4HL4A

Crystal structure of the human tbc1d20 rabgap domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
280
structure length
280
Chain Sequence
FNAKRKKKVAEIHQALNSDPTDVAALRRMAISEGGLLTDEIRRKVWPKLLNVNANDPPPISGKNLRQMSKDYQQVLLDVRRSLRRFPPGMPEEQREGLQEELIDIILLILERNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVNPELHDFMQSAEVGTIFALSWLITWFGHVLSDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TBC1 domain family member 20
publication title Catalytic mechanism of a mammalian Rab-RabGAP complex in atomic detail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase activator
total genus 98
structure length 280
sequence length 280
ec nomenclature
pdb deposition date 2012-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00566 RabGAP-TBC Rab-GTPase-TBC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1310 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4hl4A01
1.10.472.80 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4hl4A02
1FKMA 2QFZA 3HZJA 4Z6YA 4HLQA 3QYEA 2QQ8A 3QWLA 3QYBA 5EJCA 4HL4A 4NC6A 2G77A
chains in the Genus database with same CATH superfamily
4FCVA 4DV0M 4OU7A 1PKDB 3PXGA 1DGBA 2Z7JA 3U6DA 1RU3A 2ZCFB 4BXXX 4KO8A 4QSHA 2R62A 1VYWB 1NHGC 2W99A 3DOAA 3HY5A 2E5LM 3ZH9B 3LQ5B 3GP1A 3A46A 5C18A 3BG9A 3DDQB 4JXJA 3KVWA 3BLQB 4HNTA 3ZCBB 3HJQA 4X64M 1IQPA 1ZMWA 4UN0A 3LW5F 4DV5M 2CE7A 3GLIA 3DJBA 4BB9A 2DWZB 4DR7M 1IN5A 2DZNB 3SYKA 3LVWA 1QQWA 2BWBA 2O5RA 1J09A 2OQ4A 4F70B 1MU5A 4D81A 2J7OA 3WVEB 4DR1M 5CEIB 4FVMA 4EOSB 2C5XB 3PNVA 4IJEA 4CFUB 4JYAM 3UZUA 2UUAM 3GRUA 4CGYB 4ZGEB 2I40B 4DV6M 4EORB 5H37D 3TPZA 2CRUA 2CJMB 4ELJA 3QAUA 3FTEA 1NO1A 4R7GA 3L25A 2CZ1B 2DHRA 1MJGM 2JY5A 2DZLA 4LRTA 3DOGB 3NDQA 4AG6A 2EO2A 3IG8A 1WR1B 3PNYA 1OL2B 1OL1B 1IXZA 2Z4SA 3KXEC 1GUXA 4G3OA 2QGSA 4NSRA 5HVYB 2V22B 2W9ZA 1XB2B 4Y28F 2CZ0B 4MGKE 2DPPB 4BCNB 4BCMD 4ROEA 4TUWA 3LQRA 3HU3A 4F7LB 1IBLM 1XMQM 4I4LA 1MN3A 1HT1E 1QDRA 3TE6A 3BXWA 4LJ5A 2EKFA 4MIMA 2WFYB 1N34M 1I4WA 2BS2A 2CHGA 5DFLA 2LWXA 2QSFX 3K92A 2F5OA 1UNLD 3EIHA 3B7ZA 4YOOA 2WMAB 1DGHA 3GLHE 3C9PA 1QAOA 1UNHD 2R4JA 1WXQA 1VG5A 1BU2A 2CFOA 3KOWE 4CXAB 2MROB 1Z5AA 2C4GB 4GEWA 3GPXA 3W68A 2A5YB 3QWLA 4JI1M 4L16A 1GJTA 3KS4A 3U6OA 2WEVB 3U6MA 4BCQB 3FUVA 3TW7A 2P5TA 4KODA 2UZDB 3UGJA 4NC6A 5ACBA 5GKNA 4QNRA 1QAMA 4BCFB 3U6QA 2JY8A 1F4IA 3MHVC 2DWLA 2VQFM 3BBZA 3AFHA 2MJ5B 2LW4A 2QP9X 1LTMA 3BHTB 4G4QA 2CV0A 3W0FA 3M0EA 3GQ3A 3FRIA 5EFQB 2WSFF 1WGLA 2CWBA 3L26A 5ITYA 2F4VM 3QXEB 2HKJA 2WIHB 4HLQA 3M7GA 1G59A 1GABA 2LXEA 1IBKM 3RE8A 2OOAA 3CF0A 4BCOB 3MI9B 3AOGA 3VKGA 2KNAA 1JR3A 1SG9A 1UGRB 4LJAA 2IN3A 4YHHM 2LTUA 4ZPXA 3EIDB 5HBHB 2KW0A 2RGOA 2W2HA 2R0IA 1GJSA 3B74A 3QYEA 2RKOA 2R6FA 3B7QA 4LJ4A 3SHFA 4BCIB 2Y21A 3KOZE 3BHUB 5BNJB 4NXNM 2V6ZM 1Y8GA 2X49A 3QZ5B 5DYIA 3KS8A 5ITUA 5IF1B 2F5NA 2EKKA 2AHMA 4BCPB 1J5EM 2QNJA 4G4NA 3U6SA 4OVZA 2IVXA 1GH6B 2DAIA 2O25A 4LF8M 4HL4A 3GQ5A 5HBEB 5LMKB 3TNHB 3FUUA 1ZMVA 5KPTA 3U61B 4MH0E 1FINB 5EJCA 1AIPC 2F5PA 3IECA 3FKEA 2C98A 2L7HA 2LH0A 2CP8A 2LHCA 2JXNA 5BR8M 4DUZM 4AQYM 5KQDA 2CCIB 4HNUA 3K1JA 3FYDA 4M9SA 3C58A 3BG3A 2XZFA 2JP7A 2DXCB 1TH4A 3J7BA 2WHBB 2KRKA 4YY3M 1TDZA 1D3UB 2ZAMA 5DQWA 4GC5A 2BNKA 3FTFA 1JB0F 1K3WA 5FTMA 1NV8A 2Y0TA 3SBJA 2LVPC 3BOSA 4LF9M 5DNYA 1HNWM 2HWJA 2X1NB 3GLHB 5ITXA 4JV5M 2XEPA 1XXHA 3WHLA 5EXPA 4B3RM 1N36M 4OB2B 5IWAM 4X62M 1WJ7A 5HBJB 1Z5BA 4D80A 1L2DA 3TL4X 1PJQA 2HCBA 3E21A 4RNAA 4EOMB 4IBDA 2BWEA 1IBMM 2WJ9A 3HU2A 1V33A 1KYIA 1JSTB 3I51A 3J81S 1NHWC 4IBEA 3GQ4A 1G3NC 4ROCA 1T43A 3L2AA 4EOPB 1MX0A 1P3QQ 2RRUA 1DGHB 2WIPB 5ITXE 1QDTA 4XK8F 4JI2M 2UXDM 2XFTA 3FUTA 4GRIA 2QENA 1XXHE 1TDHA 3RFWA 5IZ7D 1OIPA 2LVOC 2B9RA 4LOCA 3I01M 1IY1A 2FE8A 2LVQD 1UGQB 4BCMB 2EUCA 2F2CA 5BPVA 1HQYE 4B7GA 1WIVA 1XMOM 4FM4B 4AKHA 4YC3B 3FE3A 3GPYA 4II5B 1C1KA 2DWNA 1QUTA 2MGWA 1FKMA 4AKGA 5I5ZB 3ZQJA 4LJ9A 3SC3A 4AI6A 1TTEA 4FCTA 2KNVA 4GMQA 1O9KB 3GLGA 2K9DA 2LHGA 5ITQA 1PJSA 1GLNA 3DTOA 3I4VA 3SFZA 3F5XB 4DV1M 3HO8A 4NOOB 2OPFA 4DUYM 1Q02A 2V1UA 5EXXA 4A3VB 3FUXA 2JY6B 1OTRA 2L7IA 4AG5A 1OFIA 1JOWA 3O0GD 2APLA 2Z3XA 3BG5A 1N33M 2IW8B 3JR5A 4GHLA 4DR2M 2G8LA 2IW6B 3X20B 1XO2A 3NBXX 2IW9B 3DDPB 1PRBA 1SXJC 4LRSA 4DV4M 3GLFA 5JI2E 1T6OA 1H1PB 1TH3A 2UZLB 1VDLA 2GQFA 1G3IA 4IBGA 4Z8XA 1OJLA 1E9SA 3HHWA 4KHPM 2KZSA 2L2DA 2LBCA 3D8BA 2C96A 3AV0A 3THGA 4F6SB 8CATA 2XF3A 3EIEA 3K9OA 4LGMA 1OQYA 2O01F 3SAUA 1DO2A 3GLIE 1IREB 3G33B 1OIZA 1D0KA 1NY5A 1R2YA 3IG5A 4CFWB 2CHQA 5IDNB 5FSWA 4FW9A 3U60A 1P5EB 1L8QA 4BBRM 2F5SA 4CISA 2ZM6M 4EOJB 1N78A 1NJGA 4M0DA 1AISB 4IBJA 4FD2A 4ITQA 1JQJC 5EP4A 1R7RA 2KMGA 3GLFE 2OO9A 1YSYA 3SAWA 3QYGB 3U5ZA 1W98B 3BLHB 4ZGJB 2QPAA 2WPAB 5E6JA 1IXSA 1C7YA 5EP3A 1SXJD 3U6PA 4WURA 2MH8A 4MGIE 5FTLA 2QDYB 4JX5A 2PHGA 2C99A 1V92A 1Q3BA 4KLNA 4F6WB 1XNRM 2QFZA 5EXTA 4QHTA 1VEKA 3KOYE 4LY6A 1XXHB 2WXVB 3FD9A 4YOZA 1H26B 2KNZA 5ITRA 1QYRA 4WP2A 1IM2A 1PJJA 3GO8A 4KRDB 3L28A 3MJ5A 5HNBB 3FTDA 4AZFA 2L09A 4ANRA 4Q7JA 4IBBA 4NL4H 2PJQA 2F5QA 1R4GA 2XSZD 1ZAEA 4JN6A 1SXJA 2UZBB 2UXBM 3X26B 1QUSA 1YUBA 1JR3D 1PM5A 3AJIB 3J80S 4BBSM 2QF7A 2C5RA 1KXUA 4IMYB 3RGSA 5C1BA 4IBKA 1HNXM 5EQTA 1OIYB 4FWHA 5ICPB 2PMIB 1HR0M 4UN2B 2JWSA 4FWDA 3T1HM 5LMNM 3D8LA 5IT9S 3GPPA 2UU9M 1DV0A 1TF0B 3V76A 3FUWA 4Z6YA 1NJFA 1H25B 3T38A 1JSUB 5EXSA 3A8OB 2R7GA 4ELLA 1PJIA 2AHJB 1H4LD 4M0WA 2XSZA 2X4AA 3B7NA 4OB3B 2ERCA 1HQCA 4M9XA 3ZC7B 1SXJE 4EOQB 3R9XB 3LCVB 4IIWA 1R6BX 3HHYA 3TWKA 1EIJA 1OKVB 4BCJB 5DYGA 4CFVB 2I7PA 2H5XA 3ILKA 1VDDA 3AL0C 4NRVA 4EC8B 2JNHA 2CUZA 4AW4A 4B7FA 4EOKB 2EUFA 1N32M 5JI3E 2R4EA 5FTJA 2ZBKB 2C9CA 1BVSA 3K2LA 5DQVA 4LF4M 2Y0QA 1TFBA 3A45A 4PDGA 2DWMA 4BCND 2I53A 3HU1A 2EA0A 1QMZB 1GL6A 2M60A 4LZZA 4R71A 4CFXB 1JR3E 2K6BA 1GO5A 5HQ0B 4LF5M 4LF7M 4JI7M 3QYHB 2WZJA 3CTWB 1UFZA 4ZGDB 3KP0E 3GLIB 4RODA 4I5SA 3B9PA 5E26A 2KXEA 1JKWA 1H1QB 2WSEF 4MGYE 4S12A 3H4JA 2ZAOA 2G3QA 2JA2A 2JY7A 4F2LA 4GKJM 1E9HB 1N4MA 1UNGD 1C9BA 2KR6A 3HJ8A 3T15A 4BBAA 4L4UA 3H4CA 5FLXS 3GLFB 1D0LA 2VF7A 3HHZA 3QHRB 3FYCA 2M5ZA 1QZEA 2K0BX 4II7A 4LJ8A 2KDLA 2C6TB 3A8LB 2ZTDA 2G5GX 1K3XA 1R2ZA 2R45A 3NWLA 4JI6M 4DV2M 3U6LA 1GVNA 5EP2A 3SYLA 3VK7A 1H27B 4CJ6A 1KFVA 5KQ8A 4FX3B 4PT5A 1GUXB 2UUCM 3U60B 4JI5M 2BKZB 3MIAB 3HX3A 1OGUB 2DD4B 3SMPA 2DAMA 4GITA 2R65A 3QHWB 1IY2A 4MM3B 3KW6A 3U5ZB 1FNNA 3BHVB 3CGWA 3GRYA 1V34A 4MGHA 4I8OA 4BCGB 1OKSA 1W5SA 3VK8A 2EJSA 2FH0A 2FOIC 1IY0A 4IBFA 1W5TA 2D7EA 4JI8M 3GPUA 2W82A 1NVMA 3F92A 1L1ZA 4P17A 2CZ7B 2CZ6B 4JX6A 3X28B 3A8GB 4OX9M 1IN7A 3LQQA 4GHAA 2YQZA 1OAIA 1VQ1A 4M9ZA 1TH2A 1H28B 1SXJB 2ZPHB 3SARA 4BCKB 1IN6A 2B3TA 3E46A 2N35A 4JI3M 1A5TA 1QAQA 1VOLA 4F1IA 3GRVA 1Z59A 1VEGA 4OB0B 2HAKA 4LF6M 4LZJA 3DL1A 3HHXA 4QOSA 4IJFA 5LMUM 1E32A 3SMSA 2DENA 1GL7A 3EJ1B 4EOOB 4LFBM 3LCUA 2DZOB 1DGGA 3EOCB 3WVDB 3HBLA 2QHOB 2C9OA 2WSCF 3X24B 1NNJA 1N75A 2XH9A 1EE8A 1TGUA 2HHHM 2DXBB 5CYIB 3I4YA 1G71A 3RGPA 3JR4A 3NBIA 2XZUA 2KRUA 2D7GA 2W96A 1Z6TA 1OIUB 4PDIA 1IN4A 2YFQA 1QZMA 3U61A 3GLGE 1L2BA 3R8FA 4CIZA 2KHHA 4QNMA 2X8AA 3B57A 1H6UA 4KRCB 1QANA 3SATA 2JZ0A 2J5YA 4BY7X 3Q8GA 4EC9B 4B7HA 4MFDA 2FS1A 2DHYA 5L8RF 3SAVA 3W0LB 4OVZB 2DKLA 4X65M 4QHSA 1L2CA 3JAMS 4B3SM 3HGIA 3HZJA 4G6LB 3X25B 3SHGB 2QBYA 1EFUB 2BJVA 4P16A 3U6CA 3CF2A 2MR9A 1PGYA 4GKKM 4B3TM 3KDSE 2WMBB 1UM8A 4DV7M 3GLHA 4KT0F 2W9FA 4JX4A 1I94M 4QOZC 4DR4M 3TW6A 4F7SB 1FJGM 1AHJB 4XGIA 5FTNA 1J7KA 3QYBA 2UXCM 4G6ZA 4OW0A 3AOEC 4PD2A 5FTKA 4LG2A 1LV7A 2YR0A 2QCUA 1HNZM 4G4RA 4YOSA 1OKWB 2CV1A 1H1RB 2ZPBB 2JZ1A 1R5LA 1XC8A 3UK6A 3H4MA 2DVWB 3HHTB 2BS3A 1E9RA 1UGPB 1ZP2A 2G9XB 3VYHB 4OB1B 2R46A 3MMPA 3PVSA 4M6VA 4F6UB 1IFYA 5LQFB 2QQ8A 2FNAA 2Z8YM 2DAGA 3POMA 4OR5B 4RKUF 2NQ8C 2ZTCA 4W5WA 3K9PA 5EP1A 2R18A 4CHTB 2G77A 3WHKA 2L4EA 1FVVB 4IBIA 1VINA 3IHPA 1AD6A 3L27A 5A2QS 4EOIB 1E94E 1T3TA 1VEJA 1ENWA 2QDJA 4LFAM 3RGFB 4BCHB 1OFHA 2DD5B 4F7JB 1DO0A 3Q8XA 4LGYA 5KO3A 2D7HA 3LMMA 4NSOB 2ZPEB 4HNVA 1WHCA 1F5QB 4D82A 3A42A 4PCZA 3UMMA 4RF1A 3C3DA 4Y72B 3KP1E 1AUAA 1YLAA 2XFSA 1TD6A 2KEBA 4JI0M 4NSTB 1G8PA 2ZZDB 1O9KA 1D0MA 1KSFX 2FFJA 5IREB 4B08A 3MK6A 2DNAA 2LVAA 3A8HB 4CFUD 1TR8A 2CV2A 2Y20A 3J2PB 3T6PA 3K8ZA 3E4RA 4RF0A 2CCHB 1ZV1A 3E9SA 2VIIA 4XBOA 2UZEB 3KHIA 4I3ZB 4DR3M 2C5VB 2KA6B 2C5NB 3DFZA 4GH9A 3HB9A 2LNHC 2ZPGB 3AOEA 3PFIA 1Q3CA 3FRHA 3C3EA 4LCBA 4L15A 3GLGB 3FTCA 3QZ9B 1ORYB 2UUBM 1PJTA 4JI4M 4DR5M 3KOXE 4LFCM 2DI0A 4MFEA 2DAKA 4GC9A 2UUEB 3TQSA 5F3WA 2YNMD 3I04M 2XGNA 4DR6M 2PK2A 1XNQM 2BJWA 2V1CA 1H24B 2L6OA 3J27B 3TNWB 1HJPA 2OOBA 4BLCA 1NY6A 2CYZB 4CRLB 3M03A 2I7NA 3MY5B 1XHBA 5IDPB 3DZDA 2Z4RA 5KPRA 4HEOA 1QLBA 3LVVA 2Q2EB 3VDUA 2DAEA 3T1YM 2ZANA 3HKPA 1OAOC 2ZPIB 3KFUG 2KZUA 4I81A 4BY1X 4WW0A 3GTMS 3HWSA 1E7PA 3BLRB 4K0KM 1NV9A 3MY1B 1QVRA 1G41A 5FGKB 4AKIA 3K7AM 2BPMB 3KSXA 2JGZB 1WGNA 4EONB 4REZA 4F7NB 4BCQD 4CFNB 4X66M 1K82A 4G4OA 4EIWA 1IN8A 2QBYB 2VDBB 2QZ4A 2L4FA 4CFMB 4TTHA 3M6AA 1URCB 4LJ7A 1Z5CA 4L78A 1ZMUA 1IXRC 3UJNA 3TN8B 2HL7A 3U6EA 4B3MM 3AKZA 1G4AE 4MGZE 3GRRA 2VF8A 2BS4A 2LVNC 1V29B 1CUKA 3PO3S 2CEAA 3SASA 2ZPFB 5L2WB 1H1SB 4MB7A 3HJSA 2RGHA 5KPZA 4DV3M 2D0QB 5IHYA 4DBGB 1IXSB 1NNUC 3VYGB 1Q39A 3VLFB 1UGSB 3VFDA 1D2NA 2GNOA 4L6V6 3CF6E 3A98B 4NRWA 2JUJA 4GIPA 3B89A 4L8RC 3TNIB 3KSJA 3DA1A 1YE9A 2DXIA 3VDPA 1XWIA 1GY3B 4R3DA 1DGFA 2CHVA 3VKHA 1ZQ9A 5ITTA 2DMEA 2J7NA 3L29A 7CATA 3J7AS 2VQEM 2PK9B 4IBCA 4FWGA 1L1TA 4LJ6A 1OI9B 4EOLB 3TWLA 2K47A 3TWMA 1N77A 3A8MB 2R44A 1S3SA 1NSFA 2H1RA 4FCWA 3W67A 4NXMM 2C5OB 3OTOM 2XLJA 1GKIA 1HT2E 1X37A 4OGRB
chains in the Genus database with same CATH topology
1I94M 4FCVA 5EXSA 3A8OB 5FTMA 2Y0TA 3SBJA 4DR4M 4QOZC 3TW6A 4DV0M 4OU7A 1PJIA 3BOSA 2AHJB 3PXGA 4LF9M 1DGBA 2Z7JA 4M0WA 2XSZA 2X4AA 1FJGM 1AHJB 4XGIA 3U6DA 5FTNA 5DNYA 1HNWM 1J7KA 4OB3B 3QYBA 2ERCA 2UXCM 2ZCFB 1HQCA 4M9XA 3ZC7B 1SXJE 4G6ZA 4OW0A 3AOEC 4PD2A 5FTKA 3R9XB 3GLHB 4LG2A 1LV7A 4KO8A 5ITXA 4QSHA 2R62A 2YR0A 2QCUA 4IIWA 1R6BX 3HHYA 1HNZM 4JV5M 3TWKA 4G4RA 2XEPA 1XXHA 2CV1A 1NHGC 3WHLA 2ZPBB 3DOAA 5DYGA 2I7PA 3ILKA 5EXPA 1VDDA 1N36M 2E5LM 4B3RM 1XC8A 3UK6A 3H4MA 4OB2B 3AL0C 4NRVA 2DVWB 3ZH9B 5IWAM 4X62M 3HHTB 2BS3A 1E9RA 3GP1A 1UGPB 1Z5BA 4D80A 3A46A 5C18A 1L2DA 3TL4X 2CUZA 4AW4A 2HCBA 4RNAA 3BG9A 3VYHB 4OB1B 4JXJA 2R46A 4B7FA 4IBDA 3KVWA 3PVSA 4M6VA 4HNTA 3ZCBB 1IBMM 2QQ8A 3HJQA 2FNAA 1N32M 2WJ9A 3HU2A 5JI3E 4X64M 1IQPA 2R4EA 5FTJA 1KYIA 2ZBKB 3I51A 3J81S 4DV5M 2C9CA 2CE7A 2NQ8C 3GLIA 3K2LA 4W5WA 4BB9A 4LF4M 2Y0QA 5EP1A 1NHWC 4IBEA 3GQ4A 3A45A 2R18A 2DWZB 4PDGA 4CHTB 2DWMA 1IN5A 4DR7M 2G77A 2DZNB 3WHKA 3SYKA 3LVWA 1QQWA 2O5RA 4IBIA 1J09A 3HU1A 2OQ4A 2EA0A 1MU5A 4D81A 2J7OA 1GL6A 3WVEB 2M60A 3L2AA 4DR1M 4LZZA 3L27A 5A2QS 4FVMA 1E94E 1MX0A 1T3TA 3PNVA 4LF5M 4IJEA 4JI7M 4LF7M 3QYHB 1DGHB 3CTWB 4JYAM 5ITXE 3UZUA 2UXDM 4JI2M 4ZGDB 3KP0E 3GLIB 2UUAM 2QDJA 3GRUA 2XFTA 3FUTA 4LFAM 4CGYB 4GRIA 2QENA 4I5SA 1OFHA 2DD5B 3B9PA 1TDHA 4ZGEB 5E26A 1DO0A 3RFWA 5IZ7D 2KXEA 3Q8XA 4LGYA 5KO3A 2D7HA 3LMMA 4NSOB 2ZPEB 4HNVA 4LOCA 4MGYE 4S12A 2ZAOA 4DV6M 1IY1A 2FE8A 1UGQB 4D82A 2JA2A 3A42A 4PCZA 3UMMA 5H37D 4GKJM 3TPZA 2EUCA 4ELJA 4RF1A 5BPVA 3QAUA 3FTEA 2KR6A 1HQYE 3HJ8A 4B7GA 3KP1E 3T15A 4BBAA 4L4UA 3H4CA 4R7GA 3L25A 1XMOM 2CZ1B 2XFSA 4FM4B 4AKHA 2KEBA 5FLXS 2DHRA 3GLFB 3GPYA 4JI0M 1C1KA 1G8PA 2DWNA 3HHZA 2ZZDB 3FYCA 4LRTA 1KSFX 2FFJA 2M5ZA 5IREB 1FKMA 4AG6A 4B08A 4AKGA 3MK6A 2EO2A 4II7A 3IG8A 3PNYA 4LJ9A 4LJ8A 3A8HB 2CV2A 3SC3A 3A8LB 4AI6A 1IXZA 2Z4SA 2G5GX 2Y20A 1K3XA 3KXEC 4FCTA 3J2PB 1R2ZA 3K8ZA 4NSRA 2R45A 3E4RA 4RF0A 3NWLA 4JI6M 4GMQA 4DV2M 3U6LA 3E9SA 2VIIA 4XBOA 4MGKE 2CZ0B 1GVNA 3GLGA 2DPPB 5EP2A 3SYLA 3VK7A 4TUWA 3LQRA 5ITQA 3KHIA 1KFVA 4DR3M 3HU3A 5KQ8A 1IBLM 2KA6B 3DFZA 1GLNA 4GH9A 4I4LA 1XMQM 3I4VA 3HB9A 4PT5A 3SFZA 2LNHC 2UUCM 3U60B 2ZPGB 1HT1E 3TE6A 3AOEA 3PFIA 4JI5M 1Q3CA 4LJ5A 4DV1M 4LCBA 4MIMA 4L15A 3GLGB 3FTCA 2DD4B 3HO8A 3SMPA 1N34M 1I4WA 2BS2A 1ORYB 4NOOB 2CHGA 2UUBM 4JI4M 3QZ9B 2OPFA 4DUYM 2LWXA 3K92A 4GITA 2R65A 4DR5M 2V1UA 3KOXE 4LFCM 2F5OA 5EXXA 4A3VB 3EIHA 3FUXA 1IY2A 4MFEA 4MM3B 3KW6A 4GC9A 2L7IA 1DGHA 3U5ZB 1FNNA 4AG5A 3TQSA 1OFIA 1QAOA 3GRYA 2YNMD 5F3WA 2Z3XA 2XGNA 3BG5A 4DR6M 1XNQM 1N33M 2BJWA 2R4JA 1WXQA 2V1CA 2L6OA 3JR5A 2CFOA 4MGHA 4GHLA 3KOWE 4DR2M 4I8OA 1Z5AA 3J27B 2G8LA 1W5SA 4BLCA 3VK8A 1NY6A 2CYZB 3X20B 3GPXA 2FOIC 1IY0A 4IBFA 2A5YB 3QWLA 2I7NA 1XHBA 4JI1M 1SXJC 3DZDA 4LRSA 4DV4M 2Z4RA 1W5TA 5KPRA 4L16A 2D7EA 3KS4A 3U6OA 4JI8M 3GPUA 3U6MA 3GLFA 1QLBA 2W82A 1NVMA 5JI2E 1TH3A 3LVVA 2Q2EB 1G3IA 3VDUA 3FUVA 1L1ZA 3TW7A 4IBGA 2P5TA 4KODA 3T1YM 3UGJA 2CZ7B 2CZ6B 4JX6A 4NC6A 2ZANA 5GKNA 3HKPA 3X28B 4QNRA 4Z8XA 3KFUG 2ZPIB 2KZUA 1OJLA 1QAMA 4I81A 3A8GB 1E9SA 4WW0A 3HHWA 3U6QA 4OX9M 1IN7A 3LQQA 4KHPM 2KZSA 4GHAA 3D8BA 2YQZA 3HWSA 2C96A 3AV0A 3THGA 1E7PA 3MHVC 2DWLA 2VQFM 8CATA 2XF3A 3EIEA 3AFHA 4M9ZA 4K0KM 1TH2A 4LGMA 1QVRA 2QP9X 3SAUA 1SXJB 1DO2A 1IREB 1G41A 4G4QA 2ZPHB 4AKIA 3SARA 1IN6A 3KSXA 2CV0A 3W0FA 1NY5A 4JI3M 1R2YA 3M0EA 3IG5A 3GQ3A 2CHQA 4REZA 1QAQA 5FSWA 4FW9A 3U60A 4BBRM 1L8QA 3GRVA 4X66M 1K82A 2ZM6M 1Z59A 4G4OA 2F5SA 1NJGA 4CISA 1N78A 4OB0B 3L26A 4M0DA 5ITYA 2F4VM 4IBJA 4EIWA 4FD2A 1IN8A 2QBYB 3QXEB 4LF6M 2HKJA 2QZ4A 4ITQA 4LZJA 3DL1A 1JQJC 3HHXA 3M6AA 4HLQA 5EP4A 1R7RA 4QOSA 4LJ7A 3M7GA 1G59A 1Z5CA 4IJFA 4L78A 2KMGA 5LMUM 1E32A 2LXEA 1IBKM 3SMSA 3RE8A 1IXRC 3UJNA 1GL7A 3CF0A 2HL7A 3U6EA 4B3MM 3AKZA 3AOGA 1G4AE 4MGZE 1YSYA 3SAWA 3GRRA 3VKGA 3QYGB 3U5ZA 4LFBM 4ZGJB 1JR3A 2QPAA 2BS4A 1UGRB 2DZOB 4LJAA 5E6JA 4YHHM 1V29B 1DGGA 2CEAA 4ZPXA 3SASA 3WVDB 5EP3A 1SXJD 2ZPFB 3HBLA 2KW0A 3U6PA 4WURA 2RGOA 4MGIE 4MB7A 5FTLA 2QDYB 2C9OA 3HJSA 3X24B 2RGHA 5KPZA 1NNJA 1N75A 3QYEA 2RKOA 4JX5A 4LJ4A 3SHFA 2XH9A 2Y21A 4DV3M 3KOZE 2C99A 1EE8A 1TGUA 2HHHM 2DXBB 1Q3BA 3I4YA 2D0QB 4NXNM 2V6ZM 4KLNA 3RGPA 3JR4A 1IXSB 1NNUC 1XNRM 3NBIA 2QFZA 3VYGB 2XZUA 2KRUA 2D7GA 4QHTA 5EXTA 1Q39A 2X49A 3QZ5B 5DYIA 3VLFB 3KOYE 4LY6A 5ITUA 3KS8A 1XXHB 1UGSB 1Z6TA 3VFDA 1D2NA 2F5NA 4PDIA 3FD9A 2AHMA 1J5EM 1IN4A 2YFQA 3CF6E 3A98B 4G4NA 5ITRA 1QZMA 4NRWA 3U61A 4GIPA 1L2BA 3R8FA 1QYRA 1IM2A 3U6SA 4L8RC 4OVZA 3GO8A 1PJJA 4QNMA 2X8AA 3KSJA 3L28A 1H6UA 3MJ5A 1QANA 3DA1A 1YE9A 3SATA 2DXIA 3VDPA 1XWIA 3FTDA 4LF8M 4R3DA 1DGFA 4AZFA 2L09A 4HL4A 2CHVA 3VKHA 3GQ5A 4IBBA 4NL4H 1ZQ9A 5ITTA 2F5QA 2XSZD 1ZAEA 4JN6A 2J7NA 3FUUA 1SXJA 3L29A 4B7HA 2UXBM 7CATA 5KPTA 3X26B 3J7AS 1YUBA 2VQEM 4MFDA 3U61B 4MH0E 3SAVA 1JR3D 1PM5A 3W0LB 4IBCA 4OVZB 3AJIB 4X65M 5EJCA 4FWGA 2F5PA 4QHSA 1L2CA 3FKEA 3JAMS 4B3SM 3J80S 1L1TA 2C98A 2L7HA 2LH0A 3HGIA 4LJ6A 4BBSM 2QF7A 3HZJA 2C5RA 3X25B 3TWLA 5BR8M 3SHGB 2QBYA 2K47A 3RGSA 4DUZM 2BJVA 5C1BA 4IBKA 1HNXM 3TWMA 4AQYM 1N77A 5EQTA 4FWHA 5KQDA 3A8MB 4HNUA 4P16A 3K1JA 1HR0M 3FYDA 3U6CA 4M9SA 1S3SA 3C58A 3BG3A 1NSFA 2H1RA 4FCWA 2XZFA 4FWDA 2DXCB 1TH4A 3J7BA 3T1HM 5LMNM 2KRKA 3D8LA 4YY3M 5IT9S 1TDZA 3GPPA 3CF2A 2UU9M 4NXMM 2ZAMA 4GKKM 3FUWA 3OTOM 4B3TM 3KDSE 4Z6YA 1NJFA 2XLJA 1GKIA 4GC5A 2BNKA 1HT2E 1X37A 1UM8A 4DV7M 3GLHA 3T38A 3FTFA 1K3WA 4JX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FKM A;  2QFZ A;  3HZJ A;  4Z6Y A;  4HLQ A;  3QYE A;  2QQ8 A;  3QWL A;  3QYB A;  5EJC A;  4HL4 A;  4NC6 A;  2G77 A; 
#chains in the Genus database with same CATH topology
 4FCV A;  4DV0 M;  4OU7 A;  1PKD B;  3PXG A;  1DGB A;  2Z7J A;  3U6D A;  1RU3 A;  2ZCF B;  4BXX X;  4KO8 A;  4QSH A;  2R62 A;  1VYW B;  1NHG C;  2W99 A;  3DOA A;  3HY5 A;  2E5L M;  3ZH9 B;  3LQ5 B;  3GP1 A;  3A46 A;  5C18 A;  3BG9 A;  3DDQ B;  4JXJ A;  3KVW A;  3BLQ B;  4HNT A;  3ZCB B;  3HJQ A;  4X64 M;  1IQP A;  1ZMW A;  4UN0 A;  3LW5 F;  4DV5 M;  2CE7 A;  3GLI A;  3DJB A;  4BB9 A;  2DWZ B;  4DR7 M;  1IN5 A;  2DZN B;  3SYK A;  3LVW A;  1QQW A;  2BWB A;  2O5R A;  1J09 A;  2OQ4 A;  4F70 B;  1MU5 A;  4D81 A;  2J7O A;  3WVE B;  4DR1 M;  5CEI B;  4FVM A;  4EOS B;  2C5X B;  3PNV A;  4IJE A;  4CFU B;  4JYA M;  3UZU A;  2UUA M;  3GRU A;  4CGY B;  4ZGE B;  2I40 B;  4DV6 M;  4EOR B;  5H37 D;  3TPZ A;  2CRU A;  2CJM B;  4ELJ A;  3QAU A;  3FTE A;  1NO1 A;  4R7G A;  3L25 A;  2CZ1 B;  2DHR A;  1MJG M;  2JY5 A;  2DZL A;  4LRT A;  3DOG B;  3NDQ A;  4AG6 A;  2EO2 A;  3IG8 A;  1WR1 B;  3PNY A;  1OL2 B;  1OL1 B;  1IXZ A;  2Z4S A;  3KXE C;  1GUX A;  4G3O A;  2QGS A;  4NSR A;  5HVY B;  2V22 B;  2W9Z A;  1XB2 B;  4Y28 F;  2CZ0 B;  4MGK E;  2DPP B;  4BCN B;  4BCM D;  4ROE A;  4TUW A;  3LQR A;  3HU3 A;  4F7L B;  1IBL M;  1XMQ M;  4I4L A;  1MN3 A;  1HT1 E;  1QDR A;  3TE6 A;  3BXW A;  4LJ5 A;  2EKF A;  4MIM A;  2WFY B;  1N34 M;  1I4W A;  2BS2 A;  2CHG A;  5DFL A;  2LWX A;  2QSF X;  3K92 A;  2F5O A;  1UNL D;  3EIH A;  3B7Z A;  4YOO A;  2WMA B;  1DGH A;  3GLH E;  3C9P A;  1QAO A;  1UNH D;  2R4J A;  1WXQ A;  1VG5 A;  1BU2 A;  2CFO A;  3KOW E;  4CXA B;  2MRO B;  1Z5A A;  2C4G B;  4GEW A;  3GPX A;  3W68 A;  2A5Y B;  3QWL A;  4JI1 M;  4L16 A;  1GJT A;  3KS4 A;  3U6O A;  2WEV B;  3U6M A;  4BCQ B;  3FUV A;  3TW7 A;  2P5T A;  4KOD A;  2UZD B;  3UGJ A;  4NC6 A;  5ACB A;  5GKN A;  4QNR A;  1QAM A;  4BCF B;  3U6Q A;  2JY8 A;  1F4I A;  3MHV C;  2DWL A;  2VQF M;  3BBZ A;  3AFH A;  2MJ5 B;  2LW4 A;  2QP9 X;  1LTM A;  3BHT B;  4G4Q A;  2CV0 A;  3W0F A;  3M0E A;  3GQ3 A;  3FRI A;  5EFQ B;  2WSF F;  1WGL A;  2CWB A;  3L26 A;  5ITY A;  2F4V M;  3QXE B;  2HKJ A;  2WIH B;  4HLQ A;  3M7G A;  1G59 A;  1GAB A;  2LXE A;  1IBK M;  3RE8 A;  2OOA A;  3CF0 A;  4BCO B;  3MI9 B;  3AOG A;  3VKG A;  2KNA A;  1JR3 A;  1SG9 A;  1UGR B;  4LJA A;  2IN3 A;  4YHH M;  2LTU A;  4ZPX A;  3EID B;  5HBH B;  2KW0 A;  2RGO A;  2W2H A;  2R0I A;  1GJS A;  3B74 A;  3QYE A;  2RKO A;  2R6F A;  3B7Q A;  4LJ4 A;  3SHF A;  4BCI B;  2Y21 A;  3KOZ E;  3BHU B;  5BNJ B;  4NXN M;  2V6Z M;  1Y8G A;  2X49 A;  3QZ5 B;  5DYI A;  3KS8 A;  5ITU A;  5IF1 B;  2F5N A;  2EKK A;  2AHM A;  4BCP B;  1J5E M;  2QNJ A;  4G4N A;  3U6S A;  4OVZ A;  2IVX A;  1GH6 B;  2DAI A;  2O25 A;  4LF8 M;  4HL4 A;  3GQ5 A;  5HBE B;  5LMK B;  3TNH B;  3FUU A;  1ZMV A;  5KPT A;  3U61 B;  4MH0 E;  1FIN B;  5EJC A;  1AIP C;  2F5P A;  3IEC A;  3FKE A;  2C98 A;  2L7H A;  2LH0 A;  2CP8 A;  2LHC A;  2JXN A;  5BR8 M;  4DUZ M;  4AQY M;  5KQD A;  2CCI B;  4HNU A;  3K1J A;  3FYD A;  4M9S A;  3C58 A;  3BG3 A;  2XZF A;  2JP7 A;  2DXC B;  1TH4 A;  3J7B A;  2WHB B;  2KRK A;  4YY3 M;  1TDZ A;  1D3U B;  2ZAM A;  5DQW A;  4GC5 A;  2BNK A;  3FTF A;  1JB0 F;  1K3W A;  5FTM A;  1NV8 A;  2Y0T A;  3SBJ A;  2LVP C;  3BOS A;  4LF9 M;  5DNY A;  1HNW M;  2HWJ A;  2X1N B;  3GLH B;  5ITX A;  4JV5 M;  2XEP A;  1XXH A;  3WHL A;  5EXP A;  4B3R M;  1N36 M;  4OB2 B;  5IWA M;  4X62 M;  1WJ7 A;  5HBJ B;  1Z5B A;  4D80 A;  1L2D A;  3TL4 X;  1PJQ A;  2HCB A;  3E21 A;  4RNA A;  4EOM B;  4IBD A;  2BWE A;  1IBM M;  2WJ9 A;  3HU2 A;  1V33 A;  1KYI A;  1JST B;  3I51 A;  3J81 S;  1NHW C;  4IBE A;  3GQ4 A;  1G3N C;  4ROC A;  1T43 A;  3L2A A;  4EOP B;  1MX0 A;  1P3Q Q;  2RRU A;  1DGH B;  2WIP B;  5ITX E;  1QDT A;  4XK8 F;  4JI2 M;  2UXD M;  2XFT A;  3FUT A;  4GRI A;  2QEN A;  1XXH E;  1TDH A;  3RFW A;  5IZ7 D;  1OIP A;  2LVO C;  2B9R A;  4LOC A;  3I01 M;  1IY1 A;  2FE8 A;  2LVQ D;  1UGQ B;  4BCM B;  2EUC A;  2F2C A;  5BPV A;  1HQY E;  4B7G A;  1WIV A;  1XMO M;  4FM4 B;  4AKH A;  4YC3 B;  3FE3 A;  3GPY A;  4II5 B;  1C1K A;  2DWN A;  1QUT A;  2MGW A;  1FKM A;  4AKG A;  5I5Z B;  3ZQJ A;  4LJ9 A;  3SC3 A;  4AI6 A;  1TTE A;  4FCT A;  2KNV A;  4GMQ A;  1O9K B;  3GLG A;  2K9D A;  2LHG A;  5ITQ A;  1PJS A;  1GLN A;  3DTO A;  3I4V A;  3SFZ A;  3F5X B;  4DV1 M;  3HO8 A;  4NOO B;  2OPF A;  4DUY M;  1Q02 A;  2V1U A;  5EXX A;  4A3V B;  3FUX A;  2JY6 B;  1OTR A;  2L7I A;  4AG5 A;  1OFI A;  1JOW A;  3O0G D;  2APL A;  2Z3X A;  3BG5 A;  1N33 M;  2IW8 B;  3JR5 A;  4GHL A;  4DR2 M;  2G8L A;  2IW6 B;  3X20 B;  1XO2 A;  3NBX X;  2IW9 B;  3DDP B;  1PRB A;  1SXJ C;  4LRS A;  4DV4 M;  3GLF A;  5JI2 E;  1T6O A;  1H1P B;  1TH3 A;  2UZL B;  1VDL A;  2GQF A;  1G3I A;  4IBG A;  4Z8X A;  1OJL A;  1E9S A;  3HHW A;  4KHP M;  2KZS A;  2L2D A;  2LBC A;  3D8B A;  2C96 A;  3AV0 A;  3THG A;  4F6S B;  8CAT A;  2XF3 A;  3EIE A;  3K9O A;  4LGM A;  1OQY A;  2O01 F;  3SAU A;  1DO2 A;  3GLI E;  1IRE B;  3G33 B;  1OIZ A;  1D0K A;  1NY5 A;  1R2Y A;  3IG5 A;  4CFW B;  2CHQ A;  5IDN B;  5FSW A;  4FW9 A;  3U60 A;  1P5E B;  1L8Q A;  4BBR M;  2F5S A;  4CIS A;  2ZM6 M;  4EOJ B;  1N78 A;  1NJG A;  4M0D A;  1AIS B;  4IBJ A;  4FD2 A;  4ITQ A;  1JQJ C;  5EP4 A;  1R7R A;  2KMG A;  3GLF E;  2OO9 A;  1YSY A;  3SAW A;  3QYG B;  3U5Z A;  1W98 B;  3BLH B;  4ZGJ B;  2QPA A;  2WPA B;  5E6J A;  1IXS A;  1C7Y A;  5EP3 A;  1SXJ D;  3U6P A;  4WUR A;  2MH8 A;  4MGI E;  5FTL A;  2QDY B;  4JX5 A;  2PHG A;  2C99 A;  1V92 A;  1Q3B A;  4KLN A;  4F6W B;  1XNR M;  2QFZ A;  5EXT A;  4QHT A;  1VEK A;  3KOY E;  4LY6 A;  1XXH B;  2WXV B;  3FD9 A;  4YOZ A;  1H26 B;  2KNZ A;  5ITR A;  1QYR A;  4WP2 A;  1IM2 A;  1PJJ A;  3GO8 A;  4KRD B;  3L28 A;  3MJ5 A;  5HNB B;  3FTD A;  4AZF A;  2L09 A;  4ANR A;  4Q7J A;  4IBB A;  4NL4 H;  2PJQ A;  2F5Q A;  1R4G A;  2XSZ D;  1ZAE A;  4JN6 A;  1SXJ A;  2UZB B;  2UXB M;  3X26 B;  1QUS A;  1YUB A;  1JR3 D;  1PM5 A;  3AJI B;  3J80 S;  4BBS M;  2QF7 A;  2C5R A;  1KXU A;  4IMY B;  3RGS A;  5C1B A;  4IBK A;  1HNX M;  5EQT A;  1OIY B;  4FWH A;  5ICP B;  2PMI B;  1HR0 M;  4UN2 B;  2JWS A;  4FWD A;  3T1H M;  5LMN M;  3D8L A;  5IT9 S;  3GPP A;  2UU9 M;  1DV0 A;  1TF0 B;  3V76 A;  3FUW A;  4Z6Y A;  1NJF A;  1H25 B;  3T38 A;  1JSU B;  5EXS A;  3A8O B;  2R7G A;  4ELL A;  1PJI A;  2AHJ B;  1H4L D;  4M0W A;  2XSZ A;  2X4A A;  3B7N A;  4OB3 B;  2ERC A;  1HQC A;  4M9X A;  3ZC7 B;  1SXJ E;  4EOQ B;  3R9X B;  3LCV B;  4IIW A;  1R6B X;  3HHY A;  3TWK A;  1EIJ A;  1OKV B;  4BCJ B;  5DYG A;  4CFV B;  2I7P A;  2H5X A;  3ILK A;  1VDD A;  3AL0 C;  4NRV A;  4EC8 B;  2JNH A;  2CUZ A;  4AW4 A;  4B7F A;  4EOK B;  2EUF A;  1N32 M;  5JI3 E;  2R4E A;  5FTJ A;  2ZBK B;  2C9C A;  1BVS A;  3K2L A;  5DQV A;  4LF4 M;  2Y0Q A;  1TFB A;  3A45 A;  4PDG A;  2DWM A;  4BCN D;  2I53 A;  3HU1 A;  2EA0 A;  1QMZ B;  1GL6 A;  2M60 A;  4LZZ A;  4R71 A;  4CFX B;  1JR3 E;  2K6B A;  1GO5 A;  5HQ0 B;  4LF5 M;  4LF7 M;  4JI7 M;  3QYH B;  2WZJ A;  3CTW B;  1UFZ A;  4ZGD B;  3KP0 E;  3GLI B;  4ROD A;  4I5S A;  3B9P A;  5E26 A;  2KXE A;  1JKW A;  1H1Q B;  2WSE F;  4MGY E;  4S12 A;  3H4J A;  2ZAO A;  2G3Q A;  2JA2 A;  2JY7 A;  4F2L A;  4GKJ M;  1E9H B;  1N4M A;  1UNG D;  1C9B A;  2KR6 A;  3HJ8 A;  3T15 A;  4BBA A;  4L4U A;  3H4C A;  5FLX S;  3GLF B;  1D0L A;  2VF7 A;  3HHZ A;  3QHR B;  3FYC A;  2M5Z A;  1QZE A;  2K0B X;  4II7 A;  4LJ8 A;  2KDL A;  2C6T B;  3A8L B;  2ZTD A;  2G5G X;  1K3X A;  1R2Z A;  2R45 A;  3NWL A;  4JI6 M;  4DV2 M;  3U6L A;  1GVN A;  5EP2 A;  3SYL A;  3VK7 A;  1H27 B;  4CJ6 A;  1KFV A;  5KQ8 A;  4FX3 B;  4PT5 A;  1GUX B;  2UUC M;  3U60 B;  4JI5 M;  2BKZ B;  3MIA B;  3HX3 A;  1OGU B;  2DD4 B;  3SMP A;  2DAM A;  4GIT A;  2R65 A;  3QHW B;  1IY2 A;  4MM3 B;  3KW6 A;  3U5Z B;  1FNN A;  3BHV B;  3CGW A;  3GRY A;  1V34 A;  4MGH A;  4I8O A;  4BCG B;  1OKS A;  1W5S A;  3VK8 A;  2EJS A;  2FH0 A;  2FOI C;  1IY0 A;  4IBF A;  1W5T A;  2D7E A;  4JI8 M;  3GPU A;  2W82 A;  1NVM A;  3F92 A;  1L1Z A;  4P17 A;  2CZ7 B;  2CZ6 B;  4JX6 A;  3X28 B;  3A8G B;  4OX9 M;  1IN7 A;  3LQQ A;  4GHA A;  2YQZ A;  1OAI A;  1VQ1 A;  4M9Z A;  1TH2 A;  1H28 B;  1SXJ B;  2ZPH B;  3SAR A;  4BCK B;  1IN6 A;  2B3T A;  3E46 A;  2N35 A;  4JI3 M;  1A5T A;  1QAQ A;  1VOL A;  4F1I A;  3GRV A;  1Z59 A;  1VEG A;  4OB0 B;  2HAK A;  4LF6 M;  4LZJ A;  3DL1 A;  3HHX A;  4QOS A;  4IJF A;  5LMU M;  1E32 A;  3SMS A;  2DEN A;  1GL7 A;  3EJ1 B;  4EOO B;  4LFB M;  3LCU A;  2DZO B;  1DGG A;  3EOC B;  3WVD B;  3HBL A;  2QHO B;  2C9O A;  2WSC F;  3X24 B;  1NNJ A;  1N75 A;  2XH9 A;  1EE8 A;  1TGU A;  2HHH M;  2DXB B;  5CYI B;  3I4Y A;  1G71 A;  3RGP A;  3JR4 A;  3NBI A;  2XZU A;  2KRU A;  2D7G A;  2W96 A;  1Z6T A;  1OIU B;  4PDI A;  1IN4 A;  2YFQ A;  1QZM A;  3U61 A;  3GLG E;  1L2B A;  3R8F A;  4CIZ A;  2KHH A;  4QNM A;  2X8A A;  3B57 A;  1H6U A;  4KRC B;  1QAN A;  3SAT A;  2JZ0 A;  2J5Y A;  4BY7 X;  3Q8G A;  4EC9 B;  4B7H A;  4MFD A;  2FS1 A;  2DHY A;  5L8R F;  3SAV A;  3W0L B;  4OVZ B;  2DKL A;  4X65 M;  4QHS A;  1L2C A;  3JAM S;  4B3S M;  3HGI A;  3HZJ A;  4G6L B;  3X25 B;  3SHG B;  2QBY A;  1EFU B;  2BJV A;  4P16 A;  3U6C A;  3CF2 A;  2MR9 A;  1PGY A;  4GKK M;  4B3T M;  3KDS E;  2WMB B;  1UM8 A;  4DV7 M;  3GLH A;  4KT0 F;  2W9F A;  4JX4 A;  1I94 M;  4QOZ C;  4DR4 M;  3TW6 A;  4F7S B;  1FJG M;  1AHJ B;  4XGI A;  5FTN A;  1J7K A;  3QYB A;  2UXC M;  4G6Z A;  4OW0 A;  3AOE C;  4PD2 A;  5FTK A;  4LG2 A;  1LV7 A;  2YR0 A;  2QCU A;  1HNZ M;  4G4R A;  4YOS A;  1OKW B;  2CV1 A;  1H1R B;  2ZPB B;  2JZ1 A;  1R5L A;  1XC8 A;  3UK6 A;  3H4M A;  2DVW B;  3HHT B;  2BS3 A;  1E9R A;  1UGP B;  1ZP2 A;  2G9X B;  3VYH B;  4OB1 B;  2R46 A;  3MMP A;  3PVS A;  4M6V A;  4F6U B;  1IFY A;  5LQF B;  2QQ8 A;  2FNA A;  2Z8Y M;  2DAG A;  3POM A;  4OR5 B;  4RKU F;  2NQ8 C;  2ZTC A;  4W5W A;  3K9P A;  5EP1 A;  2R18 A;  4CHT B;  2G77 A;  3WHK A;  2L4E A;  1FVV B;  4IBI A;  1VIN A;  3IHP A;  1AD6 A;  3L27 A;  5A2Q S;  4EOI B;  1E94 E;  1T3T A;  1VEJ A;  1ENW A;  2QDJ A;  4LFA M;  3RGF B;  4BCH B;  1OFH A;  2DD5 B;  4F7J B;  1DO0 A;  3Q8X A;  4LGY A;  5KO3 A;  2D7H A;  3LMM A;  4NSO B;  2ZPE B;  4HNV A;  1WHC A;  1F5Q B;  4D82 A;  3A42 A;  4PCZ A;  3UMM A;  4RF1 A;  3C3D A;  4Y72 B;  3KP1 E;  1AUA A;  1YLA A;  2XFS A;  1TD6 A;  2KEB A;  4JI0 M;  4NST B;  1G8P A;  2ZZD B;  1O9K A;  1D0M A;  1KSF X;  2FFJ A;  5IRE B;  4B08 A;  3MK6 A;  2DNA A;  2LVA A;  3A8H B;  4CFU D;  1TR8 A;  2CV2 A;  2Y20 A;  3J2P B;  3T6P A;  3K8Z A;  3E4R A;  4RF0 A;  2CCH B;  1ZV1 A;  3E9S A;  2VII A;  4XBO A;  2UZE B;  3KHI A;  4I3Z B;  4DR3 M;  2C5V B;  2KA6 B;  2C5N B;  3DFZ A;  4GH9 A;  3HB9 A;  2LNH C;  2ZPG B;  3AOE A;  3PFI A;  1Q3C A;  3FRH A;  3C3E A;  4LCB A;  4L15 A;  3GLG B;  3FTC A;  3QZ9 B;  1ORY B;  2UUB M;  1PJT A;  4JI4 M;  4DR5 M;  3KOX E;  4LFC M;  2DI0 A;  4MFE A;  2DAK A;  4GC9 A;  2UUE B;  3TQS A;  5F3W A;  2YNM D;  3I04 M;  2XGN A;  4DR6 M;  2PK2 A;  1XNQ M;  2BJW A;  2V1C A;  1H24 B;  2L6O A;  3J27 B;  3TNW B;  1HJP A;  2OOB A;  4BLC A;  1NY6 A;  2CYZ B;  4CRL B;  3M03 A;  2I7N A;  3MY5 B;  1XHB A;  5IDP B;  3DZD A;  2Z4R A;  5KPR A;  4HEO A;  1QLB A;  3LVV A;  2Q2E B;  3VDU A;  2DAE A;  3T1Y M;  2ZAN A;  3HKP A;  1OAO C;  2ZPI B;  3KFU G;  2KZU A;  4I81 A;  4BY1 X;  4WW0 A;  3GTM S;  3HWS A;  1E7P A;  3BLR B;  4K0K M;  1NV9 A;  3MY1 B;  1QVR A;  1G41 A;  5FGK B;  4AKI A;  3K7A M;  2BPM B;  3KSX A;  2JGZ B;  1WGN A;  4EON B;  4REZ A;  4F7N B;  4BCQ D;  4CFN B;  4X66 M;  1K82 A;  4G4O A;  4EIW A;  1IN8 A;  2QBY B;  2VDB B;  2QZ4 A;  2L4F A;  4CFM B;  4TTH A;  3M6A A;  1URC B;  4LJ7 A;  1Z5C A;  4L78 A;  1ZMU A;  1IXR C;  3UJN A;  3TN8 B;  2HL7 A;  3U6E A;  4B3M M;  3AKZ A;  1G4A E;  4MGZ E;  3GRR A;  2VF8 A;  2BS4 A;  2LVN C;  1V29 B;  1CUK A;  3PO3 S;  2CEA A;  3SAS A;  2ZPF B;  5L2W B;  1H1S B;  4MB7 A;  3HJS A;  2RGH A;  5KPZ A;  4DV3 M;  2D0Q B;  5IHY A;  4DBG B;  1IXS B;  1NNU C;  3VYG B;  1Q39 A;  3VLF B;  1UGS B;  3VFD A;  1D2N A;  2GNO A;  4L6V 6;  3CF6 E;  3A98 B;  4NRW A;  2JUJ A;  4GIP A;  3B89 A;  4L8R C;  3TNI B;  3KSJ A;  3DA1 A;  1YE9 A;  2DXI A;  3VDP A;  1XWI A;  1GY3 B;  4R3D A;  1DGF A;  2CHV A;  3VKH A;  1ZQ9 A;  5ITT A;  2DME A;  2J7N A;  3L29 A;  7CAT A;  3J7A S;  2VQE M;  2PK9 B;  4IBC A;  4FWG A;  1L1T A;  4LJ6 A;  1OI9 B;  4EOL B;  3TWL A;  2K47 A;  3TWM A;  1N77 A;  3A8M B;  2R44 A;  1S3S A;  1NSF A;  2H1R A;  4FCW A;  3W67 A;  4NXM M;  2C5O B;  3OTO M;  2XLJ A;  1GKI A;  1HT2 E;  1X37 A;  4OGR B; 
#chains in the Genus database with same CATH homology
 1I94 M;  4FCV A;  5EXS A;  3A8O B;  5FTM A;  2Y0T A;  3SBJ A;  4DR4 M;  4QOZ C;  3TW6 A;  4DV0 M;  4OU7 A;  1PJI A;  3BOS A;  2AHJ B;  3PXG A;  4LF9 M;  1DGB A;  2Z7J A;  4M0W A;  2XSZ A;  2X4A A;  1FJG M;  1AHJ B;  4XGI A;  3U6D A;  5FTN A;  5DNY A;  1HNW M;  1J7K A;  4OB3 B;  3QYB A;  2ERC A;  2UXC M;  2ZCF B;  1HQC A;  4M9X A;  3ZC7 B;  1SXJ E;  4G6Z A;  4OW0 A;  3AOE C;  4PD2 A;  5FTK A;  3R9X B;  3GLH B;  4LG2 A;  1LV7 A;  4KO8 A;  5ITX A;  4QSH A;  2R62 A;  2YR0 A;  2QCU A;  4IIW A;  1R6B X;  3HHY A;  1HNZ M;  4JV5 M;  3TWK A;  4G4R A;  2XEP A;  1XXH A;  2CV1 A;  1NHG C;  3WHL A;  2ZPB B;  3DOA A;  5DYG A;  2I7P A;  3ILK A;  5EXP A;  1VDD A;  1N36 M;  2E5L M;  4B3R M;  1XC8 A;  3UK6 A;  3H4M A;  4OB2 B;  3AL0 C;  4NRV A;  2DVW B;  3ZH9 B;  5IWA M;  4X62 M;  3HHT B;  2BS3 A;  1E9R A;  3GP1 A;  1UGP B;  1Z5B A;  4D80 A;  3A46 A;  5C18 A;  1L2D A;  3TL4 X;  2CUZ A;  4AW4 A;  2HCB A;  4RNA A;  3BG9 A;  3VYH B;  4OB1 B;  4JXJ A;  2R46 A;  4B7F A;  4IBD A;  3KVW A;  3PVS A;  4M6V A;  4HNT A;  3ZCB B;  1IBM M;  2QQ8 A;  3HJQ A;  2FNA A;  1N32 M;  2WJ9 A;  3HU2 A;  5JI3 E;  4X64 M;  1IQP A;  2R4E A;  5FTJ A;  1KYI A;  2ZBK B;  3I51 A;  3J81 S;  4DV5 M;  2C9C A;  2CE7 A;  2NQ8 C;  3GLI A;  3K2L A;  4W5W A;  4BB9 A;  4LF4 M;  2Y0Q A;  5EP1 A;  1NHW C;  4IBE A;  3GQ4 A;  3A45 A;  2R18 A;  2DWZ B;  4PDG A;  4CHT B;  2DWM A;  1IN5 A;  4DR7 M;  2G77 A;  2DZN B;  3WHK A;  3SYK A;  3LVW A;  1QQW A;  2O5R A;  4IBI A;  1J09 A;  3HU1 A;  2OQ4 A;  2EA0 A;  1MU5 A;  4D81 A;  2J7O A;  1GL6 A;  3WVE B;  2M60 A;  3L2A A;  4DR1 M;  4LZZ A;  3L27 A;  5A2Q S;  4FVM A;  1E94 E;  1MX0 A;  1T3T A;  3PNV A;  4LF5 M;  4IJE A;  4JI7 M;  4LF7 M;  3QYH B;  1DGH B;  3CTW B;  4JYA M;  5ITX E;  3UZU A;  2UXD M;  4JI2 M;  4ZGD B;  3KP0 E;  3GLI B;  2UUA M;  2QDJ A;  3GRU A;  2XFT A;  3FUT A;  4LFA M;  4CGY B;  4GRI A;  2QEN A;  4I5S A;  1OFH A;  2DD5 B;  3B9P A;  1TDH A;  4ZGE B;  5E26 A;  1DO0 A;  3RFW A;  5IZ7 D;  2KXE A;  3Q8X A;  4LGY A;  5KO3 A;  2D7H A;  3LMM A;  4NSO B;  2ZPE B;  4HNV A;  4LOC A;  4MGY E;  4S12 A;  2ZAO A;  4DV6 M;  1IY1 A;  2FE8 A;  1UGQ B;  4D82 A;  2JA2 A;  3A42 A;  4PCZ A;  3UMM A;  5H37 D;  4GKJ M;  3TPZ A;  2EUC A;  4ELJ A;  4RF1 A;  5BPV A;  3QAU A;  3FTE A;  2KR6 A;  1HQY E;  3HJ8 A;  4B7G A;  3KP1 E;  3T15 A;  4BBA A;  4L4U A;  3H4C A;  4R7G A;  3L25 A;  1XMO M;  2CZ1 B;  2XFS A;  4FM4 B;  4AKH A;  2KEB A;  5FLX S;  2DHR A;  3GLF B;  3GPY A;  4JI0 M;  1C1K A;  1G8P A;  2DWN A;  3HHZ A;  2ZZD B;  3FYC A;  4LRT A;  1KSF X;  2FFJ A;  2M5Z A;  5IRE B;  1FKM A;  4AG6 A;  4B08 A;  4AKG A;  3MK6 A;  2EO2 A;  4II7 A;  3IG8 A;  3PNY A;  4LJ9 A;  4LJ8 A;  3A8H B;  2CV2 A;  3SC3 A;  3A8L B;  4AI6 A;  1IXZ A;  2Z4S A;  2G5G X;  2Y20 A;  1K3X A;  3KXE C;  4FCT A;  3J2P B;  1R2Z A;  3K8Z A;  4NSR A;  2R45 A;  3E4R A;  4RF0 A;  3NWL A;  4JI6 M;  4GMQ A;  4DV2 M;  3U6L A;  3E9S A;  2VII A;  4XBO A;  4MGK E;  2CZ0 B;  1GVN A;  3GLG A;  2DPP B;  5EP2 A;  3SYL A;  3VK7 A;  4TUW A;  3LQR A;  5ITQ A;  3KHI A;  1KFV A;  4DR3 M;  3HU3 A;  5KQ8 A;  1IBL M;  2KA6 B;  3DFZ A;  1GLN A;  4GH9 A;  4I4L A;  1XMQ M;  3I4V A;  3HB9 A;  4PT5 A;  3SFZ A;  2LNH C;  2UUC M;  3U60 B;  2ZPG B;  1HT1 E;  3TE6 A;  3AOE A;  3PFI A;  4JI5 M;  1Q3C A;  4LJ5 A;  4DV1 M;  4LCB A;  4MIM A;  4L15 A;  3GLG B;  3FTC A;  2DD4 B;  3HO8 A;  3SMP A;  1N34 M;  1I4W A;  2BS2 A;  1ORY B;  4NOO B;  2CHG A;  2UUB M;  4JI4 M;  3QZ9 B;  2OPF A;  4DUY M;  2LWX A;  3K92 A;  4GIT A;  2R65 A;  4DR5 M;  2V1U A;  3KOX E;  4LFC M;  2F5O A;  5EXX A;  4A3V B;  3EIH A;  3FUX A;  1IY2 A;  4MFE A;  4MM3 B;  3KW6 A;  4GC9 A;  2L7I A;  1DGH A;  3U5Z B;  1FNN A;  4AG5 A;  3TQS A;  1OFI A;  1QAO A;  3GRY A;  2YNM D;  5F3W A;  2Z3X A;  2XGN A;  3BG5 A;  4DR6 M;  1XNQ M;  1N33 M;  2BJW A;  2R4J A;  1WXQ A;  2V1C A;  2L6O A;  3JR5 A;  2CFO A;  4MGH A;  4GHL A;  3KOW E;  4DR2 M;  4I8O A;  1Z5A A;  3J27 B;  2G8L A;  1W5S A;  4BLC A;  3VK8 A;  1NY6 A;  2CYZ B;  3X20 B;  3GPX A;  2FOI C;  1IY0 A;  4IBF A;  2A5Y B;  3QWL A;  2I7N A;  1XHB A;  4JI1 M;  1SXJ C;  3DZD A;  4LRS A;  4DV4 M;  2Z4R A;  1W5T A;  5KPR A;  4L16 A;  2D7E A;  3KS4 A;  3U6O A;  4JI8 M;  3GPU A;  3U6M A;  3GLF A;  1QLB A;  2W82 A;  1NVM A;  5JI2 E;  1TH3 A;  3LVV A;  2Q2E B;  1G3I A;  3VDU A;  3FUV A;  1L1Z A;  3TW7 A;  4IBG A;  2P5T A;  4KOD A;  3T1Y M;  3UGJ A;  2CZ7 B;  2CZ6 B;  4JX6 A;  4NC6 A;  2ZAN A;  5GKN A;  3HKP A;  3X28 B;  4QNR A;  4Z8X A;  3KFU G;  2ZPI B;  2KZU A;  1OJL A;  1QAM A;  4I81 A;  3A8G B;  1E9S A;  4WW0 A;  3HHW A;  3U6Q A;  4OX9 M;  1IN7 A;  3LQQ A;  4KHP M;  2KZS A;  4GHA A;  3D8B A;  2YQZ A;  3HWS A;  2C96 A;  3AV0 A;  3THG A;  1E7P A;  3MHV C;  2DWL A;  2VQF M;  8CAT A;  2XF3 A;  3EIE A;  3AFH A;  4M9Z A;  4K0K M;  1TH2 A;  4LGM A;  1QVR A;  2QP9 X;  3SAU A;  1SXJ B;  1DO2 A;  1IRE B;  1G41 A;  4G4Q A;  2ZPH B;  4AKI A;  3SAR A;  1IN6 A;  3KSX A;  2CV0 A;  3W0F A;  1NY5 A;  4JI3 M;  1R2Y A;  3M0E A;  3IG5 A;  3GQ3 A;  2CHQ A;  4REZ A;  1QAQ A;  5FSW A;  4FW9 A;  3U60 A;  4BBR M;  1L8Q A;  3GRV A;  4X66 M;  1K82 A;  2ZM6 M;  1Z59 A;  4G4O A;  2F5S A;  1NJG A;  4CIS A;  1N78 A;  4OB0 B;  3L26 A;  4M0D A;  5ITY A;  2F4V M;  4IBJ A;  4EIW A;  4FD2 A;  1IN8 A;  2QBY B;  3QXE B;  4LF6 M;  2HKJ A;  2QZ4 A;  4ITQ A;  4LZJ A;  3DL1 A;  1JQJ C;  3HHX A;  3M6A A;  4HLQ A;  5EP4 A;  1R7R A;  4QOS A;  4LJ7 A;  3M7G A;  1G59 A;  1Z5C A;  4IJF A;  4L78 A;  2KMG A;  5LMU M;  1E32 A;  2LXE A;  1IBK M;  3SMS A;  3RE8 A;  1IXR C;  3UJN A;  1GL7 A;  3CF0 A;  2HL7 A;  3U6E A;  4B3M M;  3AKZ A;  3AOG A;  1G4A E;  4MGZ E;  1YSY A;  3SAW A;  3GRR A;  3VKG A;  3QYG B;  3U5Z A;  4LFB M;  4ZGJ B;  1JR3 A;  2QPA A;  2BS4 A;  1UGR B;  2DZO B;  4LJA A;  5E6J A;  4YHH M;  1V29 B;  1DGG A;  2CEA A;  4ZPX A;  3SAS A;  3WVD B;  5EP3 A;  1SXJ D;  2ZPF B;  3HBL A;  2KW0 A;  3U6P A;  4WUR A;  2RGO A;  4MGI E;  4MB7 A;  5FTL A;  2QDY B;  2C9O A;  3HJS A;  3X24 B;  2RGH A;  5KPZ A;  1NNJ A;  1N75 A;  3QYE A;  2RKO A;  4JX5 A;  4LJ4 A;  3SHF A;  2XH9 A;  2Y21 A;  4DV3 M;  3KOZ E;  2C99 A;  1EE8 A;  1TGU A;  2HHH M;  2DXB B;  1Q3B A;  3I4Y A;  2D0Q B;  4NXN M;  2V6Z M;  4KLN A;  3RGP A;  3JR4 A;  1IXS B;  1NNU C;  1XNR M;  3NBI A;  2QFZ A;  3VYG B;  2XZU A;  2KRU A;  2D7G A;  4QHT A;  5EXT A;  1Q39 A;  2X49 A;  3QZ5 B;  5DYI A;  3VLF B;  3KOY E;  4LY6 A;  5ITU A;  3KS8 A;  1XXH B;  1UGS B;  1Z6T A;  3VFD A;  1D2N A;  2F5N A;  4PDI A;  3FD9 A;  2AHM A;  1J5E M;  1IN4 A;  2YFQ A;  3CF6 E;  3A98 B;  4G4N A;  5ITR A;  1QZM A;  4NRW A;  3U61 A;  4GIP A;  1L2B A;  3R8F A;  1QYR A;  1IM2 A;  3U6S A;  4L8R C;  4OVZ A;  3GO8 A;  1PJJ A;  4QNM A;  2X8A A;  3KSJ A;  3L28 A;  1H6U A;  3MJ5 A;  1QAN A;  3DA1 A;  1YE9 A;  3SAT A;  2DXI A;  3VDP A;  1XWI A;  3FTD A;  4LF8 M;  4R3D A;  1DGF A;  4AZF A;  2L09 A;  4HL4 A;  2CHV A;  3VKH A;  3GQ5 A;  4IBB A;  4NL4 H;  1ZQ9 A;  5ITT A;  2F5Q A;  2XSZ D;  1ZAE A;  4JN6 A;  2J7N A;  3FUU A;  1SXJ A;  3L29 A;  4B7H A;  2UXB M;  7CAT A;  5KPT A;  3X26 B;  3J7A S;  1YUB A;  2VQE M;  4MFD A;  3U61 B;  4MH0 E;  3SAV A;  1JR3 D;  1PM5 A;  3W0L B;  4IBC A;  4OVZ B;  3AJI B;  4X65 M;  5EJC A;  4FWG A;  2F5P A;  4QHS A;  1L2C A;  3FKE A;  3JAM S;  4B3S M;  3J80 S;  1L1T A;  2C98 A;  2L7H A;  2LH0 A;  3HGI A;  4LJ6 A;  4BBS M;  2QF7 A;  3HZJ A;  2C5R A;  3X25 B;  3TWL A;  5BR8 M;  3SHG B;  2QBY A;  2K47 A;  3RGS A;  4DUZ M;  2BJV A;  5C1B A;  4IBK A;  1HNX M;  3TWM A;  4AQY M;  1N77 A;  5EQT A;  4FWH A;  5KQD A;  3A8M B;  4HNU A;  4P16 A;  3K1J A;  1HR0 M;  3FYD A;  3U6C A;  4M9S A;  1S3S A;  3C58 A;  3BG3 A;  1NSF A;  2H1R A;  4FCW A;  2XZF A;  4FWD A;  2DXC B;  1TH4 A;  3J7B A;  3T1H M;  5LMN M;  2KRK A;  3D8L A;  4YY3 M;  5IT9 S;  1TDZ A;  3GPP A;  3CF2 A;  2UU9 M;  4NXM M;  2ZAM A;  4GKK M;  3FUW A;  3OTO M;  4B3T M;  3KDS E;  4Z6Y A;  1NJF A;  2XLJ A;  1GKI A;  4GC5 A;  2BNK A;  1HT2 E;  1X37 A;  1UM8 A;  4DV7 M;  3GLH A;  3T38 A;  3FTF A;  1K3W A;  4JX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...