4EOKB

Thr 160 phosphorylated cdk2 h84s, q85m, k89d - human cyclin a3 complex with the inhibitor nu6102
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eokB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4eokB02
4BCHB 2C4GB 5HNBB 4EOPB 1AD6A 1GUXA 5HQ0B 1ZP2A 2CCHB 4BCJB 2C5NB 4UN0A 4F6WB 5CEIB 2UZLB 4OR5B 3MI9B 4FX3B 5IDNB 4G6LB 5HBHB 1FVVB 4YOSA 3DOGB 4BCGB 2QDJA 4EORB 3BHVB 1KXUA 4BCKB 4F70B 5L2WB 1H28B 3BLHB 4BCMB 1UNHD 3MIAB 4CFMB 4BCMD 1H1RB 1XO2A 3POMA 1H24B 5HVYB 1TFBA 1UNGD 2B9RA 4I3ZB 2PK2A 4EOSB 1W98B 2C6TB 1OKVB 3EJ1B 2WEVB 2W9ZA 3TNHB 4CRLB 1JKWA 1H1PB 1H25B 1GH6B 1JOWA 2CCIB 5ICPB 2BPMB 1H27B 4BCPB 3EOCB 3TNIB 2C5OB 4KRCB 1QMZB 1BU2A 5FGKB 1D3UB 4BCND 4CFWB 5EFQB 4CFUB 1VINA 5LMKB 2I40B 3EIDB 4CFUD 1AISB 1H26B 4EOJB 3BLRB 3G33B 4F7SB 4F7NB 3QHRB 4BCOB 2IVXA 4EOOB 4CXAB 3BLQB 4YC3B 2JGZB 4YOOA 5ACBA 1G3NC 1H1SB 4BCFB 2C5VB 1P5EB 2W96A 3F5XB 1JSTB 4F6SB 4RODA 4EC8B 4IMYB 2W9FA 3BHUB 2V22B 1OL1B 5HBJB 3BHTB 4ELJA 2R7GA 2WIPB 3DDPB 3TNWB 3LQ5B 4BCNB 5HBEB 1OKWB 3TN8B 1VOLA 1JSUB 2C5XB 4EOIB 4BCQB 1OGUB 2W2HA 3O0GD 4F6UB 4BCQD 4EC9B 5LQFB 1URCB 1O9KA 2UZDB 4NSTB 3RGFB 4EOKB 5I5ZB 3MY5B 4F7JB 1N4MA 1PKDB 1VYWB 3K7AM 2WFYB 4OGRB 4CFXB 2F2CA 2IW6B 2UUEB 2WMBB 3DDQB 1C9BA 5IF1B 2BKZB 2G9XB 2WPAB 1UNLD 4EOMB 1GUXB 1OL2B 1H1QB 1E9HB 4Y72B 4KRDB 2IW9B 3QHWB 1GY3B 4ROEA 1H4LD 4II5B 4ELLA 4EOLB 2WXVB 2I53A 2UZEB 4CFNB 2CJMB 2X1NB 1OI9B 5CYIB 2IW8B 4EOQB 2WMAB 4YOZA 3M03A 4BCIB 2UZBB 1OIYB 4F7LB 5IDPB 4CFVB 1FINB 2W99A 5BNJB 3MY1B 4EONB 2WIHB 3H4CA 2WHBB 2PHGA 2EUFA 2PK9B 1O9KB 4TTHA 4ROCA 1OIUB 1F5QB 2PMIB
chains in the Genus database with same CATH superfamily
4FX3B 4G6LB 5HBHB 4BCGB 2ZPIB 2QDJA 1KXUA 4CFMB 3DTOA 1H24B 2QQ8A 2ZZDB 3TNHB 4NC6A 1H25B 2CCIB 2BPMB 5IHYA 2CZ7B 1QMZB 3VYHB 4HNTA 3HO8A 5EFQB 2QFZA 1VINA 5LMKB 2I40B 4CFUD 1FKMA 1H26B 3BLRB 4F7NB 3QHRB 4AKHA 2IVXA 4CXAB 2JGZB 3F5XB 4RODA 4IMYB 3BHUB 4ELJA 3DL1A 3X26B 4OB0B 3LQ5B 4BCNB 3TN8B 2KMGA 1OGUB 3O0GD 2DXCB 4NSTB 1O9KA 2UZDB 4HNUA 4ZGEB 1PKDB 4OGRB 1ENWA 2WMBB 2G9XB 3QHWB 2AHJB 4EOLB 1TD6A 4CFNB 3QYBA 1OI9B 4LOCA 5CYIB 4OB3B 4YOZA 4BCIB 3X25B 3MY1B 3H4CA 2D0QB 2PK9B 5HNBB 1AD6A 2DPPB 1ZP2A 2C5NB 4UN0A 5CEIB 4YOSA 4EORB 3DOGB 2ZPGB 1UNHD 4OB1B 3POMA 5HVYB 1TFBA 1UNGD 4I3ZB 3VKHA 4EOSB 1UGRB 2C6TB 2WEVB 2W9ZA 4CRLB 1H1PB 1JOWA 1GH6B 5ICPB 1H27B 4KRCB 4OB2B 1D3UB 4CFUB 1AISB 4F7SB 2BS4A 3HZJA 3TW7A 1UGQB 3X20B 4YOOA 5ACBA 1G3NC 1H1SB 4BCFB 3VKGA 1UGSB 4QSHA 1P5EB 1JSTB 3GTMS 4F6SB 4EC8B 4Z6YA 1IREB 1OKWB 1VOLA 4EOIB 4BCQD 4EC9B 3RGFB 4AKIA 2CZ1B 4F7JB 2WFYB 3BG3A 2F2CA 2IW6B 2UUEB 1C9BA 5IF1B 2KR6A 1UNLD 4EOMB 2DXBB 1GUXB 1OL2B 1E9HB 4KRDB 4II5B 2WXVB 2UZEB 3QXEB 2X1NB 3BG5A 2IW8B 4EOQB 2WMAB 2PJQA 3M03A 2DD5B 4F7LB 1OIYB 4CFVB 2G77A 5BNJB 2WIHB 2WHBB 3PO3S 2ZCFB 4HNVA 3TW6A 2PMIB 4BCHB 3WVEB 1GUXA 3KHIA 4BCJB 4F6WB 3MI9B 4BCKB 4F70B 5L2WB 1H28B 4BCMD 1XO2A 2B9RA 2WJ9A 2PK2A 1OKVB 3EJ1B 4HLQA 4BCPB 2QF7A 3EOCB 2C5OB 3WVDB 1BU2A 3QZ9B 5FGKB 4ZGJB 4BCND 3QYGB 4FM4B 4EOJB 3G33B 4BCOB 4EOOB 3BLQB 4YC3B 5EJCA 3A8OB 4AKGA 3HHTB 2W9FA 3DJBA 4HL4A 2DD4B 2V22B 5HBJB 2R7GA 4BBSM 2DMEA 2ZPFB 1QLBA 4JX6A 2C5XB 4BCQB 2W2HA 3HBLA 4F6UB 1URCB 2CZ0B 3MY5B 1E7PA 1N4MA 3K7AM 3A8HB 3A8GB 3DDQB 2WPAB 1H1QB 2ZPEB 4Y72B 2IW9B 3A8LB 1GY3B 4ELLA 2QDYB 2LW4A 2CJMB 4BY1X 3VYGB 4MFDA 5IDPB 1UGPB 2ZPHB 1FINB 2IN3A 4M6VA 2PHGA 2EUFA 1O9KB 4TTHA 3NDQA 1OIUB 4MFEA 1F5QB 2C4GB 4EOPB 5HQ0B 3X24B 2CCHB 2UZLB 5DQWA 4OR5B 5IDNB 1FVVB 3BHVB 3QZ5B 3BLHB 4BCMB 3MIAB 1H1RB 1V29B 2QGSA 1W98B 2CYZB 1JKWA 4BXXX 3TNIB 4JX5A 1AHJB 4CFWB 3EIDB 3B57A 3HB9A 3A8MB 2CZ6B 3BG9A 2BS3A 2C5VB 2W96A 1OL1B 3BHTB 2WIPB 3DDPB 3TNWB 5HBEB 1JSUB 3X28B 5LQFB 5I5ZB 4EOKB 1VYWB 4CFXB 3QYHB 5DQVA 4JX4A 4MIMA 2BKZB 4AI6A 4BY7X 2ZPBB 4BBRM 4ROEA 1H4LD 3QWLA 2I53A 2BS2A 3QYEA 2UZBB 2W99A 4EONB 4ZGDB 4ROCA
chains in the Genus database with same CATH topology
4BCHB 2C4GB 5HNBB 4EOPB 1AD6A 1GUXA 5HQ0B 1ZP2A 2CCHB 4BCJB 2C5NB 4UN0A 4F6WB 5CEIB 2UZLB 4OR5B 3MI9B 4FX3B 5IDNB 4G6LB 5HBHB 1FVVB 4YOSA 3DOGB 4BCGB 2QDJA 4EORB 3BHVB 1KXUA 4BCKB 4F70B 5L2WB 1H28B 3BLHB 4BCMB 1UNHD 3MIAB 4CFMB 4BCMD 1H1RB 1XO2A 3POMA 1H24B 5HVYB 1TFBA 1UNGD 2B9RA 4I3ZB 2PK2A 4EOSB 1W98B 2C6TB 1OKVB 3EJ1B 2WEVB 2W9ZA 3TNHB 4CRLB 1JKWA 1H1PB 1H25B 1GH6B 1JOWA 2CCIB 5ICPB 2BPMB 1H27B 4BCPB 3EOCB 3TNIB 2C5OB 4KRCB 1QMZB 1BU2A 5FGKB 1D3UB 4BCND 4CFWB 5EFQB 4CFUB 1VINA 5LMKB 2I40B 3EIDB 4CFUD 1AISB 1H26B 4EOJB 3BLRB 3G33B 4F7SB 4F7NB 3QHRB 4BCOB 2IVXA 4EOOB 4CXAB 3BLQB 4YC3B 2JGZB 4YOOA 5ACBA 1G3NC 1H1SB 4BCFB 2C5VB 1P5EB 2W96A 3F5XB 1JSTB 4F6SB 4RODA 4EC8B 4IMYB 2W9FA 3BHUB 2V22B 1OL1B 5HBJB 3BHTB 4ELJA 2R7GA 2WIPB 3DDPB 3TNWB 3LQ5B 4BCNB 5HBEB 1OKWB 3TN8B 1VOLA 1JSUB 2C5XB 4EOIB 4BCQB 1OGUB 2W2HA 3O0GD 4F6UB 4BCQD 4EC9B 5LQFB 1URCB 1O9KA 2UZDB 4NSTB 3RGFB 4EOKB 5I5ZB 3MY5B 4F7JB 1N4MA 1PKDB 1VYWB 3K7AM 2WFYB 4OGRB 4CFXB 2F2CA 2IW6B 2UUEB 2WMBB 3DDQB 1C9BA 5IF1B 2BKZB 2G9XB 2WPAB 1UNLD 4EOMB 1GUXB 1OL2B 1H1QB 1E9HB 4Y72B 4KRDB 2IW9B 3QHWB 1GY3B 4ROEA 1H4LD 4II5B 4ELLA 4EOLB 2WXVB 2I53A 2UZEB 4CFNB 2CJMB 2X1NB 1OI9B 5CYIB 2IW8B 4EOQB 2WMAB 4YOZA 3M03A 4BCIB 2UZBB 1OIYB 4F7LB 5IDPB 4CFVB 1FINB 2W99A 5BNJB 3MY1B 4EONB 2WIHB 3H4CA 2WHBB 2PHGA 2EUFA 2PK9B 1O9KB 4TTHA 4ROCA 1OIUB 1F5QB 2PMIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCH B;  2C4G B;  5HNB B;  4EOP B;  1AD6 A;  1GUX A;  5HQ0 B;  1ZP2 A;  2CCH B;  4BCJ B;  2C5N B;  4UN0 A;  4F6W B;  5CEI B;  2UZL B;  4OR5 B;  3MI9 B;  4FX3 B;  5IDN B;  4G6L B;  5HBH B;  1FVV B;  4YOS A;  3DOG B;  4BCG B;  2QDJ A;  4EOR B;  3BHV B;  1KXU A;  4BCK B;  4F70 B;  5L2W B;  1H28 B;  3BLH B;  4BCM B;  1UNH D;  3MIA B;  4CFM B;  4BCM D;  1H1R B;  1XO2 A;  3POM A;  1H24 B;  5HVY B;  1TFB A;  1UNG D;  2B9R A;  4I3Z B;  2PK2 A;  4EOS B;  1W98 B;  2C6T B;  1OKV B;  3EJ1 B;  2WEV B;  2W9Z A;  3TNH B;  4CRL B;  1JKW A;  1H1P B;  1H25 B;  1GH6 B;  1JOW A;  2CCI B;  5ICP B;  2BPM B;  1H27 B;  4BCP B;  3EOC B;  3TNI B;  2C5O B;  4KRC B;  1QMZ B;  1BU2 A;  5FGK B;  1D3U B;  4BCN D;  4CFW B;  5EFQ B;  4CFU B;  1VIN A;  5LMK B;  2I40 B;  3EID B;  4CFU D;  1AIS B;  1H26 B;  4EOJ B;  3BLR B;  3G33 B;  4F7S B;  4F7N B;  3QHR B;  4BCO B;  2IVX A;  4EOO B;  4CXA B;  3BLQ B;  4YC3 B;  2JGZ B;  4YOO A;  5ACB A;  1G3N C;  1H1S B;  4BCF B;  2C5V B;  1P5E B;  2W96 A;  3F5X B;  1JST B;  4F6S B;  4ROD A;  4EC8 B;  4IMY B;  2W9F A;  3BHU B;  2V22 B;  1OL1 B;  5HBJ B;  3BHT B;  4ELJ A;  2R7G A;  2WIP B;  3DDP B;  3TNW B;  3LQ5 B;  4BCN B;  5HBE B;  1OKW B;  3TN8 B;  1VOL A;  1JSU B;  2C5X B;  4EOI B;  4BCQ B;  1OGU B;  2W2H A;  3O0G D;  4F6U B;  4BCQ D;  4EC9 B;  5LQF B;  1URC B;  1O9K A;  2UZD B;  4NST B;  3RGF B;  4EOK B;  5I5Z B;  3MY5 B;  4F7J B;  1N4M A;  1PKD B;  1VYW B;  3K7A M;  2WFY B;  4OGR B;  4CFX B;  2F2C A;  2IW6 B;  2UUE B;  2WMB B;  3DDQ B;  1C9B A;  5IF1 B;  2BKZ B;  2G9X B;  2WPA B;  1UNL D;  4EOM B;  1GUX B;  1OL2 B;  1H1Q B;  1E9H B;  4Y72 B;  4KRD B;  2IW9 B;  3QHW B;  1GY3 B;  4ROE A;  1H4L D;  4II5 B;  4ELL A;  4EOL B;  2WXV B;  2I53 A;  2UZE B;  4CFN B;  2CJM B;  2X1N B;  1OI9 B;  5CYI B;  2IW8 B;  4EOQ B;  2WMA B;  4YOZ A;  3M03 A;  4BCI B;  2UZB B;  1OIY B;  4F7L B;  5IDP B;  4CFV B;  1FIN B;  2W99 A;  5BNJ B;  3MY1 B;  4EON B;  2WIH B;  3H4C A;  2WHB B;  2PHG A;  2EUF A;  2PK9 B;  1O9K B;  4TTH A;  4ROC A;  1OIU B;  1F5Q B;  2PMI B; 
#chains in the Genus database with same CATH topology
 4FX3 B;  4G6L B;  5HBH B;  4BCG B;  2ZPI B;  2QDJ A;  1KXU A;  4CFM B;  3DTO A;  1H24 B;  2QQ8 A;  2ZZD B;  3TNH B;  4NC6 A;  1H25 B;  2CCI B;  2BPM B;  5IHY A;  2CZ7 B;  1QMZ B;  3VYH B;  4HNT A;  3HO8 A;  5EFQ B;  2QFZ A;  1VIN A;  5LMK B;  2I40 B;  4CFU D;  1FKM A;  1H26 B;  3BLR B;  4F7N B;  3QHR B;  4AKH A;  2IVX A;  4CXA B;  2JGZ B;  3F5X B;  4ROD A;  4IMY B;  3BHU B;  4ELJ A;  3DL1 A;  3X26 B;  4OB0 B;  3LQ5 B;  4BCN B;  3TN8 B;  2KMG A;  1OGU B;  3O0G D;  2DXC B;  4NST B;  1O9K A;  2UZD B;  4HNU A;  4ZGE B;  1PKD B;  4OGR B;  1ENW A;  2WMB B;  2G9X B;  3QHW B;  2AHJ B;  4EOL B;  1TD6 A;  4CFN B;  3QYB A;  1OI9 B;  4LOC A;  5CYI B;  4OB3 B;  4YOZ A;  4BCI B;  3X25 B;  3MY1 B;  3H4C A;  2D0Q B;  2PK9 B;  5HNB B;  1AD6 A;  2DPP B;  1ZP2 A;  2C5N B;  4UN0 A;  5CEI B;  4YOS A;  4EOR B;  3DOG B;  2ZPG B;  1UNH D;  4OB1 B;  3POM A;  5HVY B;  1TFB A;  1UNG D;  4I3Z B;  3VKH A;  4EOS B;  1UGR B;  2C6T B;  2WEV B;  2W9Z A;  4CRL B;  1H1P B;  1JOW A;  1GH6 B;  5ICP B;  1H27 B;  4KRC B;  4OB2 B;  1D3U B;  4CFU B;  1AIS B;  4F7S B;  2BS4 A;  3HZJ A;  3TW7 A;  1UGQ B;  3X20 B;  4YOO A;  5ACB A;  1G3N C;  1H1S B;  4BCF B;  3VKG A;  1UGS B;  4QSH A;  1P5E B;  1JST B;  3GTM S;  4F6S B;  4EC8 B;  4Z6Y A;  1IRE B;  1OKW B;  1VOL A;  4EOI B;  4BCQ D;  4EC9 B;  3RGF B;  4AKI A;  2CZ1 B;  4F7J B;  2WFY B;  3BG3 A;  2F2C A;  2IW6 B;  2UUE B;  1C9B A;  5IF1 B;  2KR6 A;  1UNL D;  4EOM B;  2DXB B;  1GUX B;  1OL2 B;  1E9H B;  4KRD B;  4II5 B;  2WXV B;  2UZE B;  3QXE B;  2X1N B;  3BG5 A;  2IW8 B;  4EOQ B;  2WMA B;  2PJQ A;  3M03 A;  2DD5 B;  4F7L B;  1OIY B;  4CFV B;  2G77 A;  5BNJ B;  2WIH B;  2WHB B;  3PO3 S;  2ZCF B;  4HNV A;  3TW6 A;  2PMI B;  4BCH B;  3WVE B;  1GUX A;  3KHI A;  4BCJ B;  4F6W B;  3MI9 B;  4BCK B;  4F70 B;  5L2W B;  1H28 B;  4BCM D;  1XO2 A;  2B9R A;  2WJ9 A;  2PK2 A;  1OKV B;  3EJ1 B;  4HLQ A;  4BCP B;  2QF7 A;  3EOC B;  2C5O B;  3WVD B;  1BU2 A;  3QZ9 B;  5FGK B;  4ZGJ B;  4BCN D;  3QYG B;  4FM4 B;  4EOJ B;  3G33 B;  4BCO B;  4EOO B;  3BLQ B;  4YC3 B;  5EJC A;  3A8O B;  4AKG A;  3HHT B;  2W9F A;  3DJB A;  4HL4 A;  2DD4 B;  2V22 B;  5HBJ B;  2R7G A;  4BBS M;  2DME A;  2ZPF B;  1QLB A;  4JX6 A;  2C5X B;  4BCQ B;  2W2H A;  3HBL A;  4F6U B;  1URC B;  2CZ0 B;  3MY5 B;  1E7P A;  1N4M A;  3K7A M;  3A8H B;  3A8G B;  3DDQ B;  2WPA B;  1H1Q B;  2ZPE B;  4Y72 B;  2IW9 B;  3A8L B;  1GY3 B;  4ELL A;  2QDY B;  2LW4 A;  2CJM B;  4BY1 X;  3VYG B;  4MFD A;  5IDP B;  1UGP B;  2ZPH B;  1FIN B;  2IN3 A;  4M6V A;  2PHG A;  2EUF A;  1O9K B;  4TTH A;  3NDQ A;  1OIU B;  4MFE A;  1F5Q B;  2C4G B;  4EOP B;  5HQ0 B;  3X24 B;  2CCH B;  2UZL B;  5DQW A;  4OR5 B;  5IDN B;  1FVV B;  3BHV B;  3QZ5 B;  3BLH B;  4BCM B;  3MIA B;  1H1R B;  1V29 B;  2QGS A;  1W98 B;  2CYZ B;  1JKW A;  4BXX X;  3TNI B;  4JX5 A;  1AHJ B;  4CFW B;  3EID B;  3B57 A;  3HB9 A;  3A8M B;  2CZ6 B;  3BG9 A;  2BS3 A;  2C5V B;  2W96 A;  1OL1 B;  3BHT B;  2WIP B;  3DDP B;  3TNW B;  5HBE B;  1JSU B;  3X28 B;  5LQF B;  5I5Z B;  4EOK B;  1VYW B;  4CFX B;  3QYH B;  5DQV A;  4JX4 A;  4MIM A;  2BKZ B;  4AI6 A;  4BY7 X;  2ZPB B;  4BBR M;  4ROE A;  1H4L D;  3QWL A;  2I53 A;  2BS2 A;  3QYE A;  2UZB B;  2W99 A;  4EON B;  4ZGD B;  4ROC A; 
#chains in the Genus database with same CATH homology
 4BCH B;  2C4G B;  5HNB B;  4EOP B;  1AD6 A;  1GUX A;  5HQ0 B;  1ZP2 A;  2CCH B;  4BCJ B;  2C5N B;  4UN0 A;  4F6W B;  5CEI B;  2UZL B;  4OR5 B;  3MI9 B;  4FX3 B;  5IDN B;  4G6L B;  5HBH B;  1FVV B;  4YOS A;  3DOG B;  4BCG B;  2QDJ A;  4EOR B;  3BHV B;  1KXU A;  4BCK B;  4F70 B;  5L2W B;  1H28 B;  3BLH B;  4BCM B;  1UNH D;  3MIA B;  4CFM B;  4BCM D;  1H1R B;  1XO2 A;  3POM A;  1H24 B;  5HVY B;  1TFB A;  1UNG D;  2B9R A;  4I3Z B;  2PK2 A;  4EOS B;  1W98 B;  2C6T B;  1OKV B;  3EJ1 B;  2WEV B;  2W9Z A;  3TNH B;  4CRL B;  1JKW A;  1H1P B;  1H25 B;  1GH6 B;  1JOW A;  2CCI B;  5ICP B;  2BPM B;  1H27 B;  4BCP B;  3EOC B;  3TNI B;  2C5O B;  4KRC B;  1QMZ B;  1BU2 A;  5FGK B;  1D3U B;  4BCN D;  4CFW B;  5EFQ B;  4CFU B;  1VIN A;  5LMK B;  2I40 B;  3EID B;  4CFU D;  1AIS B;  1H26 B;  4EOJ B;  3BLR B;  3G33 B;  4F7S B;  4F7N B;  3QHR B;  4BCO B;  2IVX A;  4EOO B;  4CXA B;  3BLQ B;  4YC3 B;  2JGZ B;  4YOO A;  5ACB A;  1G3N C;  1H1S B;  4BCF B;  2C5V B;  1P5E B;  2W96 A;  3F5X B;  1JST B;  4F6S B;  4ROD A;  4EC8 B;  4IMY B;  2W9F A;  3BHU B;  2V22 B;  1OL1 B;  5HBJ B;  3BHT B;  4ELJ A;  2R7G A;  2WIP B;  3DDP B;  3TNW B;  3LQ5 B;  4BCN B;  5HBE B;  1OKW B;  3TN8 B;  1VOL A;  1JSU B;  2C5X B;  4EOI B;  4BCQ B;  1OGU B;  2W2H A;  3O0G D;  4F6U B;  4BCQ D;  4EC9 B;  5LQF B;  1URC B;  1O9K A;  2UZD B;  4NST B;  3RGF B;  4EOK B;  5I5Z B;  3MY5 B;  4F7J B;  1N4M A;  1PKD B;  1VYW B;  3K7A M;  2WFY B;  4OGR B;  4CFX B;  2F2C A;  2IW6 B;  2UUE B;  2WMB B;  3DDQ B;  1C9B A;  5IF1 B;  2BKZ B;  2G9X B;  2WPA B;  1UNL D;  4EOM B;  1GUX B;  1OL2 B;  1H1Q B;  1E9H B;  4Y72 B;  4KRD B;  2IW9 B;  3QHW B;  1GY3 B;  4ROE A;  1H4L D;  4II5 B;  4ELL A;  4EOL B;  2WXV B;  2I53 A;  2UZE B;  4CFN B;  2CJM B;  2X1N B;  1OI9 B;  5CYI B;  2IW8 B;  4EOQ B;  2WMA B;  4YOZ A;  3M03 A;  4BCI B;  2UZB B;  1OIY B;  4F7L B;  5IDP B;  4CFV B;  1FIN B;  2W99 A;  5BNJ B;  3MY1 B;  4EON B;  2WIH B;  3H4C A;  2WHB B;  2PHG A;  2EUF A;  2PK9 B;  1O9K B;  4TTH A;  4ROC A;  1OIU B;  1F5Q B;  2PMI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...