4CFNB

Structure-based design of c8-substituted o6-cyclohexylmethoxyguanine cdk1 and 2 inhibitors.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
256
structure length
254
Chain Sequence
DYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title 8-Substituted O6-Cyclohexylmethylguanine Cdk2 Inhibitors; Using Structure-Based Inhibitor Design to Optimise an Alternative Binding Mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 254
sequence length 256
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfnB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4cfnB02
4BCMD 3MY1B 1OKWB 4EC8B 3TNIB 1TFBA 1OGUB 2IW8B 1UNGD 2BPMB 4F7JB 5HBHB 4BCGB 4CXAB 5LMKB 4TTHA 3BHVB 3LQ5B 1VOLA 4CRLB 5HVYB 2WXVB 4EOSB 4NSTB 4F6SB 4CFUB 5HBJB 1E9HB 2IW6B 4EORB 1F5QB 4BCOB 2C5XB 1FVVB 1VYWB 2I40B 2R7GA 2UUEB 3H4CA 5EFQB 4YOZA 1H26B 2WIHB 5HNBB 1QMZB 2W96A 4OGRB 4EOPB 4II5B 4EOLB 3DDQB 1OL2B 1D3UB 4EONB 2WFYB 4EOJB 2V22B 4YOSA 4BCHB 4IMYB 4F6UB 4BCIB 1JSTB 5L2WB 2CCHB 4ELJA 4FX3B 1AISB 5HQ0B 4EOKB 3MI9B 4BCKB 5ICPB 2WMBB 4BCQD 4BCND 1UNLD 2WEVB 3EIDB 1ZP2A 5CYIB 3EJ1B 1H27B 4UN0A 3DOGB 4F70B 4F6WB 2PMIB 3DDPB 4ROEA 2C4GB 1BU2A 1GUXB 1KXUA 1GY3B 1AD6A 1OL1B 1H4LD 3G33B 4YC3B 4ROCA 3BLRB 4BCMB 2QDJA 1G3NC 3BHUB 4BCFB 5FGKB 2W2HA 3BLHB 4EOIB 5CEIB 2B9RA 4BCQB 4BCNB 1O9KB 4CFWB 2CJMB 1OIUB 3QHWB 4KRDB 3QHRB 4OR5B 1JOWA 4Y72B 1H25B 3O0GD 1N4MA 2UZEB 3EOCB 2G9XB 4EOQB 1H28B 4F7LB 2C5VB 2UZBB 4KRCB 2X1NB 1UNHD 2W9ZA 1H1QB 2F2CA 4CFMB 4EOOB 3POMA 5IF1B 2I53A 4CFNB 3M03A 4F7SB 4EC9B 1H1PB 1GH6B 4BCJB 1PKDB 4I3ZB 1C9BA 2JGZB 1W98B 2EUFA 1XO2A 2C5NB 2C5OB 2BKZB 3TNHB 1OIYB 3K7AM 3MY5B 3BLQB 4CFVB 5BNJB 2C6TB 3MIAB 2CCIB 2W99A 5I5ZB 4RODA 2WMAB 4YOOA 2PK2A 1H24B 3TN8B 1JSUB 2UZLB 2WIPB 3TNWB 2UZDB 5HBEB 1VINA 5ACBA 1P5EB 2WPAB 1JKWA 1OKVB 1OI9B 1H1RB 3F5XB 4F7NB 5IDNB 2WHBB 5LQFB 1FINB 2IVXA 1URCB 1GUXA 5IDPB 4CFUD 3RGFB 2PK9B 4G6LB 4CFXB 4BCPB 3BHTB 2W9FA 4EOMB 1H1SB 1O9KA 2IW9B 2PHGA 4ELLA
chains in the Genus database with same CATH superfamily
1TFBA 4BXXX 2BPMB 2QQ8A 3LQ5B 2WXVB 4NSTB 4F6SB 2D0QB 4CFUB 5HBJB 1F5QB 1VYWB 4YOZA 4EOPB 4EOLB 2WFYB 4IMYB 4BCIB 1JSTB 4JX5A 4EOKB 4BCKB 4OB0B 4BCQD 4BCND 3EIDB 1H27B 4MFEA 2DXCB 5IHYA 1KXUA 1GY3B 1AD6A 2BS2A 4BCMB 4AKIA 5FGKB 4EOIB 5CEIB 1H25B 3EOCB 2G9XB 1H28B 2ZPFB 5DQVA 2UZBB 4AKGA 4KRCB 3KHIA 2F2CA 5IF1B 4EC9B 2C5NB 3TNHB 3K7AM 2CCIB 4MFDA 2WMAB 2PJQA 4JX4A 1JSUB 3QYGB 1QLBA 1VINA 4FM4B 3HBLA 3VKHA 1P5EB 2WPAB 5IDNB 2WHBB 5LQFB 2IVXA 2KMGA 2PK9B 4G6LB 4BCPB 5DQWA 4EOMB 2PHGA 1V29B 1OKWB 1OGUB 1UNGD 3BHVB 4EOSB 1TD6A 2ZPHB 2IW6B 4HL4A 2C5XB 1FVVB 2R7GA 2DD5B 3H4CA 4BY7X 5HNBB 4OGRB 4HNTA 4II5B 4EOJB 2CZ0B 2ZZDB 4BCHB 4F6UB 3X24B 4QSHA 4ELJA 3MI9B 2WMBB 1UGRB 5CYIB 2PMIB 3VYHB 2DD4B 4ROEA 1GUXB 3G33B 1H4LD 2QDJA 4BCFB 2DMEA 3BG3A 4BCQB 4BCNB 4CFWB 3DTOA 3QHWB 4OR5B 3TW7A 1JOWA 3QZ5B 4Z6YA 1N4MA 3GTMS 1UGPB 3A8OB 4CFMB 3POMA 3NDQA 4CFNB 3HO8A 3BG5A 4BCJB 4I3ZB 3WVEB 3X26B 1C9BA 2C5OB 2BKZB 4CFVB 4AI6A 4RODA 2QDYB 4YOOA 2KR6A 1H24B 3VKGA 2WIPB 2UZDB 3HZJA 1OKVB 1OI9B 3A8LB 3F5XB 4JX6A 4F7NB 2ZPBB 3BG9A 1FKMA 3X25B 4BCMD 4F7JB 5HBHB 4CXAB 4TTHA 1VOLA 4ZGEB 4OB3B 3HB9A 5HVYB 1E9HB 2I40B 1UGQB 1H26B 2WIHB 1QMZB 4HNVA 2DXBB 3DDQB 1OL2B 3A8GB 4YOSA 2CCHB 2AHJB 1AISB 5ICPB 1UNLD 3DL1A 2CYZB 2ZPGB 2WEVB 2IN3A 3EJ1B 4OB1B 3QXEB 4BBRM 4UN0A 3DOGB 1BU2A 4HLQA 4ROCA 2W2HA 3BHUB 1G3NC 2QGSA 3BLHB 1O9KB 4HNUA 4KRDB 2G77A 3A8MB 4F7LB 1UGSB 2X1NB 1UNHD 4EOOB 1IREB 2I53A 1H1PB 1GH6B 1PKDB 2JGZB 2EUFA 1OIYB 3MY5B 3BLQB 5BNJB 3MIAB 5I5ZB 2DPPB 3B57A 2ZCFB 3TN8B 2WJ9A 5ACBA 4BY1X 1FINB 1GUXA 5IDPB 4CFUD 5EJCA 3RGFB 4CFXB 3BHTB 1H1SB 2W99A 2IW9B 4ELLA 3A8HB 3MY1B 4MIMA 3TNIB 4EC8B 4ZGDB 2IW8B 3TW6A 4BCGB 2ZPEB 5LMKB 4CRLB 1AHJB 4EORB 4BBSM 4BCOB 2BS3A 2UUEB 5EFQB 3QWLA 2W96A 1D3UB 4EONB 2V22B 2CZ6B 3DJBA 5L2WB 2QFZA 2CZ7B 4FX3B 5HQ0B 3X28B 4AKHA 1ZP2A 2CZ1B 2BS4A 4F70B 1E7PA 4F6WB 3DDPB 2QF7A 2LW4A 2C4GB 1OL1B 4YC3B 3QYHB 4OB2B 3BLRB 3QZ9B 2B9RA 2CJMB 2ZPIB 1OIUB 3PO3S 3QHRB 4Y72B 3O0GD 2UZEB 3QYEA 4EOQB 2C5VB 2W9ZA 1H1QB 3M03A 4F7SB 3VYGB 4NC6A 1W98B 1XO2A 2C6TB 3WVDB 4M6VA 2PK2A 1ENWA 2UZLB 4LOCA 3TNWB 5HBEB 1JKWA 1H1RB 4ZGJB 1URCB 3X20B 2W9FA 3HHTB 1O9KA 3QYBA
chains in the Genus database with same CATH topology
4BCMD 3MY1B 1OKWB 4EC8B 3TNIB 1TFBA 1OGUB 2IW8B 1UNGD 2BPMB 4F7JB 5HBHB 4BCGB 4CXAB 5LMKB 4TTHA 3BHVB 3LQ5B 1VOLA 4CRLB 5HVYB 2WXVB 4EOSB 4NSTB 4F6SB 4CFUB 5HBJB 1E9HB 2IW6B 4EORB 1F5QB 4BCOB 2C5XB 1FVVB 1VYWB 2I40B 2R7GA 2UUEB 3H4CA 5EFQB 4YOZA 1H26B 2WIHB 5HNBB 1QMZB 2W96A 4OGRB 4EOPB 4II5B 4EOLB 3DDQB 1OL2B 1D3UB 4EONB 2WFYB 4EOJB 2V22B 4YOSA 4BCHB 4IMYB 4F6UB 4BCIB 1JSTB 5L2WB 2CCHB 4ELJA 4FX3B 1AISB 5HQ0B 4EOKB 3MI9B 4BCKB 5ICPB 2WMBB 4BCQD 4BCND 1UNLD 2WEVB 3EIDB 1ZP2A 5CYIB 3EJ1B 1H27B 4UN0A 3DOGB 4F70B 4F6WB 2PMIB 3DDPB 4ROEA 2C4GB 1BU2A 1GUXB 1KXUA 1GY3B 1AD6A 1OL1B 1H4LD 3G33B 4YC3B 4ROCA 3BLRB 4BCMB 2QDJA 1G3NC 3BHUB 4BCFB 5FGKB 2W2HA 3BLHB 4EOIB 5CEIB 2B9RA 4BCQB 4BCNB 1O9KB 4CFWB 2CJMB 1OIUB 3QHWB 4KRDB 3QHRB 4OR5B 1JOWA 4Y72B 1H25B 3O0GD 1N4MA 2UZEB 3EOCB 2G9XB 4EOQB 1H28B 4F7LB 2C5VB 2UZBB 4KRCB 2X1NB 1UNHD 2W9ZA 1H1QB 2F2CA 4CFMB 4EOOB 3POMA 5IF1B 2I53A 4CFNB 3M03A 4F7SB 4EC9B 1H1PB 1GH6B 4BCJB 1PKDB 4I3ZB 1C9BA 2JGZB 1W98B 2EUFA 1XO2A 2C5NB 2C5OB 2BKZB 3TNHB 1OIYB 3K7AM 3MY5B 3BLQB 4CFVB 5BNJB 2C6TB 3MIAB 2CCIB 2W99A 5I5ZB 4RODA 2WMAB 4YOOA 2PK2A 1H24B 3TN8B 1JSUB 2UZLB 2WIPB 3TNWB 2UZDB 5HBEB 1VINA 5ACBA 1P5EB 2WPAB 1JKWA 1OKVB 1OI9B 1H1RB 3F5XB 4F7NB 5IDNB 2WHBB 5LQFB 1FINB 2IVXA 1URCB 1GUXA 5IDPB 4CFUD 3RGFB 2PK9B 4G6LB 4CFXB 4BCPB 3BHTB 2W9FA 4EOMB 1H1SB 1O9KA 2IW9B 2PHGA 4ELLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCM D;  3MY1 B;  1OKW B;  4EC8 B;  3TNI B;  1TFB A;  1OGU B;  2IW8 B;  1UNG D;  2BPM B;  4F7J B;  5HBH B;  4BCG B;  4CXA B;  5LMK B;  4TTH A;  3BHV B;  3LQ5 B;  1VOL A;  4CRL B;  5HVY B;  2WXV B;  4EOS B;  4NST B;  4F6S B;  4CFU B;  5HBJ B;  1E9H B;  2IW6 B;  4EOR B;  1F5Q B;  4BCO B;  2C5X B;  1FVV B;  1VYW B;  2I40 B;  2R7G A;  2UUE B;  3H4C A;  5EFQ B;  4YOZ A;  1H26 B;  2WIH B;  5HNB B;  1QMZ B;  2W96 A;  4OGR B;  4EOP B;  4II5 B;  4EOL B;  3DDQ B;  1OL2 B;  1D3U B;  4EON B;  2WFY B;  4EOJ B;  2V22 B;  4YOS A;  4BCH B;  4IMY B;  4F6U B;  4BCI B;  1JST B;  5L2W B;  2CCH B;  4ELJ A;  4FX3 B;  1AIS B;  5HQ0 B;  4EOK B;  3MI9 B;  4BCK B;  5ICP B;  2WMB B;  4BCQ D;  4BCN D;  1UNL D;  2WEV B;  3EID B;  1ZP2 A;  5CYI B;  3EJ1 B;  1H27 B;  4UN0 A;  3DOG B;  4F70 B;  4F6W B;  2PMI B;  3DDP B;  4ROE A;  2C4G B;  1BU2 A;  1GUX B;  1KXU A;  1GY3 B;  1AD6 A;  1OL1 B;  1H4L D;  3G33 B;  4YC3 B;  4ROC A;  3BLR B;  4BCM B;  2QDJ A;  1G3N C;  3BHU B;  4BCF B;  5FGK B;  2W2H A;  3BLH B;  4EOI B;  5CEI B;  2B9R A;  4BCQ B;  4BCN B;  1O9K B;  4CFW B;  2CJM B;  1OIU B;  3QHW B;  4KRD B;  3QHR B;  4OR5 B;  1JOW A;  4Y72 B;  1H25 B;  3O0G D;  1N4M A;  2UZE B;  3EOC B;  2G9X B;  4EOQ B;  1H28 B;  4F7L B;  2C5V B;  2UZB B;  4KRC B;  2X1N B;  1UNH D;  2W9Z A;  1H1Q B;  2F2C A;  4CFM B;  4EOO B;  3POM A;  5IF1 B;  2I53 A;  4CFN B;  3M03 A;  4F7S B;  4EC9 B;  1H1P B;  1GH6 B;  4BCJ B;  1PKD B;  4I3Z B;  1C9B A;  2JGZ B;  1W98 B;  2EUF A;  1XO2 A;  2C5N B;  2C5O B;  2BKZ B;  3TNH B;  1OIY B;  3K7A M;  3MY5 B;  3BLQ B;  4CFV B;  5BNJ B;  2C6T B;  3MIA B;  2CCI B;  2W99 A;  5I5Z B;  4ROD A;  2WMA B;  4YOO A;  2PK2 A;  1H24 B;  3TN8 B;  1JSU B;  2UZL B;  2WIP B;  3TNW B;  2UZD B;  5HBE B;  1VIN A;  5ACB A;  1P5E B;  2WPA B;  1JKW A;  1OKV B;  1OI9 B;  1H1R B;  3F5X B;  4F7N B;  5IDN B;  2WHB B;  5LQF B;  1FIN B;  2IVX A;  1URC B;  1GUX A;  5IDP B;  4CFU D;  3RGF B;  2PK9 B;  4G6L B;  4CFX B;  4BCP B;  3BHT B;  2W9F A;  4EOM B;  1H1S B;  1O9K A;  2IW9 B;  2PHG A;  4ELL A; 
#chains in the Genus database with same CATH topology
 1TFB A;  4BXX X;  2BPM B;  2QQ8 A;  3LQ5 B;  2WXV B;  4NST B;  4F6S B;  2D0Q B;  4CFU B;  5HBJ B;  1F5Q B;  1VYW B;  4YOZ A;  4EOP B;  4EOL B;  2WFY B;  4IMY B;  4BCI B;  1JST B;  4JX5 A;  4EOK B;  4BCK B;  4OB0 B;  4BCQ D;  4BCN D;  3EID B;  1H27 B;  4MFE A;  2DXC B;  5IHY A;  1KXU A;  1GY3 B;  1AD6 A;  2BS2 A;  4BCM B;  4AKI A;  5FGK B;  4EOI B;  5CEI B;  1H25 B;  3EOC B;  2G9X B;  1H28 B;  2ZPF B;  5DQV A;  2UZB B;  4AKG A;  4KRC B;  3KHI A;  2F2C A;  5IF1 B;  4EC9 B;  2C5N B;  3TNH B;  3K7A M;  2CCI B;  4MFD A;  2WMA B;  2PJQ A;  4JX4 A;  1JSU B;  3QYG B;  1QLB A;  1VIN A;  4FM4 B;  3HBL A;  3VKH A;  1P5E B;  2WPA B;  5IDN B;  2WHB B;  5LQF B;  2IVX A;  2KMG A;  2PK9 B;  4G6L B;  4BCP B;  5DQW A;  4EOM B;  2PHG A;  1V29 B;  1OKW B;  1OGU B;  1UNG D;  3BHV B;  4EOS B;  1TD6 A;  2ZPH B;  2IW6 B;  4HL4 A;  2C5X B;  1FVV B;  2R7G A;  2DD5 B;  3H4C A;  4BY7 X;  5HNB B;  4OGR B;  4HNT A;  4II5 B;  4EOJ B;  2CZ0 B;  2ZZD B;  4BCH B;  4F6U B;  3X24 B;  4QSH A;  4ELJ A;  3MI9 B;  2WMB B;  1UGR B;  5CYI B;  2PMI B;  3VYH B;  2DD4 B;  4ROE A;  1GUX B;  3G33 B;  1H4L D;  2QDJ A;  4BCF B;  2DME A;  3BG3 A;  4BCQ B;  4BCN B;  4CFW B;  3DTO A;  3QHW B;  4OR5 B;  3TW7 A;  1JOW A;  3QZ5 B;  4Z6Y A;  1N4M A;  3GTM S;  1UGP B;  3A8O B;  4CFM B;  3POM A;  3NDQ A;  4CFN B;  3HO8 A;  3BG5 A;  4BCJ B;  4I3Z B;  3WVE B;  3X26 B;  1C9B A;  2C5O B;  2BKZ B;  4CFV B;  4AI6 A;  4ROD A;  2QDY B;  4YOO A;  2KR6 A;  1H24 B;  3VKG A;  2WIP B;  2UZD B;  3HZJ A;  1OKV B;  1OI9 B;  3A8L B;  3F5X B;  4JX6 A;  4F7N B;  2ZPB B;  3BG9 A;  1FKM A;  3X25 B;  4BCM D;  4F7J B;  5HBH B;  4CXA B;  4TTH A;  1VOL A;  4ZGE B;  4OB3 B;  3HB9 A;  5HVY B;  1E9H B;  2I40 B;  1UGQ B;  1H26 B;  2WIH B;  1QMZ B;  4HNV A;  2DXB B;  3DDQ B;  1OL2 B;  3A8G B;  4YOS A;  2CCH B;  2AHJ B;  1AIS B;  5ICP B;  1UNL D;  3DL1 A;  2CYZ B;  2ZPG B;  2WEV B;  2IN3 A;  3EJ1 B;  4OB1 B;  3QXE B;  4BBR M;  4UN0 A;  3DOG B;  1BU2 A;  4HLQ A;  4ROC A;  2W2H A;  3BHU B;  1G3N C;  2QGS A;  3BLH B;  1O9K B;  4HNU A;  4KRD B;  2G77 A;  3A8M B;  4F7L B;  1UGS B;  2X1N B;  1UNH D;  4EOO B;  1IRE B;  2I53 A;  1H1P B;  1GH6 B;  1PKD B;  2JGZ B;  2EUF A;  1OIY B;  3MY5 B;  3BLQ B;  5BNJ B;  3MIA B;  5I5Z B;  2DPP B;  3B57 A;  2ZCF B;  3TN8 B;  2WJ9 A;  5ACB A;  4BY1 X;  1FIN B;  1GUX A;  5IDP B;  4CFU D;  5EJC A;  3RGF B;  4CFX B;  3BHT B;  1H1S B;  2W99 A;  2IW9 B;  4ELL A;  3A8H B;  3MY1 B;  4MIM A;  3TNI B;  4EC8 B;  4ZGD B;  2IW8 B;  3TW6 A;  4BCG B;  2ZPE B;  5LMK B;  4CRL B;  1AHJ B;  4EOR B;  4BBS M;  4BCO B;  2BS3 A;  2UUE B;  5EFQ B;  3QWL A;  2W96 A;  1D3U B;  4EON B;  2V22 B;  2CZ6 B;  3DJB A;  5L2W B;  2QFZ A;  2CZ7 B;  4FX3 B;  5HQ0 B;  3X28 B;  4AKH A;  1ZP2 A;  2CZ1 B;  2BS4 A;  4F70 B;  1E7P A;  4F6W B;  3DDP B;  2QF7 A;  2LW4 A;  2C4G B;  1OL1 B;  4YC3 B;  3QYH B;  4OB2 B;  3BLR B;  3QZ9 B;  2B9R A;  2CJM B;  2ZPI B;  1OIU B;  3PO3 S;  3QHR B;  4Y72 B;  3O0G D;  2UZE B;  3QYE A;  4EOQ B;  2C5V B;  2W9Z A;  1H1Q B;  3M03 A;  4F7S B;  3VYG B;  4NC6 A;  1W98 B;  1XO2 A;  2C6T B;  3WVD B;  4M6V A;  2PK2 A;  1ENW A;  2UZL B;  4LOC A;  3TNW B;  5HBE B;  1JKW A;  1H1R B;  4ZGJ B;  1URC B;  3X20 B;  2W9F A;  3HHT B;  1O9K A;  3QYB A; 
#chains in the Genus database with same CATH homology
 4BCM D;  3MY1 B;  1OKW B;  4EC8 B;  3TNI B;  1TFB A;  1OGU B;  2IW8 B;  1UNG D;  2BPM B;  4F7J B;  5HBH B;  4BCG B;  4CXA B;  5LMK B;  4TTH A;  3BHV B;  3LQ5 B;  1VOL A;  4CRL B;  5HVY B;  2WXV B;  4EOS B;  4NST B;  4F6S B;  4CFU B;  5HBJ B;  1E9H B;  2IW6 B;  4EOR B;  1F5Q B;  4BCO B;  2C5X B;  1FVV B;  1VYW B;  2I40 B;  2R7G A;  2UUE B;  3H4C A;  5EFQ B;  4YOZ A;  1H26 B;  2WIH B;  5HNB B;  1QMZ B;  2W96 A;  4OGR B;  4EOP B;  4II5 B;  4EOL B;  3DDQ B;  1OL2 B;  1D3U B;  4EON B;  2WFY B;  4EOJ B;  2V22 B;  4YOS A;  4BCH B;  4IMY B;  4F6U B;  4BCI B;  1JST B;  5L2W B;  2CCH B;  4ELJ A;  4FX3 B;  1AIS B;  5HQ0 B;  4EOK B;  3MI9 B;  4BCK B;  5ICP B;  2WMB B;  4BCQ D;  4BCN D;  1UNL D;  2WEV B;  3EID B;  1ZP2 A;  5CYI B;  3EJ1 B;  1H27 B;  4UN0 A;  3DOG B;  4F70 B;  4F6W B;  2PMI B;  3DDP B;  4ROE A;  2C4G B;  1BU2 A;  1GUX B;  1KXU A;  1GY3 B;  1AD6 A;  1OL1 B;  1H4L D;  3G33 B;  4YC3 B;  4ROC A;  3BLR B;  4BCM B;  2QDJ A;  1G3N C;  3BHU B;  4BCF B;  5FGK B;  2W2H A;  3BLH B;  4EOI B;  5CEI B;  2B9R A;  4BCQ B;  4BCN B;  1O9K B;  4CFW B;  2CJM B;  1OIU B;  3QHW B;  4KRD B;  3QHR B;  4OR5 B;  1JOW A;  4Y72 B;  1H25 B;  3O0G D;  1N4M A;  2UZE B;  3EOC B;  2G9X B;  4EOQ B;  1H28 B;  4F7L B;  2C5V B;  2UZB B;  4KRC B;  2X1N B;  1UNH D;  2W9Z A;  1H1Q B;  2F2C A;  4CFM B;  4EOO B;  3POM A;  5IF1 B;  2I53 A;  4CFN B;  3M03 A;  4F7S B;  4EC9 B;  1H1P B;  1GH6 B;  4BCJ B;  1PKD B;  4I3Z B;  1C9B A;  2JGZ B;  1W98 B;  2EUF A;  1XO2 A;  2C5N B;  2C5O B;  2BKZ B;  3TNH B;  1OIY B;  3K7A M;  3MY5 B;  3BLQ B;  4CFV B;  5BNJ B;  2C6T B;  3MIA B;  2CCI B;  2W99 A;  5I5Z B;  4ROD A;  2WMA B;  4YOO A;  2PK2 A;  1H24 B;  3TN8 B;  1JSU B;  2UZL B;  2WIP B;  3TNW B;  2UZD B;  5HBE B;  1VIN A;  5ACB A;  1P5E B;  2WPA B;  1JKW A;  1OKV B;  1OI9 B;  1H1R B;  3F5X B;  4F7N B;  5IDN B;  2WHB B;  5LQF B;  1FIN B;  2IVX A;  1URC B;  1GUX A;  5IDP B;  4CFU D;  3RGF B;  2PK9 B;  4G6L B;  4CFX B;  4BCP B;  3BHT B;  2W9F A;  4EOM B;  1H1S B;  1O9K A;  2IW9 B;  2PHG A;  4ELL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...