3PO3S

Arrested rna polymerase ii reactivation intermediate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
164
structure length
164
Chain Sequence
HKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNAQGATIERSVTDRFTCGKCKEKKVSYYQLQTRSAAAPLTTFCTCEACGNRWKFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 33
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01096 TFIIS_C Transcription factor S-II (TFIIS)
S PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.30 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Transcription elongation factor S-II, central domain 3po3S01
2.20.25.10 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 3po3S02
1ZB9A 3FKII 2NVXI 4A3FI 2RBLA 4MH4A 5C4JI 3I4NI 1L1OC 1TWGI 3CQZI 3GTMS 4NBDA 3S16I 3PO3I 4BY1I 3S15I 3S14I 1I3QI 1TFIA 4BBRI 3S1RI 4Y52I 4NBGA 4A3CI 1WW9A 3S1QI 4A3LI 2LW4A 2P3YA 2YU9I 1YUAA 2JR6A 2DE6A 4BY1X 2R7ZI 3H3VJ 4A3BI 3VMGA 1LQLA 4NB8A 5C4XI 5CM2M 4A3DI 1X3WA 2JNYA 4A3JI 4A3MI 3GTPI 1RLYA 3S1NI 3S1MI 3S2DI 5FLMI 1I50I 2K5RA 1TWAI 3I07A 3U50C 2DE5A 3GTJI 1DL6A 3GTMI 2F4OA 4BXXI 4NBBA 1RO4A 1ZB8A 1R9TI 3GTOI 1SFOI 1USPB 1ENWA 2NVYI 3GTLI 2BJOA 2AKLA 2PK7A 2JS4A 3GTQI 2JA5I 3D6WA 3S17I 2DE7A 2JA8I 1Y1VI 3PO2I 1QYPA 3VB9A 3RZOI 4BXXX 4NBAA 2JA6I 3HOYI 4A3II 1X3ZA 4XX2A 4Y7NI 3H0GI 4NBHA 5C3EI 1N2FA 5C44I 4BY7X 1ML8A 3ESWA 3HOUI 3LUSA 4NB9A 3HOXI 3Q87A 3I4MI 3GCFA 2NVTI 3GTKI 2HF1A 1TWCI 2R93I 4X6AI 3HOVI 3GKQA 4NBFA 3HOWI 2F4MA 4NBCA 3EERA 2JA7I 4BY7I 2J6AA 3VMIA 1WCMI 2NVQI 5IP9I 3HOZI 2KPIA 2R92I 4A3KI 4QTTA 3RZDI 3M3YI 1K83I 3PO3S 4A3GI 1NUIA 1TWFI 1TWHI 1USPA 1Y1VS 2E2JI 4NBEA 5IP7I 4BBSI 3NDQA 4QTUA 2E2HI 3GTGI 2B63I 3M4OI 1PFTA 2VUMI 4A3EI 1VLAA 4NOZA 3VMHA 1Y1WI 1I6HI 2DMEA 3K7AI 3S2HI 4A93I 2E2II
chains in the Genus database with same CATH superfamily
4BCOB 3F3PC 5C4JI 3HO8A 3I4NI 1L1OC 2VF1A 1NJI2 3JAMf 3CCQ1 3B57A 4BCQD 1QVFZ 1TFBA 2AHJB 3S16I 3EIDB 3X25B 1FINB 3S15I 1I3QI 4DQYB 1TFIA 2JGZB 2C5OB 3NFZA 1OL1B 2WFYB 1GUXA 4A3LI 3I55Z 1Y8CA 2LFUA 1QF8A 2DE6A 3CCJ1 2E9HA 3VYHB 1X0TA 2LIYA 2R7ZI 1H26B 4OR5B 2CZ1B 3QHWB 4TNUA 4A3BI 2OTJZ 1O9KA 2VPZA 3DJBA 2OTL1 4NB8A 2WMAB 1VQ81 2KR6A 3I561 3NH5A 3X28B 1Q7Y2 3CMAZ 2IZ3A 3JAMb 1VQP1 2V8KA 5ICPB 4JX5A 3DL1A 2QQ8A 1RO4A 2O53A 4EOQB 3OW2Z 1SFOI 1USPB 3GTLI 2WXVB 1WJ2A 1H1SB 5HNBB 5D1OA 3A8OB 2JS4A 3OW2Y 1H24B 2DD4B 1QVFY 2QLVB 1QYPA 1W98B 2ZPGB 4EONB 3CXCY 5EJCA 2JA6I 2OTLZ 2D0QB 1X3ZA 3BG5A 5D1OB 4EOPB 3A8HB 4BCMB 3H0GI 1D3UB 1JWHC 2Y0SA 4ZGDB 3LUSA 2V45A 5IT9f 2QGSA 4EOIB 3I4MI 1AD6A 2NVTI 4BCHB 4MONA 1Q862 3HOVI 5HBHB 2F4MA 3J80f 5CYIB 2GTIA 3EERA 1XO2A 3M03A 4NH1C 4DK1A 1WCMI 2JMOA 1Q811 3QXEB 3QYGB 3QYEA 4CFXB 4EOJB 3PO3S 2OZKA 1TWFI 5HBEB 2CJMB 1N8R1 1QVGY 1FVVB 1Y1VS 4F6UB 4F7LB 3HHTB 2QA41 3NDQA 3CCL1 3QZ9B 2LEXA 2UUEB 4IMYB 1Z03A 3BG1B 4RV9A 2IV2X 1PFTA 2RIQA 3X24B 1KRLA 1AA6A 1Q16A 2E7ZA 2NAPA 4S1TA 1VQ6Z 1YI2Z 2DMEA 4AKIA 2M48A 2E2II 5I5ZB 3FKII 3CCQZ 2IZ4A 2RBLA 5BNJB 1UGSB 3VYGB 4F6SB 3BHVB 2QEXZ 3D9XA 3LQ5B 3GTMS 4NBDA 3MZKB 3PO3I 4OB2B 3S14I 3EEDA 3CC2Z 1VQ5Z 2CCIB 4OGRB 2UZLB 1WW9A 2DD5B 3DTOA 4EOMB 1YUAA 2JR6A 2F2CA 3P5JB 3CME1 4HNVA 4BY1X 3TN8B 1H27B 4OB3B 4RVDA 3H3VJ 2QFZA 2JIPA 3HKZA 4E30A 1VQ8Z 1K8A2 2M6NA 2ZAEB 1LQLA 4CFNB 5CM2M 1VINA 2PMZA 4A3DI 2ZPHB 3NH4A 1Q7Y1 1X3WA 4E2ZA 4A3MI 4MFDA 5A2Qb 3GTPI 3MZLB 4CL1A 3CCV1 3S1NI 3S2DI 5FLMI 2YADA 3I551 2DE5A 1DL6A 2CCHB 4Y72B 2F4OA 1K9M1 1WZNA 3X26B 5LMKB 1YIJZ 3GTOI 4ZGEB 3G71Z 2BJOA 4HNTA 1VQLZ 2AKLA 4DGLA 4EOLB 3KHIA 1Z02A 3GTQI 3S17I 3PO2I 4MIMA 4MD9A 3RZOI 1OKWB 5IF1B 2OOYB 5CEIB 1BU2A 3HOYI 4FM4B 4E2XA 4A3II 3MY1B 4Y7NI 3TW7A 4YOOA 1IREB 5C3EI 5C44I 4LOCA 5DQVA 4BCJB 3T4NB 1OL2B 2CZ7B 2W99A 4RS4A 1VOLA 1VQ61 1Q821 4YOSA 4NB9A 2GTHA 4ROEA 2W04A 4BCPB 3Q87A 3A8MB 4E33A 4HH4A 4BCMD 1FDIA 4RVFA 4F7SB 2HU9A 4X6AI 1Z01A 3NDJA 2W9ZA 3BLRB 4NBCA 4NC6A 3F5XB 2UZEB 2ZPEB 1UGRB 1H1QB 1M1K2 5IP9I 2I40B 1AISB 3O0GD 1YUKA 2KPIA 4QTTA 4E32A 3RZDI 1QMZB 4MRIA 4YC3B 2WEVB 4A3GI 1TWHI 4ELLA 4EORB 1GH6B 5T6BA 3CCM1 1K8A1 1P9NA 5T64A 1YIT1 1VYWB 5IP7I 4II5B 2E2HI 5D1PA 2PK2A 3GTGI 2B63I 2VUMI 5HVYB 4A3EI 1JOWA 3QYBA 3CCSZ 3BHUB 4E2WA 3BLQB 2WMBB 4FX3B 4EWCA 1Y1WI 2IW6B 2C5VB 2WIPB 4MFEA 3NH8A 4F7JB 3QWLA 1VQO1 4A93I 2DPPB 2NVXI 3HZJA 1S721 1KD11 4A3FI 2W2HA 4RVHA 4BCNB 5FLXb 2RT9A 2GU2A 3CQZI 2V3VA 3J81f 4BY1I 4JX6A 3TNIB 4ZGJB 2W03A 3MIAB 2R6MA 2I3CA 3G4SZ 2C6TB 1UGQB 3BG3A 3D2LA 4NBGA 3TE5B 3DDPB 5DQWA 4AYBA 3TW6A 2LW4A 2WHBB 2IVXA 2P3YA 2PHGA 2JIRA 2I53A 1NP6A 3MY5B 2KI7B 4NFRA 3CD61 3DDQB 2PM9A 4MD8A 1YJW1 1YJN1 3VMGA 4TTHA 5IT9b 2VPYA 4CFVB 4A3JI 3CCEZ 1KQSZ 3J81b 1VQOZ 3IR7A 3S1MI 1O9KB 4CFUD 1VQ4Z 1VQ91 1URCB 1KQSY 2JIQA 2K5RA 3I07A 3U50C 3CC21 3WVEB 3GTMI 1VQ41 4KRCB 3G4S1 3MONA 1RO2A 2V8JA 1AHJB 4I3ZB 1R9TI 4AKGA 3CMA1 2NVYI 3CCR1 2PK7A 1M901 4BCND 5IHYA 1YJWZ 2DE7A 2JA5I 2JA8I 2IN3A 1UNHD 1OI9B 4CRLB 3KIFA 1FDOA 1SIWA 2G77A 3TNHB 4XX2A 3EOCB 4NBHA 4RVGA 1N2FA 4F70B 4OB0B 4BY7X 2EGTA 5FGKB 4BBSM 1ML8A 2OOXB 1JKWA 3ESWA 2CYZB 4BCIB 2CZ0B 1VQ51 1VQN1 1GY3B 1H25B 3CPWZ 1N8R2 1P5EB 1N4MA 3FQQA 3MI9B 3GCFA 3IX0A 3CCU1 4UN0A 2HF1A 1VQNZ 3GTKI 3GKQA 2Q4ZA 4G6LB 1H1RB 4NBFA 1YHQZ 2G9XB 3CPWY 3CCMZ 2P28A 3HOWI 2BS4A 3BG0B 1VQ9Z 2C5XB 1UNGD 1E9HB 2EUFA 3WVDB 1KD12 3IFUA 2C4GB 2NVQI 1UGPB 4F7NB 3I56Z 4HLQA 2ZPBB 5IDPB 4AKHA 1K83I 1WIIA 1NUIA 3DOGB 4YOZA 4HGYA 3CD6Z 3G33B 2W9FA 1VQK1 2VPXA 5EFQB 5FLXf 3HB9A 4EOSB 4QTUA 3CCS1 1W2BZ 2ZZDB 3POMA 3M4OI 3CCUZ 1TD6A 3HBLA 2BS2A 3FQMA 1W2BY 1VLAA 2JUBA 1VQM1 3A8GB 2QDJA 3CCE1 4CFWB 2QA4Z 5AN9F 1FKMA 1K9M2 3S2HI 1JSTB 4HGZA 4BCQB 1ZB9A 2QRDB 3CC41 4OB1B 2OTJ1 2B9RA 2WIHB 4MH4A 2V8IA 1VQL1 3EJ1B 3CCRZ 3CC4Z 4E2YA 1TWGI 2BS3A 5HBJB 2BPMB 5T67A 1K731 4AI6A 1YI21 3F3FC 1OGUB 3H4CA 4BBRI 2QKDA 2QRCB 4HNUA 1C9BA 3S1RI 1YJ91 1M902 4Y52I 1F5QB 1JJ2Y 4A3CI 2DXCB 3CCVZ 3S1QI 2YU9I 1RO0A 4EOKB 2QEX1 2H85A 2K3RA 2WB1A 1JJ2Z 2QDYB 3QYHB 2IW9B 4KRDB 3BLHB 1ZH1A 4CFMB 2JIMA 1H1PB 5C4XI 4E31A 5A2Qf 3KIHA 1V29B 2JNYA 1H28B 1H4LD 3G711 2WJ9A 4EOOB 1RQFA 4MD7A 3J7A4 1QLBA 3RGFB 1VQMZ 3X20B 4BCKB 4ROCA 1VQ7Z 1RLYA 3CXCZ 3CMEZ 1KXUA 1UNLD 1I50I 1TWAI 1E7PA 3CCLZ 3GTJI 1Q861 4F6WB 5ACBA 1YJ9Z 1YITZ 4BXXI 2W96A 4CXAB 4NSTB 4NBBA 3QWUA 1VQPZ 4CFUB 1ZB8A 2C5NB 3NDIA 1ENWA 1OIUB 4ELJA 4HL4A 1VQKZ 3K7AM 4RODA 1OKVB 3D6WA 1QXFA 1Y1VI 2QF7A 2G2KA 3IF8A 3VB9A 4BXXX 2VPWA 4NBAA 1M1K1 1JSUB 4QSHA 3TNWB 3CCJZ 1S72Z 1KC81 3VKHA 4JX4A 2JIOA 2ZPIB 3QHRB 1KC82 2X1NB 1Q812 2VUGA 2PMIB 3HOUI 3BG9A 1YHQ1 3CC7Z 1NJI1 3HOXI 2RHBA 4Z6YA 1QVGZ 2Q51A 3TDHB 1Q822 1TWCI 2R93I 4BCFB 4EC8B 5LQFB 1K732 3BHTB 2WAQA 2IW8B 2JA7I 4BY7I 2WPAB 1ZP2A 5IDNB 2J6AA 3VMIA 2R7GA 4BBRM 2QREB 3J80b 3G6EZ 2AYDA 3HOZI 2R92I 4A3KI 2ZPFB 2CZ6B 2KMGA 1S7MA 3G6E1 3M3YI 4MXUA 2V22B 1YJNZ 1GUXB 2PK9B 2QR1B 1USPA 5L2WB 4EC9B 2UZDB 2E2JI 2O4HA 4NBEA 2UZBB 3QZ5B 3VTNA 4BBSI 3CC71 1YIJ1 1OIYB 4M6VA 1PKDB 3A8LB 2ZCFB 4BCGB 5HQ0B 1RNIA 2BKZB 2DXBB 2PJQA 3VKGA 4NOZA 1G3NC 3VMHA 1I6HI 2RPRA 1VQ71 5LL6f 3K7AI
chains in the Genus database with same CATH topology
3F3PC 5C4JI 3I4NI 1L1OC 2VF1A 1NJI2 3JAMf 3CCQ1 1QVFZ 3S16I 3S15I 1I3QI 4DQYB 1TFIA 3NFZA 4A3LI 3I55Z 2LFUA 1QF8A 2DE6A 3CCJ1 2E9HA 1X0TA 2LIYA 2R7ZI 4TNUA 4A3BI 2OTJZ 2OTL1 4NB8A 1VQ81 3I561 3NH5A 1Q7Y2 3CMAZ 2IZ3A 3JAMb 1VQP1 2V8KA 1RO4A 2O53A 3OW2Z 1SFOI 1USPB 3GTLI 5D1OA 2JS4A 3OW2Y 1QVFY 2QLVB 1QYPA 3CXCY 2JA6I 2OTLZ 1X3ZA 5D1OB 3H0GI 1JWHC 2Y0SA 3LUSA 5IT9f 3I4MI 2NVTI 4MONA 1Q862 3HOVI 2F4MA 3J80f 2GTIA 3EERA 4NH1C 4DK1A 1WCMI 2JMOA 1Q811 3PO3S 2OZKA 1TWFI 1N8R1 1QVGY 1Y1VS 2QA41 3NDQA 3CCL1 1Z03A 3BG1B 4RV9A 1PFTA 2RIQA 1KRLA 3K7AI 4S1TA 1VQ6Z 1YI2Z 2M48A 2DMEA 2E2II 3FKII 3CCQZ 2IZ4A 2RBLA 2QEXZ 3D9XA 3GTMS 4NBDA 3MZKB 3PO3I 3S14I 3EEDA 3CC2Z 1VQ5Z 1WW9A 1YUAA 2JR6A 3P5JB 3CME1 4BY1X 4RVDA 3H3VJ 3HKZA 4E30A 1VQ8Z 1K8A2 2M6NA 2ZAEB 1LQLA 5CM2M 2PMZA 4A3DI 3NH4A 1Q7Y1 1X3WA 4E2ZA 4A3MI 5A2Qb 3GTPI 3MZLB 4CL1A 3CCV1 3S1NI 3S2DI 5FLMI 2YADA 3I551 2DE5A 1DL6A 1K9M1 2F4OA 1YIJZ 3GTOI 3G71Z 2BJOA 1VQLZ 2AKLA 4DGLA 1Z02A 3GTQI 3S17I 3PO2I 4MD9A 3RZOI 2OOYB 3HOYI 4E2XA 4A3II 4Y7NI 5C3EI 5C44I 3T4NB 4RS4A 1VQ61 1Q821 4NB9A 2GTHA 4E33A 2W04A 3Q87A 4HH4A 4RVFA 4X6AI 2HU9A 1Z01A 3NDJA 4NBCA 1M1K2 5IP9I 1YUKA 2KPIA 4QTTA 4E32A 3RZDI 4MRIA 4A3GI 1TWHI 5T6BA 3CCM1 1K8A1 1P9NA 5T64A 1YIT1 5IP7I 2E2HI 5D1PA 3GTGI 2B63I 2VUMI 4A3EI 3CCSZ 4E2WA 4EWCA 1Y1WI 3NH8A 4A93I 1VQO1 2NVXI 1S721 1KD11 4A3FI 4RVHA 5FLXb 2RT9A 2GU2A 3CQZI 3J81f 4BY1I 2W03A 2R6MA 2I3CA 3G4SZ 3TE5B 4NBGA 4AYBA 2LW4A 2P3YA 1NP6A 2KI7B 4NFRA 3CD61 2PM9A 4MD8A 1YJW1 1YJN1 3VMGA 5IT9b 4A3JI 3CCEZ 1KQSZ 3J81b 1VQOZ 3S1MI 1VQ4Z 1VQ91 1KQSY 3CC21 2K5RA 3I07A 3U50C 3GTMI 1VQ41 3G4S1 3MONA 1RO2A 2V8JA 1R9TI 3CMA1 2NVYI 3CCR1 2PK7A 1M901 2JA5I 1YJWZ 2DE7A 2JA8I 3KIFA 4XX2A 4NBHA 4RVGA 1N2FA 2EGTA 4BY7X 1ML8A 2OOXB 3ESWA 1VQN1 1VQ51 3CPWZ 1N8R2 3FQQA 3IX0A 3GCFA 3CCU1 1VQNZ 2HF1A 3GTKI 3GKQA 2Q4ZA 4NBFA 3CPWY 1YHQZ 3HOWI 3CCMZ 2P28A 3BG0B 1VQ9Z 1KD12 3IFUA 2NVQI 3I56Z 1K83I 1WIIA 1NUIA 4HGYA 3CD6Z 1VQK1 5FLXf 4QTUA 3CCS1 1W2BZ 3M4OI 3CCUZ 3FQMA 1W2BY 1VLAA 2JUBA 3CCE1 2QA4Z 5AN9F 1K9M2 3S2HI 4HGZA 1ZB9A 2QRDB 3CC41 2OTJ1 4MH4A 2V8IA 1VQL1 3CCRZ 3CC4Z 4E2YA 1TWGI 5T67A 1K731 1YI21 3F3FC 4BBRI 2QKDA 2QRCB 3S1RI 1YJ91 1M902 4Y52I 1JJ2Y 4A3CI 3CCVZ 3S1QI 2YU9I 1RO0A 2QEX1 2H85A 2K3RA 2WB1A 1JJ2Z 1ZH1A 5C4XI 4E31A 5A2Qf 3KIHA 2JNYA 3J7A4 3G711 1RQFA 4MD7A 1VQMZ 1VQ7Z 1RLYA 3CXCZ 3CMEZ 1I50I 1TWAI 1Q861 3CCLZ 3GTJI 1YJ9Z 1YITZ 4BXXI 4NBBA 3QWUA 1VQPZ 1ZB8A 3NDIA 1ENWA 1VQKZ 3D6WA 1Y1VI 2G2KA 3IF8A 3VB9A 4BXXX 1M1K1 4NBAA 3CCJZ 1S72Z 1KC81 1KC82 1Q812 2VUGA 3HOUI 1YHQ1 3CC7Z 1NJI1 3HOXI 2RHBA 1QVGZ 3TDHB 2Q51A 1Q822 1TWCI 2R93I 1K732 2WAQA 2JA7I 4BY7I 2J6AA 3VMIA 2QREB 3J80b 3G6EZ 3HOZI 2R92I 4A3KI 1S7MA 3G6E1 3M3YI 4MXUA 1YJNZ 2QR1B 1USPA 2E2JI 2O4HA 4NBEA 3VTNA 4BBSI 3CC71 1YIJ1 1RNIA 4NOZA 3VMHA 1I6HI 2RPRA 1VQ71 5LL6f 1VQM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZB9 A;  3FKI I;  2NVX I;  4A3F I;  2RBL A;  4MH4 A;  5C4J I;  3I4N I;  1L1O C;  1TWG I;  3CQZ I;  3GTM S;  4NBD A;  3S16 I;  3PO3 I;  4BY1 I;  3S15 I;  3S14 I;  1I3Q I;  1TFI A;  4BBR I;  3S1R I;  4Y52 I;  4NBG A;  4A3C I;  1WW9 A;  3S1Q I;  4A3L I;  2LW4 A;  2P3Y A;  2YU9 I;  1YUA A;  2JR6 A;  2DE6 A;  4BY1 X;  2R7Z I;  3H3V J;  4A3B I;  3VMG A;  1LQL A;  4NB8 A;  5C4X I;  5CM2 M;  4A3D I;  1X3W A;  2JNY A;  4A3J I;  4A3M I;  3GTP I;  1RLY A;  3S1N I;  3S1M I;  3S2D I;  5FLM I;  1I50 I;  2K5R A;  1TWA I;  3I07 A;  3U50 C;  2DE5 A;  3GTJ I;  1DL6 A;  3GTM I;  2F4O A;  4BXX I;  4NBB A;  1RO4 A;  1ZB8 A;  1R9T I;  3GTO I;  1SFO I;  1USP B;  1ENW A;  2NVY I;  3GTL I;  2BJO A;  2AKL A;  2PK7 A;  2JS4 A;  3GTQ I;  2JA5 I;  3D6W A;  3S17 I;  2DE7 A;  2JA8 I;  1Y1V I;  3PO2 I;  1QYP A;  3VB9 A;  3RZO I;  4BXX X;  4NBA A;  2JA6 I;  3HOY I;  4A3I I;  1X3Z A;  4XX2 A;  4Y7N I;  3H0G I;  4NBH A;  5C3E I;  1N2F A;  5C44 I;  4BY7 X;  1ML8 A;  3ESW A;  3HOU I;  3LUS A;  4NB9 A;  3HOX I;  3Q87 A;  3I4M I;  3GCF A;  2NVT I;  3GTK I;  2HF1 A;  1TWC I;  2R93 I;  4X6A I;  3HOV I;  3GKQ A;  4NBF A;  3HOW I;  2F4M A;  4NBC A;  3EER A;  2JA7 I;  4BY7 I;  2J6A A;  3VMI A;  1WCM I;  2NVQ I;  5IP9 I;  3HOZ I;  2KPI A;  2R92 I;  4A3K I;  4QTT A;  3RZD I;  3M3Y I;  1K83 I;  3PO3 S;  4A3G I;  1NUI A;  1TWF I;  1TWH I;  1USP A;  1Y1V S;  2E2J I;  4NBE A;  5IP7 I;  4BBS I;  3NDQ A;  4QTU A;  2E2H I;  3GTG I;  2B63 I;  3M4O I;  1PFT A;  2VUM I;  4A3E I;  1VLA A;  4NOZ A;  3VMH A;  1Y1W I;  1I6H I;  2DME A;  3K7A I;  3S2H I;  4A93 I;  2E2I I; 
#chains in the Genus database with same CATH topology
 4BCO B;  3F3P C;  5C4J I;  3HO8 A;  3I4N I;  1L1O C;  2VF1 A;  1NJI 2;  3JAM f;  3CCQ 1;  3B57 A;  4BCQ D;  1QVF Z;  1TFB A;  2AHJ B;  3S16 I;  3EID B;  3X25 B;  1FIN B;  3S15 I;  1I3Q I;  4DQY B;  1TFI A;  2JGZ B;  2C5O B;  3NFZ A;  1OL1 B;  2WFY B;  1GUX A;  4A3L I;  3I55 Z;  1Y8C A;  2LFU A;  1QF8 A;  2DE6 A;  3CCJ 1;  2E9H A;  3VYH B;  1X0T A;  2LIY A;  2R7Z I;  1H26 B;  4OR5 B;  2CZ1 B;  3QHW B;  4TNU A;  4A3B I;  2OTJ Z;  1O9K A;  2VPZ A;  3DJB A;  2OTL 1;  4NB8 A;  2WMA B;  1VQ8 1;  2KR6 A;  3I56 1;  3NH5 A;  3X28 B;  1Q7Y 2;  3CMA Z;  2IZ3 A;  3JAM b;  1VQP 1;  2V8K A;  5ICP B;  4JX5 A;  3DL1 A;  2QQ8 A;  1RO4 A;  2O53 A;  4EOQ B;  3OW2 Z;  1SFO I;  1USP B;  3GTL I;  2WXV B;  1WJ2 A;  1H1S B;  5HNB B;  5D1O A;  3A8O B;  2JS4 A;  3OW2 Y;  1H24 B;  2DD4 B;  1QVF Y;  2QLV B;  1QYP A;  1W98 B;  2ZPG B;  4EON B;  3CXC Y;  5EJC A;  2JA6 I;  2OTL Z;  2D0Q B;  1X3Z A;  3BG5 A;  5D1O B;  4EOP B;  3A8H B;  4BCM B;  3H0G I;  1D3U B;  1JWH C;  2Y0S A;  4ZGD B;  3LUS A;  2V45 A;  5IT9 f;  2QGS A;  4EOI B;  3I4M I;  1AD6 A;  2NVT I;  4BCH B;  4MON A;  1Q86 2;  3HOV I;  5HBH B;  2F4M A;  3J80 f;  5CYI B;  2GTI A;  3EER A;  1XO2 A;  3M03 A;  4NH1 C;  4DK1 A;  1WCM I;  2JMO A;  1Q81 1;  3QXE B;  3QYG B;  3QYE A;  4CFX B;  4EOJ B;  3PO3 S;  2OZK A;  1TWF I;  5HBE B;  2CJM B;  1N8R 1;  1QVG Y;  1FVV B;  1Y1V S;  4F6U B;  4F7L B;  3HHT B;  2QA4 1;  3NDQ A;  3CCL 1;  3QZ9 B;  2LEX A;  2UUE B;  4IMY B;  1Z03 A;  3BG1 B;  4RV9 A;  2IV2 X;  1PFT A;  2RIQ A;  3X24 B;  1KRL A;  1AA6 A;  1Q16 A;  2E7Z A;  2NAP A;  4S1T A;  1VQ6 Z;  1YI2 Z;  2DME A;  4AKI A;  2M48 A;  2E2I I;  5I5Z B;  3FKI I;  3CCQ Z;  2IZ4 A;  2RBL A;  5BNJ B;  1UGS B;  3VYG B;  4F6S B;  3BHV B;  2QEX Z;  3D9X A;  3LQ5 B;  3GTM S;  4NBD A;  3MZK B;  3PO3 I;  4OB2 B;  3S14 I;  3EED A;  3CC2 Z;  1VQ5 Z;  2CCI B;  4OGR B;  2UZL B;  1WW9 A;  2DD5 B;  3DTO A;  4EOM B;  1YUA A;  2JR6 A;  2F2C A;  3P5J B;  3CME 1;  4HNV A;  4BY1 X;  3TN8 B;  1H27 B;  4OB3 B;  4RVD A;  3H3V J;  2QFZ A;  2JIP A;  3HKZ A;  4E30 A;  1VQ8 Z;  1K8A 2;  2M6N A;  2ZAE B;  1LQL A;  4CFN B;  5CM2 M;  1VIN A;  2PMZ A;  4A3D I;  2ZPH B;  3NH4 A;  1Q7Y 1;  1X3W A;  4E2Z A;  4A3M I;  4MFD A;  5A2Q b;  3GTP I;  3MZL B;  4CL1 A;  3CCV 1;  3S1N I;  3S2D I;  5FLM I;  2YAD A;  3I55 1;  2DE5 A;  1DL6 A;  2CCH B;  4Y72 B;  2F4O A;  1K9M 1;  1WZN A;  3X26 B;  5LMK B;  1YIJ Z;  3GTO I;  4ZGE B;  3G71 Z;  2BJO A;  4HNT A;  1VQL Z;  2AKL A;  4DGL A;  4EOL B;  3KHI A;  1Z02 A;  3GTQ I;  3S17 I;  3PO2 I;  4MIM A;  4MD9 A;  3RZO I;  1OKW B;  5IF1 B;  2OOY B;  5CEI B;  1BU2 A;  3HOY I;  4FM4 B;  4E2X A;  4A3I I;  3MY1 B;  4Y7N I;  3TW7 A;  4YOO A;  1IRE B;  5C3E I;  5C44 I;  4LOC A;  5DQV A;  4BCJ B;  3T4N B;  1OL2 B;  2CZ7 B;  2W99 A;  4RS4 A;  1VOL A;  1VQ6 1;  1Q82 1;  4YOS A;  4NB9 A;  2GTH A;  4ROE A;  2W04 A;  4BCP B;  3Q87 A;  3A8M B;  4E33 A;  4HH4 A;  4BCM D;  1FDI A;  4RVF A;  4F7S B;  2HU9 A;  4X6A I;  1Z01 A;  3NDJ A;  2W9Z A;  3BLR B;  4NBC A;  4NC6 A;  3F5X B;  2UZE B;  2ZPE B;  1UGR B;  1H1Q B;  1M1K 2;  5IP9 I;  2I40 B;  1AIS B;  3O0G D;  1YUK A;  2KPI A;  4QTT A;  4E32 A;  3RZD I;  1QMZ B;  4MRI A;  4YC3 B;  2WEV B;  4A3G I;  1TWH I;  4ELL A;  4EOR B;  1GH6 B;  5T6B A;  3CCM 1;  1K8A 1;  1P9N A;  5T64 A;  1YIT 1;  1VYW B;  5IP7 I;  4II5 B;  2E2H I;  5D1P A;  2PK2 A;  3GTG I;  2B63 I;  2VUM I;  5HVY B;  4A3E I;  1JOW A;  3QYB A;  3CCS Z;  3BHU B;  4E2W A;  3BLQ B;  2WMB B;  4FX3 B;  4EWC A;  1Y1W I;  2IW6 B;  2C5V B;  2WIP B;  4MFE A;  3NH8 A;  4F7J B;  3QWL A;  1VQO 1;  4A93 I;  2DPP B;  2NVX I;  3HZJ A;  1S72 1;  1KD1 1;  4A3F I;  2W2H A;  4RVH A;  4BCN B;  5FLX b;  2RT9 A;  2GU2 A;  3CQZ I;  2V3V A;  3J81 f;  4BY1 I;  4JX6 A;  3TNI B;  4ZGJ B;  2W03 A;  3MIA B;  2R6M A;  2I3C A;  3G4S Z;  2C6T B;  1UGQ B;  3BG3 A;  3D2L A;  4NBG A;  3TE5 B;  3DDP B;  5DQW A;  4AYB A;  3TW6 A;  2LW4 A;  2WHB B;  2IVX A;  2P3Y A;  2PHG A;  2JIR A;  2I53 A;  1NP6 A;  3MY5 B;  2KI7 B;  4NFR A;  3CD6 1;  3DDQ B;  2PM9 A;  4MD8 A;  1YJW 1;  1YJN 1;  3VMG A;  4TTH A;  5IT9 b;  2VPY A;  4CFV B;  4A3J I;  3CCE Z;  1KQS Z;  3J81 b;  1VQO Z;  3IR7 A;  3S1M I;  1O9K B;  4CFU D;  1VQ4 Z;  1VQ9 1;  1URC B;  1KQS Y;  2JIQ A;  2K5R A;  3I07 A;  3U50 C;  3CC2 1;  3WVE B;  3GTM I;  1VQ4 1;  4KRC B;  3G4S 1;  3MON A;  1RO2 A;  2V8J A;  1AHJ B;  4I3Z B;  1R9T I;  4AKG A;  3CMA 1;  2NVY I;  3CCR 1;  2PK7 A;  1M90 1;  4BCN D;  5IHY A;  1YJW Z;  2DE7 A;  2JA5 I;  2JA8 I;  2IN3 A;  1UNH D;  1OI9 B;  4CRL B;  3KIF A;  1FDO A;  1SIW A;  2G77 A;  3TNH B;  4XX2 A;  3EOC B;  4NBH A;  4RVG A;  1N2F A;  4F70 B;  4OB0 B;  4BY7 X;  2EGT A;  5FGK B;  4BBS M;  1ML8 A;  2OOX B;  1JKW A;  3ESW A;  2CYZ B;  4BCI B;  2CZ0 B;  1VQ5 1;  1VQN 1;  1GY3 B;  1H25 B;  3CPW Z;  1N8R 2;  1P5E B;  1N4M A;  3FQQ A;  3MI9 B;  3GCF A;  3IX0 A;  3CCU 1;  4UN0 A;  2HF1 A;  1VQN Z;  3GTK I;  3GKQ A;  2Q4Z A;  4G6L B;  1H1R B;  4NBF A;  1YHQ Z;  2G9X B;  3CPW Y;  3CCM Z;  2P28 A;  3HOW I;  2BS4 A;  3BG0 B;  1VQ9 Z;  2C5X B;  1UNG D;  1E9H B;  2EUF A;  3WVD B;  1KD1 2;  3IFU A;  2C4G B;  2NVQ I;  1UGP B;  4F7N B;  3I56 Z;  4HLQ A;  2ZPB B;  5IDP B;  4AKH A;  1K83 I;  1WII A;  1NUI A;  3DOG B;  4YOZ A;  4HGY A;  3CD6 Z;  3G33 B;  2W9F A;  1VQK 1;  2VPX A;  5EFQ B;  5FLX f;  3HB9 A;  4EOS B;  4QTU A;  3CCS 1;  1W2B Z;  2ZZD B;  3POM A;  3M4O I;  3CCU Z;  1TD6 A;  3HBL A;  2BS2 A;  3FQM A;  1W2B Y;  1VLA A;  2JUB A;  1VQM 1;  3A8G B;  2QDJ A;  3CCE 1;  4CFW B;  2QA4 Z;  5AN9 F;  1FKM A;  1K9M 2;  3S2H I;  1JST B;  4HGZ A;  4BCQ B;  1ZB9 A;  2QRD B;  3CC4 1;  4OB1 B;  2OTJ 1;  2B9R A;  2WIH B;  4MH4 A;  2V8I A;  1VQL 1;  3EJ1 B;  3CCR Z;  3CC4 Z;  4E2Y A;  1TWG I;  2BS3 A;  5HBJ B;  2BPM B;  5T67 A;  1K73 1;  4AI6 A;  1YI2 1;  3F3F C;  1OGU B;  3H4C A;  4BBR I;  2QKD A;  2QRC B;  4HNU A;  1C9B A;  3S1R I;  1YJ9 1;  1M90 2;  4Y52 I;  1F5Q B;  1JJ2 Y;  4A3C I;  2DXC B;  3CCV Z;  3S1Q I;  2YU9 I;  1RO0 A;  4EOK B;  2QEX 1;  2H85 A;  2K3R A;  2WB1 A;  1JJ2 Z;  2QDY B;  3QYH B;  2IW9 B;  4KRD B;  3BLH B;  1ZH1 A;  4CFM B;  2JIM A;  1H1P B;  5C4X I;  4E31 A;  5A2Q f;  3KIH A;  1V29 B;  2JNY A;  1H28 B;  1H4L D;  3G71 1;  2WJ9 A;  4EOO B;  1RQF A;  4MD7 A;  3J7A 4;  1QLB A;  3RGF B;  1VQM Z;  3X20 B;  4BCK B;  4ROC A;  1VQ7 Z;  1RLY A;  3CXC Z;  3CME Z;  1KXU A;  1UNL D;  1I50 I;  1TWA I;  1E7P A;  3CCL Z;  3GTJ I;  1Q86 1;  4F6W B;  5ACB A;  1YJ9 Z;  1YIT Z;  4BXX I;  2W96 A;  4CXA B;  4NST B;  4NBB A;  3QWU A;  1VQP Z;  4CFU B;  1ZB8 A;  2C5N B;  3NDI A;  1ENW A;  1OIU B;  4ELJ A;  4HL4 A;  1VQK Z;  3K7A M;  4ROD A;  1OKV B;  3D6W A;  1QXF A;  1Y1V I;  2QF7 A;  2G2K A;  3IF8 A;  3VB9 A;  4BXX X;  2VPW A;  4NBA A;  1M1K 1;  1JSU B;  4QSH A;  3TNW B;  3CCJ Z;  1S72 Z;  1KC8 1;  3VKH A;  4JX4 A;  2JIO A;  2ZPI B;  3QHR B;  1KC8 2;  2X1N B;  1Q81 2;  2VUG A;  2PMI B;  3HOU I;  3BG9 A;  1YHQ 1;  3CC7 Z;  1NJI 1;  3HOX I;  2RHB A;  4Z6Y A;  1QVG Z;  2Q51 A;  3TDH B;  1Q82 2;  1TWC I;  2R93 I;  4BCF B;  4EC8 B;  5LQF B;  1K73 2;  3BHT B;  2WAQ A;  2IW8 B;  2JA7 I;  4BY7 I;  2WPA B;  1ZP2 A;  5IDN B;  2J6A A;  3VMI A;  2R7G A;  4BBR M;  2QRE B;  3J80 b;  3G6E Z;  2AYD A;  3HOZ I;  2R92 I;  4A3K I;  2ZPF B;  2CZ6 B;  2KMG A;  1S7M A;  3G6E 1;  3M3Y I;  4MXU A;  2V22 B;  1YJN Z;  1GUX B;  2PK9 B;  2QR1 B;  1USP A;  5L2W B;  4EC9 B;  2UZD B;  2E2J I;  2O4H A;  4NBE A;  2UZB B;  3QZ5 B;  3VTN A;  4BBS I;  3CC7 1;  1YIJ 1;  1OIY B;  4M6V A;  1PKD B;  3A8L B;  2ZCF B;  4BCG B;  5HQ0 B;  1RNI A;  2BKZ B;  2DXB B;  2PJQ A;  3VKG A;  4NOZ A;  1G3N C;  3VMH A;  1I6H I;  2RPR A;  1VQ7 1;  5LL6 f;  3K7A I; 
#chains in the Genus database with same CATH homology
 3F3P C;  5C4J I;  3I4N I;  1L1O C;  2VF1 A;  1NJI 2;  3JAM f;  3CCQ 1;  1QVF Z;  3S16 I;  3S15 I;  1I3Q I;  4DQY B;  1TFI A;  3NFZ A;  4A3L I;  3I55 Z;  2LFU A;  1QF8 A;  2DE6 A;  3CCJ 1;  2E9H A;  1X0T A;  2LIY A;  2R7Z I;  4TNU A;  4A3B I;  2OTJ Z;  2OTL 1;  4NB8 A;  1VQ8 1;  3I56 1;  3NH5 A;  1Q7Y 2;  3CMA Z;  2IZ3 A;  3JAM b;  1VQP 1;  2V8K A;  1RO4 A;  2O53 A;  3OW2 Z;  1SFO I;  1USP B;  3GTL I;  5D1O A;  2JS4 A;  3OW2 Y;  1QVF Y;  2QLV B;  1QYP A;  3CXC Y;  2JA6 I;  2OTL Z;  1X3Z A;  5D1O B;  3H0G I;  1JWH C;  2Y0S A;  3LUS A;  5IT9 f;  3I4M I;  2NVT I;  4MON A;  1Q86 2;  3HOV I;  2F4M A;  3J80 f;  2GTI A;  3EER A;  4NH1 C;  4DK1 A;  1WCM I;  2JMO A;  1Q81 1;  3PO3 S;  2OZK A;  1TWF I;  1N8R 1;  1QVG Y;  1Y1V S;  2QA4 1;  3NDQ A;  3CCL 1;  1Z03 A;  3BG1 B;  4RV9 A;  1PFT A;  2RIQ A;  1KRL A;  3K7A I;  4S1T A;  1VQ6 Z;  1YI2 Z;  2M48 A;  2DME A;  2E2I I;  3FKI I;  3CCQ Z;  2IZ4 A;  2RBL A;  2QEX Z;  3D9X A;  3GTM S;  4NBD A;  3MZK B;  3PO3 I;  3S14 I;  3EED A;  3CC2 Z;  1VQ5 Z;  1WW9 A;  1YUA A;  2JR6 A;  3P5J B;  3CME 1;  4BY1 X;  4RVD A;  3H3V J;  3HKZ A;  4E30 A;  1VQ8 Z;  1K8A 2;  2M6N A;  2ZAE B;  1LQL A;  5CM2 M;  2PMZ A;  4A3D I;  3NH4 A;  1Q7Y 1;  1X3W A;  4E2Z A;  4A3M I;  5A2Q b;  3GTP I;  3MZL B;  4CL1 A;  3CCV 1;  3S1N I;  3S2D I;  5FLM I;  2YAD A;  3I55 1;  2DE5 A;  1DL6 A;  1K9M 1;  2F4O A;  1YIJ Z;  3GTO I;  3G71 Z;  2BJO A;  1VQL Z;  2AKL A;  4DGL A;  1Z02 A;  3GTQ I;  3S17 I;  3PO2 I;  4MD9 A;  3RZO I;  2OOY B;  3HOY I;  4E2X A;  4A3I I;  4Y7N I;  5C3E I;  5C44 I;  3T4N B;  4RS4 A;  1VQ6 1;  1Q82 1;  4NB9 A;  2GTH A;  4E33 A;  2W04 A;  3Q87 A;  4HH4 A;  4RVF A;  4X6A I;  2HU9 A;  1Z01 A;  3NDJ A;  4NBC A;  1M1K 2;  5IP9 I;  1YUK A;  2KPI A;  4QTT A;  4E32 A;  3RZD I;  4MRI A;  4A3G I;  1TWH I;  5T6B A;  3CCM 1;  1K8A 1;  1P9N A;  5T64 A;  1YIT 1;  5IP7 I;  2E2H I;  5D1P A;  3GTG I;  2B63 I;  2VUM I;  4A3E I;  3CCS Z;  4E2W A;  4EWC A;  1Y1W I;  3NH8 A;  4A93 I;  1VQO 1;  2NVX I;  1S72 1;  1KD1 1;  4A3F I;  4RVH A;  5FLX b;  2RT9 A;  2GU2 A;  3CQZ I;  3J81 f;  4BY1 I;  2W03 A;  2R6M A;  2I3C A;  3G4S Z;  3TE5 B;  4NBG A;  4AYB A;  2LW4 A;  2P3Y A;  1NP6 A;  2KI7 B;  4NFR A;  3CD6 1;  2PM9 A;  4MD8 A;  1YJW 1;  1YJN 1;  3VMG A;  5IT9 b;  4A3J I;  3CCE Z;  1KQS Z;  3J81 b;  1VQO Z;  3S1M I;  1VQ4 Z;  1VQ9 1;  1KQS Y;  3CC2 1;  2K5R A;  3I07 A;  3U50 C;  3GTM I;  1VQ4 1;  3G4S 1;  3MON A;  1RO2 A;  2V8J A;  1R9T I;  3CMA 1;  2NVY I;  3CCR 1;  2PK7 A;  1M90 1;  2JA5 I;  1YJW Z;  2DE7 A;  2JA8 I;  3KIF A;  4XX2 A;  4NBH A;  4RVG A;  1N2F A;  2EGT A;  4BY7 X;  1ML8 A;  2OOX B;  3ESW A;  1VQN 1;  1VQ5 1;  3CPW Z;  1N8R 2;  3FQQ A;  3IX0 A;  3GCF A;  3CCU 1;  1VQN Z;  2HF1 A;  3GTK I;  3GKQ A;  2Q4Z A;  4NBF A;  3CPW Y;  1YHQ Z;  3HOW I;  3CCM Z;  2P28 A;  3BG0 B;  1VQ9 Z;  1KD1 2;  3IFU A;  2NVQ I;  3I56 Z;  1K83 I;  1WII A;  1NUI A;  4HGY A;  3CD6 Z;  1VQK 1;  5FLX f;  4QTU A;  3CCS 1;  1W2B Z;  3M4O I;  3CCU Z;  3FQM A;  1W2B Y;  1VLA A;  2JUB A;  3CCE 1;  2QA4 Z;  5AN9 F;  1K9M 2;  3S2H I;  4HGZ A;  1ZB9 A;  2QRD B;  3CC4 1;  2OTJ 1;  4MH4 A;  2V8I A;  1VQL 1;  3CCR Z;  3CC4 Z;  4E2Y A;  1TWG I;  5T67 A;  1K73 1;  1YI2 1;  3F3F C;  4BBR I;  2QKD A;  2QRC B;  3S1R I;  1YJ9 1;  1M90 2;  4Y52 I;  1JJ2 Y;  4A3C I;  3CCV Z;  3S1Q I;  2YU9 I;  1RO0 A;  2QEX 1;  2H85 A;  2K3R A;  2WB1 A;  1JJ2 Z;  1ZH1 A;  5C4X I;  4E31 A;  5A2Q f;  3KIH A;  2JNY A;  3J7A 4;  3G71 1;  1RQF A;  4MD7 A;  1VQM Z;  1VQ7 Z;  1RLY A;  3CXC Z;  3CME Z;  1I50 I;  1TWA I;  1Q86 1;  3CCL Z;  3GTJ I;  1YJ9 Z;  1YIT Z;  4BXX I;  4NBB A;  3QWU A;  1VQP Z;  1ZB8 A;  3NDI A;  1ENW A;  1VQK Z;  3D6W A;  1Y1V I;  2G2K A;  3IF8 A;  3VB9 A;  4BXX X;  1M1K 1;  4NBA A;  3CCJ Z;  1S72 Z;  1KC8 1;  1KC8 2;  1Q81 2;  2VUG A;  3HOU I;  1YHQ 1;  3CC7 Z;  1NJI 1;  3HOX I;  2RHB A;  1QVG Z;  3TDH B;  2Q51 A;  1Q82 2;  1TWC I;  2R93 I;  1K73 2;  2WAQ A;  2JA7 I;  4BY7 I;  2J6A A;  3VMI A;  2QRE B;  3J80 b;  3G6E Z;  3HOZ I;  2R92 I;  4A3K I;  1S7M A;  3G6E 1;  3M3Y I;  4MXU A;  1YJN Z;  2QR1 B;  1USP A;  2E2J I;  2O4H A;  4NBE A;  3VTN A;  4BBS I;  3CC7 1;  1YIJ 1;  1RNI A;  4NOZ A;  3VMH A;  1I6H I;  2RPR A;  1VQ7 1;  5LL6 f;  1VQM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...