3EOCB

Cdk2/cyclina complexed with a imidazo triazin-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Imidazo[5,1-f][1,2,4]triazin-2-amines as novel inhibitors of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 93
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB02
1H26B 2BPMB 2WIHB 2PHGA 4YC3B 2EUFA 1JOWA 4EOOB 5EFQB 3MIAB 2B9RA 1H4LD 3BLHB 5IF1B 2C4GB 1G3NC 1TFBA 2C6TB 4CRLB 4EOMB 3DDPB 1JSTB 2W9FA 2UUEB 1FVVB 2WMBB 3M03A 3DDQB 4CFUB 4EORB 1UNGD 1OIYB 2UZBB 4EOQB 1H24B 3BHUB 4OR5B 1OL1B 4BCNB 4EC8B 1H1QB 1BU2A 2W2HA 3TN8B 5I5ZB 1H28B 3POMA 2UZEB 2C5XB 3QHRB 2CCHB 2W96A 2CJMB 4CFVB 1JSUB 3TNWB 5CEIB 1URCB 4TTHA 4BCPB 3O0GD 3MI9B 4F6SB 1OIUB 4F70B 1AD6A 1VINA 4BCMB 2C5VB 4F7NB 3LQ5B 4BCFB 4BCGB 4ELLA 3H4CA 2UZDB 2W9ZA 5HVYB 4G6LB 1VOLA 4EOJB 4ROCA 1H1SB 4EOKB 4IMYB 1VYWB 2PK9B 3K7AM 2WIPB 2CCIB 3BHVB 4EOLB 3F5XB 4BCOB 4FX3B 2IW6B 4ELJA 3EOCB 1PKDB 2BKZB 4EC9B 4YOSA 2WFYB 4Y72B 2WHBB 1F5QB 4BCIB 5LQFB 2R7GA 2X1NB 4KRDB 3MY5B 3QHWB 2V22B 2WXVB 3BLRB 4F6WB 3BHTB 2IW9B 2I53A 4CFWB 4EOIB 4BCKB 1GH6B 1FINB 1H25B 3BLQB 1E9HB 5HNBB 5HBEB 4II5B 4OGRB 5HBHB 1O9KB 1GY3B 3EJ1B 4KRCB 1P5EB 4NSTB 2WMAB 5CYIB 2WEVB 5ICPB 2PK2A 1QMZB 1C9BA 1GUXB 2F2CA 5HQ0B 1JKWA 3RGFB 1XO2A 4CXAB 1D3UB 1UNLD 4CFNB 2C5OB 4YOZA 1H27B 1KXUA 1H1RB 4BCHB 5L2WB 1OL2B 4UN0A 4I3ZB 4CFXB 5BNJB 3EIDB 3G33B 4EONB 4F7SB 4F6UB 3TNIB 3MY1B 4BCND 1H1PB 2IW8B 5HBJB 4BCQD 4F7JB 1O9KA 4BCJB 3TNHB 4RODA 1ZP2A 5ACBA 2C5NB 1GUXA 1OKVB 1N4MA 2IVXA 2I40B 1W98B 5IDPB 5IDNB 4BCMD 2WPAB 1OGUB 2UZLB 3DOGB 2JGZB 2QDJA 4F7LB 4EOSB 4CFMB 1AISB 2W99A 2G9XB 1UNHD 2PMIB 4CFUD 4BCQB 4ROEA 5FGKB 4EOPB 1OI9B 1OKWB 5LMKB 4YOOA
chains in the Genus database with same CATH superfamily
2BPMB 2KMGA 3MIAB 5IF1B 2C4GB 1G3NC 2W9FA 3NDQA 2LW4A 3QXEB 2CZ0B 2WMBB 4EORB 2ZPEB 1UNGD 3BHUB 2W2HA 3TN8B 2DXBB 3POMA 2QDYB 3TNWB 3BG3A 3A8OB 2CYZB 4F6SB 4F70B 1VINA 4BCMB 3LQ5B 2CZ7B 4ELLA 2UZDB 4HLQA 3TW6A 1VOLA 4ROCA 2PK9B 2CCIB 4EOLB 3F5XB 4BCOB 4FX3B 2IW6B 4YOSA 2WFYB 4Y72B 5LQFB 2X1NB 4MFDA 5DQVA 2ZPHB 3MY5B 2V22B 2WJ9A 4CFWB 2I53A 4OB1B 1FINB 1E7PA 4KRCB 1P5EB 2PK2A 1QMZB 1C9BA 1GUXB 1JKWA 1D3UB 4CFNB 1H27B 3PO3S 4CFXB 3G33B 4EONB 4OB2B 4HNVA 4LOCA 1ZP2A 1UGQB 2C5NB 1N4MA 1W98B 5IDNB 2WPAB 2JGZB 4CFMB 3HO8A 2BS2A 5FGKB 4EOPB 1OKWB 4AKGA 2BS4A 2WIHB 2PHGA 4EOOB 1JOWA 5EFQB 1H4LD 3X26B 2DMEA 4EOMB 3DDPB 4BXXX 3DTOA 2UZBB 4EOQB 1BU2A 5I5ZB 2UZEB 2C5XB 4ZGEB 2W96A 2D0QB 1JSUB 5CEIB 3VKGA 3MI9B 1IREB 4JX6A 2C5VB 4BCFB 4BCGB 4EOJB 2ZPIB 4EOKB 2KR6A 3K7AM 5EJCA 3DL1A 5DQWA 1ENWA 3EOCB 4EC9B 4BY1X 4BCIB 3X28B 4KRDB 3TW7A 3QYEA 1UGPB 3BHTB 1GH6B 3BLQB 4BY7X 5HNBB 3QWLA 4II5B 1O9KB 4NSTB 2WMAB 2ZPFB 1UNLD 1KXUA 1H1RB 4BCHB 5L2WB 4UN0A 4I3ZB 5BNJB 3EIDB 3VKHA 4M6VA 2IW8B 4BCJB 2AHJB 4OB3B 4MFEA 2QFZA 1AISB 2G9XB 1UGSB 4YOOA 3QZ5B 4YC3B 2B9RA 2CZ1B 3BLHB 2C6TB 4CRLB 1V29B 3BG5A 4HNTA 1JSTB 2UUEB 3VYGB 3M03A 1H24B 4OR5B 1H1QB 4AI6A 1H28B 3QHRB 2DD5B 4TTHA 3O0GD 1OIUB 2W9ZA 5HVYB 4G6LB 1H1SB 2BS3A 1VYWB 3HBLA 2BKZB 2ZCFB 1AHJB 2WHBB 1F5QB 2ZPGB 2WXVB 3BLRB 4F6WB 2IW9B 4BCKB 2QQ8A 1E9HB 3VYHB 4OGRB 3A8MB 3EJ1B 2WEVB 2F2CA 2G77A 1XO2A 2C5OB 4YOZA 3QYBA 3TNIB 3MY1B 3A8LB 2QF7A 1H1PB 3GTMS 4F7JB 3X25B 4Z6YA 3TNHB 3HB9A 3BG9A 1GUXA 2I40B 4BCMD 2IN3A 2UZLB 3DOGB 2QDJA 4F7LB 3WVEB 4CFUD 4HL4A 3WVDB 4BCND 5LMKB 5HBEB 1H26B 3QZ9B 2EUFA 1TD6A 4AKIA 1TFBA 3HZJA 4NC6A 3X24B 1FVVB 3DDQB 4CFUB 1OIYB 1OL1B 3DJBA 4BCNB 4EC8B 2ZZDB 4QSHA 2CCHB 2PJQA 2CJMB 4CFVB 1URCB 4BCPB 1AD6A 4F7NB 4OB0B 3H4CA 2DPPB 4AKHA 3KHIA 4BBRM 4IMYB 2WIPB 3BHVB 4ELJA 4ZGJB 1PKDB 4JX4A 2R7GA 3A8HB 4FM4B 3QHWB 3HHTB 2DD4B 4EOIB 4MIMA 1H25B 4JX5A 5IHYA 5HBHB 3A8GB 1GY3B 5ICPB 5CYIB 1FKMA 2ZPBB 5HQ0B 3RGFB 3QYGB 4CXAB 2DXCB 1OL2B 3X20B 2QGSA 4F7SB 4F6UB 1QLBA 3QYHB 5HBJB 4BCQD 4ZGDB 1O9KA 3B57A 4RODA 5ACBA 4HNUA 1OKVB 2IVXA 5IDPB 1OGUB 4BBSM 4EOSB 2W99A 1UNHD 2PMIB 4BCQB 4ROEA 1UGRB 2CZ6B 1OI9B
chains in the Genus database with same CATH topology
1H26B 2BPMB 2WIHB 2PHGA 4YC3B 2EUFA 1JOWA 4EOOB 5EFQB 3MIAB 2B9RA 1H4LD 3BLHB 5IF1B 2C4GB 1G3NC 1TFBA 2C6TB 4CRLB 4EOMB 3DDPB 1JSTB 2W9FA 2UUEB 1FVVB 2WMBB 3M03A 3DDQB 4CFUB 4EORB 1UNGD 1OIYB 2UZBB 4EOQB 1H24B 3BHUB 4OR5B 1OL1B 4BCNB 4EC8B 1H1QB 1BU2A 2W2HA 3TN8B 5I5ZB 1H28B 3POMA 2UZEB 2C5XB 3QHRB 2CCHB 2W96A 2CJMB 4CFVB 1JSUB 3TNWB 5CEIB 1URCB 4TTHA 4BCPB 3O0GD 3MI9B 4F6SB 1OIUB 4F70B 1AD6A 1VINA 4BCMB 2C5VB 4F7NB 3LQ5B 4BCFB 4BCGB 4ELLA 3H4CA 2UZDB 2W9ZA 5HVYB 4G6LB 1VOLA 4EOJB 4ROCA 1H1SB 4EOKB 4IMYB 1VYWB 2PK9B 3K7AM 2WIPB 2CCIB 3BHVB 4EOLB 3F5XB 4BCOB 4FX3B 2IW6B 4ELJA 3EOCB 1PKDB 2BKZB 4EC9B 4YOSA 2WFYB 4Y72B 2WHBB 1F5QB 4BCIB 5LQFB 2R7GA 2X1NB 4KRDB 3MY5B 3QHWB 2V22B 2WXVB 3BLRB 4F6WB 3BHTB 2IW9B 2I53A 4CFWB 4EOIB 4BCKB 1GH6B 1FINB 1H25B 3BLQB 1E9HB 5HNBB 5HBEB 4II5B 4OGRB 5HBHB 1O9KB 1GY3B 3EJ1B 4KRCB 1P5EB 4NSTB 2WMAB 5CYIB 2WEVB 5ICPB 2PK2A 1QMZB 1C9BA 1GUXB 2F2CA 5HQ0B 1JKWA 3RGFB 1XO2A 4CXAB 1D3UB 1UNLD 4CFNB 2C5OB 4YOZA 1H27B 1KXUA 1H1RB 4BCHB 5L2WB 1OL2B 4UN0A 4I3ZB 4CFXB 5BNJB 3EIDB 3G33B 4EONB 4F7SB 4F6UB 3TNIB 3MY1B 4BCND 1H1PB 2IW8B 5HBJB 4BCQD 4F7JB 1O9KA 4BCJB 3TNHB 4RODA 1ZP2A 5ACBA 2C5NB 1GUXA 1OKVB 1N4MA 2IVXA 2I40B 1W98B 5IDPB 5IDNB 4BCMD 2WPAB 1OGUB 2UZLB 3DOGB 2JGZB 2QDJA 4F7LB 4EOSB 4CFMB 1AISB 2W99A 2G9XB 1UNHD 2PMIB 4CFUD 4BCQB 4ROEA 5FGKB 4EOPB 1OI9B 1OKWB 5LMKB 4YOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H26 B;  2BPM B;  2WIH B;  2PHG A;  4YC3 B;  2EUF A;  1JOW A;  4EOO B;  5EFQ B;  3MIA B;  2B9R A;  1H4L D;  3BLH B;  5IF1 B;  2C4G B;  1G3N C;  1TFB A;  2C6T B;  4CRL B;  4EOM B;  3DDP B;  1JST B;  2W9F A;  2UUE B;  1FVV B;  2WMB B;  3M03 A;  3DDQ B;  4CFU B;  4EOR B;  1UNG D;  1OIY B;  2UZB B;  4EOQ B;  1H24 B;  3BHU B;  4OR5 B;  1OL1 B;  4BCN B;  4EC8 B;  1H1Q B;  1BU2 A;  2W2H A;  3TN8 B;  5I5Z B;  1H28 B;  3POM A;  2UZE B;  2C5X B;  3QHR B;  2CCH B;  2W96 A;  2CJM B;  4CFV B;  1JSU B;  3TNW B;  5CEI B;  1URC B;  4TTH A;  4BCP B;  3O0G D;  3MI9 B;  4F6S B;  1OIU B;  4F70 B;  1AD6 A;  1VIN A;  4BCM B;  2C5V B;  4F7N B;  3LQ5 B;  4BCF B;  4BCG B;  4ELL A;  3H4C A;  2UZD B;  2W9Z A;  5HVY B;  4G6L B;  1VOL A;  4EOJ B;  4ROC A;  1H1S B;  4EOK B;  4IMY B;  1VYW B;  2PK9 B;  3K7A M;  2WIP B;  2CCI B;  3BHV B;  4EOL B;  3F5X B;  4BCO B;  4FX3 B;  2IW6 B;  4ELJ A;  3EOC B;  1PKD B;  2BKZ B;  4EC9 B;  4YOS A;  2WFY B;  4Y72 B;  2WHB B;  1F5Q B;  4BCI B;  5LQF B;  2R7G A;  2X1N B;  4KRD B;  3MY5 B;  3QHW B;  2V22 B;  2WXV B;  3BLR B;  4F6W B;  3BHT B;  2IW9 B;  2I53 A;  4CFW B;  4EOI B;  4BCK B;  1GH6 B;  1FIN B;  1H25 B;  3BLQ B;  1E9H B;  5HNB B;  5HBE B;  4II5 B;  4OGR B;  5HBH B;  1O9K B;  1GY3 B;  3EJ1 B;  4KRC B;  1P5E B;  4NST B;  2WMA B;  5CYI B;  2WEV B;  5ICP B;  2PK2 A;  1QMZ B;  1C9B A;  1GUX B;  2F2C A;  5HQ0 B;  1JKW A;  3RGF B;  1XO2 A;  4CXA B;  1D3U B;  1UNL D;  4CFN B;  2C5O B;  4YOZ A;  1H27 B;  1KXU A;  1H1R B;  4BCH B;  5L2W B;  1OL2 B;  4UN0 A;  4I3Z B;  4CFX B;  5BNJ B;  3EID B;  3G33 B;  4EON B;  4F7S B;  4F6U B;  3TNI B;  3MY1 B;  4BCN D;  1H1P B;  2IW8 B;  5HBJ B;  4BCQ D;  4F7J B;  1O9K A;  4BCJ B;  3TNH B;  4ROD A;  1ZP2 A;  5ACB A;  2C5N B;  1GUX A;  1OKV B;  1N4M A;  2IVX A;  2I40 B;  1W98 B;  5IDP B;  5IDN B;  4BCM D;  2WPA B;  1OGU B;  2UZL B;  3DOG B;  2JGZ B;  2QDJ A;  4F7L B;  4EOS B;  4CFM B;  1AIS B;  2W99 A;  2G9X B;  1UNH D;  2PMI B;  4CFU D;  4BCQ B;  4ROE A;  5FGK B;  4EOP B;  1OI9 B;  1OKW B;  5LMK B;  4YOO A; 
#chains in the Genus database with same CATH topology
 2BPM B;  2KMG A;  3MIA B;  5IF1 B;  2C4G B;  1G3N C;  2W9F A;  3NDQ A;  2LW4 A;  3QXE B;  2CZ0 B;  2WMB B;  4EOR B;  2ZPE B;  1UNG D;  3BHU B;  2W2H A;  3TN8 B;  2DXB B;  3POM A;  2QDY B;  3TNW B;  3BG3 A;  3A8O B;  2CYZ B;  4F6S B;  4F70 B;  1VIN A;  4BCM B;  3LQ5 B;  2CZ7 B;  4ELL A;  2UZD B;  4HLQ A;  3TW6 A;  1VOL A;  4ROC A;  2PK9 B;  2CCI B;  4EOL B;  3F5X B;  4BCO B;  4FX3 B;  2IW6 B;  4YOS A;  2WFY B;  4Y72 B;  5LQF B;  2X1N B;  4MFD A;  5DQV A;  2ZPH B;  3MY5 B;  2V22 B;  2WJ9 A;  4CFW B;  2I53 A;  4OB1 B;  1FIN B;  1E7P A;  4KRC B;  1P5E B;  2PK2 A;  1QMZ B;  1C9B A;  1GUX B;  1JKW A;  1D3U B;  4CFN B;  1H27 B;  3PO3 S;  4CFX B;  3G33 B;  4EON B;  4OB2 B;  4HNV A;  4LOC A;  1ZP2 A;  1UGQ B;  2C5N B;  1N4M A;  1W98 B;  5IDN B;  2WPA B;  2JGZ B;  4CFM B;  3HO8 A;  2BS2 A;  5FGK B;  4EOP B;  1OKW B;  4AKG A;  2BS4 A;  2WIH B;  2PHG A;  4EOO B;  1JOW A;  5EFQ B;  1H4L D;  3X26 B;  2DME A;  4EOM B;  3DDP B;  4BXX X;  3DTO A;  2UZB B;  4EOQ B;  1BU2 A;  5I5Z B;  2UZE B;  2C5X B;  4ZGE B;  2W96 A;  2D0Q B;  1JSU B;  5CEI B;  3VKG A;  3MI9 B;  1IRE B;  4JX6 A;  2C5V B;  4BCF B;  4BCG B;  4EOJ B;  2ZPI B;  4EOK B;  2KR6 A;  3K7A M;  5EJC A;  3DL1 A;  5DQW A;  1ENW A;  3EOC B;  4EC9 B;  4BY1 X;  4BCI B;  3X28 B;  4KRD B;  3TW7 A;  3QYE A;  1UGP B;  3BHT B;  1GH6 B;  3BLQ B;  4BY7 X;  5HNB B;  3QWL A;  4II5 B;  1O9K B;  4NST B;  2WMA B;  2ZPF B;  1UNL D;  1KXU A;  1H1R B;  4BCH B;  5L2W B;  4UN0 A;  4I3Z B;  5BNJ B;  3EID B;  3VKH A;  4M6V A;  2IW8 B;  4BCJ B;  2AHJ B;  4OB3 B;  4MFE A;  2QFZ A;  1AIS B;  2G9X B;  1UGS B;  4YOO A;  3QZ5 B;  4YC3 B;  2B9R A;  2CZ1 B;  3BLH B;  2C6T B;  4CRL B;  1V29 B;  3BG5 A;  4HNT A;  1JST B;  2UUE B;  3VYG B;  3M03 A;  1H24 B;  4OR5 B;  1H1Q B;  4AI6 A;  1H28 B;  3QHR B;  2DD5 B;  4TTH A;  3O0G D;  1OIU B;  2W9Z A;  5HVY B;  4G6L B;  1H1S B;  2BS3 A;  1VYW B;  3HBL A;  2BKZ B;  2ZCF B;  1AHJ B;  2WHB B;  1F5Q B;  2ZPG B;  2WXV B;  3BLR B;  4F6W B;  2IW9 B;  4BCK B;  2QQ8 A;  1E9H B;  3VYH B;  4OGR B;  3A8M B;  3EJ1 B;  2WEV B;  2F2C A;  2G77 A;  1XO2 A;  2C5O B;  4YOZ A;  3QYB A;  3TNI B;  3MY1 B;  3A8L B;  2QF7 A;  1H1P B;  3GTM S;  4F7J B;  3X25 B;  4Z6Y A;  3TNH B;  3HB9 A;  3BG9 A;  1GUX A;  2I40 B;  4BCM D;  2IN3 A;  2UZL B;  3DOG B;  2QDJ A;  4F7L B;  3WVE B;  4CFU D;  4HL4 A;  3WVD B;  4BCN D;  5LMK B;  5HBE B;  1H26 B;  3QZ9 B;  2EUF A;  1TD6 A;  4AKI A;  1TFB A;  3HZJ A;  4NC6 A;  3X24 B;  1FVV B;  3DDQ B;  4CFU B;  1OIY B;  1OL1 B;  3DJB A;  4BCN B;  4EC8 B;  2ZZD B;  4QSH A;  2CCH B;  2PJQ A;  2CJM B;  4CFV B;  1URC B;  4BCP B;  1AD6 A;  4F7N B;  4OB0 B;  3H4C A;  2DPP B;  4AKH A;  3KHI A;  4BBR M;  4IMY B;  2WIP B;  3BHV B;  4ELJ A;  4ZGJ B;  1PKD B;  4JX4 A;  2R7G A;  3A8H B;  4FM4 B;  3QHW B;  3HHT B;  2DD4 B;  4EOI B;  4MIM A;  1H25 B;  4JX5 A;  5IHY A;  5HBH B;  3A8G B;  1GY3 B;  5ICP B;  5CYI B;  1FKM A;  2ZPB B;  5HQ0 B;  3RGF B;  3QYG B;  4CXA B;  2DXC B;  1OL2 B;  3X20 B;  2QGS A;  4F7S B;  4F6U B;  1QLB A;  3QYH B;  5HBJ B;  4BCQ D;  4ZGD B;  1O9K A;  3B57 A;  4ROD A;  5ACB A;  4HNU A;  1OKV B;  2IVX A;  5IDP B;  1OGU B;  4BBS M;  4EOS B;  2W99 A;  1UNH D;  2PMI B;  4BCQ B;  4ROE A;  1UGR B;  2CZ6 B;  1OI9 B; 
#chains in the Genus database with same CATH homology
 1H26 B;  2BPM B;  2WIH B;  2PHG A;  4YC3 B;  2EUF A;  1JOW A;  4EOO B;  5EFQ B;  3MIA B;  2B9R A;  1H4L D;  3BLH B;  5IF1 B;  2C4G B;  1G3N C;  1TFB A;  2C6T B;  4CRL B;  4EOM B;  3DDP B;  1JST B;  2W9F A;  2UUE B;  1FVV B;  2WMB B;  3M03 A;  3DDQ B;  4CFU B;  4EOR B;  1UNG D;  1OIY B;  2UZB B;  4EOQ B;  1H24 B;  3BHU B;  4OR5 B;  1OL1 B;  4BCN B;  4EC8 B;  1H1Q B;  1BU2 A;  2W2H A;  3TN8 B;  5I5Z B;  1H28 B;  3POM A;  2UZE B;  2C5X B;  3QHR B;  2CCH B;  2W96 A;  2CJM B;  4CFV B;  1JSU B;  3TNW B;  5CEI B;  1URC B;  4TTH A;  4BCP B;  3O0G D;  3MI9 B;  4F6S B;  1OIU B;  4F70 B;  1AD6 A;  1VIN A;  4BCM B;  2C5V B;  4F7N B;  3LQ5 B;  4BCF B;  4BCG B;  4ELL A;  3H4C A;  2UZD B;  2W9Z A;  5HVY B;  4G6L B;  1VOL A;  4EOJ B;  4ROC A;  1H1S B;  4EOK B;  4IMY B;  1VYW B;  2PK9 B;  3K7A M;  2WIP B;  2CCI B;  3BHV B;  4EOL B;  3F5X B;  4BCO B;  4FX3 B;  2IW6 B;  4ELJ A;  3EOC B;  1PKD B;  2BKZ B;  4EC9 B;  4YOS A;  2WFY B;  4Y72 B;  2WHB B;  1F5Q B;  4BCI B;  5LQF B;  2R7G A;  2X1N B;  4KRD B;  3MY5 B;  3QHW B;  2V22 B;  2WXV B;  3BLR B;  4F6W B;  3BHT B;  2IW9 B;  2I53 A;  4CFW B;  4EOI B;  4BCK B;  1GH6 B;  1FIN B;  1H25 B;  3BLQ B;  1E9H B;  5HNB B;  5HBE B;  4II5 B;  4OGR B;  5HBH B;  1O9K B;  1GY3 B;  3EJ1 B;  4KRC B;  1P5E B;  4NST B;  2WMA B;  5CYI B;  2WEV B;  5ICP B;  2PK2 A;  1QMZ B;  1C9B A;  1GUX B;  2F2C A;  5HQ0 B;  1JKW A;  3RGF B;  1XO2 A;  4CXA B;  1D3U B;  1UNL D;  4CFN B;  2C5O B;  4YOZ A;  1H27 B;  1KXU A;  1H1R B;  4BCH B;  5L2W B;  1OL2 B;  4UN0 A;  4I3Z B;  4CFX B;  5BNJ B;  3EID B;  3G33 B;  4EON B;  4F7S B;  4F6U B;  3TNI B;  3MY1 B;  4BCN D;  1H1P B;  2IW8 B;  5HBJ B;  4BCQ D;  4F7J B;  1O9K A;  4BCJ B;  3TNH B;  4ROD A;  1ZP2 A;  5ACB A;  2C5N B;  1GUX A;  1OKV B;  1N4M A;  2IVX A;  2I40 B;  1W98 B;  5IDP B;  5IDN B;  4BCM D;  2WPA B;  1OGU B;  2UZL B;  3DOG B;  2JGZ B;  2QDJ A;  4F7L B;  4EOS B;  4CFM B;  1AIS B;  2W99 A;  2G9X B;  1UNH D;  2PMI B;  4CFU D;  4BCQ B;  4ROE A;  5FGK B;  4EOP B;  1OI9 B;  1OKW B;  5LMK B;  4YOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...