5HNBB

Cdk8-cycc in complex with [6-hydroxy-3-(3-methyl-benzyl)-1h-indazol-5-yl]-((s)-3-hydroxy-pyrrolidin-1-yl)-methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-dependent kinase 8
publication title CDK8-CYCC IN COMPLEX WITH [6-Hydroxy-3-(3-methyl-benzyl)-1H-indazol-5-yl]-((S)-3-hydroxy-pyrrolidin-1-yl)-methanone
rcsb
source organism Homo sapiens
total genus 98
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hnbB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hnbB01
2BPMB 2WIPB 4F7NB 1JSTB 3EIDB 4BCGB 2B9RA 1BU2A 1C9BA 2WMBB 5EFQB 4EOIB 1H24B 1OKVB 1XO2A 4EOPB 4EOQB 1H26B 4YOOA 2I40B 1AISB 5HQ0B 3DDPB 1TFBA 4BCND 2JGZB 4CXAB 1E9HB 3BHUB 3RGFB 5HBJB 1VINA 4EC9B 2QDJA 4BCMD 3MIAB 4BCIB 2PK2A 4KRCB 2UZDB 2C5XB 3BHTB 2UZLB 1G3NC 3BLRB 4BCJB 1D3UB 2WXVB 3M03A 2EUFA 1QMZB 5HBHB 2WPAB 4OR5B 2X1NB 2PMIB 1JKWA 4NSTB 1UNHD 2R7GA 4BCNB 1OKWB 4EOJB 4UN0A 1OL1B 3BHVB 3H4CA 4F7JB 1JSUB 1H28B 4ELJA 5IDNB 5CEIB 5L2WB 1KXUA 2C5VB 2IVXA 2PK9B 4EC8B 2IW9B 1AD6A 2WFYB 2C6TB 4BCPB 4EOLB 4ROCA 1OGUB 2WEVB 3DOGB 1FINB 1H1SB 3BLQB 1VOLA 1H27B 1P5EB 2UUEB 3TNHB 2UZEB 1H25B 3MY5B 2W99A 3F5XB 2C5OB 2W9ZA 4BCKB 2BKZB 5LQFB 3EOCB 4YC3B 1F5QB 2WHBB 4EOOB 4F70B 1OI9B 1FVVB 1VYWB 1GH6B 3TNIB 4CRLB 1URCB 1UNGD 2W9FA 4BCQD 1GY3B 2CCIB 4F7LB 4IMYB 1O9KB 1OIYB 4F6WB 1O9KA 1UNLD 4TTHA 4CFUD 3MI9B 2IW6B 4BCMB 4EOSB 5ICPB 4CFNB 5FGKB 1OIUB 5HNBB 2G9XB 4EONB 3TNWB 2IW8B 4YOZA 3DDQB 1ZP2A 4KRDB 4BCQB 5BNJB 4EOKB 1N4MA 4FX3B 2C4GB 2W96A 5HBEB 2WMAB 5CYIB 3POMA 1W98B 2I53A 4CFUB 4EORB 3EJ1B 4F7SB 4II5B 1JOWA 2V22B 4EOMB 4CFWB 3TN8B 4CFVB 2CJMB 4YOSA 4F6SB 2WIHB 4BCFB 3LQ5B 5ACBA 5HVYB 2CCHB 1H1RB 2PHGA 1H1QB 1GUXB 3BLHB 2UZBB 4ELLA 1GUXA 3G33B 1PKDB 4BCHB 3QHWB 3K7AM 3QHRB 4CFXB 2C5NB 5IF1B 3MY1B 4ROEA 4F6UB 4BCOB 4CFMB 5LMKB 1OL2B 5I5ZB 1H4LD 2F2CA 5IDPB 2W2HA 4OGRB 4RODA 1H1PB 4Y72B 4G6LB 3O0GD 4I3ZB
chains in the Genus database with same CATH superfamily
2WIPB 4F7NB 1JSTB 5EFQB 2ZZDB 1H26B 1AISB 5HQ0B 4BCND 3BHUB 2IN3A 2LW4A 2C5XB 3BHTB 2WXVB 3M03A 4BXXX 2X1NB 3BG9A 4UN0A 1OL1B 4ELJA 5L2WB 2ZPHB 4ZGEB 2PK9B 2BS3A 3B57A 3DOGB 4HLQA 3TW7A 1FINB 2BS2A 1H1SB 3BLQB 2UZEB 4YC3B 1UGPB 3WVEB 4EOOB 1OI9B 1URCB 2W9FA 1V29B 4F7LB 1O9KA 2ZPIB 2G9XB 2IW8B 4KRDB 4ZGDB 1N4MA 2DD4B 3DJBA 3VKGA 2WIHB 1H1RB 4ELLA 4AI6A 3QHRB 2DPPB 3PO3S 4BCOB 4AKHA 1H4LD 4MFEA 1QLBA 4OGRB 3VYGB 2WJ9A 4ZGJB 2B9RA 1BU2A 3WVDB 2D0QB 3DL1A 1H24B 1OKVB 1XO2A 3QYHB 4EOPB 4EOQB 2QF7A 1AHJB 2JGZB 4CXAB 3RGFB 3X26B 1VINA 4BBSM 2QDJA 3X25B 2UZDB 1G3NC 3BLRB 2DXBB 2EUFA 2DD5B 2WPAB 4OR5B 1JKWA 4NSTB 1UNHD 4F7JB 4NC6A 5IDNB 2C5VB 2IVXA 4EOLB 4BCPB 4ROCA 5DQVA 3A8GB 3QYBA 3MY5B 5LQFB 2ZPFB 2ZPBB 1VYWB 1GH6B 2QQ8A 3TNIB 4CRLB 4M6VA 3HO8A 4JX5A 1UNLD 3A8HB 2AHJB 3MI9B 5IHYA 5FGKB 1ENWA 4EONB 4MIMA 4YOZA 3DDQB 4BCQB 4EOKB 1IREB 1UGQB 5HBEB 3VKHA 2WMAB 4CFUB 2I53A 2KR6A 1JOWA 2CJMB 4YOSA 3LQ5B 4OB2B 4HNUA 1H1QB 1GUXB 3BLHB 3G33B 3QYEA 1PKDB 3QHWB 1E7PA 4HL4A 4CFMB 5LMKB 5I5ZB 2F2CA 2W2HA 4Z6YA 4BCKB 4KRCB 4I3ZB 2DXCB 2CZ1B 4LOCA 2KMGA 1FKMA 1C9BA 3BG3A 2WMBB 3VYHB 4YOOA 2QFZA 3QYGB 3DDPB 5HBJB 2CZ6B 5EJCA 4BCJB 2UZLB 2ZCFB 4BBRM 2PMIB 1OKWB 4EOJB 3BHVB 1JSUB 3QXEB 2CZ0B 2IW9B 4JX4A 1OGUB 3A8OB 3A8LB 1H27B 1P5EB 3TNHB 3F5XB 2W9ZA 1F5QB 3QWLA 4F70B 1FVVB 3HBLA 3A8MB 3X28B 4OB0B 4BCQD 1GY3B 2CCIB 1O9KB 4BY1X 4CFUD 2IW6B 4EOSB 2PJQA 1OIUB 4OB1B 5HNBB 4OB3B 3HHTB 3HZJA 4AKIA 1ZP2A 2W96A 1W98B 4EORB 3EJ1B 4F7SB 4CFWB 4CFVB 3NDQA 4BCFB 4FM4B 2CCHB 4BY7X 2PHGA 2UZBB 3X20B 3TW6A 3K7AM 4CFXB 4F6UB 1OL2B 4QSHA 4AKGA 5IDPB 2QDYB 1TD6A 4Y72B 2ZPGB 4G6LB 2BPMB 2CYZB 3DTOA 4BCGB 3EIDB 3BG5A 4EOIB 3QZ5B 2I40B 1TFBA 1E9HB 4EC9B 2BS4A 4BCMD 3MIAB 4BCIB 2PK2A 3QZ9B 1D3UB 1QMZB 5HBHB 2R7GA 4BCNB 5DQWA 2QGSA 3H4CA 5CEIB 1H28B 1KXUA 4EC8B 1AD6A 2WFYB 2C6TB 2WEVB 1UGRB 1VOLA 2UUEB 1H25B 2W99A 2C5OB 2BKZB 3EOCB 2WHBB 3KHIA 1UNGD 3X24B 4IMYB 1OIYB 4F6WB 4TTHA 4BCMB 5ICPB 4CFNB 1UGSB 4MFDA 3TNWB 3GTMS 5BNJB 4HNVA 4FX3B 2C4GB 4JX6A 5CYIB 3HB9A 3POMA 4II5B 2V22B 4EOMB 3TN8B 5ACBA 4F6SB 5HVYB 2G77A 4HNTA 1GUXA 4BCHB 2C5NB 5IF1B 3MY1B 4ROEA 2DMEA 4RODA 1H1PB 2ZPEB 2CZ7B 3O0GD
chains in the Genus database with same CATH topology
2BPMB 2WIPB 4F7NB 1JSTB 3EIDB 4BCGB 2B9RA 1BU2A 1C9BA 2WMBB 5EFQB 4EOIB 1H24B 1OKVB 1XO2A 4EOPB 4EOQB 1H26B 4YOOA 2I40B 1AISB 5HQ0B 3DDPB 1TFBA 4BCND 2JGZB 4CXAB 1E9HB 3BHUB 3RGFB 5HBJB 1VINA 4EC9B 2QDJA 4BCMD 3MIAB 4BCIB 2PK2A 4KRCB 2UZDB 2C5XB 3BHTB 2UZLB 1G3NC 3BLRB 4BCJB 1D3UB 2WXVB 3M03A 2EUFA 1QMZB 5HBHB 2WPAB 4OR5B 2X1NB 2PMIB 1JKWA 4NSTB 1UNHD 2R7GA 4BCNB 1OKWB 4EOJB 4UN0A 1OL1B 3BHVB 3H4CA 4F7JB 1JSUB 1H28B 4ELJA 5IDNB 5CEIB 5L2WB 1KXUA 2C5VB 2IVXA 2PK9B 4EC8B 2IW9B 1AD6A 2WFYB 2C6TB 4BCPB 4EOLB 4ROCA 1OGUB 2WEVB 3DOGB 1FINB 1H1SB 3BLQB 1VOLA 1H27B 1P5EB 2UUEB 3TNHB 2UZEB 1H25B 3MY5B 2W99A 3F5XB 2C5OB 2W9ZA 4BCKB 2BKZB 5LQFB 3EOCB 4YC3B 1F5QB 2WHBB 4EOOB 4F70B 1OI9B 1FVVB 1VYWB 1GH6B 3TNIB 4CRLB 1URCB 1UNGD 2W9FA 4BCQD 1GY3B 2CCIB 4F7LB 4IMYB 1O9KB 1OIYB 4F6WB 1O9KA 1UNLD 4TTHA 4CFUD 3MI9B 2IW6B 4BCMB 4EOSB 5ICPB 4CFNB 5FGKB 1OIUB 5HNBB 2G9XB 4EONB 3TNWB 2IW8B 4YOZA 3DDQB 1ZP2A 4KRDB 4BCQB 5BNJB 4EOKB 1N4MA 4FX3B 2C4GB 2W96A 5HBEB 2WMAB 5CYIB 3POMA 1W98B 2I53A 4CFUB 4EORB 3EJ1B 4F7SB 4II5B 1JOWA 2V22B 4EOMB 4CFWB 3TN8B 4CFVB 2CJMB 4YOSA 4F6SB 2WIHB 4BCFB 3LQ5B 5ACBA 5HVYB 2CCHB 1H1RB 2PHGA 1H1QB 1GUXB 3BLHB 2UZBB 4ELLA 1GUXA 3G33B 1PKDB 4BCHB 3QHWB 3K7AM 3QHRB 4CFXB 2C5NB 5IF1B 3MY1B 4ROEA 4F6UB 4BCOB 4CFMB 5LMKB 1OL2B 5I5ZB 1H4LD 2F2CA 5IDPB 2W2HA 4OGRB 4RODA 1H1PB 4Y72B 4G6LB 3O0GD 4I3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPM B;  2WIP B;  4F7N B;  1JST B;  3EID B;  4BCG B;  2B9R A;  1BU2 A;  1C9B A;  2WMB B;  5EFQ B;  4EOI B;  1H24 B;  1OKV B;  1XO2 A;  4EOP B;  4EOQ B;  1H26 B;  4YOO A;  2I40 B;  1AIS B;  5HQ0 B;  3DDP B;  1TFB A;  4BCN D;  2JGZ B;  4CXA B;  1E9H B;  3BHU B;  3RGF B;  5HBJ B;  1VIN A;  4EC9 B;  2QDJ A;  4BCM D;  3MIA B;  4BCI B;  2PK2 A;  4KRC B;  2UZD B;  2C5X B;  3BHT B;  2UZL B;  1G3N C;  3BLR B;  4BCJ B;  1D3U B;  2WXV B;  3M03 A;  2EUF A;  1QMZ B;  5HBH B;  2WPA B;  4OR5 B;  2X1N B;  2PMI B;  1JKW A;  4NST B;  1UNH D;  2R7G A;  4BCN B;  1OKW B;  4EOJ B;  4UN0 A;  1OL1 B;  3BHV B;  3H4C A;  4F7J B;  1JSU B;  1H28 B;  4ELJ A;  5IDN B;  5CEI B;  5L2W B;  1KXU A;  2C5V B;  2IVX A;  2PK9 B;  4EC8 B;  2IW9 B;  1AD6 A;  2WFY B;  2C6T B;  4BCP B;  4EOL B;  4ROC A;  1OGU B;  2WEV B;  3DOG B;  1FIN B;  1H1S B;  3BLQ B;  1VOL A;  1H27 B;  1P5E B;  2UUE B;  3TNH B;  2UZE B;  1H25 B;  3MY5 B;  2W99 A;  3F5X B;  2C5O B;  2W9Z A;  4BCK B;  2BKZ B;  5LQF B;  3EOC B;  4YC3 B;  1F5Q B;  2WHB B;  4EOO B;  4F70 B;  1OI9 B;  1FVV B;  1VYW B;  1GH6 B;  3TNI B;  4CRL B;  1URC B;  1UNG D;  2W9F A;  4BCQ D;  1GY3 B;  2CCI B;  4F7L B;  4IMY B;  1O9K B;  1OIY B;  4F6W B;  1O9K A;  1UNL D;  4TTH A;  4CFU D;  3MI9 B;  2IW6 B;  4BCM B;  4EOS B;  5ICP B;  4CFN B;  5FGK B;  1OIU B;  5HNB B;  2G9X B;  4EON B;  3TNW B;  2IW8 B;  4YOZ A;  3DDQ B;  1ZP2 A;  4KRD B;  4BCQ B;  5BNJ B;  4EOK B;  1N4M A;  4FX3 B;  2C4G B;  2W96 A;  5HBE B;  2WMA B;  5CYI B;  3POM A;  1W98 B;  2I53 A;  4CFU B;  4EOR B;  3EJ1 B;  4F7S B;  4II5 B;  1JOW A;  2V22 B;  4EOM B;  4CFW B;  3TN8 B;  4CFV B;  2CJM B;  4YOS A;  4F6S B;  2WIH B;  4BCF B;  3LQ5 B;  5ACB A;  5HVY B;  2CCH B;  1H1R B;  2PHG A;  1H1Q B;  1GUX B;  3BLH B;  2UZB B;  4ELL A;  1GUX A;  3G33 B;  1PKD B;  4BCH B;  3QHW B;  3K7A M;  3QHR B;  4CFX B;  2C5N B;  5IF1 B;  3MY1 B;  4ROE A;  4F6U B;  4BCO B;  4CFM B;  5LMK B;  1OL2 B;  5I5Z B;  1H4L D;  2F2C A;  5IDP B;  2W2H A;  4OGR B;  4ROD A;  1H1P B;  4Y72 B;  4G6L B;  3O0G D;  4I3Z B; 
#chains in the Genus database with same CATH topology
 2WIP B;  4F7N B;  1JST B;  5EFQ B;  2ZZD B;  1H26 B;  1AIS B;  5HQ0 B;  4BCN D;  3BHU B;  2IN3 A;  2LW4 A;  2C5X B;  3BHT B;  2WXV B;  3M03 A;  4BXX X;  2X1N B;  3BG9 A;  4UN0 A;  1OL1 B;  4ELJ A;  5L2W B;  2ZPH B;  4ZGE B;  2PK9 B;  2BS3 A;  3B57 A;  3DOG B;  4HLQ A;  3TW7 A;  1FIN B;  2BS2 A;  1H1S B;  3BLQ B;  2UZE B;  4YC3 B;  1UGP B;  3WVE B;  4EOO B;  1OI9 B;  1URC B;  2W9F A;  1V29 B;  4F7L B;  1O9K A;  2ZPI B;  2G9X B;  2IW8 B;  4KRD B;  4ZGD B;  1N4M A;  2DD4 B;  3DJB A;  3VKG A;  2WIH B;  1H1R B;  4ELL A;  4AI6 A;  3QHR B;  2DPP B;  3PO3 S;  4BCO B;  4AKH A;  1H4L D;  4MFE A;  1QLB A;  4OGR B;  3VYG B;  2WJ9 A;  4ZGJ B;  2B9R A;  1BU2 A;  3WVD B;  2D0Q B;  3DL1 A;  1H24 B;  1OKV B;  1XO2 A;  3QYH B;  4EOP B;  4EOQ B;  2QF7 A;  1AHJ B;  2JGZ B;  4CXA B;  3RGF B;  3X26 B;  1VIN A;  4BBS M;  2QDJ A;  3X25 B;  2UZD B;  1G3N C;  3BLR B;  2DXB B;  2EUF A;  2DD5 B;  2WPA B;  4OR5 B;  1JKW A;  4NST B;  1UNH D;  4F7J B;  4NC6 A;  5IDN B;  2C5V B;  2IVX A;  4EOL B;  4BCP B;  4ROC A;  5DQV A;  3A8G B;  3QYB A;  3MY5 B;  5LQF B;  2ZPF B;  2ZPB B;  1VYW B;  1GH6 B;  2QQ8 A;  3TNI B;  4CRL B;  4M6V A;  3HO8 A;  4JX5 A;  1UNL D;  3A8H B;  2AHJ B;  3MI9 B;  5IHY A;  5FGK B;  1ENW A;  4EON B;  4MIM A;  4YOZ A;  3DDQ B;  4BCQ B;  4EOK B;  1IRE B;  1UGQ B;  5HBE B;  3VKH A;  2WMA B;  4CFU B;  2I53 A;  2KR6 A;  1JOW A;  2CJM B;  4YOS A;  3LQ5 B;  4OB2 B;  4HNU A;  1H1Q B;  1GUX B;  3BLH B;  3G33 B;  3QYE A;  1PKD B;  3QHW B;  1E7P A;  4HL4 A;  4CFM B;  5LMK B;  5I5Z B;  2F2C A;  2W2H A;  4Z6Y A;  4BCK B;  4KRC B;  4I3Z B;  2DXC B;  2CZ1 B;  4LOC A;  2KMG A;  1FKM A;  1C9B A;  3BG3 A;  2WMB B;  3VYH B;  4YOO A;  2QFZ A;  3QYG B;  3DDP B;  5HBJ B;  2CZ6 B;  5EJC A;  4BCJ B;  2UZL B;  2ZCF B;  4BBR M;  2PMI B;  1OKW B;  4EOJ B;  3BHV B;  1JSU B;  3QXE B;  2CZ0 B;  2IW9 B;  4JX4 A;  1OGU B;  3A8O B;  3A8L B;  1H27 B;  1P5E B;  3TNH B;  3F5X B;  2W9Z A;  1F5Q B;  3QWL A;  4F70 B;  1FVV B;  3HBL A;  3A8M B;  3X28 B;  4OB0 B;  4BCQ D;  1GY3 B;  2CCI B;  1O9K B;  4BY1 X;  4CFU D;  2IW6 B;  4EOS B;  2PJQ A;  1OIU B;  4OB1 B;  5HNB B;  4OB3 B;  3HHT B;  3HZJ A;  4AKI A;  1ZP2 A;  2W96 A;  1W98 B;  4EOR B;  3EJ1 B;  4F7S B;  4CFW B;  4CFV B;  3NDQ A;  4BCF B;  4FM4 B;  2CCH B;  4BY7 X;  2PHG A;  2UZB B;  3X20 B;  3TW6 A;  3K7A M;  4CFX B;  4F6U B;  1OL2 B;  4QSH A;  4AKG A;  5IDP B;  2QDY B;  1TD6 A;  4Y72 B;  2ZPG B;  4G6L B;  2BPM B;  2CYZ B;  3DTO A;  4BCG B;  3EID B;  3BG5 A;  4EOI B;  3QZ5 B;  2I40 B;  1TFB A;  1E9H B;  4EC9 B;  2BS4 A;  4BCM D;  3MIA B;  4BCI B;  2PK2 A;  3QZ9 B;  1D3U B;  1QMZ B;  5HBH B;  2R7G A;  4BCN B;  5DQW A;  2QGS A;  3H4C A;  5CEI B;  1H28 B;  1KXU A;  4EC8 B;  1AD6 A;  2WFY B;  2C6T B;  2WEV B;  1UGR B;  1VOL A;  2UUE B;  1H25 B;  2W99 A;  2C5O B;  2BKZ B;  3EOC B;  2WHB B;  3KHI A;  1UNG D;  3X24 B;  4IMY B;  1OIY B;  4F6W B;  4TTH A;  4BCM B;  5ICP B;  4CFN B;  1UGS B;  4MFD A;  3TNW B;  3GTM S;  5BNJ B;  4HNV A;  4FX3 B;  2C4G B;  4JX6 A;  5CYI B;  3HB9 A;  3POM A;  4II5 B;  2V22 B;  4EOM B;  3TN8 B;  5ACB A;  4F6S B;  5HVY B;  2G77 A;  4HNT A;  1GUX A;  4BCH B;  2C5N B;  5IF1 B;  3MY1 B;  4ROE A;  2DME A;  4ROD A;  1H1P B;  2ZPE B;  2CZ7 B;  3O0G D; 
#chains in the Genus database with same CATH homology
 2BPM B;  2WIP B;  4F7N B;  1JST B;  3EID B;  4BCG B;  2B9R A;  1BU2 A;  1C9B A;  2WMB B;  5EFQ B;  4EOI B;  1H24 B;  1OKV B;  1XO2 A;  4EOP B;  4EOQ B;  1H26 B;  4YOO A;  2I40 B;  1AIS B;  5HQ0 B;  3DDP B;  1TFB A;  4BCN D;  2JGZ B;  4CXA B;  1E9H B;  3BHU B;  3RGF B;  5HBJ B;  1VIN A;  4EC9 B;  2QDJ A;  4BCM D;  3MIA B;  4BCI B;  2PK2 A;  4KRC B;  2UZD B;  2C5X B;  3BHT B;  2UZL B;  1G3N C;  3BLR B;  4BCJ B;  1D3U B;  2WXV B;  3M03 A;  2EUF A;  1QMZ B;  5HBH B;  2WPA B;  4OR5 B;  2X1N B;  2PMI B;  1JKW A;  4NST B;  1UNH D;  2R7G A;  4BCN B;  1OKW B;  4EOJ B;  4UN0 A;  1OL1 B;  3BHV B;  3H4C A;  4F7J B;  1JSU B;  1H28 B;  4ELJ A;  5IDN B;  5CEI B;  5L2W B;  1KXU A;  2C5V B;  2IVX A;  2PK9 B;  4EC8 B;  2IW9 B;  1AD6 A;  2WFY B;  2C6T B;  4BCP B;  4EOL B;  4ROC A;  1OGU B;  2WEV B;  3DOG B;  1FIN B;  1H1S B;  3BLQ B;  1VOL A;  1H27 B;  1P5E B;  2UUE B;  3TNH B;  2UZE B;  1H25 B;  3MY5 B;  2W99 A;  3F5X B;  2C5O B;  2W9Z A;  4BCK B;  2BKZ B;  5LQF B;  3EOC B;  4YC3 B;  1F5Q B;  2WHB B;  4EOO B;  4F70 B;  1OI9 B;  1FVV B;  1VYW B;  1GH6 B;  3TNI B;  4CRL B;  1URC B;  1UNG D;  2W9F A;  4BCQ D;  1GY3 B;  2CCI B;  4F7L B;  4IMY B;  1O9K B;  1OIY B;  4F6W B;  1O9K A;  1UNL D;  4TTH A;  4CFU D;  3MI9 B;  2IW6 B;  4BCM B;  4EOS B;  5ICP B;  4CFN B;  5FGK B;  1OIU B;  5HNB B;  2G9X B;  4EON B;  3TNW B;  2IW8 B;  4YOZ A;  3DDQ B;  1ZP2 A;  4KRD B;  4BCQ B;  5BNJ B;  4EOK B;  1N4M A;  4FX3 B;  2C4G B;  2W96 A;  5HBE B;  2WMA B;  5CYI B;  3POM A;  1W98 B;  2I53 A;  4CFU B;  4EOR B;  3EJ1 B;  4F7S B;  4II5 B;  1JOW A;  2V22 B;  4EOM B;  4CFW B;  3TN8 B;  4CFV B;  2CJM B;  4YOS A;  4F6S B;  2WIH B;  4BCF B;  3LQ5 B;  5ACB A;  5HVY B;  2CCH B;  1H1R B;  2PHG A;  1H1Q B;  1GUX B;  3BLH B;  2UZB B;  4ELL A;  1GUX A;  3G33 B;  1PKD B;  4BCH B;  3QHW B;  3K7A M;  3QHR B;  4CFX B;  2C5N B;  5IF1 B;  3MY1 B;  4ROE A;  4F6U B;  4BCO B;  4CFM B;  5LMK B;  1OL2 B;  5I5Z B;  1H4L D;  2F2C A;  5IDP B;  2W2H A;  4OGR B;  4ROD A;  1H1P B;  4Y72 B;  4G6L B;  3O0G D;  4I3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...