3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
2DE5A 3I4MI 3RZOI 3PO3S 1I6HI 3GKQA 2JA8I 4A3BI 4BY1X 2DE7A 4BBRI 3U50C 2R7ZI 2E2II 2JA7I 3S2DI 4A3LI 1USPA 2E2HI 3GTPI 3GTMI 1TWFI 4BY7X 3GTKI 4A3II 1DL6A 3HOZI 3VMGA 5C3EI 2JA6I 1TWAI 1WW9A 3S14I 2JNYA 1TWCI 4NBHA 2JA5I 3GTJI 4NBBA 1ZB8A 4BY7I 2LW4A 2HF1A 3GCFA 1ML8A 3S1QI 3GTOI 5IP7I 4A93I 1PFTA 4NOZA 3I07A 3S15I 4A3FI 2F4MA 4QTUA 1LQLA 2JR6A 3M3YI 1TWHI 3GTQI 1Y1WI 4A3CI 2NVQI 5C4JI 2NVYI 2VUMI 3NDQA 2K5RA 1N2FA 4NBFA 3HOXI 4BY1I 3S2HI 2DE6A 5IP9I 1Y1VI 3S1NI 4Y7NI 1TFIA 1RO4A 3K7AI 5CM2M 2E2JI 1SFOI 1R9TI 3PO3I 2F4OA 3GTGI 1ZB9A 4A3EI 3I4NI 3LUSA 4NBGA 3HOUI 4A3JI 2R93I 3S1MI 3H3VJ 3PO2I 3VB9A 4BXXX 1X3WA 4Y52I 3M4OI 2R92I 4A3KI 5C44I 2P3YA 2B63I 1RLYA 4BXXI 4NBDA 1I50I 4XX2A 3HOWI 3VMHA 2PK7A 3D6WA 4BBSI 4NB9A 4A3GI 2YU9I 2JS4A 1I3QI 3GTMS 3S1RI 1Y1VS 2NVTI 3S16I 3VMIA 1X3ZA 3CQZI 1ENWA 4QTTA 3EERA 5FLMI 3RZDI 1K83I 4MH4A 4A3MI 2AKLA 3FKII 1TWGI 1L1OC 2RBLA 3Q87A 4NB8A 4NBCA 4NBAA 2NVXI 3HOVI 3ESWA 5C4XI 4NBEA 4X6AI 2DMEA 1USPB 1YUAA 1VLAA 2BJOA 4A3DI 1QYPA 1NUIA 3S17I 2KPIA 3HOYI 3H0GI 1WCMI 3GTLI 2J6AA
chains in the Genus database with same CATH superfamily
1OIYB 3MZKB 5CYIB 3I4MI 2BS3A 4BCKB 2DE7A 4YC3B 1XO2A 3U50C 3CCV1 2W96A 1Q811 3CXCZ 1W2BZ 5LMKB 3KIFA 2ZPGB 5AN9F 1D3UB 3GTMI 1KD11 3GTKI 1F5QB 3CCL1 5FGKB 3CC41 1VQNZ 3WVDB 4ELJA 1VQ4Z 3A8LB 3S14I 2GTHA 4JX6A 2QEXZ 3CC2Z 2Q4ZA 4TNUA 2KI7B 3FQMA 3GCFA 1YITZ 1SIWA 5IP7I 4A93I 3H4CA 5BNJB 3DTOA 1E7PA 1G3NC 4MFEA 2HU9A 4OR5B 4EWCA 3EIDB 3QHWB 1OL2B 1S721 4UN0A 3M3YI 1TWHI 1Y1WI 3TNHB 2PM9A 2RHBA 2PJQA 3BG1B 2WJ9A 5C4JI 3HO8A 4BBSM 1JSTB 2PMIB 1BU2A 1VQKZ 3CD6Z 3DDQB 5HBHB 1TFIA 1OI9B 1RO4A 2JIQA 3MY1B 2YADA 2CZ1B 2W9ZA 1AD6A 1V29B 2W03A 1YJW1 4F7SB 3X28B 1X0TA 3GTGI 4OGRB 4AI6A 4MXUA 3VKGA 2JIRA 4MD8A 3NDIA 2VUGA 3H3VJ 1YJN1 3D2LA 3VYHB 1Z01A 2P28A 1OGUB 1Q812 4Y52I 4OB0B 2V22B 2G77A 2WIHB 3CCLZ 5T67A 2KMGA 1RLYA 3HHTB 1KD12 3J81b 2NAPA 3CCJ1 1P9NA 2LIYA 1QLBA 5HVYB 2QKDA 3IX0A 2C6TB 1AISB 4F6WB 3POMA 2WB1A 3CME1 5IDPB 5D1OA 2OOYB 1I3QI 4HH4A 1Q7Y2 2UZLB 1RO0A 4BCPB 3VKHA 1S72Z 3VMIA 3MY5B 3S16I 1K8A1 4JX4A 1VQ9Z 3RZDI 1H24B 4KRDB 4DQYB 3O0GD 4A3MI 3FKII 5IDNB 2IZ4A 2C4GB 2JUBA 4ELLA 3D9XA 2C5XB 3JAMf 4NSTB 2WEVB 5FLXf 4HNVA 4NBEA 2QA41 2DMEA 4E2WA 4HGZA 3BG3A 2PK2A 1RO2A 1UGSB 2UZBB 3A8MB 2BJOA 3CCU1 1E9HB 1UGPB 2QQ8A 2ZPIB 4ZGJB 3TW6A 4DGLA 4OB1B 1YJNZ 4RVHA 1VOLA 2KPIA 1KC81 1H26B 2JIOA 5I5ZB 2CYZB 1Q16A 2PK9B 3PO3S 4CL1A 3CC7Z 3CC21 3TDHB 2JA8I 4A3BI 3F5XB 4MIMA 5HQ0B 3CCJZ 2EUFA 1RQFA 1JWHC 4NFRA 2E2II 4AKIA 3CMEZ 3VTNA 1M901 2UZDB 4EOPB 1FDOA 1K731 4BY7X 1N8R1 1N4MA 1DL6A 1WIIA 1O9KA 3HOZI 4RVGA 2JA6I 3BG9A 5IT9b 1NJI1 1ZB8A 2C5NB 3HBLA 2WPAB 4BCIB 2QFZA 5IF1B 1K9M1 4BCFB 2IW6B 2LFUA 3A8OB 4NOZA 5LL6f 3I07A 2M6NA 2OOXB 2F4MA 4QTUA 2QA4Z 1LQLA 1YI2Z 1FKMA 2ZPBB 1FVVB 1Y8CA 2CZ6B 3CCUZ 2NVQI 3NDQA 2K5RA 3CPWY 1UNGD 1S7MA 3NFZA 2OTJZ 1GUXB 1YIJZ 3J80f 3MZLB 4BY1I 3S2HI 2WMAB 1Y1VI 1H27B 4Y7NI 1OL1B 1QMZB 2VPWA 3CCR1 3CCS1 1R9TI 1KC82 4CFUD 1FINB 1ZB9A 4NH1C 4RVFA 3LUSA 4CFUB 4NBGA 4EOKB 4Z6YA 3NH5A 2E7ZA 3QWUA 3G4S1 3PO2I 4TTHA 1YJ91 3BHVB 3J81f 1ZH1A 4G6LB 2V8KA 1VQ51 1Q822 1FDIA 3M4OI 4EOSB 1VQ91 4A3KI 2P3YA 2DXBB 5LQFB 1K732 4NBDA 5EJCA 3CPWZ 2BS4A 4OB3B 4XX2A 1URCB 1N8R2 4NB9A 3QYBA 3IFUA 2WHBB 2JS4A 1YHQ1 1NJI2 3DOGB 5ACBA 2QR1B 2NVTI 1UGRB 1C9BA 3CQZI 3EOCB 2O53A 3EERA 5FLMI 2ZPHB 1QXFA 1QVGY 1GH6B 2QLVB 1TWGI 3J7A4 4EONB 1JKWA 2Q51A 3Q87A 2D0QB 3A8HB 4CFWB 3TE5B 2GTIA 3CC71 3RGFB 4BCJB 5A2Qb 4EC8B 4E2XA 1USPB 2O4HA 3CCRZ 4AYBA 3CCSZ 4E30A 2PHGA 3EJ1B 2ZPEB 1WZNA 1H28B 2VPXA 3G6E1 4E32A 3G4SZ 2G9XB 3G33B 4BCQD 1YJ9Z 1Q861 3HOYI 5EFQB 1VQ5Z 3VB9A 4RS4A 2IV2X 1JJ2Y 2DE5A 4BCQB 4YOSA 1JSUB 4ROCA 3RZOI 1YUKA 3GKQA 1QF8A 1QVGZ 3CCE1 1RNIA 3X20B 4HGYA 4BBRI 2R7ZI 4JX5A 2X1NB 2JA7I 5D1PA 2C5VB 2F2CA 1UNLD 1NP6A 5IT9f 1YHQZ 1YI21 4KRCB 4E2ZA 2CZ7B 3BLQB 4HLQA 1H1RB 2PMZA 1VQLZ 2R6MA 5C3EI 1TWAI 1WW9A 2JNYA 3QYHB 3QYGB 1TWCI 4F70B 4NBHA 3BHUB 1YIJ1 2OTJ1 2VF1A 2BKZB 2HF1A 2KR6A 1Z02A 1ML8A 4BY7I 1OKVB 4M6VA 2VPYA 3X24B 2C5OB 4F7LB 1PFTA 1JJ2Z 3A8GB 4A3FI 2UUEB 4I3ZB 2JR6A 3GTQI 1AA6A 4A3CI 1UNHD 2ZZDB 3MONA 4ZGEB 4E33A 1VQM1 1VQ81 3G6EZ 2VUMI 4CFXB 4NBFA 2VPZA 1VQO1 2DE6A 5IP9I 3HZJA 1WJ2A 3K7AI 5ICPB 3CCQ1 3PO3I 2CJMB 2QDJA 1Q862 2V8JA 3BG5A 2G2KA 3DDPB 3I4NI 4AKHA 3CCEZ 1K8A2 4A3JI 2R93I 2QGSA 1VQ61 2W9FA 4MD9A 2ZPFB 1Z03A 4BXXX 3T4NB 1X3WA 3F3FC 4BCGB 2R92I 4ROEA 4RODA 3OW2Y 2DPPB 2B63I 1H1PB 4MRIA 1GUXA 2RT9A 5T64A 3CMA1 3HOWI 1P5EB 1TFBA 2PK7A 4QSHA 4BBSI 4MD7A 4A3GI 2I53A 4OB2B 2YU9I 3WVEB 4BCOB 4YOOA 3GTMS 4MONA 3S1RI 3QXEB 1Y1VS 3VYGB 5HNBB 4HL4A 1ENWA 4QTTA 4MH4A 2OTL1 3QYEA 5A2Qf 1H25B 3TNIB 1VQMZ 1VYWB 1VQ8Z 1VQP1 2RBLA 4NB8A 4NBCA 2ZCFB 4NBAA 4MFDA 2NVXI 1VQOZ 3P5JB 3OW2Z 5C4XI 2RPRA 4EOQB 3M03A 4F6SB 3HB9A 2I3CA 2W04A 1M902 4EOJB 4X6AI 3CCQZ 2CZ0B 5HBEB 3QWLA 2JGZB 3K7AM 4CFVB 2BS2A 3LQ5B 3MIAB 5DQVA 1YUAA 2QRDB 4CXAB 2R7GA 1VQ6Z 1Q7Y1 1K9M2 1OKWB 2DD4B 4AKGA 1VQL1 1H4LD 2QREB 3GTLI 1IREB 3NDJA 4NC6A 3DL1A 1I6HI 2JMOA 1GY3B 4S1TA 4BY1X 2JIPA 3CMAZ 1VQ71 2RIQA 2IN3A 3IF8A 3S2DI 4A3LI 1USPA 1KXUA 2E2HI 4BCND 4F6UB 5CEIB 2K3RA 2V8IA 3G711 3GTPI 2W99A 1TWFI 1M1K1 3NH4A 2AYDA 3EEDA 3HKZA 4RV9A 4A3II 4BCNB 3VMGA 1W98B 2IZ3A 2JA5I 3J80b 2UZEB 4NBBA 4EOOB 3GTJI 2OTLZ 2CCIB 2LW4A 4HNTA 1KRLA 4DK1A 3CCM1 1KQSY 2M48A 3S1QI 3GTOI 1VQPZ 3CCVZ 3KIHA 3I561 4Y72B 3S15I 2IW8B 1OIUB 2EGTA 3TN8B 4EORB 3FQQA 4EOMB 1VINA 3X26B 2BPMB 3CC4Z 2QDYB 2NVYI 1N2FA 2E9HA 1QVFY 5IHYA 4HNUA 2DXCB 3IR7A 3HOXI 3I551 4II5B 3TW7A 3S1NI 2WMBB 4F7NB 5CM2M 2E2JI 3TNWB 1SFOI 4CRLB 2V3VA 2F4OA 3MI9B 5D1OB 3QZ5B 2IVXA 4A3EI 1VQ7Z 2CCHB 2ZAEB 4E31A 3BHTB 1KQSZ 3HOUI 2WXVB 1TD6A 3S1MI 3X25B 1JOWA 2GU2A 2H85A 4E2YA 3G71Z 3BG0B 5T6BA 2LEXA 5C44I 1ZP2A 1H1QB 3BLHB 4ZGDB 2DD5B 2IW9B 1M1K2 1YJWZ 4BXXI 3DJBA 1I50I 1QVFZ 3VMHA 3D6WA 2I40B 4BCMD 4EOIB 3CCMZ 2B9RA 4FX3B 4BCHB 3QZ9B 4YOZA 2JIMA 2V45A 3I56Z 4CFNB 4BCMB 2WFYB 4RVDA 1VQN1 1AHJB 1VQ41 3F3PC 1X3ZA 2QRCB 2QEX1 1PKDB 3KHIA 1K83I 4EC9B 2AKLA 1YIT1 5L2WB 1H1SB 4BBRM 2AHJB 1L1OC 1Q821 3CXCY 1W2BY 2QF7A 3HOVI 5HBJB 3BLRB 3ESWA 3QHRB 4F7JB 3I55Z 3NH8A 2Y0SA 2WAQA 1UGQB 4LOCA 3JAMb 4CFMB 1VLAA 5FLXb 4A3DI 1QYPA 3B57A 4FM4B 1O9KB 5DQWA 2WIPB 1NUIA 3S17I 3CD61 4EOLB 1VQK1 2OZKA 2W2HA 3H0GI 4IMYB 1WCMI 2J6AA
chains in the Genus database with same CATH topology
3MZKB 3I4MI 2DE7A 3U50C 3CCV1 1Q811 3CXCZ 1W2BZ 3KIFA 5AN9F 3GTMI 1KD11 3GTKI 3CCL1 3CC41 1VQNZ 1VQ4Z 3S14I 2GTHA 2QEXZ 3CC2Z 2Q4ZA 4TNUA 2KI7B 3FQMA 3GCFA 1YITZ 5IP7I 4A93I 2HU9A 4EWCA 1S721 3M3YI 1TWHI 1Y1WI 2PM9A 2RHBA 3BG1B 5C4JI 3CD6Z 1VQKZ 1TFIA 1RO4A 2YADA 2W03A 1YJW1 1X0TA 3GTGI 4MXUA 4MD8A 3NDIA 2VUGA 3H3VJ 1YJN1 1Z01A 2P28A 1Q812 4Y52I 3CCLZ 5T67A 1RLYA 1KD12 3J81b 3CCJ1 1P9NA 2LIYA 3IX0A 2QKDA 2WB1A 3CME1 5D1OA 2OOYB 1I3QI 4HH4A 1Q7Y2 1RO0A 1S72Z 3S16I 3VMIA 1K8A1 1VQ9Z 3RZDI 4DQYB 4A3MI 3FKII 2IZ4A 2JUBA 3D9XA 3JAMf 5FLXf 4NBEA 2QA41 2DMEA 4E2WA 4HGZA 1RO2A 3CCU1 2BJOA 4DGLA 1YJNZ 4RVHA 2KPIA 1KC81 3PO3S 4CL1A 3CC7Z 3CC21 3TDHB 2JA8I 4A3BI 3CCJZ 1RQFA 1JWHC 4NFRA 2E2II 3CMEZ 3VTNA 1M901 1K731 4BY7X 1N8R1 1DL6A 1WIIA 3HOZI 4RVGA 2JA6I 5IT9b 1NJI1 1ZB8A 1K9M1 2LFUA 4NOZA 5LL6f 3I07A 2M6NA 2OOXB 2F4MA 4QTUA 2QA4Z 1LQLA 1YI2Z 3CCUZ 2NVQI 3NDQA 2K5RA 3CPWY 2OTJZ 1S7MA 3NFZA 1YIJZ 3J80f 3MZLB 4BY1I 3S2HI 1Y1VI 4Y7NI 3CCR1 1R9TI 3CCS1 1KC82 1ZB9A 4NH1C 4RVFA 3LUSA 4NBGA 3NH5A 3QWUA 3G4S1 3PO2I 1YJ91 3J81f 1ZH1A 2V8KA 1VQ51 1Q822 3M4OI 1VQ91 4A3KI 2P3YA 1K732 4NBDA 3CPWZ 4XX2A 1N8R2 4NB9A 3IFUA 2JS4A 1YHQ1 1NJI2 2QR1B 2NVTI 3CQZI 3EERA 2O53A 5FLMI 1QVGY 2QLVB 1TWGI 3J7A4 2Q51A 3Q87A 3TE5B 2GTIA 3CC71 5A2Qb 4E2XA 1USPB 2O4HA 3CCRZ 4AYBA 3CCSZ 4E30A 3G6E1 4E32A 3G4SZ 3HOYI 1YJ9Z 1Q861 1VQ5Z 3VB9A 4RS4A 1JJ2Y 2DE5A 3RZOI 1YUKA 3GKQA 1QF8A 1QVGZ 3CCE1 1RNIA 4HGYA 4BBRI 2R7ZI 2JA7I 5D1PA 1NP6A 5IT9f 1YHQZ 1YI21 4E2ZA 2PMZA 1VQLZ 2R6MA 5C3EI 1TWAI 1WW9A 2JNYA 1TWCI 4NBHA 2OTJ1 1YIJ1 2VF1A 4BY7I 2HF1A 1Z02A 1ML8A 1PFTA 1JJ2Z 4A3FI 2JR6A 3GTQI 4A3CI 3MONA 1VQM1 4E33A 1VQ81 2VUMI 3G6EZ 4NBFA 1VQO1 2DE6A 5IP9I 3K7AI 3CCQ1 3PO3I 1Q862 2V8JA 2G2KA 3I4NI 3CCEZ 1K8A2 4A3JI 2R93I 1VQ61 4MD9A 1Z03A 4BXXX 3T4NB 1X3WA 3F3FC 2R92I 3OW2Y 2B63I 4MRIA 5T64A 2RT9A 3CMA1 3HOWI 2PK7A 4BBSI 4MD7A 4A3GI 2YU9I 3GTMS 4MONA 3S1RI 1Y1VS 4QTTA 1ENWA 4MH4A 2OTL1 5A2Qf 1VQMZ 1VQ8Z 1VQP1 2RBLA 4NB8A 4NBCA 4NBAA 2NVXI 1VQOZ 3OW2Z 3P5JB 5C4XI 2RPRA 4X6AI 2I3CA 2W04A 1M902 3CCQZ 1YUAA 2QRDB 1VQ6Z 1Q7Y1 1K9M2 1VQL1 2QREB 3GTLI 3NDJA 1I6HI 2JMOA 4S1TA 4BY1X 1VQ71 3CMAZ 2RIQA 3IF8A 3S2DI 4A3LI 1USPA 2E2HI 3GTPI 3G711 2K3RA 2V8IA 1M1K1 1TWFI 3NH4A 3EEDA 3HKZA 4RV9A 4A3II 3VMGA 2IZ3A 2JA5I 3J80b 3GTJI 4NBBA 2OTLZ 2LW4A 1KRLA 1KQSY 4DK1A 3CCM1 2M48A 3S1QI 3GTOI 1VQPZ 3CCVZ 3KIHA 3I561 3S15I 2EGTA 3FQQA 3CC4Z 2NVYI 1N2FA 2E9HA 1QVFY 3HOXI 3I551 3S1NI 5CM2M 2E2JI 1SFOI 2F4OA 5D1OB 4A3EI 1KQSZ 1VQ7Z 2ZAEB 4E31A 3HOUI 3S1MI 2GU2A 2H85A 4E2YA 3G71Z 3BG0B 5T6BA 5C44I 1M1K2 1YJWZ 4BXXI 1I50I 1QVFZ 3VMHA 3D6WA 3CCMZ 3I56Z 4RVDA 1VQN1 1VQ41 3F3PC 1X3ZA 2QRCB 2QEX1 1K83I 2AKLA 1YIT1 1L1OC 1Q821 3CXCY 1W2BY 3HOVI 3ESWA 3I55Z 3NH8A 2Y0SA 2WAQA 3JAMb 1VLAA 5FLXb 4A3DI 1QYPA 1NUIA 3S17I 3CD61 1VQK1 2OZKA 3H0GI 1WCMI 2J6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE5 A;  3I4M I;  3RZO I;  3PO3 S;  1I6H I;  3GKQ A;  2JA8 I;  4A3B I;  4BY1 X;  2DE7 A;  4BBR I;  3U50 C;  2R7Z I;  2E2I I;  2JA7 I;  3S2D I;  4A3L I;  1USP A;  2E2H I;  3GTP I;  3GTM I;  1TWF I;  4BY7 X;  3GTK I;  4A3I I;  1DL6 A;  3HOZ I;  3VMG A;  5C3E I;  2JA6 I;  1TWA I;  1WW9 A;  3S14 I;  2JNY A;  1TWC I;  4NBH A;  2JA5 I;  3GTJ I;  4NBB A;  1ZB8 A;  4BY7 I;  2LW4 A;  2HF1 A;  3GCF A;  1ML8 A;  3S1Q I;  3GTO I;  5IP7 I;  4A93 I;  1PFT A;  4NOZ A;  3I07 A;  3S15 I;  4A3F I;  2F4M A;  4QTU A;  1LQL A;  2JR6 A;  3M3Y I;  1TWH I;  3GTQ I;  1Y1W I;  4A3C I;  2NVQ I;  5C4J I;  2NVY I;  2VUM I;  3NDQ A;  2K5R A;  1N2F A;  4NBF A;  3HOX I;  4BY1 I;  3S2H I;  2DE6 A;  5IP9 I;  1Y1V I;  3S1N I;  4Y7N I;  1TFI A;  1RO4 A;  3K7A I;  5CM2 M;  2E2J I;  1SFO I;  1R9T I;  3PO3 I;  2F4O A;  3GTG I;  1ZB9 A;  4A3E I;  3I4N I;  3LUS A;  4NBG A;  3HOU I;  4A3J I;  2R93 I;  3S1M I;  3H3V J;  3PO2 I;  3VB9 A;  4BXX X;  1X3W A;  4Y52 I;  3M4O I;  2R92 I;  4A3K I;  5C44 I;  2P3Y A;  2B63 I;  1RLY A;  4BXX I;  4NBD A;  1I50 I;  4XX2 A;  3HOW I;  3VMH A;  2PK7 A;  3D6W A;  4BBS I;  4NB9 A;  4A3G I;  2YU9 I;  2JS4 A;  1I3Q I;  3GTM S;  3S1R I;  1Y1V S;  2NVT I;  3S16 I;  3VMI A;  1X3Z A;  3CQZ I;  1ENW A;  4QTT A;  3EER A;  5FLM I;  3RZD I;  1K83 I;  4MH4 A;  4A3M I;  2AKL A;  3FKI I;  1TWG I;  1L1O C;  2RBL A;  3Q87 A;  4NB8 A;  4NBC A;  4NBA A;  2NVX I;  3HOV I;  3ESW A;  5C4X I;  4NBE A;  4X6A I;  2DME A;  1USP B;  1YUA A;  1VLA A;  2BJO A;  4A3D I;  1QYP A;  1NUI A;  3S17 I;  2KPI A;  3HOY I;  3H0G I;  1WCM I;  3GTL I;  2J6A A; 
#chains in the Genus database with same CATH topology
 1OIY B;  3MZK B;  5CYI B;  3I4M I;  2BS3 A;  4BCK B;  2DE7 A;  4YC3 B;  1XO2 A;  3U50 C;  3CCV 1;  2W96 A;  1Q81 1;  3CXC Z;  1W2B Z;  5LMK B;  3KIF A;  2ZPG B;  5AN9 F;  1D3U B;  3GTM I;  1KD1 1;  3GTK I;  1F5Q B;  3CCL 1;  5FGK B;  3CC4 1;  1VQN Z;  3WVD B;  4ELJ A;  1VQ4 Z;  3A8L B;  3S14 I;  2GTH A;  4JX6 A;  2QEX Z;  3CC2 Z;  2Q4Z A;  4TNU A;  2KI7 B;  3FQM A;  3GCF A;  1YIT Z;  1SIW A;  5IP7 I;  4A93 I;  3H4C A;  5BNJ B;  3DTO A;  1E7P A;  1G3N C;  4MFE A;  2HU9 A;  4OR5 B;  4EWC A;  3EID B;  3QHW B;  1OL2 B;  1S72 1;  4UN0 A;  3M3Y I;  1TWH I;  1Y1W I;  3TNH B;  2PM9 A;  2RHB A;  2PJQ A;  3BG1 B;  2WJ9 A;  5C4J I;  3HO8 A;  4BBS M;  1JST B;  2PMI B;  1BU2 A;  1VQK Z;  3CD6 Z;  3DDQ B;  5HBH B;  1TFI A;  1OI9 B;  1RO4 A;  2JIQ A;  3MY1 B;  2YAD A;  2CZ1 B;  2W9Z A;  1AD6 A;  1V29 B;  2W03 A;  1YJW 1;  4F7S B;  3X28 B;  1X0T A;  3GTG I;  4OGR B;  4AI6 A;  4MXU A;  3VKG A;  2JIR A;  4MD8 A;  3NDI A;  2VUG A;  3H3V J;  1YJN 1;  3D2L A;  3VYH B;  1Z01 A;  2P28 A;  1OGU B;  1Q81 2;  4Y52 I;  4OB0 B;  2V22 B;  2G77 A;  2WIH B;  3CCL Z;  5T67 A;  2KMG A;  1RLY A;  3HHT B;  1KD1 2;  3J81 b;  2NAP A;  3CCJ 1;  1P9N A;  2LIY A;  1QLB A;  5HVY B;  2QKD A;  3IX0 A;  2C6T B;  1AIS B;  4F6W B;  3POM A;  2WB1 A;  3CME 1;  5IDP B;  5D1O A;  2OOY B;  1I3Q I;  4HH4 A;  1Q7Y 2;  2UZL B;  1RO0 A;  4BCP B;  3VKH A;  1S72 Z;  3VMI A;  3MY5 B;  3S16 I;  1K8A 1;  4JX4 A;  1VQ9 Z;  3RZD I;  1H24 B;  4KRD B;  4DQY B;  3O0G D;  4A3M I;  3FKI I;  5IDN B;  2IZ4 A;  2C4G B;  2JUB A;  4ELL A;  3D9X A;  2C5X B;  3JAM f;  4NST B;  2WEV B;  5FLX f;  4HNV A;  4NBE A;  2QA4 1;  2DME A;  4E2W A;  4HGZ A;  3BG3 A;  2PK2 A;  1RO2 A;  1UGS B;  2UZB B;  3A8M B;  2BJO A;  3CCU 1;  1E9H B;  1UGP B;  2QQ8 A;  2ZPI B;  4ZGJ B;  3TW6 A;  4DGL A;  4OB1 B;  1YJN Z;  4RVH A;  1VOL A;  2KPI A;  1KC8 1;  1H26 B;  2JIO A;  5I5Z B;  2CYZ B;  1Q16 A;  2PK9 B;  3PO3 S;  4CL1 A;  3CC7 Z;  3CC2 1;  3TDH B;  2JA8 I;  4A3B I;  3F5X B;  4MIM A;  5HQ0 B;  3CCJ Z;  2EUF A;  1RQF A;  1JWH C;  4NFR A;  2E2I I;  4AKI A;  3CME Z;  3VTN A;  1M90 1;  2UZD B;  4EOP B;  1FDO A;  1K73 1;  4BY7 X;  1N8R 1;  1N4M A;  1DL6 A;  1WII A;  1O9K A;  3HOZ I;  4RVG A;  2JA6 I;  3BG9 A;  5IT9 b;  1NJI 1;  1ZB8 A;  2C5N B;  3HBL A;  2WPA B;  4BCI B;  2QFZ A;  5IF1 B;  1K9M 1;  4BCF B;  2IW6 B;  2LFU A;  3A8O B;  4NOZ A;  5LL6 f;  3I07 A;  2M6N A;  2OOX B;  2F4M A;  4QTU A;  2QA4 Z;  1LQL A;  1YI2 Z;  1FKM A;  2ZPB B;  1FVV B;  1Y8C A;  2CZ6 B;  3CCU Z;  2NVQ I;  3NDQ A;  2K5R A;  3CPW Y;  1UNG D;  1S7M A;  3NFZ A;  2OTJ Z;  1GUX B;  1YIJ Z;  3J80 f;  3MZL B;  4BY1 I;  3S2H I;  2WMA B;  1Y1V I;  1H27 B;  4Y7N I;  1OL1 B;  1QMZ B;  2VPW A;  3CCR 1;  3CCS 1;  1R9T I;  1KC8 2;  4CFU D;  1FIN B;  1ZB9 A;  4NH1 C;  4RVF A;  3LUS A;  4CFU B;  4NBG A;  4EOK B;  4Z6Y A;  3NH5 A;  2E7Z A;  3QWU A;  3G4S 1;  3PO2 I;  4TTH A;  1YJ9 1;  3BHV B;  3J81 f;  1ZH1 A;  4G6L B;  2V8K A;  1VQ5 1;  1Q82 2;  1FDI A;  3M4O I;  4EOS B;  1VQ9 1;  4A3K I;  2P3Y A;  2DXB B;  5LQF B;  1K73 2;  4NBD A;  5EJC A;  3CPW Z;  2BS4 A;  4OB3 B;  4XX2 A;  1URC B;  1N8R 2;  4NB9 A;  3QYB A;  3IFU A;  2WHB B;  2JS4 A;  1YHQ 1;  1NJI 2;  3DOG B;  5ACB A;  2QR1 B;  2NVT I;  1UGR B;  1C9B A;  3CQZ I;  3EOC B;  2O53 A;  3EER A;  5FLM I;  2ZPH B;  1QXF A;  1QVG Y;  1GH6 B;  2QLV B;  1TWG I;  3J7A 4;  4EON B;  1JKW A;  2Q51 A;  3Q87 A;  2D0Q B;  3A8H B;  4CFW B;  3TE5 B;  2GTI A;  3CC7 1;  3RGF B;  4BCJ B;  5A2Q b;  4EC8 B;  4E2X A;  1USP B;  2O4H A;  3CCR Z;  4AYB A;  3CCS Z;  4E30 A;  2PHG A;  3EJ1 B;  2ZPE B;  1WZN A;  1H28 B;  2VPX A;  3G6E 1;  4E32 A;  3G4S Z;  2G9X B;  3G33 B;  4BCQ D;  1YJ9 Z;  1Q86 1;  3HOY I;  5EFQ B;  1VQ5 Z;  3VB9 A;  4RS4 A;  2IV2 X;  1JJ2 Y;  2DE5 A;  4BCQ B;  4YOS A;  1JSU B;  4ROC A;  3RZO I;  1YUK A;  3GKQ A;  1QF8 A;  1QVG Z;  3CCE 1;  1RNI A;  3X20 B;  4HGY A;  4BBR I;  2R7Z I;  4JX5 A;  2X1N B;  2JA7 I;  5D1P A;  2C5V B;  2F2C A;  1UNL D;  1NP6 A;  5IT9 f;  1YHQ Z;  1YI2 1;  4KRC B;  4E2Z A;  2CZ7 B;  3BLQ B;  4HLQ A;  1H1R B;  2PMZ A;  1VQL Z;  2R6M A;  5C3E I;  1TWA I;  1WW9 A;  2JNY A;  3QYH B;  3QYG B;  1TWC I;  4F70 B;  4NBH A;  3BHU B;  1YIJ 1;  2OTJ 1;  2VF1 A;  2BKZ B;  2HF1 A;  2KR6 A;  1Z02 A;  1ML8 A;  4BY7 I;  1OKV B;  4M6V A;  2VPY A;  3X24 B;  2C5O B;  4F7L B;  1PFT A;  1JJ2 Z;  3A8G B;  4A3F I;  2UUE B;  4I3Z B;  2JR6 A;  3GTQ I;  1AA6 A;  4A3C I;  1UNH D;  2ZZD B;  3MON A;  4ZGE B;  4E33 A;  1VQM 1;  1VQ8 1;  3G6E Z;  2VUM I;  4CFX B;  4NBF A;  2VPZ A;  1VQO 1;  2DE6 A;  5IP9 I;  3HZJ A;  1WJ2 A;  3K7A I;  5ICP B;  3CCQ 1;  3PO3 I;  2CJM B;  2QDJ A;  1Q86 2;  2V8J A;  3BG5 A;  2G2K A;  3DDP B;  3I4N I;  4AKH A;  3CCE Z;  1K8A 2;  4A3J I;  2R93 I;  2QGS A;  1VQ6 1;  2W9F A;  4MD9 A;  2ZPF B;  1Z03 A;  4BXX X;  3T4N B;  1X3W A;  3F3F C;  4BCG B;  2R92 I;  4ROE A;  4ROD A;  3OW2 Y;  2DPP B;  2B63 I;  1H1P B;  4MRI A;  1GUX A;  2RT9 A;  5T64 A;  3CMA 1;  3HOW I;  1P5E B;  1TFB A;  2PK7 A;  4QSH A;  4BBS I;  4MD7 A;  4A3G I;  2I53 A;  4OB2 B;  2YU9 I;  3WVE B;  4BCO B;  4YOO A;  3GTM S;  4MON A;  3S1R I;  3QXE B;  1Y1V S;  3VYG B;  5HNB B;  4HL4 A;  1ENW A;  4QTT A;  4MH4 A;  2OTL 1;  3QYE A;  5A2Q f;  1H25 B;  3TNI B;  1VQM Z;  1VYW B;  1VQ8 Z;  1VQP 1;  2RBL A;  4NB8 A;  4NBC A;  2ZCF B;  4NBA A;  4MFD A;  2NVX I;  1VQO Z;  3P5J B;  3OW2 Z;  5C4X I;  2RPR A;  4EOQ B;  3M03 A;  4F6S B;  3HB9 A;  2I3C A;  2W04 A;  1M90 2;  4EOJ B;  4X6A I;  3CCQ Z;  2CZ0 B;  5HBE B;  3QWL A;  2JGZ B;  3K7A M;  4CFV B;  2BS2 A;  3LQ5 B;  3MIA B;  5DQV A;  1YUA A;  2QRD B;  4CXA B;  2R7G A;  1VQ6 Z;  1Q7Y 1;  1K9M 2;  1OKW B;  2DD4 B;  4AKG A;  1VQL 1;  1H4L D;  2QRE B;  3GTL I;  1IRE B;  3NDJ A;  4NC6 A;  3DL1 A;  1I6H I;  2JMO A;  1GY3 B;  4S1T A;  4BY1 X;  2JIP A;  3CMA Z;  1VQ7 1;  2RIQ A;  2IN3 A;  3IF8 A;  3S2D I;  4A3L I;  1USP A;  1KXU A;  2E2H I;  4BCN D;  4F6U B;  5CEI B;  2K3R A;  2V8I A;  3G71 1;  3GTP I;  2W99 A;  1TWF I;  1M1K 1;  3NH4 A;  2AYD A;  3EED A;  3HKZ A;  4RV9 A;  4A3I I;  4BCN B;  3VMG A;  1W98 B;  2IZ3 A;  2JA5 I;  3J80 b;  2UZE B;  4NBB A;  4EOO B;  3GTJ I;  2OTL Z;  2CCI B;  2LW4 A;  4HNT A;  1KRL A;  4DK1 A;  3CCM 1;  1KQS Y;  2M48 A;  3S1Q I;  3GTO I;  1VQP Z;  3CCV Z;  3KIH A;  3I56 1;  4Y72 B;  3S15 I;  2IW8 B;  1OIU B;  2EGT A;  3TN8 B;  4EOR B;  3FQQ A;  4EOM B;  1VIN A;  3X26 B;  2BPM B;  3CC4 Z;  2QDY B;  2NVY I;  1N2F A;  2E9H A;  1QVF Y;  5IHY A;  4HNU A;  2DXC B;  3IR7 A;  3HOX I;  3I55 1;  4II5 B;  3TW7 A;  3S1N I;  2WMB B;  4F7N B;  5CM2 M;  2E2J I;  3TNW B;  1SFO I;  4CRL B;  2V3V A;  2F4O A;  3MI9 B;  5D1O B;  3QZ5 B;  2IVX A;  4A3E I;  1VQ7 Z;  2CCH B;  2ZAE B;  4E31 A;  3BHT B;  1KQS Z;  3HOU I;  2WXV B;  1TD6 A;  3S1M I;  3X25 B;  1JOW A;  2GU2 A;  2H85 A;  4E2Y A;  3G71 Z;  3BG0 B;  5T6B A;  2LEX A;  5C44 I;  1ZP2 A;  1H1Q B;  3BLH B;  4ZGD B;  2DD5 B;  2IW9 B;  1M1K 2;  1YJW Z;  4BXX I;  3DJB A;  1I50 I;  1QVF Z;  3VMH A;  3D6W A;  2I40 B;  4BCM D;  4EOI B;  3CCM Z;  2B9R A;  4FX3 B;  4BCH B;  3QZ9 B;  4YOZ A;  2JIM A;  2V45 A;  3I56 Z;  4CFN B;  4BCM B;  2WFY B;  4RVD A;  1VQN 1;  1AHJ B;  1VQ4 1;  3F3P C;  1X3Z A;  2QRC B;  2QEX 1;  1PKD B;  3KHI A;  1K83 I;  4EC9 B;  2AKL A;  1YIT 1;  5L2W B;  1H1S B;  4BBR M;  2AHJ B;  1L1O C;  1Q82 1;  3CXC Y;  1W2B Y;  2QF7 A;  3HOV I;  5HBJ B;  3BLR B;  3ESW A;  3QHR B;  4F7J B;  3I55 Z;  3NH8 A;  2Y0S A;  2WAQ A;  1UGQ B;  4LOC A;  3JAM b;  4CFM B;  1VLA A;  5FLX b;  4A3D I;  1QYP A;  3B57 A;  4FM4 B;  1O9K B;  5DQW A;  2WIP B;  1NUI A;  3S17 I;  3CD6 1;  4EOL B;  1VQK 1;  2OZK A;  2W2H A;  3H0G I;  4IMY B;  1WCM I;  2J6A A; 
#chains in the Genus database with same CATH homology
 3MZK B;  3I4M I;  2DE7 A;  3U50 C;  3CCV 1;  1Q81 1;  3CXC Z;  1W2B Z;  3KIF A;  5AN9 F;  3GTM I;  1KD1 1;  3GTK I;  3CCL 1;  3CC4 1;  1VQN Z;  1VQ4 Z;  3S14 I;  2GTH A;  2QEX Z;  3CC2 Z;  2Q4Z A;  4TNU A;  2KI7 B;  3FQM A;  3GCF A;  1YIT Z;  5IP7 I;  4A93 I;  2HU9 A;  4EWC A;  1S72 1;  3M3Y I;  1TWH I;  1Y1W I;  2PM9 A;  2RHB A;  3BG1 B;  5C4J I;  3CD6 Z;  1VQK Z;  1TFI A;  1RO4 A;  2YAD A;  2W03 A;  1YJW 1;  1X0T A;  3GTG I;  4MXU A;  4MD8 A;  3NDI A;  2VUG A;  3H3V J;  1YJN 1;  1Z01 A;  2P28 A;  1Q81 2;  4Y52 I;  3CCL Z;  5T67 A;  1RLY A;  1KD1 2;  3J81 b;  3CCJ 1;  1P9N A;  2LIY A;  3IX0 A;  2QKD A;  2WB1 A;  3CME 1;  5D1O A;  2OOY B;  1I3Q I;  4HH4 A;  1Q7Y 2;  1RO0 A;  1S72 Z;  3S16 I;  3VMI A;  1K8A 1;  1VQ9 Z;  3RZD I;  4DQY B;  4A3M I;  3FKI I;  2IZ4 A;  2JUB A;  3D9X A;  3JAM f;  5FLX f;  4NBE A;  2QA4 1;  2DME A;  4E2W A;  4HGZ A;  1RO2 A;  3CCU 1;  2BJO A;  4DGL A;  1YJN Z;  4RVH A;  2KPI A;  1KC8 1;  3PO3 S;  4CL1 A;  3CC7 Z;  3CC2 1;  3TDH B;  2JA8 I;  4A3B I;  3CCJ Z;  1RQF A;  1JWH C;  4NFR A;  2E2I I;  3CME Z;  3VTN A;  1M90 1;  1K73 1;  4BY7 X;  1N8R 1;  1DL6 A;  1WII A;  3HOZ I;  4RVG A;  2JA6 I;  5IT9 b;  1NJI 1;  1ZB8 A;  1K9M 1;  2LFU A;  4NOZ A;  5LL6 f;  3I07 A;  2M6N A;  2OOX B;  2F4M A;  4QTU A;  2QA4 Z;  1LQL A;  1YI2 Z;  3CCU Z;  2NVQ I;  3NDQ A;  2K5R A;  3CPW Y;  2OTJ Z;  1S7M A;  3NFZ A;  1YIJ Z;  3J80 f;  3MZL B;  4BY1 I;  3S2H I;  1Y1V I;  4Y7N I;  3CCR 1;  1R9T I;  3CCS 1;  1KC8 2;  1ZB9 A;  4NH1 C;  4RVF A;  3LUS A;  4NBG A;  3NH5 A;  3QWU A;  3G4S 1;  3PO2 I;  1YJ9 1;  3J81 f;  1ZH1 A;  2V8K A;  1VQ5 1;  1Q82 2;  3M4O I;  1VQ9 1;  4A3K I;  2P3Y A;  1K73 2;  4NBD A;  3CPW Z;  4XX2 A;  1N8R 2;  4NB9 A;  3IFU A;  2JS4 A;  1YHQ 1;  1NJI 2;  2QR1 B;  2NVT I;  3CQZ I;  3EER A;  2O53 A;  5FLM I;  1QVG Y;  2QLV B;  1TWG I;  3J7A 4;  2Q51 A;  3Q87 A;  3TE5 B;  2GTI A;  3CC7 1;  5A2Q b;  4E2X A;  1USP B;  2O4H A;  3CCR Z;  4AYB A;  3CCS Z;  4E30 A;  3G6E 1;  4E32 A;  3G4S Z;  3HOY I;  1YJ9 Z;  1Q86 1;  1VQ5 Z;  3VB9 A;  4RS4 A;  1JJ2 Y;  2DE5 A;  3RZO I;  1YUK A;  3GKQ A;  1QF8 A;  1QVG Z;  3CCE 1;  1RNI A;  4HGY A;  4BBR I;  2R7Z I;  2JA7 I;  5D1P A;  1NP6 A;  5IT9 f;  1YHQ Z;  1YI2 1;  4E2Z A;  2PMZ A;  1VQL Z;  2R6M A;  5C3E I;  1TWA I;  1WW9 A;  2JNY A;  1TWC I;  4NBH A;  2OTJ 1;  1YIJ 1;  2VF1 A;  4BY7 I;  2HF1 A;  1Z02 A;  1ML8 A;  1PFT A;  1JJ2 Z;  4A3F I;  2JR6 A;  3GTQ I;  4A3C I;  3MON A;  1VQM 1;  4E33 A;  1VQ8 1;  2VUM I;  3G6E Z;  4NBF A;  1VQO 1;  2DE6 A;  5IP9 I;  3K7A I;  3CCQ 1;  3PO3 I;  1Q86 2;  2V8J A;  2G2K A;  3I4N I;  3CCE Z;  1K8A 2;  4A3J I;  2R93 I;  1VQ6 1;  4MD9 A;  1Z03 A;  4BXX X;  3T4N B;  1X3W A;  3F3F C;  2R92 I;  3OW2 Y;  2B63 I;  4MRI A;  5T64 A;  2RT9 A;  3CMA 1;  3HOW I;  2PK7 A;  4BBS I;  4MD7 A;  4A3G I;  2YU9 I;  3GTM S;  4MON A;  3S1R I;  1Y1V S;  4QTT A;  1ENW A;  4MH4 A;  2OTL 1;  5A2Q f;  1VQM Z;  1VQ8 Z;  1VQP 1;  2RBL A;  4NB8 A;  4NBC A;  4NBA A;  2NVX I;  1VQO Z;  3OW2 Z;  3P5J B;  5C4X I;  2RPR A;  4X6A I;  2I3C A;  2W04 A;  1M90 2;  3CCQ Z;  1YUA A;  2QRD B;  1VQ6 Z;  1Q7Y 1;  1K9M 2;  1VQL 1;  2QRE B;  3GTL I;  3NDJ A;  1I6H I;  2JMO A;  4S1T A;  4BY1 X;  1VQ7 1;  3CMA Z;  2RIQ A;  3IF8 A;  3S2D I;  4A3L I;  1USP A;  2E2H I;  3GTP I;  3G71 1;  2K3R A;  2V8I A;  1M1K 1;  1TWF I;  3NH4 A;  3EED A;  3HKZ A;  4RV9 A;  4A3I I;  3VMG A;  2IZ3 A;  2JA5 I;  3J80 b;  3GTJ I;  4NBB A;  2OTL Z;  2LW4 A;  1KRL A;  1KQS Y;  4DK1 A;  3CCM 1;  2M48 A;  3S1Q I;  3GTO I;  1VQP Z;  3CCV Z;  3KIH A;  3I56 1;  3S15 I;  2EGT A;  3FQQ A;  3CC4 Z;  2NVY I;  1N2F A;  2E9H A;  1QVF Y;  3HOX I;  3I55 1;  3S1N I;  5CM2 M;  2E2J I;  1SFO I;  2F4O A;  5D1O B;  4A3E I;  1KQS Z;  1VQ7 Z;  2ZAE B;  4E31 A;  3HOU I;  3S1M I;  2GU2 A;  2H85 A;  4E2Y A;  3G71 Z;  3BG0 B;  5T6B A;  5C44 I;  1M1K 2;  1YJW Z;  4BXX I;  1I50 I;  1QVF Z;  3VMH A;  3D6W A;  3CCM Z;  3I56 Z;  4RVD A;  1VQN 1;  1VQ4 1;  3F3P C;  1X3Z A;  2QRC B;  2QEX 1;  1K83 I;  2AKL A;  1YIT 1;  1L1O C;  1Q82 1;  3CXC Y;  1W2B Y;  3HOV I;  3ESW A;  3I55 Z;  3NH8 A;  2Y0S A;  2WAQ A;  3JAM b;  1VLA A;  5FLX b;  4A3D I;  1QYP A;  1NUI A;  3S17 I;  3CD6 1;  1VQK 1;  2OZK A;  3H0G I;  1WCM I;  2J6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...