;  1GUX B;  4YOZ A;  3G33 B;  3HBL A;  2ZPE B;  4CFW B;  1OIY B;  3BG9 A;  4ROD A;  4EOP B;  4F6S B;  2UZD B;  3MY5 B;  3VKH A;  5IDN B;  2WFY B;  3VKG A;  1JST B;  4QSH A;  2UZL B;  3EOC B;  4BCJ B;  2W9Z A;  2LW4 A;  3QYB A;  3X20 B;  3H4C A;  2F2C A;  1UNH D;  5ACB A;  4AKH A;  1ZP2 A;  4FX3 B;  1JSU B;  1F5Q B;  2QDJ A;  2DPP B;  4BCG B;  2C6T B;  1AD6 A;  2CZ7 B;  4HLQ A;  4IMY B;  2DD5 B;  3BHU B;  1E9H B;  4Y72 B;  5I5Z B;  1N4M A;  1UGS B;  1VYW B;  2V22 B;  2ZCF B;  3DDQ B;  1H1Q B;  1OL1 B;  3DDP B;  4F7N B;  3HZJ A;  4HNV A;  2ZZD B;  4MFD A;  1BU2 A;  1QMZ B;  4Z6Y A;  2W2H A;  1H24 B;  4OB0 B;  4OB1 B;  3WVE B;  2WMB B;  4EOI B;  4BCO B;  2ZPB B;  1H27 B;  2AHJ B;  1G3N C;  4ROC A;  2BS4 A;  4F70 B;  4HL4 A;  2JGZ B;  3X26 B;  1FIN B;  1H1P B;  2G9X B;  3X25 B;  1W98 B;  1OKV B;  5HNB B;  4ELL A;  2BKZ B;  4TTH A;  3BHT B;  4I3Z B;  5IHY A;  3TW6 A;  4CFU D;  1PKD B;  2WXV B;  2CCI B;  1H26 B;  2C5X B;  3F5X B;  3K7A M;  3BLQ B;  4BBR M;  3QWL A;  1QLB A;  5HBE B;  1OL2 B;  1VIN A;  3QHW B;  5IDP B;  4EOK B;  1H4L D;  4EOS B;  4ROE A;  3TNW B;  2PJQ A;  2WMA B;  5EFQ B;  4BCM B;  4MFE A;  3VYG B;  4CRL B;  4YC3 B;  3DJB A;  4EOM B;  1H25 B;  5L2W B;  4YOO A;  4EOL B;  1P5E B;  1FVV B;  2B9R A;  2PK9 B;  4EOR B;  4BCQ B;  2WIP B;  3QYG B;  1GH6 B;  3DL1 A;  4BCK B;  1OIU B;  5EJC A;  1IRE B;  2PK2 A;  5HBJ B;  4F6W B;  4BCN B;  2C4G B;  1E7P A;  2WEV B;  2IW8 B;  2ZPG B;  2I40 B;  4EOJ B;  1O9K A;  3TN8 B;  3A8O B;  2DXC B;  4UN0 A;  5CYI B;  2R7G A;  4HNU A;  2BS3 A;  1OKW B;  1FKM A;  2W96 A;  2CCH B;  4KRD B;  1OGU B;  2DME A;  3EJ1 B;  4EOO B;  5LQF B;  4ELJ A;  2QFZ A;  3TW7 A;  3GTM S;  3RGF B;  4OGR B;  3BG5 A;  3X24 B;  1ENW A;  3BLR B;  2ZPF B;  2IW6 B;  2CYZ B;  5IF1 B;  3M03 A;  2W9F A;  2ZPI B;  4YOS A;  3POM A;  1UNG D;  5CEI B;  4CFX B;  3VYH B;  2WJ9 A;  3MY1 B;  1AHJ B;  3QYH B;  2IW9 B;  4ZGE B;  4M6V A;  4OR5 B;  4F6U B;  4NST B;  4ZGD B;  4EOQ B;  3WVD B;  3MI9 B;  4CXA B;  1XO2 A;  2UUE B;  3KHI A;  3QZ5 B;  3A8G B;  4OB3 B;  1UNL D;  2I53 A;  3DTO A;  5FGK B;  4BY1 X;  2QQ8 A;  4NC6 A;  4BBS M;  3BG3 A;  2QF7 A;  3B57 A;  3QZ9 B;  2C5O B;  4HNT A;  1JOW A;  3NDQ A;  3QYE A;  4BXX X;  4F7L B;  1H1S B;  2QGS A;  5ICP B;  4BCP B;  2CJM B;  4AKI A;  1AIS B;  1TD6 A;  2EUF A;  4F7S B;  4G6L B;  4OB2 B;  1UGQ B;  2C5N B;  2G77 A;  2WHB B;  2UZE B;  2BS2 A;  2CZ1 B;  4ZGJ B;  4CFV B;  1V29 B;  4BCH B;  3QXE B;  4EON B;  2C5V B;  1D3U B;  2DXB B;  2PMI B;  4BCI B;  4FM4 B;  5DQV A;  1UGP B;  3TNH B;  4CFU B;  3O0G D;  2D0Q B;  3A8H B;  3DOG B;  4CFM B;  1GY3 B;  4BCM D;  2BPM B;  4EC9 B;  2X1N B;  2ZPH B;  3BHV B;  4II5 B;  2W99 A;  3HO8 A;  1O9K B;  3HHT B; 
#chains in the Genus database with same CATH homology
 2IW9 B;  5BNJ B;  2WMA B;  5EFQ B;  4BCM B;  1E9H B;  4OR5 B;  4Y72 B;  1VOL A;  4F6U B;  4NST B;  5HVY B;  4EOQ B;  5HBH B;  3MI9 B;  4KRC B;  4YC3 B;  4CRL B;  5I5Z B;  1N4M A;  1H28 B;  4CXA B;  1TFB A;  4EOM B;  1H25 B;  1XO2 A;  2WIH B;  1H1R B;  1URC B;  4BCQ D;  2UUE B;  1VYW B;  5L2W B;  2V22 B;  4YOO A;  3TNI B;  3MIA B;  1OI9 B;  4EOL B;  2PHG A;  1P5E B;  1H1Q B;  1UNL D;  3DDQ B;  1KXU A;  1FVV B;  2B9R A;  2IVX A;  1OL1 B;  2PK9 B;  3DDP B;  3QHR B;  4BCN D;  2I53 A;  1GUX A;  4EOR B;  4BCQ B;  1JKW A;  2WIP B;  5FGK B;  1GH6 B;  3BLH B;  4F7N B;  4BCK B;  1OIU B;  5LMK B;  3EID B;  1C9B A;  2PK2 A;  2WPA B;  1BU2 A;  5HBJ B;  1QMZ B;  4F6W B;  4BCN B;  2W2H A;  2UZB B;  2C4G B;  2WEV B;  2IW8 B;  2C5O B;  1H24 B;  5HQ0 B;  4BCF B;  3LQ5 B;  1JOW A;  2I40 B;  4EOJ B;  4F7L B;  2WMB B;  1O9K A;  3TN8 B;  4EOI B;  1H1S B;  4BCO B;  4F7J B;  1H27 B;  5ICP B;  4BCP B;  1G3N C;  2CJM B;  1AIS B;  4ROC A;  2EUF A;  4CFN B;  4EC8 B;  4F70 B;  1GUX B;  4UN0 A;  4YOZ A;  4F7S B;  5CYI B;  2R7G A;  4G6L B;  2JGZ B;  3G33 B;  1FIN B;  1OKW B;  1H1P B;  2G9X B;  2C5N B;  1W98 B;  1OKV B;  2W96 A;  2WHB B;  5HNB B;  4ELL A;  4CFW B;  1OIY B;  2CCH B;  2BKZ B;  2UZE B;  4ROD A;  4EOP B;  4KRD B;  4TTH A;  3BHT B;  1OGU B;  3EJ1 B;  4F6S B;  4EOO B;  5LQF B;  4I3Z B;  4ELJ A;  2UZD B;  4CFU D;  4CFV B;  1PKD B;  2WXV B;  3MY5 B;  3RGF B;  4OGR B;  5IDN B;  4BCH B;  2CCI B;  1H26 B;  2WFY B;  4EON B;  2C5X B;  2C5V B;  1D3U B;  3F5X B;  1JST B;  3BLR B;  2PMI B;  3K7A M;  4BCI B;  3BLQ B;  2UZL B;  3EOC B;  4BCJ B;  2W9Z A;  3TNH B;  5HBE B;  4CFU B;  3O0G D;  3H4C A;  2IW6 B;  5IF1 B;  2F2C A;  3M03 A;  1UNH D;  5ACB A;  1ZP2 A;  2W9F A;  3DOG B;  1OL2 B;  4FX3 B;  4YOS A;  1GY3 B;  1VIN A;  3QHW B;  1JSU B;  1F5Q B;  4BCM D;  4CFM B;  2QDJ A;  4EOK B;  5IDP B;  1H4L D;  4EOS B;  4BCG B;  2C6T B;  3POM A;  2BPM B;  1AD6 A;  4EC9 B;  2X1N B;  3BHV B;  1UNG D;  4II5 B;  4IMY B;  2W99 A;  4ROE A;  5CEI B;  3TNW B;  4CFX B;  3BHU B;  1O9K B;  3MY1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...