3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
1SFOI 5IP9I 4A3BI 4A3LI 4BXXI 3I4NI 4NBCA 3RZOI 2VUMI 2JS4A 4QTTA 4BXXX 3M4OI 3HOYI 1R9TI 3PO3S 2RBLA 3VMHA 2PK7A 4NBAA 1N2FA 4A3FI 4A3EI 2YU9I 4NBFA 3H3VJ 2LW4A 5C44I 3ESWA 3NDQA 2JA7I 1RLYA 3GTJI 3M3YI 3GTGI 2F4MA 1Y1VI 4A3CI 1ENWA 1USPA 5FLMI 1K83I 4A3DI 3S2HI 2J6AA 2JA8I 1Y1VS 3CQZI 2R92I 4A3MI 2AKLA 3U50C 2B63I 1TWFI 5C4JI 4NBHA 3GCFA 3GTLI 3K7AI 4NOZA 1ML8A 3LUSA 4NB8A 1I6HI 1TWCI 2DE5A 2NVQI 2JR6A 3S16I 2E2JI 2BJOA 2DE7A 4NBEA 3D6WA 3S17I 4BBSI 1LQLA 1ZB8A 4QTUA 3HOXI 3Q87A 1TFIA 3FKII 3I07A 3H0GI 3VMGA 4Y7NI 3GTPI 2HF1A 2JA5I 4A93I 1WCMI 1RO4A 2NVXI 4BY7I 3VMIA 4NBDA 4BY1I 2R7ZI 1WW9A 4BY7X 1QYPA 5C3EI 4X6AI 1VLAA 3I4MI 2DMEA 4BY1X 3EERA 4NBBA 3HOWI 3GTOI 4Y52I 3S1MI 1I50I 4A3II 4BBRI 2KPIA 3HOUI 1ZB9A 3RZDI 1YUAA 4NBGA 3PO2I 4A3JI 2E2II 2DE6A 4A3GI 4MH4A 2NVTI 4XX2A 3S1RI 3S2DI 1I3QI 4NB9A 5IP7I 1USPB 1TWAI 1X3WA 3GTMS 1X3ZA 1DL6A 3GKQA 3S14I 3GTKI 2E2HI 1TWHI 5CM2M 2JNYA 3S15I 2K5RA 3HOZI 5C4XI 3GTQI 1L1OC 1PFTA 2JA6I 3HOVI 1NUIA 2P3YA 2F4OA 4A3KI 3GTMI 1Y1WI 3S1QI 1TWGI 3VB9A 3PO3I 2NVYI 3S1NI 2R93I
chains in the Genus database with same CATH superfamily
1SFOI 1V29B 2I3CA 2DXCB 1URCB 3D9XA 4EOKB 3RGFB 4OB2B 2JIQA 1VQ8Z 1M902 3M4OI 1R9TI 3VMHA 2AYDA 2LIYA 3BLRB 4CFXB 2JUBA 1FKMA 5CYIB 4NBAA 1H1PB 2WPAB 2QR1B 5FLXf 1H1QB 3H3VJ 2CJMB 2LW4A 1M1K1 4FM4B 3GTJI 4G6LB 4OGRB 3VYGB 1RQFA 4E32A 3OW2Y 1RO0A 1C9BA 1JKWA 1AA6A 2KI7B 1IREB 4CFUB 1P9NA 1QF8A 2CZ1B 1VQ9Z 4HGZA 3DOGB 4MFDA 1X0TA 1YHQ1 1OL2B 1UGQB 1FDOA 3U50C 2W99A 2F2CA 2X1NB 2ZPHB 1PKDB 3B57A 3WVDB 2Y0SA 4NBHA 5D1OA 3BG3A 3D2LA 2KR6A 4E2YA 4NB8A 3CC4Z 4OB0B 2QQ8A 3QZ9B 1TWCI 2DE5A 1ZH1A 1H4LD 4I3ZB 2JR6A 2RHBA 1QLBA 3CCM1 1NJI2 1VQL1 2WXVB 3EOCB 3QYGB 2BKZB 3VYHB 4ELLA 3X20B 3OW2Z 2OTL1 2ZZDB 2VPYA 5HVYB 2B9RA 3G4S1 3QYHB 3MY5B 5BNJB 3CME1 4QTUA 3HOXI 3DL1A 2GU2A 5HBJB 5FLXb 4IMYB 4EOPB 1K8A1 2QGSA 3DDQB 4F7NB 3FKII 2QRCB 3I07A 3H0GI 4Y7NI 3GTPI 4MD7A 4A93I 2NVXI 2R7ZI 1H24B 3MIAB 2DMEA 3G71Z 2P28A 4CFWB 3EEDA 3S1MI 2QDYB 4EOJB 2O4HA 2UZLB 1YITZ 4BCPB 4NFRA 3CCV1 4A3GI 2NVTI 4RVDA 2OTJ1 1KXUA 5IP7I 2WFYB 2NAPA 2QA41 1TWAI 2JIOA 1X3WA 1YIJ1 2G77A 5HBHB 2OOYB 2WAQA 1E7PA 4JX5A 1OKVB 3KHIA 3A8OB 3I56Z 3QWUA 5CM2M 3CMA1 2IZ3A 1K8A2 2CZ0B 3KIFA 4Y72B 5A2Qb 2K5RA 2IV2X 4RODA 1GUXA 5D1PA 5C4XI 3MZLB 2R7GA 3X25B 1PFTA 3CCLZ 4F7LB 2JA6I 5DQVA 2P3YA 3BHTB 3TW7A 1K731 1VQP1 2F4OA 1YJW1 4A3KI 3S1QI 1WIIA 3BG1B 1AHJB 4A3BI 1M901 1S721 1OL1B 1VQ7Z 3RZOI 1VQNZ 3WVEB 4QTTA 2KMGA 3A8LB 4YOZA 2GTHA 4BCNB 4F6UB 1JSUB 4FX3B 2EUFA 4HNUA 1YI2Z 2RIQA 3CC2Z 1GH6B 4TNUA 1FINB 5HNBB 2JA7I 1BU2A 2JIRA 3BG5A 2JIMA 3KIHA 1JOWA 3GTGI 4YOOA 4ROCA 1Y1VI 2BS4A 4ROEA 1K732 3QHRB 5T64A 2W03A 4S1TA 4BCQB 4A3DI 3S2HI 2R6MA 3CCJ1 4CFNB 2CYZB 1Y1VS 4LOCA 1O9KA 2R92I 4A3MI 1W2BY 1YJ91 2AKLA 4TTHA 4JX6A 3T4NB 2DD5B 1Q16A 3GCFA 3CCU1 1NJI1 3GTLI 3HBLA 1ML8A 4HLQA 2NVQI 3CCQ1 3CC71 1Z02A 2OOXB 2QEX1 3BLQB 4KRCB 5FGKB 5ICPB 2BJOA 4NBEA 4MXUA 1YJN1 1VQ61 1SIWA 1OI9B 1W98B 3S17I 1Z01A 4AI6A 3BHUB 2W96A 3Q87A 3QWLA 3QHWB 5HBEB 4BCIB 3J80b 4CXAB 1W2BZ 3HZJA 3POMA 4YC3B 3I551 5EJCA 3VMIA 4NBDA 3VKGA 4BY1I 1WW9A 3I4MI 4BY1X 4RVFA 5D1OB 1UNHD 1K9M2 2VPZA 3GTOI 4Y52I 2ZPFB 3FQQA 1ZP2A 1Q812 4AKIA 1ZB9A 4RS4A 3PO2I 4A3JI 4ZGEB 4MH4A 4RVHA 4XX2A 1N4MA 3S1RI 3CPWY 5A2Qf 1KRLA 4F70B 1USPB 1KC82 3LQ5B 3GTMS 1WJ2A 2UUEB 1AISB 1YHQZ 1Q7Y2 4F7SB 3GTKI 4HL4A 4EONB 1G3NC 3S15I 3K7AM 3TE5B 4F7JB 3BLHB 2PK2A 4EOSB 4BCMB 1WZNA 3CD61 2WMAB 2DD4B 3IX0A 2OZKA 2QF7A 1VQLZ 3BHVB 5HQ0B 3CCMZ 4QSHA 3M03A 3HOVI 1NUIA 3CCS1 2OTLZ 2V8JA 2CZ6B 3CPWZ 3MONA 3G4SZ 3G6E1 4CFVB 1Y1WI 2PMIB 1S7MA 1TWGI 1QMZB 4BCGB 3JAMf 4HGYA 3CMEZ 3PO3I 2NVYI 5I5ZB 3S1NI 2R93I 2ZPEB 3A8MB 3DDPB 3TW6A 2V8KA 1Q822 4BXXI 2I53A 2W2HA 3NFZA 3HO8A 2WJ9A 4OB3B 2ZAEB 2JS4A 4NBCA 4BXXX 2QKDA 2LEXA 2VUMI 3PO3S 2RBLA 3IR7A 2K3RA 2RPRA 4A3FI 4BBRM 1H1RB 1VQO1 3MZKB 1N8R1 4NBFA 1VQKZ 5C44I 3ESWA 4F6WB 4F6SB 2DPPB 1RLYA 1OGUB 2Q4ZA 4MD8A 2C5VB 3QYEA 5T6BA 3TNIB 4E2WA 3CCVZ 2OTJZ 4A3CI 1VQ51 2O53A 2QA4Z 3P5JB 1ENWA 2G2KA 4EC9B 1QXFA 1YIJZ 1Q861 1K83I 2QREB 3BG9A 4HNTA 1RNIA 2J6AA 2LFUA 3CMAZ 1QVFY 4MFEA 3CCE1 3NDJA 2PHGA 3NH5A 3CXCY 1VQ41 2AHJB 4JX4A 4CFUD 4OR5B 4BCFB 1H27B 2B63I 1VOLA 3JAMb 2QRDB 1UGSB 4EOMB 3K7AI 4NOZA 2W9ZA 2BPMB 5IHYA 2Q51A 1VQPZ 3TDHB 1YJWZ 3J80f 3S16I 1VQM1 1N8R2 2E2JI 4E33A 5CEIB 2DE7A 3NH4A 5T67A 2RT9A 3CCR1 2CZ7B 2WB1A 4EWCA 1S72Z 5IDNB 4HH4A 3CCEZ 2VPWA 4HNVA 3IF8A 5DQWA 3F3FC 1QVFZ 3CXCZ 3QYBA 1Q862 2HF1A 3F5XB 2IVXA 1AD6A 1RO4A 1WCMI 1VQ81 2V3VA 4BCJB 1K9M1 5C3EI 4X6AI 1VLAA 4NSTB 1Q811 2WIPB 3EERA 4NBBA 4DK1A 5LL6f 3MI9B 4EC8B 3J7A4 4II5B 4BBRI 4BCKB 2ZPGB 1YUAA 1UGRB 2V45A 2ZPBB 1KQSY 1KC81 5LQFB 1XO2A 4NB9A 1OKWB 3NDIA 1Q7Y1 3CCJZ 3TNHB 4E30A 1TD6A 3S14I 2UZEB 1YJ9Z 2E2HI 2JNYA 1VQ91 3X28B 3HB9A 2C5XB 3CCUZ 4NC6A 4EOOB 4ELJA 3HOZI 3X26B 3VTNA 2CCIB 2WMBB 4M6VA 3CCQZ 4BCHB 3G33B 3CC7Z 2QEXZ 1QVGY 3IFUA 3CC41 1KD11 4KRDB 2C5OB 1VQK1 1E9HB 1KQSZ 2G9XB 2PMZA 4BBSM 2W04A 1YJNZ 3GTMI 1NP6A 1VQ6Z 3VB9A 4AKGA 4EOQB 2V22B 1Q821 2CCHB 1H28B 4CL1A 3J81b 1UGPB 4OB1B 1Z03A 4EOIB 2VF1A 4E31A 5IP9I 4A3LI 3I4NI 3A8GB 3I55Z 4DGLA 3HOYI 2PK7A 3A8HB 2M6NA 1N2FA 4A3EI 4BCND 2UZDB 2YU9I 3O0GD 3G711 1QVGZ 1D3UB 4DQYB 3NDQA 3M3YI 3F3PC 2ZPIB 2F4MA 2IN3A 2WHBB 1M1K2 1YIT1 2H85A 1Y8CA 2WIHB 1KD12 1USPA 5FLMI 4ZGJB 2C5NB 3HHTB 4BCQD 2JA8I 2M48A 1VYWB 2JMOA 3CQZI 3CD6Z 4BCOB 1FDIA 3I561 5AN9F 1OIUB 4MIMA 4CFMB 1TWFI 5C4JI 2V8IA 3BG0B 3EIDB 5L2WB 2E9HA 2YADA 1GUXB 3LUSA 1I6HI 3CCSZ 3CCL1 3G6EZ 2PJQA 2C4GB 1JJ2Y 4MONA 1TFBA 1H25B 3D6WA 3H4CA 4MRIA 1UNGD 5IT9f 4BBSI 1LQLA 1ZB8A 3MY1B 3VKHA 2ZCFB 1UNLD 5IF1B 1OIYB 4UN0A 1TFIA 4E2ZA 2BS3A 1RO2A 3VMGA 1YUKA 1VQ71 2JA5I 2W9FA 1VQN1 1JWHC 4EOLB 2DXBB 4EORB 4RVGA 4BY7I 2D0QB 1VQOZ 4ZGDB 2VPXA 3TN8B 4BY7X 1QYPA 3EJ1B 3NH8A 3DTOA 5ACBA 3QZ5B 1YI21 3HOWI 2I40B 2JIPA 5LMKB 2IW8B 1I50I 1P5EB 1VINA 2KPIA 3CC21 4A3II 3HOUI 3RZDI 4Z6YA 1JJ2Z 1VQ5Z 4NBGA 2IZ4A 2E2II 5IDPB 2DE6A 3S2DI 4MD9A 1I3QI 2BS2A 4RV9A 2GTIA 2QFZA 2E7ZA 2PK9B 4E2XA 1X3ZA 1DL6A 5EFQB 1VQ4Z 3GKQA 1JSTB 2IW6B 4YOSA 2UZBB 1FVVB 1TWHI 4CRLB 1O9KB 2QDJA 4AYBA 3DJBA 3QXEB 1GY3B 1F5QB 2PM9A 3HKZA 3J81f 5IT9b 4BCMD 2C6TB 1H26B 2JGZB 3GTQI 1L1OC 4NH1C 2EGTA 2VUGA 2HU9A 1VQMZ 4AKHA 2IW9B 3FQMA 2WEVB 3X24B 3CCRZ 3TNWB 1H1SB 2QLVB
chains in the Genus database with same CATH topology
1SFOI 2I3CA 3D9XA 1VQ8Z 1M902 3M4OI 1R9TI 3VMHA 2LIYA 2JUBA 4NBAA 2QR1B 5FLXf 3H3VJ 2LW4A 1M1K1 3GTJI 1RQFA 4E32A 3OW2Y 1RO0A 2KI7B 1QF8A 1P9NA 1VQ9Z 4HGZA 1YHQ1 1X0TA 3U50C 2Y0SA 4NBHA 5D1OA 4E2YA 4NB8A 3CC4Z 1VQKZ 1TWCI 2DE5A 1ZH1A 2RHBA 1VQL1 2JR6A 3CCM1 1NJI2 3OW2Z 2OTL1 3G4S1 3CME1 4QTUA 3HOXI 2GU2A 5FLXb 1K8A1 3FKII 2QRCB 3I07A 3H0GI 4Y7NI 3GTPI 4MD7A 4A93I 2NVXI 2R7ZI 3G71Z 2DMEA 2P28A 3EEDA 3S1MI 2O4HA 1YITZ 4NFRA 3CCV1 4A3GI 2NVTI 4RVDA 2OTJ1 5IP7I 2QA41 1TWAI 1X3WA 1YIJ1 2WAQA 2OOYB 3I56Z 3QWUA 5CM2M 3CMA1 2IZ3A 1K8A2 3KIFA 5A2Qb 2K5RA 5D1PA 5C4XI 3MZLB 3CCLZ 1PFTA 2JA6I 2P3YA 1K731 1VQP1 2F4OA 1YJW1 4A3KI 3S1QI 1WIIA 3BG1B 4A3BI 1M901 1S721 1VQ7Z 3RZOI 1VQNZ 4QTTA 2GTHA 1YI2Z 2RIQA 3CC2Z 4TNUA 2JA7I 3KIHA 3GTGI 1Y1VI 1K732 5T64A 2W03A 4S1TA 4A3DI 3S2HI 2R6MA 3CCJ1 1Y1VS 2R92I 4A3MI 1W2BY 1YJ91 2AKLA 3T4NB 3GCFA 3CCU1 1NJI1 3GTLI 1ML8A 2NVQI 3CCQ1 3CC71 1Z02A 2OOXB 2QEX1 2BJOA 4NBEA 4MXUA 1YJN1 1VQ61 3S17I 1Z01A 3Q87A 3J80b 1W2BZ 3I551 3VMIA 4NBDA 4BY1I 1WW9A 3I4MI 4BY1X 4RVFA 5D1OB 1K9M2 3GTOI 4Y52I 3FQQA 1Q812 1ZB9A 4RS4A 3PO2I 4A3JI 4MH4A 4RVHA 4XX2A 3S1RI 3CPWY 5A2Qf 1KRLA 1USPB 1KC82 3GTMS 1YHQZ 1Q7Y2 3GTKI 3S15I 3TE5B 3CD61 3IX0A 2OZKA 1VQLZ 3CCMZ 3HOVI 1NUIA 3CCS1 2OTLZ 2V8JA 3CPWZ 3MONA 3G4SZ 3G6E1 1Y1WI 1S7MA 1TWGI 3JAMf 4HGYA 3CMEZ 3PO3I 2NVYI 3S1NI 2R93I 2V8KA 1Q822 4BXXI 3NFZA 4NBCA 2ZAEB 2VUMI 2JS4A 4BXXX 2QKDA 3PO3S 2RBLA 2K3RA 2RPRA 4A3FI 1VQO1 3MZKB 1N8R1 4NBFA 5C44I 3ESWA 1RLYA 4MD8A 4E2WA 3CCVZ 2Q4ZA 5T6BA 2OTJZ 4A3CI 1VQ51 2O53A 2QA4Z 3P5JB 1ENWA 2G2KA 1YIJZ 1Q861 1K83I 2QREB 1RNIA 2J6AA 2LFUA 3CMAZ 1QVFY 3CCE1 3NDJA 1VQ41 3NH5A 3CXCY 2B63I 3JAMb 2QRDB 3K7AI 4NOZA 2Q51A 1VQPZ 3TDHB 1YJWZ 3J80f 3S16I 1VQM1 1N8R2 2E2JI 4E33A 2DE7A 3NH4A 5T67A 2RT9A 3CCR1 2WB1A 4EWCA 1S72Z 4HH4A 3CCEZ 1QVFZ 3IF8A 3F3FC 3CXCZ 1Q862 2HF1A 1WCMI 1RO4A 1VQ81 1K9M1 5C3EI 4X6AI 1VLAA 1Q811 3EERA 4NBBA 4DK1A 5LL6f 3J7A4 4BBRI 1YUAA 1KQSY 1KC81 4NB9A 3NDIA 1Q7Y1 3CCJZ 4E30A 3S14I 1YJ9Z 2E2HI 2JNYA 1VQ91 3CCUZ 3HOZI 3VTNA 3CCQZ 3CC7Z 2QEXZ 1QVGY 3IFUA 3CC41 1KD11 1VQK1 1KQSZ 2W04A 2PMZA 1YJNZ 3GTMI 1NP6A 1VQ6Z 3VB9A 1Q821 4CL1A 3J81b 1Z03A 4E31A 5IP9I 2VF1A 4A3LI 3I4NI 3I55Z 4DGLA 3HOYI 2PK7A 2M6NA 1N2FA 4A3EI 2YU9I 3G711 1QVGZ 4DQYB 3NDQA 3M3YI 3F3PC 2F4MA 1M1K2 1YIT1 2H85A 1KD12 1USPA 5FLMI 2JA8I 2M48A 2JMOA 3CQZI 3CD6Z 3I561 5AN9F 1TWFI 5C4JI 2V8IA 3BG0B 2E9HA 2YADA 3LUSA 1I6HI 3CCSZ 3CCL1 3G6EZ 1JJ2Y 4MONA 3D6WA 4MRIA 5IT9f 4BBSI 1LQLA 1ZB8A 1TFIA 4E2ZA 1RO2A 3VMGA 1YUKA 1VQ71 2JA5I 1VQN1 1JWHC 4BY7I 4RVGA 1VQOZ 4BY7X 1QYPA 3NH8A 1YI21 3HOWI 1I50I 4A3II 3CC21 2KPIA 3HOUI 3RZDI 1JJ2Z 1VQ5Z 4NBGA 2IZ4A 2E2II 2DE6A 3S2DI 4MD9A 1I3QI 4RV9A 2GTIA 4E2XA 1X3ZA 1DL6A 1VQ4Z 3GKQA 1TWHI 4AYBA 2PM9A 3HKZA 3J81f 5IT9b 3GTQI 1L1OC 4NH1C 2EGTA 2VUGA 2HU9A 1VQMZ 3FQMA 3CCRZ 2QLVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO I;  5IP9 I;  4A3B I;  4A3L I;  4BXX I;  3I4N I;  4NBC A;  3RZO I;  2VUM I;  2JS4 A;  4QTT A;  4BXX X;  3M4O I;  3HOY I;  1R9T I;  3PO3 S;  2RBL A;  3VMH A;  2PK7 A;  4NBA A;  1N2F A;  4A3F I;  4A3E I;  2YU9 I;  4NBF A;  3H3V J;  2LW4 A;  5C44 I;  3ESW A;  3NDQ A;  2JA7 I;  1RLY A;  3GTJ I;  3M3Y I;  3GTG I;  2F4M A;  1Y1V I;  4A3C I;  1ENW A;  1USP A;  5FLM I;  1K83 I;  4A3D I;  3S2H I;  2J6A A;  2JA8 I;  1Y1V S;  3CQZ I;  2R92 I;  4A3M I;  2AKL A;  3U50 C;  2B63 I;  1TWF I;  5C4J I;  4NBH A;  3GCF A;  3GTL I;  3K7A I;  4NOZ A;  1ML8 A;  3LUS A;  4NB8 A;  1I6H I;  1TWC I;  2DE5 A;  2NVQ I;  2JR6 A;  3S16 I;  2E2J I;  2BJO A;  2DE7 A;  4NBE A;  3D6W A;  3S17 I;  4BBS I;  1LQL A;  1ZB8 A;  4QTU A;  3HOX I;  3Q87 A;  1TFI A;  3FKI I;  3I07 A;  3H0G I;  3VMG A;  4Y7N I;  3GTP I;  2HF1 A;  2JA5 I;  4A93 I;  1WCM I;  1RO4 A;  2NVX I;  4BY7 I;  3VMI A;  4NBD A;  4BY1 I;  2R7Z I;  1WW9 A;  4BY7 X;  1QYP A;  5C3E I;  4X6A I;  1VLA A;  3I4M I;  2DME A;  4BY1 X;  3EER A;  4NBB A;  3HOW I;  3GTO I;  4Y52 I;  3S1M I;  1I50 I;  4A3I I;  4BBR I;  2KPI A;  3HOU I;  1ZB9 A;  3RZD I;  1YUA A;  4NBG A;  3PO2 I;  4A3J I;  2E2I I;  2DE6 A;  4A3G I;  4MH4 A;  2NVT I;  4XX2 A;  3S1R I;  3S2D I;  1I3Q I;  4NB9 A;  5IP7 I;  1USP B;  1TWA I;  1X3W A;  3GTM S;  1X3Z A;  1DL6 A;  3GKQ A;  3S14 I;  3GTK I;  2E2H I;  1TWH I;  5CM2 M;  2JNY A;  3S15 I;  2K5R A;  3HOZ I;  5C4X I;  3GTQ I;  1L1O C;  1PFT A;  2JA6 I;  3HOV I;  1NUI A;  2P3Y A;  2F4O A;  4A3K I;  3GTM I;  1Y1W I;  3S1Q I;  1TWG I;  3VB9 A;  3PO3 I;  2NVY I;  3S1N I;  2R93 I; 
#chains in the Genus database with same CATH topology
 1SFO I;  1V29 B;  2I3C A;  2DXC B;  1URC B;  3D9X A;  4EOK B;  3RGF B;  4OB2 B;  2JIQ A;  1VQ8 Z;  1M90 2;  3M4O I;  1R9T I;  3VMH A;  2AYD A;  2LIY A;  3BLR B;  4CFX B;  2JUB A;  1FKM A;  5CYI B;  4NBA A;  1H1P B;  2WPA B;  2QR1 B;  5FLX f;  1H1Q B;  3H3V J;  2CJM B;  2LW4 A;  1M1K 1;  4FM4 B;  3GTJ I;  4G6L B;  4OGR B;  3VYG B;  1RQF A;  4E32 A;  3OW2 Y;  1RO0 A;  1C9B A;  1JKW A;  1AA6 A;  2KI7 B;  1IRE B;  4CFU B;  1P9N A;  1QF8 A;  2CZ1 B;  1VQ9 Z;  4HGZ A;  3DOG B;  4MFD A;  1X0T A;  1YHQ 1;  1OL2 B;  1UGQ B;  1FDO A;  3U50 C;  2W99 A;  2F2C A;  2X1N B;  2ZPH B;  1PKD B;  3B57 A;  3WVD B;  2Y0S A;  4NBH A;  5D1O A;  3BG3 A;  3D2L A;  2KR6 A;  4E2Y A;  4NB8 A;  3CC4 Z;  4OB0 B;  2QQ8 A;  3QZ9 B;  1TWC I;  2DE5 A;  1ZH1 A;  1H4L D;  4I3Z B;  2JR6 A;  2RHB A;  1QLB A;  3CCM 1;  1NJI 2;  1VQL 1;  2WXV B;  3EOC B;  3QYG B;  2BKZ B;  3VYH B;  4ELL A;  3X20 B;  3OW2 Z;  2OTL 1;  2ZZD B;  2VPY A;  5HVY B;  2B9R A;  3G4S 1;  3QYH B;  3MY5 B;  5BNJ B;  3CME 1;  4QTU A;  3HOX I;  3DL1 A;  2GU2 A;  5HBJ B;  5FLX b;  4IMY B;  4EOP B;  1K8A 1;  2QGS A;  3DDQ B;  4F7N B;  3FKI I;  2QRC B;  3I07 A;  3H0G I;  4Y7N I;  3GTP I;  4MD7 A;  4A93 I;  2NVX I;  2R7Z I;  1H24 B;  3MIA B;  2DME A;  3G71 Z;  2P28 A;  4CFW B;  3EED A;  3S1M I;  2QDY B;  4EOJ B;  2O4H A;  2UZL B;  1YIT Z;  4BCP B;  4NFR A;  3CCV 1;  4A3G I;  2NVT I;  4RVD A;  2OTJ 1;  1KXU A;  5IP7 I;  2WFY B;  2NAP A;  2QA4 1;  1TWA I;  2JIO A;  1X3W A;  1YIJ 1;  2G77 A;  5HBH B;  2OOY B;  2WAQ A;  1E7P A;  4JX5 A;  1OKV B;  3KHI A;  3A8O B;  3I56 Z;  3QWU A;  5CM2 M;  3CMA 1;  2IZ3 A;  1K8A 2;  2CZ0 B;  3KIF A;  4Y72 B;  5A2Q b;  2K5R A;  2IV2 X;  4ROD A;  1GUX A;  5D1P A;  5C4X I;  3MZL B;  2R7G A;  3X25 B;  1PFT A;  3CCL Z;  4F7L B;  2JA6 I;  5DQV A;  2P3Y A;  3BHT B;  3TW7 A;  1K73 1;  1VQP 1;  2F4O A;  1YJW 1;  4A3K I;  3S1Q I;  1WII A;  3BG1 B;  1AHJ B;  4A3B I;  1M90 1;  1S72 1;  1OL1 B;  1VQ7 Z;  3RZO I;  1VQN Z;  3WVE B;  4QTT A;  2KMG A;  3A8L B;  4YOZ A;  2GTH A;  4BCN B;  4F6U B;  1JSU B;  4FX3 B;  2EUF A;  4HNU A;  1YI2 Z;  2RIQ A;  3CC2 Z;  1GH6 B;  4TNU A;  1FIN B;  5HNB B;  2JA7 I;  1BU2 A;  2JIR A;  3BG5 A;  2JIM A;  3KIH A;  1JOW A;  3GTG I;  4YOO A;  4ROC A;  1Y1V I;  2BS4 A;  4ROE A;  1K73 2;  3QHR B;  5T64 A;  2W03 A;  4S1T A;  4BCQ B;  4A3D I;  3S2H I;  2R6M A;  3CCJ 1;  4CFN B;  2CYZ B;  1Y1V S;  4LOC A;  1O9K A;  2R92 I;  4A3M I;  1W2B Y;  1YJ9 1;  2AKL A;  4TTH A;  4JX6 A;  3T4N B;  2DD5 B;  1Q16 A;  3GCF A;  3CCU 1;  1NJI 1;  3GTL I;  3HBL A;  1ML8 A;  4HLQ A;  2NVQ I;  3CCQ 1;  3CC7 1;  1Z02 A;  2OOX B;  2QEX 1;  3BLQ B;  4KRC B;  5FGK B;  5ICP B;  2BJO A;  4NBE A;  4MXU A;  1YJN 1;  1VQ6 1;  1SIW A;  1OI9 B;  1W98 B;  3S17 I;  1Z01 A;  4AI6 A;  3BHU B;  2W96 A;  3Q87 A;  3QWL A;  3QHW B;  5HBE B;  4BCI B;  3J80 b;  4CXA B;  1W2B Z;  3HZJ A;  3POM A;  4YC3 B;  3I55 1;  5EJC A;  3VMI A;  4NBD A;  3VKG A;  4BY1 I;  1WW9 A;  3I4M I;  4BY1 X;  4RVF A;  5D1O B;  1UNH D;  1K9M 2;  2VPZ A;  3GTO I;  4Y52 I;  2ZPF B;  3FQQ A;  1ZP2 A;  1Q81 2;  4AKI A;  1ZB9 A;  4RS4 A;  3PO2 I;  4A3J I;  4ZGE B;  4MH4 A;  4RVH A;  4XX2 A;  1N4M A;  3S1R I;  3CPW Y;  5A2Q f;  1KRL A;  4F70 B;  1USP B;  1KC8 2;  3LQ5 B;  3GTM S;  1WJ2 A;  2UUE B;  1AIS B;  1YHQ Z;  1Q7Y 2;  4F7S B;  3GTK I;  4HL4 A;  4EON B;  1G3N C;  3S15 I;  3K7A M;  3TE5 B;  4F7J B;  3BLH B;  2PK2 A;  4EOS B;  4BCM B;  1WZN A;  3CD6 1;  2WMA B;  2DD4 B;  3IX0 A;  2OZK A;  2QF7 A;  1VQL Z;  3BHV B;  5HQ0 B;  3CCM Z;  4QSH A;  3M03 A;  3HOV I;  1NUI A;  3CCS 1;  2OTL Z;  2V8J A;  2CZ6 B;  3CPW Z;  3MON A;  3G4S Z;  3G6E 1;  4CFV B;  1Y1W I;  2PMI B;  1S7M A;  1TWG I;  1QMZ B;  4BCG B;  3JAM f;  4HGY A;  3CME Z;  3PO3 I;  2NVY I;  5I5Z B;  3S1N I;  2R93 I;  2ZPE B;  3A8M B;  3DDP B;  3TW6 A;  2V8K A;  1Q82 2;  4BXX I;  2I53 A;  2W2H A;  3NFZ A;  3HO8 A;  2WJ9 A;  4OB3 B;  2ZAE B;  2JS4 A;  4NBC A;  4BXX X;  2QKD A;  2LEX A;  2VUM I;  3PO3 S;  2RBL A;  3IR7 A;  2K3R A;  2RPR A;  4A3F I;  4BBR M;  1H1R B;  1VQO 1;  3MZK B;  1N8R 1;  4NBF A;  1VQK Z;  5C44 I;  3ESW A;  4F6W B;  4F6S B;  2DPP B;  1RLY A;  1OGU B;  2Q4Z A;  4MD8 A;  2C5V B;  3QYE A;  5T6B A;  3TNI B;  4E2W A;  3CCV Z;  2OTJ Z;  4A3C I;  1VQ5 1;  2O53 A;  2QA4 Z;  3P5J B;  1ENW A;  2G2K A;  4EC9 B;  1QXF A;  1YIJ Z;  1Q86 1;  1K83 I;  2QRE B;  3BG9 A;  4HNT A;  1RNI A;  2J6A A;  2LFU A;  3CMA Z;  1QVF Y;  4MFE A;  3CCE 1;  3NDJ A;  2PHG A;  3NH5 A;  3CXC Y;  1VQ4 1;  2AHJ B;  4JX4 A;  4CFU D;  4OR5 B;  4BCF B;  1H27 B;  2B63 I;  1VOL A;  3JAM b;  2QRD B;  1UGS B;  4EOM B;  3K7A I;  4NOZ A;  2W9Z A;  2BPM B;  5IHY A;  2Q51 A;  1VQP Z;  3TDH B;  1YJW Z;  3J80 f;  3S16 I;  1VQM 1;  1N8R 2;  2E2J I;  4E33 A;  5CEI B;  2DE7 A;  3NH4 A;  5T67 A;  2RT9 A;  3CCR 1;  2CZ7 B;  2WB1 A;  4EWC A;  1S72 Z;  5IDN B;  4HH4 A;  3CCE Z;  2VPW A;  4HNV A;  3IF8 A;  5DQW A;  3F3F C;  1QVF Z;  3CXC Z;  3QYB A;  1Q86 2;  2HF1 A;  3F5X B;  2IVX A;  1AD6 A;  1RO4 A;  1WCM I;  1VQ8 1;  2V3V A;  4BCJ B;  1K9M 1;  5C3E I;  4X6A I;  1VLA A;  4NST B;  1Q81 1;  2WIP B;  3EER A;  4NBB A;  4DK1 A;  5LL6 f;  3MI9 B;  4EC8 B;  3J7A 4;  4II5 B;  4BBR I;  4BCK B;  2ZPG B;  1YUA A;  1UGR B;  2V45 A;  2ZPB B;  1KQS Y;  1KC8 1;  5LQF B;  1XO2 A;  4NB9 A;  1OKW B;  3NDI A;  1Q7Y 1;  3CCJ Z;  3TNH B;  4E30 A;  1TD6 A;  3S14 I;  2UZE B;  1YJ9 Z;  2E2H I;  2JNY A;  1VQ9 1;  3X28 B;  3HB9 A;  2C5X B;  3CCU Z;  4NC6 A;  4EOO B;  4ELJ A;  3HOZ I;  3X26 B;  3VTN A;  2CCI B;  2WMB B;  4M6V A;  3CCQ Z;  4BCH B;  3G33 B;  3CC7 Z;  2QEX Z;  1QVG Y;  3IFU A;  3CC4 1;  1KD1 1;  4KRD B;  2C5O B;  1VQK 1;  1E9H B;  1KQS Z;  2G9X B;  2PMZ A;  4BBS M;  2W04 A;  1YJN Z;  3GTM I;  1NP6 A;  1VQ6 Z;  3VB9 A;  4AKG A;  4EOQ B;  2V22 B;  1Q82 1;  2CCH B;  1H28 B;  4CL1 A;  3J81 b;  1UGP B;  4OB1 B;  1Z03 A;  4EOI B;  2VF1 A;  4E31 A;  5IP9 I;  4A3L I;  3I4N I;  3A8G B;  3I55 Z;  4DGL A;  3HOY I;  2PK7 A;  3A8H B;  2M6N A;  1N2F A;  4A3E I;  4BCN D;  2UZD B;  2YU9 I;  3O0G D;  3G71 1;  1QVG Z;  1D3U B;  4DQY B;  3NDQ A;  3M3Y I;  3F3P C;  2ZPI B;  2F4M A;  2IN3 A;  2WHB B;  1M1K 2;  1YIT 1;  2H85 A;  1Y8C A;  2WIH B;  1KD1 2;  1USP A;  5FLM I;  4ZGJ B;  2C5N B;  3HHT B;  4BCQ D;  2JA8 I;  2M48 A;  1VYW B;  2JMO A;  3CQZ I;  3CD6 Z;  4BCO B;  1FDI A;  3I56 1;  5AN9 F;  1OIU B;  4MIM A;  4CFM B;  1TWF I;  5C4J I;  2V8I A;  3BG0 B;  3EID B;  5L2W B;  2E9H A;  2YAD A;  1GUX B;  3LUS A;  1I6H I;  3CCS Z;  3CCL 1;  3G6E Z;  2PJQ A;  2C4G B;  1JJ2 Y;  4MON A;  1TFB A;  1H25 B;  3D6W A;  3H4C A;  4MRI A;  1UNG D;  5IT9 f;  4BBS I;  1LQL A;  1ZB8 A;  3MY1 B;  3VKH A;  2ZCF B;  1UNL D;  5IF1 B;  1OIY B;  4UN0 A;  1TFI A;  4E2Z A;  2BS3 A;  1RO2 A;  3VMG A;  1YUK A;  1VQ7 1;  2JA5 I;  2W9F A;  1VQN 1;  1JWH C;  4EOL B;  2DXB B;  4EOR B;  4RVG A;  4BY7 I;  2D0Q B;  1VQO Z;  4ZGD B;  2VPX A;  3TN8 B;  4BY7 X;  1QYP A;  3EJ1 B;  3NH8 A;  3DTO A;  5ACB A;  3QZ5 B;  1YI2 1;  3HOW I;  2I40 B;  2JIP A;  5LMK B;  2IW8 B;  1I50 I;  1P5E B;  1VIN A;  2KPI A;  3CC2 1;  4A3I I;  3HOU I;  3RZD I;  4Z6Y A;  1JJ2 Z;  1VQ5 Z;  4NBG A;  2IZ4 A;  2E2I I;  5IDP B;  2DE6 A;  3S2D I;  4MD9 A;  1I3Q I;  2BS2 A;  4RV9 A;  2GTI A;  2QFZ A;  2E7Z A;  2PK9 B;  4E2X A;  1X3Z A;  1DL6 A;  5EFQ B;  1VQ4 Z;  3GKQ A;  1JST B;  2IW6 B;  4YOS A;  2UZB B;  1FVV B;  1TWH I;  4CRL B;  1O9K B;  2QDJ A;  4AYB A;  3DJB A;  3QXE B;  1GY3 B;  1F5Q B;  2PM9 A;  3HKZ A;  3J81 f;  5IT9 b;  4BCM D;  2C6T B;  1H26 B;  2JGZ B;  3GTQ I;  1L1O C;  4NH1 C;  2EGT A;  2VUG A;  2HU9 A;  1VQM Z;  4AKH A;  2IW9 B;  3FQM A;  2WEV B;  3X24 B;  3CCR Z;  3TNW B;  1H1S B;  2QLV B; 
#chains in the Genus database with same CATH homology
 1SFO I;  2I3C A;  3D9X A;  1VQ8 Z;  1M90 2;  3M4O I;  1R9T I;  3VMH A;  2LIY A;  2JUB A;  4NBA A;  2QR1 B;  5FLX f;  3H3V J;  2LW4 A;  1M1K 1;  3GTJ I;  1RQF A;  4E32 A;  3OW2 Y;  1RO0 A;  2KI7 B;  1QF8 A;  1P9N A;  1VQ9 Z;  4HGZ A;  1YHQ 1;  1X0T A;  3U50 C;  2Y0S A;  4NBH A;  5D1O A;  4E2Y A;  4NB8 A;  3CC4 Z;  1VQK Z;  1TWC I;  2DE5 A;  1ZH1 A;  2RHB A;  1VQL 1;  2JR6 A;  3CCM 1;  1NJI 2;  3OW2 Z;  2OTL 1;  3G4S 1;  3CME 1;  4QTU A;  3HOX I;  2GU2 A;  5FLX b;  1K8A 1;  3FKI I;  2QRC B;  3I07 A;  3H0G I;  4Y7N I;  3GTP I;  4MD7 A;  4A93 I;  2NVX I;  2R7Z I;  3G71 Z;  2DME A;  2P28 A;  3EED A;  3S1M I;  2O4H A;  1YIT Z;  4NFR A;  3CCV 1;  4A3G I;  2NVT I;  4RVD A;  2OTJ 1;  5IP7 I;  2QA4 1;  1TWA I;  1X3W A;  1YIJ 1;  2WAQ A;  2OOY B;  3I56 Z;  3QWU A;  5CM2 M;  3CMA 1;  2IZ3 A;  1K8A 2;  3KIF A;  5A2Q b;  2K5R A;  5D1P A;  5C4X I;  3MZL B;  3CCL Z;  1PFT A;  2JA6 I;  2P3Y A;  1K73 1;  1VQP 1;  2F4O A;  1YJW 1;  4A3K I;  3S1Q I;  1WII A;  3BG1 B;  4A3B I;  1M90 1;  1S72 1;  1VQ7 Z;  3RZO I;  1VQN Z;  4QTT A;  2GTH A;  1YI2 Z;  2RIQ A;  3CC2 Z;  4TNU A;  2JA7 I;  3KIH A;  3GTG I;  1Y1V I;  1K73 2;  5T64 A;  2W03 A;  4S1T A;  4A3D I;  3S2H I;  2R6M A;  3CCJ 1;  1Y1V S;  2R92 I;  4A3M I;  1W2B Y;  1YJ9 1;  2AKL A;  3T4N B;  3GCF A;  3CCU 1;  1NJI 1;  3GTL I;  1ML8 A;  2NVQ I;  3CCQ 1;  3CC7 1;  1Z02 A;  2OOX B;  2QEX 1;  2BJO A;  4NBE A;  4MXU A;  1YJN 1;  1VQ6 1;  3S17 I;  1Z01 A;  3Q87 A;  3J80 b;  1W2B Z;  3I55 1;  3VMI A;  4NBD A;  4BY1 I;  1WW9 A;  3I4M I;  4BY1 X;  4RVF A;  5D1O B;  1K9M 2;  3GTO I;  4Y52 I;  3FQQ A;  1Q81 2;  1ZB9 A;  4RS4 A;  3PO2 I;  4A3J I;  4MH4 A;  4RVH A;  4XX2 A;  3S1R I;  3CPW Y;  5A2Q f;  1KRL A;  1USP B;  1KC8 2;  3GTM S;  1YHQ Z;  1Q7Y 2;  3GTK I;  3S15 I;  3TE5 B;  3CD6 1;  3IX0 A;  2OZK A;  1VQL Z;  3CCM Z;  3HOV I;  1NUI A;  3CCS 1;  2OTL Z;  2V8J A;  3CPW Z;  3MON A;  3G4S Z;  3G6E 1;  1Y1W I;  1S7M A;  1TWG I;  3JAM f;  4HGY A;  3CME Z;  3PO3 I;  2NVY I;  3S1N I;  2R93 I;  2V8K A;  1Q82 2;  4BXX I;  3NFZ A;  4NBC A;  2ZAE B;  2VUM I;  2JS4 A;  4BXX X;  2QKD A;  3PO3 S;  2RBL A;  2K3R A;  2RPR A;  4A3F I;  1VQO 1;  3MZK B;  1N8R 1;  4NBF A;  5C44 I;  3ESW A;  1RLY A;  4MD8 A;  4E2W A;  3CCV Z;  2Q4Z A;  5T6B A;  2OTJ Z;  4A3C I;  1VQ5 1;  2O53 A;  2QA4 Z;  3P5J B;  1ENW A;  2G2K A;  1YIJ Z;  1Q86 1;  1K83 I;  2QRE B;  1RNI A;  2J6A A;  2LFU A;  3CMA Z;  1QVF Y;  3CCE 1;  3NDJ A;  1VQ4 1;  3NH5 A;  3CXC Y;  2B63 I;  3JAM b;  2QRD B;  3K7A I;  4NOZ A;  2Q51 A;  1VQP Z;  3TDH B;  1YJW Z;  3J80 f;  3S16 I;  1VQM 1;  1N8R 2;  2E2J I;  4E33 A;  2DE7 A;  3NH4 A;  5T67 A;  2RT9 A;  3CCR 1;  2WB1 A;  4EWC A;  1S72 Z;  4HH4 A;  3CCE Z;  1QVF Z;  3IF8 A;  3F3F C;  3CXC Z;  1Q86 2;  2HF1 A;  1WCM I;  1RO4 A;  1VQ8 1;  1K9M 1;  5C3E I;  4X6A I;  1VLA A;  1Q81 1;  3EER A;  4NBB A;  4DK1 A;  5LL6 f;  3J7A 4;  4BBR I;  1YUA A;  1KQS Y;  1KC8 1;  4NB9 A;  3NDI A;  1Q7Y 1;  3CCJ Z;  4E30 A;  3S14 I;  1YJ9 Z;  2E2H I;  2JNY A;  1VQ9 1;  3CCU Z;  3HOZ I;  3VTN A;  3CCQ Z;  3CC7 Z;  2QEX Z;  1QVG Y;  3IFU A;  3CC4 1;  1KD1 1;  1VQK 1;  1KQS Z;  2W04 A;  2PMZ A;  1YJN Z;  3GTM I;  1NP6 A;  1VQ6 Z;  3VB9 A;  1Q82 1;  4CL1 A;  3J81 b;  1Z03 A;  4E31 A;  5IP9 I;  2VF1 A;  4A3L I;  3I4N I;  3I55 Z;  4DGL A;  3HOY I;  2PK7 A;  2M6N A;  1N2F A;  4A3E I;  2YU9 I;  3G71 1;  1QVG Z;  4DQY B;  3NDQ A;  3M3Y I;  3F3P C;  2F4M A;  1M1K 2;  1YIT 1;  2H85 A;  1KD1 2;  1USP A;  5FLM I;  2JA8 I;  2M48 A;  2JMO A;  3CQZ I;  3CD6 Z;  3I56 1;  5AN9 F;  1TWF I;  5C4J I;  2V8I A;  3BG0 B;  2E9H A;  2YAD A;  3LUS A;  1I6H I;  3CCS Z;  3CCL 1;  3G6E Z;  1JJ2 Y;  4MON A;  3D6W A;  4MRI A;  5IT9 f;  4BBS I;  1LQL A;  1ZB8 A;  1TFI A;  4E2Z A;  1RO2 A;  3VMG A;  1YUK A;  1VQ7 1;  2JA5 I;  1VQN 1;  1JWH C;  4BY7 I;  4RVG A;  1VQO Z;  4BY7 X;  1QYP A;  3NH8 A;  1YI2 1;  3HOW I;  1I50 I;  4A3I I;  3CC2 1;  2KPI A;  3HOU I;  3RZD I;  1JJ2 Z;  1VQ5 Z;  4NBG A;  2IZ4 A;  2E2I I;  2DE6 A;  3S2D I;  4MD9 A;  1I3Q I;  4RV9 A;  2GTI A;  4E2X A;  1X3Z A;  1DL6 A;  1VQ4 Z;  3GKQ A;  1TWH I;  4AYB A;  2PM9 A;  3HKZ A;  3J81 f;  5IT9 b;  3GTQ I;  1L1O C;  4NH1 C;  2EGT A;  2VUG A;  2HU9 A;  1VQM Z;  3FQM A;  3CCR Z;  2QLV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...