3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
2E2HI 3HOVI 2JS4A 2J6AA 3GTOI 4NBGA 4BBSI 4NBEA 3HOWI 1TFIA 4NBDA 4A3KI 2KPIA 3GTQI 3GTJI 4NBCA 2VUMI 2RBLA 4NB8A 1YUAA 2NVYI 2R92I 2R7ZI 3NDQA 4X6AI 1QYPA 1RO4A 2NVXI 4A3CI 4NBBA 3I4MI 2JA8I 3RZOI 1NUIA 3S17I 3VB9A 1USPB 2NVQI 3GTMS 3D6WA 4A3DI 5C3EI 1X3WA 5CM2M 2DE6A 1PFTA 3S2HI 4NBAA 5C44I 4Y7NI 3GTKI 2HF1A 4BY7X 1LQLA 2JA7I 1ZB8A 2DE5A 5IP9I 4BBRI 4A93I 1WCMI 3K7AI 1ENWA 4BY7I 3PO3S 4MH4A 3LUSA 3GTLI 1N2FA 4A3EI 3I07A 3EERA 1TWFI 2JR6A 4BY1X 2E2II 1Y1VS 3PO3I 3HOXI 1USPA 2P3YA 2DMEA 3FKII 3GKQA 1L1OC 2F4MA 5C4JI 1Y1WI 1I50I 2LW4A 3S1RI 3GTGI 1ZB9A 1Y1VI 3S1NI 2BJOA 3HOZI 4NBHA 3GCFA 3M3YI 3S14I 1TWCI 2JA6I 1TWGI 5C4XI 4Y52I 3RZDI 1R9TI 1WW9A 3PO2I 3CQZI 4NBFA 2NVTI 4BXXI 4NB9A 3VMGA 1DL6A 3I4NI 4A3II 3GTPI 1TWHI 4A3GI 3M4OI 2PK7A 1TWAI 3S15I 5IP7I 5FLMI 3S1MI 4QTTA 2B63I 2AKLA 4BXXX 2JNYA 3VMIA 4A3BI 1RLYA 4A3JI 1SFOI 3ESWA 4NOZA 3S2DI 3HOYI 3S16I 3S1QI 4A3MI 3GTMI 1K83I 2K5RA 3H0GI 3H3VJ 2R93I 4A3LI 2JA5I 2E2JI 1I3QI 3VMHA 3Q87A 2YU9I 1I6HI 1X3ZA 2DE7A 2F4OA 4BY1I 1ML8A 3HOUI 1VLAA 4XX2A 4QTUA 3U50C 4A3FI
chains in the Genus database with same CATH superfamily
2E2HI 3HOVI 2JS4A 1AISB 2OTJ1 5HBJB 4BBSI 3HOWI 3J7A4 3IR7A 3QZ5B 3M03A 2QGSA 3GTQI 1C9BA 4FX3B 3BHVB 2V8KA 1VOLA 2Q4ZA 2QQ8A 2IZ3A 2P28A 2R6MA 5IT9f 2O4HA 2QA4Z 2UUEB 1AHJB 3RZOI 3CMAZ 3HB9A 3KIFA 3J81b 2CCIB 1H1PB 2UZDB 3GTMS 3D6WA 1K732 3CCRZ 1X3WA 2W9FA 1PFTA 4OGRB 2OZKA 2JIPA 3CC71 4EC8B 4RVGA 1VQL1 3MY1B 3IF8A 2O53A 1YUKA 1Q822 2JIMA 3VYGB 3CCSZ 2CCHB 1RQFA 1IREB 4BBRI 2ZPGB 3CPWZ 1M1K1 4IMYB 4CFUD 2WMBB 3LUSA 1VQ71 2RPRA 3CCUZ 3J80b 2QEXZ 5T67A 1TWFI 5IF1B 2I53A 1Y1VS 3PO3I 3CXCY 3WVDB 4BCMB 1K9M1 4AKHA 1L1OC 3CC7Z 2LFUA 5C4JI 3BHUB 3TN8B 4HNVA 2RT9A 2WB1A 4LOCA 1GY3B 2PM9A 3S1RI 2BKZB 4AYBA 1ZB9A 2C5XB 4BCFB 3QHRB 1ZH1A 1VQ91 4EOPB 1BU2A 1H4LD 1YJN1 1YJW1 3HKZA 4NBHA 1FKMA 2RIQA 2JIOA 3GCFA 3S14I 3LQ5B 1TWGI 2E7ZA 1VQN1 5BNJB 4UN0A 1R9TI 1WW9A 5A2Qf 1N4MA 1E9HB 3X24B 4A3GI 2KR6A 3CCE1 1H1QB 2PK7A 4KRDB 3OW2Y 3S15I 5IP7I 5FLMI 2PK2A 1VQ4Z 4QTTA 1H1SB 2CZ1B 2GTHA 1GUXB 2AKLA 4BXXX 3A8GB 2F2CA 3MI9B 3VMIA 1RLYA 1KRLA 1VQK1 4OB3B 1Z02A 1JJ2Y 1UNHD 2K5RA 3H3VJ 3DJBA 3CCU1 1AA6A 2QREB 2JA5I 2ZAEB 1JKWA 1I3QI 4CL1A 3NFZA 1OKVB 3A8HB 2M6NA 2YU9I 1X3ZA 4ZGDB 1PKDB 3BLQB 2F4OA 1VLAA 5D1PA 4RVHA 2JUBA 1O9KA 1Y1VI 4ELLA 2IW6B 3B57A 2M48A 4NBGA 4I3ZB 5HQ0B 4F7LB 1K731 2ZPFB 1TFIA 1QLBA 2IW8B 2KPIA 5FLXf 4F7NB 2V8IA 2C6TB 1Q812 1YUAA 3DOGB 2R92I 1VQ81 2R7ZI 2DD4B 2I40B 2DXBB 4JX4A 1JWHC 3CC4Z 2NVXI 3I56Z 3DTOA 1Q16A 3CMEZ 4EOOB 2JA8I 1URCB 3CCJ1 1YIJ1 1QVGY 3VB9A 3KHIA 4BCOB 2V45A 1OIUB 1USPB 3F5XB 5IDPB 1YI21 4F6SB 1NP6A 4AKGA 5EFQB 3F3FC 1QMZB 3J81f 4KRCB 3KIHA 5CM2M 2DE6A 4YOZA 1FDOA 2VPZA 3MZKB 3S2HI 3NH8A 5C44I 2ZPIB 2OTJZ 3POMA 4RS4A 5LL6f 4MFDA 2RHBA 3A8OB 4BCKB 1VQPZ 4MD8A 3X28B 2V3VA 2DE5A 4A93I 4Z6YA 1VQLZ 2WEVB 1ENWA 1W98B 3A8MB 3BLRB 1RNIA 2VPYA 3FQQA 1OGUB 3TDHB 3RGFB 1M1K2 1OL1B 3JAMb 2W04A 1G3NC 2BS3A 4ROEA 4AI6A 2GTIA 4E32A 2JGZB 4BCIB 2E2II 2P3YA 1F5QB 3GKQA 3QYEA 2F4MA 2AHJB 3QYGB 1Y1WI 1UGSB 4RV9A 4CFMB 2BS4A 1K9M2 2DPPB 1I50I 1YI2Z 1NJI2 2NAPA 3G6E1 2WPAB 2G2KA 2W99A 3M3YI 2V22B 3MIAB 1TWCI 4HH4A 1M901 5IHYA 1UGQB 3PO2I 3DDPB 1DL6A 4NBFA 2ZPEB 1ZP2A 1VQOZ 2IVXA 4A3II 5HBHB 4QSHA 2BPMB 3O0GD 3CC21 1Q861 3QYBA 4EOSB 3S1MI 3EJ1B 3TNHB 3F3PC 2B63I 2QEX1 2V8JA 1UGPB 2D0QB 4MFEA 1KQSY 4A3JI 3ESWA 2G77A 2WHBB 2OOXB 4CRLB 4NOZA 1S7MA 3S1QI 3GTMI 2QFZA 2C4GB 1VQM1 3IX0A 2C5VB 3VTNA 1VQ6Z 4A3LI 4BCQD 4BCND 2C5NB 4MONA 3I55Z 2E2JI 2VF1A 5CEIB 2GU2A 3MZLB 5T64A 3VMHA 1VQKZ 2UZBB 1I6HI 1X0TA 1NJI1 4E2WA 4A3FI 5D1OA 3FQMA 1V29B 3QWUA 3BG1B 1KXUA 4E2ZA 2KMGA 5D1OB 1TD6A 4OB0B 3GTJI 4NBCA 3WVEB 2VUMI 1KQSZ 1GUXA 2PMIB 3HBLA 5DQWA 2RBLA 4NB8A 2NVYI 4BBRM 4BCHB 1JOWA 4ROCA 3G4SZ 2HU9A 3NDQA 4YC3B 5EJCA 2W9ZA 5HBEB 2PK9B 2QF7A 1RO4A 2E9HA 1QVFY 1YJNZ 4A3CI 1VQ61 3I4MI 1JSUB 3P5JB 4EOJB 1WJ2A 1Q862 2QDJA 1NUIA 1VQMZ 3CCQ1 4CFUB 5T6BA 4DGLA 4E2YA 4AKIA 3TE5B 3EEDA 3EIDB 1YIT1 4MIMA 4ELJA 1Q7Y2 4A3DI 1H28B 3A8LB 1S72Z 2JMOA 5ICPB 1P5EB 1UNGD 4NBAA 1OKWB 2HF1A 1Q811 4BY7X 3CC2Z 1LQLA 2QR1B 4M6VA 4F6UB 3CD6Z 2B9RA 4RODA 1D3UB 1ZB8A 1YHQ1 4NC6A 3QWLA 1VQ41 4NH1C 5IP9I 2UZEB 4II5B 3K7AI 5I5ZB 2WXVB 2K3RA 3CCS1 3J80f 2QDYB 4EWCA 3GTLI 1N2FA 4A3EI 4HLQA 4ZGJB 2H85A 4E31A 3EERA 3QHWB 2WJ9A 3VKHA 4BY1X 2WIPB 1USPA 4HGZA 4CXAB 1AD6A 1H25B 1O9KB 3CCR1 2CYZB 3VYHB 3G71Z 1S721 4E33A 2IN3A 5L2WB 4JX5A 2DD5B 1WZNA 1SIWA 4EOIB 1OL2B 1VINA 3HZJA 5FGKB 1TFBA 4ZGEB 3S1NI 2I3CA 3HOZI 2JA6I 5CYIB 5C4XI 2WFYB 1JJ2Z 4Y52I 1Z03A 2OTL1 2QRCB 4YOOA 3U50C 2PHGA 2PJQA 3CQZI 1W2BY 2IZ4A 1QVGZ 3G33B 3VMGA 3CCM1 1KC82 2NVTI 1VQ7Z 4EOKB 3CME1 4BCMD 5HVYB 1GH6B 3CC41 3D9XA 4F6WB 3CCEZ 3CCMZ 2AYDA 2OOYB 2JIRA 2VPWA 4EOMB 1VQ51 1W2BZ 4EOQB 1M902 2PMZA 3S2DI 2EUFA 2JIQA 3HOYI 1K83I 2R7GA 1VQNZ 1FDIA 1P9NA 3H0GI 4CFNB 2R93I 3NDJA 3Q87A 1JSTB 4E2XA 3TNWB 4CFVB 3HHTB 2KI7B 2QRDB 3EOCB 4BY1I 4CFXB 4QTUA 2QA41 3GTKI 4EC9B 2BS2A 3CCL1 3BG5A 1YJ9Z 2VUGA 2J6AA 3GTOI 4NBEA 4DQYB 4NBDA 1VQ5Z 4A3KI 1UNLD 2OTLZ 2G9XB 1K8A1 2UZLB 4JX6A 4OB2B 3X26B 5IT9b 3OW2Z 3QYHB 5LQFB 4X6AI 1QYPA 3CD61 4MD9A 4NBBA 1H26B 3S17I 4EOLB 4BCQB 4BCNB 3JAMf 4EONB 2NVQI 2WAQA 1Y8CA 2Y0SA 5C3EI 2ZPBB 2ZCFB 2LIYA 3IFUA 4NSTB 4RVDA 1OIYB 3I561 4Y7NI 2YADA 3MY5B 3CCQZ 3T4NB 1VQ9Z 3TW7A 2QLVB 2LEXA 2ZPHB 5FLXb 3G711 5A2Qb 2JA7I 4BCJB 2WMAB 1QF8A 5AN9F 1UGRB 1XO2A 2VPXA 3CXCZ 3BG3A 4OB1B 5LMKB 1KD12 5DQVA 1WCMI 1YIJZ 4Y72B 2WIHB 5IDNB 3PO3S 4MH4A 4MRIA 4BY7I 1Q7Y1 4DK1A 5HNBB 3I07A 4TNUA 4TTHA 1VQ8Z 2DXCB 5ACBA 3NH5A 3CPWY 2JR6A 3CMA1 3HOXI 2DMEA 3X25B 4YOSA 3DL1A 1K8A2 3FKII 4HNTA 1YHQZ 3BG0B 3QZ9B 4MD7A 3BG9A 4G6LB 2Q51A 2LW4A 2QKDA 4BCGB 4CFWB 3GTGI 3TW6A 2C5OB 2BJOA 3CCLZ 1YJ91 3BLHB 4NFRA 3CCJZ 1VQP1 4S1TA 1YITZ 1RO0A 1VQO1 4E30A 4F7JB 3BHTB 3RZDI 2W2HA 1N8R2 4F7SB 4BXXI 3MONA 4NB9A 4MXUA 3CCV1 3I4NI 3GTPI 1TWHI 1QVFZ 1VYWB 1QXFA 3M4OI 3H4CA 1FINB 1OI9B 3G4S1 3HO8A 2W96A 2CJMB 3TNIB 2IV2X 3G6EZ 1TWAI 1RO2A 1Q821 2JNYA 3D2LA 4A3BI 3DDQB 1SFOI 1YJWZ 1H24B 2CZ0B 4EORB 4HGYA 3S16I 2CZ6B 2EGTA 4A3MI 1N8R1 1KC81 3X20B 1Z01A 2CZ7B 1E7PA 3NDIA 1WIIA 4HL4A 3K7AM 2IW9B 1H27B 3QXEB 4BBSM 4F70B 4RVFA 1FVVB 4HNUA 2DE7A 1KD11 3NH4A 3I551 1H1RB 2ZZDB 2X1NB 1ML8A 3HOUI 3CCVZ 4XX2A 4BCPB 4OR5B 4FM4B 3VKGA 2W03A
chains in the Genus database with same CATH topology
2E2HI 3HOVI 2JS4A 2OTJ1 4BBSI 3HOWI 3J7A4 3GTQI 2V8KA 2Q4ZA 2IZ3A 2P28A 2R6MA 5IT9f 2O4HA 2QA4Z 3RZOI 3CMAZ 3KIFA 3J81b 1K732 3GTMS 3D6WA 3CCRZ 1X3WA 1PFTA 2OZKA 3CC71 4RVGA 1VQL1 3IF8A 2O53A 1YUKA 1Q822 3CCSZ 1RQFA 4BBRI 3CPWZ 1M1K1 3LUSA 1VQ71 2RPRA 3CCUZ 3J80b 2QEXZ 5T67A 1TWFI 1Y1VS 3PO3I 3CXCY 1K9M1 1L1OC 3CC7Z 2LFUA 5C4JI 2RT9A 2WB1A 2PM9A 3S1RI 4AYBA 1ZB9A 1ZH1A 1VQ91 1YJW1 1YJN1 3HKZA 4NBHA 2RIQA 3GCFA 3S14I 1TWGI 1VQN1 1R9TI 1WW9A 5A2Qf 4A3GI 3CCE1 2PK7A 3OW2Y 3S15I 5IP7I 5FLMI 1VQ4Z 4QTTA 2GTHA 2AKLA 4BXXX 3VMIA 1RLYA 1KRLA 1VQK1 1Z02A 1JJ2Y 2K5RA 3H3VJ 3CCU1 2QREB 2JA5I 2ZAEB 1I3QI 4CL1A 3NFZA 2M6NA 2YU9I 1X3ZA 2F4OA 1VLAA 5D1PA 4RVHA 2JUBA 1Y1VI 2M48A 4NBGA 1K731 1TFIA 2KPIA 5FLXf 2V8IA 1Q812 1YUAA 2R92I 1VQ81 2R7ZI 1JWHC 3CC4Z 2NVXI 3I56Z 3CMEZ 2JA8I 3CCJ1 1YIJ1 1QVGY 3VB9A 1USPB 1YI21 1NP6A 3F3FC 3J81f 3KIHA 5CM2M 2DE6A 3MZKB 3S2HI 3NH8A 5C44I 2OTJZ 4RS4A 5LL6f 2RHBA 1VQPZ 4MD8A 2DE5A 4A93I 1VQLZ 1ENWA 3TDHB 1RNIA 3FQQA 1M1K2 3JAMb 2W04A 4E32A 2GTIA 2E2II 2P3YA 3GKQA 2F4MA 1Y1WI 4RV9A 1K9M2 1I50I 1NJI2 1YI2Z 3G6E1 2G2KA 3M3YI 1TWCI 4HH4A 1M901 3PO2I 1DL6A 4NBFA 1VQOZ 4A3II 3CC21 1Q861 3S1MI 3F3PC 2B63I 2QEX1 2V8JA 1KQSY 4A3JI 3ESWA 2OOXB 4NOZA 1S7MA 3S1QI 3GTMI 1VQM1 3IX0A 3VTNA 1VQ6Z 4A3LI 4MONA 3I55Z 2E2JI 2VF1A 5T64A 2GU2A 3MZLB 3VMHA 1VQKZ 1I6HI 1X0TA 1NJI1 4E2WA 4A3FI 5D1OA 3FQMA 3QWUA 3BG1B 4E2ZA 5D1OB 3GTJI 4NBCA 2VUMI 1KQSZ 2RBLA 4NB8A 2NVYI 3G4SZ 2HU9A 3NDQA 1RO4A 2E9HA 1QVFY 4A3CI 1YJNZ 1VQ61 3I4MI 3P5JB 1Q862 1NUIA 1VQMZ 3CCQ1 5T6BA 4DGLA 4E2YA 3TE5B 3EEDA 1YIT1 1Q7Y2 4A3DI 1S72Z 2JMOA 4NBAA 2HF1A 1Q811 4BY7X 3CC2Z 1LQLA 2QR1B 3CD6Z 1YHQ1 1ZB8A 1VQ41 4NH1C 5IP9I 3K7AI 2K3RA 3CCS1 3J80f 4EWCA 3GTLI 1N2FA 4A3EI 2H85A 4E31A 3EERA 4BY1X 1USPA 4HGZA 3CCR1 3G71Z 1S721 4E33A 3S1NI 2I3CA 3HOZI 2JA6I 5C4XI 1JJ2Z 4Y52I 1Z03A 2OTL1 2QRCB 1KC82 1W2BY 3CQZI 2NVTI 2IZ4A 1QVGZ 3CCM1 3VMGA 1VQ7Z 3CME1 3CC41 3D9XA 3CCEZ 3CCMZ 2OOYB 1W2BZ 1VQ51 1M902 2PMZA 3S2DI 3HOYI 1K83I 1VQNZ 1P9NA 3H0GI 2R93I 3NDJA 3Q87A 4E2XA 2KI7B 2QRDB 4BY1I 4QTUA 2QA41 3GTKI 1YJ9Z 3CCL1 2VUGA 2J6AA 3GTOI 4NBEA 4DQYB 4NBDA 1VQ5Z 4A3KI 2OTLZ 1K8A1 5IT9b 3OW2Z 4X6AI 1QYPA 3CD61 4MD9A 4NBBA 3S17I 3JAMf 2NVQI 2WAQA 2Y0SA 5C3EI 2LIYA 3IFUA 4RVDA 3I561 4Y7NI 2YADA 3CCQZ 3T4NB 1VQ9Z 2QLVB 5FLXb 3G711 5A2Qb 2JA7I 1QF8A 5AN9F 3CXCZ 1KD12 1WCMI 1YIJZ 4BY7I 3PO3S 4MH4A 4MRIA 1Q7Y1 4DK1A 3I07A 4TNUA 1VQ8Z 3NH5A 3CPWY 2JR6A 3CMA1 3HOXI 2DMEA 1K8A2 3FKII 1YHQZ 3BG0B 4MD7A 2Q51A 2LW4A 2QKDA 3GTGI 2BJOA 3CCLZ 1YJ91 4NFRA 1VQP1 3CCJZ 4S1TA 1YITZ 1RO0A 1VQO1 4E30A 3RZDI 1N8R2 4BXXI 3MONA 4NB9A 4MXUA 3CCV1 3I4NI 3GTPI 1TWHI 1QVFZ 3M4OI 3G4S1 3G6EZ 1TWAI 1RO2A 1Q821 2JNYA 4A3BI 1SFOI 1YJWZ 4HGYA 3S16I 2EGTA 4A3MI 1N8R1 1KC81 1Z01A 3NDIA 1WIIA 4RVFA 2DE7A 1KD11 3NH4A 3I551 1ML8A 3HOUI 3CCVZ 4XX2A 3U50C 2W03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  3HOV I;  2JS4 A;  2J6A A;  3GTO I;  4NBG A;  4BBS I;  4NBE A;  3HOW I;  1TFI A;  4NBD A;  4A3K I;  2KPI A;  3GTQ I;  3GTJ I;  4NBC A;  2VUM I;  2RBL A;  4NB8 A;  1YUA A;  2NVY I;  2R92 I;  2R7Z I;  3NDQ A;  4X6A I;  1QYP A;  1RO4 A;  2NVX I;  4A3C I;  4NBB A;  3I4M I;  2JA8 I;  3RZO I;  1NUI A;  3S17 I;  3VB9 A;  1USP B;  2NVQ I;  3GTM S;  3D6W A;  4A3D I;  5C3E I;  1X3W A;  5CM2 M;  2DE6 A;  1PFT A;  3S2H I;  4NBA A;  5C44 I;  4Y7N I;  3GTK I;  2HF1 A;  4BY7 X;  1LQL A;  2JA7 I;  1ZB8 A;  2DE5 A;  5IP9 I;  4BBR I;  4A93 I;  1WCM I;  3K7A I;  1ENW A;  4BY7 I;  3PO3 S;  4MH4 A;  3LUS A;  3GTL I;  1N2F A;  4A3E I;  3I07 A;  3EER A;  1TWF I;  2JR6 A;  4BY1 X;  2E2I I;  1Y1V S;  3PO3 I;  3HOX I;  1USP A;  2P3Y A;  2DME A;  3FKI I;  3GKQ A;  1L1O C;  2F4M A;  5C4J I;  1Y1W I;  1I50 I;  2LW4 A;  3S1R I;  3GTG I;  1ZB9 A;  1Y1V I;  3S1N I;  2BJO A;  3HOZ I;  4NBH A;  3GCF A;  3M3Y I;  3S14 I;  1TWC I;  2JA6 I;  1TWG I;  5C4X I;  4Y52 I;  3RZD I;  1R9T I;  1WW9 A;  3PO2 I;  3CQZ I;  4NBF A;  2NVT I;  4BXX I;  4NB9 A;  3VMG A;  1DL6 A;  3I4N I;  4A3I I;  3GTP I;  1TWH I;  4A3G I;  3M4O I;  2PK7 A;  1TWA I;  3S15 I;  5IP7 I;  5FLM I;  3S1M I;  4QTT A;  2B63 I;  2AKL A;  4BXX X;  2JNY A;  3VMI A;  4A3B I;  1RLY A;  4A3J I;  1SFO I;  3ESW A;  4NOZ A;  3S2D I;  3HOY I;  3S16 I;  3S1Q I;  4A3M I;  3GTM I;  1K83 I;  2K5R A;  3H0G I;  3H3V J;  2R93 I;  4A3L I;  2JA5 I;  2E2J I;  1I3Q I;  3VMH A;  3Q87 A;  2YU9 I;  1I6H I;  1X3Z A;  2DE7 A;  2F4O A;  4BY1 I;  1ML8 A;  3HOU I;  1VLA A;  4XX2 A;  4QTU A;  3U50 C;  4A3F I; 
#chains in the Genus database with same CATH topology
 2E2H I;  3HOV I;  2JS4 A;  1AIS B;  2OTJ 1;  5HBJ B;  4BBS I;  3HOW I;  3J7A 4;  3IR7 A;  3QZ5 B;  3M03 A;  2QGS A;  3GTQ I;  1C9B A;  4FX3 B;  3BHV B;  2V8K A;  1VOL A;  2Q4Z A;  2QQ8 A;  2IZ3 A;  2P28 A;  2R6M A;  5IT9 f;  2O4H A;  2QA4 Z;  2UUE B;  1AHJ B;  3RZO I;  3CMA Z;  3HB9 A;  3KIF A;  3J81 b;  2CCI B;  1H1P B;  2UZD B;  3GTM S;  3D6W A;  1K73 2;  3CCR Z;  1X3W A;  2W9F A;  1PFT A;  4OGR B;  2OZK A;  2JIP A;  3CC7 1;  4EC8 B;  4RVG A;  1VQL 1;  3MY1 B;  3IF8 A;  2O53 A;  1YUK A;  1Q82 2;  2JIM A;  3VYG B;  3CCS Z;  2CCH B;  1RQF A;  1IRE B;  4BBR I;  2ZPG B;  3CPW Z;  1M1K 1;  4IMY B;  4CFU D;  2WMB B;  3LUS A;  1VQ7 1;  2RPR A;  3CCU Z;  3J80 b;  2QEX Z;  5T67 A;  1TWF I;  5IF1 B;  2I53 A;  1Y1V S;  3PO3 I;  3CXC Y;  3WVD B;  4BCM B;  1K9M 1;  4AKH A;  1L1O C;  3CC7 Z;  2LFU A;  5C4J I;  3BHU B;  3TN8 B;  4HNV A;  2RT9 A;  2WB1 A;  4LOC A;  1GY3 B;  2PM9 A;  3S1R I;  2BKZ B;  4AYB A;  1ZB9 A;  2C5X B;  4BCF B;  3QHR B;  1ZH1 A;  1VQ9 1;  4EOP B;  1BU2 A;  1H4L D;  1YJN 1;  1YJW 1;  3HKZ A;  4NBH A;  1FKM A;  2RIQ A;  2JIO A;  3GCF A;  3S14 I;  3LQ5 B;  1TWG I;  2E7Z A;  1VQN 1;  5BNJ B;  4UN0 A;  1R9T I;  1WW9 A;  5A2Q f;  1N4M A;  1E9H B;  3X24 B;  4A3G I;  2KR6 A;  3CCE 1;  1H1Q B;  2PK7 A;  4KRD B;  3OW2 Y;  3S15 I;  5IP7 I;  5FLM I;  2PK2 A;  1VQ4 Z;  4QTT A;  1H1S B;  2CZ1 B;  2GTH A;  1GUX B;  2AKL A;  4BXX X;  3A8G B;  2F2C A;  3MI9 B;  3VMI A;  1RLY A;  1KRL A;  1VQK 1;  4OB3 B;  1Z02 A;  1JJ2 Y;  1UNH D;  2K5R A;  3H3V J;  3DJB A;  3CCU 1;  1AA6 A;  2QRE B;  2JA5 I;  2ZAE B;  1JKW A;  1I3Q I;  4CL1 A;  3NFZ A;  1OKV B;  3A8H B;  2M6N A;  2YU9 I;  1X3Z A;  4ZGD B;  1PKD B;  3BLQ B;  2F4O A;  1VLA A;  5D1P A;  4RVH A;  2JUB A;  1O9K A;  1Y1V I;  4ELL A;  2IW6 B;  3B57 A;  2M48 A;  4NBG A;  4I3Z B;  5HQ0 B;  4F7L B;  1K73 1;  2ZPF B;  1TFI A;  1QLB A;  2IW8 B;  2KPI A;  5FLX f;  4F7N B;  2V8I A;  2C6T B;  1Q81 2;  1YUA A;  3DOG B;  2R92 I;  1VQ8 1;  2R7Z I;  2DD4 B;  2I40 B;  2DXB B;  4JX4 A;  1JWH C;  3CC4 Z;  2NVX I;  3I56 Z;  3DTO A;  1Q16 A;  3CME Z;  4EOO B;  2JA8 I;  1URC B;  3CCJ 1;  1YIJ 1;  1QVG Y;  3VB9 A;  3KHI A;  4BCO B;  2V45 A;  1OIU B;  1USP B;  3F5X B;  5IDP B;  1YI2 1;  4F6S B;  1NP6 A;  4AKG A;  5EFQ B;  3F3F C;  1QMZ B;  3J81 f;  4KRC B;  3KIH A;  5CM2 M;  2DE6 A;  4YOZ A;  1FDO A;  2VPZ A;  3MZK B;  3S2H I;  3NH8 A;  5C44 I;  2ZPI B;  2OTJ Z;  3POM A;  4RS4 A;  5LL6 f;  4MFD A;  2RHB A;  3A8O B;  4BCK B;  1VQP Z;  4MD8 A;  3X28 B;  2V3V A;  2DE5 A;  4A93 I;  4Z6Y A;  1VQL Z;  2WEV B;  1ENW A;  1W98 B;  3A8M B;  3BLR B;  1RNI A;  2VPY A;  3FQQ A;  1OGU B;  3TDH B;  3RGF B;  1M1K 2;  1OL1 B;  3JAM b;  2W04 A;  1G3N C;  2BS3 A;  4ROE A;  4AI6 A;  2GTI A;  4E32 A;  2JGZ B;  4BCI B;  2E2I I;  2P3Y A;  1F5Q B;  3GKQ A;  3QYE A;  2F4M A;  2AHJ B;  3QYG B;  1Y1W I;  1UGS B;  4RV9 A;  4CFM B;  2BS4 A;  1K9M 2;  2DPP B;  1I50 I;  1YI2 Z;  1NJI 2;  2NAP A;  3G6E 1;  2WPA B;  2G2K A;  2W99 A;  3M3Y I;  2V22 B;  3MIA B;  1TWC I;  4HH4 A;  1M90 1;  5IHY A;  1UGQ B;  3PO2 I;  3DDP B;  1DL6 A;  4NBF A;  2ZPE B;  1ZP2 A;  1VQO Z;  2IVX A;  4A3I I;  5HBH B;  4QSH A;  2BPM B;  3O0G D;  3CC2 1;  1Q86 1;  3QYB A;  4EOS B;  3S1M I;  3EJ1 B;  3TNH B;  3F3P C;  2B63 I;  2QEX 1;  2V8J A;  1UGP B;  2D0Q B;  4MFE A;  1KQS Y;  4A3J I;  3ESW A;  2G77 A;  2WHB B;  2OOX B;  4CRL B;  4NOZ A;  1S7M A;  3S1Q I;  3GTM I;  2QFZ A;  2C4G B;  1VQM 1;  3IX0 A;  2C5V B;  3VTN A;  1VQ6 Z;  4A3L I;  4BCQ D;  4BCN D;  2C5N B;  4MON A;  3I55 Z;  2E2J I;  2VF1 A;  5CEI B;  2GU2 A;  3MZL B;  5T64 A;  3VMH A;  1VQK Z;  2UZB B;  1I6H I;  1X0T A;  1NJI 1;  4E2W A;  4A3F I;  5D1O A;  3FQM A;  1V29 B;  3QWU A;  3BG1 B;  1KXU A;  4E2Z A;  2KMG A;  5D1O B;  1TD6 A;  4OB0 B;  3GTJ I;  4NBC A;  3WVE B;  2VUM I;  1KQS Z;  1GUX A;  2PMI B;  3HBL A;  5DQW A;  2RBL A;  4NB8 A;  2NVY I;  4BBR M;  4BCH B;  1JOW A;  4ROC A;  3G4S Z;  2HU9 A;  3NDQ A;  4YC3 B;  5EJC A;  2W9Z A;  5HBE B;  2PK9 B;  2QF7 A;  1RO4 A;  2E9H A;  1QVF Y;  1YJN Z;  4A3C I;  1VQ6 1;  3I4M I;  1JSU B;  3P5J B;  4EOJ B;  1WJ2 A;  1Q86 2;  2QDJ A;  1NUI A;  1VQM Z;  3CCQ 1;  4CFU B;  5T6B A;  4DGL A;  4E2Y A;  4AKI A;  3TE5 B;  3EED A;  3EID B;  1YIT 1;  4MIM A;  4ELJ A;  1Q7Y 2;  4A3D I;  1H28 B;  3A8L B;  1S72 Z;  2JMO A;  5ICP B;  1P5E B;  1UNG D;  4NBA A;  1OKW B;  2HF1 A;  1Q81 1;  4BY7 X;  3CC2 Z;  1LQL A;  2QR1 B;  4M6V A;  4F6U B;  3CD6 Z;  2B9R A;  4ROD A;  1D3U B;  1ZB8 A;  1YHQ 1;  4NC6 A;  3QWL A;  1VQ4 1;  4NH1 C;  5IP9 I;  2UZE B;  4II5 B;  3K7A I;  5I5Z B;  2WXV B;  2K3R A;  3CCS 1;  3J80 f;  2QDY B;  4EWC A;  3GTL I;  1N2F A;  4A3E I;  4HLQ A;  4ZGJ B;  2H85 A;  4E31 A;  3EER A;  3QHW B;  2WJ9 A;  3VKH A;  4BY1 X;  2WIP B;  1USP A;  4HGZ A;  4CXA B;  1AD6 A;  1H25 B;  1O9K B;  3CCR 1;  2CYZ B;  3VYH B;  3G71 Z;  1S72 1;  4E33 A;  2IN3 A;  5L2W B;  4JX5 A;  2DD5 B;  1WZN A;  1SIW A;  4EOI B;  1OL2 B;  1VIN A;  3HZJ A;  5FGK B;  1TFB A;  4ZGE B;  3S1N I;  2I3C A;  3HOZ I;  2JA6 I;  5CYI B;  5C4X I;  2WFY B;  1JJ2 Z;  4Y52 I;  1Z03 A;  2OTL 1;  2QRC B;  4YOO A;  3U50 C;  2PHG A;  2PJQ A;  3CQZ I;  1W2B Y;  2IZ4 A;  1QVG Z;  3G33 B;  3VMG A;  3CCM 1;  1KC8 2;  2NVT I;  1VQ7 Z;  4EOK B;  3CME 1;  4BCM D;  5HVY B;  1GH6 B;  3CC4 1;  3D9X A;  4F6W B;  3CCE Z;  3CCM Z;  2AYD A;  2OOY B;  2JIR A;  2VPW A;  4EOM B;  1VQ5 1;  1W2B Z;  4EOQ B;  1M90 2;  2PMZ A;  3S2D I;  2EUF A;  2JIQ A;  3HOY I;  1K83 I;  2R7G A;  1VQN Z;  1FDI A;  1P9N A;  3H0G I;  4CFN B;  2R93 I;  3NDJ A;  3Q87 A;  1JST B;  4E2X A;  3TNW B;  4CFV B;  3HHT B;  2KI7 B;  2QRD B;  3EOC B;  4BY1 I;  4CFX B;  4QTU A;  2QA4 1;  3GTK I;  4EC9 B;  2BS2 A;  3CCL 1;  3BG5 A;  1YJ9 Z;  2VUG A;  2J6A A;  3GTO I;  4NBE A;  4DQY B;  4NBD A;  1VQ5 Z;  4A3K I;  1UNL D;  2OTL Z;  2G9X B;  1K8A 1;  2UZL B;  4JX6 A;  4OB2 B;  3X26 B;  5IT9 b;  3OW2 Z;  3QYH B;  5LQF B;  4X6A I;  1QYP A;  3CD6 1;  4MD9 A;  4NBB A;  1H26 B;  3S17 I;  4EOL B;  4BCQ B;  4BCN B;  3JAM f;  4EON B;  2NVQ I;  2WAQ A;  1Y8C A;  2Y0S A;  5C3E I;  2ZPB B;  2ZCF B;  2LIY A;  3IFU A;  4NST B;  4RVD A;  1OIY B;  3I56 1;  4Y7N I;  2YAD A;  3MY5 B;  3CCQ Z;  3T4N B;  1VQ9 Z;  3TW7 A;  2QLV B;  2LEX A;  2ZPH B;  5FLX b;  3G71 1;  5A2Q b;  2JA7 I;  4BCJ B;  2WMA B;  1QF8 A;  5AN9 F;  1UGR B;  1XO2 A;  2VPX A;  3CXC Z;  3BG3 A;  4OB1 B;  5LMK B;  1KD1 2;  5DQV A;  1WCM I;  1YIJ Z;  4Y72 B;  2WIH B;  5IDN B;  3PO3 S;  4MH4 A;  4MRI A;  4BY7 I;  1Q7Y 1;  4DK1 A;  5HNB B;  3I07 A;  4TNU A;  4TTH A;  1VQ8 Z;  2DXC B;  5ACB A;  3NH5 A;  3CPW Y;  2JR6 A;  3CMA 1;  3HOX I;  2DME A;  3X25 B;  4YOS A;  3DL1 A;  1K8A 2;  3FKI I;  4HNT A;  1YHQ Z;  3BG0 B;  3QZ9 B;  4MD7 A;  3BG9 A;  4G6L B;  2Q51 A;  2LW4 A;  2QKD A;  4BCG B;  4CFW B;  3GTG I;  3TW6 A;  2C5O B;  2BJO A;  3CCL Z;  1YJ9 1;  3BLH B;  4NFR A;  3CCJ Z;  1VQP 1;  4S1T A;  1YIT Z;  1RO0 A;  1VQO 1;  4E30 A;  4F7J B;  3BHT B;  3RZD I;  2W2H A;  1N8R 2;  4F7S B;  4BXX I;  3MON A;  4NB9 A;  4MXU A;  3CCV 1;  3I4N I;  3GTP I;  1TWH I;  1QVF Z;  1VYW B;  1QXF A;  3M4O I;  3H4C A;  1FIN B;  1OI9 B;  3G4S 1;  3HO8 A;  2W96 A;  2CJM B;  3TNI B;  2IV2 X;  3G6E Z;  1TWA I;  1RO2 A;  1Q82 1;  2JNY A;  3D2L A;  4A3B I;  3DDQ B;  1SFO I;  1YJW Z;  1H24 B;  2CZ0 B;  4EOR B;  4HGY A;  3S16 I;  2CZ6 B;  2EGT A;  4A3M I;  1N8R 1;  1KC8 1;  3X20 B;  1Z01 A;  2CZ7 B;  1E7P A;  3NDI A;  1WII A;  4HL4 A;  3K7A M;  2IW9 B;  1H27 B;  3QXE B;  4BBS M;  4F70 B;  4RVF A;  1FVV B;  4HNU A;  2DE7 A;  1KD1 1;  3NH4 A;  3I55 1;  1H1R B;  2ZZD B;  2X1N B;  1ML8 A;  3HOU I;  3CCV Z;  4XX2 A;  4BCP B;  4OR5 B;  4FM4 B;  3VKG A;  2W03 A; 
#chains in the Genus database with same CATH homology
 2E2H I;  3HOV I;  2JS4 A;  2OTJ 1;  4BBS I;  3HOW I;  3J7A 4;  3GTQ I;  2V8K A;  2Q4Z A;  2IZ3 A;  2P28 A;  2R6M A;  5IT9 f;  2O4H A;  2QA4 Z;  3RZO I;  3CMA Z;  3KIF A;  3J81 b;  1K73 2;  3GTM S;  3D6W A;  3CCR Z;  1X3W A;  1PFT A;  2OZK A;  3CC7 1;  4RVG A;  1VQL 1;  3IF8 A;  2O53 A;  1YUK A;  1Q82 2;  3CCS Z;  1RQF A;  4BBR I;  3CPW Z;  1M1K 1;  3LUS A;  1VQ7 1;  2RPR A;  3CCU Z;  3J80 b;  2QEX Z;  5T67 A;  1TWF I;  1Y1V S;  3PO3 I;  3CXC Y;  1K9M 1;  1L1O C;  3CC7 Z;  2LFU A;  5C4J I;  2RT9 A;  2WB1 A;  2PM9 A;  3S1R I;  4AYB A;  1ZB9 A;  1ZH1 A;  1VQ9 1;  1YJW 1;  1YJN 1;  3HKZ A;  4NBH A;  2RIQ A;  3GCF A;  3S14 I;  1TWG I;  1VQN 1;  1R9T I;  1WW9 A;  5A2Q f;  4A3G I;  3CCE 1;  2PK7 A;  3OW2 Y;  3S15 I;  5IP7 I;  5FLM I;  1VQ4 Z;  4QTT A;  2GTH A;  2AKL A;  4BXX X;  3VMI A;  1RLY A;  1KRL A;  1VQK 1;  1Z02 A;  1JJ2 Y;  2K5R A;  3H3V J;  3CCU 1;  2QRE B;  2JA5 I;  2ZAE B;  1I3Q I;  4CL1 A;  3NFZ A;  2M6N A;  2YU9 I;  1X3Z A;  2F4O A;  1VLA A;  5D1P A;  4RVH A;  2JUB A;  1Y1V I;  2M48 A;  4NBG A;  1K73 1;  1TFI A;  2KPI A;  5FLX f;  2V8I A;  1Q81 2;  1YUA A;  2R92 I;  1VQ8 1;  2R7Z I;  1JWH C;  3CC4 Z;  2NVX I;  3I56 Z;  3CME Z;  2JA8 I;  3CCJ 1;  1YIJ 1;  1QVG Y;  3VB9 A;  1USP B;  1YI2 1;  1NP6 A;  3F3F C;  3J81 f;  3KIH A;  5CM2 M;  2DE6 A;  3MZK B;  3S2H I;  3NH8 A;  5C44 I;  2OTJ Z;  4RS4 A;  5LL6 f;  2RHB A;  1VQP Z;  4MD8 A;  2DE5 A;  4A93 I;  1VQL Z;  1ENW A;  3TDH B;  1RNI A;  3FQQ A;  1M1K 2;  3JAM b;  2W04 A;  4E32 A;  2GTI A;  2E2I I;  2P3Y A;  3GKQ A;  2F4M A;  1Y1W I;  4RV9 A;  1K9M 2;  1I50 I;  1NJI 2;  1YI2 Z;  3G6E 1;  2G2K A;  3M3Y I;  1TWC I;  4HH4 A;  1M90 1;  3PO2 I;  1DL6 A;  4NBF A;  1VQO Z;  4A3I I;  3CC2 1;  1Q86 1;  3S1M I;  3F3P C;  2B63 I;  2QEX 1;  2V8J A;  1KQS Y;  4A3J I;  3ESW A;  2OOX B;  4NOZ A;  1S7M A;  3S1Q I;  3GTM I;  1VQM 1;  3IX0 A;  3VTN A;  1VQ6 Z;  4A3L I;  4MON A;  3I55 Z;  2E2J I;  2VF1 A;  5T64 A;  2GU2 A;  3MZL B;  3VMH A;  1VQK Z;  1I6H I;  1X0T A;  1NJI 1;  4E2W A;  4A3F I;  5D1O A;  3FQM A;  3QWU A;  3BG1 B;  4E2Z A;  5D1O B;  3GTJ I;  4NBC A;  2VUM I;  1KQS Z;  2RBL A;  4NB8 A;  2NVY I;  3G4S Z;  2HU9 A;  3NDQ A;  1RO4 A;  2E9H A;  1QVF Y;  4A3C I;  1YJN Z;  1VQ6 1;  3I4M I;  3P5J B;  1Q86 2;  1NUI A;  1VQM Z;  3CCQ 1;  5T6B A;  4DGL A;  4E2Y A;  3TE5 B;  3EED A;  1YIT 1;  1Q7Y 2;  4A3D I;  1S72 Z;  2JMO A;  4NBA A;  2HF1 A;  1Q81 1;  4BY7 X;  3CC2 Z;  1LQL A;  2QR1 B;  3CD6 Z;  1YHQ 1;  1ZB8 A;  1VQ4 1;  4NH1 C;  5IP9 I;  3K7A I;  2K3R A;  3CCS 1;  3J80 f;  4EWC A;  3GTL I;  1N2F A;  4A3E I;  2H85 A;  4E31 A;  3EER A;  4BY1 X;  1USP A;  4HGZ A;  3CCR 1;  3G71 Z;  1S72 1;  4E33 A;  3S1N I;  2I3C A;  3HOZ I;  2JA6 I;  5C4X I;  1JJ2 Z;  4Y52 I;  1Z03 A;  2OTL 1;  2QRC B;  1KC8 2;  1W2B Y;  3CQZ I;  2NVT I;  2IZ4 A;  1QVG Z;  3CCM 1;  3VMG A;  1VQ7 Z;  3CME 1;  3CC4 1;  3D9X A;  3CCE Z;  3CCM Z;  2OOY B;  1W2B Z;  1VQ5 1;  1M90 2;  2PMZ A;  3S2D I;  3HOY I;  1K83 I;  1VQN Z;  1P9N A;  3H0G I;  2R93 I;  3NDJ A;  3Q87 A;  4E2X A;  2KI7 B;  2QRD B;  4BY1 I;  4QTU A;  2QA4 1;  3GTK I;  1YJ9 Z;  3CCL 1;  2VUG A;  2J6A A;  3GTO I;  4NBE A;  4DQY B;  4NBD A;  1VQ5 Z;  4A3K I;  2OTL Z;  1K8A 1;  5IT9 b;  3OW2 Z;  4X6A I;  1QYP A;  3CD6 1;  4MD9 A;  4NBB A;  3S17 I;  3JAM f;  2NVQ I;  2WAQ A;  2Y0S A;  5C3E I;  2LIY A;  3IFU A;  4RVD A;  3I56 1;  4Y7N I;  2YAD A;  3CCQ Z;  3T4N B;  1VQ9 Z;  2QLV B;  5FLX b;  3G71 1;  5A2Q b;  2JA7 I;  1QF8 A;  5AN9 F;  3CXC Z;  1KD1 2;  1WCM I;  1YIJ Z;  4BY7 I;  3PO3 S;  4MH4 A;  4MRI A;  1Q7Y 1;  4DK1 A;  3I07 A;  4TNU A;  1VQ8 Z;  3NH5 A;  3CPW Y;  2JR6 A;  3CMA 1;  3HOX I;  2DME A;  1K8A 2;  3FKI I;  1YHQ Z;  3BG0 B;  4MD7 A;  2Q51 A;  2LW4 A;  2QKD A;  3GTG I;  2BJO A;  3CCL Z;  1YJ9 1;  4NFR A;  1VQP 1;  3CCJ Z;  4S1T A;  1YIT Z;  1RO0 A;  1VQO 1;  4E30 A;  3RZD I;  1N8R 2;  4BXX I;  3MON A;  4NB9 A;  4MXU A;  3CCV 1;  3I4N I;  3GTP I;  1TWH I;  1QVF Z;  3M4O I;  3G4S 1;  3G6E Z;  1TWA I;  1RO2 A;  1Q82 1;  2JNY A;  4A3B I;  1SFO I;  1YJW Z;  4HGY A;  3S16 I;  2EGT A;  4A3M I;  1N8R 1;  1KC8 1;  1Z01 A;  3NDI A;  1WII A;  4RVF A;  2DE7 A;  1KD1 1;  3NH4 A;  3I55 1;  1ML8 A;  3HOU I;  3CCV Z;  4XX2 A;  3U50 C;  2W03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...