4HL4A

Crystal structure of the human tbc1d20 rabgap domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase activator
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hl4A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hl4A02
2QFZA 2G77A 3QYBA 2QQ8A 3HZJA 1FKMA 4HLQA 4Z6YA 4NC6A 4HL4A 3QYEA 5EJCA 3QWLA
chains in the Genus database with same CATH superfamily
2DAEA 3AJIB 3JR4A 4IJFA 3SHFA 4LGYA 3RGFB 3LVWA 2C5OB 5KPZA 4L8RC 3NDQA 1TF0B 1NNUC 2DZNB 4BCPB 7CATA 2JNHA 5FSWA 3FRHA 2LVAA 1K82A 1E94E 1L1TA 1UNLD 2J7OA 1T43A 5ITXE 2DMEA 4M9ZA 1KXUA 3VK8A 4BCQD 1QZEA 1Y8GA 3HX3A 2YFQA 2F5QA 5IT9S 1QANA 1MX0A 2KR6A 2MH8A 3L27A 4REZA 3TNWB 2ERCA 2KNVA 2V1CA 2YR0A 2FS1A 4UN2B 4UN0A 1V92A 5EXXA 4ELJA 2N35A 4AKGA 1WHCA 3LCUA 5ITXA 4B3SM 4CFXB 4D80A 4IBEA 2Y0QA 3A8OB 5IDNB 3EIDB 4OW0A 4DR7M 1IM2A 4X66M 3QAUA 1Z5BA 4QNMA 1PJJA 4R7GA 1D2NA 2F4VM 1VDLA 2RGHA 1VYWB 2FOIC 4ZGDB 4M0WA 2DNAA 2DKLA 4FWGA 5KPRA 5EP2A 1XC8A 1BU2A 3CF0A 3SMPA 2K0BX 3W67A 2DWLA 2BWEA 3FUWA 1QZMA 2NQ8C 1MN3A 4MGKE 4DV1M 2WIPB 4LZZA 4PCZA 4CISA 2FH0A 3X28B 3HBLA 1NJFA 5GKNA 2LWXA 1H4LD 4LF6M 1JOWA 2BS4A 3B57A 3ZQJA 3SAVA 2UZLB 3D8LA 3KOXE 1R5LA 3E46A 1N34M 1G8PA 3SARA 4CGYB 2UXBM 2XF3A 4ROEA 3HGIA 2R65A 4DV3M 3GRUA 3L2AA 2W9FA 1JR3E 3SAUA 4AG6A 5ITRA 3FRIA 2ZPEB 4HNUA 4X64M 3A42A 1OL1B 3MJ5A 2QCUA 2QDJA 2Y20A 4FCWA 3V76A 4BLCA 2DD5B 1FNNA 2C99A 4QSHA 5FLXS 2G77A 1ENWA 3R9XB 4LJ8A 1NJGA 4BCMB 4M9SA 5EP1A 2JXNA 3DFZA 3JAMS 1JR3A 1PRBA 2DAMA 3CF6E 1HJPA 2M60A 1WIVA 1R6BX 4IIWA 2YQZA 3AOEA 4XBOA 3SYKA 3SBJA 4JI7M 5FTJA 2D0QB 1J5EM 3HZJA 4BCNB 4IJEA 2CE7A 4NRWA 1QUSA 3DZDA 3MY5B 5HVYB 2L7IA 2B9RA 1N36M 3FKEA 1IN8A 1WGNA 5FTKA 3WHKA 4LZJA 1JR3D 4B08A 2BPMB 1GJTA 2WMAB 3A8HB 3IHPA 4MGYE 3ZCBB 3J81S 5IZ7D 1GH6B 4OVZB 2CZ0B 2EA0A 2BS2A 3U6CA 5C1BA 3C3EA 3QYBA 4NSRA 1IY1A 1KYIA 3G33B 5DYGA 1YLAA 3IG8A 1S3SA 4HEOA 1BVSA 4NXNM 4M6VA 4YOOA 4JV5M 4JX5A 1XO2A 1CUKA 5HBHB 2DXIA 2D7EA 3TW6A 1FVVB 3B7NA 1VEGA 2XZFA 1TD6A 2CV0A 1QYRA 2LVPC 2CEAA 2L2DA 1IN5A 2JUJA 4G4QA 2CUZA 4OB1B 5ITYA 2VQFM 4EOIB 1WR1B 2CZ1B 4ITQA 3H4CA 4LJAA 4G4OA 2EUFA 4JI5M 1TR8A 3DJBA 3KXEC 4QNRA 3BOSA 4S12A 2QQ8A 1W5TA 4LRSA 2WIHB 1AIPC 1R4GA 1NHWC 4LF9M 5EXTA 3HHZA 1VDDA 3RGPA 4OVZA 4XGIA 3TNHB 2QFZA 3UGJA 4BCND 4MGHA 2XGNA 3GPPA 3SASA 1GLNA 3HHXA 5LQFB 4BCFB 1GKIA 4OB0B 2C5VB 5EFQB 3U60A 1OKSA 3GQ5A 2JWSA 3TNIB 3MY1B 4GEWA 1PJQA 1TGUA 3I01M 1V33A 1HNXM 4DUYM 1OAOC 2QNJA 4I3ZB 2WSCF 2VDBB 4RNAA 3U61B 4GHLA 2HCBA 2GNOA 4JYAM 4CFUB 1UNGD 4MH0E 4F7NB 3TN8B 1D0LA 3K1JA 1XNQM 3J27B 4OB2B 3RE8A 1HR0M 1N33M 5HQ0B 3FTFA 3HJ8A 4I81A 4WURA 4OGRB 3BG3A 4FW9A 3F92A 1XB2B 1XXHB 1SG9A 3C9PA 5I5ZB 5ITTA 1OJLA 4YOSA 4JN6A 4JI3M 3TWLA 4BB9A 4MGIE 4LJ7A 1C7YA 3HHYA 5DQVA 4QOSA 1ORYB 1Q02A 3BHUB 3SAWA 2FFJA 1DGGA 4P16A 3DDQB 4IMYB 5FTNA 5L8RF 2DVWB 5E6JA 3A45A 1H28B 1Q3BA 3B74A 1QDTA 1URCB 1XXHE 4HNTA 5JI2E 3W68A 3FTCA 3KS8A 1UFZA 5KQ8A 3U61A 1IFYA 4WP2A 2JY7A 1IN4A 1KSFX 3BXWA 1SXJC 3IG5A 3M0EA 3T15A 1UGRB 3HU2A 3QYGB 2D7GA 4DV0M 1TDZA 3QHWB 3HWSA 1XXHA 3ZH9B 4YC3B 4IBGA 4KLNA 3HHWA 4D82A 5KQDA 3NBXX 3KSXA 1N78A 1V34A 2LHCA 3EIHA 2QBYB 2G9XB 2JGZB 2X49A 3Q8GA 2ZAOA 3JR5A 4DBGB 1Q3CA 4EOPB 1OFIA 2DWMA 3DA1A 2ZM6M 1YSYA 2FE8A 5IF1B 5BR8M 1XWIA 1VEJA 3D8BA 3QZ9B 4JI1M 2HAKA 2EUCA 3LCVB 4YY3M 3CTWB 3X24B 3W0FA 3K9OA 1NHGC 3GLHB 2WZJA 2LVQD 2XLJA 2X4AA 3H4MA 4DUZM 1GO5A 4F1IA 2Z4RA 3FUTA 1R7RA 1IBLM 1GVNA 4CFMB 4M9XA 3KFUG 1GABA 1Q39A 2O25A 4LF5M 2DZOB 1G3IA 1DGBA 5EQTA 4BXXX 1F4IA 3VFDA 1OKVB 3FUXA 1G41A 3U6QA 3GPUA 4EOKB 5IDPB 1E7PA 2I53A 1G59A 1PJIA 1N77A 4BCJB 4MFEA 2QBYA 4CIZA 2EKFA 2R0IA 3GLHE 1HNZM 3C58A 2UZEB 3HY5A 4BCIB 2OPFA 2DAKA 3GRRA 4M0DA 2C5XB 1WGLA 4CHTB 1ZAEA 1IBMM 1GJSA 4EOSB 2BS3A 4GHAA 3SYLA 4F6UB 3X26B 3HU1A 4DR4M 1H6UA 2KDLA 3GLHA 3NBIA 4LFAM 2KMGA 4JI8M 3LMMA 3QYEA 3HHTB 2F2CA 2RGOA 1H1PB 2I7NA 4JI4M 3M6AA 3GLGE 2CCHB 2ZTDA 1PKDB 2L09A 1J09A 1GL6A 3AV0A 4G3OA 1QQWA 4GKKM 1E9HB 4GIPA 2UXCM 1D0KA 2CV1A 5HBJB 4JX4A 5IWAM 1PJTA 2XSZA 2LXEA 1OIYB 1IY2A 1O9KB 3GLGA 4A3VB 1G3NC 4DV6M 1HT1E 3VKGA 1SXJE 4IBIA 2W2HA 2VF7A 2C5RA 1IN6A 3ZC7B 2KW0A 3GLFA 3VDPA 1AISB 4LF4M 4FM4B 1ZMUA 3NWLA 5IHYA 2ZZDB 1IBKM 4X65M 2K47A 2Q2EB 4EC9B 4FWHA 4AZFA 4HLQA 2QGSA 3U6EA 4F2LA 1UM8A 1SXJA 1P3QQ 3E21A 4HL4A 4PT5A 4LJ4A 2DD4B 1YE9A 2JY5A 2LHGA 1OFHA 3GP1A 3O0GD 4Q7JA 4CXAB 4DV2M 3QXEB 4RF0A 3PNVA 2L6OA 4L16A 4TUWA 3TQSA 1UGPB 4QOZC 2RRUA 2G5GX 1I4WA 4DR3M 1GL7A 2CV2A 4EOQB 2ZPFB 3MHVC 4PDIA 1O9KA 1JSUB 2C9CA 2R6FA 1V29B 4LG2A 4AQYM 3U60B 3B89A 1F5QB 3TW7A 2VIIA 1ZV1A 4DR2M 4EOOB 1T3TA 1IXSB 1XMQM 2MROB 2B3TA 2XFTA 1QAMA 2CWBA 5H37D 3T1YM 2G3QA 4AW4A 1T6OA 3FD9A 4Y28F 4ANRA 2OQ4A 1K3WA 1E9RA 4ROCA 1D3UB 4YHHM 3F5XB 4LJ9A 4F7LB 5ACBA 1EE8A 3A8MB 1OKWB 3A8GB 3SC3A 4XK8F 1OAIA 4ZGJB 1L8QA 3T1HM 1K3XA 2PJQA 1H1SB 3DTOA 3QYHB 4BCMD 4NXMM 3MI9B 1R2ZA 2LH0A 3AFHA 4EORB 1QLBA 3VLFB 3LQ5B 4L4UA 2L7HA 2X8AA 5EP4A 1IXRC 4FD2A 2K9DA 4GC5A 3GO8A 3KP0E 4JI0M 1HT2E 2R18A 1WXQA 2Z3XA 1H27B 1W5SA 3PFIA 2Y0TA 3HJSA 2UUEB 3K7AM 2K6BA 1DO2A 2DHYA 1NO1A 1E32A 3U5ZA 2APLA 1Z5AA 3GRVA 1WJ7A 4AG5A 5HBEB 4F70B 1IXSA 2XFSA 1DGHB 4F6WB 3H4JA 2BJVA 5F3WA 3HJQA 1OL2B 5EXPA 2QPAA 4IBCA 4II5B 3GLIB 4MIMA 4GITA 2C98A 5EXSA 1N4MA 4GMQA 3RFWA 1Z5CA 4BCOB 4CFNB 1XNRM 1N32M 2W82A 4Y72B 2HKJA 4G4NA 1VQ1A 3BLHB 4EC8B 2ZBKB 3L25A 5ITQA 2WSFF 5HNBB 4PD2A 3CGWA 2QP9X 3FTEA 3EJ1B 3PXGA 4FVMA 2WHBB 4BCHB 1X37A 3KOWE 1L1ZA 3QWLA 4B3MM 4I5SA 1MJGM 2EJSA 4L78A 3GLIE 3RGSA 3A46A 2A5YB 2V1UA 2PMIB 2KRUA 1C9BA 2F5PA 4IBKA 1PM5A 1NV8A 4MGZE 1TFBA 2KRKA 3B7QA 3T38A 4LFCM 2C96A 3EOCB 4X62M 1G71A 2UUCM 1DGHA 3U6OA 3DDPB 3FUVA 3MIAB 3ILKA 2JY8A 2JZ1A 2V22B 2UXDM 2UZBB 1A5TA 3GLIA 1L2CA 2R4JA 4ELLA 1YUBA 4JX6A 2UZDB 3KW6A 2Z4SA 3BBZA 2DZLA 1H26B 3A8LB 3I4YA 2I7PA 2W9ZA 4TTHA 4JI2M 2KNZA 4KRCB 3MK6A 3UJNA 2LNHC 2P5TA 2C6TB 4MM3B 2AHJB 2CJMB 4CJ6A 1PJSA 1VG5A 4CFUD 3DOGB 1OIPA 4FCVA 2CP8A 2VQEM 2PK9B 4BCKB 2IW9B 2CHGA 4IBFA 1LTMA 2QENA 3X25B 2KNAA 1NV9A 3TE6A 2XZUA 5LMNM 3GQ4A 2ZPGB 3FUUA 5EJCA 3AL0C 2DPPB 1QUTA 5FTLA 1AD6A 1XMOM 1JKWA 2RKOA 4HNVA 4KHPM 4I4LA 4AI6A 2IN3A 2H1RA 4BBAA 2ZPBB 2EO2A 4IBBA 4Z8XA 2WEVB 2F5NA 1MU5A 1D0MA 2QDYB 4DR1M 1XHBA 3EIEA 3DL1A 2CFOA 1J7KA 4AKHA 1Z59A 2LVOC 2E5LM 3A98B 2LTUA 4KO8A 4OB3B 2Z8YM 3LW5F 4B7HA 2WFYB 3U6LA 1AHJB 4G4RA 2KA6B 2WPAB 1ZMWA 4LJ5A 3GLGB 4QHTA 2R45A 2AHMA 3KOZE 3FYDA 4LOCA 3W0LB 3J7BA 4WW0A 2LW4A 5CEIB 3GLFB 1ZQ9A 4BBRM 4GC9A 4Z6YA 1NNJA 2CCIB 3KP1E 4EIWA 2C9OA 3GPYA 1TTEA 3OTOM 3KS4A 1FINB 4GKJM 4CRLB 1QAQA 2M5ZA 3HO8A 4W5WA 2HHHM 4L15A 1DO0A 1SXJB 5LMUM 3BHVB 1Z6TA 3WVDB 5LMKB 1OIUB 2MJ5B 1NVMA 3FTDA 3SATA 2CHQA 2UU9M 1RU3A 1OGUB 2DXBB 2JZ0A 3L29A 2BNKA 1QDRA 2BWBA 1UGSB 3GLFE 1E9SA 1JQJC 1VEKA 5BPVA 4NSTB 3FE3A 4MFDA 3GQ3A 5BNJB 2DAIA 2HL7A 3BG5A 1I94M 2MR9A 3C3DA 3Q8XA 4DV4M 4KT0F 4II7A 1DV0A 5C18A 2QHOB 3HB9A 2DXCB 2JP7A 2IW8B 2WMBB 3R8FA 4OX9M 1JSTB 3AKZA 2OOBA 2KZSA 2ZAMA 3U6MA 2DWNA 5FGKB 4K0KM 4OU7A 3K92A 2KHHA 3K9PA 1TH3A 1IXZA 2O5RA 3BG9A 1TH2A 2R4EA 4B7GA 1W98B 3THGA 3TPZA 2XSZD 4PDGA 5KO3A 4R71A 5DYIA 3BLRB 3E4RA 3WVEB 4G6LB 5FTMA 3TL4X 1VOLA 5A2QS 4D81A 2D7HA 2MGWA 2J5YA 1UGQB 1QMZB 1QVRA 3BHTB 3U6DA 2OOAA 3PO3S 2YNMD 3AOGA 4LF7M 3B9PA 4LCBA 1NSFA 3VK7A 4KRDB 3UK6A 2UUAM 3QHRB 1AUAA 2Z7JA 4AKIA 4R3DA 1EIJA 1SXJD 4FWDA 4F7SB 4B7FA 2O01F 2OO9A 3TWMA 3U5ZB 3QZ5B 3I04M 2IVXA 2G8LA 4NL4H 5KPTA 4NSOB 5L2WB 2IW6B 1HQYE 1IREB 1HQCA 1ZMVA 2BJWA 4F7JB 3MMPA 3M7GA 4F6SB 2R46A 2ZANA 5JI3E 3J80S 4ZGEB 2LVNC 1P5EB 2L4EA 4JXJA 5IREB 3IECA 3KSJA 1DGFA 1HNWM 3BLQB 4BY1X 3E9SA 2BKZB 3LVVA 1OTRA 2QF7A 3DOAA 2ZPIB 1VINA 2R7GA 1JB0F 1PGYA 4LF8M 4LFBM 5DNYA 2CZ7B 2I40B 4EONB 3K2LA 1N75A 4LY6A 2X1NB 3VDUA 4NC6A 3U6PA 2CYZB 2FNAA 3VKHA 1R2YA 2WJ9A 3WHLA 4DR5M 2W99A 1FJGM 4IBDA 5ITUA 3TWKA 1LV7A 3FYCA 4CFWB 4L6V6 2KZUA 2VF8A 1GUXB 4LJ6A 3KVWA 3SMSA 5E26A 4EOJB 1NY5A 2CZ6B 4BY7X 2CRUA 3GRYA 2DAGA 2DI0A 3HU3A 1H1RB 2GQFA 2XEPA 2C5NB 2F5OA 2EKKA 4FCTA 1H24B 1UNHD 3M03A 1L2BA 2C4GB 2CHVA 3PVSA 4LGMA 1H1QB 1TDHA 4MB7A 2QSFX 3CF2A 1KFVA 2F5SA 4DR6M 4P17A 4RF1A 2XH9A 4NRVA 2QZ4A 4G6ZA 3SFZA 2H5XA 3LQQA 3T6PA 1H25B 2ZTCA 4B3RM 2KXEA 4IBJA 4OR5B 2WSEF 1L2DA 1G4AE 4BCQB 4KODA 2DENA 3GTMS 1IN7A 4LRTA 1GY3B 1OQYA 4YOZA 3VYGB 4BCGB 4GH9A 2R62A 4B3TM 4GRIA 2ZCFB 3J7AS 1IY0A 3HKPA 3I51A 3POMA 2JA2A 4DV7M 1GUXA 3GPXA 4EOLB 2J7NA 3K8ZA 2UUBM 3U6SA 5EP3A 3AOEC 1FKMA 3B7ZA 3UMMA 4DV5M 3KHIA 5CYIB 3KOYE 8CATA 1OI9B 3X20B 4RODA 3UZUA 3VYHB 1ZP2A 2PK2A 1IQPA 1NY6A 1OIZA 2R44A 4RKUF 1C1KA 3PNYA 2HWJA 3J2PB 4NOOB 2DHRA 1QAOA 4EOMB 3L26A 3L28A 2KEBA 2ZPHB 2WXVB 2V6ZM 2JY6B 2L4FA 2Y21A 2W96A 4JI6M 3LQRA 3SHGB 4FX3B 5ICPB 4BBSM 2LBCA 1EFUB 5DFLA 4ZPXA 3I4VA 2DWZB 2PHGA 5DQWA 4CFVB 4QHSA 4I8OA 3KDSE 1TH4A
chains in the Genus database with same CATH topology
3L29A 2BNKA 4DR2M 3AJIB 1XXHB 1T3TA 3JR4A 4IJFA 3SHFA 1UGSB 4LGYA 1E9SA 5ITTA 1JQJC 1IXSB 3LVWA 1OJLA 5BPVA 1XMQM 4MFDA 5KPZA 4L8RC 2XFTA 3GQ3A 4JN6A 1QAMA 4JI3M 3TWLA 1NNUC 2DZNB 5H37D 3T1YM 7CATA 4AW4A 5FSWA 2HL7A 4BB9A 3BG5A 3FD9A 1I94M 4MGIE 2OQ4A 1K3WA 1K82A 1E94E 1E9RA 1L1TA 4YHHM 4LJ9A 4LJ7A 2J7OA 3Q8XA 3HHYA 4DV4M 4II7A 4QOSA 1ORYB 1EE8A 5ITXE 3A8MB 4M9ZA 3VK8A 5C18A 3HB9A 3A8GB 3SAWA 3SC3A 2DXCB 4ZGJB 2FFJA 2YFQA 1DGGA 4P16A 3R8FA 2F5QA 5IT9S 1QANA 4OX9M 1L8QA 3AKZA 5FTNA 3T1HM 2KZSA 1MX0A 2KR6A 2ZAMA 2DVWB 5E6JA 3U6MA 1K3XA 3A45A 2DWNA 3L27A 1Q3BA 4REZA 4K0KM 3QYHB 4OU7A 3K92A 2ERCA 2V1CA 4NXMM 1TH3A 1IXZA 2O5RA 2YR0A 3BG9A 1TH2A 2R4EA 4B7GA 5EXXA 3THGA 3TPZA 4ELJA 1R2ZA 2LH0A 3AFHA 1QLBA 2XSZD 4HNTA 5JI2E 4PDGA 4AKGA 3VLFB 5ITXA 5KO3A 4B3SM 3FTCA 4D80A 4IBEA 2L7HA 2X8AA 4L4UA 3KS8A 5DYIA 2Y0QA 5EP4A 3A8OB 1IXRC 4FD2A 5KQ8A 4OW0A 3U61A 1IM2A 4GC5A 3GO8A 3E4RA 4DR7M 3WVEB 3KP0E 4X66M 4JI0M 1HT2E 5FTMA 3QAUA 3TL4X 5A2QS 2R18A 1WXQA 1Z5BA 4QNMA 1PJJA 4R7GA 2Z3XA 1IN4A 1KSFX 4D81A 1D2NA 2F4VM 1SXJC 1W5SA 2D7HA 3PFIA 1UGQB 2Y0TA 3HJSA 3IG5A 1QVRA 2RGHA 3M0EA 3T15A 2FOIC 1UGRB 4ZGDB 3HU2A 3QYGB 3U6DA 1DO2A 4M0WA 5KPRA 4FWGA 5EP2A 1XC8A 2D7GA 2YNMD 4DV0M 1TDZA 3CF0A 3HWSA 3SMPA 1XXHA 1E32A 3ZH9B 3U5ZA 4IBGA 3AOGA 4KLNA 4LF7M 1Z5AA 3B9PA 3GRVA 4AG5A 2DWLA 3HHWA 4LCBA 1NSFA 2XFSA 4D82A 5KQDA 3FUWA 1QZMA 1DGHB 3VK7A 2NQ8C 4MGKE 2BJVA 3UK6A 4DV1M 5F3WA 3HJQA 4LZZA 2UUAM 4PCZA 5EXPA 4CISA 3KSXA 1N78A 3EIHA 3X28B 3HBLA 2Z7JA 1NJFA 2QPAA 4AKIA 4IBCA 5GKNA 2QBYB 4R3DA 3GLIB 2LWXA 1SXJD 2X49A 4MIMA 2ZAOA 4FWDA 4GITA 4LF6M 2C98A 5EXSA 4B7FA 2BS4A 4GMQA 3RFWA 1Z5CA 3JR5A 3SAVA 1Q3CA 3D8LA 1XNRM 1OFIA 3KOXE 2W82A 3TWMA 1N32M 3U5ZB 3QZ5B 2HKJA 2DWMA 3DA1A 4G4NA 1N34M 2ZM6M 1YSYA 2G8LA 4NL4H 1G8PA 5KPTA 2FE8A 4NSOB 3SARA 5BR8M 4CGYB 1XWIA 1HQYE 2ZBKB 3D8BA 2XF3A 2UXBM 3QZ9B 3L25A 5ITQA 4JI1M 2EUCA 3HGIA 4YY3M 1IREB 2R65A 4DV3M 3GRUA 3L2AA 1HQCA 4PD2A 3SAUA 3CTWB 2BJWA 4AG6A 2QP9X 3X24B 3W0FA 5ITRA 3FTEA 1NHGC 3PXGA 3GLHB 3M7GA 2ZPEB 2XLJA 4HNUA 2X4AA 4FVMA 3H4MA 4DUZM 4X64M 2R46A 2ZANA 1X37A 3A42A 2Z4RA 5JI3E 3KOWE 3J80S 4ZGEB 3MJ5A 3FUTA 1L1ZA 2QCUA 2QDJA 1R7RA 1IBLM 3QWLA 4B3MM 2Y20A 4FCWA 4I5SA 4JXJA 5IREB 3KSJA 1DGFA 4BLCA 1HNWM 1FNNA 2C99A 3E9SA 2DD5B 4QSHA 1GVNA 4L78A 5FLXS 3RGSA 3LVVA 4M9XA 3A46A 2G77A 2A5YB 3KFUG 3R9XB 2V1UA 4LJ8A 2KRUA 1NJGA 1Q39A 4M9SA 5EP1A 2F5PA 3DFZA 4IBKA 2DZOB 1PM5A 3JAMS 4LF5M 2QF7A 1JR3A 1G3IA 3DOAA 4MGZE 3CF6E 1DGBA 2ZPIB 5EQTA 2KRKA 2M60A 3T38A 3VFDA 4LFCM 2C96A 4X62M 1R6BX 4LF8M 3FUXA 4LFBM 4IIWA 1G41A 2YQZA 5DNYA 3AOEA 3U6QA 4XBOA 2CZ7B 2UUCM 1DGHA 3U6OA 3K2LA 1N75A 3GPUA 4LY6A 3FUVA 3SYKA 3ILKA 3SBJA 1E7PA 3VDUA 4JI7M 4NC6A 5FTJA 3U6PA 1G59A 2CYZB 2FNAA 1PJIA 1N77A 2D0QB 1J5EM 4MFEA 3VKHA 3HZJA 4IJEA 1R2YA 2CE7A 2QBYA 4NRWA 2UXDM 2WJ9A 3GLIA 1L2CA 3DZDA 3WHLA 4DR5M 2R4JA 1HNZM 3C58A 1YUBA 4JX6A 2L7IA 1FJGM 4IBDA 5ITUA 3TWKA 2OPFA 1LV7A 1N36M 3FYCA 3KW6A 2Z4SA 3GRRA 4M0DA 3FKEA 1IN8A 3WHKA 1ZAEA 5FTKA 4LZJA 4CHTB 2KZUA 1IBMM 2BS3A 1JR3D 3A8LB 3I4YA 2I7PA 4LJ6A 3KVWA 4JI2M 4GHAA 4B08A 3SMSA 5E26A 3SYLA 3MK6A 3UJNA 3A8HB 1NY5A 4MGYE 2LNHC 2P5TA 2CZ6B 3ZCBB 3J81S 4MM3B 5IZ7D 2AHJB 3X26B 3HU1A 4DR4M 3GRYA 1H6UA 3GLHA 4OVZB 3HU3A 3NBIA 2XEPA 4LFAM 2KMGA 4FCVA 2VQEM 2F5OA 2CZ0B 4JI8M 2EA0A 3LMMA 4FCTA 2BS2A 3U6CA 3QYEA 2CHGA 5C1BA 4IBFA 3HHTB 2QENA 3QYBA 2RGOA 3X25B 4NSRA 2I7NA 4JI4M 1IY1A 1KYIA 3M6AA 5DYGA 1L2BA 2CHVA 3IG8A 3TE6A 1S3SA 3PVSA 2XZUA 4LGMA 5LMNM 4NXNM 4M6VA 3GQ4A 2ZPGB 1TDHA 3FUUA 4MB7A 2L09A 5EJCA 3CF2A 1J09A 1KFVA 3AL0C 4JV5M 2DPPB 4JX5A 2F5SA 4DR6M 5FTLA 1GL6A 3AV0A 1XMOM 4RF1A 2XH9A 4NRVA 1QQWA 2QZ4A 4G6ZA 4GKKM 4GIPA 3SFZA 2UXCM 2DXIA 2RKOA 4HNVA 4KHPM 4I4LA 2D7EA 4AI6A 3LQQA 2H1RA 2CV1A 4BBAA 4JX4A 3TW6A 5IWAM 2ZPBB 2EO2A 4B3RM 2KXEA 4IBBA 4IBJA 1L2DA 2XZFA 4Z8XA 2XSZA 2LXEA 1G4AE 2CV0A 4KODA 1QYRA 1IY2A 2F5NA 1MU5A 1IN7A 4LRTA 2CEAA 3GLGA 2QDYB 3VYGB 1IN5A 4DR1M 1XHBA 3EIEA 4GH9A 4A3VB 4G4QA 2CUZA 2R62A 4DV6M 4OB1B 1HT1E 5ITYA 2VQFM 4B3TM 4GRIA 3DL1A 2ZCFB 3J7AS 2CFOA 3VKGA 1J7KA 2CZ1B 4ITQA 1SXJE 3H4CA 4AKHA 4IBIA 4LJAA 4G4OA 1IY0A 1IN6A 2C5RA 3HKPA 3ZC7B 1Z59A 2KW0A 3GLFA 3VDPA 2E5LM 4JI5M 3I51A 3A98B 4KO8A 4OB3B 3KXEC 4QNRA 4B7HA 2JA2A 4LF4M 3U6LA 4DV7M 4FM4B 3GPXA 3BOSA 2J7NA 4S12A 4G4RA 3NWLA 1AHJB 2KA6B 3K8ZA 2QQ8A 2UUBM 1W5TA 4LRSA 3U6SA 2ZZDB 4LJ5A 5EP3A 3AOEC 3GLGB 1IBKM 4QHTA 4X65M 1FKMA 1NHWC 2K47A 2Q2EB 2R45A 4LF9M 3UMMA 5EXTA 2AHMA 4FWHA 4AZFA 3KOZE 3HHZA 4DV5M 1VDDA 4HLQA 3RGPA 3FYDA 4OVZA 4LOCA 3U6EA 3W0LB 4XGIA 3KHIA 3J7BA 4WW0A 3KOYE 8CATA 2QFZA 3UGJA 4MGHA 2XGNA 1UM8A 1SXJA 3GPPA 3SASA 3GLFB 1GLNA 3X20B 4HL4A 3UZUA 3VYHB 4PT5A 3HHXA 4LJ4A 1ZQ9A 4BBRM 4GC9A 4Z6YA 1IQPA 1NY6A 1NNJA 1GKIA 4OB0B 3KP1E 1YE9A 2DD4B 4EIWA 1C1KA 2C9OA 1OFHA 3GP1A 3PNYA 3U60A 4DV2M 3GPYA 3GQ5A 3QXEB 4RF0A 3J2PB 4NOOB 3PNVA 2DHRA 1QAOA 2L6OA 4L16A 3L26A 4TUWA 3OTOM 3KS4A 3L28A 2KEBA 2ZPHB 3TQSA 1TGUA 4GKJM 1UGPB 1QAQA 2M5ZA 4QOZC 3HO8A 2V6ZM 4W5WA 1HNXM 4DUYM 2Y21A 2HHHM 2G5GX 4JI6M 3LQRA 4L15A 1I4WA 4RNAA 1GL7A 3SHGB 4DR3M 3U61B 1DO0A 4GHLA 1SXJB 2HCBA 2CV2A 5LMUM 4JYAM 4BBSM 2ZPFB 4MH0E 3MHVC 4PDIA 1Z6TA 3WVDB 3K1JA 1XNQM 4ZPXA 3J27B 2C9CA 1V29B 3I4VA 4OB2B 2DWZB 3RE8A 1HR0M 1NVMA 4LG2A 4AQYM 3FTDA 3U60B 1N33M 3SATA 2CHQA 3FTFA 3HJ8A 2UU9M 4I81A 4QHSA 4WURA 4I8OA 3BG3A 3KDSE 4FW9A 2DXBB 1TH4A 3TW7A 2VIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFZ A;  2G77 A;  3QYB A;  2QQ8 A;  3HZJ A;  1FKM A;  4HLQ A;  4Z6Y A;  4NC6 A;  4HL4 A;  3QYE A;  5EJC A;  3QWL A; 
#chains in the Genus database with same CATH topology
 2DAE A;  3AJI B;  3JR4 A;  4IJF A;  3SHF A;  4LGY A;  3RGF B;  3LVW A;  2C5O B;  5KPZ A;  4L8R C;  3NDQ A;  1TF0 B;  1NNU C;  2DZN B;  4BCP B;  7CAT A;  2JNH A;  5FSW A;  3FRH A;  2LVA A;  1K82 A;  1E94 E;  1L1T A;  1UNL D;  2J7O A;  1T43 A;  5ITX E;  2DME A;  4M9Z A;  1KXU A;  3VK8 A;  4BCQ D;  1QZE A;  1Y8G A;  3HX3 A;  2YFQ A;  2F5Q A;  5IT9 S;  1QAN A;  1MX0 A;  2KR6 A;  2MH8 A;  3L27 A;  4REZ A;  3TNW B;  2ERC A;  2KNV A;  2V1C A;  2YR0 A;  2FS1 A;  4UN2 B;  4UN0 A;  1V92 A;  5EXX A;  4ELJ A;  2N35 A;  4AKG A;  1WHC A;  3LCU A;  5ITX A;  4B3S M;  4CFX B;  4D80 A;  4IBE A;  2Y0Q A;  3A8O B;  5IDN B;  3EID B;  4OW0 A;  4DR7 M;  1IM2 A;  4X66 M;  3QAU A;  1Z5B A;  4QNM A;  1PJJ A;  4R7G A;  1D2N A;  2F4V M;  1VDL A;  2RGH A;  1VYW B;  2FOI C;  4ZGD B;  4M0W A;  2DNA A;  2DKL A;  4FWG A;  5KPR A;  5EP2 A;  1XC8 A;  1BU2 A;  3CF0 A;  3SMP A;  2K0B X;  3W67 A;  2DWL A;  2BWE A;  3FUW A;  1QZM A;  2NQ8 C;  1MN3 A;  4MGK E;  4DV1 M;  2WIP B;  4LZZ A;  4PCZ A;  4CIS A;  2FH0 A;  3X28 B;  3HBL A;  1NJF A;  5GKN A;  2LWX A;  1H4L D;  4LF6 M;  1JOW A;  2BS4 A;  3B57 A;  3ZQJ A;  3SAV A;  2UZL B;  3D8L A;  3KOX E;  1R5L A;  3E46 A;  1N34 M;  1G8P A;  3SAR A;  4CGY B;  2UXB M;  2XF3 A;  4ROE A;  3HGI A;  2R65 A;  4DV3 M;  3GRU A;  3L2A A;  2W9F A;  1JR3 E;  3SAU A;  4AG6 A;  5ITR A;  3FRI A;  2ZPE B;  4HNU A;  4X64 M;  3A42 A;  1OL1 B;  3MJ5 A;  2QCU A;  2QDJ A;  2Y20 A;  4FCW A;  3V76 A;  4BLC A;  2DD5 B;  1FNN A;  2C99 A;  4QSH A;  5FLX S;  2G77 A;  1ENW A;  3R9X B;  4LJ8 A;  1NJG A;  4BCM B;  4M9S A;  5EP1 A;  2JXN A;  3DFZ A;  3JAM S;  1JR3 A;  1PRB A;  2DAM A;  3CF6 E;  1HJP A;  2M60 A;  1WIV A;  1R6B X;  4IIW A;  2YQZ A;  3AOE A;  4XBO A;  3SYK A;  3SBJ A;  4JI7 M;  5FTJ A;  2D0Q B;  1J5E M;  3HZJ A;  4BCN B;  4IJE A;  2CE7 A;  4NRW A;  1QUS A;  3DZD A;  3MY5 B;  5HVY B;  2L7I A;  2B9R A;  1N36 M;  3FKE A;  1IN8 A;  1WGN A;  5FTK A;  3WHK A;  4LZJ A;  1JR3 D;  4B08 A;  2BPM B;  1GJT A;  2WMA B;  3A8H B;  3IHP A;  4MGY E;  3ZCB B;  3J81 S;  5IZ7 D;  1GH6 B;  4OVZ B;  2CZ0 B;  2EA0 A;  2BS2 A;  3U6C A;  5C1B A;  3C3E A;  3QYB A;  4NSR A;  1IY1 A;  1KYI A;  3G33 B;  5DYG A;  1YLA A;  3IG8 A;  1S3S A;  4HEO A;  1BVS A;  4NXN M;  4M6V A;  4YOO A;  4JV5 M;  4JX5 A;  1XO2 A;  1CUK A;  5HBH B;  2DXI A;  2D7E A;  3TW6 A;  1FVV B;  3B7N A;  1VEG A;  2XZF A;  1TD6 A;  2CV0 A;  1QYR A;  2LVP C;  2CEA A;  2L2D A;  1IN5 A;  2JUJ A;  4G4Q A;  2CUZ A;  4OB1 B;  5ITY A;  2VQF M;  4EOI B;  1WR1 B;  2CZ1 B;  4ITQ A;  3H4C A;  4LJA A;  4G4O A;  2EUF A;  4JI5 M;  1TR8 A;  3DJB A;  3KXE C;  4QNR A;  3BOS A;  4S12 A;  2QQ8 A;  1W5T A;  4LRS A;  2WIH B;  1AIP C;  1R4G A;  1NHW C;  4LF9 M;  5EXT A;  3HHZ A;  1VDD A;  3RGP A;  4OVZ A;  4XGI A;  3TNH B;  2QFZ A;  3UGJ A;  4BCN D;  4MGH A;  2XGN A;  3GPP A;  3SAS A;  1GLN A;  3HHX A;  5LQF B;  4BCF B;  1GKI A;  4OB0 B;  2C5V B;  5EFQ B;  3U60 A;  1OKS A;  3GQ5 A;  2JWS A;  3TNI B;  3MY1 B;  4GEW A;  1PJQ A;  1TGU A;  3I01 M;  1V33 A;  1HNX M;  4DUY M;  1OAO C;  2QNJ A;  4I3Z B;  2WSC F;  2VDB B;  4RNA A;  3U61 B;  4GHL A;  2HCB A;  2GNO A;  4JYA M;  4CFU B;  1UNG D;  4MH0 E;  4F7N B;  3TN8 B;  1D0L A;  3K1J A;  1XNQ M;  3J27 B;  4OB2 B;  3RE8 A;  1HR0 M;  1N33 M;  5HQ0 B;  3FTF A;  3HJ8 A;  4I81 A;  4WUR A;  4OGR B;  3BG3 A;  4FW9 A;  3F92 A;  1XB2 B;  1XXH B;  1SG9 A;  3C9P A;  5I5Z B;  5ITT A;  1OJL A;  4YOS A;  4JN6 A;  4JI3 M;  3TWL A;  4BB9 A;  4MGI E;  4LJ7 A;  1C7Y A;  3HHY A;  5DQV A;  4QOS A;  1ORY B;  1Q02 A;  3BHU B;  3SAW A;  2FFJ A;  1DGG A;  4P16 A;  3DDQ B;  4IMY B;  5FTN A;  5L8R F;  2DVW B;  5E6J A;  3A45 A;  1H28 B;  1Q3B A;  3B74 A;  1QDT A;  1URC B;  1XXH E;  4HNT A;  5JI2 E;  3W68 A;  3FTC A;  3KS8 A;  1UFZ A;  5KQ8 A;  3U61 A;  1IFY A;  4WP2 A;  2JY7 A;  1IN4 A;  1KSF X;  3BXW A;  1SXJ C;  3IG5 A;  3M0E A;  3T15 A;  1UGR B;  3HU2 A;  3QYG B;  2D7G A;  4DV0 M;  1TDZ A;  3QHW B;  3HWS A;  1XXH A;  3ZH9 B;  4YC3 B;  4IBG A;  4KLN A;  3HHW A;  4D82 A;  5KQD A;  3NBX X;  3KSX A;  1N78 A;  1V34 A;  2LHC A;  3EIH A;  2QBY B;  2G9X B;  2JGZ B;  2X49 A;  3Q8G A;  2ZAO A;  3JR5 A;  4DBG B;  1Q3C A;  4EOP B;  1OFI A;  2DWM A;  3DA1 A;  2ZM6 M;  1YSY A;  2FE8 A;  5IF1 B;  5BR8 M;  1XWI A;  1VEJ A;  3D8B A;  3QZ9 B;  4JI1 M;  2HAK A;  2EUC A;  3LCV B;  4YY3 M;  3CTW B;  3X24 B;  3W0F A;  3K9O A;  1NHG C;  3GLH B;  2WZJ A;  2LVQ D;  2XLJ A;  2X4A A;  3H4M A;  4DUZ M;  1GO5 A;  4F1I A;  2Z4R A;  3FUT A;  1R7R A;  1IBL M;  1GVN A;  4CFM B;  4M9X A;  3KFU G;  1GAB A;  1Q39 A;  2O25 A;  4LF5 M;  2DZO B;  1G3I A;  1DGB A;  5EQT A;  4BXX X;  1F4I A;  3VFD A;  1OKV B;  3FUX A;  1G41 A;  3U6Q A;  3GPU A;  4EOK B;  5IDP B;  1E7P A;  2I53 A;  1G59 A;  1PJI A;  1N77 A;  4BCJ B;  4MFE A;  2QBY A;  4CIZ A;  2EKF A;  2R0I A;  3GLH E;  1HNZ M;  3C58 A;  2UZE B;  3HY5 A;  4BCI B;  2OPF A;  2DAK A;  3GRR A;  4M0D A;  2C5X B;  1WGL A;  4CHT B;  1ZAE A;  1IBM M;  1GJS A;  4EOS B;  2BS3 A;  4GHA A;  3SYL A;  4F6U B;  3X26 B;  3HU1 A;  4DR4 M;  1H6U A;  2KDL A;  3GLH A;  3NBI A;  4LFA M;  2KMG A;  4JI8 M;  3LMM A;  3QYE A;  3HHT B;  2F2C A;  2RGO A;  1H1P B;  2I7N A;  4JI4 M;  3M6A A;  3GLG E;  2CCH B;  2ZTD A;  1PKD B;  2L09 A;  1J09 A;  1GL6 A;  3AV0 A;  4G3O A;  1QQW A;  4GKK M;  1E9H B;  4GIP A;  2UXC M;  1D0K A;  2CV1 A;  5HBJ B;  4JX4 A;  5IWA M;  1PJT A;  2XSZ A;  2LXE A;  1OIY B;  1IY2 A;  1O9K B;  3GLG A;  4A3V B;  1G3N C;  4DV6 M;  1HT1 E;  3VKG A;  1SXJ E;  4IBI A;  2W2H A;  2VF7 A;  2C5R A;  1IN6 A;  3ZC7 B;  2KW0 A;  3GLF A;  3VDP A;  1AIS B;  4LF4 M;  4FM4 B;  1ZMU A;  3NWL A;  5IHY A;  2ZZD B;  1IBK M;  4X65 M;  2K47 A;  2Q2E B;  4EC9 B;  4FWH A;  4AZF A;  4HLQ A;  2QGS A;  3U6E A;  4F2L A;  1UM8 A;  1SXJ A;  1P3Q Q;  3E21 A;  4HL4 A;  4PT5 A;  4LJ4 A;  2DD4 B;  1YE9 A;  2JY5 A;  2LHG A;  1OFH A;  3GP1 A;  3O0G D;  4Q7J A;  4CXA B;  4DV2 M;  3QXE B;  4RF0 A;  3PNV A;  2L6O A;  4L16 A;  4TUW A;  3TQS A;  1UGP B;  4QOZ C;  2RRU A;  2G5G X;  1I4W A;  4DR3 M;  1GL7 A;  2CV2 A;  4EOQ B;  2ZPF B;  3MHV C;  4PDI A;  1O9K A;  1JSU B;  2C9C A;  2R6F A;  1V29 B;  4LG2 A;  4AQY M;  3U60 B;  3B89 A;  1F5Q B;  3TW7 A;  2VII A;  1ZV1 A;  4DR2 M;  4EOO B;  1T3T A;  1IXS B;  1XMQ M;  2MRO B;  2B3T A;  2XFT A;  1QAM A;  2CWB A;  5H37 D;  3T1Y M;  2G3Q A;  4AW4 A;  1T6O A;  3FD9 A;  4Y28 F;  4ANR A;  2OQ4 A;  1K3W A;  1E9R A;  4ROC A;  1D3U B;  4YHH M;  3F5X B;  4LJ9 A;  4F7L B;  5ACB A;  1EE8 A;  3A8M B;  1OKW B;  3A8G B;  3SC3 A;  4XK8 F;  1OAI A;  4ZGJ B;  1L8Q A;  3T1H M;  1K3X A;  2PJQ A;  1H1S B;  3DTO A;  3QYH B;  4BCM D;  4NXM M;  3MI9 B;  1R2Z A;  2LH0 A;  3AFH A;  4EOR B;  1QLB A;  3VLF B;  3LQ5 B;  4L4U A;  2L7H A;  2X8A A;  5EP4 A;  1IXR C;  4FD2 A;  2K9D A;  4GC5 A;  3GO8 A;  3KP0 E;  4JI0 M;  1HT2 E;  2R18 A;  1WXQ A;  2Z3X A;  1H27 B;  1W5S A;  3PFI A;  2Y0T A;  3HJS A;  2UUE B;  3K7A M;  2K6B A;  1DO2 A;  2DHY A;  1NO1 A;  1E32 A;  3U5Z A;  2APL A;  1Z5A A;  3GRV A;  1WJ7 A;  4AG5 A;  5HBE B;  4F70 B;  1IXS A;  2XFS A;  1DGH B;  4F6W B;  3H4J A;  2BJV A;  5F3W A;  3HJQ A;  1OL2 B;  5EXP A;  2QPA A;  4IBC A;  4II5 B;  3GLI B;  4MIM A;  4GIT A;  2C98 A;  5EXS A;  1N4M A;  4GMQ A;  3RFW A;  1Z5C A;  4BCO B;  4CFN B;  1XNR M;  1N32 M;  2W82 A;  4Y72 B;  2HKJ A;  4G4N A;  1VQ1 A;  3BLH B;  4EC8 B;  2ZBK B;  3L25 A;  5ITQ A;  2WSF F;  5HNB B;  4PD2 A;  3CGW A;  2QP9 X;  3FTE A;  3EJ1 B;  3PXG A;  4FVM A;  2WHB B;  4BCH B;  1X37 A;  3KOW E;  1L1Z A;  3QWL A;  4B3M M;  4I5S A;  1MJG M;  2EJS A;  4L78 A;  3GLI E;  3RGS A;  3A46 A;  2A5Y B;  2V1U A;  2PMI B;  2KRU A;  1C9B A;  2F5P A;  4IBK A;  1PM5 A;  1NV8 A;  4MGZ E;  1TFB A;  2KRK A;  3B7Q A;  3T38 A;  4LFC M;  2C96 A;  3EOC B;  4X62 M;  1G71 A;  2UUC M;  1DGH A;  3U6O A;  3DDP B;  3FUV A;  3MIA B;  3ILK A;  2JY8 A;  2JZ1 A;  2V22 B;  2UXD M;  2UZB B;  1A5T A;  3GLI A;  1L2C A;  2R4J A;  4ELL A;  1YUB A;  4JX6 A;  2UZD B;  3KW6 A;  2Z4S A;  3BBZ A;  2DZL A;  1H26 B;  3A8L B;  3I4Y A;  2I7P A;  2W9Z A;  4TTH A;  4JI2 M;  2KNZ A;  4KRC B;  3MK6 A;  3UJN A;  2LNH C;  2P5T A;  2C6T B;  4MM3 B;  2AHJ B;  2CJM B;  4CJ6 A;  1PJS A;  1VG5 A;  4CFU D;  3DOG B;  1OIP A;  4FCV A;  2CP8 A;  2VQE M;  2PK9 B;  4BCK B;  2IW9 B;  2CHG A;  4IBF A;  1LTM A;  2QEN A;  3X25 B;  2KNA A;  1NV9 A;  3TE6 A;  2XZU A;  5LMN M;  3GQ4 A;  2ZPG B;  3FUU A;  5EJC A;  3AL0 C;  2DPP B;  1QUT A;  5FTL A;  1AD6 A;  1XMO M;  1JKW A;  2RKO A;  4HNV A;  4KHP M;  4I4L A;  4AI6 A;  2IN3 A;  2H1R A;  4BBA A;  2ZPB B;  2EO2 A;  4IBB A;  4Z8X A;  2WEV B;  2F5N A;  1MU5 A;  1D0M A;  2QDY B;  4DR1 M;  1XHB A;  3EIE A;  3DL1 A;  2CFO A;  1J7K A;  4AKH A;  1Z59 A;  2LVO C;  2E5L M;  3A98 B;  2LTU A;  4KO8 A;  4OB3 B;  2Z8Y M;  3LW5 F;  4B7H A;  2WFY B;  3U6L A;  1AHJ B;  4G4R A;  2KA6 B;  2WPA B;  1ZMW A;  4LJ5 A;  3GLG B;  4QHT A;  2R45 A;  2AHM A;  3KOZ E;  3FYD A;  4LOC A;  3W0L B;  3J7B A;  4WW0 A;  2LW4 A;  5CEI B;  3GLF B;  1ZQ9 A;  4BBR M;  4GC9 A;  4Z6Y A;  1NNJ A;  2CCI B;  3KP1 E;  4EIW A;  2C9O A;  3GPY A;  1TTE A;  3OTO M;  3KS4 A;  1FIN B;  4GKJ M;  4CRL B;  1QAQ A;  2M5Z A;  3HO8 A;  4W5W A;  2HHH M;  4L15 A;  1DO0 A;  1SXJ B;  5LMU M;  3BHV B;  1Z6T A;  3WVD B;  5LMK B;  1OIU B;  2MJ5 B;  1NVM A;  3FTD A;  3SAT A;  2CHQ A;  2UU9 M;  1RU3 A;  1OGU B;  2DXB B;  2JZ0 A;  3L29 A;  2BNK A;  1QDR A;  2BWB A;  1UGS B;  3GLF E;  1E9S A;  1JQJ C;  1VEK A;  5BPV A;  4NST B;  3FE3 A;  4MFD A;  3GQ3 A;  5BNJ B;  2DAI A;  2HL7 A;  3BG5 A;  1I94 M;  2MR9 A;  3C3D A;  3Q8X A;  4DV4 M;  4KT0 F;  4II7 A;  1DV0 A;  5C18 A;  2QHO B;  3HB9 A;  2DXC B;  2JP7 A;  2IW8 B;  2WMB B;  3R8F A;  4OX9 M;  1JST B;  3AKZ A;  2OOB A;  2KZS A;  2ZAM A;  3U6M A;  2DWN A;  5FGK B;  4K0K M;  4OU7 A;  3K92 A;  2KHH A;  3K9P A;  1TH3 A;  1IXZ A;  2O5R A;  3BG9 A;  1TH2 A;  2R4E A;  4B7G A;  1W98 B;  3THG A;  3TPZ A;  2XSZ D;  4PDG A;  5KO3 A;  4R71 A;  5DYI A;  3BLR B;  3E4R A;  3WVE B;  4G6L B;  5FTM A;  3TL4 X;  1VOL A;  5A2Q S;  4D81 A;  2D7H A;  2MGW A;  2J5Y A;  1UGQ B;  1QMZ B;  1QVR A;  3BHT B;  3U6D A;  2OOA A;  3PO3 S;  2YNM D;  3AOG A;  4LF7 M;  3B9P A;  4LCB A;  1NSF A;  3VK7 A;  4KRD B;  3UK6 A;  2UUA M;  3QHR B;  1AUA A;  2Z7J A;  4AKI A;  4R3D A;  1EIJ A;  1SXJ D;  4FWD A;  4F7S B;  4B7F A;  2O01 F;  2OO9 A;  3TWM A;  3U5Z B;  3QZ5 B;  3I04 M;  2IVX A;  2G8L A;  4NL4 H;  5KPT A;  4NSO B;  5L2W B;  2IW6 B;  1HQY E;  1IRE B;  1HQC A;  1ZMV A;  2BJW A;  4F7J B;  3MMP A;  3M7G A;  4F6S B;  2R46 A;  2ZAN A;  5JI3 E;  3J80 S;  4ZGE B;  2LVN C;  1P5E B;  2L4E A;  4JXJ A;  5IRE B;  3IEC A;  3KSJ A;  1DGF A;  1HNW M;  3BLQ B;  4BY1 X;  3E9S A;  2BKZ B;  3LVV A;  1OTR A;  2QF7 A;  3DOA A;  2ZPI B;  1VIN A;  2R7G A;  1JB0 F;  1PGY A;  4LF8 M;  4LFB M;  5DNY A;  2CZ7 B;  2I40 B;  4EON B;  3K2L A;  1N75 A;  4LY6 A;  2X1N B;  3VDU A;  4NC6 A;  3U6P A;  2CYZ B;  2FNA A;  3VKH A;  1R2Y A;  2WJ9 A;  3WHL A;  4DR5 M;  2W99 A;  1FJG M;  4IBD A;  5ITU A;  3TWK A;  1LV7 A;  3FYC A;  4CFW B;  4L6V 6;  2KZU A;  2VF8 A;  1GUX B;  4LJ6 A;  3KVW A;  3SMS A;  5E26 A;  4EOJ B;  1NY5 A;  2CZ6 B;  4BY7 X;  2CRU A;  3GRY A;  2DAG A;  2DI0 A;  3HU3 A;  1H1R B;  2GQF A;  2XEP A;  2C5N B;  2F5O A;  2EKK A;  4FCT A;  1H24 B;  1UNH D;  3M03 A;  1L2B A;  2C4G B;  2CHV A;  3PVS A;  4LGM A;  1H1Q B;  1TDH A;  4MB7 A;  2QSF X;  3CF2 A;  1KFV A;  2F5S A;  4DR6 M;  4P17 A;  4RF1 A;  2XH9 A;  4NRV A;  2QZ4 A;  4G6Z A;  3SFZ A;  2H5X A;  3LQQ A;  3T6P A;  1H25 B;  2ZTC A;  4B3R M;  2KXE A;  4IBJ A;  4OR5 B;  2WSE F;  1L2D A;  1G4A E;  4BCQ B;  4KOD A;  2DEN A;  3GTM S;  1IN7 A;  4LRT A;  1GY3 B;  1OQY A;  4YOZ A;  3VYG B;  4BCG B;  4GH9 A;  2R62 A;  4B3T M;  4GRI A;  2ZCF B;  3J7A S;  1IY0 A;  3HKP A;  3I51 A;  3POM A;  2JA2 A;  4DV7 M;  1GUX A;  3GPX A;  4EOL B;  2J7N A;  3K8Z A;  2UUB M;  3U6S A;  5EP3 A;  3AOE C;  1FKM A;  3B7Z A;  3UMM A;  4DV5 M;  3KHI A;  5CYI B;  3KOY E;  8CAT A;  1OI9 B;  3X20 B;  4ROD A;  3UZU A;  3VYH B;  1ZP2 A;  2PK2 A;  1IQP A;  1NY6 A;  1OIZ A;  2R44 A;  4RKU F;  1C1K A;  3PNY A;  2HWJ A;  3J2P B;  4NOO B;  2DHR A;  1QAO A;  4EOM B;  3L26 A;  3L28 A;  2KEB A;  2ZPH B;  2WXV B;  2V6Z M;  2JY6 B;  2L4F A;  2Y21 A;  2W96 A;  4JI6 M;  3LQR A;  3SHG B;  4FX3 B;  5ICP B;  4BBS M;  2LBC A;  1EFU B;  5DFL A;  4ZPX A;  3I4V A;  2DWZ B;  2PHG A;  5DQW A;  4CFV B;  4QHS A;  4I8O A;  3KDS E;  1TH4 A; 
#chains in the Genus database with same CATH homology
 3L29 A;  2BNK A;  4DR2 M;  3AJI B;  1XXH B;  1T3T A;  3JR4 A;  4IJF A;  3SHF A;  1UGS B;  4LGY A;  1E9S A;  5ITT A;  1JQJ C;  1IXS B;  3LVW A;  1OJL A;  5BPV A;  1XMQ M;  4MFD A;  5KPZ A;  4L8R C;  2XFT A;  3GQ3 A;  4JN6 A;  1QAM A;  4JI3 M;  3TWL A;  1NNU C;  2DZN B;  5H37 D;  3T1Y M;  7CAT A;  4AW4 A;  5FSW A;  2HL7 A;  4BB9 A;  3BG5 A;  3FD9 A;  1I94 M;  4MGI E;  2OQ4 A;  1K3W A;  1K82 A;  1E94 E;  1E9R A;  1L1T A;  4YHH M;  4LJ9 A;  4LJ7 A;  2J7O A;  3Q8X A;  3HHY A;  4DV4 M;  4II7 A;  4QOS A;  1ORY B;  1EE8 A;  5ITX E;  3A8M B;  4M9Z A;  3VK8 A;  5C18 A;  3HB9 A;  3A8G B;  3SAW A;  3SC3 A;  2DXC B;  4ZGJ B;  2FFJ A;  2YFQ A;  1DGG A;  4P16 A;  3R8F A;  2F5Q A;  5IT9 S;  1QAN A;  4OX9 M;  1L8Q A;  3AKZ A;  5FTN A;  3T1H M;  2KZS A;  1MX0 A;  2KR6 A;  2ZAM A;  2DVW B;  5E6J A;  3U6M A;  1K3X A;  3A45 A;  2DWN A;  3L27 A;  1Q3B A;  4REZ A;  4K0K M;  3QYH B;  4OU7 A;  3K92 A;  2ERC A;  2V1C A;  4NXM M;  1TH3 A;  1IXZ A;  2O5R A;  2YR0 A;  3BG9 A;  1TH2 A;  2R4E A;  4B7G A;  5EXX A;  3THG A;  3TPZ A;  4ELJ A;  1R2Z A;  2LH0 A;  3AFH A;  1QLB A;  2XSZ D;  4HNT A;  5JI2 E;  4PDG A;  4AKG A;  3VLF B;  5ITX A;  5KO3 A;  4B3S M;  3FTC A;  4D80 A;  4IBE A;  2L7H A;  2X8A A;  4L4U A;  3KS8 A;  5DYI A;  2Y0Q A;  5EP4 A;  3A8O B;  1IXR C;  4FD2 A;  5KQ8 A;  4OW0 A;  3U61 A;  1IM2 A;  4GC5 A;  3GO8 A;  3E4R A;  4DR7 M;  3WVE B;  3KP0 E;  4X66 M;  4JI0 M;  1HT2 E;  5FTM A;  3QAU A;  3TL4 X;  5A2Q S;  2R18 A;  1WXQ A;  1Z5B A;  4QNM A;  1PJJ A;  4R7G A;  2Z3X A;  1IN4 A;  1KSF X;  4D81 A;  1D2N A;  2F4V M;  1SXJ C;  1W5S A;  2D7H A;  3PFI A;  1UGQ B;  2Y0T A;  3HJS A;  3IG5 A;  1QVR A;  2RGH A;  3M0E A;  3T15 A;  2FOI C;  1UGR B;  4ZGD B;  3HU2 A;  3QYG B;  3U6D A;  1DO2 A;  4M0W A;  5KPR A;  4FWG A;  5EP2 A;  1XC8 A;  2D7G A;  2YNM D;  4DV0 M;  1TDZ A;  3CF0 A;  3HWS A;  3SMP A;  1XXH A;  1E32 A;  3ZH9 B;  3U5Z A;  4IBG A;  3AOG A;  4KLN A;  4LF7 M;  1Z5A A;  3B9P A;  3GRV A;  4AG5 A;  2DWL A;  3HHW A;  4LCB A;  1NSF A;  2XFS A;  4D82 A;  5KQD A;  3FUW A;  1QZM A;  1DGH B;  3VK7 A;  2NQ8 C;  4MGK E;  2BJV A;  3UK6 A;  4DV1 M;  5F3W A;  3HJQ A;  4LZZ A;  2UUA M;  4PCZ A;  5EXP A;  4CIS A;  3KSX A;  1N78 A;  3EIH A;  3X28 B;  3HBL A;  2Z7J A;  1NJF A;  2QPA A;  4AKI A;  4IBC A;  5GKN A;  2QBY B;  4R3D A;  3GLI B;  2LWX A;  1SXJ D;  2X49 A;  4MIM A;  2ZAO A;  4FWD A;  4GIT A;  4LF6 M;  2C98 A;  5EXS A;  4B7F A;  2BS4 A;  4GMQ A;  3RFW A;  1Z5C A;  3JR5 A;  3SAV A;  1Q3C A;  3D8L A;  1XNR M;  1OFI A;  3KOX E;  2W82 A;  3TWM A;  1N32 M;  3U5Z B;  3QZ5 B;  2HKJ A;  2DWM A;  3DA1 A;  4G4N A;  1N34 M;  2ZM6 M;  1YSY A;  2G8L A;  4NL4 H;  1G8P A;  5KPT A;  2FE8 A;  4NSO B;  3SAR A;  5BR8 M;  4CGY B;  1XWI A;  1HQY E;  2ZBK B;  3D8B A;  2XF3 A;  2UXB M;  3QZ9 B;  3L25 A;  5ITQ A;  4JI1 M;  2EUC A;  3HGI A;  4YY3 M;  1IRE B;  2R65 A;  4DV3 M;  3GRU A;  3L2A A;  1HQC A;  4PD2 A;  3SAU A;  3CTW B;  2BJW A;  4AG6 A;  2QP9 X;  3X24 B;  3W0F A;  5ITR A;  3FTE A;  1NHG C;  3PXG A;  3GLH B;  3M7G A;  2ZPE B;  2XLJ A;  4HNU A;  2X4A A;  4FVM A;  3H4M A;  4DUZ M;  4X64 M;  2R46 A;  2ZAN A;  1X37 A;  3A42 A;  2Z4R A;  5JI3 E;  3KOW E;  3J80 S;  4ZGE B;  3MJ5 A;  3FUT A;  1L1Z A;  2QCU A;  2QDJ A;  1R7R A;  1IBL M;  3QWL A;  4B3M M;  2Y20 A;  4FCW A;  4I5S A;  4JXJ A;  5IRE B;  3KSJ A;  1DGF A;  4BLC A;  1HNW M;  1FNN A;  2C99 A;  3E9S A;  2DD5 B;  4QSH A;  1GVN A;  4L78 A;  5FLX S;  3RGS A;  3LVV A;  4M9X A;  3A46 A;  2G77 A;  2A5Y B;  3KFU G;  3R9X B;  2V1U A;  4LJ8 A;  2KRU A;  1NJG A;  1Q39 A;  4M9S A;  5EP1 A;  2F5P A;  3DFZ A;  4IBK A;  2DZO B;  1PM5 A;  3JAM S;  4LF5 M;  2QF7 A;  1JR3 A;  1G3I A;  3DOA A;  4MGZ E;  3CF6 E;  1DGB A;  2ZPI B;  5EQT A;  2KRK A;  2M60 A;  3T38 A;  3VFD A;  4LFC M;  2C96 A;  4X62 M;  1R6B X;  4LF8 M;  3FUX A;  4LFB M;  4IIW A;  1G41 A;  2YQZ A;  5DNY A;  3AOE A;  3U6Q A;  4XBO A;  2CZ7 B;  2UUC M;  1DGH A;  3U6O A;  3K2L A;  1N75 A;  3GPU A;  4LY6 A;  3FUV A;  3SYK A;  3ILK A;  3SBJ A;  1E7P A;  3VDU A;  4JI7 M;  4NC6 A;  5FTJ A;  3U6P A;  1G59 A;  2CYZ B;  2FNA A;  1PJI A;  1N77 A;  2D0Q B;  1J5E M;  4MFE A;  3VKH A;  3HZJ A;  4IJE A;  1R2Y A;  2CE7 A;  2QBY A;  4NRW A;  2UXD M;  2WJ9 A;  3GLI A;  1L2C A;  3DZD A;  3WHL A;  4DR5 M;  2R4J A;  1HNZ M;  3C58 A;  1YUB A;  4JX6 A;  2L7I A;  1FJG M;  4IBD A;  5ITU A;  3TWK A;  2OPF A;  1LV7 A;  1N36 M;  3FYC A;  3KW6 A;  2Z4S A;  3GRR A;  4M0D A;  3FKE A;  1IN8 A;  3WHK A;  1ZAE A;  5FTK A;  4LZJ A;  4CHT B;  2KZU A;  1IBM M;  2BS3 A;  1JR3 D;  3A8L B;  3I4Y A;  2I7P A;  4LJ6 A;  3KVW A;  4JI2 M;  4GHA A;  4B08 A;  3SMS A;  5E26 A;  3SYL A;  3MK6 A;  3UJN A;  3A8H B;  1NY5 A;  4MGY E;  2LNH C;  2P5T A;  2CZ6 B;  3ZCB B;  3J81 S;  4MM3 B;  5IZ7 D;  2AHJ B;  3X26 B;  3HU1 A;  4DR4 M;  3GRY A;  1H6U A;  3GLH A;  4OVZ B;  3HU3 A;  3NBI A;  2XEP A;  4LFA M;  2KMG A;  4FCV A;  2VQE M;  2F5O A;  2CZ0 B;  4JI8 M;  2EA0 A;  3LMM A;  4FCT A;  2BS2 A;  3U6C A;  3QYE A;  2CHG A;  5C1B A;  4IBF A;  3HHT B;  2QEN A;  3QYB A;  2RGO A;  3X25 B;  4NSR A;  2I7N A;  4JI4 M;  1IY1 A;  1KYI A;  3M6A A;  5DYG A;  1L2B A;  2CHV A;  3IG8 A;  3TE6 A;  1S3S A;  3PVS A;  2XZU A;  4LGM A;  5LMN M;  4NXN M;  4M6V A;  3GQ4 A;  2ZPG B;  1TDH A;  3FUU A;  4MB7 A;  2L09 A;  5EJC A;  3CF2 A;  1J09 A;  1KFV A;  3AL0 C;  4JV5 M;  2DPP B;  4JX5 A;  2F5S A;  4DR6 M;  5FTL A;  1GL6 A;  3AV0 A;  1XMO M;  4RF1 A;  2XH9 A;  4NRV A;  1QQW A;  2QZ4 A;  4G6Z A;  4GKK M;  4GIP A;  3SFZ A;  2UXC M;  2DXI A;  2RKO A;  4HNV A;  4KHP M;  4I4L A;  2D7E A;  4AI6 A;  3LQQ A;  2H1R A;  2CV1 A;  4BBA A;  4JX4 A;  3TW6 A;  5IWA M;  2ZPB B;  2EO2 A;  4B3R M;  2KXE A;  4IBB A;  4IBJ A;  1L2D A;  2XZF A;  4Z8X A;  2XSZ A;  2LXE A;  1G4A E;  2CV0 A;  4KOD A;  1QYR A;  1IY2 A;  2F5N A;  1MU5 A;  1IN7 A;  4LRT A;  2CEA A;  3GLG A;  2QDY B;  3VYG B;  1IN5 A;  4DR1 M;  1XHB A;  3EIE A;  4GH9 A;  4A3V B;  4G4Q A;  2CUZ A;  2R62 A;  4DV6 M;  4OB1 B;  1HT1 E;  5ITY A;  2VQF M;  4B3T M;  4GRI A;  3DL1 A;  2ZCF B;  3J7A S;  2CFO A;  3VKG A;  1J7K A;  2CZ1 B;  4ITQ A;  1SXJ E;  3H4C A;  4AKH A;  4IBI A;  4LJA A;  4G4O A;  1IY0 A;  1IN6 A;  2C5R A;  3HKP A;  3ZC7 B;  1Z59 A;  2KW0 A;  3GLF A;  3VDP A;  2E5L M;  4JI5 M;  3I51 A;  3A98 B;  4KO8 A;  4OB3 B;  3KXE C;  4QNR A;  4B7H A;  2JA2 A;  4LF4 M;  3U6L A;  4DV7 M;  4FM4 B;  3GPX A;  3BOS A;  2J7N A;  4S12 A;  4G4R A;  3NWL A;  1AHJ B;  2KA6 B;  3K8Z A;  2QQ8 A;  2UUB M;  1W5T A;  4LRS A;  3U6S A;  2ZZD B;  4LJ5 A;  5EP3 A;  3AOE C;  3GLG B;  1IBK M;  4QHT A;  4X65 M;  1FKM A;  1NHW C;  2K47 A;  2Q2E B;  2R45 A;  4LF9 M;  3UMM A;  5EXT A;  2AHM A;  4FWH A;  4AZF A;  3KOZ E;  3HHZ A;  4DV5 M;  1VDD A;  4HLQ A;  3RGP A;  3FYD A;  4OVZ A;  4LOC A;  3U6E A;  3W0L B;  4XGI A;  3KHI A;  3J7B A;  4WW0 A;  3KOY E;  8CAT A;  2QFZ A;  3UGJ A;  4MGH A;  2XGN A;  1UM8 A;  1SXJ A;  3GPP A;  3SAS A;  3GLF B;  1GLN A;  3X20 B;  4HL4 A;  3UZU A;  3VYH B;  4PT5 A;  3HHX A;  4LJ4 A;  1ZQ9 A;  4BBR M;  4GC9 A;  4Z6Y A;  1IQP A;  1NY6 A;  1NNJ A;  1GKI A;  4OB0 B;  3KP1 E;  1YE9 A;  2DD4 B;  4EIW A;  1C1K A;  2C9O A;  1OFH A;  3GP1 A;  3PNY A;  3U60 A;  4DV2 M;  3GPY A;  3GQ5 A;  3QXE B;  4RF0 A;  3J2P B;  4NOO B;  3PNV A;  2DHR A;  1QAO A;  2L6O A;  4L16 A;  3L26 A;  4TUW A;  3OTO M;  3KS4 A;  3L28 A;  2KEB A;  2ZPH B;  3TQS A;  1TGU A;  4GKJ M;  1UGP B;  1QAQ A;  2M5Z A;  4QOZ C;  3HO8 A;  2V6Z M;  4W5W A;  1HNX M;  4DUY M;  2Y21 A;  2HHH M;  2G5G X;  4JI6 M;  3LQR A;  4L15 A;  1I4W A;  4RNA A;  1GL7 A;  3SHG B;  4DR3 M;  3U61 B;  1DO0 A;  4GHL A;  1SXJ B;  2HCB A;  2CV2 A;  5LMU M;  4JYA M;  4BBS M;  2ZPF B;  4MH0 E;  3MHV C;  4PDI A;  1Z6T A;  3WVD B;  3K1J A;  1XNQ M;  4ZPX A;  3J27 B;  2C9C A;  1V29 B;  3I4V A;  4OB2 B;  2DWZ B;  3RE8 A;  1HR0 M;  1NVM A;  4LG2 A;  4AQY M;  3FTD A;  3U60 B;  1N33 M;  3SAT A;  2CHQ A;  3FTF A;  3HJ8 A;  2UU9 M;  4I81 A;  4QHS A;  4WUR A;  4I8O A;  3BG3 A;  3KDS E;  4FW9 A;  2DXB B;  1TH4 A;  3TW7 A;  2VII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...