4HL4A

Crystal structure of the human tbc1d20 rabgap domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hl4A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hl4A02
2QFZA 3QYEA 4HL4A 4Z6YA 2G77A 4HLQA 3HZJA 1FKMA 2QQ8A 3QYBA 4NC6A 5EJCA 3QWLA
chains in the Genus database with same CATH superfamily
1JB0F 1OI9B 4GH9A 3LQQA 3NDQA 3C3EA 1QZMA 1WHCA 3ZH9B 2C5NB 2PJQA 3MJ5A 3K7AM 4OVZA 2ZZDB 1IBKM 3J2PB 1GABA 3VYHB 3HZJA 1NNJA 4L4UA 2WPAB 4ITQA 3X24B 3A98B 5ICPB 3GLHA 3WHKA 4FCVA 4EOMB 2QZ4A 2C9OA 2ZTCA 4BXXX 5H37D 5JI3E 2IN3A 3SC3A 1EE8A 1QDRA 1IN7A 1DO0A 4IBEA 1G8PA 3J7AS 2W9FA 4LF6M 3I04M 1UGQB 3QWLA 3FRHA 4LGMA 2R18A 3DL1A 4P16A 4BB9A 2LVAA 3BG5A 3HU3A 3HHZA 4BCJB 3QXEB 1LTMA 3TW6A 5C18A 1DGHA 1SXJD 3M0EA 2DD4B 3DDPB 3MHVC 2RGHA 3HHTB 2Y0QA 4CISA 1GL6A 4MM3B 1UNHD 1OFIA 2I7NA 4GKKM 4L8RC 2CHVA 2DHYA 3A8HB 4LZZA 2JZ1A 2WFYB 3HJ8A 3TNWB 3FUTA 2G8LA 1TGUA 4DR4M 3DJBA 3DDQB 2PMIB 4GITA 2EKKA 4M0DA 4ZGDB 3LCUA 3TE6A 3O0GD 4CFNB 2W82A 3CF2A 1JSUB 4HL4A 5IDPB 2RKOA 5KPZA 1AHJB 5A2QS 2HCBA 1FJGM 3X28B 2ZPIB 1OIZA 1UNLD 1V33A 3K1JA 1T3TA 1Z5CA 3GLIA 1TF0B 4JYAM 2BS2A 2RRUA 1TH4A 2DWMA 4MH0E 1MJGM 1IY1A 1YSYA 1GJTA 1E9RA 3TPZA 1C9BA 4OGRB 4WW0A 4YY3M 2EA0A 3U6MA 4CFMB 4HLQA 1XMQM 1TTEA 2HHHM 1H26B 4R71A 4AI6A 2LXEA 1DGBA 1NHGC 4G6ZA 3LQ5B 3SAWA 3FUXA 3FUVA 1PJQA 2OOBA 1PKDB 4XGIA 1N34M 3R9XB 1SXJE 3BHVB 4OB2B 2VQEM 1UM8A 3U6QA 4F7NB 4DR1M 1X37A 2WZJA 4DR5M 5ITQA 3D8LA 2C96A 3A45A 4EOOB 1JR3D 1OKVB 4L78A 4CRLB 2DAIA 4IBBA 1H24B 4QOZC 1GY3B 3QHWB 1G3IA 3DA1A 1QAQA 3GP1A 1D0LA 2QDYB 4B7HA 2K47A 3B74A 2UXCM 4NSTB 4BCPB 4KO8A 2BJVA 1GUXB 3SHGB 1AD6A 4F7LB 3GRVA 5CYIB 1S3SA 1H25B 2BKZB 2JUJA 3KS4A 3SYKA 5HBJB 4A3VB 3PO3S 2C5VB 2DAGA 2DNAA 1TFBA 5ITXA 1OKSA 4D81A 4EOQB 5EP4A 1GO5A 4L16A 2CEAA 2LHCA 4EOLB 2LW4A 4K0KM 2WEVB 1Q3BA 4F6UB 2QPAA 1AISB 2DPPB 2R4JA 3DZDA 4X65M 2WSCF 4MGIE 3DTOA 5L8RF 3WVEB 3KSXA 2LHGA 2L2DA 3HB9A 1W98B 2R4EA 1TDZA 2D7HA 1D3UB 4GC9A 4DUZM 4ELJA 2L6OA 1JR3E 1JQJC 3RGPA 1Y8GA 1Z5BA 5IT9S 1VEJA 1R4GA 2FH0A 2DVWB 4GC5A 2DZNB 5JI2E 2F4VM 4JI3M 2CZ7B 1C1KA 4F6SB 1NHWC 4NRWA 1QYRA 3GLHB 1FVVB 1D0KA 2JGZB 1H1SB 2HAKA 1XNRM 1BU2A 4DR7M 3EIEA 1MU5A 1UGPB 4HNVA 2CHGA 2DMEA 3HKPA 1NJGA 2LNHC 3HWSA 3VDPA 4AKGA 2R44A 1A5TA 1IXZA 1OFHA 2XFSA 3H4MA 4MGHA 1IY0A 3FYCA 4CXAB 2Z3XA 2BS3A 1G3NC 1H1QB 1FNNA 4ELLA 4X64M 4Z8XA 4LRTA 1HJPA 4OB0B 3LW5F 3UZUA 1FINB 4NXNM 2H5XA 4F7JB 3NBXX 3BG3A 3QAUA 1R5LA 1G41A 4LF9M 4IBFA 4B3RM 4B08A 3VK7A 3T38A 2UZLB 1ENWA 2JY5A 2L4EA 1PGYA 2Y0TA 1KXUA 4RF1A 4KHPM 1TD6A 3AOGA 2UZDB 3GQ4A 4M9SA 4Y28F 1QUTA 1T43A 3HX3A 1BVSA 3U6EA 2JY7A 3KHIA 3SAVA 2A5YB 4KT0F 5BPVA 2ZBKB 3HBLA 1N4MA 3OTOM 1N78A 4M0WA 4PD2A 4ZGJB 4M9ZA 3AJIB 3B7ZA 3GLIB 2JA2A 1H27B 2O01F 3EJ1B 4DV2M 5BNJB 3GPXA 2Z4RA 4DV1M 1XXHB 5ITUA 2XF3A 3U6OA 4OB3B 4JI4M 4BCOB 4TUWA 3K92A 2F5NA 1F5QB 2H1RA 1OAIA 2D7GA 3FYDA 2KR6A 2FFJA 1G4AE 2F5SA 3SARA 4MGYE 2V22B 2GQFA 4W5WA 4IBDA 3W0FA 2DZOB 4QOSA 5EJCA 1DGFA 3AV0A 3M6AA 4F1IA 4I4LA 3U5ZB 2XLJA 4CHTB 4XBOA 2WJ9A 4GMQA 3K9OA 1VEKA 2W96A 1IN8A 2DKLA 2CV1A 2KDLA 2KW0A 4IBJA 1AUAA 4EOPB 4MIMA 2XFTA 4I3ZB 4MFEA 2VF7A 5E26A 2G77A 2Z7JA 2UUBM 4AG5A 4EONB 4EIWA 3E9SA 2QNJA 4FCTA 3VDUA 4BCNB 3KXEC 2ZPGB 2J7OA 3Q8XA 1V29B 3GPUA 2IW6B 5HVYB 4ZGEB 1VDLA 3VYGB 4F6WB 4JXJA 2KHHA 1Q02A 5GKNA 4YOOA 1O9KA 1HNXM 2ZPEB 1ORYB 3L29A 3E4RA 3FTDA 2KA6B 4QHTA 4RF0A 2UZEB 4NC6A 8CATA 1TR8A 1YE9A 4DR2M 3T15A 3WHLA 3T1YM 4JX6A 2G5GX 4CFXB 1EIJA 2KEBA 3FTFA 3PNVA 1AIPC 1GL7A 1LV7A 1PRBA 4HEOA 3FTCA 2CFOA 1PM5A 2DXCB 4OX9M 2AHJB 1NO1A 4JX4A 3Q8GA 4M9XA 3VK8A 2QBYA 5DQVA 3K9PA 4BY7X 1QANA 3DOAA 4D80A 3ZQJA 5KPTA 3I4VA 3QYEA 2C5XB 4DBGB 5HNBB 3T6PA 4PCZA 2JZ0A 1N32M 1TDHA 2WIPB 5EQTA 1E94E 1L2DA 2C98A 4LF5M 2WSEF 3R8FA 3KOWE 5EP2A 3UMMA 4BBSM 1SXJA 2EO2A 1TH3A 2V6ZM 4M6VA 1VINA 2DZLA 4MGZE 5ITRA 3W68A 2PK9B 5BR8M 3GLFB 4IBGA 2CV0A 2ZTDA 2MJ5B 2XEPA 2O5RA 4G3OA 1QQWA 3BHUB 5FLXS 3SASA 3RGFB 4LJ8A 5EXXA 1FKMA 4P17A 4GKJM 2EUFA 3U61B 3VKGA 2XZFA 3CF0A 2CP8A 3PNYA 5LMKB 4IBCA 3TWMA 3IG5A 4TTHA 2UU9M 4AW4A 4AKIA 2W9ZA 3PVSA 2DAKA 2UUCM 4CFUB 4BCND 2CZ6B 1W5TA 1XB2B 1UGSB 2MGWA 1E9HB 4DV4M 4MGKE 3HU1A 3AL0C 5ITYA 3GQ3A 4F7SB 2CCIB 2UUEB 2R46A 2UXDM 2K6BA 2JWSA 1OIUB 1H6UA 4IMYB 4NSOB 4II5B 1OIYB 1XXHE 3GRYA 2CRUA 3UJNA 4BCKB 1GH6B 3TWLA 4LG2A 2RGOA 3I4YA 3QZ9B 1Z5AA 3L2AA 4UN2B 4G4RA 2KRKA 4QNMA 3SHFA 3SAUA 2G9XB 4DV0M 3SYLA 1Q39A 3F92A 4FWHA 1NJFA 1OL2B 4FD2A 4QNRA 3BOSA 4AQYM 1OKWB 3MK6A 4IBIA 2R62A 4QSHA 2FOIC 2ZAMA 1N33M 4LY6A 3FUWA 5DNYA 2HL7A 3BHTB 4GEWA 3GLGB 2CHQA 4YOZA 2K0BX 1JR3A 4DR3M 2L7HA 1WIVA 1IBMM 1DV0A 2Y20A 5EXPA 2OOAA 2EUCA 3HHWA 2AHMA 4B3SM 3SFZA 4GIPA 3THGA 4X62M 1H1PB 3RFWA 1H28B 2X8AA 1OL1B 4BCGB 4CIZA 2YNMD 1QZEA 1ZQ9A 2HWJA 4DV7M 1KFVA 3IHPA 5F3WA 3CGWA 4AKHA 1OAOC 2L7IA 5FTNA 5C1BA 3K2LA 1IXSA 4CFUD 2J5YA 3KFUG 2Y21A 3E21A 1JOWA 4OVZB 2WMBB 2ZPHB 4OR5B 3L27A 1WR1B 3A8LB 3X20B 3CF6E 1JSTB 3KVWA 3AKZA 2R6FA 2DWLA 2OQ4A 3KDSE 2EKFA 4AG6A 2VQFM 2ERCA 3FRIA 5KQ8A 4CFVB 2ZANA 3JAMS 4AZFA 2KNZA 1HQYE 1R6BX 2KZUA 3HHXA 2QP9X 2XZUA 3A46A 3TL4X 3L28A 4RNAA 3WVDB 5IREB 3ILKA 4MB7A 2LH0A 2IW9B 4CJ6A 1DGHB 1O9KB 2WXVB 2JNHA 3V76A 2CZ1B 4Y72B 1XWIA 2BWBA 3GLFE 4WP2A 2K9DA 2X49A 3NWLA 5IDNB 1OTRA 3HGIA 2KRUA 2CE7A 3GQ5A 2ZPFB 2LWXA 3B7NA 2XSZA 4ROEA 4LJ7A 1I4WA 1QVRA 2HKJA 2MR9A 2ZPBB 2DHRA 4Z6YA 4HNUA 3POMA 4DV6M 1URCB 1IFYA 1IQPA 1E9SA 2LVQD 1F4IA 4LCBA 2KNVA 2LVPC 3JR4A 3QZ5B 5FTMA 2B3TA 3VLFB 2DAMA 3RGSA 2DXIA 1VYWB 2PK2A 4WURA 4LF4M 1PJJA 4FWDA 2X4AA 2F5OA 2N35A 1PJTA 1R2YA 1VEGA 4BCHB 2W99A 4B7GA 1J09A 3MMPA 4JI7M 1R7RA 1KYIA 4KRCB 2R65A 4X66M 3BBZA 3ZC7B 4LFAM 4LJAA 5HQ0B 4GHLA 1JKWA 1HT2E 4G4QA 1ZMWA 2CWBA 3W0LB 3J80S 1MX0A 1V34A 5KPRA 4G6LB 4BCMB 3BLRB 3PXGA 1XO2A 2LVOC 5EP3A 3LQRA 1SG9A 4F2LA 1UFZA 2D7EA 4LGYA 4PDGA 2DWNA 2Z8YM 3IG8A 1PJIA 2BNKA 1L8QA 3GLGE 3TNIB 5HBHB 3MY1B 2BS4A 4BCFB 1IBLM 2I7PA 2C9CA 3AOEC 3KW6A 1IREB 5IZ7D 5LMNM 2KNAA 4KODA 4GRIA 3K8ZA 3GO8A 4S12A 1GJSA 2ZCFB 1NV8A 4G4NA 1PJSA 1HQCA 3FKEA 3EIDB 2WHBB 3TN8B 3PFIA 4D82A 3BLHB 3U6SA 3C58A 1YUBA 1ZV1A 2VDBB 1Z6TA 5EFQB 4NSRA 4LOCA 1IN4A 3FTEA 3HJSA 1NNUC 2JY8A 2W2HA 1HNWM 4EOIB 1MN3A 4EC8B 3FUUA 5IWAM 1K82A 2C99A 3GLHE 1T6OA 2PHGA 2FE8A 2UZBB 4LF7M 4JI5M 3KP1E 2JP7A 2BWEA 4I81A 2C5OB 3C3DA 1NY5A 5IF1B 1WJ7A 5DFLA 5I5ZB 1I94M 1GVNA 4NRVA 3J7BA 2CUZA 1OIPA 5DYIA 4FVMA 1D2NA 5FTLA 2QDJA 4BCMD 1ZAEA 4B3MM 1DGGA 3TNHB 1OGUB 1IXSB 1XNQM 2E5LM 5FSWA 2OPFA 4IJFA 2V1UA 4L15A 1G59A 4BCQB 5L2WB 1L2CA 3SATA 4DUYM 4PT5A 4FX3B 3LMMA 1VDDA 4LF8M 1HT1E 2LBCA 1UGRB 5FTJA 4LFCM 4Q7JA 5EXSA 2QENA 1ZMUA 3U60A 1C7YA 3L26A 1WGLA 3DFZA 1CUKA 1YLAA 4JI0M 2DI0A 4JI6M 5LQFB 3GTMS 3VFDA 2OO9A 5IHYA 1IXRC 3KP0E 4OW0A 1XXHA 2VF8A 4IIWA 5LMUM 2BJWA 2DENA 3HJQA 3JR5A 4BCIB 3M03A 1E32A 2B9RA 4F70B 3B9PA 1SXJC 4BY1X 4L6V6 4MFDA 2MH8A 4IBKA 1K3XA 1QUSA 3NBIA 1N36M 1KSFX 4JV5M 2IVXA 2DXBB 1NVMA 2X1NB 2ZM6M 3H4CA 4FCWA 1IM2A 4B3TM 3GLIE 2APLA 4DV3M 2WMAB 2J7NA 3UK6A 4BLCA 4ROCA 2CJMB 2I40B 3ZCBB 3A42A 3U5ZA 2FS1A 5EXTA 4RKUF 4EOKB 1QMZB 1NV9A 2QF7A 1V92A 2QHOB 1L2BA 4LJ6A 3QYGB 2GNOA 3MY5B 1G71A 2CV2A 1Z59A 4XK8F 3SMSA 1OJLA 4G4OA 1P5EB 3LVWA 2WIHB 5FGKB 4PDIA 2O25A 2QSFX 3J81S 3KOZE 2F5QA 2MROB 3GRUA 3HU2A 1IN6A 2L4FA 4EOSB 2R45A 3T1HM 5DQWA 2G3QA 4R7GA 1L1TA 2IW8B 3W67A 3I01M 2D0QB 1QAOA 3A8GB 5KO3A 2M5ZA 3SMPA 3EOCB 1H4LD 3X26B 4YHHM 4CGYB 4OU7A 4BCQD 2VIIA 2UUAM 1QLBA 4UN0A 2KMGA 4LJ4A 4OB1B 1VQ1A 1QAMA 2YFQA 2CZ0B 1WXQA 4GHAA 2Z4SA 2P5TA 1ZP2A 2LTUA 4NOOB 3GPPA 3EIHA 4CFWB 1IY2A 1TH2A 3KS8A 4NL4H 4BBRM 4ZPXA 3DOGB 2C4GB 1N75A 3QYHB 3F5XB 2F2CA 2R7GA 1J7KA 3LVVA 1J5EM 4LRSA 2NQ8C 4I8OA 2KZSA 3B7QA 4FM4B 3LCVB 4I5SA 2LVNC 5ITXE 2CYZB 2DAEA 2QFZA 4FWGA 1IN5A 3U6LA 1D0MA 1H1RB 3E46A 3VKHA 1WGNA 4LJ5A 4REZA 3U6CA 3BG9A 2L09A 1ZMVA 2QCUA 3B89A 3IECA 2C6TB 3AFHA 3GLFA 5KQDA 4B7FA 2CCHB 3HHYA 2XSZD 4FW9A 3H4JA 3U61A 3KSJA 1HNZM 3TW7A 1VG5A 3BLQB 1EFUB 4HNTA 5DYGA 1K3WA 4LJ9A 1OQYA 2ZAOA 5EP1A 4DR6M 3M7GA 2WSFF 3RE8A 3B57A 2DD5B 2V1CA 5CEIB 2KXEA 2C5RA 3KOYE 4JI2M 3HO8A 1E7PA 3UGJA 1P3QQ 1UNGD 1NY6A 2YR0A 2XGNA 4JN6A 3A8MB 4LZJA 3U6DA 3C9PA 1L1ZA 4ANRA 1DO2A 2Q2EB 1XHBA 3A8OB 2EJSA 4YOSA 1N77A 3CTWB 2YQZA 1Q3CA 3FD9A 2QBYB 1VOLA 3I51A 2QGSA 2I53A 4BBAA 1W5SA 3X25B 3D8BA 3L25A 1QDTA 3G33B 1GUXA 4JX5A 2R0IA 1HR0M 2XH9A 3TQSA 4YC3B 2JY6B 4LFBM 2M60A 5HBEB 4NXMM 3J27B 1SXJB 3GRRA 4DV5M 3MIAB 5ITTA 3HY5A 3GLGA 2QQ8A 1XMOM 3MI9B 5FTKA 3SBJA 2F5PA 1XC8A 3BXWA 5E6JA 3QYBA 7CATA 3U60B 4EC9B 4R3DA 2DWZB 4II7A 5ACBA 3TWKA 4JI8M 1RU3A 3QHRB 4KLNA 4EOJB 4JI1M 4EORB 3GPYA 3U6PA 2FNAA 3AOEA 1GKIA 4KRDB 3FE3A 4RODA 1R2ZA 1NSFA 4IJEA 1GLNA 2JXNA 2BPMB 4QHSA 2UXBM 3KOXE
chains in the Genus database with same CATH topology
2LNHC 3HWSA 4B3MM 1DGGA 1IXSB 4FD2A 3VDPA 2E5LM 4QNRA 1XNQM 4AKGA 5FSWA 3BOSA 4AQYM 2OPFA 4IJFA 2V1UA 4GH9A 3MK6A 3LQQA 4L15A 1G59A 4IBIA 1L2CA 1QZMA 2R62A 3SATA 3ZH9B 4DUYM 4PT5A 1IXZA 3LMMA 1VDDA 4QSHA 1OFHA 3MJ5A 2FOIC 2ZAMA 4OVZA 1N33M 4LY6A 3FUWA 4LF8M 2XFSA 5DNYA 3H4MA 2HL7A 1HT1E 4MGHA 3GLGB 2ZZDB 2CHQA 1UGRB 1IBKM 1IY0A 5FTJA 3J2PB 4LFCM 1JR3A 3VYHB 3FYCA 4DR3M 3HZJA 2Z3XA 2L7HA 1IBMM 2BS3A 5EXSA 1NNJA 2QENA 3U60A 1FNNA 4L4UA 4ITQA 3X24B 3A98B 3L26A 2Y20A 5EXPA 3DFZA 4X64M 4Z8XA 3GLHA 4LRTA 3WHKA 2EUCA 4FCVA 3HHWA 4OB0B 4JI0M 4JI6M 2AHMA 2QZ4A 2C9OA 3UZUA 4B3SM 3SFZA 4GIPA 3THGA 3VFDA 4X62M 4NXNM 5H37D 5JI3E 3RFWA 3BG3A 3QAUA 1IXRC 3KP0E 4OW0A 1G41A 1XXHA 2X8AA 4IIWA 4IBFA 5LMUM 4LF9M 2BJWA 1EE8A 3SC3A 3HJQA 1IN7A 3JR5A 2YNMD 1ZQ9A 4B3RM 4B08A 3VK7A 3T38A 1DO0A 4DV7M 4IBEA 1G8PA 1KFVA 3J7AS 5F3WA 4AKHA 2L7IA 1E32A 4LF6M 5FTNA 5C1BA 3K2LA 2Y0TA 3B9PA 1UGQB 3QWLA 1SXJC 4RF1A 4KHPM 3AOGA 4MFDA 4LGMA 2R18A 4M9SA 3GQ4A 3DL1A 3KFUG 4P16A 4IBKA 4BB9A 1K3XA 1N36M 3NBIA 3BG5A 3HU3A 1KSFX 3HHZA 2Y21A 4JV5M 3QXEB 3U6EA 2DXBB 1NVMA 4OVZB 2ZM6M 3H4CA 3KHIA 4FCWA 3TW6A 2ZPHB 3SAVA 1IM2A 5C18A 3L27A 1DGHA 1SXJD 3M0EA 4B3TM 2A5YB 2DD4B 5BPVA 2ZBKB 3MHVC 4DV3M 2RGHA 3HBLA 3OTOM 2J7NA 1N78A 3A8LB 4M0WA 2Y0QA 3HHTB 3X20B 4PD2A 3UK6A 4BLCA 4CISA 4ZGJB 1GL6A 3CF6E 3ZCBB 4M9ZA 3KVWA 3A42A 3U5ZA 4MM3B 5EXTA 3AJIB 3AKZA 2DWLA 3GLIB 2OQ4A 2JA2A 3KDSE 1OFIA 2QF7A 4DV2M 3GPXA 2Z4RA 2I7NA 1L2BA 4GKKM 4LJ6A 4L8RC 3QYGB 2CHVA 3A8HB 2CV2A 1Z59A 4LZZA 4DV1M 3SMSA 1OJLA 1XXHB 4AG6A 2VQFM 2ERCA 5ITUA 4G4OA 3HJ8A 2XF3A 3LVWA 3U6OA 4OB3B 5KQ8A 3FUTA 2G8LA 4PDIA 3J81S 4JI4M 3KOZE 2F5QA 1TGUA 3GRUA 3HU2A 2ZANA 1IN6A 3JAMS 4AZFA 4DR4M 3K92A 4TUWA 1HQYE 2R45A 3T1HM 1R6BX 2KZUA 2F5NA 3HHXA 4GITA 4R7GA 2QP9X 2H1RA 4M0DA 2XZUA 3A46A 3TL4X 2D7GA 1L1TA 4ZGDB 3FYDA 3TE6A 3L28A 4RNAA 2KR6A 3WVDB 2D0QB 2W82A 2FFJA 1G4AE 1QAOA 3CF2A 3ILKA 5IREB 3A8GB 5KO3A 2M5ZA 3SMPA 4HL4A 3X26B 4YHHM 4CGYB 4OU7A 4MB7A 2F5SA 2RKOA 2LH0A 5KPZA 1AHJB 3SARA 2VIIA 4MGYE 5A2QS 2HCBA 1DGHB 2UUAM 1QLBA 4W5WA 1FJGM 3X28B 4IBDA 2ZPIB 3W0FA 2DZOB 2CZ1B 2KMGA 4LJ4A 4QOSA 5EJCA 1XWIA 1DGFA 4OB1B 3AV0A 3M6AA 4I4LA 3U5ZB 1QAMA 4CHTB 2XLJA 2X49A 2YFQA 3K1JA 3NWLA 4XBOA 1T3TA 1Z5CA 3GLIA 2CZ0B 3HGIA 2WJ9A 2KRUA 2CE7A 4GMQA 3GQ5A 2ZPFB 2LWXA 1IN8A 4JYAM 1WXQA 4GHAA 2CV1A 2BS2A 1TH4A 2KW0A 2Z4SA 2XSZA 2DWMA 2P5TA 4LJ7A 4MH0E 1IY1A 4IBJA 4NOOB 3GPPA 1YSYA 1I4WA 1QVRA 2HKJA 4MIMA 1E9RA 2XFTA 3TPZA 2ZPBB 2DHRA 4WW0A 4YY3M 2EA0A 3U6MA 4Z6YA 4MFEA 3EIHA 5E26A 2G77A 4HNUA 4HLQA 1IY2A 1XMQM 1TH2A 3KS8A 2Z7JA 2HHHM 2UUBM 4DV6M 4AI6A 2LXEA 4NL4H 1IQPA 4AG5A 4BBRM 1E9SA 1DGBA 4EIWA 1NHGC 4ZPXA 3E9SA 4G6ZA 1N75A 4LCBA 4FCTA 3VDUA 3QYHB 3KXEC 3SAWA 3JR4A 3QZ5B 5FTMA 2ZPGB 2J7OA 3Q8XA 1V29B 3GPUA 3FUXA 1J7KA 3FUVA 3VLFB 3RGSA 3LVVA 1J5EM 4LRSA 2NQ8C 4I8OA 4XGIA 2KZSA 4ZGEB 2DXIA 1N34M 4FM4B 3R9XB 1SXJE 4I5SA 4OB2B 3VYGB 4JXJA 2VQEM 1UM8A 5GKNA 3U6QA 2ZPEB 4DR1M 1HNXM 1ORYB 5ITXE 2CYZB 3L29A 1X37A 4DR5M 5ITQA 4FWGA 2QFZA 3D8LA 3E4RA 2C96A 3FTDA 3A45A 2KA6B 4WURA 1IN5A 1PJJA 4QHTA 4LF4M 4RF0A 4FWDA 4NC6A 2X4AA 3U6LA 1JR3D 2F5OA 3VKHA 8CATA 4LJ5A 4REZA 4L78A 3U6CA 1R2YA 3BG9A 1YE9A 2L09A 4DR2M 3T15A 3WHLA 3T1YM 4JX6A 2QCUA 2G5GX 4B7GA 1J09A 4JI7M 1R7RA 1KYIA 3AFHA 3GLFA 2R65A 2KEBA 4IBBA 5KQDA 4QOZC 3FTFA 4X66M 3PNVA 4B7FA 1GL7A 1G3IA 1LV7A 3DA1A 3HHYA 3ZC7B 4LFAM 2XSZD 4FW9A 1QAQA 4LJAA 3GP1A 4GHLA 3U61A 3KSJA 1HNZM 2QDYB 3FTCA 2CFOA 1PM5A 2DXCB 1HT2E 4OX9M 2AHJB 4B7HA 4G4QA 4JX4A 3TW7A 2K47A 4M9XA 3VK8A 2QBYA 3W0LB 2UXCM 3J80S 4HNTA 5DYGA 1QANA 1MX0A 4LJ9A 1K3WA 5KPRA 3DOAA 4D80A 3PXGA 2ZAOA 5EP1A 4KO8A 2BJVA 5KPTA 4DR6M 3M7GA 3I4VA 3QYEA 5EP3A 3LQRA 3RE8A 3SHGB 4PCZA 2DD5B 2V1CA 1N32M 1TDHA 2D7EA 4LGYA 2KXEA 4PDGA 3GRVA 5EQTA 2DWNA 1E94E 2C5RA 3KOYE 1L2DA 2C98A 4LF5M 3R8FA 3IG8A 3KOWE 1S3SA 5EP2A 1PJIA 3KS4A 4JI2M 2BNKA 1L8QA 3UMMA 3SYKA 3HO8A 1E7PA 3UGJA 4BBSM 4A3VB 1SXJA 2BS4A 2EO2A 1TH3A 2V6ZM 1IBLM 2I7PA 2C9CA 1NY6A 4M6VA 3AOEC 2YR0A 3KW6A 2XGNA 5ITXA 4JN6A 1IREB 3A8MB 4MGZE 5IZ7D 4D81A 5LMNM 5EP4A 5ITRA 5BR8M 4LZJA 3GLFB 4KODA 4GRIA 4IBGA 3U6DA 2CV0A 3K8ZA 2XEPA 2O5RA 3GO8A 1QQWA 4S12A 4L16A 5FLXS 1L1ZA 2CEAA 3SASA 2ZCFB 4LJ8A 5EXXA 1FKMA 1DO2A 4G4NA 4GKJM 1HQCA 4K0KM 2Q2EB 1Q3BA 1XHBA 3FKEA 3U61B 3A8OB 3VKGA 2XZFA 3CF0A 2QPAA 1N77A 3CTWB 2YQZA 3PFIA 3PNYA 4D82A 1Q3CA 3FD9A 4IBCA 3TWMA 2QBYB 3IG5A 2DPPB 2R4JA 3U6SA 3I51A 3C58A 1YUBA 3DZDA 4BBAA 1W5SA 2UU9M 4AW4A 3X25B 4X65M 4AKIA 3D8BA 4MGIE 3L25A 1Z6TA 3PVSA 2UUCM 3WVEB 4JX5A 4NSRA 4LOCA 2CZ6B 3KSXA 1IN4A 1HR0M 2XH9A 1W5TA 3TQSA 3FTEA 3HJSA 1NNUC 1UGSB 4DV4M 4MGKE 3HB9A 1HNWM 2R4EA 4LFBM 2M60A 1TDZA 2D7HA 3HU1A 4GC9A 4DUZM 4NXMM 3J27B 3AL0C 4ELJA 2L6OA 1SXJB 5ITYA 3GQ3A 3GRRA 1JQJC 3FUUA 3RGPA 4DV5M 1Z5BA 5IT9S 2R46A 5ITTA 2UXDM 5IWAM 1K82A 2DVWB 4GC5A 3GLGA 2C99A 2QQ8A 1XMOM 2DZNB 1H6UA 5FTKA 5JI2E 2F4VM 4JI3M 3SBJA 2FE8A 2F5PA 4LF7M 1XC8A 4JI5M 2CZ7B 1C1KA 3KP1E 5E6JA 3QYBA 7CATA 3U60B 4I81A 4NSOB 1NHWC 4R3DA 2DWZB 4NRWA 4II7A 1QYRA 1NY5A 3GRYA 3GLHB 3TWKA 3UJNA 4JI8M 3TWLA 4KLNA 1I94M 4LG2A 2RGOA 4JI1M 3GPYA 3I4YA 1GVNA 4NRVA 3U6PA 2FNAA 3QZ9B 3AOEA 1GKIA 1XNRM 4DR7M 3EIEA 3J7BA 2CUZA 1Z5AA 3L2AA 4G4RA 1MU5A 2KRKA 1R2ZA 4QNMA 3SHFA 1UGPB 1NSFA 4HNVA 3SAUA 2CHGA 4IJEA 1GLNA 4DV0M 3SYLA 5DYIA 4FVMA 3HKPA 1Q39A 1D2NA 5FTLA 2QDJA 4FWHA 1NJGA 4QHSA 1ZAEA 1NJFA 2UXBM 3KOXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QFZ A;  3QYE A;  4HL4 A;  4Z6Y A;  2G77 A;  4HLQ A;  3HZJ A;  1FKM A;  2QQ8 A;  3QYB A;  4NC6 A;  5EJC A;  3QWL A; 
#chains in the Genus database with same CATH topology
 1JB0 F;  1OI9 B;  4GH9 A;  3LQQ A;  3NDQ A;  3C3E A;  1QZM A;  1WHC A;  3ZH9 B;  2C5N B;  2PJQ A;  3MJ5 A;  3K7A M;  4OVZ A;  2ZZD B;  1IBK M;  3J2P B;  1GAB A;  3VYH B;  3HZJ A;  1NNJ A;  4L4U A;  2WPA B;  4ITQ A;  3X24 B;  3A98 B;  5ICP B;  3GLH A;  3WHK A;  4FCV A;  4EOM B;  2QZ4 A;  2C9O A;  2ZTC A;  4BXX X;  5H37 D;  5JI3 E;  2IN3 A;  3SC3 A;  1EE8 A;  1QDR A;  1IN7 A;  1DO0 A;  4IBE A;  1G8P A;  3J7A S;  2W9F A;  4LF6 M;  3I04 M;  1UGQ B;  3QWL A;  3FRH A;  4LGM A;  2R18 A;  3DL1 A;  4P16 A;  4BB9 A;  2LVA A;  3BG5 A;  3HU3 A;  3HHZ A;  4BCJ B;  3QXE B;  1LTM A;  3TW6 A;  5C18 A;  1DGH A;  1SXJ D;  3M0E A;  2DD4 B;  3DDP B;  3MHV C;  2RGH A;  3HHT B;  2Y0Q A;  4CIS A;  1GL6 A;  4MM3 B;  1UNH D;  1OFI A;  2I7N A;  4GKK M;  4L8R C;  2CHV A;  2DHY A;  3A8H B;  4LZZ A;  2JZ1 A;  2WFY B;  3HJ8 A;  3TNW B;  3FUT A;  2G8L A;  1TGU A;  4DR4 M;  3DJB A;  3DDQ B;  2PMI B;  4GIT A;  2EKK A;  4M0D A;  4ZGD B;  3LCU A;  3TE6 A;  3O0G D;  4CFN B;  2W82 A;  3CF2 A;  1JSU B;  4HL4 A;  5IDP B;  2RKO A;  5KPZ A;  1AHJ B;  5A2Q S;  2HCB A;  1FJG M;  3X28 B;  2ZPI B;  1OIZ A;  1UNL D;  1V33 A;  3K1J A;  1T3T A;  1Z5C A;  3GLI A;  1TF0 B;  4JYA M;  2BS2 A;  2RRU A;  1TH4 A;  2DWM A;  4MH0 E;  1MJG M;  1IY1 A;  1YSY A;  1GJT A;  1E9R A;  3TPZ A;  1C9B A;  4OGR B;  4WW0 A;  4YY3 M;  2EA0 A;  3U6M A;  4CFM B;  4HLQ A;  1XMQ M;  1TTE A;  2HHH M;  1H26 B;  4R71 A;  4AI6 A;  2LXE A;  1DGB A;  1NHG C;  4G6Z A;  3LQ5 B;  3SAW A;  3FUX A;  3FUV A;  1PJQ A;  2OOB A;  1PKD B;  4XGI A;  1N34 M;  3R9X B;  1SXJ E;  3BHV B;  4OB2 B;  2VQE M;  1UM8 A;  3U6Q A;  4F7N B;  4DR1 M;  1X37 A;  2WZJ A;  4DR5 M;  5ITQ A;  3D8L A;  2C96 A;  3A45 A;  4EOO B;  1JR3 D;  1OKV B;  4L78 A;  4CRL B;  2DAI A;  4IBB A;  1H24 B;  4QOZ C;  1GY3 B;  3QHW B;  1G3I A;  3DA1 A;  1QAQ A;  3GP1 A;  1D0L A;  2QDY B;  4B7H A;  2K47 A;  3B74 A;  2UXC M;  4NST B;  4BCP B;  4KO8 A;  2BJV A;  1GUX B;  3SHG B;  1AD6 A;  4F7L B;  3GRV A;  5CYI B;  1S3S A;  1H25 B;  2BKZ B;  2JUJ A;  3KS4 A;  3SYK A;  5HBJ B;  4A3V B;  3PO3 S;  2C5V B;  2DAG A;  2DNA A;  1TFB A;  5ITX A;  1OKS A;  4D81 A;  4EOQ B;  5EP4 A;  1GO5 A;  4L16 A;  2CEA A;  2LHC A;  4EOL B;  2LW4 A;  4K0K M;  2WEV B;  1Q3B A;  4F6U B;  2QPA A;  1AIS B;  2DPP B;  2R4J A;  3DZD A;  4X65 M;  2WSC F;  4MGI E;  3DTO A;  5L8R F;  3WVE B;  3KSX A;  2LHG A;  2L2D A;  3HB9 A;  1W98 B;  2R4E A;  1TDZ A;  2D7H A;  1D3U B;  4GC9 A;  4DUZ M;  4ELJ A;  2L6O A;  1JR3 E;  1JQJ C;  3RGP A;  1Y8G A;  1Z5B A;  5IT9 S;  1VEJ A;  1R4G A;  2FH0 A;  2DVW B;  4GC5 A;  2DZN B;  5JI2 E;  2F4V M;  4JI3 M;  2CZ7 B;  1C1K A;  4F6S B;  1NHW C;  4NRW A;  1QYR A;  3GLH B;  1FVV B;  1D0K A;  2JGZ B;  1H1S B;  2HAK A;  1XNR M;  1BU2 A;  4DR7 M;  3EIE A;  1MU5 A;  1UGP B;  4HNV A;  2CHG A;  2DME A;  3HKP A;  1NJG A;  2LNH C;  3HWS A;  3VDP A;  4AKG A;  2R44 A;  1A5T A;  1IXZ A;  1OFH A;  2XFS A;  3H4M A;  4MGH A;  1IY0 A;  3FYC A;  4CXA B;  2Z3X A;  2BS3 A;  1G3N C;  1H1Q B;  1FNN A;  4ELL A;  4X64 M;  4Z8X A;  4LRT A;  1HJP A;  4OB0 B;  3LW5 F;  3UZU A;  1FIN B;  4NXN M;  2H5X A;  4F7J B;  3NBX X;  3BG3 A;  3QAU A;  1R5L A;  1G41 A;  4LF9 M;  4IBF A;  4B3R M;  4B08 A;  3VK7 A;  3T38 A;  2UZL B;  1ENW A;  2JY5 A;  2L4E A;  1PGY A;  2Y0T A;  1KXU A;  4RF1 A;  4KHP M;  1TD6 A;  3AOG A;  2UZD B;  3GQ4 A;  4M9S A;  4Y28 F;  1QUT A;  1T43 A;  3HX3 A;  1BVS A;  3U6E A;  2JY7 A;  3KHI A;  3SAV A;  2A5Y B;  4KT0 F;  5BPV A;  2ZBK B;  3HBL A;  1N4M A;  3OTO M;  1N78 A;  4M0W A;  4PD2 A;  4ZGJ B;  4M9Z A;  3AJI B;  3B7Z A;  3GLI B;  2JA2 A;  1H27 B;  2O01 F;  3EJ1 B;  4DV2 M;  5BNJ B;  3GPX A;  2Z4R A;  4DV1 M;  1XXH B;  5ITU A;  2XF3 A;  3U6O A;  4OB3 B;  4JI4 M;  4BCO B;  4TUW A;  3K92 A;  2F5N A;  1F5Q B;  2H1R A;  1OAI A;  2D7G A;  3FYD A;  2KR6 A;  2FFJ A;  1G4A E;  2F5S A;  3SAR A;  4MGY E;  2V22 B;  2GQF A;  4W5W A;  4IBD A;  3W0F A;  2DZO B;  4QOS A;  5EJC A;  1DGF A;  3AV0 A;  3M6A A;  4F1I A;  4I4L A;  3U5Z B;  2XLJ A;  4CHT B;  4XBO A;  2WJ9 A;  4GMQ A;  3K9O A;  1VEK A;  2W96 A;  1IN8 A;  2DKL A;  2CV1 A;  2KDL A;  2KW0 A;  4IBJ A;  1AUA A;  4EOP B;  4MIM A;  2XFT A;  4I3Z B;  4MFE A;  2VF7 A;  5E26 A;  2G77 A;  2Z7J A;  2UUB M;  4AG5 A;  4EON B;  4EIW A;  3E9S A;  2QNJ A;  4FCT A;  3VDU A;  4BCN B;  3KXE C;  2ZPG B;  2J7O A;  3Q8X A;  1V29 B;  3GPU A;  2IW6 B;  5HVY B;  4ZGE B;  1VDL A;  3VYG B;  4F6W B;  4JXJ A;  2KHH A;  1Q02 A;  5GKN A;  4YOO A;  1O9K A;  1HNX M;  2ZPE B;  1ORY B;  3L29 A;  3E4R A;  3FTD A;  2KA6 B;  4QHT A;  4RF0 A;  2UZE B;  4NC6 A;  8CAT A;  1TR8 A;  1YE9 A;  4DR2 M;  3T15 A;  3WHL A;  3T1Y M;  4JX6 A;  2G5G X;  4CFX B;  1EIJ A;  2KEB A;  3FTF A;  3PNV A;  1AIP C;  1GL7 A;  1LV7 A;  1PRB A;  4HEO A;  3FTC A;  2CFO A;  1PM5 A;  2DXC B;  4OX9 M;  2AHJ B;  1NO1 A;  4JX4 A;  3Q8G A;  4M9X A;  3VK8 A;  2QBY A;  5DQV A;  3K9P A;  4BY7 X;  1QAN A;  3DOA A;  4D80 A;  3ZQJ A;  5KPT A;  3I4V A;  3QYE A;  2C5X B;  4DBG B;  5HNB B;  3T6P A;  4PCZ A;  2JZ0 A;  1N32 M;  1TDH A;  2WIP B;  5EQT A;  1E94 E;  1L2D A;  2C98 A;  4LF5 M;  2WSE F;  3R8F A;  3KOW E;  5EP2 A;  3UMM A;  4BBS M;  1SXJ A;  2EO2 A;  1TH3 A;  2V6Z M;  4M6V A;  1VIN A;  2DZL A;  4MGZ E;  5ITR A;  3W68 A;  2PK9 B;  5BR8 M;  3GLF B;  4IBG A;  2CV0 A;  2ZTD A;  2MJ5 B;  2XEP A;  2O5R A;  4G3O A;  1QQW A;  3BHU B;  5FLX S;  3SAS A;  3RGF B;  4LJ8 A;  5EXX A;  1FKM A;  4P17 A;  4GKJ M;  2EUF A;  3U61 B;  3VKG A;  2XZF A;  3CF0 A;  2CP8 A;  3PNY A;  5LMK B;  4IBC A;  3TWM A;  3IG5 A;  4TTH A;  2UU9 M;  4AW4 A;  4AKI A;  2W9Z A;  3PVS A;  2DAK A;  2UUC M;  4CFU B;  4BCN D;  2CZ6 B;  1W5T A;  1XB2 B;  1UGS B;  2MGW A;  1E9H B;  4DV4 M;  4MGK E;  3HU1 A;  3AL0 C;  5ITY A;  3GQ3 A;  4F7S B;  2CCI B;  2UUE B;  2R46 A;  2UXD M;  2K6B A;  2JWS A;  1OIU B;  1H6U A;  4IMY B;  4NSO B;  4II5 B;  1OIY B;  1XXH E;  3GRY A;  2CRU A;  3UJN A;  4BCK B;  1GH6 B;  3TWL A;  4LG2 A;  2RGO A;  3I4Y A;  3QZ9 B;  1Z5A A;  3L2A A;  4UN2 B;  4G4R A;  2KRK A;  4QNM A;  3SHF A;  3SAU A;  2G9X B;  4DV0 M;  3SYL A;  1Q39 A;  3F92 A;  4FWH A;  1NJF A;  1OL2 B;  4FD2 A;  4QNR A;  3BOS A;  4AQY M;  1OKW B;  3MK6 A;  4IBI A;  2R62 A;  4QSH A;  2FOI C;  2ZAM A;  1N33 M;  4LY6 A;  3FUW A;  5DNY A;  2HL7 A;  3BHT B;  4GEW A;  3GLG B;  2CHQ A;  4YOZ A;  2K0B X;  1JR3 A;  4DR3 M;  2L7H A;  1WIV A;  1IBM M;  1DV0 A;  2Y20 A;  5EXP A;  2OOA A;  2EUC A;  3HHW A;  2AHM A;  4B3S M;  3SFZ A;  4GIP A;  3THG A;  4X62 M;  1H1P B;  3RFW A;  1H28 B;  2X8A A;  1OL1 B;  4BCG B;  4CIZ A;  2YNM D;  1QZE A;  1ZQ9 A;  2HWJ A;  4DV7 M;  1KFV A;  3IHP A;  5F3W A;  3CGW A;  4AKH A;  1OAO C;  2L7I A;  5FTN A;  5C1B A;  3K2L A;  1IXS A;  4CFU D;  2J5Y A;  3KFU G;  2Y21 A;  3E21 A;  1JOW A;  4OVZ B;  2WMB B;  2ZPH B;  4OR5 B;  3L27 A;  1WR1 B;  3A8L B;  3X20 B;  3CF6 E;  1JST B;  3KVW A;  3AKZ A;  2R6F A;  2DWL A;  2OQ4 A;  3KDS E;  2EKF A;  4AG6 A;  2VQF M;  2ERC A;  3FRI A;  5KQ8 A;  4CFV B;  2ZAN A;  3JAM S;  4AZF A;  2KNZ A;  1HQY E;  1R6B X;  2KZU A;  3HHX A;  2QP9 X;  2XZU A;  3A46 A;  3TL4 X;  3L28 A;  4RNA A;  3WVD B;  5IRE B;  3ILK A;  4MB7 A;  2LH0 A;  2IW9 B;  4CJ6 A;  1DGH B;  1O9K B;  2WXV B;  2JNH A;  3V76 A;  2CZ1 B;  4Y72 B;  1XWI A;  2BWB A;  3GLF E;  4WP2 A;  2K9D A;  2X49 A;  3NWL A;  5IDN B;  1OTR A;  3HGI A;  2KRU A;  2CE7 A;  3GQ5 A;  2ZPF B;  2LWX A;  3B7N A;  2XSZ A;  4ROE A;  4LJ7 A;  1I4W A;  1QVR A;  2HKJ A;  2MR9 A;  2ZPB B;  2DHR A;  4Z6Y A;  4HNU A;  3POM A;  4DV6 M;  1URC B;  1IFY A;  1IQP A;  1E9S A;  2LVQ D;  1F4I A;  4LCB A;  2KNV A;  2LVP C;  3JR4 A;  3QZ5 B;  5FTM A;  2B3T A;  3VLF B;  2DAM A;  3RGS A;  2DXI A;  1VYW B;  2PK2 A;  4WUR A;  4LF4 M;  1PJJ A;  4FWD A;  2X4A A;  2F5O A;  2N35 A;  1PJT A;  1R2Y A;  1VEG A;  4BCH B;  2W99 A;  4B7G A;  1J09 A;  3MMP A;  4JI7 M;  1R7R A;  1KYI A;  4KRC B;  2R65 A;  4X66 M;  3BBZ A;  3ZC7 B;  4LFA M;  4LJA A;  5HQ0 B;  4GHL A;  1JKW A;  1HT2 E;  4G4Q A;  1ZMW A;  2CWB A;  3W0L B;  3J80 S;  1MX0 A;  1V34 A;  5KPR A;  4G6L B;  4BCM B;  3BLR B;  3PXG A;  1XO2 A;  2LVO C;  5EP3 A;  3LQR A;  1SG9 A;  4F2L A;  1UFZ A;  2D7E A;  4LGY A;  4PDG A;  2DWN A;  2Z8Y M;  3IG8 A;  1PJI A;  2BNK A;  1L8Q A;  3GLG E;  3TNI B;  5HBH B;  3MY1 B;  2BS4 A;  4BCF B;  1IBL M;  2I7P A;  2C9C A;  3AOE C;  3KW6 A;  1IRE B;  5IZ7 D;  5LMN M;  2KNA A;  4KOD A;  4GRI A;  3K8Z A;  3GO8 A;  4S12 A;  1GJS A;  2ZCF B;  1NV8 A;  4G4N A;  1PJS A;  1HQC A;  3FKE A;  3EID B;  2WHB B;  3TN8 B;  3PFI A;  4D82 A;  3BLH B;  3U6S A;  3C58 A;  1YUB A;  1ZV1 A;  2VDB B;  1Z6T A;  5EFQ B;  4NSR A;  4LOC A;  1IN4 A;  3FTE A;  3HJS A;  1NNU C;  2JY8 A;  2W2H A;  1HNW M;  4EOI B;  1MN3 A;  4EC8 B;  3FUU A;  5IWA M;  1K82 A;  2C99 A;  3GLH E;  1T6O A;  2PHG A;  2FE8 A;  2UZB B;  4LF7 M;  4JI5 M;  3KP1 E;  2JP7 A;  2BWE A;  4I81 A;  2C5O B;  3C3D A;  1NY5 A;  5IF1 B;  1WJ7 A;  5DFL A;  5I5Z B;  1I94 M;  1GVN A;  4NRV A;  3J7B A;  2CUZ A;  1OIP A;  5DYI A;  4FVM A;  1D2N A;  5FTL A;  2QDJ A;  4BCM D;  1ZAE A;  4B3M M;  1DGG A;  3TNH B;  1OGU B;  1IXS B;  1XNQ M;  2E5L M;  5FSW A;  2OPF A;  4IJF A;  2V1U A;  4L15 A;  1G59 A;  4BCQ B;  5L2W B;  1L2C A;  3SAT A;  4DUY M;  4PT5 A;  4FX3 B;  3LMM A;  1VDD A;  4LF8 M;  1HT1 E;  2LBC A;  1UGR B;  5FTJ A;  4LFC M;  4Q7J A;  5EXS A;  2QEN A;  1ZMU A;  3U60 A;  1C7Y A;  3L26 A;  1WGL A;  3DFZ A;  1CUK A;  1YLA A;  4JI0 M;  2DI0 A;  4JI6 M;  5LQF B;  3GTM S;  3VFD A;  2OO9 A;  5IHY A;  1IXR C;  3KP0 E;  4OW0 A;  1XXH A;  2VF8 A;  4IIW A;  5LMU M;  2BJW A;  2DEN A;  3HJQ A;  3JR5 A;  4BCI B;  3M03 A;  1E32 A;  2B9R A;  4F70 B;  3B9P A;  1SXJ C;  4BY1 X;  4L6V 6;  4MFD A;  2MH8 A;  4IBK A;  1K3X A;  1QUS A;  3NBI A;  1N36 M;  1KSF X;  4JV5 M;  2IVX A;  2DXB B;  1NVM A;  2X1N B;  2ZM6 M;  3H4C A;  4FCW A;  1IM2 A;  4B3T M;  3GLI E;  2APL A;  4DV3 M;  2WMA B;  2J7N A;  3UK6 A;  4BLC A;  4ROC A;  2CJM B;  2I40 B;  3ZCB B;  3A42 A;  3U5Z A;  2FS1 A;  5EXT A;  4RKU F;  4EOK B;  1QMZ B;  1NV9 A;  2QF7 A;  1V92 A;  2QHO B;  1L2B A;  4LJ6 A;  3QYG B;  2GNO A;  3MY5 B;  1G71 A;  2CV2 A;  1Z59 A;  4XK8 F;  3SMS A;  1OJL A;  4G4O A;  1P5E B;  3LVW A;  2WIH B;  5FGK B;  4PDI A;  2O25 A;  2QSF X;  3J81 S;  3KOZ E;  2F5Q A;  2MRO B;  3GRU A;  3HU2 A;  1IN6 A;  2L4F A;  4EOS B;  2R45 A;  3T1H M;  5DQW A;  2G3Q A;  4R7G A;  1L1T A;  2IW8 B;  3W67 A;  3I01 M;  2D0Q B;  1QAO A;  3A8G B;  5KO3 A;  2M5Z A;  3SMP A;  3EOC B;  1H4L D;  3X26 B;  4YHH M;  4CGY B;  4OU7 A;  4BCQ D;  2VII A;  2UUA M;  1QLB A;  4UN0 A;  2KMG A;  4LJ4 A;  4OB1 B;  1VQ1 A;  1QAM A;  2YFQ A;  2CZ0 B;  1WXQ A;  4GHA A;  2Z4S A;  2P5T A;  1ZP2 A;  2LTU A;  4NOO B;  3GPP A;  3EIH A;  4CFW B;  1IY2 A;  1TH2 A;  3KS8 A;  4NL4 H;  4BBR M;  4ZPX A;  3DOG B;  2C4G B;  1N75 A;  3QYH B;  3F5X B;  2F2C A;  2R7G A;  1J7K A;  3LVV A;  1J5E M;  4LRS A;  2NQ8 C;  4I8O A;  2KZS A;  3B7Q A;  4FM4 B;  3LCV B;  4I5S A;  2LVN C;  5ITX E;  2CYZ B;  2DAE A;  2QFZ A;  4FWG A;  1IN5 A;  3U6L A;  1D0M A;  1H1R B;  3E46 A;  3VKH A;  1WGN A;  4LJ5 A;  4REZ A;  3U6C A;  3BG9 A;  2L09 A;  1ZMV A;  2QCU A;  3B89 A;  3IEC A;  2C6T B;  3AFH A;  3GLF A;  5KQD A;  4B7F A;  2CCH B;  3HHY A;  2XSZ D;  4FW9 A;  3H4J A;  3U61 A;  3KSJ A;  1HNZ M;  3TW7 A;  1VG5 A;  3BLQ B;  1EFU B;  4HNT A;  5DYG A;  1K3W A;  4LJ9 A;  1OQY A;  2ZAO A;  5EP1 A;  4DR6 M;  3M7G A;  2WSF F;  3RE8 A;  3B57 A;  2DD5 B;  2V1C A;  5CEI B;  2KXE A;  2C5R A;  3KOY E;  4JI2 M;  3HO8 A;  1E7P A;  3UGJ A;  1P3Q Q;  1UNG D;  1NY6 A;  2YR0 A;  2XGN A;  4JN6 A;  3A8M B;  4LZJ A;  3U6D A;  3C9P A;  1L1Z A;  4ANR A;  1DO2 A;  2Q2E B;  1XHB A;  3A8O B;  2EJS A;  4YOS A;  1N77 A;  3CTW B;  2YQZ A;  1Q3C A;  3FD9 A;  2QBY B;  1VOL A;  3I51 A;  2QGS A;  2I53 A;  4BBA A;  1W5S A;  3X25 B;  3D8B A;  3L25 A;  1QDT A;  3G33 B;  1GUX A;  4JX5 A;  2R0I A;  1HR0 M;  2XH9 A;  3TQS A;  4YC3 B;  2JY6 B;  4LFB M;  2M60 A;  5HBE B;  4NXM M;  3J27 B;  1SXJ B;  3GRR A;  4DV5 M;  3MIA B;  5ITT A;  3HY5 A;  3GLG A;  2QQ8 A;  1XMO M;  3MI9 B;  5FTK A;  3SBJ A;  2F5P A;  1XC8 A;  3BXW A;  5E6J A;  3QYB A;  7CAT A;  3U60 B;  4EC9 B;  4R3D A;  2DWZ B;  4II7 A;  5ACB A;  3TWK A;  4JI8 M;  1RU3 A;  3QHR B;  4KLN A;  4EOJ B;  4JI1 M;  4EOR B;  3GPY A;  3U6P A;  2FNA A;  3AOE A;  1GKI A;  4KRD B;  3FE3 A;  4ROD A;  1R2Z A;  1NSF A;  4IJE A;  1GLN A;  2JXN A;  2BPM B;  4QHS A;  2UXB M;  3KOX E; 
#chains in the Genus database with same CATH homology
 2LNH C;  3HWS A;  4B3M M;  1DGG A;  1IXS B;  4FD2 A;  3VDP A;  2E5L M;  4QNR A;  1XNQ M;  4AKG A;  5FSW A;  3BOS A;  4AQY M;  2OPF A;  4IJF A;  2V1U A;  4GH9 A;  3MK6 A;  3LQQ A;  4L15 A;  1G59 A;  4IBI A;  1L2C A;  1QZM A;  2R62 A;  3SAT A;  3ZH9 B;  4DUY M;  4PT5 A;  1IXZ A;  3LMM A;  1VDD A;  4QSH A;  1OFH A;  3MJ5 A;  2FOI C;  2ZAM A;  4OVZ A;  1N33 M;  4LY6 A;  3FUW A;  4LF8 M;  2XFS A;  5DNY A;  3H4M A;  2HL7 A;  1HT1 E;  4MGH A;  3GLG B;  2ZZD B;  2CHQ A;  1UGR B;  1IBK M;  1IY0 A;  5FTJ A;  3J2P B;  4LFC M;  1JR3 A;  3VYH B;  3FYC A;  4DR3 M;  3HZJ A;  2Z3X A;  2L7H A;  1IBM M;  2BS3 A;  5EXS A;  1NNJ A;  2QEN A;  3U60 A;  1FNN A;  4L4U A;  4ITQ A;  3X24 B;  3A98 B;  3L26 A;  2Y20 A;  5EXP A;  3DFZ A;  4X64 M;  4Z8X A;  3GLH A;  4LRT A;  3WHK A;  2EUC A;  4FCV A;  3HHW A;  4OB0 B;  4JI0 M;  4JI6 M;  2AHM A;  2QZ4 A;  2C9O A;  3UZU A;  4B3S M;  3SFZ A;  4GIP A;  3THG A;  3VFD A;  4X62 M;  4NXN M;  5H37 D;  5JI3 E;  3RFW A;  3BG3 A;  3QAU A;  1IXR C;  3KP0 E;  4OW0 A;  1G41 A;  1XXH A;  2X8A A;  4IIW A;  4IBF A;  5LMU M;  4LF9 M;  2BJW A;  1EE8 A;  3SC3 A;  3HJQ A;  1IN7 A;  3JR5 A;  2YNM D;  1ZQ9 A;  4B3R M;  4B08 A;  3VK7 A;  3T38 A;  1DO0 A;  4DV7 M;  4IBE A;  1G8P A;  1KFV A;  3J7A S;  5F3W A;  4AKH A;  2L7I A;  1E32 A;  4LF6 M;  5FTN A;  5C1B A;  3K2L A;  2Y0T A;  3B9P A;  1UGQ B;  3QWL A;  1SXJ C;  4RF1 A;  4KHP M;  3AOG A;  4MFD A;  4LGM A;  2R18 A;  4M9S A;  3GQ4 A;  3DL1 A;  3KFU G;  4P16 A;  4IBK A;  4BB9 A;  1K3X A;  1N36 M;  3NBI A;  3BG5 A;  3HU3 A;  1KSF X;  3HHZ A;  2Y21 A;  4JV5 M;  3QXE B;  3U6E A;  2DXB B;  1NVM A;  4OVZ B;  2ZM6 M;  3H4C A;  3KHI A;  4FCW A;  3TW6 A;  2ZPH B;  3SAV A;  1IM2 A;  5C18 A;  3L27 A;  1DGH A;  1SXJ D;  3M0E A;  4B3T M;  2A5Y B;  2DD4 B;  5BPV A;  2ZBK B;  3MHV C;  4DV3 M;  2RGH A;  3HBL A;  3OTO M;  2J7N A;  1N78 A;  3A8L B;  4M0W A;  2Y0Q A;  3HHT B;  3X20 B;  4PD2 A;  3UK6 A;  4BLC A;  4CIS A;  4ZGJ B;  1GL6 A;  3CF6 E;  3ZCB B;  4M9Z A;  3KVW A;  3A42 A;  3U5Z A;  4MM3 B;  5EXT A;  3AJI B;  3AKZ A;  2DWL A;  3GLI B;  2OQ4 A;  2JA2 A;  3KDS E;  1OFI A;  2QF7 A;  4DV2 M;  3GPX A;  2Z4R A;  2I7N A;  1L2B A;  4GKK M;  4LJ6 A;  4L8R C;  3QYG B;  2CHV A;  3A8H B;  2CV2 A;  1Z59 A;  4LZZ A;  4DV1 M;  3SMS A;  1OJL A;  1XXH B;  4AG6 A;  2VQF M;  2ERC A;  5ITU A;  4G4O A;  3HJ8 A;  2XF3 A;  3LVW A;  3U6O A;  4OB3 B;  5KQ8 A;  3FUT A;  2G8L A;  4PDI A;  3J81 S;  4JI4 M;  3KOZ E;  2F5Q A;  1TGU A;  3GRU A;  3HU2 A;  2ZAN A;  1IN6 A;  3JAM S;  4AZF A;  4DR4 M;  3K92 A;  4TUW A;  1HQY E;  2R45 A;  3T1H M;  1R6B X;  2KZU A;  2F5N A;  3HHX A;  4GIT A;  4R7G A;  2QP9 X;  2H1R A;  4M0D A;  2XZU A;  3A46 A;  3TL4 X;  2D7G A;  1L1T A;  4ZGD B;  3FYD A;  3TE6 A;  3L28 A;  4RNA A;  2KR6 A;  3WVD B;  2D0Q B;  2W82 A;  2FFJ A;  1G4A E;  1QAO A;  3CF2 A;  3ILK A;  5IRE B;  3A8G B;  5KO3 A;  2M5Z A;  3SMP A;  4HL4 A;  3X26 B;  4YHH M;  4CGY B;  4OU7 A;  4MB7 A;  2F5S A;  2RKO A;  2LH0 A;  5KPZ A;  1AHJ B;  3SAR A;  2VII A;  4MGY E;  5A2Q S;  2HCB A;  1DGH B;  2UUA M;  1QLB A;  4W5W A;  1FJG M;  3X28 B;  4IBD A;  2ZPI B;  3W0F A;  2DZO B;  2CZ1 B;  2KMG A;  4LJ4 A;  4QOS A;  5EJC A;  1XWI A;  1DGF A;  4OB1 B;  3AV0 A;  3M6A A;  4I4L A;  3U5Z B;  1QAM A;  4CHT B;  2XLJ A;  2X49 A;  2YFQ A;  3K1J A;  3NWL A;  4XBO A;  1T3T A;  1Z5C A;  3GLI A;  2CZ0 B;  3HGI A;  2WJ9 A;  2KRU A;  2CE7 A;  4GMQ A;  3GQ5 A;  2ZPF B;  2LWX A;  1IN8 A;  4JYA M;  1WXQ A;  4GHA A;  2CV1 A;  2BS2 A;  1TH4 A;  2KW0 A;  2Z4S A;  2XSZ A;  2DWM A;  2P5T A;  4LJ7 A;  4MH0 E;  1IY1 A;  4IBJ A;  4NOO B;  3GPP A;  1YSY A;  1I4W A;  1QVR A;  2HKJ A;  4MIM A;  1E9R A;  2XFT A;  3TPZ A;  2ZPB B;  2DHR A;  4WW0 A;  4YY3 M;  2EA0 A;  3U6M A;  4Z6Y A;  4MFE A;  3EIH A;  5E26 A;  2G77 A;  4HNU A;  4HLQ A;  1IY2 A;  1XMQ M;  1TH2 A;  3KS8 A;  2Z7J A;  2HHH M;  2UUB M;  4DV6 M;  4AI6 A;  2LXE A;  4NL4 H;  1IQP A;  4AG5 A;  4BBR M;  1E9S A;  1DGB A;  4EIW A;  1NHG C;  4ZPX A;  3E9S A;  4G6Z A;  1N75 A;  4LCB A;  4FCT A;  3VDU A;  3QYH B;  3KXE C;  3SAW A;  3JR4 A;  3QZ5 B;  5FTM A;  2ZPG B;  2J7O A;  3Q8X A;  1V29 B;  3GPU A;  3FUX A;  1J7K A;  3FUV A;  3VLF B;  3RGS A;  3LVV A;  1J5E M;  4LRS A;  2NQ8 C;  4I8O A;  4XGI A;  2KZS A;  4ZGE B;  2DXI A;  1N34 M;  4FM4 B;  3R9X B;  1SXJ E;  4I5S A;  4OB2 B;  3VYG B;  4JXJ A;  2VQE M;  1UM8 A;  5GKN A;  3U6Q A;  2ZPE B;  4DR1 M;  1HNX M;  1ORY B;  5ITX E;  2CYZ B;  3L29 A;  1X37 A;  4DR5 M;  5ITQ A;  4FWG A;  2QFZ A;  3D8L A;  3E4R A;  2C96 A;  3FTD A;  3A45 A;  2KA6 B;  4WUR A;  1IN5 A;  1PJJ A;  4QHT A;  4LF4 M;  4RF0 A;  4FWD A;  4NC6 A;  2X4A A;  3U6L A;  1JR3 D;  2F5O A;  3VKH A;  8CAT A;  4LJ5 A;  4REZ A;  4L78 A;  3U6C A;  1R2Y A;  3BG9 A;  1YE9 A;  2L09 A;  4DR2 M;  3T15 A;  3WHL A;  3T1Y M;  4JX6 A;  2QCU A;  2G5G X;  4B7G A;  1J09 A;  4JI7 M;  1R7R A;  1KYI A;  3AFH A;  3GLF A;  2R65 A;  2KEB A;  4IBB A;  5KQD A;  4QOZ C;  3FTF A;  4X66 M;  3PNV A;  4B7F A;  1GL7 A;  1G3I A;  1LV7 A;  3DA1 A;  3HHY A;  3ZC7 B;  4LFA M;  2XSZ D;  4FW9 A;  1QAQ A;  4LJA A;  3GP1 A;  4GHL A;  3U61 A;  3KSJ A;  1HNZ M;  2QDY B;  3FTC A;  2CFO A;  1PM5 A;  2DXC B;  1HT2 E;  4OX9 M;  2AHJ B;  4B7H A;  4G4Q A;  4JX4 A;  3TW7 A;  2K47 A;  4M9X A;  3VK8 A;  2QBY A;  3W0L B;  2UXC M;  3J80 S;  4HNT A;  5DYG A;  1QAN A;  1MX0 A;  4LJ9 A;  1K3W A;  5KPR A;  3DOA A;  4D80 A;  3PXG A;  2ZAO A;  5EP1 A;  4KO8 A;  2BJV A;  5KPT A;  4DR6 M;  3M7G A;  3I4V A;  3QYE A;  5EP3 A;  3LQR A;  3RE8 A;  3SHG B;  4PCZ A;  2DD5 B;  2V1C A;  1N32 M;  1TDH A;  2D7E A;  4LGY A;  2KXE A;  4PDG A;  3GRV A;  5EQT A;  2DWN A;  1E94 E;  2C5R A;  3KOY E;  1L2D A;  2C98 A;  4LF5 M;  3R8F A;  3IG8 A;  3KOW E;  1S3S A;  5EP2 A;  1PJI A;  3KS4 A;  4JI2 M;  2BNK A;  1L8Q A;  3UMM A;  3SYK A;  3HO8 A;  1E7P A;  3UGJ A;  4BBS M;  4A3V B;  1SXJ A;  2BS4 A;  2EO2 A;  1TH3 A;  2V6Z M;  1IBL M;  2I7P A;  2C9C A;  1NY6 A;  4M6V A;  3AOE C;  2YR0 A;  3KW6 A;  2XGN A;  5ITX A;  4JN6 A;  1IRE B;  3A8M B;  4MGZ E;  5IZ7 D;  4D81 A;  5LMN M;  5EP4 A;  5ITR A;  5BR8 M;  4LZJ A;  3GLF B;  4KOD A;  4GRI A;  4IBG A;  3U6D A;  2CV0 A;  3K8Z A;  2XEP A;  2O5R A;  3GO8 A;  1QQW A;  4S12 A;  4L16 A;  5FLX S;  1L1Z A;  2CEA A;  3SAS A;  2ZCF B;  4LJ8 A;  5EXX A;  1FKM A;  1DO2 A;  4G4N A;  4GKJ M;  1HQC A;  4K0K M;  2Q2E B;  1Q3B A;  1XHB A;  3FKE A;  3U61 B;  3A8O B;  3VKG A;  2XZF A;  3CF0 A;  2QPA A;  1N77 A;  3CTW B;  2YQZ A;  3PFI A;  3PNY A;  4D82 A;  1Q3C A;  3FD9 A;  4IBC A;  3TWM A;  2QBY B;  3IG5 A;  2DPP B;  2R4J A;  3U6S A;  3I51 A;  3C58 A;  1YUB A;  3DZD A;  4BBA A;  1W5S A;  2UU9 M;  4AW4 A;  3X25 B;  4X65 M;  4AKI A;  3D8B A;  4MGI E;  3L25 A;  1Z6T A;  3PVS A;  2UUC M;  3WVE B;  4JX5 A;  4NSR A;  4LOC A;  2CZ6 B;  3KSX A;  1IN4 A;  1HR0 M;  2XH9 A;  1W5T A;  3TQS A;  3FTE A;  3HJS A;  1NNU C;  1UGS B;  4DV4 M;  4MGK E;  3HB9 A;  1HNW M;  2R4E A;  4LFB M;  2M60 A;  1TDZ A;  2D7H A;  3HU1 A;  4GC9 A;  4DUZ M;  4NXM M;  3J27 B;  3AL0 C;  4ELJ A;  2L6O A;  1SXJ B;  5ITY A;  3GQ3 A;  3GRR A;  1JQJ C;  3FUU A;  3RGP A;  4DV5 M;  1Z5B A;  5IT9 S;  2R46 A;  5ITT A;  2UXD M;  5IWA M;  1K82 A;  2DVW B;  4GC5 A;  3GLG A;  2C99 A;  2QQ8 A;  1XMO M;  2DZN B;  1H6U A;  5FTK A;  5JI2 E;  2F4V M;  4JI3 M;  3SBJ A;  2FE8 A;  2F5P A;  4LF7 M;  1XC8 A;  4JI5 M;  2CZ7 B;  1C1K A;  3KP1 E;  5E6J A;  3QYB A;  7CAT A;  3U60 B;  4I81 A;  4NSO B;  1NHW C;  4R3D A;  2DWZ B;  4NRW A;  4II7 A;  1QYR A;  1NY5 A;  3GRY A;  3GLH B;  3TWK A;  3UJN A;  4JI8 M;  3TWL A;  4KLN A;  1I94 M;  4LG2 A;  2RGO A;  4JI1 M;  3GPY A;  3I4Y A;  1GVN A;  4NRV A;  3U6P A;  2FNA A;  3QZ9 B;  3AOE A;  1GKI A;  1XNR M;  4DR7 M;  3EIE A;  3J7B A;  2CUZ A;  1Z5A A;  3L2A A;  4G4R A;  1MU5 A;  2KRK A;  1R2Z A;  4QNM A;  3SHF A;  1UGP B;  1NSF A;  4HNV A;  3SAU A;  2CHG A;  4IJE A;  1GLN A;  4DV0 M;  3SYL A;  5DYI A;  4FVM A;  3HKP A;  1Q39 A;  1D2N A;  5FTL A;  2QDJ A;  4FWH A;  1NJG A;  4QHS A;  1ZAE A;  1NJF A;  2UXB M;  3KOX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...