3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
b'HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
source organism Saccharomyces cerevisiae
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
2E2HI 1L1OC 3U50C 1K83I 2E2II 1SFOI 3M4OI 2R92I 3D6WA 2VUMI 3GTOI 4QTTA 4A3CI 4NOZA 2AKLA 5IP7I 3H0GI 3S14I 4NBDA 1ZB8A 3LUSA 2JA5I 1QYPA 2KPIA 4NBAA 1ML8A 4BBSI 1DL6A 4NBHA 3EERA 3S1QI 1Y1WI 3GTQI 4A3EI 3I4NI 2DMEA 2B63I 1TFIA 3S2HI 3S16I 4A3BI 4A3MI 3S1MI 2JNYA 1Y1VI 2JR6A 2YU9I 2JS4A 4NB8A 3VMIA 4A3II 2DE7A 3M3YI 4NBFA 3FKII 3GTGI 3PO3S 1ENWA 4NBCA 3PO2I 2DE6A 4QTUA 3VMHA 3RZOI 3GTMS 2K5RA 3VMGA 2NVXI 2JA7I 4BXXI 1WW9A 3S15I 3HOXI 4NB9A 1I50I 2E2JI 5CM2M 3CQZI 1PFTA 3S1NI 3HOWI 2DE5A 5C44I 2JA8I 2RBLA 1USPA 3GTMI 4A3DI 1TWAI 2P3YA 3GCFA 3GTJI 2NVYI 4BY7I 1I3QI 4A3FI 2NVTI 3K7AI 1N2FA 1RO4A 2R7ZI 3Q87A 4NBGA 3H3VJ 4NBBA 4A3GI 3HOUI 2NVQI 4BBRI 1R9TI 3PO3I 1X3WA 4NBEA 2F4OA 4Y7NI 4Y52I 4BY1X 4A3KI 1TWGI 5IP9I 5C4XI 1WCMI 3HOYI 5FLMI 3HOZI 4A3LI 4BY1I 1ZB9A 1VLAA 4BXXX 1LQLA 1I6HI 2JA6I 3I07A 1YUAA 3ESWA 5C4JI 2BJOA 1Y1VS 3GTLI 1USPB 2HF1A 3HOVI 2F4MA 4BY7X 3GKQA 3GTPI 1TWCI 3S1RI 3I4MI 3S2DI 4X6AI 2J6AA 3NDQA 3S17I 1TWFI 3VB9A 2R93I 2LW4A 1TWHI 1X3ZA 1NUIA 4XX2A 4A3JI 1RLYA 4MH4A 4A93I 2PK7A 3GTKI 5C3EI 3RZDI
chains in the Genus database with same CATH superfamily
2E2HI 4BCGB 2ZPIB 2IW8B 1VQNZ 4MFEA 4EWCA 1K83I 4E31A 3G33B 2W2HA 5D1OA 1SFOI 4EORB 1N4MA 3BHVB 3M4OI 1M1K1 1RQFA 2QLVB 2UZBB 3BLQB 3H0GI 1S7MA 4M6VA 1KC81 2V22B 3QXEB 1Q822 2BS4A 2VF1A 2JA5I 1NP6A 4EOQB 4HLQA 1ML8A 3EOCB 4G6LB 2UZEB 1UNHD 2CZ6B 4F70B 3I4NI 4MD8A 2ZZDB 2YADA 4RV9A 1FDIA 4A3BI 2RHBA 4BCNB 1X0TA 4HGZA 3VMIA 5A2Qf 1VQKZ 2DE7A 2DXCB 2ZAEB 1YHQZ 2LFUA 1OIUB 2I40B 4NBFA 1YJW1 1UGQB 5LQFB 2WEVB 3GTGI 3CCMZ 1M901 1GY3B 3VKGA 1JSUB 3J81f 2JMOA 3A8MB 2VPYA 2BPMB 3VMGA 1RO0A 1K8A1 2JA7I 3S15I 4MONA 3HOXI 1H27B 3H4CA 4JX5A 1O9KA 4F6SB 1E7PA 2C6TB 3CQZI 3VTNA 3CCQ1 5DQVA 3BG3A 2UZDB 3TW6A 1OI9B 4AKGA 1OKWB 1USPA 3QWLA 5ACBA 3BG0B 3GTJI 1W2BY 2OTJ1 5FLXf 3CXCY 3CCUZ 3K7AI 1H28B 1UNLD 2H85A 1VQPZ 1RO4A 2WFYB 1H1QB 2PMIB 1YI21 1X3WA 4Y7NI 2QA41 4IMYB 1TWGI 1YITZ 5C4XI 1QVFY 1K9M2 1PKDB 3HOYI 1VQ6Z 3DJBA 4MXUA 2JIQA 1VLAA 4BXXX 5L2WB 2V3VA 1VQ4Z 1LQLA 3X26B 5IDPB 2E7ZA 3KIHA 1YUAA 4DQYB 1WIIA 5C4JI 2X1NB 3BLHB 2BJOA 2LIYA 3GTLI 3DDQB 1RO2A 3HOVI 2F4MA 3GKQA 1Z02A 2PJQA 3NDJA 3O0GD 2QFZA 3I4MI 4ROEA 4X6AI 1D3UB 1C9BA 3NDQA 4Z6YA 4BCQD 3DOGB 4CFMB 2V8KA 3CCR1 1X3ZA 2C5VB 1YJWZ 5HBJB 4NH1C 5HNBB 2GTHA 2IN3A 1YIT1 3EJ1B 2JIMA 5C3EI 2R7ZI 2R7GA 2PM9A 1VQLZ 2ZPFB 3U50C 5CEIB 1ZH1A 3EEDA 2IV2X 2R92I 4CXAB 1QVGY 2VUMI 4BCHB 1VQL1 2WPAB 4A3CI 5IT9b 3WVDB 2AKLA 5IP7I 4JX4A 1N8R2 3S14I 3TE5B 2Q4ZA 4NBDA 1ZB8A 1M1K2 1VQ9Z 3EIDB 4EC8B 2JIOA 2KPIA 2VPXA 1VINA 4CFUB 4YOZA 3CC71 5T67A 4F7NB 3BG9A 1WZNA 3EERA 3I55Z 3CCLZ 3S1QI 3CCJZ 4A3EI 3GTQI 2DMEA 2ZPEB 2E9HA 2NAPA 4ELLA 3S1MI 2ZPBB 3POMA 3CCSZ 4CFNB 3HBLA 2JS4A 4CFWB 4MRIA 2R6MA 2WAQA 4FX3B 3OW2Z 1KRLA 4HL4A 1VOLA 2C5NB 1UNGD 2B9RA 2CJMB 2M48A 3PO3S 2RT9A 1ENWA 4KRCB 3CCS1 2M6NA 3PO2I 1P9NA 4EONB 5EJCA 1JSTB 3J80b 1O9KB 3GTMS 4F7SB 2OOYB 2QF7A 5T6BA 2K5RA 4BXXI 1WW9A 1Q7Y1 1K731 3QYEA 4BCQB 1VQ5Z 2VUGA 1JOWA 4EOLB 3JAMf 3HOWI 4KRDB 4BCKB 2QGSA 2WHBB 3J7A4 3CCL1 2DD5B 1H1RB 2UUEB 5CYIB 3J81b 4OB2B 4OGRB 1I3QI 4RVGA 4A3FI 2NVTI 2QKDA 1VQ71 1N2FA 2K3RA 4ZGEB 4NFRA 3MY5B 5ICPB 3TNHB 3HOUI 3A8LB 3KHIA 1H1SB 2NVQI 3QHWB 1R9TI 2ZPGB 4AYBA 3TNWB 4A3DI 5HQ0B 3MZLB 4A3KI 5HBHB 2Y0SA 1F5QB 2ZPHB 1WCMI 1TFBA 5FLMI 3FQMA 3CMAZ 1TD6A 2AHJB 3I561 4TNUA 3I07A 4FM4B 3QHRB 2VPZA 3ESWA 3A8HB 3CC41 1Q7Y2 5AN9F 1YI2Z 3QZ5B 4RS4A 2PK2A 2F2CA 3CME1 4BY7X 3TDHB 3QYBA 4BCMB 4MD9A 1H1PB 2BKZB 2JGZB 1OKVB 5LMKB 2J6AA 4E30A 4MD7A 1TWFI 3D2LA 1YJ9Z 3CCVZ 4CL1A 2V8IA 4MIMA 3NFZA 2LW4A 1NUIA 2OOXB 2QREB 4A3JI 2AYDA 4DK1A 4A93I 4AI6A 3RZDI 4AKIA 1KC82 4YC3B 3CCQZ 2G77A 2QR1B 3VYHB 4TTHA 3TW7A 2W96A 2C5XB 3D6WA 1G3NC 1FINB 3GTOI 4DGLA 3F3FC 2W04A 1YIJ1 4BCPB 4NOZA 4RVFA 1VQP1 1VQN1 4BBSI 1YIJZ 3MI9B 1VQK1 2KI7B 3I551 1JJ2Y 3X24B 4NBHA 1FDOA 3G71Z 3A8GB 1Y1WI 2I3CA 2UZLB 3J80f 2B63I 1VYWB 3S2HI 3S16I 3DTOA 4A3MI 1Y1VI 2JR6A 2CZ7B 2KR6A 2QQ8A 4A3II 2I53A 1NJI2 3CMA1 3NH8A 4I3ZB 4RVDA 3HB9A 1Z01A 1RNIA 2JIRA 5DQWA 3FKII 1KQSZ 1VQ91 1KD11 1JKWA 3QYGB 2W9FA 1Q862 1H26B 3IX0A 1Y8CA 3VMHA 3RZOI 1VQ41 1UGRB 1Q811 1AD6A 1UGPB 3G6EZ 1I50I 1IREB 2W9ZA 4BCJB 1PFTA 3S1NI 5IDNB 1W98B 3X28B 1ZP2A 5IF1B 2QRCB 2RBLA 1URCB 2ZCFB 1V29B 4NSTB 1YJ91 4YOSA 2NVYI 4BY7I 1K9M1 2G9XB 4HNUA 3G4S1 4S1TA 1QXFA 4A3GI 1WJ2A 2QDJA 4F6UB 4CFUD 2QRDB 2F4OA 4NBEA 1KQSY 4Y52I 1VQOZ 1QMZB 1YUKA 4RODA 4BY1X 1QLBA 2VPWA 5IP9I 3BHUB 4EOKB 2EUFA 4HNTA 4ZGJB 4BBSM 3P5JB 3HOZI 3QZ9B 4BY1I 1GUXA 1H4LD 2WIHB 2HU9A 2OTLZ 4EOSB 2QEX1 2KMGA 2CCHB 3MY1B 5IHYA 3QWUA 1AISB 2DPPB 2O4HA 1VQMZ 3CCJ1 3NH4A 1K8A2 2V45A 1VQ61 1P5EB 5D1OB 5A2Qb 3CD6Z 2IZ4A 3B57A 1Q861 1TWCI 1M902 1KD12 3S17I 1GH6B 3CCE1 2DXBB 1TWHI 5EFQB 4HGYA 1RLYA 4HH4A 3TN8B 3HZJA 4JX6A 4F6WB 1JWHC 3CCEZ 1S721 1UGSB 4E2XA 3MIAB 4E2ZA 2C4GB 1YJN1 3M03A 1N8R1 1L1OC 2E2II 2WMAB 3CMEZ 3BHTB 4OR5B 1VQ7Z 2CCIB 5FLXb 4F7JB 4QTTA 3CC7Z 1VQM1 4BBRM 2C5OB 2GU2A 2DD4B 1YHQ1 3IF8A 3CCV1 4E33A 3LUSA 1Z03A 3CCM1 1QYPA 2O53A 4NBAA 1DL6A 2OZKA 3G711 3CXCZ 1OL1B 4Y72B 4EOPB 3BLRB 1E9HB 3F3PC 2PK9B 4E2YA 1TFIA 4CRLB 1VQO1 3CPWZ 1H24B 3BG1B 2CZ0B 2JNYA 2BS2A 3HHTB 2YU9I 1QF8A 4YOOA 1S72Z 4EC9B 4NB8A 2RIQA 3I56Z 3HO8A 1Q16A 4BCMD 5LL6f 3M3YI 1FVVB 4OB3B 2P28A 1H25B 4NBCA 4BCIB 2DE6A 4UN0A 3QYHB 4QTUA 2IW9B 3TNIB 1JJ2Z 2NVXI 1SIWA 5HBEB 4RVHA 2QDYB 4E32A 3VYGB 3G6E1 2WIPB 3FQQA 4NB9A 3VKHA 3RGFB 2W03A 2E2JI 5CM2M 4ROCA 1VQ81 4II5B 2DE5A 2Q51A 5C44I 2JA8I 3GTMI 3MZKB 1XO2A 1TWAI 2P3YA 3GCFA 4HNVA 3D9XA 3X25B 2PMZA 4CFVB 3K7AM 3G4SZ 2WJ9A 2BS3A 5D1PA 1W2BZ 2EGTA 3Q87A 3A8OB 3HKZA 4NBGA 3DDPB 4BCOB 4NBBA 3CC2Z 3CPWY 3H3VJ 4EOMB 4F7LB 5I5ZB 3IFUA 4BBRI 3PO3I 1YJNZ 5HVYB 4EOIB 4EOOB 3WVEB 3CC21 4NC6A 2RPRA 2GTIA 4OB0B 2QA4Z 3CC4Z 2CYZB 3X20B 4A3LI 1QVFZ 3IR7A 1Q812 2PHGA 3DL1A 4MFDA 1ZB9A 4BCND 4EOJB 2G2KA 2OTL1 1OGUB 2JUBA 3T4NB 3KIFA 1I6HI 2JA6I 3F5XB 1GUXB 5FGKB 1VQ8Z 2V8JA 1Y1VS 2LEXA 1KXUA 1BU2A 1K732 2WMBB 4ELJA 2WXVB 1USPB 1FKMA 3CD61 2HF1A 1NJI1 3LQ5B 3S1RI 3GTPI 3S2DI 3NDIA 4LOCA 1OL2B 4AKHA 5IT9f 2D0QB 4BCFB 4ZGDB 2IW6B 4QSHA 2OTJZ 1QVGZ 3VB9A 2R93I 4E2WA 3MONA 5BNJB 2IZ3A 4OB1B 4XX2A 3CCU1 2W99A 2JIPA 2WB1A 1OIYB 5T64A 3BG5A 1AA6A 3JAMb 4MH4A 2QEXZ 3CCRZ 1VQ51 1AHJB 2PK7A 3GTKI 2CZ1B 3OW2Y 3NH5A 2IVXA 4CFXB 1Q821
chains in the Genus database with same CATH topology
2E2HI 1VQNZ 4EWCA 1K83I 4E31A 5D1OA 1SFOI 3M4OI 1M1K1 1RQFA 2QLVB 3H0GI 1S7MA 1KC81 1Q822 2VF1A 2JA5I 1NP6A 1ML8A 3I4NI 4MD8A 2YADA 4RV9A 4A3BI 2RHBA 1X0TA 4HGZA 3VMIA 5A2Qf 1VQKZ 2DE7A 1YHQZ 2ZAEB 2LFUA 4NBFA 1YJW1 3GTGI 3CCMZ 1M901 3J81f 2JMOA 3VMGA 1RO0A 1K8A1 2JA7I 3S15I 4MONA 3HOXI 3CQZI 3VTNA 3CCQ1 1USPA 4A3DI 3BG0B 2OTJ1 1W2BY 3GTJI 5FLXf 3CXCY 3CCUZ 3K7AI 1VQPZ 2H85A 1RO4A 1YI21 1X3WA 4Y7NI 2QA41 1TWGI 1YITZ 5C4XI 1QVFY 1K9M2 3HOYI 1VQ6Z 4MXUA 1VLAA 4BXXX 1LQLA 3KIHA 1YUAA 4DQYB 1WIIA 5C4JI 2BJOA 2LIYA 3GTLI 1RO2A 3HOVI 2F4MA 3GKQA 1Z02A 3NDJA 3I4MI 4X6AI 3NDQA 2V8KA 3CCR1 1X3ZA 1YJWZ 4NH1C 2GTHA 1YIT1 5C3EI 2R7ZI 2PM9A 1VQLZ 3U50C 1ZH1A 3EEDA 2R92I 1QVGY 2VUMI 1VQL1 4A3CI 5IT9b 2AKLA 5IP7I 1N8R2 3S14I 3TE5B 2Q4ZA 4NBDA 1ZB8A 1M1K2 1VQ9Z 2KPIA 3CC71 5T67A 3EERA 3I55Z 3CCLZ 3S1QI 3CCJZ 4A3EI 3GTQI 2DMEA 2E9HA 3S1MI 3CCSZ 2JS4A 4MRIA 2R6MA 2WAQA 3OW2Z 1KRLA 2RT9A 2M48A 3PO3S 1ENWA 3CCS1 2M6NA 3PO2I 1P9NA 3J80b 3GTMS 2OOYB 5T6BA 2K5RA 4BXXI 1WW9A 1Q7Y1 1K731 1VQ5Z 2VUGA 3JAMf 3HOWI 3J7A4 3CCL1 3J81b 1I3QI 4RVGA 4A3FI 2NVTI 2QKDA 1VQ71 1N2FA 2K3RA 4NFRA 3HOUI 2NVQI 1R9TI 4AYBA 3MZLB 4A3KI 2Y0SA 1WCMI 5FLMI 3FQMA 3CMAZ 3I561 4TNUA 3I07A 3ESWA 3CC41 1Q7Y2 5AN9F 1YI2Z 4RS4A 3CME1 4BY7X 3TDHB 4MD9A 2J6AA 4E30A 4MD7A 1TWFI 1YJ9Z 3CCVZ 4CL1A 2V8IA 3NFZA 2LW4A 1NUIA 2OOXB 2QREB 4A3JI 4DK1A 4A93I 3RZDI 1KC82 3CCQZ 2QR1B 3D6WA 3GTOI 4DGLA 3F3FC 2W04A 1YIJ1 4NOZA 4RVFA 1VQP1 4BBSI 1YIJZ 1VQK1 2KI7B 3I551 1JJ2Y 4NBHA 3G71Z 1Y1WI 2I3CA 3J80f 2B63I 3S2HI 3S16I 4A3MI 1Y1VI 2JR6A 4A3II 1NJI2 3CMA1 3NH8A 4RVDA 1Z01A 3FKII 1RNIA 1KQSZ 1VQ91 1KD11 1Q862 3IX0A 3VMHA 3RZOI 1VQ41 1Q811 3G6EZ 1I50I 1PFTA 3S1NI 2QRCB 2RBLA 1YJ91 2NVYI 4BY7I 1K9M1 3G4S1 4S1TA 4A3GI 1KQSY 2QRDB 2F4OA 4NBEA 4Y52I 1VQOZ 1YUKA 4BY1X 5IP9I 3P5JB 3HOZI 4BY1I 2HU9A 2OTLZ 2QEX1 3QWUA 2O4HA 1VQMZ 3CCJ1 3NH4A 1K8A2 1VQ61 5D1OB 5A2Qb 3CD6Z 2IZ4A 1Q861 1TWCI 1M902 1KD12 3S17I 3CCE1 1TWHI 4HGYA 1RLYA 4HH4A 1JWHC 3CCEZ 1S721 4E2XA 4E2ZA 1YJN1 1N8R1 1L1OC 2E2II 3CMEZ 1VQ7Z 3CC7Z 5FLXb 4QTTA 1VQM1 2GU2A 1YHQ1 3IF8A 3CCV1 4E33A 3LUSA 1Z03A 3CCM1 1QYPA 2O53A 4NBAA 1DL6A 2OZKA 3G711 3CXCZ 3F3PC 4E2YA 1TFIA 1VQO1 3CPWZ 3BG1B 2JNYA 2YU9I 1QF8A 1S72Z 4NB8A 2RIQA 3I56Z 5LL6f 3M3YI 2P28A 4NBCA 2DE6A 4QTUA 1JJ2Z 2NVXI 4RVHA 4E32A 3G6E1 3FQQA 4NB9A 2W03A 2E2JI 5CM2M 1VQ81 2DE5A 2Q51A 5C44I 2JA8I 3GTMI 3MZKB 1TWAI 2P3YA 3GCFA 3D9XA 2PMZA 3G4SZ 5D1PA 1W2BZ 2EGTA 3Q87A 3CC2Z 3HKZA 4NBGA 3CPWY 3H3VJ 4NBBA 3IFUA 4BBRI 3PO3I 1YJNZ 3CC21 2RPRA 2GTIA 2QA4Z 3CC4Z 4A3LI 1QVFZ 1Q812 1ZB9A 2G2KA 2OTL1 2JUBA 3T4NB 3KIFA 1I6HI 2JA6I 1VQ8Z 2V8JA 1Y1VS 1K732 1USPB 3CD61 2HF1A 1NJI1 3GTPI 3S1RI 3S2DI 3NDIA 5IT9f 2OTJZ 1QVGZ 3VB9A 2R93I 4E2WA 3MONA 2IZ3A 1VQ4Z 4XX2A 3CCU1 2WB1A 1VQN1 3CCRZ 5T64A 1VQ51 3JAMb 4MH4A 2QEXZ 2PK7A 3GTKI 3OW2Y 3NH5A 1Q821
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H I;  1L1O C;  3U50 C;  1K83 I;  2E2I I;  1SFO I;  3M4O I;  2R92 I;  3D6W A;  2VUM I;  3GTO I;  4QTT A;  4A3C I;  4NOZ A;  2AKL A;  5IP7 I;  3H0G I;  3S14 I;  4NBD A;  1ZB8 A;  3LUS A;  2JA5 I;  1QYP A;  2KPI A;  4NBA A;  1ML8 A;  4BBS I;  1DL6 A;  4NBH A;  3EER A;  3S1Q I;  1Y1W I;  3GTQ I;  4A3E I;  3I4N I;  2DME A;  2B63 I;  1TFI A;  3S2H I;  3S16 I;  4A3B I;  4A3M I;  3S1M I;  2JNY A;  1Y1V I;  2JR6 A;  2YU9 I;  2JS4 A;  4NB8 A;  3VMI A;  4A3I I;  2DE7 A;  3M3Y I;  4NBF A;  3FKI I;  3GTG I;  3PO3 S;  1ENW A;  4NBC A;  3PO2 I;  2DE6 A;  4QTU A;  3VMH A;  3RZO I;  3GTM S;  2K5R A;  3VMG A;  2NVX I;  2JA7 I;  4BXX I;  1WW9 A;  3S15 I;  3HOX I;  4NB9 A;  1I50 I;  2E2J I;  5CM2 M;  3CQZ I;  1PFT A;  3S1N I;  3HOW I;  2DE5 A;  5C44 I;  2JA8 I;  2RBL A;  1USP A;  3GTM I;  4A3D I;  1TWA I;  2P3Y A;  3GCF A;  3GTJ I;  2NVY I;  4BY7 I;  1I3Q I;  4A3F I;  2NVT I;  3K7A I;  1N2F A;  1RO4 A;  2R7Z I;  3Q87 A;  4NBG A;  3H3V J;  4NBB A;  4A3G I;  3HOU I;  2NVQ I;  4BBR I;  1R9T I;  3PO3 I;  1X3W A;  4NBE A;  2F4O A;  4Y7N I;  4Y52 I;  4BY1 X;  4A3K I;  1TWG I;  5IP9 I;  5C4X I;  1WCM I;  3HOY I;  5FLM I;  3HOZ I;  4A3L I;  4BY1 I;  1ZB9 A;  1VLA A;  4BXX X;  1LQL A;  1I6H I;  2JA6 I;  3I07 A;  1YUA A;  3ESW A;  5C4J I;  2BJO A;  1Y1V S;  3GTL I;  1USP B;  2HF1 A;  3HOV I;  2F4M A;  4BY7 X;  3GKQ A;  3GTP I;  1TWC I;  3S1R I;  3I4M I;  3S2D I;  4X6A I;  2J6A A;  3NDQ A;  3S17 I;  1TWF I;  3VB9 A;  2R93 I;  2LW4 A;  1TWH I;  1X3Z A;  1NUI A;  4XX2 A;  4A3J I;  1RLY A;  4MH4 A;  4A93 I;  2PK7 A;  3GTK I;  5C3E I;  3RZD I; 
#chains in the Genus database with same CATH topology
 2E2H I;  4BCG B;  2ZPI B;  2IW8 B;  1VQN Z;  4MFE A;  4EWC A;  1K83 I;  4E31 A;  3G33 B;  2W2H A;  5D1O A;  1SFO I;  4EOR B;  1N4M A;  3BHV B;  3M4O I;  1M1K 1;  1RQF A;  2QLV B;  2UZB B;  3BLQ B;  3H0G I;  1S7M A;  4M6V A;  1KC8 1;  2V22 B;  3QXE B;  1Q82 2;  2BS4 A;  2VF1 A;  2JA5 I;  1NP6 A;  4EOQ B;  4HLQ A;  1ML8 A;  3EOC B;  4G6L B;  2UZE B;  1UNH D;  2CZ6 B;  4F70 B;  3I4N I;  4MD8 A;  2ZZD B;  2YAD A;  4RV9 A;  1FDI A;  4A3B I;  2RHB A;  4BCN B;  1X0T A;  4HGZ A;  3VMI A;  5A2Q f;  1VQK Z;  2DE7 A;  2DXC B;  2ZAE B;  1YHQ Z;  2LFU A;  1OIU B;  2I40 B;  4NBF A;  1YJW 1;  1UGQ B;  5LQF B;  2WEV B;  3GTG I;  3CCM Z;  1M90 1;  1GY3 B;  3VKG A;  1JSU B;  3J81 f;  2JMO A;  3A8M B;  2VPY A;  2BPM B;  3VMG A;  1RO0 A;  1K8A 1;  2JA7 I;  3S15 I;  4MON A;  3HOX I;  1H27 B;  3H4C A;  4JX5 A;  1O9K A;  4F6S B;  1E7P A;  2C6T B;  3CQZ I;  3VTN A;  3CCQ 1;  5DQV A;  3BG3 A;  2UZD B;  3TW6 A;  1OI9 B;  4AKG A;  1OKW B;  1USP A;  3QWL A;  5ACB A;  3BG0 B;  3GTJ I;  1W2B Y;  2OTJ 1;  5FLX f;  3CXC Y;  3CCU Z;  3K7A I;  1H28 B;  1UNL D;  2H85 A;  1VQP Z;  1RO4 A;  2WFY B;  1H1Q B;  2PMI B;  1YI2 1;  1X3W A;  4Y7N I;  2QA4 1;  4IMY B;  1TWG I;  1YIT Z;  5C4X I;  1QVF Y;  1K9M 2;  1PKD B;  3HOY I;  1VQ6 Z;  3DJB A;  4MXU A;  2JIQ A;  1VLA A;  4BXX X;  5L2W B;  2V3V A;  1VQ4 Z;  1LQL A;  3X26 B;  5IDP B;  2E7Z A;  3KIH A;  1YUA A;  4DQY B;  1WII A;  5C4J I;  2X1N B;  3BLH B;  2BJO A;  2LIY A;  3GTL I;  3DDQ B;  1RO2 A;  3HOV I;  2F4M A;  3GKQ A;  1Z02 A;  2PJQ A;  3NDJ A;  3O0G D;  2QFZ A;  3I4M I;  4ROE A;  4X6A I;  1D3U B;  1C9B A;  3NDQ A;  4Z6Y A;  4BCQ D;  3DOG B;  4CFM B;  2V8K A;  3CCR 1;  1X3Z A;  2C5V B;  1YJW Z;  5HBJ B;  4NH1 C;  5HNB B;  2GTH A;  2IN3 A;  1YIT 1;  3EJ1 B;  2JIM A;  5C3E I;  2R7Z I;  2R7G A;  2PM9 A;  1VQL Z;  2ZPF B;  3U50 C;  5CEI B;  1ZH1 A;  3EED A;  2IV2 X;  2R92 I;  4CXA B;  1QVG Y;  2VUM I;  4BCH B;  1VQL 1;  2WPA B;  4A3C I;  5IT9 b;  3WVD B;  2AKL A;  5IP7 I;  4JX4 A;  1N8R 2;  3S14 I;  3TE5 B;  2Q4Z A;  4NBD A;  1ZB8 A;  1M1K 2;  1VQ9 Z;  3EID B;  4EC8 B;  2JIO A;  2KPI A;  2VPX A;  1VIN A;  4CFU B;  4YOZ A;  3CC7 1;  5T67 A;  4F7N B;  3BG9 A;  1WZN A;  3EER A;  3I55 Z;  3CCL Z;  3S1Q I;  3CCJ Z;  4A3E I;  3GTQ I;  2DME A;  2ZPE B;  2E9H A;  2NAP A;  4ELL A;  3S1M I;  2ZPB B;  3POM A;  3CCS Z;  4CFN B;  3HBL A;  2JS4 A;  4CFW B;  4MRI A;  2R6M A;  2WAQ A;  4FX3 B;  3OW2 Z;  1KRL A;  4HL4 A;  1VOL A;  2C5N B;  1UNG D;  2B9R A;  2CJM B;  2M48 A;  3PO3 S;  2RT9 A;  1ENW A;  4KRC B;  3CCS 1;  2M6N A;  3PO2 I;  1P9N A;  4EON B;  5EJC A;  1JST B;  3J80 b;  1O9K B;  3GTM S;  4F7S B;  2OOY B;  2QF7 A;  5T6B A;  2K5R A;  4BXX I;  1WW9 A;  1Q7Y 1;  1K73 1;  3QYE A;  4BCQ B;  1VQ5 Z;  2VUG A;  1JOW A;  4EOL B;  3JAM f;  3HOW I;  4KRD B;  4BCK B;  2QGS A;  2WHB B;  3J7A 4;  3CCL 1;  2DD5 B;  1H1R B;  2UUE B;  5CYI B;  3J81 b;  4OB2 B;  4OGR B;  1I3Q I;  4RVG A;  4A3F I;  2NVT I;  2QKD A;  1VQ7 1;  1N2F A;  2K3R A;  4ZGE B;  4NFR A;  3MY5 B;  5ICP B;  3TNH B;  3HOU I;  3A8L B;  3KHI A;  1H1S B;  2NVQ I;  3QHW B;  1R9T I;  2ZPG B;  4AYB A;  3TNW B;  4A3D I;  5HQ0 B;  3MZL B;  4A3K I;  5HBH B;  2Y0S A;  1F5Q B;  2ZPH B;  1WCM I;  1TFB A;  5FLM I;  3FQM A;  3CMA Z;  1TD6 A;  2AHJ B;  3I56 1;  4TNU A;  3I07 A;  4FM4 B;  3QHR B;  2VPZ A;  3ESW A;  3A8H B;  3CC4 1;  1Q7Y 2;  5AN9 F;  1YI2 Z;  3QZ5 B;  4RS4 A;  2PK2 A;  2F2C A;  3CME 1;  4BY7 X;  3TDH B;  3QYB A;  4BCM B;  4MD9 A;  1H1P B;  2BKZ B;  2JGZ B;  1OKV B;  5LMK B;  2J6A A;  4E30 A;  4MD7 A;  1TWF I;  3D2L A;  1YJ9 Z;  3CCV Z;  4CL1 A;  2V8I A;  4MIM A;  3NFZ A;  2LW4 A;  1NUI A;  2OOX B;  2QRE B;  4A3J I;  2AYD A;  4DK1 A;  4A93 I;  4AI6 A;  3RZD I;  4AKI A;  1KC8 2;  4YC3 B;  3CCQ Z;  2G77 A;  2QR1 B;  3VYH B;  4TTH A;  3TW7 A;  2W96 A;  2C5X B;  3D6W A;  1G3N C;  1FIN B;  3GTO I;  4DGL A;  3F3F C;  2W04 A;  1YIJ 1;  4BCP B;  4NOZ A;  4RVF A;  1VQP 1;  1VQN 1;  4BBS I;  1YIJ Z;  3MI9 B;  1VQK 1;  2KI7 B;  3I55 1;  1JJ2 Y;  3X24 B;  4NBH A;  1FDO A;  3G71 Z;  3A8G B;  1Y1W I;  2I3C A;  2UZL B;  3J80 f;  2B63 I;  1VYW B;  3S2H I;  3S16 I;  3DTO A;  4A3M I;  1Y1V I;  2JR6 A;  2CZ7 B;  2KR6 A;  2QQ8 A;  4A3I I;  2I53 A;  1NJI 2;  3CMA 1;  3NH8 A;  4I3Z B;  4RVD A;  3HB9 A;  1Z01 A;  1RNI A;  2JIR A;  5DQW A;  3FKI I;  1KQS Z;  1VQ9 1;  1KD1 1;  1JKW A;  3QYG B;  2W9F A;  1Q86 2;  1H26 B;  3IX0 A;  1Y8C A;  3VMH A;  3RZO I;  1VQ4 1;  1UGR B;  1Q81 1;  1AD6 A;  1UGP B;  3G6E Z;  1I50 I;  1IRE B;  2W9Z A;  4BCJ B;  1PFT A;  3S1N I;  5IDN B;  1W98 B;  3X28 B;  1ZP2 A;  5IF1 B;  2QRC B;  2RBL A;  1URC B;  2ZCF B;  1V29 B;  4NST B;  1YJ9 1;  4YOS A;  2NVY I;  4BY7 I;  1K9M 1;  2G9X B;  4HNU A;  3G4S 1;  4S1T A;  1QXF A;  4A3G I;  1WJ2 A;  2QDJ A;  4F6U B;  4CFU D;  2QRD B;  2F4O A;  4NBE A;  1KQS Y;  4Y52 I;  1VQO Z;  1QMZ B;  1YUK A;  4ROD A;  4BY1 X;  1QLB A;  2VPW A;  5IP9 I;  3BHU B;  4EOK B;  2EUF A;  4HNT A;  4ZGJ B;  4BBS M;  3P5J B;  3HOZ I;  3QZ9 B;  4BY1 I;  1GUX A;  1H4L D;  2WIH B;  2HU9 A;  2OTL Z;  4EOS B;  2QEX 1;  2KMG A;  2CCH B;  3MY1 B;  5IHY A;  3QWU A;  1AIS B;  2DPP B;  2O4H A;  1VQM Z;  3CCJ 1;  3NH4 A;  1K8A 2;  2V45 A;  1VQ6 1;  1P5E B;  5D1O B;  5A2Q b;  3CD6 Z;  2IZ4 A;  3B57 A;  1Q86 1;  1TWC I;  1M90 2;  1KD1 2;  3S17 I;  1GH6 B;  3CCE 1;  2DXB B;  1TWH I;  5EFQ B;  4HGY A;  1RLY A;  4HH4 A;  3TN8 B;  3HZJ A;  4JX6 A;  4F6W B;  1JWH C;  3CCE Z;  1S72 1;  1UGS B;  4E2X A;  3MIA B;  4E2Z A;  2C4G B;  1YJN 1;  3M03 A;  1N8R 1;  1L1O C;  2E2I I;  2WMA B;  3CME Z;  3BHT B;  4OR5 B;  1VQ7 Z;  2CCI B;  5FLX b;  4F7J B;  4QTT A;  3CC7 Z;  1VQM 1;  4BBR M;  2C5O B;  2GU2 A;  2DD4 B;  1YHQ 1;  3IF8 A;  3CCV 1;  4E33 A;  3LUS A;  1Z03 A;  3CCM 1;  1QYP A;  2O53 A;  4NBA A;  1DL6 A;  2OZK A;  3G71 1;  3CXC Z;  1OL1 B;  4Y72 B;  4EOP B;  3BLR B;  1E9H B;  3F3P C;  2PK9 B;  4E2Y A;  1TFI A;  4CRL B;  1VQO 1;  3CPW Z;  1H24 B;  3BG1 B;  2CZ0 B;  2JNY A;  2BS2 A;  3HHT B;  2YU9 I;  1QF8 A;  4YOO A;  1S72 Z;  4EC9 B;  4NB8 A;  2RIQ A;  3I56 Z;  3HO8 A;  1Q16 A;  4BCM D;  5LL6 f;  3M3Y I;  1FVV B;  4OB3 B;  2P28 A;  1H25 B;  4NBC A;  4BCI B;  2DE6 A;  4UN0 A;  3QYH B;  4QTU A;  2IW9 B;  3TNI B;  1JJ2 Z;  2NVX I;  1SIW A;  5HBE B;  4RVH A;  2QDY B;  4E32 A;  3VYG B;  3G6E 1;  2WIP B;  3FQQ A;  4NB9 A;  3VKH A;  3RGF B;  2W03 A;  2E2J I;  5CM2 M;  4ROC A;  1VQ8 1;  4II5 B;  2DE5 A;  2Q51 A;  5C44 I;  2JA8 I;  3GTM I;  3MZK B;  1XO2 A;  1TWA I;  2P3Y A;  3GCF A;  4HNV A;  3D9X A;  3X25 B;  2PMZ A;  4CFV B;  3K7A M;  3G4S Z;  2WJ9 A;  2BS3 A;  5D1P A;  1W2B Z;  2EGT A;  3Q87 A;  3A8O B;  3HKZ A;  4NBG A;  3DDP B;  4BCO B;  4NBB A;  3CC2 Z;  3CPW Y;  3H3V J;  4EOM B;  4F7L B;  5I5Z B;  3IFU A;  4BBR I;  3PO3 I;  1YJN Z;  5HVY B;  4EOI B;  4EOO B;  3WVE B;  3CC2 1;  4NC6 A;  2RPR A;  2GTI A;  4OB0 B;  2QA4 Z;  3CC4 Z;  2CYZ B;  3X20 B;  4A3L I;  1QVF Z;  3IR7 A;  1Q81 2;  2PHG A;  3DL1 A;  4MFD A;  1ZB9 A;  4BCN D;  4EOJ B;  2G2K A;  2OTL 1;  1OGU B;  2JUB A;  3T4N B;  3KIF A;  1I6H I;  2JA6 I;  3F5X B;  1GUX B;  5FGK B;  1VQ8 Z;  2V8J A;  1Y1V S;  2LEX A;  1KXU A;  1BU2 A;  1K73 2;  2WMB B;  4ELJ A;  2WXV B;  1USP B;  1FKM A;  3CD6 1;  2HF1 A;  1NJI 1;  3LQ5 B;  3S1R I;  3GTP I;  3S2D I;  3NDI A;  4LOC A;  1OL2 B;  4AKH A;  5IT9 f;  2D0Q B;  4BCF B;  4ZGD B;  2IW6 B;  4QSH A;  2OTJ Z;  1QVG Z;  3VB9 A;  2R93 I;  4E2W A;  3MON A;  5BNJ B;  2IZ3 A;  4OB1 B;  4XX2 A;  3CCU 1;  2W99 A;  2JIP A;  2WB1 A;  1OIY B;  5T64 A;  3BG5 A;  1AA6 A;  3JAM b;  4MH4 A;  2QEX Z;  3CCR Z;  1VQ5 1;  1AHJ B;  2PK7 A;  3GTK I;  2CZ1 B;  3OW2 Y;  3NH5 A;  2IVX A;  4CFX B;  1Q82 1; 
#chains in the Genus database with same CATH homology
 2E2H I;  1VQN Z;  4EWC A;  1K83 I;  4E31 A;  5D1O A;  1SFO I;  3M4O I;  1M1K 1;  1RQF A;  2QLV B;  3H0G I;  1S7M A;  1KC8 1;  1Q82 2;  2VF1 A;  2JA5 I;  1NP6 A;  1ML8 A;  3I4N I;  4MD8 A;  2YAD A;  4RV9 A;  4A3B I;  2RHB A;  1X0T A;  4HGZ A;  3VMI A;  5A2Q f;  1VQK Z;  2DE7 A;  1YHQ Z;  2ZAE B;  2LFU A;  4NBF A;  1YJW 1;  3GTG I;  3CCM Z;  1M90 1;  3J81 f;  2JMO A;  3VMG A;  1RO0 A;  1K8A 1;  2JA7 I;  3S15 I;  4MON A;  3HOX I;  3CQZ I;  3VTN A;  3CCQ 1;  1USP A;  4A3D I;  3BG0 B;  2OTJ 1;  1W2B Y;  3GTJ I;  5FLX f;  3CXC Y;  3CCU Z;  3K7A I;  1VQP Z;  2H85 A;  1RO4 A;  1YI2 1;  1X3W A;  4Y7N I;  2QA4 1;  1TWG I;  1YIT Z;  5C4X I;  1QVF Y;  1K9M 2;  3HOY I;  1VQ6 Z;  4MXU A;  1VLA A;  4BXX X;  1LQL A;  3KIH A;  1YUA A;  4DQY B;  1WII A;  5C4J I;  2BJO A;  2LIY A;  3GTL I;  1RO2 A;  3HOV I;  2F4M A;  3GKQ A;  1Z02 A;  3NDJ A;  3I4M I;  4X6A I;  3NDQ A;  2V8K A;  3CCR 1;  1X3Z A;  1YJW Z;  4NH1 C;  2GTH A;  1YIT 1;  5C3E I;  2R7Z I;  2PM9 A;  1VQL Z;  3U50 C;  1ZH1 A;  3EED A;  2R92 I;  1QVG Y;  2VUM I;  1VQL 1;  4A3C I;  5IT9 b;  2AKL A;  5IP7 I;  1N8R 2;  3S14 I;  3TE5 B;  2Q4Z A;  4NBD A;  1ZB8 A;  1M1K 2;  1VQ9 Z;  2KPI A;  3CC7 1;  5T67 A;  3EER A;  3I55 Z;  3CCL Z;  3S1Q I;  3CCJ Z;  4A3E I;  3GTQ I;  2DME A;  2E9H A;  3S1M I;  3CCS Z;  2JS4 A;  4MRI A;  2R6M A;  2WAQ A;  3OW2 Z;  1KRL A;  2RT9 A;  2M48 A;  3PO3 S;  1ENW A;  3CCS 1;  2M6N A;  3PO2 I;  1P9N A;  3J80 b;  3GTM S;  2OOY B;  5T6B A;  2K5R A;  4BXX I;  1WW9 A;  1Q7Y 1;  1K73 1;  1VQ5 Z;  2VUG A;  3JAM f;  3HOW I;  3J7A 4;  3CCL 1;  3J81 b;  1I3Q I;  4RVG A;  4A3F I;  2NVT I;  2QKD A;  1VQ7 1;  1N2F A;  2K3R A;  4NFR A;  3HOU I;  2NVQ I;  1R9T I;  4AYB A;  3MZL B;  4A3K I;  2Y0S A;  1WCM I;  5FLM I;  3FQM A;  3CMA Z;  3I56 1;  4TNU A;  3I07 A;  3ESW A;  3CC4 1;  1Q7Y 2;  5AN9 F;  1YI2 Z;  4RS4 A;  3CME 1;  4BY7 X;  3TDH B;  4MD9 A;  2J6A A;  4E30 A;  4MD7 A;  1TWF I;  1YJ9 Z;  3CCV Z;  4CL1 A;  2V8I A;  3NFZ A;  2LW4 A;  1NUI A;  2OOX B;  2QRE B;  4A3J I;  4DK1 A;  4A93 I;  3RZD I;  1KC8 2;  3CCQ Z;  2QR1 B;  3D6W A;  3GTO I;  4DGL A;  3F3F C;  2W04 A;  1YIJ 1;  4NOZ A;  4RVF A;  1VQP 1;  4BBS I;  1YIJ Z;  1VQK 1;  2KI7 B;  3I55 1;  1JJ2 Y;  4NBH A;  3G71 Z;  1Y1W I;  2I3C A;  3J80 f;  2B63 I;  3S2H I;  3S16 I;  4A3M I;  1Y1V I;  2JR6 A;  4A3I I;  1NJI 2;  3CMA 1;  3NH8 A;  4RVD A;  1Z01 A;  3FKI I;  1RNI A;  1KQS Z;  1VQ9 1;  1KD1 1;  1Q86 2;  3IX0 A;  3VMH A;  3RZO I;  1VQ4 1;  1Q81 1;  3G6E Z;  1I50 I;  1PFT A;  3S1N I;  2QRC B;  2RBL A;  1YJ9 1;  2NVY I;  4BY7 I;  1K9M 1;  3G4S 1;  4S1T A;  4A3G I;  1KQS Y;  2QRD B;  2F4O A;  4NBE A;  4Y52 I;  1VQO Z;  1YUK A;  4BY1 X;  5IP9 I;  3P5J B;  3HOZ I;  4BY1 I;  2HU9 A;  2OTL Z;  2QEX 1;  3QWU A;  2O4H A;  1VQM Z;  3CCJ 1;  3NH4 A;  1K8A 2;  1VQ6 1;  5D1O B;  5A2Q b;  3CD6 Z;  2IZ4 A;  1Q86 1;  1TWC I;  1M90 2;  1KD1 2;  3S17 I;  3CCE 1;  1TWH I;  4HGY A;  1RLY A;  4HH4 A;  1JWH C;  3CCE Z;  1S72 1;  4E2X A;  4E2Z A;  1YJN 1;  1N8R 1;  1L1O C;  2E2I I;  3CME Z;  1VQ7 Z;  3CC7 Z;  5FLX b;  4QTT A;  1VQM 1;  2GU2 A;  1YHQ 1;  3IF8 A;  3CCV 1;  4E33 A;  3LUS A;  1Z03 A;  3CCM 1;  1QYP A;  2O53 A;  4NBA A;  1DL6 A;  2OZK A;  3G71 1;  3CXC Z;  3F3P C;  4E2Y A;  1TFI A;  1VQO 1;  3CPW Z;  3BG1 B;  2JNY A;  2YU9 I;  1QF8 A;  1S72 Z;  4NB8 A;  2RIQ A;  3I56 Z;  5LL6 f;  3M3Y I;  2P28 A;  4NBC A;  2DE6 A;  4QTU A;  1JJ2 Z;  2NVX I;  4RVH A;  4E32 A;  3G6E 1;  3FQQ A;  4NB9 A;  2W03 A;  2E2J I;  5CM2 M;  1VQ8 1;  2DE5 A;  2Q51 A;  5C44 I;  2JA8 I;  3GTM I;  3MZK B;  1TWA I;  2P3Y A;  3GCF A;  3D9X A;  2PMZ A;  3G4S Z;  5D1P A;  1W2B Z;  2EGT A;  3Q87 A;  3CC2 Z;  3HKZ A;  4NBG A;  3CPW Y;  3H3V J;  4NBB A;  3IFU A;  4BBR I;  3PO3 I;  1YJN Z;  3CC2 1;  2RPR A;  2GTI A;  2QA4 Z;  3CC4 Z;  4A3L I;  1QVF Z;  1Q81 2;  1ZB9 A;  2G2K A;  2OTL 1;  2JUB A;  3T4N B;  3KIF A;  1I6H I;  2JA6 I;  1VQ8 Z;  2V8J A;  1Y1V S;  1K73 2;  1USP B;  3CD6 1;  2HF1 A;  1NJI 1;  3GTP I;  3S1R I;  3S2D I;  3NDI A;  5IT9 f;  2OTJ Z;  1QVG Z;  3VB9 A;  2R93 I;  4E2W A;  3MON A;  2IZ3 A;  1VQ4 Z;  4XX2 A;  3CCU 1;  2WB1 A;  1VQN 1;  3CCR Z;  5T64 A;  1VQ5 1;  3JAM b;  4MH4 A;  2QEX Z;  2PK7 A;  3GTK I;  3OW2 Y;  3NH5 A;  1Q82 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...