4HL4A

Crystal structure of the human tbc1d20 rabgap domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
b'FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
molecule tags Hydrolase activator
source organism Homo sapiens
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hl4A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hl4A02
4HL4A 2QQ8A 4HLQA 3QWLA 3QYEA 4Z6YA 3QYBA 3HZJA 5EJCA 4NC6A 2G77A 2QFZA 1FKMA
chains in the Genus database with same CATH superfamily
2VQEM 2Y20A 2CZ7B 1N75A 2E5LM 2DVWB 3J2PB 4FW9A 4RKUF 4ZPXA 4IIWA 3HZJA 4QNRA 4JI7M 4LZZA 2MR9A 1QUTA 3HHXA 1IY0A 5ITTA 1XXHE 1SXJC 2CHVA 2Z8YM 3SYKA 1DGHB 2DAEA 4M9ZA 3VDUA 3GLGA 4DV5M 1PJJA 2UUBM 4LFBM 1NNUC 2OPFA 2LHCA 4GMQA 3RFWA 3BG3A 3AJIB 1VDLA 1XHBA 4IBJA 1G8PA 2VF8A 1VEJA 3GQ3A 3DDPB 3MY1B 4BCKB 1L1TA 1HT2E 1SG9A 2DHRA 2V1UA 4LRTA 4JV5M 2X4AA 3M03A 4YC3B 2EUCA 1QDRA 2JUJA 4IBGA 1HNXM 5BNJB 3TNHB 1IXZA 3GLFE 3TW6A 1NV8A 3L25A 3BHUB 5HNBB 1IREB 2H5XA 4EOOB 1GVNA 1MU5A 3TWLA 1L1ZA 3KSXA 2DD4B 2EUFA 2UZDB 3U6LA 1TD6A 3IECA 2RGOA 4ANRA 3RGFB 4KO8A 5ICPB 4L6V6 4JI5M 1QZEA 3ZH9B 3VKGA 3WVDB 2XGNA 1KSFX 3GRVA 1JKWA 4F7JB 1OKVB 4CFUB 2HCBA 5BR8M 4OB3B 5GKNA 3K9OA 1PJSA 2LNHC 1NNJA 2HL7A 2Z4RA 4ELLA 2LXEA 1N78A 1H1QB 2ZZDB 2UXCM 1HQYE 1Z5CA 1HNWM 3MK6A 4KODA 4AW4A 1XNQM 2XZFA 5EFQB 1DGGA 3VDPA 5DFLA 2NQ8C 4MGIE 2CRUA 1TDHA 1G3IA 1GUXB 3QHRB 4CFXB 4KT0F 4ROEA 2L4FA 3A8LB 3HKPA 3KW6A 4MFEA 3HB9A 2DXCB 4WW0A 3GQ5A 3PNYA 2FE8A 1SXJB 4QHTA 1HJPA 2V1CA 3T15A 2IW8B 1Q3BA 1C7YA 2R4JA 1E9SA 4NL4H 2J7OA 1OL2B 1YE9A 3KOYE 4JI0M 2F5SA 4CFMB 2R18A 3SATA 4QSHA 1QAQA 2A5YB 2DZNB 3M7GA 3LVVA 1AUAA 4IBCA 3HJQA 1UGSB 3BLQB 4EOJB 7CATA 2O01F 1MJGM 2HKJA 2UXDM 2WHBB 2CCIB 1C1KA 2L4EA 1AIPC 2VDBB 1JR3A 3U6CA 3SAVA 3J7AS 4BBSM 3GQ4A 3B9PA 4EC8B 2K0BX 4CISA 5CEIB 5C18A 2QENA 1IY2A 4BCQB 1Y8GA 1VINA 1OIPA 4FWDA 3HWSA 4G4RA 3EOCB 4W5WA 3GP1A 3BOSA 3CF0A 3E46A 2DZLA 3PFIA 1VDDA 3KHIA 2HHHM 4FWHA 3UGJA 3DL1A 2KZSA 3GPUA 3QYEA 3SMSA 1D3UB 4NXMM 4BCMD 2KEBA 2OOAA 4IBKA 3BG5A 3A8MB 4BY7X 2WIHB 1UNHD 3W0FA 2DMEA 2LVNC 1J09A 1OAOC 1IN4A 2EKFA 8CATA 1OTRA 4QOZC 4GITA 1NHWC 3V76A 5KO3A 2R46A 3BXWA 1H4LD 1YSYA 3C9PA 4BY1X 3KP0E 2CHQA 1D2NA 1VQ1A 4LFCM 3QYGB 1PJTA 1WIVA 4LGYA 3TE6A 2OQ4A 4II5B 3VYHB 3AOGA 4Q7JA 3SAWA 2WIPB 2QP9X 4IBEA 3A98B 1TR8A 2L7IA 1QZMA 2APLA 3GLHB 4IBFA 4OU7A 3SHGB 4DV7M 4LF8M 3HU2A 3ILKA 4F6WB 4HNTA 1I94M 1IN7A 3FUUA 3WHLA 3GTMS 1NJFA 2FS1A 4AKIA 4NSRA 2XSZA 5DYIA 2QBYB 4CIZA 1C9BA 3QZ5B 4MGZE 3PNVA 5EJCA 3E4RA 4GHAA 3LQ5B 4REZA 2GNOA 4DV6M 2HAKA 3X24B 1T6OA 4OGRB 3I01M 4ZGJB 3AV0A 4KLNA 2HWJA 4BB9A 4B7HA 1G3NC 4CFUD 4B3SM 4IBDA 4TTHA 3RGSA 2CCHB 4L16A 3CGWA 4Y72B 3KDSE 2UXBM 4EIWA 1UGRB 3SYLA 4MGHA 4FCTA 2K9DA 1VYWB 2KR6A 3GLHA 3GPPA 2PHGA 3HO8A 1ORYB 4JX5A 2F5QA 4EOIB 4X65M 3FYDA 4R3DA 3R9XB 2BS4A 2WSFF 1AD6A 4CFWB 4EOKB 5HQ0B 3L29A 2ZAMA 4NSTB 4EONB 3KXEC 3U6MA 1TDZA 1IY1A 4M9XA 1P5EB 4LGMA 1FNNA 2KRUA 1XNRM 4MM3B 3DJBA 1L2BA 1W5SA 4BCPB 1W98B 3L2AA 2F5PA 5KPTA 2CZ1B 1NO1A 1QANA 1R2ZA 2WPAB 1R7RA 3HJSA 1QAMA 1IXRC 2DHYA 2DKLA 1VEGA 2QCUA 4JI8M 3GLIE 2JGZB 3FE3A 5EQTA 1XB2B 2UUEB 3KFUG 3EIHA 2ZPHB 2JWSA 2I7NA 2JY7A 2JZ0A 4MH0E 2Y0QA 3QAUA 4LJ5A 4G4OA 1OAIA 2UUAM 3T1HM 4EOSB 4LJ4A 2CZ6B 1F5QB 1OIUB 3FTEA 1FKMA 1FINB 1D0MA 2WXVB 4R71A 3EIEA 3FUXA 2R45A 4IJFA 1BU2A 3AOEA 5L2WB 2JY5A 3SC3A 4ROCA 2G9XB 3GLFA 3U6OA 4AKHA 2DWZB 3LMMA 1O9KB 2C4GB 2R0IA 3NBIA 4L8RC 2CHGA 3LW5F 3AL0C 4I8OA 4DV3M 2X8AA 3DOAA 2C5NB 5EXSA 5CYIB 5LMKB 5LQFB 3U6PA 2WMBB 3J80S 2R65A 1N36M 1K3WA 2UZLB 1XXHB 3FRIA 3MMPA 4X66M 4NOOB 1QVRA 1NJGA 2X49A 1GKIA 3SASA 2BJWA 4CJ6A 1PRBA 4LJ9A 1GH6B 2R62A 3CTWB 1H24B 4DBGB 5FGKB 1AHJB 5JI3E 5L8RF 4X64M 1IFYA 2XH9A 4OX9M 4TUWA 4CFNB 3NBXX 2DZOB 4X62M 4AG5A 4DR2M 3U6QA 3BHTB 4DUYM 3CF2A 1IQPA 3D8LA 5DYGA 3TWKA 1WJ7A 2LVAA 3GRUA 2AHJB 2BKZB 2W9ZA 5IDPB 1XXHA 3L27A 1QUSA 4YOOA 4EOQB 1ZAEA 3A42A 1GABA 2KDLA 2JNHA 2RRUA 4P17A 3GLFB 1KXUA 1O9KA 4D82A 1TGUA 1GJTA 2EKKA 4FCVA 4GRIA 3VK7A 1MN3A 1QLBA 3HHWA 4BCGB 4D80A 1OJLA 1QYRA 2ZTDA 4DV4M 1XO2A 4NRWA 2ZCFB 4UN0A 4KRCB 4HL4A 5C1BA 1TF0B 5ITRA 1KFVA 3KOXE 4MGYE 1OKWB 5KQ8A 3H4MA 2R44A 3U5ZB 3MIAB 3F92A 2Z4SA 1G41A 4IJEA 4PCZA 1Z59A 5IREB 4D81A 3U61B 5F3WA 1UNLD 2DWLA 1WR1B 2L7HA 1S3SA 4L4UA 2X1NB 2QZ4A 4B3TM 3IG5A 3WVEB 4DR6M 3DOGB 3FUWA 2FH0A 4F2LA 4PD2A 2LW4A 2XLJA 2DAMA 4M0WA 2W9FA 2DXIA 2XSZD 3DA1A 3EIDB 1WGNA 2BNKA 3TL4X 2XZUA 2GQFA 4GHLA 4GKJM 3EJ1B 3NWLA 3H4CA 3QZ9B 5DQWA 4L78A 3TW7A 4DR4M 2C98A 4YOSA 4JI1M 3VKHA 2DENA 3W67A 4LY6A 2KW0A 1P3QQ 3FTCA 5ITXE 2C6TB 2LBCA 4FVMA 4KHPM 2PJQA 2P5TA 3LQRA 2ZPFB 1Z5BA 1SXJE 1IBMM 2BWEA 1IN5A 4LJ6A 2KNVA 4DV0M 1LV7A 2WSEF 1GY3B 4EOMB 2Z3XA 3FUTA 5FTJA 2QDJA 4LF7M 4FX3B 2DWMA 1JSUB 2EJSA 2C99A 2YR0A 5ITUA 1H1SB 1JSTB 3HX3A 3W0LB 3K1JA 2L6OA 4GC5A 1DO0A 1V92A 3K92A 4PT5A 2CJMB 3K9PA 3U6SA 3FRHA 4UN2B 1V34A 2R4EA 3B7NA 4XGIA 4GEWA 1J7KA 3GPYA 4DR3M 3GLGE 3X20B 1CUKA 4QOSA 4I4LA 3HBLA 1OI9B 4EOLB 1ENWA 2CYZB 2LWXA 3D8BA 5LMUM 4WURA 4PDGA 1V29B 2DD5B 3MHVC 2M5ZA 3VLFB 4JN6A 4IMYB 2D7EA 2B3TA 4G6ZA 4B08A 4HLQA 3PXGA 4GIPA 3SMPA 1ZP2A 1HR0M 2B9RA 3FTDA 4YOZA 4BCMB 4BCJB 3SHFA 2R7GA 3QYBA 5EXTA 4PDIA 5FLXS 4BCIB 3PO3S 4AI6A 2F5NA 3HHZA 3Q8XA 1KYIA 4B7FA 2LVOC 3E21A 3UK6A 1G71A 5IDNB 5ACBA 1XMOM 3SAUA 2WMAB 4OB0B 3H4JA 3GRRA 2WJ9A 1UNGD 1H6UA 2XFTA 3KS4A 3X25B 1H27B 3JAMS 3JR4A 2CE7A 1GJSA 2PK9B 5HBJB 3KOWE 1OKSA 1R5LA 2UUCM 3VFDA 2IVXA 2QDYB 3TNWB 4JI6M 1TH3A 2ZANA 3IG8A 2D7GA 3G33B 1MX0A 1NV9A 1H28B 1PM5A 4LJ7A 4M9SA 1OIYB 3X28B 3VK8A 4CFVB 5EP2A 4RF0A 5KQDA 4WP2A 4JI3M 2JZ1A 1QMZB 2FOIC 2KHHA 3CF6E 1XC8A 4ZGEB 2ZTCA 3KS8A 3F5XB 4BBAA 1JR3E 3QWLA 4M0DA 3K7AM 2WEVB 2ERCA 2M60A 3DFZA 2CFOA 1IN8A 5EP3A 2KA6B 3KOZE 3MJ5A 3MY5B 4LJ8A 1QDTA 2Z7JA 4EORB 5H37D 2YFQA 5E26A 1R6BX 4HEOA 4DV1M 4LF6M 3A8GB 1YUBA 3SBJA 1WHCA 1OFHA 1EIJA 4I5SA 2EA0A 3RE8A 2D7HA 4YHHM 2C5RA 1K82A 1IBKM 2UU9M 2WFYB 3KVWA 4LCBA 2FNAA 3TN8B 3O0GD 1FVVB 1E9HB 3A46A 4FWGA 2ZPIB 4BCHB 2YNMD 2C5OB 1XMQM 2W2HA 2ZAOA 4F7LB 3I4VA 4JX6A 2CV2A 2QBYA 1SXJA 1WXQA 2DAKA 3GRYA 2ZM6M 3T1YM 2G77A 2LHGA 1JR3D 2CV1A 1UM8A 4LG2A 2C5VB 3THGA 4G4QA 2MROB 4OW0A 4OVZA 2CV0A 1DV0A 1G59A 3HHYA 2W82A 2VIIA 1NY6A 2QNJA 4R7GA 2L2DA 2CZ0B 2QGSA 3BLHB 4BCOB 4BCND 5ITYA 2KXEA 2XEPA 1IXSB 2BJVA 2C96A 2Y21A 5DNYA 4DUZM 1K3XA 4JI4M 3FTFA 2PK2A 2W99A 3DTOA 4NSOB 3GLIB 3LQQA 3QHWB 3B89A 2I53A 2QPAA 3C58A 4DR1M 3ZCBB 2CP8A 4JXJA 1N34M 4JX4A 1BVSA 2ZPBB 1R4GA 1GL7A 1IXSA 2BWBA 2MH8A 3AOEC 4LF4M 5E6JA 5IWAM 4LRSA 3J81S 2JY6B 2OOBA 2V22B 1G4AE 4RF1A 4DR5M 1E9RA 1E32A 3WHKA 2ZPEB 2PMIB 1PGYA 2H1RA 2C9OA 3LCVB 2LVQD 1NSFA 2JP7A 2OO9A 3B7ZA 4LJAA 2JA2A 4MB7A 4Z6YA 4DR7M 3C3DA 2JXNA 4XBOA 2J5YA 1NHGC 1NY5A 1OFIA 4NC6A 5FTNA 3L26A 3T6PA 3SFZA 2VQFM 3BHVB 2LTUA 3I4YA 2BPMB 2BS2A 4MGKE 3HY5A 3T38A 4F70B 1TH2A 1TFBA 1EE8A 4LZJA 3LVWA 4Z8XA 2ZPGB 3U6DA 1L2CA 5EXXA 2V6ZM 2KRKA 4AQYM 4GH9A 4LFAM 1JB0F 2AHMA 3X26B 1JOWA 3AFHA 3PVSA 2MJ5B 2N35A 1Q39A 2MGWA 2K47A 3FD9A 1D0LA 1T43A 1IM2A 3K8ZA 3M6AA 1H25B 4BXXX 4CRLB 2VF7A 3TWMA 2JY8A 1JQJC 3NDQA 4OB1B 1N4MA 1N33M 2IW6B 3HJ8A 4IBIA 4S12A 1F4IA 5FTKA 3TPZA 2G8LA 2F2CA 2I40B 2QHOB 1TH4A 4F7SB 4QHSA 4LF9M 4BLCA 5FSWA 4EC9B 1HQCA 3QXEB 1ZV1A 4GC9A 1EFUB 1Q02A 1J5EM 4CXAB 2ZBKB 3B7QA 3W68A 1L2DA 1TTEA 1GUXA 3A8HB 2J7NA 3UJNA 4F6SB 4HNUA 1ZQ9A 2G5GX 2RGHA 3J7BA 4KRDB 1ZMWA 4CGYB 3J27B 3BBZA 1YLAA 2DAGA 5HBEB 2O5RA 4G6LB 4NXNM 3LCUA 1QAOA 4JI2M 1RU3A 4BCQD 1AISB 2EO2A 1UGQB 1OIZA 2C9CA 2DXBB 4YY3M 1VG5A 1ZMVA 1OL1B 2WZJA 4I3ZB 4ZGDB 2YQZA 2DNAA 5KPZA 3GLIA 4MFDA 4F7NB 2KNZA 5DQVA 5IF1B 3TNIB 3RGPA 3HHTB 4GKKM 1X37A 2K6BA 3HU3A 4B3MM 3B74A 4II7A 3U60B 4B7GA 5ITQA 5IZ7D 2W96A 3HGIA 1VOLA 2R6FA 3KSJA 4FD2A 2KNAA 4A3VB 1DGBA 3U6EA 3DDQB 3VYGB 4OVZB 4AG6A 4P16A 4AKGA 1GO5A 1OGUB 3POMA 2BS3A 2XFSA 4ITQA 2O25A 3FUVA 4M6VA 2CEAA 4Y28F 2LVPC 2XF3A 4G4NA 3GLHE 3UZUA 3R8FA 2KZUA 3BLRB 3A45A 3FKEA 2IW9B 1Z6TA 3E9SA 3AKZA 4BCNB 5FTMA 5KPRA 1E7PA 3DZDA 1D0KA 3HU1A 2CUZA 5EXPA 2LH0A 4OB2B 1DGFA 5BPVA 1Q3CA 1LTMA 2KMGA 5EP1A 1H1PB 1DGHA 2WSCF 4NRVA 3GLGB 1UGPB 2QFZA 1H1RB 3C3EA 4G3OA 2C5XB 3TQSA 3GO8A 4BCFB 1XWIA 2I7PA 1PJIA 1T3TA 4CHTB 1GLNA 3K2LA 3A8OB 3ZC7B 5IHYA 2G3QA 4ELJA 1UFZA 4F6UB 1I4WA 1HT1E 3JR5A 5IT9S 4JYAM 1URCB 4OR5B 4HNVA 4AZFA 3U60A 4FM4B 4I81A 3SARA 2D0QB 4QNMA 1ZMUA 4BBRM 5A2QS 4RODA 3QYHB 2Y0TA 2QQ8A 2RKOA 3M0EA 3MI9B 5I5ZB 1L8QA 1SXJD 4IBBA 1PJQA 5ITXA 1N32M 3BG9A 2F5OA 3I51A 3Q8GA 4FCWA 5LMNM 3B57A 4MIMA 3I04M 5HVYB 1IBLM 2F4VM 2CWBA 1R2YA 1DO2A 1FJGM 1N77A 3U61A 2UZBB 3IHPA 1GL6A 1QQWA 5FTLA 2QF7A 1PKDB 3U5ZA 2Q2EB 4K0KM 2DAIA 2FFJA 1W5TA 2DI0A 2L09A 1HNZM 1VEKA 4LOCA 4F1IA 5EP4A 1E94E 1NVMA 3FYCA 4RNAA 1WGLA 3L28A 3UMMA 3OTOM 4LF5M 2UZEB 4DV2M 1H26B 1V33A 1Z5AA 2QSFX 3ZQJA 5JI2E 2DPPB 4XK8F 1OQYA 5HBHB 3KP1E 4B3RM 1IN6A 2DWNA 2IN3A 1A5TA 4L15A 3GPXA 4EOPB
chains in the Genus database with same CATH topology
2VQEM 2Y20A 2CZ7B 1N75A 2E5LM 2DVWB 3J2PB 4FW9A 4ZPXA 4IIWA 4QNRA 4JI7M 3HZJA 4LZZA 3HHXA 1IY0A 5ITTA 1SXJC 2CHVA 3SYKA 3VDUA 1DGHB 4M9ZA 3GLGA 4DV5M 1PJJA 2UUBM 3A8GB 4LFBM 1NNUC 2OPFA 3BG3A 4GMQA 3RFWA 3AJIB 1XHBA 4IBJA 3GQ3A 1G8PA 1L1TA 1HT2E 2DHRA 2V1UA 4JV5M 4LRTA 2X4AA 2EUCA 1HNXM 4IBGA 1IXZA 3TW6A 3L25A 1IREB 4HNTA 1GVNA 1MU5A 3TWLA 1L1ZA 3KSXA 2DD4B 3U6LA 2RGOA 4KO8A 4JI5M 3ZH9B 3VKGA 3WVDB 2XGNA 1KSFX 3GRVA 2HCBA 5BR8M 4OB3B 5GKNA 2LNHC 1NNJA 2HL7A 2Z4RA 2LXEA 1N78A 2ZZDB 2UXCM 1HQYE 1Z5CA 1HNWM 3MK6A 4KODA 4AW4A 1XNQM 2XZFA 1DGGA 3VDPA 2NQ8C 4MGIE 1TDHA 1G3IA 3A8LB 3HKPA 3KW6A 4MFEA 3HB9A 2DXCB 4WW0A 3GQ5A 3PNYA 2FE8A 1SXJB 4QHTA 2V1CA 3T15A 1Q3BA 2R4JA 1E9SA 4NL4H 2J7OA 1YE9A 3KOYE 4JI0M 2F5SA 2R18A 3SATA 4QSHA 1QAQA 2A5YB 2DZNB 3M7GA 3LVVA 4IBCA 3HJQA 1UGSB 7CATA 2HKJA 2UXDM 1C1KA 4BBSM 3U6CA 3J7AS 1JR3A 3SAVA 3GQ4A 3B9PA 4CISA 5C18A 2QENA 1IY2A 4FWDA 4G4RA 3HWSA 4W5WA 3GP1A 3BOSA 3CF0A 3PFIA 1VDDA 3KHIA 2HHHM 4FWHA 3UGJA 3DL1A 2KZSA 3GPUA 3QYEA 3SMSA 2KEBA 4IBKA 3BG5A 3A8MB 3W0FA 1J09A 4QOZC 1IN4A 8CATA 4GITA 1NHWC 5KO3A 2R46A 1YSYA 3KP0E 2CHQA 1D2NA 4LFCM 3QYGB 3TE6A 4LGYA 2OQ4A 3VYHB 3AOGA 3SAWA 2QP9X 4IBEA 3A98B 2L7IA 3GLHB 1QZMA 4OU7A 4DV7M 4IBFA 3SHGB 4LF8M 3HU2A 3ILKA 1I94M 1IN7A 3FUUA 3WHLA 1NJFA 4AKIA 4NSRA 2XSZA 5DYIA 2QBYB 3QZ5B 4MGZE 3PNVA 5EJCA 3E4RA 4GHAA 4REZA 4DV6M 3X24B 4ZGJB 3AV0A 4KLNA 4BB9A 4B7HA 4B3SM 4IBDA 3RGSA 4L16A 3KDSE 2UXBM 4EIWA 1UGRB 3SYLA 4MGHA 4FCTA 3HO8A 2KR6A 3GLHA 3GPPA 1ORYB 4JX5A 2F5QA 4X65M 3FYDA 4R3DA 3R9XB 2BS4A 3L29A 2ZAMA 3KXEC 3U6MA 1TDZA 1IY1A 4M9XA 4LGMA 1FNNA 2KRUA 1XNRM 4MM3B 1L2BA 1W5SA 3L2AA 2F5PA 5KPTA 2CZ1B 1QANA 1R2ZA 1R7RA 3HJSA 1QAMA 1IXRC 4JI8M 2QCUA 5EQTA 3KFUG 3EIHA 2ZPHB 2I7NA 4MH0E 2Y0QA 3QAUA 4LJ5A 4G4OA 2UUAM 3T1HM 4LJ4A 2CZ6B 3FTEA 1FKMA 3EIEA 3FUXA 2R45A 4IJFA 3AOEA 3SC3A 3GLFA 3U6OA 4AKHA 2DWZB 3LMMA 3NBIA 4L8RC 2CHGA 3AL0C 4I8OA 4DV3M 2X8AA 3DOAA 5EXSA 3U6PA 3J80S 2R65A 1N36M 1K3WA 1XXHB 4X66M 4NOOB 1QVRA 1NJGA 2X49A 1GKIA 3SASA 2BJWA 4LJ9A 2R62A 3CTWB 1AHJB 5JI3E 4X64M 2XH9A 4OX9M 4TUWA 3U6QA 2DZOB 4X62M 4AG5A 4DR2M 4DUYM 3CF2A 1IQPA 3D8LA 5DYGA 3TWKA 2AHJB 3GRUA 1XXHA 3L27A 1ZAEA 3A42A 3GLFB 4D82A 1TGUA 4FCVA 4GRIA 3VK7A 1QLBA 3HHWA 4D80A 1OJLA 1QYRA 4DV4M 4NRWA 2ZCFB 4HL4A 5C1BA 5ITRA 1KFVA 3KOXE 4MGYE 5KQ8A 3H4MA 3U5ZB 2Z4SA 1G41A 4IJEA 4PCZA 1Z59A 5IREB 4D81A 3U61B 5F3WA 2DWLA 2L7HA 1S3SA 4L4UA 3WVEB 2QZ4A 4B3TM 3IG5A 4DR6M 3FUWA 4PD2A 2XLJA 4M0WA 2DXIA 2XSZD 3DA1A 2BNKA 3TL4X 4GKJM 2XZUA 3H4CA 4GHLA 3QZ9B 3NWLA 4L78A 3TW7A 4DR4M 2C98A 4JI1M 3VKHA 4LY6A 2KW0A 3FTCA 5ITXE 4FVMA 4KHPM 2P5TA 3LQRA 2ZPFB 1Z5BA 1SXJE 1IBMM 4LJ6A 1IN5A 4DV0M 1LV7A 2Z3XA 3FUTA 5FTJA 2QDJA 4LF7M 2DWMA 2C99A 2YR0A 5ITUA 3W0LB 3K1JA 2L6OA 4GC5A 1DO0A 3K92A 4PT5A 3U6SA 2R4EA 3GPYA 4XGIA 1J7KA 4DR3M 3X20B 4QOSA 4I4LA 3HBLA 2CYZB 2LWXA 3D8BA 5LMUM 4WURA 4PDGA 1V29B 2DD5B 3MHVC 2M5ZA 3VLFB 4JN6A 2D7EA 4G6ZA 4B08A 4HLQA 3PXGA 4GIPA 3SMPA 1HR0M 3FTDA 3SHFA 3QYBA 5EXTA 4PDIA 5FLXS 4AI6A 2F5NA 3HHZA 3Q8XA 1KYIA 4B7FA 3UK6A 1XMOM 3SAUA 4OB0B 3GRRA 2WJ9A 1H6UA 2XFTA 3KS4A 3X25B 3JAMS 3JR4A 2CE7A 3KOWE 2UUCM 3VFDA 2QDYB 4JI6M 1TH3A 2ZANA 3IG8A 2D7GA 1MX0A 1PM5A 4LJ7A 4M9SA 3X28B 3VK8A 5EP2A 4RF0A 5KQDA 4JI3M 2FOIC 3CF6E 1XC8A 4ZGEB 3KS8A 4BBAA 3QWLA 4M0DA 2ERCA 2M60A 3DFZA 2CFOA 1IN8A 5EP3A 2KA6B 3KOZE 3MJ5A 4LJ8A 2Z7JA 5H37D 2YFQA 5E26A 1R6BX 4DV1M 4LF6M 1YUBA 3SBJA 1OFHA 4I5SA 2EA0A 3RE8A 2D7HA 4YHHM 2C5RA 1K82A 1IBKM 2UU9M 3KVWA 4LCBA 2FNAA 2ZPIB 3A46A 4FWGA 2YNMD 1XMQM 2ZAOA 3I4VA 4JX6A 2CV2A 2QBYA 1SXJA 1WXQA 3GRYA 2ZM6M 3T1YM 2G77A 1JR3D 2CV1A 1UM8A 4LG2A 3THGA 4G4QA 4OW0A 4OVZA 2CV0A 1G59A 3HHYA 2W82A 2VIIA 1NY6A 4R7GA 2CZ0B 5ITYA 2KXEA 2XEPA 1IXSB 2BJVA 2C96A 2Y21A 5DNYA 4DUZM 1K3XA 4JI4M 3FTFA 4NSOB 3GLIB 3LQQA 2QPAA 3C58A 4DR1M 3ZCBB 4JXJA 1N34M 4JX4A 2ZPBB 3AOEC 1GL7A 4LF4M 5E6JA 5IWAM 4LRSA 3J81S 1G4AE 4RF1A 4DR5M 1E9RA 1E32A 3WHKA 2ZPEB 2H1RA 2C9OA 1NSFA 4LJAA 4MB7A 2JA2A 4Z6YA 4DR7M 4XBOA 3L26A 1NHGC 1NY5A 5FTNA 1OFIA 2VQFM 4NC6A 3SFZA 3I4YA 2BS2A 4MGKE 3T38A 1TH2A 1EE8A 4LZJA 3LVWA 4Z8XA 2ZPGB 3U6DA 1L2CA 5EXXA 2V6ZM 2KRKA 4AQYM 4GH9A 4LFAM 3X26B 2AHMA 3AFHA 3PVSA 1Q39A 3FD9A 2K47A 3K8ZA 3M6AA 1IM2A 3TWMA 1JQJC 4OB1B 1N33M 3HJ8A 4IBIA 4S12A 5FTKA 3TPZA 2G8LA 1TH4A 4QHSA 4LF9M 4BLCA 5FSWA 1HQCA 3QXEB 4GC9A 1J5EM 2ZBKB 1L2DA 3A8HB 4HNUA 2J7NA 3UJNA 1ZQ9A 2G5GX 2RGHA 3J7BA 4CGYB 3J27B 2O5RA 4NXNM 4JI2M 1QAOA 2EO2A 1UGQB 2C9CA 2DXBB 4YY3M 4ZGDB 2YQZA 4MFDA 5KPZA 3GLIA 3RGPA 4GKKM 1X37A 3HU3A 4B3MM 4II7A 3U60B 4B7GA 5ITQA 5IZ7D 3HGIA 3KSJA 4FD2A 4A3VB 3U6EA 1DGBA 3VYGB 4OVZB 4AG6A 4P16A 4AKGA 2BS3A 2XFSA 4ITQA 3FUVA 4M6VA 2CEAA 2XF3A 4G4NA 3UZUA 3R8FA 2KZUA 3A45A 3FKEA 1Z6TA 3E9SA 3AKZA 5FTMA 5KPRA 1E7PA 3DZDA 3HU1A 2CUZA 5EXPA 2LH0A 4OB2B 1DGFA 5BPVA 1Q3CA 2KMGA 5EP1A 1DGHA 4NRVA 3GLGB 1UGPB 2QFZA 3TQSA 3GO8A 1XWIA 2I7PA 1PJIA 1T3TA 4CHTB 1GLNA 3K2LA 3A8OB 3ZC7B 4ELJA 1I4WA 1HT1E 3JR5A 5IT9S 4JYAM 4HNVA 4AZFA 3U60A 4FM4B 4I81A 3SARA 2D0QB 4QNMA 4BBRM 5A2QS 3QYHB 2Y0TA 3M0EA 2RKOA 2QQ8A 1L8QA 1SXJD 4IBBA 5ITXA 1N32M 3BG9A 2F5OA 3I51A 4FCWA 4MIMA 5LMNM 1IBLM 2F4VM 1R2YA 1DO2A 1FJGM 1N77A 3U61A 1GL6A 1QQWA 5FTLA 2QF7A 3U5ZA 2Q2EB 4K0KM 2FFJA 1W5TA 2L09A 1HNZM 4LOCA 5EP4A 1E94E 1NVMA 3FYCA 4RNAA 3L28A 3UMMA 3OTOM 4LF5M 4DV2M 1Z5AA 5JI2E 2DPPB 3KP1E 4B3RM 1IN6A 2DWNA 3HHTB 4NXMM 4L15A 3GPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HL4 A;  2QQ8 A;  4HLQ A;  3QWL A;  3QYE A;  4Z6Y A;  3QYB A;  3HZJ A;  5EJC A;  4NC6 A;  2G77 A;  2QFZ A;  1FKM A; 
#chains in the Genus database with same CATH topology
 2VQE M;  2Y20 A;  2CZ7 B;  1N75 A;  2E5L M;  2DVW B;  3J2P B;  4FW9 A;  4RKU F;  4ZPX A;  4IIW A;  3HZJ A;  4QNR A;  4JI7 M;  4LZZ A;  2MR9 A;  1QUT A;  3HHX A;  1IY0 A;  5ITT A;  1XXH E;  1SXJ C;  2CHV A;  2Z8Y M;  3SYK A;  1DGH B;  2DAE A;  4M9Z A;  3VDU A;  3GLG A;  4DV5 M;  1PJJ A;  2UUB M;  4LFB M;  1NNU C;  2OPF A;  2LHC A;  4GMQ A;  3RFW A;  3BG3 A;  3AJI B;  1VDL A;  1XHB A;  4IBJ A;  1G8P A;  2VF8 A;  1VEJ A;  3GQ3 A;  3DDP B;  3MY1 B;  4BCK B;  1L1T A;  1HT2 E;  1SG9 A;  2DHR A;  2V1U A;  4LRT A;  4JV5 M;  2X4A A;  3M03 A;  4YC3 B;  2EUC A;  1QDR A;  2JUJ A;  4IBG A;  1HNX M;  5BNJ B;  3TNH B;  1IXZ A;  3GLF E;  3TW6 A;  1NV8 A;  3L25 A;  3BHU B;  5HNB B;  1IRE B;  2H5X A;  4EOO B;  1GVN A;  1MU5 A;  3TWL A;  1L1Z A;  3KSX A;  2DD4 B;  2EUF A;  2UZD B;  3U6L A;  1TD6 A;  3IEC A;  2RGO A;  4ANR A;  3RGF B;  4KO8 A;  5ICP B;  4L6V 6;  4JI5 M;  1QZE A;  3ZH9 B;  3VKG A;  3WVD B;  2XGN A;  1KSF X;  3GRV A;  1JKW A;  4F7J B;  1OKV B;  4CFU B;  2HCB A;  5BR8 M;  4OB3 B;  5GKN A;  3K9O A;  1PJS A;  2LNH C;  1NNJ A;  2HL7 A;  2Z4R A;  4ELL A;  2LXE A;  1N78 A;  1H1Q B;  2ZZD B;  2UXC M;  1HQY E;  1Z5C A;  1HNW M;  3MK6 A;  4KOD A;  4AW4 A;  1XNQ M;  2XZF A;  5EFQ B;  1DGG A;  3VDP A;  5DFL A;  2NQ8 C;  4MGI E;  2CRU A;  1TDH A;  1G3I A;  1GUX B;  3QHR B;  4CFX B;  4KT0 F;  4ROE A;  2L4F A;  3A8L B;  3HKP A;  3KW6 A;  4MFE A;  3HB9 A;  2DXC B;  4WW0 A;  3GQ5 A;  3PNY A;  2FE8 A;  1SXJ B;  4QHT A;  1HJP A;  2V1C A;  3T15 A;  2IW8 B;  1Q3B A;  1C7Y A;  2R4J A;  1E9S A;  4NL4 H;  2J7O A;  1OL2 B;  1YE9 A;  3KOY E;  4JI0 M;  2F5S A;  4CFM B;  2R18 A;  3SAT A;  4QSH A;  1QAQ A;  2A5Y B;  2DZN B;  3M7G A;  3LVV A;  1AUA A;  4IBC A;  3HJQ A;  1UGS B;  3BLQ B;  4EOJ B;  7CAT A;  2O01 F;  1MJG M;  2HKJ A;  2UXD M;  2WHB B;  2CCI B;  1C1K A;  2L4E A;  1AIP C;  2VDB B;  1JR3 A;  3U6C A;  3SAV A;  3J7A S;  4BBS M;  3GQ4 A;  3B9P A;  4EC8 B;  2K0B X;  4CIS A;  5CEI B;  5C18 A;  2QEN A;  1IY2 A;  4BCQ B;  1Y8G A;  1VIN A;  1OIP A;  4FWD A;  3HWS A;  4G4R A;  3EOC B;  4W5W A;  3GP1 A;  3BOS A;  3CF0 A;  3E46 A;  2DZL A;  3PFI A;  1VDD A;  3KHI A;  2HHH M;  4FWH A;  3UGJ A;  3DL1 A;  2KZS A;  3GPU A;  3QYE A;  3SMS A;  1D3U B;  4NXM M;  4BCM D;  2KEB A;  2OOA A;  4IBK A;  3BG5 A;  3A8M B;  4BY7 X;  2WIH B;  1UNH D;  3W0F A;  2DME A;  2LVN C;  1J09 A;  1OAO C;  1IN4 A;  2EKF A;  8CAT A;  1OTR A;  4QOZ C;  4GIT A;  1NHW C;  3V76 A;  5KO3 A;  2R46 A;  3BXW A;  1H4L D;  1YSY A;  3C9P A;  4BY1 X;  3KP0 E;  2CHQ A;  1D2N A;  1VQ1 A;  4LFC M;  3QYG B;  1PJT A;  1WIV A;  4LGY A;  3TE6 A;  2OQ4 A;  4II5 B;  3VYH B;  3AOG A;  4Q7J A;  3SAW A;  2WIP B;  2QP9 X;  4IBE A;  3A98 B;  1TR8 A;  2L7I A;  1QZM A;  2APL A;  3GLH B;  4IBF A;  4OU7 A;  3SHG B;  4DV7 M;  4LF8 M;  3HU2 A;  3ILK A;  4F6W B;  4HNT A;  1I94 M;  1IN7 A;  3FUU A;  3WHL A;  3GTM S;  1NJF A;  2FS1 A;  4AKI A;  4NSR A;  2XSZ A;  5DYI A;  2QBY B;  4CIZ A;  1C9B A;  3QZ5 B;  4MGZ E;  3PNV A;  5EJC A;  3E4R A;  4GHA A;  3LQ5 B;  4REZ A;  2GNO A;  4DV6 M;  2HAK A;  3X24 B;  1T6O A;  4OGR B;  3I01 M;  4ZGJ B;  3AV0 A;  4KLN A;  2HWJ A;  4BB9 A;  4B7H A;  1G3N C;  4CFU D;  4B3S M;  4IBD A;  4TTH A;  3RGS A;  2CCH B;  4L16 A;  3CGW A;  4Y72 B;  3KDS E;  2UXB M;  4EIW A;  1UGR B;  3SYL A;  4MGH A;  4FCT A;  2K9D A;  1VYW B;  2KR6 A;  3GLH A;  3GPP A;  2PHG A;  3HO8 A;  1ORY B;  4JX5 A;  2F5Q A;  4EOI B;  4X65 M;  3FYD A;  4R3D A;  3R9X B;  2BS4 A;  2WSF F;  1AD6 A;  4CFW B;  4EOK B;  5HQ0 B;  3L29 A;  2ZAM A;  4NST B;  4EON B;  3KXE C;  3U6M A;  1TDZ A;  1IY1 A;  4M9X A;  1P5E B;  4LGM A;  1FNN A;  2KRU A;  1XNR M;  4MM3 B;  3DJB A;  1L2B A;  1W5S A;  4BCP B;  1W98 B;  3L2A A;  2F5P A;  5KPT A;  2CZ1 B;  1NO1 A;  1QAN A;  1R2Z A;  2WPA B;  1R7R A;  3HJS A;  1QAM A;  1IXR C;  2DHY A;  2DKL A;  1VEG A;  2QCU A;  4JI8 M;  3GLI E;  2JGZ B;  3FE3 A;  5EQT A;  1XB2 B;  2UUE B;  3KFU G;  3EIH A;  2ZPH B;  2JWS A;  2I7N A;  2JY7 A;  2JZ0 A;  4MH0 E;  2Y0Q A;  3QAU A;  4LJ5 A;  4G4O A;  1OAI A;  2UUA M;  3T1H M;  4EOS B;  4LJ4 A;  2CZ6 B;  1F5Q B;  1OIU B;  3FTE A;  1FKM A;  1FIN B;  1D0M A;  2WXV B;  4R71 A;  3EIE A;  3FUX A;  2R45 A;  4IJF A;  1BU2 A;  3AOE A;  5L2W B;  2JY5 A;  3SC3 A;  4ROC A;  2G9X B;  3GLF A;  3U6O A;  4AKH A;  2DWZ B;  3LMM A;  1O9K B;  2C4G B;  2R0I A;  3NBI A;  4L8R C;  2CHG A;  3LW5 F;  3AL0 C;  4I8O A;  4DV3 M;  2X8A A;  3DOA A;  2C5N B;  5EXS A;  5CYI B;  5LMK B;  5LQF B;  3U6P A;  2WMB B;  3J80 S;  2R65 A;  1N36 M;  1K3W A;  2UZL B;  1XXH B;  3FRI A;  3MMP A;  4X66 M;  4NOO B;  1QVR A;  1NJG A;  2X49 A;  1GKI A;  3SAS A;  2BJW A;  4CJ6 A;  1PRB A;  4LJ9 A;  1GH6 B;  2R62 A;  3CTW B;  1H24 B;  4DBG B;  5FGK B;  1AHJ B;  5JI3 E;  5L8R F;  4X64 M;  1IFY A;  2XH9 A;  4OX9 M;  4TUW A;  4CFN B;  3NBX X;  2DZO B;  4X62 M;  4AG5 A;  4DR2 M;  3U6Q A;  3BHT B;  4DUY M;  3CF2 A;  1IQP A;  3D8L A;  5DYG A;  3TWK A;  1WJ7 A;  2LVA A;  3GRU A;  2AHJ B;  2BKZ B;  2W9Z A;  5IDP B;  1XXH A;  3L27 A;  1QUS A;  4YOO A;  4EOQ B;  1ZAE A;  3A42 A;  1GAB A;  2KDL A;  2JNH A;  2RRU A;  4P17 A;  3GLF B;  1KXU A;  1O9K A;  4D82 A;  1TGU A;  1GJT A;  2EKK A;  4FCV A;  4GRI A;  3VK7 A;  1MN3 A;  1QLB A;  3HHW A;  4BCG B;  4D80 A;  1OJL A;  1QYR A;  2ZTD A;  4DV4 M;  1XO2 A;  4NRW A;  2ZCF B;  4UN0 A;  4KRC B;  4HL4 A;  5C1B A;  1TF0 B;  5ITR A;  1KFV A;  3KOX E;  4MGY E;  1OKW B;  5KQ8 A;  3H4M A;  2R44 A;  3U5Z B;  3MIA B;  3F92 A;  2Z4S A;  1G41 A;  4IJE A;  4PCZ A;  1Z59 A;  5IRE B;  4D81 A;  3U61 B;  5F3W A;  1UNL D;  2DWL A;  1WR1 B;  2L7H A;  1S3S A;  4L4U A;  2X1N B;  2QZ4 A;  4B3T M;  3IG5 A;  3WVE B;  4DR6 M;  3DOG B;  3FUW A;  2FH0 A;  4F2L A;  4PD2 A;  2LW4 A;  2XLJ A;  2DAM A;  4M0W A;  2W9F A;  2DXI A;  2XSZ D;  3DA1 A;  3EID B;  1WGN A;  2BNK A;  3TL4 X;  2XZU A;  2GQF A;  4GHL A;  4GKJ M;  3EJ1 B;  3NWL A;  3H4C A;  3QZ9 B;  5DQW A;  4L78 A;  3TW7 A;  4DR4 M;  2C98 A;  4YOS A;  4JI1 M;  3VKH A;  2DEN A;  3W67 A;  4LY6 A;  2KW0 A;  1P3Q Q;  3FTC A;  5ITX E;  2C6T B;  2LBC A;  4FVM A;  4KHP M;  2PJQ A;  2P5T A;  3LQR A;  2ZPF B;  1Z5B A;  1SXJ E;  1IBM M;  2BWE A;  1IN5 A;  4LJ6 A;  2KNV A;  4DV0 M;  1LV7 A;  2WSE F;  1GY3 B;  4EOM B;  2Z3X A;  3FUT A;  5FTJ A;  2QDJ A;  4LF7 M;  4FX3 B;  2DWM A;  1JSU B;  2EJS A;  2C99 A;  2YR0 A;  5ITU A;  1H1S B;  1JST B;  3HX3 A;  3W0L B;  3K1J A;  2L6O A;  4GC5 A;  1DO0 A;  1V92 A;  3K92 A;  4PT5 A;  2CJM B;  3K9P A;  3U6S A;  3FRH A;  4UN2 B;  1V34 A;  2R4E A;  3B7N A;  4XGI A;  4GEW A;  1J7K A;  3GPY A;  4DR3 M;  3GLG E;  3X20 B;  1CUK A;  4QOS A;  4I4L A;  3HBL A;  1OI9 B;  4EOL B;  1ENW A;  2CYZ B;  2LWX A;  3D8B A;  5LMU M;  4WUR A;  4PDG A;  1V29 B;  2DD5 B;  3MHV C;  2M5Z A;  3VLF B;  4JN6 A;  4IMY B;  2D7E A;  2B3T A;  4G6Z A;  4B08 A;  4HLQ A;  3PXG A;  4GIP A;  3SMP A;  1ZP2 A;  1HR0 M;  2B9R A;  3FTD A;  4YOZ A;  4BCM B;  4BCJ B;  3SHF A;  2R7G A;  3QYB A;  5EXT A;  4PDI A;  5FLX S;  4BCI B;  3PO3 S;  4AI6 A;  2F5N A;  3HHZ A;  3Q8X A;  1KYI A;  4B7F A;  2LVO C;  3E21 A;  3UK6 A;  1G71 A;  5IDN B;  5ACB A;  1XMO M;  3SAU A;  2WMA B;  4OB0 B;  3H4J A;  3GRR A;  2WJ9 A;  1UNG D;  1H6U A;  2XFT A;  3KS4 A;  3X25 B;  1H27 B;  3JAM S;  3JR4 A;  2CE7 A;  1GJS A;  2PK9 B;  5HBJ B;  3KOW E;  1OKS A;  1R5L A;  2UUC M;  3VFD A;  2IVX A;  2QDY B;  3TNW B;  4JI6 M;  1TH3 A;  2ZAN A;  3IG8 A;  2D7G A;  3G33 B;  1MX0 A;  1NV9 A;  1H28 B;  1PM5 A;  4LJ7 A;  4M9S A;  1OIY B;  3X28 B;  3VK8 A;  4CFV B;  5EP2 A;  4RF0 A;  5KQD A;  4WP2 A;  4JI3 M;  2JZ1 A;  1QMZ B;  2FOI C;  2KHH A;  3CF6 E;  1XC8 A;  4ZGE B;  2ZTC A;  3KS8 A;  3F5X B;  4BBA A;  1JR3 E;  3QWL A;  4M0D A;  3K7A M;  2WEV B;  2ERC A;  2M60 A;  3DFZ A;  2CFO A;  1IN8 A;  5EP3 A;  2KA6 B;  3KOZ E;  3MJ5 A;  3MY5 B;  4LJ8 A;  1QDT A;  2Z7J A;  4EOR B;  5H37 D;  2YFQ A;  5E26 A;  1R6B X;  4HEO A;  4DV1 M;  4LF6 M;  3A8G B;  1YUB A;  3SBJ A;  1WHC A;  1OFH A;  1EIJ A;  4I5S A;  2EA0 A;  3RE8 A;  2D7H A;  4YHH M;  2C5R A;  1K82 A;  1IBK M;  2UU9 M;  2WFY B;  3KVW A;  4LCB A;  2FNA A;  3TN8 B;  3O0G D;  1FVV B;  1E9H B;  3A46 A;  4FWG A;  2ZPI B;  4BCH B;  2YNM D;  2C5O B;  1XMQ M;  2W2H A;  2ZAO A;  4F7L B;  3I4V A;  4JX6 A;  2CV2 A;  2QBY A;  1SXJ A;  1WXQ A;  2DAK A;  3GRY A;  2ZM6 M;  3T1Y M;  2G77 A;  2LHG A;  1JR3 D;  2CV1 A;  1UM8 A;  4LG2 A;  2C5V B;  3THG A;  4G4Q A;  2MRO B;  4OW0 A;  4OVZ A;  2CV0 A;  1DV0 A;  1G59 A;  3HHY A;  2W82 A;  2VII A;  1NY6 A;  2QNJ A;  4R7G A;  2L2D A;  2CZ0 B;  2QGS A;  3BLH B;  4BCO B;  4BCN D;  5ITY A;  2KXE A;  2XEP A;  1IXS B;  2BJV A;  2C96 A;  2Y21 A;  5DNY A;  4DUZ M;  1K3X A;  4JI4 M;  3FTF A;  2PK2 A;  2W99 A;  3DTO A;  4NSO B;  3GLI B;  3LQQ A;  3QHW B;  3B89 A;  2I53 A;  2QPA A;  3C58 A;  4DR1 M;  3ZCB B;  2CP8 A;  4JXJ A;  1N34 M;  4JX4 A;  1BVS A;  2ZPB B;  1R4G A;  1GL7 A;  1IXS A;  2BWB A;  2MH8 A;  3AOE C;  4LF4 M;  5E6J A;  5IWA M;  4LRS A;  3J81 S;  2JY6 B;  2OOB A;  2V22 B;  1G4A E;  4RF1 A;  4DR5 M;  1E9R A;  1E32 A;  3WHK A;  2ZPE B;  2PMI B;  1PGY A;  2H1R A;  2C9O A;  3LCV B;  2LVQ D;  1NSF A;  2JP7 A;  2OO9 A;  3B7Z A;  4LJA A;  2JA2 A;  4MB7 A;  4Z6Y A;  4DR7 M;  3C3D A;  2JXN A;  4XBO A;  2J5Y A;  1NHG C;  1NY5 A;  1OFI A;  4NC6 A;  5FTN A;  3L26 A;  3T6P A;  3SFZ A;  2VQF M;  3BHV B;  2LTU A;  3I4Y A;  2BPM B;  2BS2 A;  4MGK E;  3HY5 A;  3T38 A;  4F70 B;  1TH2 A;  1TFB A;  1EE8 A;  4LZJ A;  3LVW A;  4Z8X A;  2ZPG B;  3U6D A;  1L2C A;  5EXX A;  2V6Z M;  2KRK A;  4AQY M;  4GH9 A;  4LFA M;  1JB0 F;  2AHM A;  3X26 B;  1JOW A;  3AFH A;  3PVS A;  2MJ5 B;  2N35 A;  1Q39 A;  2MGW A;  2K47 A;  3FD9 A;  1D0L A;  1T43 A;  1IM2 A;  3K8Z A;  3M6A A;  1H25 B;  4BXX X;  4CRL B;  2VF7 A;  3TWM A;  2JY8 A;  1JQJ C;  3NDQ A;  4OB1 B;  1N4M A;  1N33 M;  2IW6 B;  3HJ8 A;  4IBI A;  4S12 A;  1F4I A;  5FTK A;  3TPZ A;  2G8L A;  2F2C A;  2I40 B;  2QHO B;  1TH4 A;  4F7S B;  4QHS A;  4LF9 M;  4BLC A;  5FSW A;  4EC9 B;  1HQC A;  3QXE B;  1ZV1 A;  4GC9 A;  1EFU B;  1Q02 A;  1J5E M;  4CXA B;  2ZBK B;  3B7Q A;  3W68 A;  1L2D A;  1TTE A;  1GUX A;  3A8H B;  2J7N A;  3UJN A;  4F6S B;  4HNU A;  1ZQ9 A;  2G5G X;  2RGH A;  3J7B A;  4KRD B;  1ZMW A;  4CGY B;  3J27 B;  3BBZ A;  1YLA A;  2DAG A;  5HBE B;  2O5R A;  4G6L B;  4NXN M;  3LCU A;  1QAO A;  4JI2 M;  1RU3 A;  4BCQ D;  1AIS B;  2EO2 A;  1UGQ B;  1OIZ A;  2C9C A;  2DXB B;  4YY3 M;  1VG5 A;  1ZMV A;  1OL1 B;  2WZJ A;  4I3Z B;  4ZGD B;  2YQZ A;  2DNA A;  5KPZ A;  3GLI A;  4MFD A;  4F7N B;  2KNZ A;  5DQV A;  5IF1 B;  3TNI B;  3RGP A;  3HHT B;  4GKK M;  1X37 A;  2K6B A;  3HU3 A;  4B3M M;  3B74 A;  4II7 A;  3U60 B;  4B7G A;  5ITQ A;  5IZ7 D;  2W96 A;  3HGI A;  1VOL A;  2R6F A;  3KSJ A;  4FD2 A;  2KNA A;  4A3V B;  1DGB A;  3U6E A;  3DDQ B;  3VYG B;  4OVZ B;  4AG6 A;  4P16 A;  4AKG A;  1GO5 A;  1OGU B;  3POM A;  2BS3 A;  2XFS A;  4ITQ A;  2O25 A;  3FUV A;  4M6V A;  2CEA A;  4Y28 F;  2LVP C;  2XF3 A;  4G4N A;  3GLH E;  3UZU A;  3R8F A;  2KZU A;  3BLR B;  3A45 A;  3FKE A;  2IW9 B;  1Z6T A;  3E9S A;  3AKZ A;  4BCN B;  5FTM A;  5KPR A;  1E7P A;  3DZD A;  1D0K A;  3HU1 A;  2CUZ A;  5EXP A;  2LH0 A;  4OB2 B;  1DGF A;  5BPV A;  1Q3C A;  1LTM A;  2KMG A;  5EP1 A;  1H1P B;  1DGH A;  2WSC F;  4NRV A;  3GLG B;  1UGP B;  2QFZ A;  1H1R B;  3C3E A;  4G3O A;  2C5X B;  3TQS A;  3GO8 A;  4BCF B;  1XWI A;  2I7P A;  1PJI A;  1T3T A;  4CHT B;  1GLN A;  3K2L A;  3A8O B;  3ZC7 B;  5IHY A;  2G3Q A;  4ELJ A;  1UFZ A;  4F6U B;  1I4W A;  1HT1 E;  3JR5 A;  5IT9 S;  4JYA M;  1URC B;  4OR5 B;  4HNV A;  4AZF A;  3U60 A;  4FM4 B;  4I81 A;  3SAR A;  2D0Q B;  4QNM A;  1ZMU A;  4BBR M;  5A2Q S;  4ROD A;  3QYH B;  2Y0T A;  2QQ8 A;  2RKO A;  3M0E A;  3MI9 B;  5I5Z B;  1L8Q A;  1SXJ D;  4IBB A;  1PJQ A;  5ITX A;  1N32 M;  3BG9 A;  2F5O A;  3I51 A;  3Q8G A;  4FCW A;  5LMN M;  3B57 A;  4MIM A;  3I04 M;  5HVY B;  1IBL M;  2F4V M;  2CWB A;  1R2Y A;  1DO2 A;  1FJG M;  1N77 A;  3U61 A;  2UZB B;  3IHP A;  1GL6 A;  1QQW A;  5FTL A;  2QF7 A;  1PKD B;  3U5Z A;  2Q2E B;  4K0K M;  2DAI A;  2FFJ A;  1W5T A;  2DI0 A;  2L09 A;  1HNZ M;  1VEK A;  4LOC A;  4F1I A;  5EP4 A;  1E94 E;  1NVM A;  3FYC A;  4RNA A;  1WGL A;  3L28 A;  3UMM A;  3OTO M;  4LF5 M;  2UZE B;  4DV2 M;  1H26 B;  1V33 A;  1Z5A A;  2QSF X;  3ZQJ A;  5JI2 E;  2DPP B;  4XK8 F;  1OQY A;  5HBH B;  3KP1 E;  4B3R M;  1IN6 A;  2DWN A;  2IN3 A;  1A5T A;  4L15 A;  3GPX A;  4EOP B; 
#chains in the Genus database with same CATH homology
 2VQE M;  2Y20 A;  2CZ7 B;  1N75 A;  2E5L M;  2DVW B;  3J2P B;  4FW9 A;  4ZPX A;  4IIW A;  4QNR A;  4JI7 M;  3HZJ A;  4LZZ A;  3HHX A;  1IY0 A;  5ITT A;  1SXJ C;  2CHV A;  3SYK A;  3VDU A;  1DGH B;  4M9Z A;  3GLG A;  4DV5 M;  1PJJ A;  2UUB M;  3A8G B;  4LFB M;  1NNU C;  2OPF A;  3BG3 A;  4GMQ A;  3RFW A;  3AJI B;  1XHB A;  4IBJ A;  3GQ3 A;  1G8P A;  1L1T A;  1HT2 E;  2DHR A;  2V1U A;  4JV5 M;  4LRT A;  2X4A A;  2EUC A;  1HNX M;  4IBG A;  1IXZ A;  3TW6 A;  3L25 A;  1IRE B;  4HNT A;  1GVN A;  1MU5 A;  3TWL A;  1L1Z A;  3KSX A;  2DD4 B;  3U6L A;  2RGO A;  4KO8 A;  4JI5 M;  3ZH9 B;  3VKG A;  3WVD B;  2XGN A;  1KSF X;  3GRV A;  2HCB A;  5BR8 M;  4OB3 B;  5GKN A;  2LNH C;  1NNJ A;  2HL7 A;  2Z4R A;  2LXE A;  1N78 A;  2ZZD B;  2UXC M;  1HQY E;  1Z5C A;  1HNW M;  3MK6 A;  4KOD A;  4AW4 A;  1XNQ M;  2XZF A;  1DGG A;  3VDP A;  2NQ8 C;  4MGI E;  1TDH A;  1G3I A;  3A8L B;  3HKP A;  3KW6 A;  4MFE A;  3HB9 A;  2DXC B;  4WW0 A;  3GQ5 A;  3PNY A;  2FE8 A;  1SXJ B;  4QHT A;  2V1C A;  3T15 A;  1Q3B A;  2R4J A;  1E9S A;  4NL4 H;  2J7O A;  1YE9 A;  3KOY E;  4JI0 M;  2F5S A;  2R18 A;  3SAT A;  4QSH A;  1QAQ A;  2A5Y B;  2DZN B;  3M7G A;  3LVV A;  4IBC A;  3HJQ A;  1UGS B;  7CAT A;  2HKJ A;  2UXD M;  1C1K A;  4BBS M;  3U6C A;  3J7A S;  1JR3 A;  3SAV A;  3GQ4 A;  3B9P A;  4CIS A;  5C18 A;  2QEN A;  1IY2 A;  4FWD A;  4G4R A;  3HWS A;  4W5W A;  3GP1 A;  3BOS A;  3CF0 A;  3PFI A;  1VDD A;  3KHI A;  2HHH M;  4FWH A;  3UGJ A;  3DL1 A;  2KZS A;  3GPU A;  3QYE A;  3SMS A;  2KEB A;  4IBK A;  3BG5 A;  3A8M B;  3W0F A;  1J09 A;  4QOZ C;  1IN4 A;  8CAT A;  4GIT A;  1NHW C;  5KO3 A;  2R46 A;  1YSY A;  3KP0 E;  2CHQ A;  1D2N A;  4LFC M;  3QYG B;  3TE6 A;  4LGY A;  2OQ4 A;  3VYH B;  3AOG A;  3SAW A;  2QP9 X;  4IBE A;  3A98 B;  2L7I A;  3GLH B;  1QZM A;  4OU7 A;  4DV7 M;  4IBF A;  3SHG B;  4LF8 M;  3HU2 A;  3ILK A;  1I94 M;  1IN7 A;  3FUU A;  3WHL A;  1NJF A;  4AKI A;  4NSR A;  2XSZ A;  5DYI A;  2QBY B;  3QZ5 B;  4MGZ E;  3PNV A;  5EJC A;  3E4R A;  4GHA A;  4REZ A;  4DV6 M;  3X24 B;  4ZGJ B;  3AV0 A;  4KLN A;  4BB9 A;  4B7H A;  4B3S M;  4IBD A;  3RGS A;  4L16 A;  3KDS E;  2UXB M;  4EIW A;  1UGR B;  3SYL A;  4MGH A;  4FCT A;  3HO8 A;  2KR6 A;  3GLH A;  3GPP A;  1ORY B;  4JX5 A;  2F5Q A;  4X65 M;  3FYD A;  4R3D A;  3R9X B;  2BS4 A;  3L29 A;  2ZAM A;  3KXE C;  3U6M A;  1TDZ A;  1IY1 A;  4M9X A;  4LGM A;  1FNN A;  2KRU A;  1XNR M;  4MM3 B;  1L2B A;  1W5S A;  3L2A A;  2F5P A;  5KPT A;  2CZ1 B;  1QAN A;  1R2Z A;  1R7R A;  3HJS A;  1QAM A;  1IXR C;  4JI8 M;  2QCU A;  5EQT A;  3KFU G;  3EIH A;  2ZPH B;  2I7N A;  4MH0 E;  2Y0Q A;  3QAU A;  4LJ5 A;  4G4O A;  2UUA M;  3T1H M;  4LJ4 A;  2CZ6 B;  3FTE A;  1FKM A;  3EIE A;  3FUX A;  2R45 A;  4IJF A;  3AOE A;  3SC3 A;  3GLF A;  3U6O A;  4AKH A;  2DWZ B;  3LMM A;  3NBI A;  4L8R C;  2CHG A;  3AL0 C;  4I8O A;  4DV3 M;  2X8A A;  3DOA A;  5EXS A;  3U6P A;  3J80 S;  2R65 A;  1N36 M;  1K3W A;  1XXH B;  4X66 M;  4NOO B;  1QVR A;  1NJG A;  2X49 A;  1GKI A;  3SAS A;  2BJW A;  4LJ9 A;  2R62 A;  3CTW B;  1AHJ B;  5JI3 E;  4X64 M;  2XH9 A;  4OX9 M;  4TUW A;  3U6Q A;  2DZO B;  4X62 M;  4AG5 A;  4DR2 M;  4DUY M;  3CF2 A;  1IQP A;  3D8L A;  5DYG A;  3TWK A;  2AHJ B;  3GRU A;  1XXH A;  3L27 A;  1ZAE A;  3A42 A;  3GLF B;  4D82 A;  1TGU A;  4FCV A;  4GRI A;  3VK7 A;  1QLB A;  3HHW A;  4D80 A;  1OJL A;  1QYR A;  4DV4 M;  4NRW A;  2ZCF B;  4HL4 A;  5C1B A;  5ITR A;  1KFV A;  3KOX E;  4MGY E;  5KQ8 A;  3H4M A;  3U5Z B;  2Z4S A;  1G41 A;  4IJE A;  4PCZ A;  1Z59 A;  5IRE B;  4D81 A;  3U61 B;  5F3W A;  2DWL A;  2L7H A;  1S3S A;  4L4U A;  3WVE B;  2QZ4 A;  4B3T M;  3IG5 A;  4DR6 M;  3FUW A;  4PD2 A;  2XLJ A;  4M0W A;  2DXI A;  2XSZ D;  3DA1 A;  2BNK A;  3TL4 X;  4GKJ M;  2XZU A;  3H4C A;  4GHL A;  3QZ9 B;  3NWL A;  4L78 A;  3TW7 A;  4DR4 M;  2C98 A;  4JI1 M;  3VKH A;  4LY6 A;  2KW0 A;  3FTC A;  5ITX E;  4FVM A;  4KHP M;  2P5T A;  3LQR A;  2ZPF B;  1Z5B A;  1SXJ E;  1IBM M;  4LJ6 A;  1IN5 A;  4DV0 M;  1LV7 A;  2Z3X A;  3FUT A;  5FTJ A;  2QDJ A;  4LF7 M;  2DWM A;  2C99 A;  2YR0 A;  5ITU A;  3W0L B;  3K1J A;  2L6O A;  4GC5 A;  1DO0 A;  3K92 A;  4PT5 A;  3U6S A;  2R4E A;  3GPY A;  4XGI A;  1J7K A;  4DR3 M;  3X20 B;  4QOS A;  4I4L A;  3HBL A;  2CYZ B;  2LWX A;  3D8B A;  5LMU M;  4WUR A;  4PDG A;  1V29 B;  2DD5 B;  3MHV C;  2M5Z A;  3VLF B;  4JN6 A;  2D7E A;  4G6Z A;  4B08 A;  4HLQ A;  3PXG A;  4GIP A;  3SMP A;  1HR0 M;  3FTD A;  3SHF A;  3QYB A;  5EXT A;  4PDI A;  5FLX S;  4AI6 A;  2F5N A;  3HHZ A;  3Q8X A;  1KYI A;  4B7F A;  3UK6 A;  1XMO M;  3SAU A;  4OB0 B;  3GRR A;  2WJ9 A;  1H6U A;  2XFT A;  3KS4 A;  3X25 B;  3JAM S;  3JR4 A;  2CE7 A;  3KOW E;  2UUC M;  3VFD A;  2QDY B;  4JI6 M;  1TH3 A;  2ZAN A;  3IG8 A;  2D7G A;  1MX0 A;  1PM5 A;  4LJ7 A;  4M9S A;  3X28 B;  3VK8 A;  5EP2 A;  4RF0 A;  5KQD A;  4JI3 M;  2FOI C;  3CF6 E;  1XC8 A;  4ZGE B;  3KS8 A;  4BBA A;  3QWL A;  4M0D A;  2ERC A;  2M60 A;  3DFZ A;  2CFO A;  1IN8 A;  5EP3 A;  2KA6 B;  3KOZ E;  3MJ5 A;  4LJ8 A;  2Z7J A;  5H37 D;  2YFQ A;  5E26 A;  1R6B X;  4DV1 M;  4LF6 M;  1YUB A;  3SBJ A;  1OFH A;  4I5S A;  2EA0 A;  3RE8 A;  2D7H A;  4YHH M;  2C5R A;  1K82 A;  1IBK M;  2UU9 M;  3KVW A;  4LCB A;  2FNA A;  2ZPI B;  3A46 A;  4FWG A;  2YNM D;  1XMQ M;  2ZAO A;  3I4V A;  4JX6 A;  2CV2 A;  2QBY A;  1SXJ A;  1WXQ A;  3GRY A;  2ZM6 M;  3T1Y M;  2G77 A;  1JR3 D;  2CV1 A;  1UM8 A;  4LG2 A;  3THG A;  4G4Q A;  4OW0 A;  4OVZ A;  2CV0 A;  1G59 A;  3HHY A;  2W82 A;  2VII A;  1NY6 A;  4R7G A;  2CZ0 B;  5ITY A;  2KXE A;  2XEP A;  1IXS B;  2BJV A;  2C96 A;  2Y21 A;  5DNY A;  4DUZ M;  1K3X A;  4JI4 M;  3FTF A;  4NSO B;  3GLI B;  3LQQ A;  2QPA A;  3C58 A;  4DR1 M;  3ZCB B;  4JXJ A;  1N34 M;  4JX4 A;  2ZPB B;  3AOE C;  1GL7 A;  4LF4 M;  5E6J A;  5IWA M;  4LRS A;  3J81 S;  1G4A E;  4RF1 A;  4DR5 M;  1E9R A;  1E32 A;  3WHK A;  2ZPE B;  2H1R A;  2C9O A;  1NSF A;  4LJA A;  4MB7 A;  2JA2 A;  4Z6Y A;  4DR7 M;  4XBO A;  3L26 A;  1NHG C;  1NY5 A;  5FTN A;  1OFI A;  2VQF M;  4NC6 A;  3SFZ A;  3I4Y A;  2BS2 A;  4MGK E;  3T38 A;  1TH2 A;  1EE8 A;  4LZJ A;  3LVW A;  4Z8X A;  2ZPG B;  3U6D A;  1L2C A;  5EXX A;  2V6Z M;  2KRK A;  4AQY M;  4GH9 A;  4LFA M;  3X26 B;  2AHM A;  3AFH A;  3PVS A;  1Q39 A;  3FD9 A;  2K47 A;  3K8Z A;  3M6A A;  1IM2 A;  3TWM A;  1JQJ C;  4OB1 B;  1N33 M;  3HJ8 A;  4IBI A;  4S12 A;  5FTK A;  3TPZ A;  2G8L A;  1TH4 A;  4QHS A;  4LF9 M;  4BLC A;  5FSW A;  1HQC A;  3QXE B;  4GC9 A;  1J5E M;  2ZBK B;  1L2D A;  3A8H B;  4HNU A;  2J7N A;  3UJN A;  1ZQ9 A;  2G5G X;  2RGH A;  3J7B A;  4CGY B;  3J27 B;  2O5R A;  4NXN M;  4JI2 M;  1QAO A;  2EO2 A;  1UGQ B;  2C9C A;  2DXB B;  4YY3 M;  4ZGD B;  2YQZ A;  4MFD A;  5KPZ A;  3GLI A;  3RGP A;  4GKK M;  1X37 A;  3HU3 A;  4B3M M;  4II7 A;  3U60 B;  4B7G A;  5ITQ A;  5IZ7 D;  3HGI A;  3KSJ A;  4FD2 A;  4A3V B;  3U6E A;  1DGB A;  3VYG B;  4OVZ B;  4AG6 A;  4P16 A;  4AKG A;  2BS3 A;  2XFS A;  4ITQ A;  3FUV A;  4M6V A;  2CEA A;  2XF3 A;  4G4N A;  3UZU A;  3R8F A;  2KZU A;  3A45 A;  3FKE A;  1Z6T A;  3E9S A;  3AKZ A;  5FTM A;  5KPR A;  1E7P A;  3DZD A;  3HU1 A;  2CUZ A;  5EXP A;  2LH0 A;  4OB2 B;  1DGF A;  5BPV A;  1Q3C A;  2KMG A;  5EP1 A;  1DGH A;  4NRV A;  3GLG B;  1UGP B;  2QFZ A;  3TQS A;  3GO8 A;  1XWI A;  2I7P A;  1PJI A;  1T3T A;  4CHT B;  1GLN A;  3K2L A;  3A8O B;  3ZC7 B;  4ELJ A;  1I4W A;  1HT1 E;  3JR5 A;  5IT9 S;  4JYA M;  4HNV A;  4AZF A;  3U60 A;  4FM4 B;  4I81 A;  3SAR A;  2D0Q B;  4QNM A;  4BBR M;  5A2Q S;  3QYH B;  2Y0T A;  3M0E A;  2RKO A;  2QQ8 A;  1L8Q A;  1SXJ D;  4IBB A;  5ITX A;  1N32 M;  3BG9 A;  2F5O A;  3I51 A;  4FCW A;  4MIM A;  5LMN M;  1IBL M;  2F4V M;  1R2Y A;  1DO2 A;  1FJG M;  1N77 A;  3U61 A;  1GL6 A;  1QQW A;  5FTL A;  2QF7 A;  3U5Z A;  2Q2E B;  4K0K M;  2FFJ A;  1W5T A;  2L09 A;  1HNZ M;  4LOC A;  5EP4 A;  1E94 E;  1NVM A;  3FYC A;  4RNA A;  3L28 A;  3UMM A;  3OTO M;  4LF5 M;  4DV2 M;  1Z5A A;  5JI2 E;  2DPP B;  3KP1 E;  4B3R M;  1IN6 A;  2DWN A;  3HHT B;  4NXM M;  4L15 A;  3GPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...