5HNBB

Cdk8-cycc in complex with [6-hydroxy-3-(3-methyl-benzyl)-1h-indazol-5-yl]-((s)-3-hydroxy-pyrrolidin-1-yl)-methanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
266
Chain Sequence
b'KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title CDK8-CYCC IN COMPLEX WITH [6-Hydroxy-3-(3-methyl-benzyl)-1H-indazol-5-yl]-((S)-3-hydroxy-pyrrolidin-1-yl)-methanone
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hnbB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5hnbB01
1OIUB 3POMA 2WIHB 4YOOA 5L2WB 4BCNB 2I40B 4EORB 1GY3B 5HBHB 2CCIB 4EOSB 1QMZB 5BNJB 4I3ZB 2WMBB 2W96A 1JKWA 3LQ5B 2R7GA 1JOWA 1H27B 4EC8B 4IMYB 1KXUA 5HVYB 4EONB 4YC3B 2CCHB 2WMAB 3F5XB 1H28B 4ROEA 1URCB 4BCIB 4EOJB 5ICPB 3DDPB 2PMIB 5I5ZB 5LMKB 1JSTB 4CRLB 4EOMB 3MIAB 4UN0A 3BHTB 2WXVB 2C5XB 4F7NB 4F7JB 4RODA 1F5QB 4G6LB 4F6SB 4BCGB 1OGUB 1C9BA 1OI9B 1G3NC 2EUFA 5EFQB 4BCOB 2JGZB 2QDJA 4Y72B 1P5EB 2WHBB 3QHRB 4F7LB 3DDQB 1PKDB 3MI9B 5ACBA 3EIDB 1JSUB 4CFXB 4ROCA 1VOLA 1H1RB 2UZEB 1VINA 2IW6B 2PHGA 2PK9B 4CFVB 1AISB 2V22B 1UNGD 4BCPB 4EOIB 4CFMB 1H24B 4ELLA 4ELJA 5LQFB 1E9HB 1H26B 4NSTB 2WIPB 3MY5B 3BLRB 3TNIB 1D3UB 3H4CA 4BCMB 5FGKB 4CFWB 2C5OB 1GUXB 4KRCB 2W99A 4FX3B 5CYIB 4OGRB 1H25B 2C6TB 2CJMB 5HBJB 1OKVB 2UZBB 3M03A 1H4LD 1TFBA 3O0GD 3TNHB 4BCQB 1O9KB 4EOLB 4F6WB 3EOCB 4BCFB 1GUXA 4II5B 1AD6A 4BCJB 4EOQB 2C4GB 1FVVB 2BPMB 3BHVB 5IF1B 4CFNB 1FINB 4F70B 4CFUD 3BLQB 4YOZA 4TTHA 1H1SB 2I53A 4BCQD 3EJ1B 2IW9B 2X1NB 1UNLD 5IDNB 4EC9B 4BCND 2W2HA 3RGFB 3G33B 5HNBB 1W98B 2W9FA 2UZDB 4F6UB 1H1QB 1OKWB 3TN8B 3TNWB 2C5NB 3K7AM 4F7SB 2PK2A 2WPAB 4BCKB 3BHUB 4CXAB 5IDPB 4OR5B 3DOGB 3BLHB 1UNHD 4EOPB 2WEVB 2WFYB 2BKZB 5HQ0B 5HBEB 1N4MA 2W9ZA 2IVXA 1XO2A 1GH6B 1OL1B 5CEIB 2G9XB 1O9KA 1ZP2A 4BCHB 4EOKB 2C5VB 2IW8B 3QHWB 1VYWB 3MY1B 4YOSA 4BCMD 4CFUB 1H1PB 2F2CA 2B9RA 2UUEB 1BU2A 4EOOB 1OL2B 4KRDB 1OIYB 2UZLB
chains in the Genus database with same CATH superfamily
1OIUB 3NDQA 5L2WB 4OB0B 4EORB 5BNJB 2W96A 1JOWA 4EC8B 4IMYB 5DQVA 5HVYB 4YC3B 2CCHB 1URCB 2PMIB 2QFZA 1FKMA 4BCGB 5EFQB 3A8OB 4HNTA 3GTMS 4CFXB 4ROCA 1VOLA 2ZPFB 1UNGD 4BCPB 4QSHA 4LOCA 4ELJA 5LQFB 1H26B 4NSTB 4BY1X 4HL4A 4CFWB 4ZGDB 2C5OB 4OGRB 1H25B 3X24B 3M03A 3EOCB 4OB1B 4BCJB 4EOQB 2ZPHB 1FVVB 3QYHB 3BG5A 4TTHA 2DD4B 4BCQD 4MFEA 2X1NB 2WJ9A 4HLQA 1W98B 3QWLA 1AHJB 3WVDB 3TW7A 4BCKB 2BS2A 4OB3B 1UNHD 2QQ8A 4BCMD 2BS3A 4I3ZB 4BCQB 1OL2B 3VKGA 4F6SB 3POMA 1UGRB 2KMGA 2WIHB 4YOOA 5HBHB 2CCIB 3VKHA 1H27B 3PO3S 2ZPGB 2WMAB 1H28B 4ROEA 5ICPB 3DDPB 5LMKB 4EOMB 4AI6A 1UGPB 1QLBA 2C5XB 4F7NB 4RODA 3A8GB 1C9BA 2CYZB 4BCOB 2QF7A 3BG3A 5IHYA 4CFVB 2V22B 4EOIB 4ELLA 2DXBB 4BY7X 5FGKB 3VYHB 1GUXB 2W99A 4FX3B 2CJMB 5HBJB 1TFBA 4BCFB 2ZPBB 1V29B 2BPMB 2QGSA 3BHVB 4CFUD 4JX5A 1H1SB 2I53A 3DL1A 4BCND 2CZ1B 3G33B 4JX4A 2UZDB 4F6UB 3HZJA 1H1QB 2PK2A 5IDPB 3BHUB 3BLHB 2WEVB 5HBEB 1N4MA 2W9ZA 2IVXA 1XO2A 4NC6A 1O9KA 2IW8B 4CFUB 2B9RA 2UUEB 3X25B 4BCNB 2I40B 1GY3B 2WMBB 5DQWA 3F5XB 4EOJB 3MIAB 4UN0A 3A8HB 4ZGEB 1TD6A 4F7JB 1OGUB 3B57A 3QYEA 1OI9B 2EUFA 3BG9A 4BBSM 2JGZB 2QDJA 4Y72B 1P5EB 4F7LB 3QHRB 4MIMA 3DDQB 1PKDB 2QDYB 1VINA 2PHGA 3HBLA 1H24B 3QXEB 3QYBA 1E9HB 1E7PA 3MY5B 3BLRB 3TNIB 1UGSB 4BCMB 4JX6A 5CYIB 4KRCB 2C6TB 5EJCA 1OKVB 2UZBB 1H4LD 2ZPIB 1UGQB 1O9KB 4EOLB 4F6WB 2DXCB 4AKHA 1AD6A 2C4GB 3WVEB 2DPPB 1FINB 2AHJB 3EJ1B 4BXXX 5IDNB 2ZCFB 3RGFB 2W9FA 3DJBA 1OKWB 3VYGB 2PJQA 4OR5B 3DOGB 5HQ0B 3X28B 1OL1B 4BCHB 4ZGJB 2C5VB 1VYWB 3MY1B 4EOOB 4OB2B 3DTOA 3A8LB 4EOSB 1QMZB 1JKWA 3LQ5B 2R7GA 3A8MB 2ZZDB 1KXUA 4EONB 2LW4A 4BCIB 4AKGA 5I5ZB 2CZ7B 1JSTB 4CRLB 3QZ9B 3BHTB 2WXVB 4Z6YA 1F5QB 4G6LB 1G3NC 2WHBB 2KR6A 3MI9B 5ACBA 3EIDB 4MFDA 1JSUB 2BS4A 3QYGB 1H1RB 3KHIA 2UZEB 2IW6B 2PK9B 1AISB 2DD5B 4CFMB 4M6VA 2ZPEB 2WIPB 1D3UB 3H4CA 3O0GD 3TW6A 3TNHB 2CZ0B 2CZ6B 1GUXA 4II5B 3HB9A 3QZ5B 3X26B 5IF1B 4CFNB 4F70B 3BLQB 4YOZA 2IW9B 3X20B 1UNLD 4EC9B 2W2HA 4FM4B 5HNBB 3TN8B 3TNWB 2D0QB 2C5NB 3K7AM 4F7SB 2DMEA 4CXAB 2WPAB 4HNVA 4EOPB 1ENWA 2WFYB 2BKZB 3HO8A 3HHTB 1IREB 4AKIA 1GH6B 4BBRM 5CEIB 2G9XB 1ZP2A 4EOKB 3QHWB 4HNUA 4YOSA 2G77A 1H1PB 2F2CA 2IN3A 1BU2A 4KRDB 1OIYB 2UZLB
chains in the Genus database with same CATH topology
1OIUB 3POMA 2WIHB 4YOOA 5L2WB 4BCNB 2I40B 4EORB 1GY3B 5HBHB 2CCIB 4EOSB 1QMZB 5BNJB 4I3ZB 2WMBB 2W96A 1JKWA 3LQ5B 2R7GA 1JOWA 1H27B 4EC8B 4IMYB 1KXUA 5HVYB 4EONB 4YC3B 2CCHB 2WMAB 3F5XB 1H28B 4ROEA 1URCB 4BCIB 4EOJB 5ICPB 3DDPB 2PMIB 5I5ZB 5LMKB 1JSTB 4CRLB 4EOMB 3MIAB 4UN0A 3BHTB 2WXVB 2C5XB 4F7NB 4F7JB 4RODA 1F5QB 4G6LB 4F6SB 4BCGB 1OGUB 1C9BA 1OI9B 1G3NC 2EUFA 5EFQB 4BCOB 2JGZB 2QDJA 4Y72B 1P5EB 2WHBB 3QHRB 4F7LB 3DDQB 1PKDB 3MI9B 5ACBA 3EIDB 1JSUB 4CFXB 4ROCA 1VOLA 1H1RB 2UZEB 1VINA 2IW6B 2PHGA 2PK9B 4CFVB 1AISB 2V22B 1UNGD 4BCPB 4EOIB 4CFMB 1H24B 4ELLA 4ELJA 5LQFB 1E9HB 1H26B 4NSTB 2WIPB 3MY5B 3BLRB 3TNIB 1D3UB 3H4CA 4BCMB 5FGKB 4CFWB 2C5OB 1GUXB 4KRCB 2W99A 4FX3B 5CYIB 4OGRB 1H25B 2C6TB 2CJMB 5HBJB 1OKVB 2UZBB 3M03A 1H4LD 1TFBA 3O0GD 3TNHB 4BCQB 1O9KB 4EOLB 4F6WB 3EOCB 4BCFB 1GUXA 4II5B 1AD6A 4BCJB 4EOQB 2C4GB 1FVVB 2BPMB 3BHVB 5IF1B 4CFNB 1FINB 4F70B 4CFUD 3BLQB 4YOZA 4TTHA 1H1SB 2I53A 4BCQD 3EJ1B 2IW9B 2X1NB 1UNLD 5IDNB 4EC9B 4BCND 2W2HA 3RGFB 3G33B 5HNBB 1W98B 2W9FA 2UZDB 4F6UB 1H1QB 1OKWB 3TN8B 3TNWB 2C5NB 3K7AM 4F7SB 2PK2A 2WPAB 4BCKB 3BHUB 4CXAB 5IDPB 4OR5B 3DOGB 3BLHB 1UNHD 4EOPB 2WEVB 2WFYB 2BKZB 5HQ0B 5HBEB 1N4MA 2W9ZA 2IVXA 1XO2A 1GH6B 1OL1B 5CEIB 2G9XB 1O9KA 1ZP2A 4BCHB 4EOKB 2C5VB 2IW8B 3QHWB 1VYWB 3MY1B 4YOSA 4BCMD 4CFUB 1H1PB 2F2CA 2B9RA 2UUEB 1BU2A 4EOOB 1OL2B 4KRDB 1OIYB 2UZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OIU B;  3POM A;  2WIH B;  4YOO A;  5L2W B;  4BCN B;  2I40 B;  4EOR B;  1GY3 B;  5HBH B;  2CCI B;  4EOS B;  1QMZ B;  5BNJ B;  4I3Z B;  2WMB B;  2W96 A;  1JKW A;  3LQ5 B;  2R7G A;  1JOW A;  1H27 B;  4EC8 B;  4IMY B;  1KXU A;  5HVY B;  4EON B;  4YC3 B;  2CCH B;  2WMA B;  3F5X B;  1H28 B;  4ROE A;  1URC B;  4BCI B;  4EOJ B;  5ICP B;  3DDP B;  2PMI B;  5I5Z B;  5LMK B;  1JST B;  4CRL B;  4EOM B;  3MIA B;  4UN0 A;  3BHT B;  2WXV B;  2C5X B;  4F7N B;  4F7J B;  4ROD A;  1F5Q B;  4G6L B;  4F6S B;  4BCG B;  1OGU B;  1C9B A;  1OI9 B;  1G3N C;  2EUF A;  5EFQ B;  4BCO B;  2JGZ B;  2QDJ A;  4Y72 B;  1P5E B;  2WHB B;  3QHR B;  4F7L B;  3DDQ B;  1PKD B;  3MI9 B;  5ACB A;  3EID B;  1JSU B;  4CFX B;  4ROC A;  1VOL A;  1H1R B;  2UZE B;  1VIN A;  2IW6 B;  2PHG A;  2PK9 B;  4CFV B;  1AIS B;  2V22 B;  1UNG D;  4BCP B;  4EOI B;  4CFM B;  1H24 B;  4ELL A;  4ELJ A;  5LQF B;  1E9H B;  1H26 B;  4NST B;  2WIP B;  3MY5 B;  3BLR B;  3TNI B;  1D3U B;  3H4C A;  4BCM B;  5FGK B;  4CFW B;  2C5O B;  1GUX B;  4KRC B;  2W99 A;  4FX3 B;  5CYI B;  4OGR B;  1H25 B;  2C6T B;  2CJM B;  5HBJ B;  1OKV B;  2UZB B;  3M03 A;  1H4L D;  1TFB A;  3O0G D;  3TNH B;  4BCQ B;  1O9K B;  4EOL B;  4F6W B;  3EOC B;  4BCF B;  1GUX A;  4II5 B;  1AD6 A;  4BCJ B;  4EOQ B;  2C4G B;  1FVV B;  2BPM B;  3BHV B;  5IF1 B;  4CFN B;  1FIN B;  4F70 B;  4CFU D;  3BLQ B;  4YOZ A;  4TTH A;  1H1S B;  2I53 A;  4BCQ D;  3EJ1 B;  2IW9 B;  2X1N B;  1UNL D;  5IDN B;  4EC9 B;  4BCN D;  2W2H A;  3RGF B;  3G33 B;  5HNB B;  1W98 B;  2W9F A;  2UZD B;  4F6U B;  1H1Q B;  1OKW B;  3TN8 B;  3TNW B;  2C5N B;  3K7A M;  4F7S B;  2PK2 A;  2WPA B;  4BCK B;  3BHU B;  4CXA B;  5IDP B;  4OR5 B;  3DOG B;  3BLH B;  1UNH D;  4EOP B;  2WEV B;  2WFY B;  2BKZ B;  5HQ0 B;  5HBE B;  1N4M A;  2W9Z A;  2IVX A;  1XO2 A;  1GH6 B;  1OL1 B;  5CEI B;  2G9X B;  1O9K A;  1ZP2 A;  4BCH B;  4EOK B;  2C5V B;  2IW8 B;  3QHW B;  1VYW B;  3MY1 B;  4YOS A;  4BCM D;  4CFU B;  1H1P B;  2F2C A;  2B9R A;  2UUE B;  1BU2 A;  4EOO B;  1OL2 B;  4KRD B;  1OIY B;  2UZL B; 
#chains in the Genus database with same CATH topology
 1OIU B;  3NDQ A;  5L2W B;  4OB0 B;  4EOR B;  5BNJ B;  2W96 A;  1JOW A;  4EC8 B;  4IMY B;  5DQV A;  5HVY B;  4YC3 B;  2CCH B;  1URC B;  2PMI B;  2QFZ A;  1FKM A;  4BCG B;  5EFQ B;  3A8O B;  4HNT A;  3GTM S;  4CFX B;  4ROC A;  1VOL A;  2ZPF B;  1UNG D;  4BCP B;  4QSH A;  4LOC A;  4ELJ A;  5LQF B;  1H26 B;  4NST B;  4BY1 X;  4HL4 A;  4CFW B;  4ZGD B;  2C5O B;  4OGR B;  1H25 B;  3X24 B;  3M03 A;  3EOC B;  4OB1 B;  4BCJ B;  4EOQ B;  2ZPH B;  1FVV B;  3QYH B;  3BG5 A;  4TTH A;  2DD4 B;  4BCQ D;  4MFE A;  2X1N B;  2WJ9 A;  4HLQ A;  1W98 B;  3QWL A;  1AHJ B;  3WVD B;  3TW7 A;  4BCK B;  2BS2 A;  4OB3 B;  1UNH D;  2QQ8 A;  4BCM D;  2BS3 A;  4I3Z B;  4BCQ B;  1OL2 B;  3VKG A;  4F6S B;  3POM A;  1UGR B;  2KMG A;  2WIH B;  4YOO A;  5HBH B;  2CCI B;  3VKH A;  1H27 B;  3PO3 S;  2ZPG B;  2WMA B;  1H28 B;  4ROE A;  5ICP B;  3DDP B;  5LMK B;  4EOM B;  4AI6 A;  1UGP B;  1QLB A;  2C5X B;  4F7N B;  4ROD A;  3A8G B;  1C9B A;  2CYZ B;  4BCO B;  2QF7 A;  3BG3 A;  5IHY A;  4CFV B;  2V22 B;  4EOI B;  4ELL A;  2DXB B;  4BY7 X;  5FGK B;  3VYH B;  1GUX B;  2W99 A;  4FX3 B;  2CJM B;  5HBJ B;  1TFB A;  4BCF B;  2ZPB B;  1V29 B;  2BPM B;  2QGS A;  3BHV B;  4CFU D;  4JX5 A;  1H1S B;  2I53 A;  3DL1 A;  4BCN D;  2CZ1 B;  3G33 B;  4JX4 A;  2UZD B;  4F6U B;  3HZJ A;  1H1Q B;  2PK2 A;  5IDP B;  3BHU B;  3BLH B;  2WEV B;  5HBE B;  1N4M A;  2W9Z A;  2IVX A;  1XO2 A;  4NC6 A;  1O9K A;  2IW8 B;  4CFU B;  2B9R A;  2UUE B;  3X25 B;  4BCN B;  2I40 B;  1GY3 B;  2WMB B;  5DQW A;  3F5X B;  4EOJ B;  3MIA B;  4UN0 A;  3A8H B;  4ZGE B;  1TD6 A;  4F7J B;  1OGU B;  3B57 A;  3QYE A;  1OI9 B;  2EUF A;  3BG9 A;  4BBS M;  2JGZ B;  2QDJ A;  4Y72 B;  1P5E B;  4F7L B;  3QHR B;  4MIM A;  3DDQ B;  1PKD B;  2QDY B;  1VIN A;  2PHG A;  3HBL A;  1H24 B;  3QXE B;  3QYB A;  1E9H B;  1E7P A;  3MY5 B;  3BLR B;  3TNI B;  1UGS B;  4BCM B;  4JX6 A;  5CYI B;  4KRC B;  2C6T B;  5EJC A;  1OKV B;  2UZB B;  1H4L D;  2ZPI B;  1UGQ B;  1O9K B;  4EOL B;  4F6W B;  2DXC B;  4AKH A;  1AD6 A;  2C4G B;  3WVE B;  2DPP B;  1FIN B;  2AHJ B;  3EJ1 B;  4BXX X;  5IDN B;  2ZCF B;  3RGF B;  2W9F A;  3DJB A;  1OKW B;  3VYG B;  2PJQ A;  4OR5 B;  3DOG B;  5HQ0 B;  3X28 B;  1OL1 B;  4BCH B;  4ZGJ B;  2C5V B;  1VYW B;  3MY1 B;  4EOO B;  4OB2 B;  3DTO A;  3A8L B;  4EOS B;  1QMZ B;  1JKW A;  3LQ5 B;  2R7G A;  3A8M B;  2ZZD B;  1KXU A;  4EON B;  2LW4 A;  4BCI B;  4AKG A;  5I5Z B;  2CZ7 B;  1JST B;  4CRL B;  3QZ9 B;  3BHT B;  2WXV B;  4Z6Y A;  1F5Q B;  4G6L B;  1G3N C;  2WHB B;  2KR6 A;  3MI9 B;  5ACB A;  3EID B;  4MFD A;  1JSU B;  2BS4 A;  3QYG B;  1H1R B;  3KHI A;  2UZE B;  2IW6 B;  2PK9 B;  1AIS B;  2DD5 B;  4CFM B;  4M6V A;  2ZPE B;  2WIP B;  1D3U B;  3H4C A;  3O0G D;  3TW6 A;  3TNH B;  2CZ0 B;  2CZ6 B;  1GUX A;  4II5 B;  3HB9 A;  3QZ5 B;  3X26 B;  5IF1 B;  4CFN B;  4F70 B;  3BLQ B;  4YOZ A;  2IW9 B;  3X20 B;  1UNL D;  4EC9 B;  2W2H A;  4FM4 B;  5HNB B;  3TN8 B;  3TNW B;  2D0Q B;  2C5N B;  3K7A M;  4F7S B;  2DME A;  4CXA B;  2WPA B;  4HNV A;  4EOP B;  1ENW A;  2WFY B;  2BKZ B;  3HO8 A;  3HHT B;  1IRE B;  4AKI A;  1GH6 B;  4BBR M;  5CEI B;  2G9X B;  1ZP2 A;  4EOK B;  3QHW B;  4HNU A;  4YOS A;  2G77 A;  1H1P B;  2F2C A;  2IN3 A;  1BU2 A;  4KRD B;  1OIY B;  2UZL B; 
#chains in the Genus database with same CATH homology
 1OIU B;  3POM A;  2WIH B;  4YOO A;  5L2W B;  4BCN B;  2I40 B;  4EOR B;  1GY3 B;  5HBH B;  2CCI B;  4EOS B;  1QMZ B;  5BNJ B;  4I3Z B;  2WMB B;  2W96 A;  1JKW A;  3LQ5 B;  2R7G A;  1JOW A;  1H27 B;  4EC8 B;  4IMY B;  1KXU A;  5HVY B;  4EON B;  4YC3 B;  2CCH B;  2WMA B;  3F5X B;  1H28 B;  4ROE A;  1URC B;  4BCI B;  4EOJ B;  5ICP B;  3DDP B;  2PMI B;  5I5Z B;  5LMK B;  1JST B;  4CRL B;  4EOM B;  3MIA B;  4UN0 A;  3BHT B;  2WXV B;  2C5X B;  4F7N B;  4F7J B;  4ROD A;  1F5Q B;  4G6L B;  4F6S B;  4BCG B;  1OGU B;  1C9B A;  1OI9 B;  1G3N C;  2EUF A;  5EFQ B;  4BCO B;  2JGZ B;  2QDJ A;  4Y72 B;  1P5E B;  2WHB B;  3QHR B;  4F7L B;  3DDQ B;  1PKD B;  3MI9 B;  5ACB A;  3EID B;  1JSU B;  4CFX B;  4ROC A;  1VOL A;  1H1R B;  2UZE B;  1VIN A;  2IW6 B;  2PHG A;  2PK9 B;  4CFV B;  1AIS B;  2V22 B;  1UNG D;  4BCP B;  4EOI B;  4CFM B;  1H24 B;  4ELL A;  4ELJ A;  5LQF B;  1E9H B;  1H26 B;  4NST B;  2WIP B;  3MY5 B;  3BLR B;  3TNI B;  1D3U B;  3H4C A;  4BCM B;  5FGK B;  4CFW B;  2C5O B;  1GUX B;  4KRC B;  2W99 A;  4FX3 B;  5CYI B;  4OGR B;  1H25 B;  2C6T B;  2CJM B;  5HBJ B;  1OKV B;  2UZB B;  3M03 A;  1H4L D;  1TFB A;  3O0G D;  3TNH B;  4BCQ B;  1O9K B;  4EOL B;  4F6W B;  3EOC B;  4BCF B;  1GUX A;  4II5 B;  1AD6 A;  4BCJ B;  4EOQ B;  2C4G B;  1FVV B;  2BPM B;  3BHV B;  5IF1 B;  4CFN B;  1FIN B;  4F70 B;  4CFU D;  3BLQ B;  4YOZ A;  4TTH A;  1H1S B;  2I53 A;  4BCQ D;  3EJ1 B;  2IW9 B;  2X1N B;  1UNL D;  5IDN B;  4EC9 B;  4BCN D;  2W2H A;  3RGF B;  3G33 B;  5HNB B;  1W98 B;  2W9F A;  2UZD B;  4F6U B;  1H1Q B;  1OKW B;  3TN8 B;  3TNW B;  2C5N B;  3K7A M;  4F7S B;  2PK2 A;  2WPA B;  4BCK B;  3BHU B;  4CXA B;  5IDP B;  4OR5 B;  3DOG B;  3BLH B;  1UNH D;  4EOP B;  2WEV B;  2WFY B;  2BKZ B;  5HQ0 B;  5HBE B;  1N4M A;  2W9Z A;  2IVX A;  1XO2 A;  1GH6 B;  1OL1 B;  5CEI B;  2G9X B;  1O9K A;  1ZP2 A;  4BCH B;  4EOK B;  2C5V B;  2IW8 B;  3QHW B;  1VYW B;  3MY1 B;  4YOS A;  4BCM D;  4CFU B;  1H1P B;  2F2C A;  2B9R A;  2UUE B;  1BU2 A;  4EOO B;  1OL2 B;  4KRD B;  1OIY B;  2UZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...