4EOKB

Thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor nu6102
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eokB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eokB02
4F7LB 5L2WB 1OIUB 1URCB 1ZP2A 1OL1B 2UZLB 3BLRB 2F2CA 3F5XB 5ICPB 2W9ZA 1H25B 2WEVB 3EIDB 3RGFB 1H4LD 1JOWA 2EUFA 3DDPB 4EC9B 4CXAB 2C5OB 5HNBB 2W99A 3H4CA 4EOIB 2JGZB 4F70B 1P5EB 4EOJB 4CFNB 3POMA 5CYIB 4BCOB 4YC3B 1GH6B 2C4GB 3DOGB 4BCPB 1G3NC 4EORB 4ELJA 2WPAB 2CJMB 5ACBA 1AD6A 3EOCB 4F6SB 2BKZB 1KXUA 1H27B 3TN8B 1UNGD 4BCQB 4CFUD 1O9KA 1UNHD 4EOKB 1VINA 2WIHB 2WMAB 5I5ZB 2QDJA 5LQFB 1GY3B 4BCJB 4F7NB 4BCMB 4ELLA 1H28B 2UZDB 4G6LB 1OI9B 2IVXA 2IW8B 4CFWB 2W2HA 1O9KB 3MI9B 1JSUB 3EJ1B 1UNLD 3TNIB 4ROCA 2X1NB 4KRDB 4TTHA 4EOSB 3QHRB 1N4MA 3MY1B 3BLQB 1PKDB 5BNJB 1H1PB 4IMYB 4BCND 3K7AM 4OGRB 4CFXB 4CFVB 2W96A 2C5NB 4I3ZB 1OIYB 2CCHB 4FX3B 2IW6B 1FINB 2UZEB 4EOMB 4ROEA 3BHVB 1OKWB 1BU2A 2PMIB 1E9HB 2C6TB 4CRLB 1OGUB 2R7GA 5FGKB 1D3UB 2BPMB 3O0GD 4RODA 2G9XB 2PK2A 2UZBB 5HBJB 4EOOB 4EOQB 2WHBB 4NSTB 3QHWB 3BHTB 1C9BA 1AISB 2C5VB 2I40B 4F7JB 4EC8B 1GUXA 2WFYB 1H26B 1XO2A 2UUEB 2V22B 3BHUB 4BCGB 5HBEB 1H24B 2WXVB 1F5QB 1OKVB 4EOPB 2IW9B 3M03A 5IDNB 5IF1B 5HQ0B 4F6UB 3MIAB 5CEIB 2WMBB 3BLHB 4BCNB 2B9RA 1H1SB 3G33B 4UN0A 4BCKB 4CFUB 4II5B 4YOZA 1GUXB 1FVVB 2I53A 4KRCB 4BCIB 4BCHB 5EFQB 4YOSA 4BCFB 4YOOA 3DDQB 5HBHB 2CCIB 3TNHB 5LMKB 4F7SB 2PK9B 5HVYB 1H1RB 1H1QB 3TNWB 1VOLA 1VYWB 4F6WB 1OL2B 2PHGA 1QMZB 1W98B 4OR5B 2C5XB 2WIPB 4BCQD 2W9FA 5IDPB 4CFMB 4EONB 1JKWA 3LQ5B 1JSTB 3MY5B 4Y72B 4EOLB 1TFBA 4BCMD
chains in the Genus database with same CATH superfamily
4F7LB 5L2WB 1URCB 4M6VA 2ZCFB 5ICPB 2QQ8A 3DL1A 3DDPB 2C5OB 3H4CA 3BG3A 4F70B 4CFNB 5CYIB 4EORB 1AD6A 3EOCB 1H27B 2BS2A 1UNHD 2WIHB 2QDJA 3A8HB 3HB9A 4ELLA 1H28B 2UZDB 4MFDA 2IW8B 2DMEA 4ROCA 2ZPFB 3BLQB 1PKDB 1H1PB 4IMYB 4OB1B 2CCHB 2IW6B 4BXXX 3BHVB 1E9HB 1TD6A 4CRLB 1D3UB 3VYGB 4RODA 5HBJB 1UGQB 2WJ9A 2C5VB 2I40B 1GUXA 2V22B 2UUEB 4EOPB 1ENWA 3M03A 3X20B 3G33B 3X28B 4MIMA 2I53A 4BCHB 4YOSA 3DDQB 5HBHB 1OL2B 2PHGA 1W98B 4BCQD 3BG5A 1JKWA 3LQ5B 4JX6A 1XO2A 4BCMD 4AI6A 3HO8A 1OIUB 1ZP2A 2CZ6B 2D0QB 2QGSA 2F2CA 3F5XB 2W9ZA 2EUFA 5HNBB 4EOIB 2JGZB 1P5EB 4HNUA 3POMA 3X24B 2G77A 2C4GB 2BS3A 4F6SB 4EOKB 3DJBA 1GY3B 4BCJB 1OI9B 2IVXA 2ZPBB 1O9KB 3X25B 2BS4A 4HNTA 4TTHA 5IHYA 4EOSB 3QHRB 1N4MA 3MY1B 4QSHA 5BNJB 4AKGA 3K7AM 2C5NB 4ROEA 1OGUB 2R7GA 5FGKB 4ZGDB 5DQVA 4HL4A 3A8MB 2AHJB 3QYEA 2PK2A 1FKMA 4EOQB 2KR6A 3BHTB 1AISB 2WFYB 5HBEB 1H24B 4F6UB 4BCNB 3BLHB 4MFEA 4CFUB 4II5B 4YOZA 4BBRM 4BCIB 5EFQB 4YOOA 4F7SB 2PK9B 5HVYB 4JX4A 1VOLA 1VYWB 2DPPB 4F6WB 3QWLA 2C5XB 4EONB 3QYGB 3MY5B 4Y72B 2ZPGB 3B57A 2CYZB 2PJQA 2ZPIB 3NDQA 3BLRB 3TW7A 1H25B 3EIDB 3RGFB 1H4LD 1JOWA 2QF7A 4FM4B 2W99A 2QFZA 1GH6B 2W2HA 4BCPB 2WPAB 2CJMB 4OB2B 4CFUD 1VINA 5I5ZB 5LQFB 4HNVA 4G6LB 3VKHA 3MI9B 2X1NB 3HHTB 3A8OB 1V29B 4BY1X 2LW4A 3QXEB 4OGRB 2W96A 4I3ZB 1OIYB 4FX3B 1FINB 1BU2A 2PMIB 2IN3A 3BG9A 3O0GD 4OB0B 2G9XB 2UZBB 2WHBB 3A8LB 2CZ7B 2DD4B 4NSTB 3QHWB 1C9BA 2CZ0B 1H26B 4BCGB 2WXVB 1F5QB 1OKVB 5HQ0B 2CZ1B 3MIAB 2WMBB 4OB3B 2B9RA 4UN0A 4BCKB 1GUXB 1FVVB 2CCIB 3TNHB 4Z6YA 1H1RB 1H1QB 4OR5B 5DQWA 2ZPHB 4AKHA 2W9FA 3QYHB 4CFMB 1QLBA 4AKIA 1OL1B 1UGRB 3KHIA 2UZLB 3WVDB 2WEVB 4EC9B 4CXAB 4BBSM 4JX5A 3WVEB 3VKGA 4HLQA 3VYHB 4EOJB 4BCOB 4YC3B 3DOGB 1G3NC 4ELJA 5ACBA 3DTOA 2BKZB 1KXUA 3TN8B 1UNGD 4BCQB 1O9KA 2WMAB 2DD5B 2QDYB 4F7NB 4BCMB 4CFWB 1JSUB 3EJ1B 1UNLD 3TNIB 4KRDB 1AHJB 1UGPB 3X26B 4LOCA 2DXCB 3HBLA 4BCND 4CFXB 4CFVB 4ZGJB 2UZEB 4EOMB 1OKWB 3QYBA 2C6TB 2BPMB 2ZPEB 4EOOB 5EJCA 4F7JB 4EC8B 3TW6A 2ZZDB 3BHUB 3A8GB 1UGSB 3PO3S 2DXBB 2IW9B 5IDNB 5IF1B 4BY7X 1IREB 5CEIB 1H1SB 4KRCB 2KMGA 3HZJA 4BCFB 5LMKB 3GTMS 3QZ9B 3TNWB 4ZGEB 1QMZB 1E7PA 2WIPB 5IDPB 4NC6A 1JSTB 3QZ5B 4EOLB 1TFBA
chains in the Genus database with same CATH topology
4F7LB 5L2WB 1OIUB 1URCB 1ZP2A 1OL1B 2UZLB 3BLRB 2F2CA 3F5XB 5ICPB 2W9ZA 1H25B 2WEVB 3EIDB 3RGFB 1H4LD 1JOWA 2EUFA 3DDPB 4EC9B 4CXAB 2C5OB 5HNBB 2W99A 3H4CA 4EOIB 2JGZB 4F70B 1P5EB 4EOJB 4CFNB 3POMA 5CYIB 4BCOB 4YC3B 1GH6B 2C4GB 3DOGB 4BCPB 1G3NC 4EORB 4ELJA 2WPAB 2CJMB 5ACBA 1AD6A 3EOCB 4F6SB 2BKZB 1KXUA 1H27B 3TN8B 1UNGD 4BCQB 4CFUD 1O9KA 1UNHD 4EOKB 1VINA 2WIHB 2WMAB 5I5ZB 2QDJA 5LQFB 1GY3B 4BCJB 4F7NB 4BCMB 4ELLA 1H28B 2UZDB 4G6LB 1OI9B 2IVXA 2IW8B 4CFWB 2W2HA 1O9KB 3MI9B 1JSUB 3EJ1B 1UNLD 3TNIB 4ROCA 2X1NB 4KRDB 4TTHA 4EOSB 3QHRB 1N4MA 3MY1B 3BLQB 1PKDB 5BNJB 1H1PB 4IMYB 4BCND 3K7AM 4OGRB 4CFXB 4CFVB 2W96A 2C5NB 4I3ZB 1OIYB 2CCHB 4FX3B 2IW6B 1FINB 2UZEB 4EOMB 4ROEA 3BHVB 1OKWB 1BU2A 2PMIB 1E9HB 2C6TB 4CRLB 1OGUB 2R7GA 5FGKB 1D3UB 2BPMB 3O0GD 4RODA 2G9XB 2PK2A 2UZBB 5HBJB 4EOOB 4EOQB 2WHBB 4NSTB 3QHWB 3BHTB 1C9BA 1AISB 2C5VB 2I40B 4F7JB 4EC8B 1GUXA 2WFYB 1H26B 1XO2A 2UUEB 2V22B 3BHUB 4BCGB 5HBEB 1H24B 2WXVB 1F5QB 1OKVB 4EOPB 2IW9B 3M03A 5IDNB 5IF1B 5HQ0B 4F6UB 3MIAB 5CEIB 2WMBB 3BLHB 4BCNB 2B9RA 1H1SB 3G33B 4UN0A 4BCKB 4CFUB 4II5B 4YOZA 1GUXB 1FVVB 2I53A 4KRCB 4BCIB 4BCHB 5EFQB 4YOSA 4BCFB 4YOOA 3DDQB 5HBHB 2CCIB 3TNHB 5LMKB 4F7SB 2PK9B 5HVYB 1H1RB 1H1QB 3TNWB 1VOLA 1VYWB 4F6WB 1OL2B 2PHGA 1QMZB 1W98B 4OR5B 2C5XB 2WIPB 4BCQD 2W9FA 5IDPB 4CFMB 4EONB 1JKWA 3LQ5B 1JSTB 3MY5B 4Y72B 4EOLB 1TFBA 4BCMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7L B;  5L2W B;  1OIU B;  1URC B;  1ZP2 A;  1OL1 B;  2UZL B;  3BLR B;  2F2C A;  3F5X B;  5ICP B;  2W9Z A;  1H25 B;  2WEV B;  3EID B;  3RGF B;  1H4L D;  1JOW A;  2EUF A;  3DDP B;  4EC9 B;  4CXA B;  2C5O B;  5HNB B;  2W99 A;  3H4C A;  4EOI B;  2JGZ B;  4F70 B;  1P5E B;  4EOJ B;  4CFN B;  3POM A;  5CYI B;  4BCO B;  4YC3 B;  1GH6 B;  2C4G B;  3DOG B;  4BCP B;  1G3N C;  4EOR B;  4ELJ A;  2WPA B;  2CJM B;  5ACB A;  1AD6 A;  3EOC B;  4F6S B;  2BKZ B;  1KXU A;  1H27 B;  3TN8 B;  1UNG D;  4BCQ B;  4CFU D;  1O9K A;  1UNH D;  4EOK B;  1VIN A;  2WIH B;  2WMA B;  5I5Z B;  2QDJ A;  5LQF B;  1GY3 B;  4BCJ B;  4F7N B;  4BCM B;  4ELL A;  1H28 B;  2UZD B;  4G6L B;  1OI9 B;  2IVX A;  2IW8 B;  4CFW B;  2W2H A;  1O9K B;  3MI9 B;  1JSU B;  3EJ1 B;  1UNL D;  3TNI B;  4ROC A;  2X1N B;  4KRD B;  4TTH A;  4EOS B;  3QHR B;  1N4M A;  3MY1 B;  3BLQ B;  1PKD B;  5BNJ B;  1H1P B;  4IMY B;  4BCN D;  3K7A M;  4OGR B;  4CFX B;  4CFV B;  2W96 A;  2C5N B;  4I3Z B;  1OIY B;  2CCH B;  4FX3 B;  2IW6 B;  1FIN B;  2UZE B;  4EOM B;  4ROE A;  3BHV B;  1OKW B;  1BU2 A;  2PMI B;  1E9H B;  2C6T B;  4CRL B;  1OGU B;  2R7G A;  5FGK B;  1D3U B;  2BPM B;  3O0G D;  4ROD A;  2G9X B;  2PK2 A;  2UZB B;  5HBJ B;  4EOO B;  4EOQ B;  2WHB B;  4NST B;  3QHW B;  3BHT B;  1C9B A;  1AIS B;  2C5V B;  2I40 B;  4F7J B;  4EC8 B;  1GUX A;  2WFY B;  1H26 B;  1XO2 A;  2UUE B;  2V22 B;  3BHU B;  4BCG B;  5HBE B;  1H24 B;  2WXV B;  1F5Q B;  1OKV B;  4EOP B;  2IW9 B;  3M03 A;  5IDN B;  5IF1 B;  5HQ0 B;  4F6U B;  3MIA B;  5CEI B;  2WMB B;  3BLH B;  4BCN B;  2B9R A;  1H1S B;  3G33 B;  4UN0 A;  4BCK B;  4CFU B;  4II5 B;  4YOZ A;  1GUX B;  1FVV B;  2I53 A;  4KRC B;  4BCI B;  4BCH B;  5EFQ B;  4YOS A;  4BCF B;  4YOO A;  3DDQ B;  5HBH B;  2CCI B;  3TNH B;  5LMK B;  4F7S B;  2PK9 B;  5HVY B;  1H1R B;  1H1Q B;  3TNW B;  1VOL A;  1VYW B;  4F6W B;  1OL2 B;  2PHG A;  1QMZ B;  1W98 B;  4OR5 B;  2C5X B;  2WIP B;  4BCQ D;  2W9F A;  5IDP B;  4CFM B;  4EON B;  1JKW A;  3LQ5 B;  1JST B;  3MY5 B;  4Y72 B;  4EOL B;  1TFB A;  4BCM D; 
#chains in the Genus database with same CATH topology
 4F7L B;  5L2W B;  1URC B;  4M6V A;  2ZCF B;  5ICP B;  2QQ8 A;  3DL1 A;  3DDP B;  2C5O B;  3H4C A;  3BG3 A;  4F70 B;  4CFN B;  5CYI B;  4EOR B;  1AD6 A;  3EOC B;  1H27 B;  2BS2 A;  1UNH D;  2WIH B;  2QDJ A;  3A8H B;  3HB9 A;  4ELL A;  1H28 B;  2UZD B;  4MFD A;  2IW8 B;  2DME A;  4ROC A;  2ZPF B;  3BLQ B;  1PKD B;  1H1P B;  4IMY B;  4OB1 B;  2CCH B;  2IW6 B;  4BXX X;  3BHV B;  1E9H B;  1TD6 A;  4CRL B;  1D3U B;  3VYG B;  4ROD A;  5HBJ B;  1UGQ B;  2WJ9 A;  2C5V B;  2I40 B;  1GUX A;  2V22 B;  2UUE B;  4EOP B;  1ENW A;  3M03 A;  3X20 B;  3G33 B;  3X28 B;  4MIM A;  2I53 A;  4BCH B;  4YOS A;  3DDQ B;  5HBH B;  1OL2 B;  2PHG A;  1W98 B;  4BCQ D;  3BG5 A;  1JKW A;  3LQ5 B;  4JX6 A;  1XO2 A;  4BCM D;  4AI6 A;  3HO8 A;  1OIU B;  1ZP2 A;  2CZ6 B;  2D0Q B;  2QGS A;  2F2C A;  3F5X B;  2W9Z A;  2EUF A;  5HNB B;  4EOI B;  2JGZ B;  1P5E B;  4HNU A;  3POM A;  3X24 B;  2G77 A;  2C4G B;  2BS3 A;  4F6S B;  4EOK B;  3DJB A;  1GY3 B;  4BCJ B;  1OI9 B;  2IVX A;  2ZPB B;  1O9K B;  3X25 B;  2BS4 A;  4HNT A;  4TTH A;  5IHY A;  4EOS B;  3QHR B;  1N4M A;  3MY1 B;  4QSH A;  5BNJ B;  4AKG A;  3K7A M;  2C5N B;  4ROE A;  1OGU B;  2R7G A;  5FGK B;  4ZGD B;  5DQV A;  4HL4 A;  3A8M B;  2AHJ B;  3QYE A;  2PK2 A;  1FKM A;  4EOQ B;  2KR6 A;  3BHT B;  1AIS B;  2WFY B;  5HBE B;  1H24 B;  4F6U B;  4BCN B;  3BLH B;  4MFE A;  4CFU B;  4II5 B;  4YOZ A;  4BBR M;  4BCI B;  5EFQ B;  4YOO A;  4F7S B;  2PK9 B;  5HVY B;  4JX4 A;  1VOL A;  1VYW B;  2DPP B;  4F6W B;  3QWL A;  2C5X B;  4EON B;  3QYG B;  3MY5 B;  4Y72 B;  2ZPG B;  3B57 A;  2CYZ B;  2PJQ A;  2ZPI B;  3NDQ A;  3BLR B;  3TW7 A;  1H25 B;  3EID B;  3RGF B;  1H4L D;  1JOW A;  2QF7 A;  4FM4 B;  2W99 A;  2QFZ A;  1GH6 B;  2W2H A;  4BCP B;  2WPA B;  2CJM B;  4OB2 B;  4CFU D;  1VIN A;  5I5Z B;  5LQF B;  4HNV A;  4G6L B;  3VKH A;  3MI9 B;  2X1N B;  3HHT B;  3A8O B;  1V29 B;  4BY1 X;  2LW4 A;  3QXE B;  4OGR B;  2W96 A;  4I3Z B;  1OIY B;  4FX3 B;  1FIN B;  1BU2 A;  2PMI B;  2IN3 A;  3BG9 A;  3O0G D;  4OB0 B;  2G9X B;  2UZB B;  2WHB B;  3A8L B;  2CZ7 B;  2DD4 B;  4NST B;  3QHW B;  1C9B A;  2CZ0 B;  1H26 B;  4BCG B;  2WXV B;  1F5Q B;  1OKV B;  5HQ0 B;  2CZ1 B;  3MIA B;  2WMB B;  4OB3 B;  2B9R A;  4UN0 A;  4BCK B;  1GUX B;  1FVV B;  2CCI B;  3TNH B;  4Z6Y A;  1H1R B;  1H1Q B;  4OR5 B;  5DQW A;  2ZPH B;  4AKH A;  2W9F A;  3QYH B;  4CFM B;  1QLB A;  4AKI A;  1OL1 B;  1UGR B;  3KHI A;  2UZL B;  3WVD B;  2WEV B;  4EC9 B;  4CXA B;  4BBS M;  4JX5 A;  3WVE B;  3VKG A;  4HLQ A;  3VYH B;  4EOJ B;  4BCO B;  4YC3 B;  3DOG B;  1G3N C;  4ELJ A;  5ACB A;  3DTO A;  2BKZ B;  1KXU A;  3TN8 B;  1UNG D;  4BCQ B;  1O9K A;  2WMA B;  2DD5 B;  2QDY B;  4F7N B;  4BCM B;  4CFW B;  1JSU B;  3EJ1 B;  1UNL D;  3TNI B;  4KRD B;  1AHJ B;  1UGP B;  3X26 B;  4LOC A;  2DXC B;  3HBL A;  4BCN D;  4CFX B;  4CFV B;  4ZGJ B;  2UZE B;  4EOM B;  1OKW B;  3QYB A;  2C6T B;  2BPM B;  2ZPE B;  4EOO B;  5EJC A;  4F7J B;  4EC8 B;  3TW6 A;  2ZZD B;  3BHU B;  3A8G B;  1UGS B;  3PO3 S;  2DXB B;  2IW9 B;  5IDN B;  5IF1 B;  4BY7 X;  1IRE B;  5CEI B;  1H1S B;  4KRC B;  2KMG A;  3HZJ A;  4BCF B;  5LMK B;  3GTM S;  3QZ9 B;  3TNW B;  4ZGE B;  1QMZ B;  1E7P A;  2WIP B;  5IDP B;  4NC6 A;  1JST B;  3QZ5 B;  4EOL B;  1TFB A; 
#chains in the Genus database with same CATH homology
 4F7L B;  5L2W B;  1OIU B;  1URC B;  1ZP2 A;  1OL1 B;  2UZL B;  3BLR B;  2F2C A;  3F5X B;  5ICP B;  2W9Z A;  1H25 B;  2WEV B;  3EID B;  3RGF B;  1H4L D;  1JOW A;  2EUF A;  3DDP B;  4EC9 B;  4CXA B;  2C5O B;  5HNB B;  2W99 A;  3H4C A;  4EOI B;  2JGZ B;  4F70 B;  1P5E B;  4EOJ B;  4CFN B;  3POM A;  5CYI B;  4BCO B;  4YC3 B;  1GH6 B;  2C4G B;  3DOG B;  4BCP B;  1G3N C;  4EOR B;  4ELJ A;  2WPA B;  2CJM B;  5ACB A;  1AD6 A;  3EOC B;  4F6S B;  2BKZ B;  1KXU A;  1H27 B;  3TN8 B;  1UNG D;  4BCQ B;  4CFU D;  1O9K A;  1UNH D;  4EOK B;  1VIN A;  2WIH B;  2WMA B;  5I5Z B;  2QDJ A;  5LQF B;  1GY3 B;  4BCJ B;  4F7N B;  4BCM B;  4ELL A;  1H28 B;  2UZD B;  4G6L B;  1OI9 B;  2IVX A;  2IW8 B;  4CFW B;  2W2H A;  1O9K B;  3MI9 B;  1JSU B;  3EJ1 B;  1UNL D;  3TNI B;  4ROC A;  2X1N B;  4KRD B;  4TTH A;  4EOS B;  3QHR B;  1N4M A;  3MY1 B;  3BLQ B;  1PKD B;  5BNJ B;  1H1P B;  4IMY B;  4BCN D;  3K7A M;  4OGR B;  4CFX B;  4CFV B;  2W96 A;  2C5N B;  4I3Z B;  1OIY B;  2CCH B;  4FX3 B;  2IW6 B;  1FIN B;  2UZE B;  4EOM B;  4ROE A;  3BHV B;  1OKW B;  1BU2 A;  2PMI B;  1E9H B;  2C6T B;  4CRL B;  1OGU B;  2R7G A;  5FGK B;  1D3U B;  2BPM B;  3O0G D;  4ROD A;  2G9X B;  2PK2 A;  2UZB B;  5HBJ B;  4EOO B;  4EOQ B;  2WHB B;  4NST B;  3QHW B;  3BHT B;  1C9B A;  1AIS B;  2C5V B;  2I40 B;  4F7J B;  4EC8 B;  1GUX A;  2WFY B;  1H26 B;  1XO2 A;  2UUE B;  2V22 B;  3BHU B;  4BCG B;  5HBE B;  1H24 B;  2WXV B;  1F5Q B;  1OKV B;  4EOP B;  2IW9 B;  3M03 A;  5IDN B;  5IF1 B;  5HQ0 B;  4F6U B;  3MIA B;  5CEI B;  2WMB B;  3BLH B;  4BCN B;  2B9R A;  1H1S B;  3G33 B;  4UN0 A;  4BCK B;  4CFU B;  4II5 B;  4YOZ A;  1GUX B;  1FVV B;  2I53 A;  4KRC B;  4BCI B;  4BCH B;  5EFQ B;  4YOS A;  4BCF B;  4YOO A;  3DDQ B;  5HBH B;  2CCI B;  3TNH B;  5LMK B;  4F7S B;  2PK9 B;  5HVY B;  1H1R B;  1H1Q B;  3TNW B;  1VOL A;  1VYW B;  4F6W B;  1OL2 B;  2PHG A;  1QMZ B;  1W98 B;  4OR5 B;  2C5X B;  2WIP B;  4BCQ D;  2W9F A;  5IDP B;  4CFM B;  4EON B;  1JKW A;  3LQ5 B;  1JST B;  3MY5 B;  4Y72 B;  4EOL B;  1TFB A;  4BCM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...