4F70B

Crystal structure of human cdk8/cycc in complex with compound 4 (1-[3-tert-butyl-1-(4-methylphenyl)-1h-pyrazol-5-yl]-3-[2-(morpholin-4-yl)ethyl]urea)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription/inhibitor
molecule keywords Cyclin-dependent kinase 8
publication title Structure-kinetic relationship study of CDK8/CycC specific compounds.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f70B02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4f70B01
2B9RA 5HBJB 4F70B 1GUXA 1N4MA 1H24B 1H4LD 2C5NB 4F7LB 2WMAB 3MY5B 5FGKB 2CCHB 2IW8B 4BCOB 4BCFB 3BLRB 4CFVB 4BCGB 3EJ1B 4YC3B 5LMKB 2PMIB 1AISB 1AD6A 3TNIB 1GH6B 5LQFB 1OKWB 2IW9B 1OL1B 1UNGD 2BKZB 1TFBA 4IMYB 1W98B 2W9FA 4KRCB 1VYWB 2V22B 5CYIB 4ELLA 3BLQB 1OIYB 1P5EB 4BCIB 2W9ZA 4CFNB 2WPAB 4EOIB 1OKVB 5HQ0B 3BLHB 4ELJA 4F6UB 3MIAB 4F6SB 4OR5B 3G33B 1UNHD 4BCND 1FVVB 4EOQB 2F2CA 4CRLB 1H1RB 2BPMB 4F7NB 1JKWA 2C5OB 3TNHB 2X1NB 4BCQB 2WEVB 1URCB 3O0GD 4I3ZB 3M03A 4UN0A 2R7GA 4II5B 3TN8B 3TNWB 4BCJB 4EOPB 5HVYB 1VOLA 1H27B 5I5ZB 1JOWA 1JSUB 1OGUB 2UZBB 3DDPB 4EOKB 4CFMB 2G9XB 4EOMB 4CFUD 1H1PB 2C6TB 3BHTB 2WIHB 4EOOB 5IDNB 1XO2A 2PK2A 4FX3B 4BCHB 5HBEB 3BHVB 2EUFA 5BNJB 4CFWB 3BHUB 1OI9B 2WMBB 2IW6B 3LQ5B 1G3NC 1H1SB 4CFXB 2CCIB 4YOSA 2UZEB 4EOLB 2UZDB 2QDJA 3POMA 2CJMB 4EC8B 4EORB 1QMZB 4BCMB 4BCNB 5L2WB 1F5QB 1E9HB 1OL2B 3F5XB 4F6WB 4EOJB 2IVXA 4Y72B 1GY3B 2JGZB 1PKDB 1UNLD 4OGRB 5HBHB 5IF1B 2PK9B 1H25B 4CXAB 2WHBB 1H1QB 4NSTB 4BCQD 3DDQB 3QHRB 4ROEA 1FINB 2C4GB 4TTHA 1H28B 1O9KB 1H26B 5EFQB 5HNBB 4CFUB 1VINA 3K7AM 4KRDB 4F7JB 3RGFB 4ROCA 3QHWB 2W2HA 4G6LB 3H4CA 3MI9B 5ICPB 2UUEB 3EOCB 2I53A 2C5VB 5ACBA 5IDPB 1JSTB 1BU2A 3EIDB 2UZLB 3MY1B 1GUXB 5CEIB 4RODA 1O9KA 1ZP2A 2C5XB 4EOSB 1KXUA 2WIPB 2PHGA 1C9BA 4EONB 4BCKB 4YOZA 4BCPB 2W99A 4F7SB 2W96A 1D3UB 3DOGB 2WXVB 2I40B 4EC9B 1OIUB 4BCMD 2WFYB 4YOOA
chains in the Genus database with same CATH superfamily
2B9RA 1H4LD 2WMAB 3BLRB 3EJ1B 2PMIB 1AHJB 4BY7X 4HNTA 2BKZB 4IMYB 4KRCB 1VYWB 4ELLA 2D0QB 1OIYB 1P5EB 4EOIB 1OKVB 3G33B 1FVVB 4EOQB 3X20B 1H1RB 3VKGA 3TNHB 2X1NB 3WVEB 1URCB 4I3ZB 3M03A 2R7GA 4EOPB 1VOLA 1JOWA 3DDPB 2UZBB 4EOMB 4CFUD 4EOOB 3DJBA 5HBEB 1OI9B 2ZPHB 2UZDB 2QDJA 2CJMB 3QZ9B 4EC8B 2BS3A 1QMZB 1F5QB 1E9HB 3A8MB 3X26B 4F6WB 4AKHA 4Y72B 1PKDB 5IF1B 3DTOA 2PK9B 4JX6A 3HBLA 2ZPGB 4TTHA 1H26B 4HLQA 5EFQB 1E7PA 4KRDB 4F7JB 3RGFB 4ROCA 4G6LB 3MI9B 4OB1B 3A8OB 3VKHA 5IDPB 3EIDB 4RODA 1ZP2A 1KXUA 1C9BA 4EONB 4BCKB 3DOGB 3HHTB 3KHIA 3QZ5B 4F7LB 3BG5A 3A8LB 5FGKB 2CCHB 2DXBB 4BCFB 2DMEA 1UGQB 1AISB 1AD6A 5LQFB 2IW9B 1OL1B 2CYZB 4LOCA 2W9FA 2V22B 5CYIB 4CFNB 4F6UB 4F6SB 4OR5B 4OB2B 3TW6A 4CRLB 4F7NB 1JKWA 2C5OB 2WEVB 3QYGB 2PJQA 3O0GD 4II5B 5IHYA 3TNWB 4BCJB 1H27B 5I5ZB 1OGUB 4AKIA 3BHTB 3QWLA 4BY1X 4FX3B 4Z6YA 2EUFA 2ZZDB 4AI6A 3LQ5B 1V29B 1H1SB 4FM4B 4CFXB 2CCIB 3TW7A 4EOLB 3X28B 4BBRM 3F5XB 4ZGDB 2KMGA 1GY3B 1H25B 3DDQB 4ROEA 3HO8A 2C4GB 1O9KB 3QHWB 4QSHA 5ACBA 2UZLB 2QFZA 4YOZA 2W99A 4ZGEB 2WFYB 5HBJB 4F70B 1GUXA 1N4MA 1FKMA 3PO3S 2IN3A 2IW8B 5EJCA 4BCGB 2KR6A 4YC3B 3TNIB 2DD4B 1GH6B 1OKWB 1UNGD 2QF7A 2ZPBB 1TFBA 1W98B 4BCIB 2W9ZA 3BLHB 3VYHB 5DQWA 3B57A 4MFEA 3QYHB 3TN8B 2DD5B 4EOKB 2BS4A 4CFMB 3HB9A 1QLBA 2G9XB 3NDQA 1H1PB 2C6TB 2ZPEB 2WIHB 2LW4A 3BHVB 2ZCFB 4CFWB 3BHUB 2WMBB 2BS2A 3HZJA 4BXXX 3QYEA 1G3NC 4HL4A 4YOSA 2UZEB 3POMA 3X24B 4BCNB 1OL2B 2IVXA 2JGZB 2WHBB 1H1QB 4JX4A 4NSTB 4BCQD 2CZ1B 5HNBB 3H4CA 2UUEB 4MFDA 2I53A 2ZPFB 2C5VB 1BU2A 3MY1B 2C5XB 4EOSB 2WIPB 4AKGA 2PHGA 4OB3B 4BCPB 4F7SB 2W96A 5DQVA 4BCMD 4YOOA 4MIMA 1H24B 2QDYB 2C5NB 2ZPIB 3MY5B 4JX5A 3QXEB 4BCOB 4CFVB 5LMKB 2CZ0B 4OB0B 3BLQB 3WVDB 3QYBA 4ELJA 2WPAB 5HQ0B 4NC6A 3MIAB 4BCND 1UNHD 4ZGJB 2F2CA 2DPPB 2BPMB 4BCQB 1TD6A 1UGPB 4UN0A 1IREB 3DL1A 5HVYB 3A8HB 1JSUB 1UGSB 2G77A 5IDNB 1XO2A 2PK2A 4BCHB 5BNJB 2DXCB 2IW6B 2QQ8A 1UGRB 2CZ6B 3BG3A 3GTMS 4EORB 3VYGB 4BBSM 4BCMB 5L2WB 4HNVA 4EOJB 1UNLD 4OGRB 5HBHB 4CXAB 3QHRB 1FINB 1H28B 2AHJB 4CFUB 1VINA 3K7AM 2QGSA 3A8GB 2W2HA 1ENWA 5ICPB 3X25B 3EOCB 2WJ9A 1JSTB 5CEIB 1GUXB 1O9KA 4HNUA 1D3UB 2WXVB 2I40B 3BG9A 4EC9B 1OIUB 4M6VA 2CZ7B
chains in the Genus database with same CATH topology
2B9RA 5HBJB 4F70B 1GUXA 1N4MA 1H24B 1H4LD 2C5NB 4F7LB 2WMAB 3MY5B 5FGKB 2CCHB 2IW8B 4BCOB 4BCFB 3BLRB 4CFVB 4BCGB 3EJ1B 4YC3B 5LMKB 2PMIB 1AISB 1AD6A 3TNIB 1GH6B 5LQFB 1OKWB 2IW9B 1OL1B 1UNGD 2BKZB 1TFBA 4IMYB 1W98B 2W9FA 4KRCB 1VYWB 2V22B 5CYIB 4ELLA 3BLQB 1OIYB 1P5EB 4BCIB 2W9ZA 4CFNB 2WPAB 4EOIB 1OKVB 5HQ0B 3BLHB 4ELJA 4F6UB 3MIAB 4F6SB 4OR5B 3G33B 1UNHD 4BCND 1FVVB 4EOQB 2F2CA 4CRLB 1H1RB 2BPMB 4F7NB 1JKWA 2C5OB 3TNHB 2X1NB 4BCQB 2WEVB 1URCB 3O0GD 4I3ZB 3M03A 4UN0A 2R7GA 4II5B 3TN8B 3TNWB 4BCJB 4EOPB 5HVYB 1VOLA 1H27B 5I5ZB 1JOWA 1JSUB 1OGUB 2UZBB 3DDPB 4EOKB 4CFMB 2G9XB 4EOMB 4CFUD 1H1PB 2C6TB 3BHTB 2WIHB 4EOOB 5IDNB 1XO2A 2PK2A 4FX3B 4BCHB 5HBEB 3BHVB 2EUFA 5BNJB 4CFWB 3BHUB 1OI9B 2WMBB 2IW6B 3LQ5B 1G3NC 1H1SB 4CFXB 2CCIB 4YOSA 2UZEB 4EOLB 2UZDB 2QDJA 3POMA 2CJMB 4EC8B 4EORB 1QMZB 4BCMB 4BCNB 5L2WB 1F5QB 1E9HB 1OL2B 3F5XB 4F6WB 4EOJB 2IVXA 4Y72B 1GY3B 2JGZB 1PKDB 1UNLD 4OGRB 5HBHB 5IF1B 2PK9B 1H25B 4CXAB 2WHBB 1H1QB 4NSTB 4BCQD 3DDQB 3QHRB 4ROEA 1FINB 2C4GB 4TTHA 1H28B 1O9KB 1H26B 5EFQB 5HNBB 4CFUB 1VINA 3K7AM 4KRDB 4F7JB 3RGFB 4ROCA 3QHWB 2W2HA 4G6LB 3H4CA 3MI9B 5ICPB 2UUEB 3EOCB 2I53A 2C5VB 5ACBA 5IDPB 1JSTB 1BU2A 3EIDB 2UZLB 3MY1B 1GUXB 5CEIB 4RODA 1O9KA 1ZP2A 2C5XB 4EOSB 1KXUA 2WIPB 2PHGA 1C9BA 4EONB 4BCKB 4YOZA 4BCPB 2W99A 4F7SB 2W96A 1D3UB 3DOGB 2WXVB 2I40B 4EC9B 1OIUB 4BCMD 2WFYB 4YOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B9R A;  5HBJ B;  4F70 B;  1GUX A;  1N4M A;  1H24 B;  1H4L D;  2C5N B;  4F7L B;  2WMA B;  3MY5 B;  5FGK B;  2CCH B;  2IW8 B;  4BCO B;  4BCF B;  3BLR B;  4CFV B;  4BCG B;  3EJ1 B;  4YC3 B;  5LMK B;  2PMI B;  1AIS B;  1AD6 A;  3TNI B;  1GH6 B;  5LQF B;  1OKW B;  2IW9 B;  1OL1 B;  1UNG D;  2BKZ B;  1TFB A;  4IMY B;  1W98 B;  2W9F A;  4KRC B;  1VYW B;  2V22 B;  5CYI B;  4ELL A;  3BLQ B;  1OIY B;  1P5E B;  4BCI B;  2W9Z A;  4CFN B;  2WPA B;  4EOI B;  1OKV B;  5HQ0 B;  3BLH B;  4ELJ A;  4F6U B;  3MIA B;  4F6S B;  4OR5 B;  3G33 B;  1UNH D;  4BCN D;  1FVV B;  4EOQ B;  2F2C A;  4CRL B;  1H1R B;  2BPM B;  4F7N B;  1JKW A;  2C5O B;  3TNH B;  2X1N B;  4BCQ B;  2WEV B;  1URC B;  3O0G D;  4I3Z B;  3M03 A;  4UN0 A;  2R7G A;  4II5 B;  3TN8 B;  3TNW B;  4BCJ B;  4EOP B;  5HVY B;  1VOL A;  1H27 B;  5I5Z B;  1JOW A;  1JSU B;  1OGU B;  2UZB B;  3DDP B;  4EOK B;  4CFM B;  2G9X B;  4EOM B;  4CFU D;  1H1P B;  2C6T B;  3BHT B;  2WIH B;  4EOO B;  5IDN B;  1XO2 A;  2PK2 A;  4FX3 B;  4BCH B;  5HBE B;  3BHV B;  2EUF A;  5BNJ B;  4CFW B;  3BHU B;  1OI9 B;  2WMB B;  2IW6 B;  3LQ5 B;  1G3N C;  1H1S B;  4CFX B;  2CCI B;  4YOS A;  2UZE B;  4EOL B;  2UZD B;  2QDJ A;  3POM A;  2CJM B;  4EC8 B;  4EOR B;  1QMZ B;  4BCM B;  4BCN B;  5L2W B;  1F5Q B;  1E9H B;  1OL2 B;  3F5X B;  4F6W B;  4EOJ B;  2IVX A;  4Y72 B;  1GY3 B;  2JGZ B;  1PKD B;  1UNL D;  4OGR B;  5HBH B;  5IF1 B;  2PK9 B;  1H25 B;  4CXA B;  2WHB B;  1H1Q B;  4NST B;  4BCQ D;  3DDQ B;  3QHR B;  4ROE A;  1FIN B;  2C4G B;  4TTH A;  1H28 B;  1O9K B;  1H26 B;  5EFQ B;  5HNB B;  4CFU B;  1VIN A;  3K7A M;  4KRD B;  4F7J B;  3RGF B;  4ROC A;  3QHW B;  2W2H A;  4G6L B;  3H4C A;  3MI9 B;  5ICP B;  2UUE B;  3EOC B;  2I53 A;  2C5V B;  5ACB A;  5IDP B;  1JST B;  1BU2 A;  3EID B;  2UZL B;  3MY1 B;  1GUX B;  5CEI B;  4ROD A;  1O9K A;  1ZP2 A;  2C5X B;  4EOS B;  1KXU A;  2WIP B;  2PHG A;  1C9B A;  4EON B;  4BCK B;  4YOZ A;  4BCP B;  2W99 A;  4F7S B;  2W96 A;  1D3U B;  3DOG B;  2WXV B;  2I40 B;  4EC9 B;  1OIU B;  4BCM D;  2WFY B;  4YOO A; 
#chains in the Genus database with same CATH topology
 2B9R A;  1H4L D;  2WMA B;  3BLR B;  3EJ1 B;  2PMI B;  1AHJ B;  4BY7 X;  4HNT A;  2BKZ B;  4IMY B;  4KRC B;  1VYW B;  4ELL A;  2D0Q B;  1OIY B;  1P5E B;  4EOI B;  1OKV B;  3G33 B;  1FVV B;  4EOQ B;  3X20 B;  1H1R B;  3VKG A;  3TNH B;  2X1N B;  3WVE B;  1URC B;  4I3Z B;  3M03 A;  2R7G A;  4EOP B;  1VOL A;  1JOW A;  3DDP B;  2UZB B;  4EOM B;  4CFU D;  4EOO B;  3DJB A;  5HBE B;  1OI9 B;  2ZPH B;  2UZD B;  2QDJ A;  2CJM B;  3QZ9 B;  4EC8 B;  2BS3 A;  1QMZ B;  1F5Q B;  1E9H B;  3A8M B;  3X26 B;  4F6W B;  4AKH A;  4Y72 B;  1PKD B;  5IF1 B;  3DTO A;  2PK9 B;  4JX6 A;  3HBL A;  2ZPG B;  4TTH A;  1H26 B;  4HLQ A;  5EFQ B;  1E7P A;  4KRD B;  4F7J B;  3RGF B;  4ROC A;  4G6L B;  3MI9 B;  4OB1 B;  3A8O B;  3VKH A;  5IDP B;  3EID B;  4ROD A;  1ZP2 A;  1KXU A;  1C9B A;  4EON B;  4BCK B;  3DOG B;  3HHT B;  3KHI A;  3QZ5 B;  4F7L B;  3BG5 A;  3A8L B;  5FGK B;  2CCH B;  2DXB B;  4BCF B;  2DME A;  1UGQ B;  1AIS B;  1AD6 A;  5LQF B;  2IW9 B;  1OL1 B;  2CYZ B;  4LOC A;  2W9F A;  2V22 B;  5CYI B;  4CFN B;  4F6U B;  4F6S B;  4OR5 B;  4OB2 B;  3TW6 A;  4CRL B;  4F7N B;  1JKW A;  2C5O B;  2WEV B;  3QYG B;  2PJQ A;  3O0G D;  4II5 B;  5IHY A;  3TNW B;  4BCJ B;  1H27 B;  5I5Z B;  1OGU B;  4AKI A;  3BHT B;  3QWL A;  4BY1 X;  4FX3 B;  4Z6Y A;  2EUF A;  2ZZD B;  4AI6 A;  3LQ5 B;  1V29 B;  1H1S B;  4FM4 B;  4CFX B;  2CCI B;  3TW7 A;  4EOL B;  3X28 B;  4BBR M;  3F5X B;  4ZGD B;  2KMG A;  1GY3 B;  1H25 B;  3DDQ B;  4ROE A;  3HO8 A;  2C4G B;  1O9K B;  3QHW B;  4QSH A;  5ACB A;  2UZL B;  2QFZ A;  4YOZ A;  2W99 A;  4ZGE B;  2WFY B;  5HBJ B;  4F70 B;  1GUX A;  1N4M A;  1FKM A;  3PO3 S;  2IN3 A;  2IW8 B;  5EJC A;  4BCG B;  2KR6 A;  4YC3 B;  3TNI B;  2DD4 B;  1GH6 B;  1OKW B;  1UNG D;  2QF7 A;  2ZPB B;  1TFB A;  1W98 B;  4BCI B;  2W9Z A;  3BLH B;  3VYH B;  5DQW A;  3B57 A;  4MFE A;  3QYH B;  3TN8 B;  2DD5 B;  4EOK B;  2BS4 A;  4CFM B;  3HB9 A;  1QLB A;  2G9X B;  3NDQ A;  1H1P B;  2C6T B;  2ZPE B;  2WIH B;  2LW4 A;  3BHV B;  2ZCF B;  4CFW B;  3BHU B;  2WMB B;  2BS2 A;  3HZJ A;  4BXX X;  3QYE A;  1G3N C;  4HL4 A;  4YOS A;  2UZE B;  3POM A;  3X24 B;  4BCN B;  1OL2 B;  2IVX A;  2JGZ B;  2WHB B;  1H1Q B;  4JX4 A;  4NST B;  4BCQ D;  2CZ1 B;  5HNB B;  3H4C A;  2UUE B;  4MFD A;  2I53 A;  2ZPF B;  2C5V B;  1BU2 A;  3MY1 B;  2C5X B;  4EOS B;  2WIP B;  4AKG A;  2PHG A;  4OB3 B;  4BCP B;  4F7S B;  2W96 A;  5DQV A;  4BCM D;  4YOO A;  4MIM A;  1H24 B;  2QDY B;  2C5N B;  2ZPI B;  3MY5 B;  4JX5 A;  3QXE B;  4BCO B;  4CFV B;  5LMK B;  2CZ0 B;  4OB0 B;  3BLQ B;  3WVD B;  3QYB A;  4ELJ A;  2WPA B;  5HQ0 B;  4NC6 A;  3MIA B;  4BCN D;  1UNH D;  4ZGJ B;  2F2C A;  2DPP B;  2BPM B;  4BCQ B;  1TD6 A;  1UGP B;  4UN0 A;  1IRE B;  3DL1 A;  5HVY B;  3A8H B;  1JSU B;  1UGS B;  2G77 A;  5IDN B;  1XO2 A;  2PK2 A;  4BCH B;  5BNJ B;  2DXC B;  2IW6 B;  2QQ8 A;  1UGR B;  2CZ6 B;  3BG3 A;  3GTM S;  4EOR B;  3VYG B;  4BBS M;  4BCM B;  5L2W B;  4HNV A;  4EOJ B;  1UNL D;  4OGR B;  5HBH B;  4CXA B;  3QHR B;  1FIN B;  1H28 B;  2AHJ B;  4CFU B;  1VIN A;  3K7A M;  2QGS A;  3A8G B;  2W2H A;  1ENW A;  5ICP B;  3X25 B;  3EOC B;  2WJ9 A;  1JST B;  5CEI B;  1GUX B;  1O9K A;  4HNU A;  1D3U B;  2WXV B;  2I40 B;  3BG9 A;  4EC9 B;  1OIU B;  4M6V A;  2CZ7 B; 
#chains in the Genus database with same CATH homology
 2B9R A;  5HBJ B;  4F70 B;  1GUX A;  1N4M A;  1H24 B;  1H4L D;  2C5N B;  4F7L B;  2WMA B;  3MY5 B;  5FGK B;  2CCH B;  2IW8 B;  4BCO B;  4BCF B;  3BLR B;  4CFV B;  4BCG B;  3EJ1 B;  4YC3 B;  5LMK B;  2PMI B;  1AIS B;  1AD6 A;  3TNI B;  1GH6 B;  5LQF B;  1OKW B;  2IW9 B;  1OL1 B;  1UNG D;  2BKZ B;  1TFB A;  4IMY B;  1W98 B;  2W9F A;  4KRC B;  1VYW B;  2V22 B;  5CYI B;  4ELL A;  3BLQ B;  1OIY B;  1P5E B;  4BCI B;  2W9Z A;  4CFN B;  2WPA B;  4EOI B;  1OKV B;  5HQ0 B;  3BLH B;  4ELJ A;  4F6U B;  3MIA B;  4F6S B;  4OR5 B;  3G33 B;  1UNH D;  4BCN D;  1FVV B;  4EOQ B;  2F2C A;  4CRL B;  1H1R B;  2BPM B;  4F7N B;  1JKW A;  2C5O B;  3TNH B;  2X1N B;  4BCQ B;  2WEV B;  1URC B;  3O0G D;  4I3Z B;  3M03 A;  4UN0 A;  2R7G A;  4II5 B;  3TN8 B;  3TNW B;  4BCJ B;  4EOP B;  5HVY B;  1VOL A;  1H27 B;  5I5Z B;  1JOW A;  1JSU B;  1OGU B;  2UZB B;  3DDP B;  4EOK B;  4CFM B;  2G9X B;  4EOM B;  4CFU D;  1H1P B;  2C6T B;  3BHT B;  2WIH B;  4EOO B;  5IDN B;  1XO2 A;  2PK2 A;  4FX3 B;  4BCH B;  5HBE B;  3BHV B;  2EUF A;  5BNJ B;  4CFW B;  3BHU B;  1OI9 B;  2WMB B;  2IW6 B;  3LQ5 B;  1G3N C;  1H1S B;  4CFX B;  2CCI B;  4YOS A;  2UZE B;  4EOL B;  2UZD B;  2QDJ A;  3POM A;  2CJM B;  4EC8 B;  4EOR B;  1QMZ B;  4BCM B;  4BCN B;  5L2W B;  1F5Q B;  1E9H B;  1OL2 B;  3F5X B;  4F6W B;  4EOJ B;  2IVX A;  4Y72 B;  1GY3 B;  2JGZ B;  1PKD B;  1UNL D;  4OGR B;  5HBH B;  5IF1 B;  2PK9 B;  1H25 B;  4CXA B;  2WHB B;  1H1Q B;  4NST B;  4BCQ D;  3DDQ B;  3QHR B;  4ROE A;  1FIN B;  2C4G B;  4TTH A;  1H28 B;  1O9K B;  1H26 B;  5EFQ B;  5HNB B;  4CFU B;  1VIN A;  3K7A M;  4KRD B;  4F7J B;  3RGF B;  4ROC A;  3QHW B;  2W2H A;  4G6L B;  3H4C A;  3MI9 B;  5ICP B;  2UUE B;  3EOC B;  2I53 A;  2C5V B;  5ACB A;  5IDP B;  1JST B;  1BU2 A;  3EID B;  2UZL B;  3MY1 B;  1GUX B;  5CEI B;  4ROD A;  1O9K A;  1ZP2 A;  2C5X B;  4EOS B;  1KXU A;  2WIP B;  2PHG A;  1C9B A;  4EON B;  4BCK B;  4YOZ A;  4BCP B;  2W99 A;  4F7S B;  2W96 A;  1D3U B;  3DOG B;  2WXV B;  2I40 B;  4EC9 B;  1OIU B;  4BCM D;  2WFY B;  4YOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...