4HL4A

Crystal structure of the human tbc1d20 rabgap domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
molecule keywords TBC1 domain family member 20
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hl4A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hl4A02
4NC6A 4HLQA 5EJCA 2G77A 1FKMA 3HZJA 3QYBA 4HL4A 3QYEA 4Z6YA 2QQ8A 2QFZA 3QWLA
chains in the Genus database with same CATH superfamily
4IJEA 4LCBA 4LY6A 3GPPA 2WSFF 1IBLM 3B7NA 4LGMA 2AHMA 1F5QB 1QAMA 2LHGA 2MROB 3GRYA 4GH9A 4HL4A 1HNWM 2G9XB 2BJWA 1L1ZA 5IDPB 3B9PA 3C9PA 2O25A 2J7OA 1GVNA 2CE7A 2J5YA 2JWSA 3PNVA 4XBOA 5IWAM 3SAWA 3GLFB 2DAEA 3KP0E 1NNJA 4B3TM 4RF1A 2B3TA 2QENA 4D81A 2DWLA 2UZLB 3EIDB 4ANRA 1L2BA 4QHTA 3MMPA 2DD4B 1TDHA 1J09A 2QSFX 3FE3A 4GKJM 1RU3A 2CV0A 2OO9A 1FJGM 1DGHB 2DXBB 4QHSA 2CWBA 4LJ5A 4B7FA 2HAKA 3HHZA 3U5ZA 1G71A 4OX9M 1VG5A 1XNQM 4B7HA 2DXCB 1L8QA 3BLQB 4ZGDB 5EXXA 2NQ8C 2OOBA 3AOEA 3THGA 3TWMA 2DPPB 2M5ZA 2ZAMA 4NSTB 4F6SB 3W67A 4G4OA 1XHBA 3LQ5B 3GPUA 2VF7A 1OFHA 4DR7M 3K7AM 4X64M 1VDLA 2W2HA 2WSEF 1IXZA 1H1PB 1YE9A 4EOJB 1IBMM 3L2AA 2RGHA 4IBFA 2DZNB 1WXQA 3BOSA 3T15A 4AKIA 5FTMA 2BWBA 1ZMVA 3U6PA 3FUVA 1N77A 1OGUB 1N75A 5KPZA 3QYGB 4BCNB 1NVMA 4GC9A 4ZGEB 4B7GA 5LMKB 1QYRA 2XEPA 4BBRM 2K47A 5HVYB 1V33A 3AFHA 4ITQA 3GLHB 4B3RM 5ITXA 2UXDM 1W98B 3HGIA 4YOZA 4AG6A 4PD2A 4UN0A 1H1SB 4X66M 4RODA 1MX0A 3HZJA 4LJ9A 2F5QA 1JR3A 5L2WB 3KSJA 3L28A 3D8LA 4EIWA 1WJ7A 3F5XB 2XZUA 1G3IA 4JI6M 1ENWA 2D7EA 2CP8A 2KNVA 4AKHA 3HU3A 2DVWB 4EC8B 2PK9B 1JB0F 3F92A 3HHYA 3X28B 4G3OA 1HJPA 1NO1A 1N33M 2GNOA 3FRIA 2FNAA 2CZ0B 2LW4A 2UXCM 1JOWA 1FKMA 1TF0B 3GLIB 3WHLA 4TTHA 7CATA 2LH0A 1TD6A 1LTMA 2H1RA 2HL7A 3M6AA 4REZA 1Z59A 4KODA 2UUEB 1C9BA 3FKEA 2EJSA 2JZ0A 3V76A 1IXRC 4X62M 3FYDA 1E94E 2VQFM 3SAUA 2LTUA 4Q7JA 2CHGA 4HEOA 5C1BA 1IBKM 2OQ4A 2C98A 4IIWA 4LF8M 4FCWA 5FTNA 2IW6B 2OOAA 1AISB 1VEKA 2Z4SA 4CHTB 1K3WA 3LCUA 4KHPM 2XF3A 4FCTA 4NRVA 1OL2B 2G77A 1SG9A 3A98B 4G4NA 3BLHB 5DQWA 2L2DA 3ZQJA 2Q2EB 4IBBA 2HKJA 2L4EA 2DKLA 3U6DA 3R8FA 4II7A 1IREB 4Z8XA 3VK8A 2FH0A 3QHRB 3BHVB 1Z6TA 4M0DA 4EOLB 1GH6B 2ZPFB 2G5GX 2QQ8A 1XB2B 2ERCA 4LFAM 3GP1A 4GHLA 3MIAB 1LV7A 3TW7A 4NL4H 2QBYA 1WHCA 3VK7A 2UUBM 1CUKA 1H25B 3BHTB 3PO3S 2QDJA 1NSFA 1UNHD 4EOPB 2CHVA 2KZUA 2Y0TA 2F5SA 2CHQA 5IT9S 2W99A 2KNZA 2WIHB 4BCPB 2R46A 5KQDA 4F1IA 2DZLA 4DR3M 3FUWA 2DNAA 3DZDA 1QZMA 5EQTA 4EOOB 4JI5M 1SXJD 2BS4A 2WEVB 5ACBA 3GLFE 3VYGB 4R71A 4Y72B 1N32M 1WGLA 1N34M 1J5EM 4JYAM 3SC3A 4BBSM 4ELJA 2R18A 1WGNA 4JI4M 5HNBB 3L26A 1UM8A 3H4CA 3BG5A 1NJGA 3K9OA 1ZP2A 3B74A 4OB1B 3X24B 2VQEM 2KEBA 2ZZDB 4HLQA 4W5WA 1JQJC 4LFBM 3TNWB 4DV2M 4AKGA 1H1RB 2MR9A 3GRUA 2M60A 1UNGD 3ZC7B 1ZMWA 4LJAA 1BVSA 4YC3B 3NBXX 2DHRA 1OIUB 2RGOA 2C9OA 5L8RF 1IXSA 4GRIA 2IN3A 1MJGM 4G6ZA 2LBCA 1FNNA 3U6QA 2C6TB 3U6MA 2VF8A 3NWLA 4FW9A 3TNHB 5GKNA 4CJ6A 3DA1A 5EXSA 3M0EA 5BNJB 1QDRA 1E9RA 1TGUA 2D7HA 3C58A 4Z6YA 2W9FA 2EKKA 3E4RA 3HB9A 5EP2A 4JV5M 1IN8A 3I04M 4MGIE 2QBYB 2WFYB 1OAOC 1SXJB 5DFLA 5EP1A 1Y8GA 1Z5BA 3KVWA 3QYBA 3UK6A 3GLIE 1JR3D 4BCIB 3HWSA 3K9PA 4BCFB 1XXHB 2YQZA 2XSZD 4L6V6 4GIPA 2UXBM 1H27B 2F2CA 5ITUA 2QDYB 2CEAA 2JNHA 2LXEA 2CZ1B 4ELLA 1GJSA 3E21A 4HNUA 1PGYA 3W0FA 1XWIA 2DI0A 5A2QS 3KXEC 1WR1B 1SXJC 5JI3E 1S3SA 2HWJA 2KNAA 2QCUA 3U6LA 1IN6A 4PDIA 4KO8A 4IBCA 1QAOA 2LVQD 3GQ3A 2L09A 4JI2M 3HU2A 4YOOA 4EOQB 5FTLA 2DMEA 4MM3B 3GLGB 3FRHA 1G8PA 1XMOM 4JI3M 3K1JA 2BS3A 2XZFA 1QUSA 1QMZB 3ZH9B 2BWEA 1UNLD 2XFSA 5IDNB 3A42A 4LF9M 5HBHB 2UUAM 2OPFA 3KS8A 4GKKM 3DOGB 3EIHA 5FTKA 3VDUA 4B08A 2N35A 1OKVB 3MY1B 1EFUB 2L7HA 2V6ZM 2ZTDA 2RRUA 4I81A 4JN6A 2FOIC 2KRUA 3RE8A 2O01F 4DV3M 2DXIA 1IY1A 3VLFB 3GO8A 4B3MM 3DDQB 1HR0M 1NNUC 4PDGA 5DNYA 3VKGA 5HBJB 2IVXA 4YY3M 3QYHB 5LQFB 3GPYA 2PK2A 2YFQA 4X65M 3BXWA 1F4IA 3GRVA 3TW6A 1OIPA 1T3TA 3QWLA 4WW0A 1OQYA 4BCMD 3NDQA 3BG3A 2BNKA 1OFIA 1IFYA 1Q02A 4P17A 4ZGJB 3GLHA 4OB3B 3ZCBB 4JI1M 2JUJA 2R62A 1OKWB 5FGKB 4R7GA 5LMUM 1HNZM 2WJ9A 4BCKB 1IN4A 4LOCA 1KSFX 2DAGA 2DAMA 4G4RA 3MHVC 3IG8A 3I4YA 3T6PA 2Z3XA 3HHWA 1E9SA 4DR4M 1O9KB 2F5NA 3GLGA 3HHTB 5KPRA 2MH8A 3KP1E 3KOXE 3AKZA 1P5EB 2JY8A 2BKZB 4AW4A 5EXTA 4MGZE 2X4AA 2BJVA 4WP2A 5DYGA 4BCGB 3JAMS 4IBJA 4G4QA 4F70B 1PJTA 4KRDB 1UFZA 1X37A 2KA6B 4CISA 2PHGA 1VEGA 3AV0A 4FWDA 3GLFA 2B9RA 3A8OB 2PJQA 2WXVB 3J7AS 4II5B 2R45A 1KYIA 2VIIA 3LQRA 1XO2A 2CZ7B 4RKUF 1H26B 5IZ7D 2I7NA 4L15A 3W68A 4AZFA 3A46A 1EIJA 4FWHA 2CV2A 2BPMB 4FX3B 4BB9A 3GRRA 1H1QB 2XSZA 2IW8B 2C5VB 3U6SA 3J81S 1GUXB 2EKFA 4FCVA 3FUXA 5EP4A 1PM5A 1XXHA 2WMAB 2UZDB 4QOSA 4YOSA 4EC9B 2K9DA 4F2LA 1PJIA 3KDSE 4MB7A 3OTOM 3JR4A 3E9SA 2Y20A 2JXNA 1HQYE 4DV4M 4GITA 3BHUB 2C96A 2O5RA 2JA2A 4JXJA 4XGIA 3UMMA 4LF6M 5HQ0B 4LZJA 3Q8GA 5JI2E 5CEIB 2QNJA 1IN5A 1T6OA 1YUBA 3SYLA 1JSTB 4BXXX 4F6WB 4DBGB 2DWMA 4MGKE 1JR3E 3PVSA 1I4WA 1D3UB 3FTCA 2J7NA 4MFEA 3HKPA 2KW0A 3TL4X 3LCVB 1TH3A 1FVVB 3WVEB 2I40B 1EE8A 3KOZE 4MGYE 4DUYM 2QPAA 4CXAB 3BBZA 1H6UA 2YNMD 3LMMA 2CCIB 3VFDA 3HX3A 1Q39A 2ZBKB 2L6OA 4M9ZA 5KPTA 3BLRB 4QSHA 1HT1E 2QGSA 3J7BA 2UZEB 1PRBA 1Q3BA 3IG5A 4CIZA 4PT5A 1N78A 2CZ6B 3J2PB 4OVZB 3GLHE 1SXJA 3KOWE 1G41A 2HCBA 3PFIA 1L2CA 1XC8A 1H4LD 4BCMB 3G33B 1D0LA 2EA0A 3GLIA 1R4GA 1AIPC 2ZAOA 1E7PA 1KXUA 1ZQ9A 4F7LB 2WPAB 3SMSA 3FTFA 2DD5B 1MU5A 2X49A 1G4AE 3SATA 1AHJB 1IN7A 1XMQM 3QZ5B 3HY5A 3UZUA 3UGJA 3JR5A 1AD6A 2LVPC 1WIVA 1V34A 4OW0A 4L8RC 5H37D 2R7GA 3RGSA 2WSCF 2C5NB 1SXJE 1W5TA 2KHHA 2EO2A 2V1CA 3KS4A 1XNRM 3EIEA 1DO2A 3E46A 1TH4A 3J27B 2ZPEB 4LG2A 1MN3A 3TE6A 4NC6A 3KFUG 4GC5A 4BY7X 2P5TA 5EXPA 3CF6E 2D7GA 4IBIA 1NY5A 3I51A 3VDPA 5ITTA 4CFNB 1NJFA 3TPZA 3GPXA 2MGWA 2I7PA 4PCZA 4JX4A 1HNXM 1R6BX 2CFOA 1HT2E 5E26A 4M9XA 2QZ4A 2G3QA 2Y21A 8CATA 5F3WA 3HO8A 2CRUA 2CJMB 4UN2B 2KR6A 5FTJA 4JI0M 4M6VA 4MIMA 3GLGE 1UGRB 5BPVA 3DL1A 3FD9A 3B7QA 3VYHB 4HNTA 5ICPB 1R7RA 2F4VM 1GL7A 3IHPA 4FD2A 2E5LM 2CYZB 2UU9M 1K82A 3A8LB 5EJCA 3B57A 1DGHA 4NXNM 3CF0A 3LVWA 2V22B 1YLAA 4GMQA 4XK8F 3RGFB 4ZPXA 1GABA 3QHWB 1DGBA 1NY6A 1TH2A 4DV7M 2WIPB 2LVNC 1OKSA 2RKOA 2XH9A 3FUUA 3WHKA 2ZM6M 1PJJA 4P16A 2FFJA 1G3NC 2KMGA 4EOSB 3RGPA 1V29B 4LRSA 3SFZA 1OL1B 1TR8A 1PJQA 3TWKA 2WMBB 1TDZA 4D80A 3A8GB 4FM4B 2JY6B 1GUXA 3UJNA 1YSYA 4MH0E 5ITRA 1Q3CA 4TUWA 4I8OA 4JX6A 3DFZA 3K8ZA 4IBKA 3SHGB 1UGPB 3W0LB 2LVOC 4DV6M 4DR1M 2W82A 1D0MA 2GQFA 2KRKA 2L4FA 3KOYE 4LJ8A 3SASA 3R9XB 1K3XA 4EOMB 1QVRA 1IQPA 3D8BA 1V92A 1OTRA 1NV8A 2DAIA 3FTDA 2K6BA 3MJ5A 5IREB 3T38A 3T1HM 1DO0A 3ILKA 3QXEB 1NHGC 2DZOB 4M9SA 1KFVA 1QLBA 4ROEA 2LHCA 4DV5M 2F5OA 3GTMS 2DHYA 5FSWA 4GEWA 1ZV1A 2CCHB 4YHHM 4BLCA 2W9ZA 2LWXA 5LMNM 1NHWC 5CYIB 4LRTA 1C7YA 1GO5A 3KSXA 3HU1A 5ITXE 2IW9B 1NV9A 1TFBA 2ZPIB 4BY1X 4LGYA 4QNRA 4OGRB 3B89A 4I5SA 4K0KM 1O9KA 3X25B 4F7NB 4NXMM 4IBEA 4GHAA 4CFVB 1HQCA 1R2ZA 2V1UA 1E9HB 2EUFA 2CV1A 3MY5B 3X20B 2R44A 3C3EA 2ZANA 2Z8YM 2C5OB 1PJSA 2X8AA 3EOCB 2DWZB 4JX5A 1VINA 4AQYM 1AUAA 1QQWA 3RFWA 5FLXS 2ZPBB 4F7SB 2I53A 4DR2M 3TWLA 4I4LA 4BCOB 3PXGA 3U6OA 2C5XB 3U60B 3POMA 1UGQB 1GY3B 5DQVA 4CFUB 4FVMA 5E6JA 4S12A 5IHYA 3SYKA 2L7IA 4EORB 1W5SA 5IF1B 3HJQA 1IY0A 4BCJB 4OR5B 1FINB 1GL6A 1VEJA 2QHOB 1BU2A 3HJSA 3X26B 5KQ8A 1URCB 1P3QQ 5ITYA 2JZ1A 1DGFA 1D0KA 2R0IA 3AJIB 1VDDA 1PKDB 2WHBB 2C4GB 2Z4RA 3U61B 4BCND 1ZAEA 3BG9A 4KLNA 4RNAA 4MFDA 3QYEA 4LF7M 3TNIB 3PNYA 4LZZA 2APLA 3GQ4A 3FTEA 2KXEA 3HJ8A 2JP7A 3M7GA 2A5YB 2KZSA 4L78A 3SMPA 2BS2A 1R2YA 2QFZA 3DOAA 1XXHE 4F6UB 4OB0B 2DWNA 1VOLA 3C3DA 2G8LA 4DV0M 3SAVA 4LF5M 3MI9B 4DUZM 2DENA 2EUCA 3AL0C 3AOEC 4R3DA 2X1NB 5I5ZB 4MGHA 2HHHM 1ZMUA 4L4UA 1QDTA 3U6EA 2UZBB 4NOOB 4D82A 2D0QB 3K92A 3U60A 4I3ZB 2ZTCA 3CGWA 4CFUD 3O0GD 1QZEA 2XFTA 4NSRA 5DYIA 3GQ5A 3U6CA 1L2DA 1OIZA 3LW5F 1GLNA 4NSOB 2C99A 3SARA 3NBIA 1N4MA 1Z5CA 2W96A 4IMYB 3A8HB 4BCQB 3CF2A 1JKWA 1TTEA 3EJ1B 1IY2A 1VYWB 3QZ9B 4EONB 3LQQA 1T43A 2JGZB 3M03A 4FWGA 3IECA 3HHXA 1GKIA 1I94M 3MK6A 3L25A 2C5RA 5EFQB 1OJLA 3B7ZA 5EP3A 1IXSB 2Z7JA 3Q8XA 4CGYB 1VQ1A 3U5ZB 3VKHA 1N36M 1Z5AA 3LVVA 1DGGA 1R5LA 1QAQA 2KDLA 4RF0A 5C18A 4CFMB 3L27A 5ITQA 2JY7A 2FS1A 2R4EA 4AI6A 3HBLA 4B3SM 2R6FA 1OAIA 3H4MA 2VDBB 3T1YM 4QOZC 2ZPHB 5HBEB 4DV1M 2Y0QA 3FYCA 3SBJA 3AOGA 3CTWB 3KHIA 1UGSB 4CFWB 4EOIB 4BCHB 1D2NA 1IM2A 2LVAA 3DTOA 4WURA 2UUCM 1QUTA 4L16A 4AG5A 4A3VB 4G6LB 4QNMA 4JI8M 3K2LA 4Y28F 2R4JA 2YR0A 1JSUB 4F7JB 1OIYB 4LJ4A 4IBDA 4LJ6A 1QANA 3J80S 4LJ7A 3TQSA 4DR5M 4CRLB 4DR6M 1H24B 4LFCM 4BBAA 1GJTA 3KW6A 4BCQD 4M0WA 3SHFA 1G59A 1OI9B 2H5XA 1A5TA 5BR8M 2LNHC 2QP9X 2K0BX 5KO3A 4NRWA 2XLJA 2PMIB 2FE8A 4OU7A 3FUTA 3I01M 4KRCB 4LF4M 3DJBA 4EOKB 3DDPB 2XGNA 2ZPGB 4OB2B 2CUZA 2AHJB 3TN8B 1J7KA 2JY5A 3H4JA 4IJFA 1H28B 4CFXB 3A8MB 1C1KA 2ZCFB 3L29A 1L1TA 1E32A 4OVZA 3U61A 3QAUA 4HNVA 2MJ5B 4IBGA 2WZJA 2DAKA 3A45A 4JI7M 1ORYB 2R65A 2F5PA 2C9CA 4KT0F 1DV0A 3I4VA 4ROCA 3WVDB 2QF7A
chains in the Genus database with same CATH topology
4IJEA 4LCBA 4LY6A 3GPPA 1IBLM 4LGMA 2AHMA 1QAMA 3GRYA 4GH9A 4HL4A 1HNWM 2BJWA 1L1ZA 3B9PA 3PNVA 2J7OA 1GVNA 2CE7A 4XBOA 5IWAM 3SAWA 3GLFB 3KP0E 1NNJA 4B3TM 4RF1A 4D81A 2QENA 2DWLA 1L2BA 2DD4B 4QHTA 1TDHA 1J09A 2DXBB 4GKJM 1FJGM 2CV0A 1DGHB 4QHSA 4LJ5A 4B7FA 4OX9M 3HHZA 2DXCB 3U5ZA 1XNQM 4B7HA 4ZGDB 1L8QA 5EXXA 2NQ8C 3AOEA 3THGA 3TWMA 2DPPB 2M5ZA 2ZAMA 4G4OA 1XHBA 3GPUA 1OFHA 4DR7M 4X64M 1IXZA 1YE9A 1IBMM 3L2AA 2RGHA 4IBFA 2DZNB 1WXQA 3BOSA 3T15A 4AKIA 5FTMA 3U6PA 1N77A 3FUVA 1N75A 5KPZA 3QYGB 4ZGEB 1NVMA 4GC9A 4B7GA 1QYRA 2XEPA 4BBRM 2K47A 3AFHA 4B3RM 4ITQA 3GLHB 2UXDM 5ITXA 3HGIA 4AG6A 4PD2A 4X66M 1MX0A 3HZJA 4LJ9A 2F5QA 1JR3A 3KSJA 3L28A 3D8LA 4EIWA 2XZUA 1G3IA 4JI6M 2D7EA 4AKHA 3HU3A 2DVWB 3HHYA 1N33M 2CZ0B 2FNAA 2UXCM 1FKMA 3GLIB 3WHLA 7CATA 2LH0A 3M6AA 2H1RA 2HL7A 4REZA 1Z59A 4KODA 3FKEA 1IXRC 4X62M 3FYDA 1E94E 2VQFM 3SAUA 1IBKM 3X28B 2CHGA 5C1BA 4LF8M 2OQ4A 2C98A 4IIWA 4FCWA 5FTNA 2Z4SA 4CHTB 1K3WA 2XF3A 4FCTA 4NRVA 2G77A 3A98B 4G4NA 2Q2EB 4IBBA 2HKJA 3U6DA 3R8FA 4II7A 1IREB 4Z8XA 3VK8A 1Z6TA 4M0DA 2ZPFB 2G5GX 2QQ8A 2ERCA 4LFAM 3GP1A 4GHLA 1LV7A 4NL4H 2QBYA 3VK7A 2UUBM 2QDJA 1NSFA 2CHVA 2KZUA 2Y0TA 2F5SA 2CHQA 5IT9S 2R46A 5KQDA 4DR3M 3FUWA 3DZDA 1QZMA 5EQTA 4JI5M 1SXJD 2BS4A 3VYGB 1N32M 1N34M 1J5EM 4JYAM 3SC3A 4BBSM 4ELJA 2R18A 4JI4M 3L26A 1UM8A 3H4CA 3BG5A 1NJGA 4OB1B 3X24B 2VQEM 2KEBA 2ZZDB 4HLQA 4W5WA 1JQJC 4LFBM 4DV2M 4AKGA 3GRUA 2M60A 3ZC7B 4LJAA 2DHRA 2RGOA 2C9OA 4GRIA 4G6ZA 1FNNA 3U6QA 3U6MA 3NWLA 4FW9A 5GKNA 3DA1A 5EXSA 3M0EA 1E9RA 1TGUA 2D7HA 3C58A 4Z6YA 3HB9A 3E4RA 5EP2A 4JV5M 1IN8A 4MGIE 2QBYB 1SXJB 5EP1A 1Z5BA 3KVWA 3UK6A 3QYBA 1JR3D 3HWSA 1XXHB 2YQZA 2XSZD 2QDYB 4GIPA 2UXBM 5ITUA 2CEAA 2CZ1B 2LXEA 4HNUA 5A2QS 3W0FA 1XWIA 3KXEC 1SXJC 5JI3E 1S3SA 3U6LA 2QCUA 1IN6A 4PDIA 4KO8A 4IBCA 1QAOA 3GQ3A 4JI2M 2L09A 3HU2A 5FTLA 4MM3B 3GLGB 1G8PA 1XMOM 4JI3M 3K1JA 2BS3A 2XZFA 3ZH9B 2XFSA 3A42A 4LF9M 2UUAM 2OPFA 3KS8A 4GKKM 3EIHA 5FTKA 3VDUA 4B08A 2L7HA 2V6ZM 4I81A 1K3XA 3RE8A 4DV3M 4JN6A 2FOIC 2KRUA 2DXIA 3VKGA 1IY1A 3VLFB 3GO8A 4B3MM 1HR0M 1NNUC 4PDGA 5DNYA 4YY3M 3QYHB 3GPYA 2YFQA 4X65M 3GRVA 3TW6A 1T3TA 3QWLA 4WW0A 3BG3A 2BNKA 1OFIA 4ZGJB 3GLHA 4OB3B 3ZCBB 4JI1M 2R62A 4R7GA 5LMUM 1HNZM 2WJ9A 1IN4A 4LOCA 1KSFX 4G4RA 3MHVC 3IG8A 3I4YA 2Z3XA 3HHWA 1E9SA 4DR4M 2F5NA 3GLGA 3HHTB 5KPRA 3KP1E 3KOXE 3AKZA 4AW4A 5EXTA 4MGZE 2X4AA 2BJVA 5DYGA 3JAMS 4IBJA 4G4QA 1X37A 2KA6B 4CISA 3AV0A 4FWDA 3GLFA 3A8OB 3J7AS 2R45A 1KYIA 2VIIA 3LQRA 2CZ7B 5IZ7D 2I7NA 4L15A 4AZFA 3A46A 4FWHA 2CV2A 4BB9A 3GRRA 2XSZA 3U6SA 3J81S 4FCVA 3FUXA 5EP4A 1PM5A 1XXHA 4QOSA 1PJIA 3KDSE 4MB7A 3OTOM 3JR4A 3E9SA 2Y20A 1HQYE 4DV4M 4GITA 2C96A 2O5RA 2JA2A 4JXJA 4XGIA 3UMMA 4LF6M 4LZJA 5JI2E 1IN5A 1YUBA 3SYLA 2DWMA 4MGKE 3PVSA 1I4WA 3FTCA 2J7NA 4MFEA 3HKPA 2KW0A 3TL4X 1TH3A 3WVEB 1EE8A 3KOZE 4MGYE 4DUYM 2QPAA 1H6UA 2YNMD 3LMMA 3TW7A 3VFDA 1Q39A 2ZBKB 2L6OA 4M9ZA 5KPTA 4QSHA 1HT1E 3J7BA 1Q3BA 3IG5A 2CZ6B 4PT5A 1N78A 3J2PB 4OVZB 1SXJA 3KOWE 1G41A 2HCBA 3PFIA 1L2CA 1XC8A 2EA0A 3GLIA 2ZAOA 1E7PA 1ZQ9A 3SMSA 3FTFA 2DD5B 1MU5A 2X49A 1G4AE 3SATA 1AHJB 1IN7A 1XMQM 3QZ5B 3UZUA 3UGJA 3JR5A 4OW0A 4L8RC 5H37D 3RGSA 1SXJE 1W5TA 2EO2A 2V1CA 3KS4A 1XNRM 3EIEA 1DO2A 1TH4A 3J27B 2ZPEB 4LG2A 3KFUG 3TE6A 4NC6A 4GC5A 2P5TA 5EXPA 3CF6E 2D7GA 4IBIA 1NY5A 3I51A 3VDPA 5ITTA 1NJFA 3TPZA 3GPXA 2I7PA 4PCZA 4JX4A 1HNXM 1R6BX 2CFOA 1HT2E 5E26A 4M9XA 2QZ4A 8CATA 2Y21A 5F3WA 3HO8A 2KR6A 5FTJA 4JI0M 4M6VA 4MIMA 1UGRB 5BPVA 3DL1A 3FD9A 3VYHB 4HNTA 1R7RA 2F4VM 1GL7A 4FD2A 2E5LM 2CYZB 3A8LB 2UU9M 1K82A 5EJCA 1DGHA 4NXNM 3CF0A 3LVWA 4GMQA 4ZPXA 1DGBA 1NY6A 1TH2A 4DV7M 2RKOA 3FUUA 2XH9A 3WHKA 2ZM6M 1PJJA 4P16A 2FFJA 2KMGA 3RGPA 1V29B 4LRSA 3SFZA 3TWKA 3A8GB 1TDZA 4D80A 3UJNA 1YSYA 4MH0E 5ITRA 1Q3CA 4TUWA 4I8OA 4JX6A 3DFZA 3K8ZA 4IBKA 3SHGB 1UGPB 3W0LB 4DV6M 4DR1M 2W82A 4LJ8A 2KRKA 3KOYE 3SASA 3R9XB 1QVRA 1IQPA 3D8BA 4KHPM 3FTDA 3MJ5A 3T1HM 3T38A 5IREB 1DO0A 3ILKA 3QXEB 1NHGC 2DZOB 4M9SA 1KFVA 1QLBA 4DV5M 2F5OA 5FSWA 4YHHM 4BLCA 2LWXA 5LMNM 1NHWC 4LRTA 2ZPIB 3KSXA 3HU1A 5ITXE 4LGYA 4QNRA 4K0KM 4I5SA 3X25B 4NXMM 4IBEA 4GHAA 1HQCA 1R2ZA 2V1UA 2CV1A 3X20B 2ZANA 2X8AA 2DWZB 4JX5A 4AQYM 1QQWA 3RFWA 5FLXS 2ZPBB 4DR2M 3TWLA 4I4LA 3PXGA 3U6OA 3U60B 1UGQB 4FVMA 5E6JA 4S12A 3SYKA 2L7IA 1W5SA 3HJQA 1IY0A 1GL6A 3HJSA 3X26B 5KQ8A 5ITYA 1DGFA 3AJIB 4FM4B 1VDDA 2Z4RA 3U61B 1ZAEA 3BG9A 4KLNA 4RNAA 4MFDA 3QYEA 4LF7M 3PNYA 4LZZA 3GQ4A 3FTEA 2KXEA 3HJ8A 3M7GA 4L78A 2A5YB 2KZSA 3SMPA 2BS2A 2QFZA 1R2YA 3DOAA 4OB0B 2DWNA 4DV0M 2G8LA 3SAVA 4LF5M 4DUZM 3AL0C 2EUCA 3AOEC 4R3DA 4MGHA 2HHHM 4L4UA 3U6EA 4NOOB 4D82A 2D0QB 3K92A 3U60A 2XFTA 4NSRA 5DYIA 3GQ5A 3U6CA 1L2DA 4NSOB 1GLNA 2C99A 3SARA 3NBIA 1Z5CA 3A8HB 3CF2A 1IY2A 3QZ9B 3LQQA 4FWGA 3HHXA 1GKIA 1I94M 3MK6A 3L25A 2C5RA 1OJLA 5EP3A 1IXSB 2Z7JA 3Q8XA 4CGYB 3U5ZB 3VKHA 1N36M 1Z5AA 3LVVA 1DGGA 1QAQA 4RF0A 5C18A 3L27A 5ITQA 2R4EA 4AI6A 3HBLA 4B3SM 3H4MA 4QOZC 2ZPHB 3T1YM 4DV1M 2Y0QA 3FYCA 3SBJA 3AOGA 3CTWB 3KHIA 1UGSB 1D2NA 1IM2A 4WURA 2UUCM 4L16A 4AG5A 4A3VB 4QNMA 4JI8M 3K2LA 2R4JA 2YR0A 4LJ4A 4IBDA 4LJ6A 1QANA 3J80S 4LJ7A 3TQSA 4DR5M 4DR6M 4LFCM 4BBAA 3KW6A 4M0WA 3SHFA 1G59A 5BR8M 2LNHC 2QP9X 5KO3A 4NRWA 2XLJA 2FE8A 4OU7A 3FUTA 4LF4M 2XGNA 2ZPGB 4OB2B 2CUZA 2AHJB 1J7KA 4IJFA 3A8MB 1C1KA 2ZCFB 3L29A 1L1TA 1E32A 4OVZA 3U61A 3QAUA 4HNVA 4IBGA 4JI7M 3A45A 1ORYB 2R65A 2F5PA 2C9CA 3I4VA 3WVDB 2QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC6 A;  4HLQ A;  5EJC A;  2G77 A;  1FKM A;  3HZJ A;  3QYB A;  4HL4 A;  3QYE A;  4Z6Y A;  2QQ8 A;  2QFZ A;  3QWL A; 
#chains in the Genus database with same CATH topology
 4IJE A;  4LCB A;  4LY6 A;  3GPP A;  2WSF F;  1IBL M;  3B7N A;  4LGM A;  2AHM A;  1F5Q B;  1QAM A;  2LHG A;  2MRO B;  3GRY A;  4GH9 A;  4HL4 A;  1HNW M;  2G9X B;  2BJW A;  1L1Z A;  5IDP B;  3B9P A;  3C9P A;  2O25 A;  2J7O A;  1GVN A;  2CE7 A;  2J5Y A;  2JWS A;  3PNV A;  4XBO A;  5IWA M;  3SAW A;  3GLF B;  2DAE A;  3KP0 E;  1NNJ A;  4B3T M;  4RF1 A;  2B3T A;  2QEN A;  4D81 A;  2DWL A;  2UZL B;  3EID B;  4ANR A;  1L2B A;  4QHT A;  3MMP A;  2DD4 B;  1TDH A;  1J09 A;  2QSF X;  3FE3 A;  4GKJ M;  1RU3 A;  2CV0 A;  2OO9 A;  1FJG M;  1DGH B;  2DXB B;  4QHS A;  2CWB A;  4LJ5 A;  4B7F A;  2HAK A;  3HHZ A;  3U5Z A;  1G71 A;  4OX9 M;  1VG5 A;  1XNQ M;  4B7H A;  2DXC B;  1L8Q A;  3BLQ B;  4ZGD B;  5EXX A;  2NQ8 C;  2OOB A;  3AOE A;  3THG A;  3TWM A;  2DPP B;  2M5Z A;  2ZAM A;  4NST B;  4F6S B;  3W67 A;  4G4O A;  1XHB A;  3LQ5 B;  3GPU A;  2VF7 A;  1OFH A;  4DR7 M;  3K7A M;  4X64 M;  1VDL A;  2W2H A;  2WSE F;  1IXZ A;  1H1P B;  1YE9 A;  4EOJ B;  1IBM M;  3L2A A;  2RGH A;  4IBF A;  2DZN B;  1WXQ A;  3BOS A;  3T15 A;  4AKI A;  5FTM A;  2BWB A;  1ZMV A;  3U6P A;  3FUV A;  1N77 A;  1OGU B;  1N75 A;  5KPZ A;  3QYG B;  4BCN B;  1NVM A;  4GC9 A;  4ZGE B;  4B7G A;  5LMK B;  1QYR A;  2XEP A;  4BBR M;  2K47 A;  5HVY B;  1V33 A;  3AFH A;  4ITQ A;  3GLH B;  4B3R M;  5ITX A;  2UXD M;  1W98 B;  3HGI A;  4YOZ A;  4AG6 A;  4PD2 A;  4UN0 A;  1H1S B;  4X66 M;  4ROD A;  1MX0 A;  3HZJ A;  4LJ9 A;  2F5Q A;  1JR3 A;  5L2W B;  3KSJ A;  3L28 A;  3D8L A;  4EIW A;  1WJ7 A;  3F5X B;  2XZU A;  1G3I A;  4JI6 M;  1ENW A;  2D7E A;  2CP8 A;  2KNV A;  4AKH A;  3HU3 A;  2DVW B;  4EC8 B;  2PK9 B;  1JB0 F;  3F92 A;  3HHY A;  3X28 B;  4G3O A;  1HJP A;  1NO1 A;  1N33 M;  2GNO A;  3FRI A;  2FNA A;  2CZ0 B;  2LW4 A;  2UXC M;  1JOW A;  1FKM A;  1TF0 B;  3GLI B;  3WHL A;  4TTH A;  7CAT A;  2LH0 A;  1TD6 A;  1LTM A;  2H1R A;  2HL7 A;  3M6A A;  4REZ A;  1Z59 A;  4KOD A;  2UUE B;  1C9B A;  3FKE A;  2EJS A;  2JZ0 A;  3V76 A;  1IXR C;  4X62 M;  3FYD A;  1E94 E;  2VQF M;  3SAU A;  2LTU A;  4Q7J A;  2CHG A;  4HEO A;  5C1B A;  1IBK M;  2OQ4 A;  2C98 A;  4IIW A;  4LF8 M;  4FCW A;  5FTN A;  2IW6 B;  2OOA A;  1AIS B;  1VEK A;  2Z4S A;  4CHT B;  1K3W A;  3LCU A;  4KHP M;  2XF3 A;  4FCT A;  4NRV A;  1OL2 B;  2G77 A;  1SG9 A;  3A98 B;  4G4N A;  3BLH B;  5DQW A;  2L2D A;  3ZQJ A;  2Q2E B;  4IBB A;  2HKJ A;  2L4E A;  2DKL A;  3U6D A;  3R8F A;  4II7 A;  1IRE B;  4Z8X A;  3VK8 A;  2FH0 A;  3QHR B;  3BHV B;  1Z6T A;  4M0D A;  4EOL B;  1GH6 B;  2ZPF B;  2G5G X;  2QQ8 A;  1XB2 B;  2ERC A;  4LFA M;  3GP1 A;  4GHL A;  3MIA B;  1LV7 A;  3TW7 A;  4NL4 H;  2QBY A;  1WHC A;  3VK7 A;  2UUB M;  1CUK A;  1H25 B;  3BHT B;  3PO3 S;  2QDJ A;  1NSF A;  1UNH D;  4EOP B;  2CHV A;  2KZU A;  2Y0T A;  2F5S A;  2CHQ A;  5IT9 S;  2W99 A;  2KNZ A;  2WIH B;  4BCP B;  2R46 A;  5KQD A;  4F1I A;  2DZL A;  4DR3 M;  3FUW A;  2DNA A;  3DZD A;  1QZM A;  5EQT A;  4EOO B;  4JI5 M;  1SXJ D;  2BS4 A;  2WEV B;  5ACB A;  3GLF E;  3VYG B;  4R71 A;  4Y72 B;  1N32 M;  1WGL A;  1N34 M;  1J5E M;  4JYA M;  3SC3 A;  4BBS M;  4ELJ A;  2R18 A;  1WGN A;  4JI4 M;  5HNB B;  3L26 A;  1UM8 A;  3H4C A;  3BG5 A;  1NJG A;  3K9O A;  1ZP2 A;  3B74 A;  4OB1 B;  3X24 B;  2VQE M;  2KEB A;  2ZZD B;  4HLQ A;  4W5W A;  1JQJ C;  4LFB M;  3TNW B;  4DV2 M;  4AKG A;  1H1R B;  2MR9 A;  3GRU A;  2M60 A;  1UNG D;  3ZC7 B;  1ZMW A;  4LJA A;  1BVS A;  4YC3 B;  3NBX X;  2DHR A;  1OIU B;  2RGO A;  2C9O A;  5L8R F;  1IXS A;  4GRI A;  2IN3 A;  1MJG M;  4G6Z A;  2LBC A;  1FNN A;  3U6Q A;  2C6T B;  3U6M A;  2VF8 A;  3NWL A;  4FW9 A;  3TNH B;  5GKN A;  4CJ6 A;  3DA1 A;  5EXS A;  3M0E A;  5BNJ B;  1QDR A;  1E9R A;  1TGU A;  2D7H A;  3C58 A;  4Z6Y A;  2W9F A;  2EKK A;  3E4R A;  3HB9 A;  5EP2 A;  4JV5 M;  1IN8 A;  3I04 M;  4MGI E;  2QBY B;  2WFY B;  1OAO C;  1SXJ B;  5DFL A;  5EP1 A;  1Y8G A;  1Z5B A;  3KVW A;  3QYB A;  3UK6 A;  3GLI E;  1JR3 D;  4BCI B;  3HWS A;  3K9P A;  4BCF B;  1XXH B;  2YQZ A;  2XSZ D;  4L6V 6;  4GIP A;  2UXB M;  1H27 B;  2F2C A;  5ITU A;  2QDY B;  2CEA A;  2JNH A;  2LXE A;  2CZ1 B;  4ELL A;  1GJS A;  3E21 A;  4HNU A;  1PGY A;  3W0F A;  1XWI A;  2DI0 A;  5A2Q S;  3KXE C;  1WR1 B;  1SXJ C;  5JI3 E;  1S3S A;  2HWJ A;  2KNA A;  2QCU A;  3U6L A;  1IN6 A;  4PDI A;  4KO8 A;  4IBC A;  1QAO A;  2LVQ D;  3GQ3 A;  2L09 A;  4JI2 M;  3HU2 A;  4YOO A;  4EOQ B;  5FTL A;  2DME A;  4MM3 B;  3GLG B;  3FRH A;  1G8P A;  1XMO M;  4JI3 M;  3K1J A;  2BS3 A;  2XZF A;  1QUS A;  1QMZ B;  3ZH9 B;  2BWE A;  1UNL D;  2XFS A;  5IDN B;  3A42 A;  4LF9 M;  5HBH B;  2UUA M;  2OPF A;  3KS8 A;  4GKK M;  3DOG B;  3EIH A;  5FTK A;  3VDU A;  4B08 A;  2N35 A;  1OKV B;  3MY1 B;  1EFU B;  2L7H A;  2V6Z M;  2ZTD A;  2RRU A;  4I81 A;  4JN6 A;  2FOI C;  2KRU A;  3RE8 A;  2O01 F;  4DV3 M;  2DXI A;  1IY1 A;  3VLF B;  3GO8 A;  4B3M M;  3DDQ B;  1HR0 M;  1NNU C;  4PDG A;  5DNY A;  3VKG A;  5HBJ B;  2IVX A;  4YY3 M;  3QYH B;  5LQF B;  3GPY A;  2PK2 A;  2YFQ A;  4X65 M;  3BXW A;  1F4I A;  3GRV A;  3TW6 A;  1OIP A;  1T3T A;  3QWL A;  4WW0 A;  1OQY A;  4BCM D;  3NDQ A;  3BG3 A;  2BNK A;  1OFI A;  1IFY A;  1Q02 A;  4P17 A;  4ZGJ B;  3GLH A;  4OB3 B;  3ZCB B;  4JI1 M;  2JUJ A;  2R62 A;  1OKW B;  5FGK B;  4R7G A;  5LMU M;  1HNZ M;  2WJ9 A;  4BCK B;  1IN4 A;  4LOC A;  1KSF X;  2DAG A;  2DAM A;  4G4R A;  3MHV C;  3IG8 A;  3I4Y A;  3T6P A;  2Z3X A;  3HHW A;  1E9S A;  4DR4 M;  1O9K B;  2F5N A;  3GLG A;  3HHT B;  5KPR A;  2MH8 A;  3KP1 E;  3KOX E;  3AKZ A;  1P5E B;  2JY8 A;  2BKZ B;  4AW4 A;  5EXT A;  4MGZ E;  2X4A A;  2BJV A;  4WP2 A;  5DYG A;  4BCG B;  3JAM S;  4IBJ A;  4G4Q A;  4F70 B;  1PJT A;  4KRD B;  1UFZ A;  1X37 A;  2KA6 B;  4CIS A;  2PHG A;  1VEG A;  3AV0 A;  4FWD A;  3GLF A;  2B9R A;  3A8O B;  2PJQ A;  2WXV B;  3J7A S;  4II5 B;  2R45 A;  1KYI A;  2VII A;  3LQR A;  1XO2 A;  2CZ7 B;  4RKU F;  1H26 B;  5IZ7 D;  2I7N A;  4L15 A;  3W68 A;  4AZF A;  3A46 A;  1EIJ A;  4FWH A;  2CV2 A;  2BPM B;  4FX3 B;  4BB9 A;  3GRR A;  1H1Q B;  2XSZ A;  2IW8 B;  2C5V B;  3U6S A;  3J81 S;  1GUX B;  2EKF A;  4FCV A;  3FUX A;  5EP4 A;  1PM5 A;  1XXH A;  2WMA B;  2UZD B;  4QOS A;  4YOS A;  4EC9 B;  2K9D A;  4F2L A;  1PJI A;  3KDS E;  4MB7 A;  3OTO M;  3JR4 A;  3E9S A;  2Y20 A;  2JXN A;  1HQY E;  4DV4 M;  4GIT A;  3BHU B;  2C96 A;  2O5R A;  2JA2 A;  4JXJ A;  4XGI A;  3UMM A;  4LF6 M;  5HQ0 B;  4LZJ A;  3Q8G A;  5JI2 E;  5CEI B;  2QNJ A;  1IN5 A;  1T6O A;  1YUB A;  3SYL A;  1JST B;  4BXX X;  4F6W B;  4DBG B;  2DWM A;  4MGK E;  1JR3 E;  3PVS A;  1I4W A;  1D3U B;  3FTC A;  2J7N A;  4MFE A;  3HKP A;  2KW0 A;  3TL4 X;  3LCV B;  1TH3 A;  1FVV B;  3WVE B;  2I40 B;  1EE8 A;  3KOZ E;  4MGY E;  4DUY M;  2QPA A;  4CXA B;  3BBZ A;  1H6U A;  2YNM D;  3LMM A;  2CCI B;  3VFD A;  3HX3 A;  1Q39 A;  2ZBK B;  2L6O A;  4M9Z A;  5KPT A;  3BLR B;  4QSH A;  1HT1 E;  2QGS A;  3J7B A;  2UZE B;  1PRB A;  1Q3B A;  3IG5 A;  4CIZ A;  4PT5 A;  1N78 A;  2CZ6 B;  3J2P B;  4OVZ B;  3GLH E;  1SXJ A;  3KOW E;  1G41 A;  2HCB A;  3PFI A;  1L2C A;  1XC8 A;  1H4L D;  4BCM B;  3G33 B;  1D0L A;  2EA0 A;  3GLI A;  1R4G A;  1AIP C;  2ZAO A;  1E7P A;  1KXU A;  1ZQ9 A;  4F7L B;  2WPA B;  3SMS A;  3FTF A;  2DD5 B;  1MU5 A;  2X49 A;  1G4A E;  3SAT A;  1AHJ B;  1IN7 A;  1XMQ M;  3QZ5 B;  3HY5 A;  3UZU A;  3UGJ A;  3JR5 A;  1AD6 A;  2LVP C;  1WIV A;  1V34 A;  4OW0 A;  4L8R C;  5H37 D;  2R7G A;  3RGS A;  2WSC F;  2C5N B;  1SXJ E;  1W5T A;  2KHH A;  2EO2 A;  2V1C A;  3KS4 A;  1XNR M;  3EIE A;  1DO2 A;  3E46 A;  1TH4 A;  3J27 B;  2ZPE B;  4LG2 A;  1MN3 A;  3TE6 A;  4NC6 A;  3KFU G;  4GC5 A;  4BY7 X;  2P5T A;  5EXP A;  3CF6 E;  2D7G A;  4IBI A;  1NY5 A;  3I51 A;  3VDP A;  5ITT A;  4CFN B;  1NJF A;  3TPZ A;  3GPX A;  2MGW A;  2I7P A;  4PCZ A;  4JX4 A;  1HNX M;  1R6B X;  2CFO A;  1HT2 E;  5E26 A;  4M9X A;  2QZ4 A;  2G3Q A;  2Y21 A;  8CAT A;  5F3W A;  3HO8 A;  2CRU A;  2CJM B;  4UN2 B;  2KR6 A;  5FTJ A;  4JI0 M;  4M6V A;  4MIM A;  3GLG E;  1UGR B;  5BPV A;  3DL1 A;  3FD9 A;  3B7Q A;  3VYH B;  4HNT A;  5ICP B;  1R7R A;  2F4V M;  1GL7 A;  3IHP A;  4FD2 A;  2E5L M;  2CYZ B;  2UU9 M;  1K82 A;  3A8L B;  5EJC A;  3B57 A;  1DGH A;  4NXN M;  3CF0 A;  3LVW A;  2V22 B;  1YLA A;  4GMQ A;  4XK8 F;  3RGF B;  4ZPX A;  1GAB A;  3QHW B;  1DGB A;  1NY6 A;  1TH2 A;  4DV7 M;  2WIP B;  2LVN C;  1OKS A;  2RKO A;  2XH9 A;  3FUU A;  3WHK A;  2ZM6 M;  1PJJ A;  4P16 A;  2FFJ A;  1G3N C;  2KMG A;  4EOS B;  3RGP A;  1V29 B;  4LRS A;  3SFZ A;  1OL1 B;  1TR8 A;  1PJQ A;  3TWK A;  2WMB B;  1TDZ A;  4D80 A;  3A8G B;  4FM4 B;  2JY6 B;  1GUX A;  3UJN A;  1YSY A;  4MH0 E;  5ITR A;  1Q3C A;  4TUW A;  4I8O A;  4JX6 A;  3DFZ A;  3K8Z A;  4IBK A;  3SHG B;  1UGP B;  3W0L B;  2LVO C;  4DV6 M;  4DR1 M;  2W82 A;  1D0M A;  2GQF A;  2KRK A;  2L4F A;  3KOY E;  4LJ8 A;  3SAS A;  3R9X B;  1K3X A;  4EOM B;  1QVR A;  1IQP A;  3D8B A;  1V92 A;  1OTR A;  1NV8 A;  2DAI A;  3FTD A;  2K6B A;  3MJ5 A;  5IRE B;  3T38 A;  3T1H M;  1DO0 A;  3ILK A;  3QXE B;  1NHG C;  2DZO B;  4M9S A;  1KFV A;  1QLB A;  4ROE A;  2LHC A;  4DV5 M;  2F5O A;  3GTM S;  2DHY A;  5FSW A;  4GEW A;  1ZV1 A;  2CCH B;  4YHH M;  4BLC A;  2W9Z A;  2LWX A;  5LMN M;  1NHW C;  5CYI B;  4LRT A;  1C7Y A;  1GO5 A;  3KSX A;  3HU1 A;  5ITX E;  2IW9 B;  1NV9 A;  1TFB A;  2ZPI B;  4BY1 X;  4LGY A;  4QNR A;  4OGR B;  3B89 A;  4I5S A;  4K0K M;  1O9K A;  3X25 B;  4F7N B;  4NXM M;  4IBE A;  4GHA A;  4CFV B;  1HQC A;  1R2Z A;  2V1U A;  1E9H B;  2EUF A;  2CV1 A;  3MY5 B;  3X20 B;  2R44 A;  3C3E A;  2ZAN A;  2Z8Y M;  2C5O B;  1PJS A;  2X8A A;  3EOC B;  2DWZ B;  4JX5 A;  1VIN A;  4AQY M;  1AUA A;  1QQW A;  3RFW A;  5FLX S;  2ZPB B;  4F7S B;  2I53 A;  4DR2 M;  3TWL A;  4I4L A;  4BCO B;  3PXG A;  3U6O A;  2C5X B;  3U60 B;  3POM A;  1UGQ B;  1GY3 B;  5DQV A;  4CFU B;  4FVM A;  5E6J A;  4S12 A;  5IHY A;  3SYK A;  2L7I A;  4EOR B;  1W5S A;  5IF1 B;  3HJQ A;  1IY0 A;  4BCJ B;  4OR5 B;  1FIN B;  1GL6 A;  1VEJ A;  2QHO B;  1BU2 A;  3HJS A;  3X26 B;  5KQ8 A;  1URC B;  1P3Q Q;  5ITY A;  2JZ1 A;  1DGF A;  1D0K A;  2R0I A;  3AJI B;  1VDD A;  1PKD B;  2WHB B;  2C4G B;  2Z4R A;  3U61 B;  4BCN D;  1ZAE A;  3BG9 A;  4KLN A;  4RNA A;  4MFD A;  3QYE A;  4LF7 M;  3TNI B;  3PNY A;  4LZZ A;  2APL A;  3GQ4 A;  3FTE A;  2KXE A;  3HJ8 A;  2JP7 A;  3M7G A;  2A5Y B;  2KZS A;  4L78 A;  3SMP A;  2BS2 A;  1R2Y A;  2QFZ A;  3DOA A;  1XXH E;  4F6U B;  4OB0 B;  2DWN A;  1VOL A;  3C3D A;  2G8L A;  4DV0 M;  3SAV A;  4LF5 M;  3MI9 B;  4DUZ M;  2DEN A;  2EUC A;  3AL0 C;  3AOE C;  4R3D A;  2X1N B;  5I5Z B;  4MGH A;  2HHH M;  1ZMU A;  4L4U A;  1QDT A;  3U6E A;  2UZB B;  4NOO B;  4D82 A;  2D0Q B;  3K92 A;  3U60 A;  4I3Z B;  2ZTC A;  3CGW A;  4CFU D;  3O0G D;  1QZE A;  2XFT A;  4NSR A;  5DYI A;  3GQ5 A;  3U6C A;  1L2D A;  1OIZ A;  3LW5 F;  1GLN A;  4NSO B;  2C99 A;  3SAR A;  3NBI A;  1N4M A;  1Z5C A;  2W96 A;  4IMY B;  3A8H B;  4BCQ B;  3CF2 A;  1JKW A;  1TTE A;  3EJ1 B;  1IY2 A;  1VYW B;  3QZ9 B;  4EON B;  3LQQ A;  1T43 A;  2JGZ B;  3M03 A;  4FWG A;  3IEC A;  3HHX A;  1GKI A;  1I94 M;  3MK6 A;  3L25 A;  2C5R A;  5EFQ B;  1OJL A;  3B7Z A;  5EP3 A;  1IXS B;  2Z7J A;  3Q8X A;  4CGY B;  1VQ1 A;  3U5Z B;  3VKH A;  1N36 M;  1Z5A A;  3LVV A;  1DGG A;  1R5L A;  1QAQ A;  2KDL A;  4RF0 A;  5C18 A;  4CFM B;  3L27 A;  5ITQ A;  2JY7 A;  2FS1 A;  2R4E A;  4AI6 A;  3HBL A;  4B3S M;  2R6F A;  1OAI A;  3H4M A;  2VDB B;  3T1Y M;  4QOZ C;  2ZPH B;  5HBE B;  4DV1 M;  2Y0Q A;  3FYC A;  3SBJ A;  3AOG A;  3CTW B;  3KHI A;  1UGS B;  4CFW B;  4EOI B;  4BCH B;  1D2N A;  1IM2 A;  2LVA A;  3DTO A;  4WUR A;  2UUC M;  1QUT A;  4L16 A;  4AG5 A;  4A3V B;  4G6L B;  4QNM A;  4JI8 M;  3K2L A;  4Y28 F;  2R4J A;  2YR0 A;  1JSU B;  4F7J B;  1OIY B;  4LJ4 A;  4IBD A;  4LJ6 A;  1QAN A;  3J80 S;  4LJ7 A;  3TQS A;  4DR5 M;  4CRL B;  4DR6 M;  1H24 B;  4LFC M;  4BBA A;  1GJT A;  3KW6 A;  4BCQ D;  4M0W A;  3SHF A;  1G59 A;  1OI9 B;  2H5X A;  1A5T A;  5BR8 M;  2LNH C;  2QP9 X;  2K0B X;  5KO3 A;  4NRW A;  2XLJ A;  2PMI B;  2FE8 A;  4OU7 A;  3FUT A;  3I01 M;  4KRC B;  4LF4 M;  3DJB A;  4EOK B;  3DDP B;  2XGN A;  2ZPG B;  4OB2 B;  2CUZ A;  2AHJ B;  3TN8 B;  1J7K A;  2JY5 A;  3H4J A;  4IJF A;  1H28 B;  4CFX B;  3A8M B;  1C1K A;  2ZCF B;  3L29 A;  1L1T A;  1E32 A;  4OVZ A;  3U61 A;  3QAU A;  4HNV A;  2MJ5 B;  4IBG A;  2WZJ A;  2DAK A;  3A45 A;  4JI7 M;  1ORY B;  2R65 A;  2F5P A;  2C9C A;  4KT0 F;  1DV0 A;  3I4V A;  4ROC A;  3WVD B;  2QF7 A; 
#chains in the Genus database with same CATH homology
 4IJE A;  4LCB A;  4LY6 A;  3GPP A;  1IBL M;  4LGM A;  2AHM A;  1QAM A;  3GRY A;  4GH9 A;  4HL4 A;  1HNW M;  2BJW A;  1L1Z A;  3B9P A;  3PNV A;  2J7O A;  1GVN A;  2CE7 A;  4XBO A;  5IWA M;  3SAW A;  3GLF B;  3KP0 E;  1NNJ A;  4B3T M;  4RF1 A;  4D81 A;  2QEN A;  2DWL A;  1L2B A;  2DD4 B;  4QHT A;  1TDH A;  1J09 A;  2DXB B;  4GKJ M;  1FJG M;  2CV0 A;  1DGH B;  4QHS A;  4LJ5 A;  4B7F A;  4OX9 M;  3HHZ A;  2DXC B;  3U5Z A;  1XNQ M;  4B7H A;  4ZGD B;  1L8Q A;  5EXX A;  2NQ8 C;  3AOE A;  3THG A;  3TWM A;  2DPP B;  2M5Z A;  2ZAM A;  4G4O A;  1XHB A;  3GPU A;  1OFH A;  4DR7 M;  4X64 M;  1IXZ A;  1YE9 A;  1IBM M;  3L2A A;  2RGH A;  4IBF A;  2DZN B;  1WXQ A;  3BOS A;  3T15 A;  4AKI A;  5FTM A;  3U6P A;  1N77 A;  3FUV A;  1N75 A;  5KPZ A;  3QYG B;  4ZGE B;  1NVM A;  4GC9 A;  4B7G A;  1QYR A;  2XEP A;  4BBR M;  2K47 A;  3AFH A;  4B3R M;  4ITQ A;  3GLH B;  2UXD M;  5ITX A;  3HGI A;  4AG6 A;  4PD2 A;  4X66 M;  1MX0 A;  3HZJ A;  4LJ9 A;  2F5Q A;  1JR3 A;  3KSJ A;  3L28 A;  3D8L A;  4EIW A;  2XZU A;  1G3I A;  4JI6 M;  2D7E A;  4AKH A;  3HU3 A;  2DVW B;  3HHY A;  1N33 M;  2CZ0 B;  2FNA A;  2UXC M;  1FKM A;  3GLI B;  3WHL A;  7CAT A;  2LH0 A;  3M6A A;  2H1R A;  2HL7 A;  4REZ A;  1Z59 A;  4KOD A;  3FKE A;  1IXR C;  4X62 M;  3FYD A;  1E94 E;  2VQF M;  3SAU A;  1IBK M;  3X28 B;  2CHG A;  5C1B A;  4LF8 M;  2OQ4 A;  2C98 A;  4IIW A;  4FCW A;  5FTN A;  2Z4S A;  4CHT B;  1K3W A;  2XF3 A;  4FCT A;  4NRV A;  2G77 A;  3A98 B;  4G4N A;  2Q2E B;  4IBB A;  2HKJ A;  3U6D A;  3R8F A;  4II7 A;  1IRE B;  4Z8X A;  3VK8 A;  1Z6T A;  4M0D A;  2ZPF B;  2G5G X;  2QQ8 A;  2ERC A;  4LFA M;  3GP1 A;  4GHL A;  1LV7 A;  4NL4 H;  2QBY A;  3VK7 A;  2UUB M;  2QDJ A;  1NSF A;  2CHV A;  2KZU A;  2Y0T A;  2F5S A;  2CHQ A;  5IT9 S;  2R46 A;  5KQD A;  4DR3 M;  3FUW A;  3DZD A;  1QZM A;  5EQT A;  4JI5 M;  1SXJ D;  2BS4 A;  3VYG B;  1N32 M;  1N34 M;  1J5E M;  4JYA M;  3SC3 A;  4BBS M;  4ELJ A;  2R18 A;  4JI4 M;  3L26 A;  1UM8 A;  3H4C A;  3BG5 A;  1NJG A;  4OB1 B;  3X24 B;  2VQE M;  2KEB A;  2ZZD B;  4HLQ A;  4W5W A;  1JQJ C;  4LFB M;  4DV2 M;  4AKG A;  3GRU A;  2M60 A;  3ZC7 B;  4LJA A;  2DHR A;  2RGO A;  2C9O A;  4GRI A;  4G6Z A;  1FNN A;  3U6Q A;  3U6M A;  3NWL A;  4FW9 A;  5GKN A;  3DA1 A;  5EXS A;  3M0E A;  1E9R A;  1TGU A;  2D7H A;  3C58 A;  4Z6Y A;  3HB9 A;  3E4R A;  5EP2 A;  4JV5 M;  1IN8 A;  4MGI E;  2QBY B;  1SXJ B;  5EP1 A;  1Z5B A;  3KVW A;  3UK6 A;  3QYB A;  1JR3 D;  3HWS A;  1XXH B;  2YQZ A;  2XSZ D;  2QDY B;  4GIP A;  2UXB M;  5ITU A;  2CEA A;  2CZ1 B;  2LXE A;  4HNU A;  5A2Q S;  3W0F A;  1XWI A;  3KXE C;  1SXJ C;  5JI3 E;  1S3S A;  3U6L A;  2QCU A;  1IN6 A;  4PDI A;  4KO8 A;  4IBC A;  1QAO A;  3GQ3 A;  4JI2 M;  2L09 A;  3HU2 A;  5FTL A;  4MM3 B;  3GLG B;  1G8P A;  1XMO M;  4JI3 M;  3K1J A;  2BS3 A;  2XZF A;  3ZH9 B;  2XFS A;  3A42 A;  4LF9 M;  2UUA M;  2OPF A;  3KS8 A;  4GKK M;  3EIH A;  5FTK A;  3VDU A;  4B08 A;  2L7H A;  2V6Z M;  4I81 A;  1K3X A;  3RE8 A;  4DV3 M;  4JN6 A;  2FOI C;  2KRU A;  2DXI A;  3VKG A;  1IY1 A;  3VLF B;  3GO8 A;  4B3M M;  1HR0 M;  1NNU C;  4PDG A;  5DNY A;  4YY3 M;  3QYH B;  3GPY A;  2YFQ A;  4X65 M;  3GRV A;  3TW6 A;  1T3T A;  3QWL A;  4WW0 A;  3BG3 A;  2BNK A;  1OFI A;  4ZGJ B;  3GLH A;  4OB3 B;  3ZCB B;  4JI1 M;  2R62 A;  4R7G A;  5LMU M;  1HNZ M;  2WJ9 A;  1IN4 A;  4LOC A;  1KSF X;  4G4R A;  3MHV C;  3IG8 A;  3I4Y A;  2Z3X A;  3HHW A;  1E9S A;  4DR4 M;  2F5N A;  3GLG A;  3HHT B;  5KPR A;  3KP1 E;  3KOX E;  3AKZ A;  4AW4 A;  5EXT A;  4MGZ E;  2X4A A;  2BJV A;  5DYG A;  3JAM S;  4IBJ A;  4G4Q A;  1X37 A;  2KA6 B;  4CIS A;  3AV0 A;  4FWD A;  3GLF A;  3A8O B;  3J7A S;  2R45 A;  1KYI A;  2VII A;  3LQR A;  2CZ7 B;  5IZ7 D;  2I7N A;  4L15 A;  4AZF A;  3A46 A;  4FWH A;  2CV2 A;  4BB9 A;  3GRR A;  2XSZ A;  3U6S A;  3J81 S;  4FCV A;  3FUX A;  5EP4 A;  1PM5 A;  1XXH A;  4QOS A;  1PJI A;  3KDS E;  4MB7 A;  3OTO M;  3JR4 A;  3E9S A;  2Y20 A;  1HQY E;  4DV4 M;  4GIT A;  2C96 A;  2O5R A;  2JA2 A;  4JXJ A;  4XGI A;  3UMM A;  4LF6 M;  4LZJ A;  5JI2 E;  1IN5 A;  1YUB A;  3SYL A;  2DWM A;  4MGK E;  3PVS A;  1I4W A;  3FTC A;  2J7N A;  4MFE A;  3HKP A;  2KW0 A;  3TL4 X;  1TH3 A;  3WVE B;  1EE8 A;  3KOZ E;  4MGY E;  4DUY M;  2QPA A;  1H6U A;  2YNM D;  3LMM A;  3TW7 A;  3VFD A;  1Q39 A;  2ZBK B;  2L6O A;  4M9Z A;  5KPT A;  4QSH A;  1HT1 E;  3J7B A;  1Q3B A;  3IG5 A;  2CZ6 B;  4PT5 A;  1N78 A;  3J2P B;  4OVZ B;  1SXJ A;  3KOW E;  1G41 A;  2HCB A;  3PFI A;  1L2C A;  1XC8 A;  2EA0 A;  3GLI A;  2ZAO A;  1E7P A;  1ZQ9 A;  3SMS A;  3FTF A;  2DD5 B;  1MU5 A;  2X49 A;  1G4A E;  3SAT A;  1AHJ B;  1IN7 A;  1XMQ M;  3QZ5 B;  3UZU A;  3UGJ A;  3JR5 A;  4OW0 A;  4L8R C;  5H37 D;  3RGS A;  1SXJ E;  1W5T A;  2EO2 A;  2V1C A;  3KS4 A;  1XNR M;  3EIE A;  1DO2 A;  1TH4 A;  3J27 B;  2ZPE B;  4LG2 A;  3KFU G;  3TE6 A;  4NC6 A;  4GC5 A;  2P5T A;  5EXP A;  3CF6 E;  2D7G A;  4IBI A;  1NY5 A;  3I51 A;  3VDP A;  5ITT A;  1NJF A;  3TPZ A;  3GPX A;  2I7P A;  4PCZ A;  4JX4 A;  1HNX M;  1R6B X;  2CFO A;  1HT2 E;  5E26 A;  4M9X A;  2QZ4 A;  8CAT A;  2Y21 A;  5F3W A;  3HO8 A;  2KR6 A;  5FTJ A;  4JI0 M;  4M6V A;  4MIM A;  1UGR B;  5BPV A;  3DL1 A;  3FD9 A;  3VYH B;  4HNT A;  1R7R A;  2F4V M;  1GL7 A;  4FD2 A;  2E5L M;  2CYZ B;  3A8L B;  2UU9 M;  1K82 A;  5EJC A;  1DGH A;  4NXN M;  3CF0 A;  3LVW A;  4GMQ A;  4ZPX A;  1DGB A;  1NY6 A;  1TH2 A;  4DV7 M;  2RKO A;  3FUU A;  2XH9 A;  3WHK A;  2ZM6 M;  1PJJ A;  4P16 A;  2FFJ A;  2KMG A;  3RGP A;  1V29 B;  4LRS A;  3SFZ A;  3TWK A;  3A8G B;  1TDZ A;  4D80 A;  3UJN A;  1YSY A;  4MH0 E;  5ITR A;  1Q3C A;  4TUW A;  4I8O A;  4JX6 A;  3DFZ A;  3K8Z A;  4IBK A;  3SHG B;  1UGP B;  3W0L B;  4DV6 M;  4DR1 M;  2W82 A;  4LJ8 A;  2KRK A;  3KOY E;  3SAS A;  3R9X B;  1QVR A;  1IQP A;  3D8B A;  4KHP M;  3FTD A;  3MJ5 A;  3T1H M;  3T38 A;  5IRE B;  1DO0 A;  3ILK A;  3QXE B;  1NHG C;  2DZO B;  4M9S A;  1KFV A;  1QLB A;  4DV5 M;  2F5O A;  5FSW A;  4YHH M;  4BLC A;  2LWX A;  5LMN M;  1NHW C;  4LRT A;  2ZPI B;  3KSX A;  3HU1 A;  5ITX E;  4LGY A;  4QNR A;  4K0K M;  4I5S A;  3X25 B;  4NXM M;  4IBE A;  4GHA A;  1HQC A;  1R2Z A;  2V1U A;  2CV1 A;  3X20 B;  2ZAN A;  2X8A A;  2DWZ B;  4JX5 A;  4AQY M;  1QQW A;  3RFW A;  5FLX S;  2ZPB B;  4DR2 M;  3TWL A;  4I4L A;  3PXG A;  3U6O A;  3U60 B;  1UGQ B;  4FVM A;  5E6J A;  4S12 A;  3SYK A;  2L7I A;  1W5S A;  3HJQ A;  1IY0 A;  1GL6 A;  3HJS A;  3X26 B;  5KQ8 A;  5ITY A;  1DGF A;  3AJI B;  4FM4 B;  1VDD A;  2Z4R A;  3U61 B;  1ZAE A;  3BG9 A;  4KLN A;  4RNA A;  4MFD A;  3QYE A;  4LF7 M;  3PNY A;  4LZZ A;  3GQ4 A;  3FTE A;  2KXE A;  3HJ8 A;  3M7G A;  4L78 A;  2A5Y B;  2KZS A;  3SMP A;  2BS2 A;  2QFZ A;  1R2Y A;  3DOA A;  4OB0 B;  2DWN A;  4DV0 M;  2G8L A;  3SAV A;  4LF5 M;  4DUZ M;  3AL0 C;  2EUC A;  3AOE C;  4R3D A;  4MGH A;  2HHH M;  4L4U A;  3U6E A;  4NOO B;  4D82 A;  2D0Q B;  3K92 A;  3U60 A;  2XFT A;  4NSR A;  5DYI A;  3GQ5 A;  3U6C A;  1L2D A;  4NSO B;  1GLN A;  2C99 A;  3SAR A;  3NBI A;  1Z5C A;  3A8H B;  3CF2 A;  1IY2 A;  3QZ9 B;  3LQQ A;  4FWG A;  3HHX A;  1GKI A;  1I94 M;  3MK6 A;  3L25 A;  2C5R A;  1OJL A;  5EP3 A;  1IXS B;  2Z7J A;  3Q8X A;  4CGY B;  3U5Z B;  3VKH A;  1N36 M;  1Z5A A;  3LVV A;  1DGG A;  1QAQ A;  4RF0 A;  5C18 A;  3L27 A;  5ITQ A;  2R4E A;  4AI6 A;  3HBL A;  4B3S M;  3H4M A;  4QOZ C;  2ZPH B;  3T1Y M;  4DV1 M;  2Y0Q A;  3FYC A;  3SBJ A;  3AOG A;  3CTW B;  3KHI A;  1UGS B;  1D2N A;  1IM2 A;  4WUR A;  2UUC M;  4L16 A;  4AG5 A;  4A3V B;  4QNM A;  4JI8 M;  3K2L A;  2R4J A;  2YR0 A;  4LJ4 A;  4IBD A;  4LJ6 A;  1QAN A;  3J80 S;  4LJ7 A;  3TQS A;  4DR5 M;  4DR6 M;  4LFC M;  4BBA A;  3KW6 A;  4M0W A;  3SHF A;  1G59 A;  5BR8 M;  2LNH C;  2QP9 X;  5KO3 A;  4NRW A;  2XLJ A;  2FE8 A;  4OU7 A;  3FUT A;  4LF4 M;  2XGN A;  2ZPG B;  4OB2 B;  2CUZ A;  2AHJ B;  1J7K A;  4IJF A;  3A8M B;  1C1K A;  2ZCF B;  3L29 A;  1L1T A;  1E32 A;  4OVZ A;  3U61 A;  3QAU A;  4HNV A;  4IBG A;  4JI7 M;  3A45 A;  1ORY B;  2R65 A;  2F5P A;  2C9C A;  3I4V A;  3WVD B;  2QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...