3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
b'HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
3VMIA 3S15I 4A3DI 3H0GI 2J6AA 3FKII 4BBRI 5CM2M 2DE6A 3I07A 3D6WA 3HOWI 4A3CI 2F4MA 4NB9A 4XX2A 1TWFI 5FLMI 4A3GI 1RO4A 2DE5A 4QTUA 3GTQI 4NBFA 2NVXI 3PO2I 1TWGI 2JA7I 3VMHA 1ML8A 3PO3S 4A3JI 4A93I 4BY1X 1Y1VS 4Y7NI 3ESWA 4BXXI 1ENWA 4BY7X 2AKLA 4NOZA 1VLAA 2JA8I 3GTKI 5C44I 1N2FA 1USPA 1LQLA 2VUMI 1X3ZA 4NBCA 3GTPI 2JR6A 2NVQI 3Q87A 4A3EI 2B63I 3CQZI 3GTJI 4A3FI 2K5RA 3M3YI 1TWCI 2NVTI 4QTTA 3GTMI 3U50C 4X6AI 1RLYA 3M4OI 1I50I 4NB8A 1QYPA 3HOVI 3VMGA 4A3LI 2DE7A 2P3YA 2LW4A 2BJOA 3S14I 1R9TI 1WCMI 3HOYI 4MH4A 1K83I 1I3QI 2NVYI 5C4XI 3S1QI 1Y1VI 2PK7A 3I4NI 3EERA 1TWAI 5C4JI 1DL6A 2JS4A 3S1NI 2JNYA 3S2DI 4BBSI 5IP9I 3RZDI 2R92I 3GTLI 3S2HI 3HOZI 1WW9A 1Y1WI 4BXXX 1X3WA 2E2II 1NUIA 4A3BI 4A3MI 2YU9I 1PFTA 3NDQA 4A3KI 2E2JI 4BY1I 3I4MI 1USPB 3S16I 3GTGI 4Y52I 1ZB9A 1TWHI 1ZB8A 4NBBA 4BY7I 2RBLA 3GKQA 3HOUI 3LUSA 1L1OC 3GTMS 3PO3I 1I6HI 2F4OA 5C3EI 1TFIA 2KPIA 2JA5I 4NBEA 2JA6I 4A3II 3VB9A 2HF1A 3GCFA 3S1RI 2R7ZI 5IP7I 3RZOI 3H3VJ 4NBHA 1SFOI 3GTOI 2DMEA 3S17I 3K7AI 3S1MI 1YUAA 3HOXI 4NBAA 2E2HI 2R93I 4NBGA 4NBDA
chains in the Genus database with same CATH superfamily
4YOOA 4EOIB 3S15I 4A3DI 4TTHA 1O9KB 1M901 4BCMB 2DE6A 2JIPA 1QLBA 3HOWI 3CC41 1YJWZ 1YUKA 1VQLZ 1H26B 3TW6A 1VQ8Z 5I5ZB 2WIPB 2DE5A 2R6MA 1Q821 4F7NB 1PKDB 2Y0SA 4NH1C 2NVXI 5HNBB 1S7MA 2LIYA 4BCQB 1RO0A 2E9HA 2ZPGB 3A8LB 4CFUD 1K9M2 1VQP1 3EOCB 1VLAA 4HL4A 1C9BA 3G4SZ 3H4CA 2GTHA 4RVDA 5HVYB 3BLHB 1LQLA 2PMZA 3CCS1 1KC82 2VUMI 2OTJ1 4BCJB 1FINB 2NVQI 1YI2Z 2B63I 1K8A2 3CQZI 2I53A 2QFZA 2G2KA 1YHQ1 1URCB 2C5NB 3IX0A 3F3PC 2EGTA 4EOOB 1VYWB 2QF7A 1ZP2A 3QHWB 4HLQA 4CFVB 4HNUA 3A8OB 2ZAEB 5D1OA 3EEDA 1YJ9Z 1E7PA 3CMEZ 4MD7A 3GTMI 3U50C 1RLYA 4KRDB 4NB8A 3HOVI 3BG9A 2DE7A 4CFWB 4F7LB 3NFZA 1QVFZ 3F3FC 1NJI1 2WFYB 2IW8B 1R9TI 4G6LB 3TE5B 1YITZ 3X26B 4AKIA 1WZNA 2V8IA 2KMGA 2B9RA 4ZGJB 1E9HB 2AHJB 3CCV1 2JUBA 3BHUB 3S1NI 5LMKB 2JNYA 3S2DI 5HBJB 4QSHA 1WIIA 1VQ41 3RZDI 4NSTB 4CFNB 3CCUZ 4BBSI 3TN8B 2C5OB 3VYHB 2UZEB 2QR1B 1TD6A 3S2HI 4RS4A 4YC3B 2WIHB 1QF8A 1KD11 1WW9A 1VQKZ 4F6UB 1X3WA 4BCMD 1P5EB 1W98B 1V29B 1N4MA 2CCIB 4YOZA 1M902 1VQM1 1VQ7Z 1USPB 2NAPA 3CMAZ 1ZB9A 1VQ6Z 2QA41 3CC7Z 2RBLA 2GU2A 3DJBA 5IF1B 1Q822 2CYZB 4II5B 4BCQD 4OR5B 1I6HI 2W9ZA 4IMYB 3CC21 4EOSB 3TW7A 2JIRA 4NBEA 3FQMA 2JA6I 2JGZB 3I56Z 3DOGB 2DXBB 3G711 2R7ZI 4MONA 5LQFB 2OTLZ 5IHYA 2ZCFB 1UGQB 2DMEA 3S17I 4EC8B 3K7AI 3S1MI 1Q7Y1 4NBAA 2ZPEB 3HKZA 3JAMb 2R93I 3LQ5B 3H0GI 2BS3A 5A2Qf 2IV2X 3VYGB 4EORB 4E2ZA 5DQWA 1VOLA 5T67A 3QXEB 2AYDA 1Q811 3MIAB 4M6VA 1YJW1 1VQL1 4NC6A 3BHVB 2JIMA 4A3GI 1QVGZ 2LFUA 2K3RA 4NBFA 1M1K2 3EIDB 3MZLB 1TWGI 4BCND 4E2YA 2IZ4A 3PO3S 1H25B 1UNLD 1NJI2 4A3JI 2QRDB 5FLXf 2ZZDB 4Y7NI 2PMIB 4ZGDB 2WB1A 3CCQZ 4NOZA 1K731 1WJ2A 4MD8A 2JA8I 3G4S1 3B57A 3A8GB 1X3ZA 3OW2Y 1Z02A 1FKMA 3KIFA 5FLXb 3POMA 4OB3B 3Q87A 5HBHB 1YI21 3BHTB 2DXCB 1W2BZ 1KD12 2RHBA 1AISB 3OW2Z 1F5QB 1TWCI 2WEVB 4ELLA 1VQ9Z 1QMZB 4EOJB 1YJ91 5EFQB 3BG5A 3CME1 2C5VB 3CPWZ 3X20B 3IR7A 3J80b 4EOQB 1AHJB 3T4NB 2RIQA 2P3YA 2LW4A 3HO8A 5CYIB 3QHRB 4MH4A 1I3QI 5C4XI 4BCOB 1YIT1 1Z01A 1BU2A 3MZKB 1O9KA 2IW6B 1OL1B 2JS4A 1AA6A 3QYGB 1FDIA 3P5JB 1JSUB 2WHBB 4E30A 5BNJB 5ACBA 3CCU1 3GTLI 2DPPB 2BKZB 4BCFB 3HB9A 3HOZI 1VQK1 2E2II 1VINA 1QVFY 1QXFA 3CCEZ 2DD5B 1NUIA 2H85A 3CCRZ 3IF8A 5EJCA 2R7GA 3A8HB 2YU9I 1N8R2 1VQ71 4BY1I 1Q812 4MFDA 1YIJZ 3CMA1 2JMOA 3DL1A 1ZB8A 1VQ61 4NBBA 4RVHA 3CC71 4BY7I 3HOUI 5FGKB 4BCNB 1YJNZ 2JIQA 4ROEA 1H1PB 2PHGA 2DD4B 4UN0A 1KQSZ 4CXAB 3I561 5IT9f 4JX4A 2M48A 3X24B 4AKHA 1XO2A 1Y8CA 4MRIA 4EOKB 3CXCZ 3S1RI 1K732 3HHTB 3X25B 2OZKA 4ELJA 3QZ5B 4E2XA 3VTNA 2OTL1 3I55Z 3RZOI 2V8KA 3H3VJ 4EONB 4RVGA 4LOCA 2BPMB 2VPXA 1H27B 4S1TA 1RO2A 2BS4A 1H4LD 3NDIA 5IT9b 2D0QB 4BCKB 4NBGA 5AN9F 3BG0B 1D3UB 3VMIA 4AKGA 2W9FA 4OB0B 3KIHA 2J6AA 3FKII 4BBRI 1FVVB 2W96A 1JKWA 1GUXB 2YADA 1Q861 4BBSM 2O4HA 4I3ZB 4A3CI 5FLMI 4XX2A 1TWFI 2OOXB 1RO4A 1Q16A 3JAMf 3GTQI 4ROCA 2QEXZ 3PO2I 2W99A 1ML8A 4DGLA 3DDPB 4E31A 1VQ5Z 2Q51A 3QWLA 4BY1X 4JX5A 2WMBB 5HBEB 4BXXI 3CCQ1 1VQNZ 4BY7X 2AKLA 3NH8A 3CD6Z 2LEXA 3BLQB 1N2FA 1OIYB 1USPA 3QYBA 1K9M1 3FQQA 2IZ3A 1NP6A 1QVGY 3CCJZ 4F70B 4EOPB 2QKDA 4MD9A 5HQ0B 1VQ81 1VQ91 2RT9A 5LL6f 3BLRB 2EUFA 4QTTA 4BCHB 3K7AM 4E33A 2V22B 2G9XB 4BCGB 3M4OI 1QYPA 4F6SB 4HH4A 4HNVA 5L2WB 1Z03A 2QDYB 3TNWB 1VQOZ 1W2BY 1K83I 2KR6A 1OIUB 3RGFB 2NVYI 3QZ9B 3S1QI 3HZJA 4RV9A 1P9NA 3BG3A 3I4NI 3EERA 3IFUA 5C4JI 4HGYA 1H1SB 2CZ0B 3J80f 1KXUA 5IP9I 3CPWY 1OGUB 2PK2A 5IDNB 4EC9B 4RODA 5D1PA 2QDJA 1Y1WI 4BXXX 4Z6YA 2JIOA 4CFXB 3CCE1 1IREB 3TNIB 4OB1B 2VF1A 3DTOA 3CCR1 4CRLB 3CCMZ 1JJ2Z 2RPRA 4A3MI 4A3BI 3X28B 3NDQA 4F7JB 4A3KI 2UUEB 3M03A 1YIJ1 1Q862 2CZ1B 4F6WB 2CJMB 3GKQA 3D2LA 2CCHB 3LUSA 1L1OC 3GTMS 2I3CA 2QREB 2VPWA 1YJN1 3PO3I 3J81f 2WMAB 2ZPFB 2PJQA 4MIMA 3CCLZ 2F4OA 5T64A 2KPIA 4FM4B 4A3II 5D1OB 2E7ZA 3G6EZ 1OI9B 5ICPB 2V8JA 1Q7Y2 3J81b 3I551 5IP7I 1UNHD 3HBLA 1SIWA 4NBHA 4TNUA 4RVFA 1YUAA 2PM9A 1TFBA 4EOLB 1S72Z 2IN3A 4OB2B 2X1NB 1KQSY 2VPYA 5CM2M 3J7A4 5DQVA 3I07A 1OL2B 3D6WA 1JSTB 2WXVB 1UGPB 2F2CA 3CXCY 2M6NA 3CC4Z 4YOSA 2F4MA 4JX6A 4NB9A 3KHIA 1FDOA 2C5XB 4QTUA 1OKWB 2QEX1 2I40B 3TDHB 3VKHA 2JA7I 4AI6A 3QYEA 3VMHA 2C6TB 2UZLB 4A93I 1VQ51 1Y1VS 3QWUA 2HU9A 1M1K1 4MFEA 3ESWA 2C4GB 1ENWA 4CFMB 4BCIB 1VQN1 1VQPZ 3CD61 4EWCA 1JOWA 3GTKI 4HNTA 2W2HA 5C44I 3MONA 2G77A 2P28A 3CCSZ 4NBCA 2OTJZ 3QYHB 4FX3B 3GTPI 1UNGD 3VKGA 2WPAB 2JR6A 1UGRB 4A3EI 3CCJ1 3GTJI 1YHQZ 2VPZA 4A3FI 3D9XA 3A8MB 2K5RA 2IW9B 3M3YI 2BS2A 4MXUA 2NVTI 2VUGA 1H24B 4X6AI 2UZDB 1I50I 1X0TA 2CZ7B 2W04A 3VMGA 4A3LI 2V3VA 2QLVB 1VQO1 5IDPB 4BBRM 2BJOA 3S14I 4NFRA 1WCMI 3HOYI 4OGRB 2ZPBB 3MY5B 2Q4ZA 2QQ8A 1Y1VI 2GTIA 3MY1B 2PK7A 3NH5A 1TWAI 3BG1B 4CFUB 3CCVZ 1DL6A 1GUXA 2IVXA 1GY3B 1KC81 1G3NC 3G33B 1VQ4Z 2R92I 1K8A1 4Y72B 2QGSA 3TNHB 4HGZA 1H1RB 2UZBB 2ZPIB 1KRLA 2W03A 5CEIB 3CCM1 3NH4A 1PFTA 2ZPHB 1VQMZ 2E2JI 2QRCB 3I4MI 3S16I 4KRCB 3GTGI 4Y52I 1TWHI 3WVDB 2QA4Z 4E32A 2O53A 3MI9B 1N8R1 1H1QB 1RNIA 3CCL1 3DDQB 3CC2Z 5C3EI 1TFIA 2JA5I 1ZH1A 2WAQA 4ZGEB 4DK1A 3NDJA 1JWHC 2PK9B 5A2Qb 3VB9A 3G71Z 4BCPB 3G6E1 4DQYB 2HF1A 1UGSB 3GCFA 1H28B 3O0GD 3WVEB 2V45A 4E2WA 1JJ2Y 4F7SB 4CL1A 1SFOI 3GTOI 2OOYB 3EJ1B 3F5XB 2CZ6B 5T6BA 4AYBA 1GH6B 2WJ9A 1AD6A 1RQFA 2KI7B 3HOXI 1S721 2E2HI 4EOMB 4NBDA 1OKVB
chains in the Genus database with same CATH topology
3S15I 4A3DI 1M901 2DE6A 3HOWI 3CC41 1YJWZ 1YUKA 1VQLZ 1VQ8Z 2DE5A 2R6MA 1Q821 2Y0SA 4NH1C 2NVXI 1S7MA 2LIYA 1RO0A 2E9HA 1K9M2 1VQP1 1VLAA 3G4SZ 2GTHA 4RVDA 1LQLA 2PMZA 3CCS1 1KC82 2VUMI 2OTJ1 2NVQI 1YI2Z 2B63I 1K8A2 3CQZI 2G2KA 1YHQ1 3IX0A 3F3PC 2EGTA 2ZAEB 1YJ9Z 5D1OA 3EEDA 3CMEZ 4MD7A 3GTMI 3U50C 1RLYA 4NB8A 3HOVI 2DE7A 3NFZA 1QVFZ 3F3FC 1NJI1 1R9TI 3TE5B 1YITZ 2V8IA 3CCV1 2JUBA 3S1NI 2JNYA 3S2DI 1WIIA 4BBSI 1VQ41 3RZDI 3CCUZ 2QR1B 3S2HI 4RS4A 1QF8A 1KD11 1WW9A 1VQKZ 1X3WA 1M902 1VQM1 1VQ7Z 1USPB 3CMAZ 1ZB9A 1VQ6Z 2QA41 3CC7Z 2RBLA 2GU2A 1Q822 1I6HI 3CC21 4NBEA 3FQMA 2JA6I 3I56Z 3G711 2R7ZI 4MONA 2OTLZ 2DMEA 3S17I 3K7AI 3S1MI 1Q7Y1 4NBAA 3HKZA 3JAMb 2R93I 3H0GI 5A2Qf 4E2ZA 5T67A 1Q811 1YJW1 1VQL1 4A3GI 1QVGZ 2LFUA 2K3RA 4NBFA 1M1K2 3MZLB 1TWGI 4E2YA 2IZ4A 3PO3S 1NJI2 4A3JI 2QRDB 5FLXf 4Y7NI 2WB1A 3CCQZ 4NOZA 1K731 4MD8A 2JA8I 3G4S1 1X3ZA 3OW2Y 1Z02A 3KIFA 5FLXb 3Q87A 1YI21 1W2BZ 1KD12 2RHBA 3OW2Z 1TWCI 1VQ9Z 1YJ91 3CME1 3CPWZ 3J80b 3T4NB 2RIQA 2P3YA 2LW4A 4MH4A 1I3QI 5C4XI 1YIT1 1Z01A 3MZKB 2JS4A 3P5JB 4E30A 3GTLI 3CCU1 3HOZI 1VQK1 2E2II 1QVFY 3CCEZ 1NUIA 2H85A 3CCRZ 3IF8A 2YU9I 1N8R2 1VQ71 4BY1I 1Q812 1YIJZ 3CMA1 2JMOA 1VQ61 1ZB8A 4NBBA 3CC71 4RVHA 4BY7I 3HOUI 1YJNZ 1KQSZ 3I561 5IT9f 2M48A 4MRIA 3CXCZ 3S1RI 1K732 2OZKA 4E2XA 3VTNA 2OTL1 3I55Z 3RZOI 2V8KA 3H3VJ 4RVGA 4S1TA 1RO2A 3NDIA 5IT9b 4NBGA 5AN9F 3BG0B 3VMIA 3KIHA 2J6AA 3FKII 4BBRI 1Q861 2YADA 2O4HA 4A3CI 5FLMI 4XX2A 1TWFI 2OOXB 1RO4A 3JAMf 3GTQI 2QEXZ 3PO2I 1ML8A 4DGLA 4E31A 1VQ5Z 2Q51A 4BY1X 4BXXI 3CCQ1 1VQNZ 4BY7X 2AKLA 3NH8A 3CD6Z 1N2FA 1USPA 1K9M1 3FQQA 2IZ3A 1NP6A 1QVGY 3CCJZ 2QKDA 4MD9A 1VQ81 1VQ91 2RT9A 5LL6f 4QTTA 4E33A 3M4OI 1QYPA 4HH4A 1Z03A 1VQOZ 1W2BY 1K83I 2NVYI 3S1QI 4RV9A 1P9NA 3I4NI 3EERA 3IFUA 5C4JI 4HGYA 3J80f 5IP9I 3CPWY 5D1PA 1Y1WI 4BXXX 3CCE1 2VF1A 3CCR1 3CCMZ 4A3BI 1JJ2Z 2RPRA 4A3MI 3NDQA 4A3KI 1YIJ1 1Q862 3GKQA 3LUSA 1YJN1 1L1OC 3GTMS 2I3CA 2QREB 3PO3I 3J81f 3CCLZ 2F4OA 5T64A 2KPIA 4A3II 5D1OB 3G6EZ 2V8JA 1Q7Y2 3J81b 3I551 5IP7I 4NBHA 4TNUA 4RVFA 1YUAA 2PM9A 1S72Z 1KQSY 5CM2M 3J7A4 3I07A 3D6WA 3CXCY 2M6NA 3CC4Z 2F4MA 4NB9A 4QTUA 2QEX1 3TDHB 2JA7I 3VMHA 4A93I 1VQ51 1Y1VS 3QWUA 2HU9A 1M1K1 3ESWA 1ENWA 1VQN1 1VQPZ 3CD61 4EWCA 3GTKI 5C44I 3MONA 2P28A 3CCSZ 4NBCA 2OTJZ 3GTPI 2JR6A 4A3EI 3CCJ1 3GTJI 1YHQZ 4A3FI 3D9XA 2K5RA 3M3YI 4MXUA 2NVTI 2VUGA 4X6AI 1I50I 1X0TA 2W04A 3VMGA 4A3LI 2QLVB 1VQO1 2BJOA 3S14I 4NFRA 1WCMI 3HOYI 2Q4ZA 2GTIA 1Y1VI 2PK7A 3NH5A 1TWAI 3BG1B 1DL6A 3CCVZ 1KC81 1VQ4Z 2R92I 1K8A1 4HGZA 1KRLA 2W03A 3CCM1 3NH4A 1PFTA 1VQMZ 2E2JI 2QRCB 3I4MI 3S16I 3GTGI 4Y52I 1TWHI 2QA4Z 4E32A 2O53A 1N8R1 1RNIA 3CCL1 3CC2Z 5C3EI 1TFIA 2JA5I 1ZH1A 2WAQA 4DK1A 3NDJA 1JWHC 5A2Qb 3VB9A 3G71Z 3G6E1 4DQYB 2HF1A 3GCFA 4E2WA 1JJ2Y 4CL1A 1SFOI 3GTOI 2OOYB 5T6BA 4AYBA 3HOXI 1RQFA 2KI7B 1S721 2E2HI 4NBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMI A;  3S15 I;  4A3D I;  3H0G I;  2J6A A;  3FKI I;  4BBR I;  5CM2 M;  2DE6 A;  3I07 A;  3D6W A;  3HOW I;  4A3C I;  2F4M A;  4NB9 A;  4XX2 A;  1TWF I;  5FLM I;  4A3G I;  1RO4 A;  2DE5 A;  4QTU A;  3GTQ I;  4NBF A;  2NVX I;  3PO2 I;  1TWG I;  2JA7 I;  3VMH A;  1ML8 A;  3PO3 S;  4A3J I;  4A93 I;  4BY1 X;  1Y1V S;  4Y7N I;  3ESW A;  4BXX I;  1ENW A;  4BY7 X;  2AKL A;  4NOZ A;  1VLA A;  2JA8 I;  3GTK I;  5C44 I;  1N2F A;  1USP A;  1LQL A;  2VUM I;  1X3Z A;  4NBC A;  3GTP I;  2JR6 A;  2NVQ I;  3Q87 A;  4A3E I;  2B63 I;  3CQZ I;  3GTJ I;  4A3F I;  2K5R A;  3M3Y I;  1TWC I;  2NVT I;  4QTT A;  3GTM I;  3U50 C;  4X6A I;  1RLY A;  3M4O I;  1I50 I;  4NB8 A;  1QYP A;  3HOV I;  3VMG A;  4A3L I;  2DE7 A;  2P3Y A;  2LW4 A;  2BJO A;  3S14 I;  1R9T I;  1WCM I;  3HOY I;  4MH4 A;  1K83 I;  1I3Q I;  2NVY I;  5C4X I;  3S1Q I;  1Y1V I;  2PK7 A;  3I4N I;  3EER A;  1TWA I;  5C4J I;  1DL6 A;  2JS4 A;  3S1N I;  2JNY A;  3S2D I;  4BBS I;  5IP9 I;  3RZD I;  2R92 I;  3GTL I;  3S2H I;  3HOZ I;  1WW9 A;  1Y1W I;  4BXX X;  1X3W A;  2E2I I;  1NUI A;  4A3B I;  4A3M I;  2YU9 I;  1PFT A;  3NDQ A;  4A3K I;  2E2J I;  4BY1 I;  3I4M I;  1USP B;  3S16 I;  3GTG I;  4Y52 I;  1ZB9 A;  1TWH I;  1ZB8 A;  4NBB A;  4BY7 I;  2RBL A;  3GKQ A;  3HOU I;  3LUS A;  1L1O C;  3GTM S;  3PO3 I;  1I6H I;  2F4O A;  5C3E I;  1TFI A;  2KPI A;  2JA5 I;  4NBE A;  2JA6 I;  4A3I I;  3VB9 A;  2HF1 A;  3GCF A;  3S1R I;  2R7Z I;  5IP7 I;  3RZO I;  3H3V J;  4NBH A;  1SFO I;  3GTO I;  2DME A;  3S17 I;  3K7A I;  3S1M I;  1YUA A;  3HOX I;  4NBA A;  2E2H I;  2R93 I;  4NBG A;  4NBD A; 
#chains in the Genus database with same CATH topology
 4YOO A;  4EOI B;  3S15 I;  4A3D I;  4TTH A;  1O9K B;  1M90 1;  4BCM B;  2DE6 A;  2JIP A;  1QLB A;  3HOW I;  3CC4 1;  1YJW Z;  1YUK A;  1VQL Z;  1H26 B;  3TW6 A;  1VQ8 Z;  5I5Z B;  2WIP B;  2DE5 A;  2R6M A;  1Q82 1;  4F7N B;  1PKD B;  2Y0S A;  4NH1 C;  2NVX I;  5HNB B;  1S7M A;  2LIY A;  4BCQ B;  1RO0 A;  2E9H A;  2ZPG B;  3A8L B;  4CFU D;  1K9M 2;  1VQP 1;  3EOC B;  1VLA A;  4HL4 A;  1C9B A;  3G4S Z;  3H4C A;  2GTH A;  4RVD A;  5HVY B;  3BLH B;  1LQL A;  2PMZ A;  3CCS 1;  1KC8 2;  2VUM I;  2OTJ 1;  4BCJ B;  1FIN B;  2NVQ I;  1YI2 Z;  2B63 I;  1K8A 2;  3CQZ I;  2I53 A;  2QFZ A;  2G2K A;  1YHQ 1;  1URC B;  2C5N B;  3IX0 A;  3F3P C;  2EGT A;  4EOO B;  1VYW B;  2QF7 A;  1ZP2 A;  3QHW B;  4HLQ A;  4CFV B;  4HNU A;  3A8O B;  2ZAE B;  5D1O A;  3EED A;  1YJ9 Z;  1E7P A;  3CME Z;  4MD7 A;  3GTM I;  3U50 C;  1RLY A;  4KRD B;  4NB8 A;  3HOV I;  3BG9 A;  2DE7 A;  4CFW B;  4F7L B;  3NFZ A;  1QVF Z;  3F3F C;  1NJI 1;  2WFY B;  2IW8 B;  1R9T I;  4G6L B;  3TE5 B;  1YIT Z;  3X26 B;  4AKI A;  1WZN A;  2V8I A;  2KMG A;  2B9R A;  4ZGJ B;  1E9H B;  2AHJ B;  3CCV 1;  2JUB A;  3BHU B;  3S1N I;  5LMK B;  2JNY A;  3S2D I;  5HBJ B;  4QSH A;  1WII A;  1VQ4 1;  3RZD I;  4NST B;  4CFN B;  3CCU Z;  4BBS I;  3TN8 B;  2C5O B;  3VYH B;  2UZE B;  2QR1 B;  1TD6 A;  3S2H I;  4RS4 A;  4YC3 B;  2WIH B;  1QF8 A;  1KD1 1;  1WW9 A;  1VQK Z;  4F6U B;  1X3W A;  4BCM D;  1P5E B;  1W98 B;  1V29 B;  1N4M A;  2CCI B;  4YOZ A;  1M90 2;  1VQM 1;  1VQ7 Z;  1USP B;  2NAP A;  3CMA Z;  1ZB9 A;  1VQ6 Z;  2QA4 1;  3CC7 Z;  2RBL A;  2GU2 A;  3DJB A;  5IF1 B;  1Q82 2;  2CYZ B;  4II5 B;  4BCQ D;  4OR5 B;  1I6H I;  2W9Z A;  4IMY B;  3CC2 1;  4EOS B;  3TW7 A;  2JIR A;  4NBE A;  3FQM A;  2JA6 I;  2JGZ B;  3I56 Z;  3DOG B;  2DXB B;  3G71 1;  2R7Z I;  4MON A;  5LQF B;  2OTL Z;  5IHY A;  2ZCF B;  1UGQ B;  2DME A;  3S17 I;  4EC8 B;  3K7A I;  3S1M I;  1Q7Y 1;  4NBA A;  2ZPE B;  3HKZ A;  3JAM b;  2R93 I;  3LQ5 B;  3H0G I;  2BS3 A;  5A2Q f;  2IV2 X;  3VYG B;  4EOR B;  4E2Z A;  5DQW A;  1VOL A;  5T67 A;  3QXE B;  2AYD A;  1Q81 1;  3MIA B;  4M6V A;  1YJW 1;  1VQL 1;  4NC6 A;  3BHV B;  2JIM A;  4A3G I;  1QVG Z;  2LFU A;  2K3R A;  4NBF A;  1M1K 2;  3EID B;  3MZL B;  1TWG I;  4BCN D;  4E2Y A;  2IZ4 A;  3PO3 S;  1H25 B;  1UNL D;  1NJI 2;  4A3J I;  2QRD B;  5FLX f;  2ZZD B;  4Y7N I;  2PMI B;  4ZGD B;  2WB1 A;  3CCQ Z;  4NOZ A;  1K73 1;  1WJ2 A;  4MD8 A;  2JA8 I;  3G4S 1;  3B57 A;  3A8G B;  1X3Z A;  3OW2 Y;  1Z02 A;  1FKM A;  3KIF A;  5FLX b;  3POM A;  4OB3 B;  3Q87 A;  5HBH B;  1YI2 1;  3BHT B;  2DXC B;  1W2B Z;  1KD1 2;  2RHB A;  1AIS B;  3OW2 Z;  1F5Q B;  1TWC I;  2WEV B;  4ELL A;  1VQ9 Z;  1QMZ B;  4EOJ B;  1YJ9 1;  5EFQ B;  3BG5 A;  3CME 1;  2C5V B;  3CPW Z;  3X20 B;  3IR7 A;  3J80 b;  4EOQ B;  1AHJ B;  3T4N B;  2RIQ A;  2P3Y A;  2LW4 A;  3HO8 A;  5CYI B;  3QHR B;  4MH4 A;  1I3Q I;  5C4X I;  4BCO B;  1YIT 1;  1Z01 A;  1BU2 A;  3MZK B;  1O9K A;  2IW6 B;  1OL1 B;  2JS4 A;  1AA6 A;  3QYG B;  1FDI A;  3P5J B;  1JSU B;  2WHB B;  4E30 A;  5BNJ B;  5ACB A;  3CCU 1;  3GTL I;  2DPP B;  2BKZ B;  4BCF B;  3HB9 A;  3HOZ I;  1VQK 1;  2E2I I;  1VIN A;  1QVF Y;  1QXF A;  3CCE Z;  2DD5 B;  1NUI A;  2H85 A;  3CCR Z;  3IF8 A;  5EJC A;  2R7G A;  3A8H B;  2YU9 I;  1N8R 2;  1VQ7 1;  4BY1 I;  1Q81 2;  4MFD A;  1YIJ Z;  3CMA 1;  2JMO A;  3DL1 A;  1ZB8 A;  1VQ6 1;  4NBB A;  4RVH A;  3CC7 1;  4BY7 I;  3HOU I;  5FGK B;  4BCN B;  1YJN Z;  2JIQ A;  4ROE A;  1H1P B;  2PHG A;  2DD4 B;  4UN0 A;  1KQS Z;  4CXA B;  3I56 1;  5IT9 f;  4JX4 A;  2M48 A;  3X24 B;  4AKH A;  1XO2 A;  1Y8C A;  4MRI A;  4EOK B;  3CXC Z;  3S1R I;  1K73 2;  3HHT B;  3X25 B;  2OZK A;  4ELJ A;  3QZ5 B;  4E2X A;  3VTN A;  2OTL 1;  3I55 Z;  3RZO I;  2V8K A;  3H3V J;  4EON B;  4RVG A;  4LOC A;  2BPM B;  2VPX A;  1H27 B;  4S1T A;  1RO2 A;  2BS4 A;  1H4L D;  3NDI A;  5IT9 b;  2D0Q B;  4BCK B;  4NBG A;  5AN9 F;  3BG0 B;  1D3U B;  3VMI A;  4AKG A;  2W9F A;  4OB0 B;  3KIH A;  2J6A A;  3FKI I;  4BBR I;  1FVV B;  2W96 A;  1JKW A;  1GUX B;  2YAD A;  1Q86 1;  4BBS M;  2O4H A;  4I3Z B;  4A3C I;  5FLM I;  4XX2 A;  1TWF I;  2OOX B;  1RO4 A;  1Q16 A;  3JAM f;  3GTQ I;  4ROC A;  2QEX Z;  3PO2 I;  2W99 A;  1ML8 A;  4DGL A;  3DDP B;  4E31 A;  1VQ5 Z;  2Q51 A;  3QWL A;  4BY1 X;  4JX5 A;  2WMB B;  5HBE B;  4BXX I;  3CCQ 1;  1VQN Z;  4BY7 X;  2AKL A;  3NH8 A;  3CD6 Z;  2LEX A;  3BLQ B;  1N2F A;  1OIY B;  1USP A;  3QYB A;  1K9M 1;  3FQQ A;  2IZ3 A;  1NP6 A;  1QVG Y;  3CCJ Z;  4F70 B;  4EOP B;  2QKD A;  4MD9 A;  5HQ0 B;  1VQ8 1;  1VQ9 1;  2RT9 A;  5LL6 f;  3BLR B;  2EUF A;  4QTT A;  4BCH B;  3K7A M;  4E33 A;  2V22 B;  2G9X B;  4BCG B;  3M4O I;  1QYP A;  4F6S B;  4HH4 A;  4HNV A;  5L2W B;  1Z03 A;  2QDY B;  3TNW B;  1VQO Z;  1W2B Y;  1K83 I;  2KR6 A;  1OIU B;  3RGF B;  2NVY I;  3QZ9 B;  3S1Q I;  3HZJ A;  4RV9 A;  1P9N A;  3BG3 A;  3I4N I;  3EER A;  3IFU A;  5C4J I;  4HGY A;  1H1S B;  2CZ0 B;  3J80 f;  1KXU A;  5IP9 I;  3CPW Y;  1OGU B;  2PK2 A;  5IDN B;  4EC9 B;  4ROD A;  5D1P A;  2QDJ A;  1Y1W I;  4BXX X;  4Z6Y A;  2JIO A;  4CFX B;  3CCE 1;  1IRE B;  3TNI B;  4OB1 B;  2VF1 A;  3DTO A;  3CCR 1;  4CRL B;  3CCM Z;  1JJ2 Z;  2RPR A;  4A3M I;  4A3B I;  3X28 B;  3NDQ A;  4F7J B;  4A3K I;  2UUE B;  3M03 A;  1YIJ 1;  1Q86 2;  2CZ1 B;  4F6W B;  2CJM B;  3GKQ A;  3D2L A;  2CCH B;  3LUS A;  1L1O C;  3GTM S;  2I3C A;  2QRE B;  2VPW A;  1YJN 1;  3PO3 I;  3J81 f;  2WMA B;  2ZPF B;  2PJQ A;  4MIM A;  3CCL Z;  2F4O A;  5T64 A;  2KPI A;  4FM4 B;  4A3I I;  5D1O B;  2E7Z A;  3G6E Z;  1OI9 B;  5ICP B;  2V8J A;  1Q7Y 2;  3J81 b;  3I55 1;  5IP7 I;  1UNH D;  3HBL A;  1SIW A;  4NBH A;  4TNU A;  4RVF A;  1YUA A;  2PM9 A;  1TFB A;  4EOL B;  1S72 Z;  2IN3 A;  4OB2 B;  2X1N B;  1KQS Y;  2VPY A;  5CM2 M;  3J7A 4;  5DQV A;  3I07 A;  1OL2 B;  3D6W A;  1JST B;  2WXV B;  1UGP B;  2F2C A;  3CXC Y;  2M6N A;  3CC4 Z;  4YOS A;  2F4M A;  4JX6 A;  4NB9 A;  3KHI A;  1FDO A;  2C5X B;  4QTU A;  1OKW B;  2QEX 1;  2I40 B;  3TDH B;  3VKH A;  2JA7 I;  4AI6 A;  3QYE A;  3VMH A;  2C6T B;  2UZL B;  4A93 I;  1VQ5 1;  1Y1V S;  3QWU A;  2HU9 A;  1M1K 1;  4MFE A;  3ESW A;  2C4G B;  1ENW A;  4CFM B;  4BCI B;  1VQN 1;  1VQP Z;  3CD6 1;  4EWC A;  1JOW A;  3GTK I;  4HNT A;  2W2H A;  5C44 I;  3MON A;  2G77 A;  2P28 A;  3CCS Z;  4NBC A;  2OTJ Z;  3QYH B;  4FX3 B;  3GTP I;  1UNG D;  3VKG A;  2WPA B;  2JR6 A;  1UGR B;  4A3E I;  3CCJ 1;  3GTJ I;  1YHQ Z;  2VPZ A;  4A3F I;  3D9X A;  3A8M B;  2K5R A;  2IW9 B;  3M3Y I;  2BS2 A;  4MXU A;  2NVT I;  2VUG A;  1H24 B;  4X6A I;  2UZD B;  1I50 I;  1X0T A;  2CZ7 B;  2W04 A;  3VMG A;  4A3L I;  2V3V A;  2QLV B;  1VQO 1;  5IDP B;  4BBR M;  2BJO A;  3S14 I;  4NFR A;  1WCM I;  3HOY I;  4OGR B;  2ZPB B;  3MY5 B;  2Q4Z A;  2QQ8 A;  1Y1V I;  2GTI A;  3MY1 B;  2PK7 A;  3NH5 A;  1TWA I;  3BG1 B;  4CFU B;  3CCV Z;  1DL6 A;  1GUX A;  2IVX A;  1GY3 B;  1KC8 1;  1G3N C;  3G33 B;  1VQ4 Z;  2R92 I;  1K8A 1;  4Y72 B;  2QGS A;  3TNH B;  4HGZ A;  1H1R B;  2UZB B;  2ZPI B;  1KRL A;  2W03 A;  5CEI B;  3CCM 1;  3NH4 A;  1PFT A;  2ZPH B;  1VQM Z;  2E2J I;  2QRC B;  3I4M I;  3S16 I;  4KRC B;  3GTG I;  4Y52 I;  1TWH I;  3WVD B;  2QA4 Z;  4E32 A;  2O53 A;  3MI9 B;  1N8R 1;  1H1Q B;  1RNI A;  3CCL 1;  3DDQ B;  3CC2 Z;  5C3E I;  1TFI A;  2JA5 I;  1ZH1 A;  2WAQ A;  4ZGE B;  4DK1 A;  3NDJ A;  1JWH C;  2PK9 B;  5A2Q b;  3VB9 A;  3G71 Z;  4BCP B;  3G6E 1;  4DQY B;  2HF1 A;  1UGS B;  3GCF A;  1H28 B;  3O0G D;  3WVE B;  2V45 A;  4E2W A;  1JJ2 Y;  4F7S B;  4CL1 A;  1SFO I;  3GTO I;  2OOY B;  3EJ1 B;  3F5X B;  2CZ6 B;  5T6B A;  4AYB A;  1GH6 B;  2WJ9 A;  1AD6 A;  1RQF A;  2KI7 B;  3HOX I;  1S72 1;  2E2H I;  4EOM B;  4NBD A;  1OKV B; 
#chains in the Genus database with same CATH homology
 3S15 I;  4A3D I;  1M90 1;  2DE6 A;  3HOW I;  3CC4 1;  1YJW Z;  1YUK A;  1VQL Z;  1VQ8 Z;  2DE5 A;  2R6M A;  1Q82 1;  2Y0S A;  4NH1 C;  2NVX I;  1S7M A;  2LIY A;  1RO0 A;  2E9H A;  1K9M 2;  1VQP 1;  1VLA A;  3G4S Z;  2GTH A;  4RVD A;  1LQL A;  2PMZ A;  3CCS 1;  1KC8 2;  2VUM I;  2OTJ 1;  2NVQ I;  1YI2 Z;  2B63 I;  1K8A 2;  3CQZ I;  2G2K A;  1YHQ 1;  3IX0 A;  3F3P C;  2EGT A;  2ZAE B;  1YJ9 Z;  5D1O A;  3EED A;  3CME Z;  4MD7 A;  3GTM I;  3U50 C;  1RLY A;  4NB8 A;  3HOV I;  2DE7 A;  3NFZ A;  1QVF Z;  3F3F C;  1NJI 1;  1R9T I;  3TE5 B;  1YIT Z;  2V8I A;  3CCV 1;  2JUB A;  3S1N I;  2JNY A;  3S2D I;  1WII A;  4BBS I;  1VQ4 1;  3RZD I;  3CCU Z;  2QR1 B;  3S2H I;  4RS4 A;  1QF8 A;  1KD1 1;  1WW9 A;  1VQK Z;  1X3W A;  1M90 2;  1VQM 1;  1VQ7 Z;  1USP B;  3CMA Z;  1ZB9 A;  1VQ6 Z;  2QA4 1;  3CC7 Z;  2RBL A;  2GU2 A;  1Q82 2;  1I6H I;  3CC2 1;  4NBE A;  3FQM A;  2JA6 I;  3I56 Z;  3G71 1;  2R7Z I;  4MON A;  2OTL Z;  2DME A;  3S17 I;  3K7A I;  3S1M I;  1Q7Y 1;  4NBA A;  3HKZ A;  3JAM b;  2R93 I;  3H0G I;  5A2Q f;  4E2Z A;  5T67 A;  1Q81 1;  1YJW 1;  1VQL 1;  4A3G I;  1QVG Z;  2LFU A;  2K3R A;  4NBF A;  1M1K 2;  3MZL B;  1TWG I;  4E2Y A;  2IZ4 A;  3PO3 S;  1NJI 2;  4A3J I;  2QRD B;  5FLX f;  4Y7N I;  2WB1 A;  3CCQ Z;  4NOZ A;  1K73 1;  4MD8 A;  2JA8 I;  3G4S 1;  1X3Z A;  3OW2 Y;  1Z02 A;  3KIF A;  5FLX b;  3Q87 A;  1YI2 1;  1W2B Z;  1KD1 2;  2RHB A;  3OW2 Z;  1TWC I;  1VQ9 Z;  1YJ9 1;  3CME 1;  3CPW Z;  3J80 b;  3T4N B;  2RIQ A;  2P3Y A;  2LW4 A;  4MH4 A;  1I3Q I;  5C4X I;  1YIT 1;  1Z01 A;  3MZK B;  2JS4 A;  3P5J B;  4E30 A;  3GTL I;  3CCU 1;  3HOZ I;  1VQK 1;  2E2I I;  1QVF Y;  3CCE Z;  1NUI A;  2H85 A;  3CCR Z;  3IF8 A;  2YU9 I;  1N8R 2;  1VQ7 1;  4BY1 I;  1Q81 2;  1YIJ Z;  3CMA 1;  2JMO A;  1VQ6 1;  1ZB8 A;  4NBB A;  3CC7 1;  4RVH A;  4BY7 I;  3HOU I;  1YJN Z;  1KQS Z;  3I56 1;  5IT9 f;  2M48 A;  4MRI A;  3CXC Z;  3S1R I;  1K73 2;  2OZK A;  4E2X A;  3VTN A;  2OTL 1;  3I55 Z;  3RZO I;  2V8K A;  3H3V J;  4RVG A;  4S1T A;  1RO2 A;  3NDI A;  5IT9 b;  4NBG A;  5AN9 F;  3BG0 B;  3VMI A;  3KIH A;  2J6A A;  3FKI I;  4BBR I;  1Q86 1;  2YAD A;  2O4H A;  4A3C I;  5FLM I;  4XX2 A;  1TWF I;  2OOX B;  1RO4 A;  3JAM f;  3GTQ I;  2QEX Z;  3PO2 I;  1ML8 A;  4DGL A;  4E31 A;  1VQ5 Z;  2Q51 A;  4BY1 X;  4BXX I;  3CCQ 1;  1VQN Z;  4BY7 X;  2AKL A;  3NH8 A;  3CD6 Z;  1N2F A;  1USP A;  1K9M 1;  3FQQ A;  2IZ3 A;  1NP6 A;  1QVG Y;  3CCJ Z;  2QKD A;  4MD9 A;  1VQ8 1;  1VQ9 1;  2RT9 A;  5LL6 f;  4QTT A;  4E33 A;  3M4O I;  1QYP A;  4HH4 A;  1Z03 A;  1VQO Z;  1W2B Y;  1K83 I;  2NVY I;  3S1Q I;  4RV9 A;  1P9N A;  3I4N I;  3EER A;  3IFU A;  5C4J I;  4HGY A;  3J80 f;  5IP9 I;  3CPW Y;  5D1P A;  1Y1W I;  4BXX X;  3CCE 1;  2VF1 A;  3CCR 1;  3CCM Z;  4A3B I;  1JJ2 Z;  2RPR A;  4A3M I;  3NDQ A;  4A3K I;  1YIJ 1;  1Q86 2;  3GKQ A;  3LUS A;  1YJN 1;  1L1O C;  3GTM S;  2I3C A;  2QRE B;  3PO3 I;  3J81 f;  3CCL Z;  2F4O A;  5T64 A;  2KPI A;  4A3I I;  5D1O B;  3G6E Z;  2V8J A;  1Q7Y 2;  3J81 b;  3I55 1;  5IP7 I;  4NBH A;  4TNU A;  4RVF A;  1YUA A;  2PM9 A;  1S72 Z;  1KQS Y;  5CM2 M;  3J7A 4;  3I07 A;  3D6W A;  3CXC Y;  2M6N A;  3CC4 Z;  2F4M A;  4NB9 A;  4QTU A;  2QEX 1;  3TDH B;  2JA7 I;  3VMH A;  4A93 I;  1VQ5 1;  1Y1V S;  3QWU A;  2HU9 A;  1M1K 1;  3ESW A;  1ENW A;  1VQN 1;  1VQP Z;  3CD6 1;  4EWC A;  3GTK I;  5C44 I;  3MON A;  2P28 A;  3CCS Z;  4NBC A;  2OTJ Z;  3GTP I;  2JR6 A;  4A3E I;  3CCJ 1;  3GTJ I;  1YHQ Z;  4A3F I;  3D9X A;  2K5R A;  3M3Y I;  4MXU A;  2NVT I;  2VUG A;  4X6A I;  1I50 I;  1X0T A;  2W04 A;  3VMG A;  4A3L I;  2QLV B;  1VQO 1;  2BJO A;  3S14 I;  4NFR A;  1WCM I;  3HOY I;  2Q4Z A;  2GTI A;  1Y1V I;  2PK7 A;  3NH5 A;  1TWA I;  3BG1 B;  1DL6 A;  3CCV Z;  1KC8 1;  1VQ4 Z;  2R92 I;  1K8A 1;  4HGZ A;  1KRL A;  2W03 A;  3CCM 1;  3NH4 A;  1PFT A;  1VQM Z;  2E2J I;  2QRC B;  3I4M I;  3S16 I;  3GTG I;  4Y52 I;  1TWH I;  2QA4 Z;  4E32 A;  2O53 A;  1N8R 1;  1RNI A;  3CCL 1;  3CC2 Z;  5C3E I;  1TFI A;  2JA5 I;  1ZH1 A;  2WAQ A;  4DK1 A;  3NDJ A;  1JWH C;  5A2Q b;  3VB9 A;  3G71 Z;  3G6E 1;  4DQY B;  2HF1 A;  3GCF A;  4E2W A;  1JJ2 Y;  4CL1 A;  1SFO I;  3GTO I;  2OOY B;  5T6B A;  4AYB A;  3HOX I;  1RQF A;  2KI7 B;  1S72 1;  2E2H I;  4NBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...