3EOCB

Cdk2/cyclina complexed with a imidazo triazin-2-amine
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords Cell division protein kinase 2
publication title Imidazo[5,1-f][1,2,4]triazin-2-amines as novel inhibitors of polo-like kinase 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3eocB02
1O9KB 4EC9B 2PHGA 1W98B 1H1SB 1QMZB 1H25B 3QHWB 4CFNB 3DOGB 2V22B 5HQ0B 1OKWB 1JOWA 3MI9B 4KRCB 3QHRB 1G3NC 1VINA 2IW6B 4BCOB 2X1NB 1H1RB 2UZBB 1TFBA 3BHUB 4BCPB 2WIPB 4BCHB 4YOZA 1JKWA 4TTHA 2I40B 4F7JB 3O0GD 5BNJB 1UNGD 1AD6A 1OGUB 2C5VB 4EOLB 3M03A 2WHBB 1H4LD 5HBEB 4OR5B 4EOOB 5I5ZB 4BCIB 4F7NB 1F5QB 1XO2A 2CCHB 4BCND 2C5NB 1H26B 2BKZB 5HBJB 4EOQB 3BHTB 1URCB 4RODA 2G9XB 3MY1B 4CFUD 2C6TB 2IW9B 1UNLD 4EOKB 4ROCA 4BCNB 2PK9B 5ICPB 2W2HA 1BU2A 1OL1B 3H4CA 4EOMB 4BCJB 5FGKB 4CFUB 1PKDB 4F7SB 1P5EB 4BCQD 1GH6B 4OGRB 2CCIB 4BCMB 2W99A 4IMYB 1O9KA 3EJ1B 1JSTB 5CYIB 1ZP2A 4NSTB 1OI9B 3BLHB 4F7LB 4CFMB 2W9ZA 3TN8B 3EIDB 5IDNB 4BCQB 1GUXB 1H24B 4UN0A 4BCGB 1JSUB 4YOOA 1OKVB 2F2CA 4G6LB 2C4GB 4ROEA 2WEVB 2BPMB 2WMBB 3EOCB 4EORB 4YOSA 4BCMD 2W96A 2UUEB 2C5XB 1H27B 2WXVB 4CFWB 1H1QB 4EOPB 5IDPB 3BLQB 2UZLB 1D3UB 1H1PB 5ACBA 5HBHB 3TNIB 2PK2A 2QDJA 3MIAB 3TNWB 5CEIB 3DDPB 4BCKB 1E9HB 3TNHB 1H28B 3BLRB 4CFXB 5LMKB 4EONB 4I3ZB 1FVVB 2WFYB 4ELJA 1FINB 3POMA 1VOLA 1VYWB 2WPAB 4II5B 1N4MA 2UZEB 1KXUA 3DDQB 1OIUB 4EOSB 1UNHD 4FX3B 4KRDB 4ELLA 5IF1B 1GY3B 3K7AM 1AISB 4CXAB 5LQFB 2UZDB 2W9FA 1C9BA 1OIYB 4Y72B 3F5XB 5HVYB 3LQ5B 2CJMB 2PMIB 4F6UB 2B9RA 3G33B 3RGFB 4F70B 3MY5B 2I53A 2JGZB 4EOJB 4F6WB 1OL2B 4EC8B 1GUXA 5EFQB 4CRLB 4F6SB 5HNBB 2EUFA 5L2WB 4EOIB 2IW8B 2WMAB 3BHVB 2WIHB 2R7GA 4CFVB 2C5OB 2IVXA 4YC3B 4BCFB
chains in the Genus database with same CATH superfamily
1O9KB 4M6VA 3TW6A 2WIPB 3QYBA 5EJCA 4F7JB 2ZPFB 2C5VB 2BS2A 2WHBB 1H4LD 4BBSM 4EOOB 1F5QB 4BCND 2C5NB 1H26B 5HBJB 3BHTB 3DTOA 5IHYA 2C6TB 2BS3A 2IW9B 4HL4A 1UNLD 4OB2B 2DPPB 2W2HA 1OL1B 3VKGA 4MFEA 4BCJB 3HBLA 2CCIB 1O9KA 1JSTB 3QZ9B 4BCQB 4BCGB 3X26B 4YOOA 2QF7A 1UGPB 2WJ9A 4NC6A 4YOSA 3X25B 2W96A 2C5XB 4BXXX 4CFWB 1D3UB 5ACBA 3TNIB 2QDJA 5CEIB 3DDPB 4HLQA 2D0QB 3BLRB 2ZPEB 5LMKB 1FVVB 4ELJA 1FINB 1N4MA 1KXUA 4FX3B 5LQFB 4ZGJB 4Z6YA 4AI6A 2ZPGB 3F5XB 3LQ5B 3DL1A 4F6UB 3G33B 2BS4A 4OB3B 2EUFA 5L2WB 4JX5A 4ZGDB 2CZ6B 2R7GA 2PHGA 1H25B 5HQ0B 2V22B 3TW7A 1OKWB 4KRCB 1G3NC 4BCOB 2UZBB 3BHUB 4TTHA 5DQWA 2I40B 3X24B 3O0GD 2ZPBB 3M03A 4F7NB 1XO2A 2CCHB 1UGRB 3MY1B 3KHIA 4EOKB 3A8MB 3HB9A 4AKGA 5FGKB 4CFUB 4OGRB 3PO3S 4OB1B 3EJ1B 3NDQA 1ZP2A 3VYHB 3TN8B 3EIDB 5IDNB 1GUXB 4UN0A 2C4GB 2BPMB 3EOCB 4EORB 4BCMD 4HNVA 1AHJB 3BLQB 2QDYB 5HBHB 2AHJB 3TNHB 4EONB 4I3ZB 3X28B 3POMA 4II5B 4ELLA 4EOSB 1UNHD 5IF1B 2CYZB 2UZDB 2W9FA 3GTMS 1OIYB 4Y72B 3QYHB 3A8LB 2LW4A 1FKMA 3MY5B 3BG5A 1GUXA 3QYGB 4F6SB 5HNBB 4MIMA 2IW8B 4HNTA 2WMAB 3A8OB 1QLBA 2IVXA 4YC3B 1W98B 1H1SB 3QHWB 4CFNB 2QGSA 3MI9B 3QHRB 1UGSB 2X1NB 1TFBA 4BCHB 4YOZA 3B57A 1AD6A 1OGUB 5HBEB 1V29B 5I5ZB 4BCIB 2DXCB 2BKZB 4EOQB 4RODA 4HNUA 3A8HB 3QXEB 4BCNB 2PK9B 5ICPB 2KMGA 3H4CA 4ZGEB 4EOMB 1PKDB 4AKIA 4JX4A 4F7SB 2DD4B 1GH6B 4BCQD 4BCMB 5CYIB 2DMEA 3BLHB 4CFMB 2W9ZA 1UGQB 1H24B 2F2CA 4G6LB 3VKHA 4ROEA 3VYGB 2WMBB 2DXBB 1ENWA 1H1QB 4EOPB 5IDPB 3MIAB 4BCKB 1E9HB 1H28B 4CFXB 4FM4B 1VOLA 2WPAB 2UZEB 3WVDB 1OIUB 4KRDB 1GY3B 4BY7X 1C9BA 2CZ0B 4LOCA 3HHTB 3A8GB 2PMIB 3RGFB 2I53A 4EOJB 4F6WB 1OL2B 4EC8B 4CRLB 4EOIB 3BHVB 2WIHB 4EOLB 2CZ7B 3QYEA 4EC9B 3BG9A 1QMZB 2ZPIB 3DOGB 1JOWA 1VINA 2IW6B 1H1RB 4BCPB 1JKWA 4MFDA 5BNJB 1UNGD 4OR5B 1E7PA 4JX6A 1URCB 4QSHA 2G9XB 3BG3A 3HZJA 4CFUD 1IREB 2DD5B 4ROCA 1BU2A 2G77A 1P5EB 2IN3A 2QFZA 2W99A 4IMYB 3WVEB 4NSTB 1OI9B 4F7LB 2ZZDB 1JSUB 1OKVB 2WEVB 3QWLA 3X20B 2UUEB 1H27B 2WXVB 2ZPHB 4AKHA 2UZLB 1H1PB 2PK2A 3DJBA 3TNWB 2ZCFB 2WFYB 3HO8A 1VYWB 1TD6A 4BY1X 3DDQB 3K7AM 1AISB 4CXAB 2KR6A 3QZ5B 5HVYB 2CZ1B 2CJMB 2B9RA 4F70B 2QQ8A 2PJQA 2JGZB 4OB0B 5EFQB 5DQVA 4BBRM 4CFVB 2C5OB 4BCFB
chains in the Genus database with same CATH topology
1O9KB 4EC9B 2PHGA 1W98B 1H1SB 1QMZB 1H25B 3QHWB 4CFNB 3DOGB 2V22B 5HQ0B 1OKWB 1JOWA 3MI9B 4KRCB 3QHRB 1G3NC 1VINA 2IW6B 4BCOB 2X1NB 1H1RB 2UZBB 1TFBA 3BHUB 4BCPB 2WIPB 4BCHB 4YOZA 1JKWA 4TTHA 2I40B 4F7JB 3O0GD 5BNJB 1UNGD 1AD6A 1OGUB 2C5VB 4EOLB 3M03A 2WHBB 1H4LD 5HBEB 4OR5B 4EOOB 5I5ZB 4BCIB 4F7NB 1F5QB 1XO2A 2CCHB 4BCND 2C5NB 1H26B 2BKZB 5HBJB 4EOQB 3BHTB 1URCB 4RODA 2G9XB 3MY1B 4CFUD 2C6TB 2IW9B 1UNLD 4EOKB 4ROCA 4BCNB 2PK9B 5ICPB 2W2HA 1BU2A 1OL1B 3H4CA 4EOMB 4BCJB 5FGKB 4CFUB 1PKDB 4F7SB 1P5EB 4BCQD 1GH6B 4OGRB 2CCIB 4BCMB 2W99A 4IMYB 1O9KA 3EJ1B 1JSTB 5CYIB 1ZP2A 4NSTB 1OI9B 3BLHB 4F7LB 4CFMB 2W9ZA 3TN8B 3EIDB 5IDNB 4BCQB 1GUXB 1H24B 4UN0A 4BCGB 1JSUB 4YOOA 1OKVB 2F2CA 4G6LB 2C4GB 4ROEA 2WEVB 2BPMB 2WMBB 3EOCB 4EORB 4YOSA 4BCMD 2W96A 2UUEB 2C5XB 1H27B 2WXVB 4CFWB 1H1QB 4EOPB 5IDPB 3BLQB 2UZLB 1D3UB 1H1PB 5ACBA 5HBHB 3TNIB 2PK2A 2QDJA 3MIAB 3TNWB 5CEIB 3DDPB 4BCKB 1E9HB 3TNHB 1H28B 3BLRB 4CFXB 5LMKB 4EONB 4I3ZB 1FVVB 2WFYB 4ELJA 1FINB 3POMA 1VOLA 1VYWB 2WPAB 4II5B 1N4MA 2UZEB 1KXUA 3DDQB 1OIUB 4EOSB 1UNHD 4FX3B 4KRDB 4ELLA 5IF1B 1GY3B 3K7AM 1AISB 4CXAB 5LQFB 2UZDB 2W9FA 1C9BA 1OIYB 4Y72B 3F5XB 5HVYB 3LQ5B 2CJMB 2PMIB 4F6UB 2B9RA 3G33B 3RGFB 4F70B 3MY5B 2I53A 2JGZB 4EOJB 4F6WB 1OL2B 4EC8B 1GUXA 5EFQB 4CRLB 4F6SB 5HNBB 2EUFA 5L2WB 4EOIB 2IW8B 2WMAB 3BHVB 2WIHB 2R7GA 4CFVB 2C5OB 2IVXA 4YC3B 4BCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O9K B;  4EC9 B;  2PHG A;  1W98 B;  1H1S B;  1QMZ B;  1H25 B;  3QHW B;  4CFN B;  3DOG B;  2V22 B;  5HQ0 B;  1OKW B;  1JOW A;  3MI9 B;  4KRC B;  3QHR B;  1G3N C;  1VIN A;  2IW6 B;  4BCO B;  2X1N B;  1H1R B;  2UZB B;  1TFB A;  3BHU B;  4BCP B;  2WIP B;  4BCH B;  4YOZ A;  1JKW A;  4TTH A;  2I40 B;  4F7J B;  3O0G D;  5BNJ B;  1UNG D;  1AD6 A;  1OGU B;  2C5V B;  4EOL B;  3M03 A;  2WHB B;  1H4L D;  5HBE B;  4OR5 B;  4EOO B;  5I5Z B;  4BCI B;  4F7N B;  1F5Q B;  1XO2 A;  2CCH B;  4BCN D;  2C5N B;  1H26 B;  2BKZ B;  5HBJ B;  4EOQ B;  3BHT B;  1URC B;  4ROD A;  2G9X B;  3MY1 B;  4CFU D;  2C6T B;  2IW9 B;  1UNL D;  4EOK B;  4ROC A;  4BCN B;  2PK9 B;  5ICP B;  2W2H A;  1BU2 A;  1OL1 B;  3H4C A;  4EOM B;  4BCJ B;  5FGK B;  4CFU B;  1PKD B;  4F7S B;  1P5E B;  4BCQ D;  1GH6 B;  4OGR B;  2CCI B;  4BCM B;  2W99 A;  4IMY B;  1O9K A;  3EJ1 B;  1JST B;  5CYI B;  1ZP2 A;  4NST B;  1OI9 B;  3BLH B;  4F7L B;  4CFM B;  2W9Z A;  3TN8 B;  3EID B;  5IDN B;  4BCQ B;  1GUX B;  1H24 B;  4UN0 A;  4BCG B;  1JSU B;  4YOO A;  1OKV B;  2F2C A;  4G6L B;  2C4G B;  4ROE A;  2WEV B;  2BPM B;  2WMB B;  3EOC B;  4EOR B;  4YOS A;  4BCM D;  2W96 A;  2UUE B;  2C5X B;  1H27 B;  2WXV B;  4CFW B;  1H1Q B;  4EOP B;  5IDP B;  3BLQ B;  2UZL B;  1D3U B;  1H1P B;  5ACB A;  5HBH B;  3TNI B;  2PK2 A;  2QDJ A;  3MIA B;  3TNW B;  5CEI B;  3DDP B;  4BCK B;  1E9H B;  3TNH B;  1H28 B;  3BLR B;  4CFX B;  5LMK B;  4EON B;  4I3Z B;  1FVV B;  2WFY B;  4ELJ A;  1FIN B;  3POM A;  1VOL A;  1VYW B;  2WPA B;  4II5 B;  1N4M A;  2UZE B;  1KXU A;  3DDQ B;  1OIU B;  4EOS B;  1UNH D;  4FX3 B;  4KRD B;  4ELL A;  5IF1 B;  1GY3 B;  3K7A M;  1AIS B;  4CXA B;  5LQF B;  2UZD B;  2W9F A;  1C9B A;  1OIY B;  4Y72 B;  3F5X B;  5HVY B;  3LQ5 B;  2CJM B;  2PMI B;  4F6U B;  2B9R A;  3G33 B;  3RGF B;  4F70 B;  3MY5 B;  2I53 A;  2JGZ B;  4EOJ B;  4F6W B;  1OL2 B;  4EC8 B;  1GUX A;  5EFQ B;  4CRL B;  4F6S B;  5HNB B;  2EUF A;  5L2W B;  4EOI B;  2IW8 B;  2WMA B;  3BHV B;  2WIH B;  2R7G A;  4CFV B;  2C5O B;  2IVX A;  4YC3 B;  4BCF B; 
#chains in the Genus database with same CATH topology
 1O9K B;  4M6V A;  3TW6 A;  2WIP B;  3QYB A;  5EJC A;  4F7J B;  2ZPF B;  2C5V B;  2BS2 A;  2WHB B;  1H4L D;  4BBS M;  4EOO B;  1F5Q B;  4BCN D;  2C5N B;  1H26 B;  5HBJ B;  3BHT B;  3DTO A;  5IHY A;  2C6T B;  2BS3 A;  2IW9 B;  4HL4 A;  1UNL D;  4OB2 B;  2DPP B;  2W2H A;  1OL1 B;  3VKG A;  4MFE A;  4BCJ B;  3HBL A;  2CCI B;  1O9K A;  1JST B;  3QZ9 B;  4BCQ B;  4BCG B;  3X26 B;  4YOO A;  2QF7 A;  1UGP B;  2WJ9 A;  4NC6 A;  4YOS A;  3X25 B;  2W96 A;  2C5X B;  4BXX X;  4CFW B;  1D3U B;  5ACB A;  3TNI B;  2QDJ A;  5CEI B;  3DDP B;  4HLQ A;  2D0Q B;  3BLR B;  2ZPE B;  5LMK B;  1FVV B;  4ELJ A;  1FIN B;  1N4M A;  1KXU A;  4FX3 B;  5LQF B;  4ZGJ B;  4Z6Y A;  4AI6 A;  2ZPG B;  3F5X B;  3LQ5 B;  3DL1 A;  4F6U B;  3G33 B;  2BS4 A;  4OB3 B;  2EUF A;  5L2W B;  4JX5 A;  4ZGD B;  2CZ6 B;  2R7G A;  2PHG A;  1H25 B;  5HQ0 B;  2V22 B;  3TW7 A;  1OKW B;  4KRC B;  1G3N C;  4BCO B;  2UZB B;  3BHU B;  4TTH A;  5DQW A;  2I40 B;  3X24 B;  3O0G D;  2ZPB B;  3M03 A;  4F7N B;  1XO2 A;  2CCH B;  1UGR B;  3MY1 B;  3KHI A;  4EOK B;  3A8M B;  3HB9 A;  4AKG A;  5FGK B;  4CFU B;  4OGR B;  3PO3 S;  4OB1 B;  3EJ1 B;  3NDQ A;  1ZP2 A;  3VYH B;  3TN8 B;  3EID B;  5IDN B;  1GUX B;  4UN0 A;  2C4G B;  2BPM B;  3EOC B;  4EOR B;  4BCM D;  4HNV A;  1AHJ B;  3BLQ B;  2QDY B;  5HBH B;  2AHJ B;  3TNH B;  4EON B;  4I3Z B;  3X28 B;  3POM A;  4II5 B;  4ELL A;  4EOS B;  1UNH D;  5IF1 B;  2CYZ B;  2UZD B;  2W9F A;  3GTM S;  1OIY B;  4Y72 B;  3QYH B;  3A8L B;  2LW4 A;  1FKM A;  3MY5 B;  3BG5 A;  1GUX A;  3QYG B;  4F6S B;  5HNB B;  4MIM A;  2IW8 B;  4HNT A;  2WMA B;  3A8O B;  1QLB A;  2IVX A;  4YC3 B;  1W98 B;  1H1S B;  3QHW B;  4CFN B;  2QGS A;  3MI9 B;  3QHR B;  1UGS B;  2X1N B;  1TFB A;  4BCH B;  4YOZ A;  3B57 A;  1AD6 A;  1OGU B;  5HBE B;  1V29 B;  5I5Z B;  4BCI B;  2DXC B;  2BKZ B;  4EOQ B;  4ROD A;  4HNU A;  3A8H B;  3QXE B;  4BCN B;  2PK9 B;  5ICP B;  2KMG A;  3H4C A;  4ZGE B;  4EOM B;  1PKD B;  4AKI A;  4JX4 A;  4F7S B;  2DD4 B;  1GH6 B;  4BCQ D;  4BCM B;  5CYI B;  2DME A;  3BLH B;  4CFM B;  2W9Z A;  1UGQ B;  1H24 B;  2F2C A;  4G6L B;  3VKH A;  4ROE A;  3VYG B;  2WMB B;  2DXB B;  1ENW A;  1H1Q B;  4EOP B;  5IDP B;  3MIA B;  4BCK B;  1E9H B;  1H28 B;  4CFX B;  4FM4 B;  1VOL A;  2WPA B;  2UZE B;  3WVD B;  1OIU B;  4KRD B;  1GY3 B;  4BY7 X;  1C9B A;  2CZ0 B;  4LOC A;  3HHT B;  3A8G B;  2PMI B;  3RGF B;  2I53 A;  4EOJ B;  4F6W B;  1OL2 B;  4EC8 B;  4CRL B;  4EOI B;  3BHV B;  2WIH B;  4EOL B;  2CZ7 B;  3QYE A;  4EC9 B;  3BG9 A;  1QMZ B;  2ZPI B;  3DOG B;  1JOW A;  1VIN A;  2IW6 B;  1H1R B;  4BCP B;  1JKW A;  4MFD A;  5BNJ B;  1UNG D;  4OR5 B;  1E7P A;  4JX6 A;  1URC B;  4QSH A;  2G9X B;  3BG3 A;  3HZJ A;  4CFU D;  1IRE B;  2DD5 B;  4ROC A;  1BU2 A;  2G77 A;  1P5E B;  2IN3 A;  2QFZ A;  2W99 A;  4IMY B;  3WVE B;  4NST B;  1OI9 B;  4F7L B;  2ZZD B;  1JSU B;  1OKV B;  2WEV B;  3QWL A;  3X20 B;  2UUE B;  1H27 B;  2WXV B;  2ZPH B;  4AKH A;  2UZL B;  1H1P B;  2PK2 A;  3DJB A;  3TNW B;  2ZCF B;  2WFY B;  3HO8 A;  1VYW B;  1TD6 A;  4BY1 X;  3DDQ B;  3K7A M;  1AIS B;  4CXA B;  2KR6 A;  3QZ5 B;  5HVY B;  2CZ1 B;  2CJM B;  2B9R A;  4F70 B;  2QQ8 A;  2PJQ A;  2JGZ B;  4OB0 B;  5EFQ B;  5DQV A;  4BBR M;  4CFV B;  2C5O B;  4BCF B; 
#chains in the Genus database with same CATH homology
 1O9K B;  4EC9 B;  2PHG A;  1W98 B;  1H1S B;  1QMZ B;  1H25 B;  3QHW B;  4CFN B;  3DOG B;  2V22 B;  5HQ0 B;  1OKW B;  1JOW A;  3MI9 B;  4KRC B;  3QHR B;  1G3N C;  1VIN A;  2IW6 B;  4BCO B;  2X1N B;  1H1R B;  2UZB B;  1TFB A;  3BHU B;  4BCP B;  2WIP B;  4BCH B;  4YOZ A;  1JKW A;  4TTH A;  2I40 B;  4F7J B;  3O0G D;  5BNJ B;  1UNG D;  1AD6 A;  1OGU B;  2C5V B;  4EOL B;  3M03 A;  2WHB B;  1H4L D;  5HBE B;  4OR5 B;  4EOO B;  5I5Z B;  4BCI B;  4F7N B;  1F5Q B;  1XO2 A;  2CCH B;  4BCN D;  2C5N B;  1H26 B;  2BKZ B;  5HBJ B;  4EOQ B;  3BHT B;  1URC B;  4ROD A;  2G9X B;  3MY1 B;  4CFU D;  2C6T B;  2IW9 B;  1UNL D;  4EOK B;  4ROC A;  4BCN B;  2PK9 B;  5ICP B;  2W2H A;  1BU2 A;  1OL1 B;  3H4C A;  4EOM B;  4BCJ B;  5FGK B;  4CFU B;  1PKD B;  4F7S B;  1P5E B;  4BCQ D;  1GH6 B;  4OGR B;  2CCI B;  4BCM B;  2W99 A;  4IMY B;  1O9K A;  3EJ1 B;  1JST B;  5CYI B;  1ZP2 A;  4NST B;  1OI9 B;  3BLH B;  4F7L B;  4CFM B;  2W9Z A;  3TN8 B;  3EID B;  5IDN B;  4BCQ B;  1GUX B;  1H24 B;  4UN0 A;  4BCG B;  1JSU B;  4YOO A;  1OKV B;  2F2C A;  4G6L B;  2C4G B;  4ROE A;  2WEV B;  2BPM B;  2WMB B;  3EOC B;  4EOR B;  4YOS A;  4BCM D;  2W96 A;  2UUE B;  2C5X B;  1H27 B;  2WXV B;  4CFW B;  1H1Q B;  4EOP B;  5IDP B;  3BLQ B;  2UZL B;  1D3U B;  1H1P B;  5ACB A;  5HBH B;  3TNI B;  2PK2 A;  2QDJ A;  3MIA B;  3TNW B;  5CEI B;  3DDP B;  4BCK B;  1E9H B;  3TNH B;  1H28 B;  3BLR B;  4CFX B;  5LMK B;  4EON B;  4I3Z B;  1FVV B;  2WFY B;  4ELJ A;  1FIN B;  3POM A;  1VOL A;  1VYW B;  2WPA B;  4II5 B;  1N4M A;  2UZE B;  1KXU A;  3DDQ B;  1OIU B;  4EOS B;  1UNH D;  4FX3 B;  4KRD B;  4ELL A;  5IF1 B;  1GY3 B;  3K7A M;  1AIS B;  4CXA B;  5LQF B;  2UZD B;  2W9F A;  1C9B A;  1OIY B;  4Y72 B;  3F5X B;  5HVY B;  3LQ5 B;  2CJM B;  2PMI B;  4F6U B;  2B9R A;  3G33 B;  3RGF B;  4F70 B;  3MY5 B;  2I53 A;  2JGZ B;  4EOJ B;  4F6W B;  1OL2 B;  4EC8 B;  1GUX A;  5EFQ B;  4CRL B;  4F6S B;  5HNB B;  2EUF A;  5L2W B;  4EOI B;  2IW8 B;  2WMA B;  3BHV B;  2WIH B;  2R7G A;  4CFV B;  2C5O B;  2IVX A;  4YC3 B;  4BCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...