4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
b'MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
2DD5A 2QDYB 2ZZDA 4KT0E 3VYHB 3X25B 1AHJB 1QP2A 1UGRB 2ZCFB 2DD4A 4ZGEB 3X26B 2ZPEB 3VYGA 2CZ0B 2AHJB 3A8GB 3QXEB 2DXCB 3QYHB 2DPPB 2PU9B 2CZ6B 5L8RE 2CZ7B 2ZPGB 4OB3B 1PSEA 4OB1B 1DJ7B 2DD5B 3X28B 2ZZDB 1PSFA 1UGPB 3X24B 3QZ9B 1UGSB 2DD4B 4FM4B 3WVEB 2CYZB 2PUOB 2DXBB 4L6V5 3VYGB 3X20B 1QP3A 2WSCE 3A8MB 2O01E 2PVDB 4XK8E 1IREB 3QYGB 2WSFE 2PVGB 3A8HB 2CZ1B 4OB0B 3A8OB 1GXIE 2ZPFB 4Y28E 1V29B 2PUKB 4ZGJB 2WSEE 3WVDB 4OB2B 3QZ5B 3HHTB 2DXBA 2ZPHB 4ZGDB 2PVOB 2ZPBB 3A8LB 1JB0E 2DXCA 2ZPIB 4RKUE 3LW5E 1UGQB 2D0QB
chains in the Genus database with same CATH superfamily
3JV3A 2LRQA 4EORB 3MI9B 1M1GA 4KGZB 4KT0E 1O9KA 2W10A 1X27A 1OULA 2M16A 1FX7A 5J3BA 4KGVB 5HQ0B 3REAB 3CCEQ 2CZ0B 4HT9A 1WJSA 2ATCB 1VQLT 3L2VA 2EVRA 2MK5A 3P8HA 2KNBB 2AHJB 1UNGD 5GAOn 2COYA 2QK0A 2AK5A 4QW2A 1D3BB 1RADB 4F7SB 1K73U 4AKIA 3JAME 2P0QA 1V1CA 4OB1B 2LT4A 1YNZA 4MZMA 2DZ9A 3BG9A 4C92G 1YCYA 3I55A 3RESA 1J3TA 4HT8A 1Y96B 1VQ7A 3HP9A 3CXCP 4JPBW 3M56A 3CCRA 2YUPA 1PD1A 1S72A 1SSFA 1ZUYA 1KD1C 4PJOC 1UECA 2I2LA 4KGXB 1XO2A 1V76A 4DEYA 2KGTA 2QF7A 2HQXA 2ENMA 3GBQA 3DDQB 1H1RB 1ZHIA 1KQ2A 4M6VA 2DTIA 2KEAA 4AFQC 4F7UB 1EX4A 2XG8D 5FWBA 2C5OB 3BDLA 3CCQA 1TFBA 2C0TA 1VQ8T 2HD0A 1V29B 2HEQA 2MF2A 2MYSA 5KYXA 4F7UE 4HLQA 4ELLA 3SDZA 2V1QA 2L8DA 2HL5C 1WXUA 1Q81C 1RI9A 2L89A 3J80E 4BUGA 1H28B 3UPUA 4AFUC 2OTJA 4RG2A 2CP2A 2JTEA 4PFZA 4EONB 4X9CA 3S6WA 3VS2A 1GCPA 1Y71A 2V8KA 1WX6A 1QCOA 1YI2A 4NL2A 3Q1JA 5J26A 1K8AC 4XTWA 2C5VB 1PM3A 4QVZA 2ESWA 2EJFA 1IXDA 4M78C 4OMNA 1JQQA 2E5QA 3CCJQ 5CEIB 3LYIA 5KYYA 2QGFB 4RTZA 4N4IA 3JB9F 4RTXA 1QKWA 3EG3A 1X6GA 3TCJA 4AMCA 1BI3A 4M7DC 2LZ6B 2OAUA 4EOQB 4JUVA 2PNIA 1NJIU 5FU7C 1PSEA 5KYNA 1CKAA 1T0HA 2JJ9A 2E1HA 2RQRA 1VQ5A 2RK1A 1B3QA 2DL7A 3FJ5A 3V7RA 1FMKA 2EKHA 4BE2A 3EG9A 2YHTA 3HZJA 1E7PA 2JNGA 2QAZA 4FYVB 2OX7A 5HKCA 4LDVA 2HBPA 1X69A 1GFDA 2PUOB 4RCBA 5FU6B 2UZDB 2MPXC 3VS6A 2AKLA 3CQTA 3G71T 1RAIB 5LJ3g 1VQPQ 1VQOA 2K9GA 3CC7T 3G1JA 2KMTA 3QWXX 1G83A 1VQMA 2HKNA 2QTVA 4IUVA 1B7TA 3GPLA 2DXTA 4IUUA 1JU5C 3E9GA 2HSEB 2QQRA 2RQVA 3S3MA 2PUKB 1H1QB 1MNEA 1Q86R 2RHZA 5M9OA 3VS3A 2HCKA 4M75A 2CUDA 3TEEA 4BCFB 3VS7A 3RKYA 3TSWA 1D1AA 4NC6A 5GANd 2D6FA 2BS2A 2RF0A 4MZPA 3CCSA 2QQBA 3OYKA 1EZZB 4HVVA 1OU9A 1VA7A 2EQUA 1N8RU 4BY6B 1WGSA 2OTLQ 2A7YA 3CPWS 2XIDA 1ZSZA 1SG5A 2BZYA 2OJ2A 2WFYB 2F1LA 4P5NA 3ZEHA 2P4RA 1M5Q1 1VQ9Q 2W0ZA 1UTIA 5FROA 3CMEA 2KY9A 3QO3A 3VYGA 1PHTA 4J7FA 2NUPA 4BCPB 1KG1A 3E9FA 5IXBA 3BLHB 4M7AF 1RAEB 2SRCA 1M2VB 1YHQQ 4RTTA 3L42A 2G77A 1I4K1 3I35A 4OVAA 3C95A 3AT1B 2QDJA 1MMNA 4FYWB 1Q7YC 4B6MA 2DL8A 2AZVA 2GGRA 1NM7A 2BTTA 3TSZA 1N5ZA 3PIOA 1UGSB 4ME7A 5HY6A 2DBMA 4M77F 1PWTA 4M7AB 3SEMA 3DLMA 2DA9A 1VQ4Q 2XHCA 3QYBA 4J9CA 2LDMA 5LL6S 1OL2B 3TNHB 2B8AA 3A8MB 2IPOB 2LQWA 2IIMA 3EFRA 5AT1B 2LJ1A 2D8JA 1T0JA 3EG1A 2PVGB 1UE9A 3SWNB 3CCLQ 2A08A 4M75G 4C8QF 4EMGA 2YDLA 4AKGA 1W4SA 5IT9E 4FSXA 4BCQD 1HD3A 3G6EA 4UC4A 1C0MA 3QPHA 4E7LA 4J7IA 5GAMd 1FVVB 5IAYA 1M90R 3CMAQ 3OA6A 1HK9A 1QVFA 2K7AA 3M57A 1MV0B 3CCUQ 2UZEB 2BE7D 1I81A 4C0DB 4M7DE 3OYFA 1Z9QA 2JTFA 2J05A 1EIFA 3TU4K 4PJOA 2ED0A 1KFZA 4RTYA 2ZPHB 3L2WA 4M4ZA 4CFMB 3DL1A 1W6XA 1ZSGA 4QQ6A 4OGCA 1SHFA 1G3NC 3H0HA 3OYEA 2RQTA 1D0XA 2HQHA 2VXEA 5ACBA 4B9XA 3H0IA 5DLOA 2MMPA 2R5AA 1WHJA 1TG0A 4HA8A 1BU1A 2O4XB 1GUXA 2R57A 5I5ZB 5GJWB 2X3XD 3HL8A 1PRMC 3JCMc 1ABQA 1ABOA 4J9HA 2WEVB 4AFZC 1SKUB 5IF1B 1BI2A 2EQMA 2AZSA 4J9DA 4BCJB 1M8MA 3BG5A 3QXEB 2DXCB 2FZKB 1VQ8Q 1RAHB 1H92A 2DPPB 3BHTB 2D1XA 1RLQC 2KXCA 3H0FA 1ZLMA 3KXTA 2KSSA 2LX9A 3JCMg 3VS4A 2W9ZA 4NSTB 2GTOA 4HCCA 1KK7A 1Q7YR 3UA7A 4XU0A 1U1SA 3ZFJA 2RJCA 2VWFA 4M78A 4PJJA 3REBB 1NBEB 1F1BB 3CC2A 1UJYA 1YJNQ 2DX1A 1H4LD 1KC8C 2O9SA 1VQNA 4LDXA 4BD3A 3E1SA 2R5MA 5IDNB 3VU3C 1MMGA 4M7DA 4OGEA 1QVPA 1JJ2S 1QVGS 5HBHB 1TXQA 2M0YA 4FW1A 4PJOG 2OI3A 2E4HA 2LVMA 4IKFA 2HL3A 2CT3A 4KUIA 4CFVB 2O9VA 4BCIB 1FINB 3CCJT 2KXDA 5GAOr 1K1ZA 3EG2A 4E2FB 4Q5WA 1Q82U 3FIFA 1VYWB 1TSFA 4E7ZA 2W99A 2ZPBB 2MI6A 3G4SA 4C92B 2KRSA 3VKGA 1H25B 4B9WA 2WPAB 4HKEA 1S1NA 2ZAEA 2GBQA 3BG3A 4LE9A 1BK2A 4A4KA 2QDYB 4E7IA 2CKKA 3PMIA 1YIJA 2QASA 4C92E 2JM9A 3L2UA 2VGMA 4WF2A 2CS7A 1I5LA 1G8XA 4X34A 4ZN1A 1UNHD 1MMDA 1AWJA 1YJ9A 1AEYA 1CSKA 1VQ6A 2QFZA 3HTRA 5KYWA 4C92D 2DILA 1KSWA 2V8JA 2CH4W 3QKJA 3QYHB 1VQPT 2LMJA 4XAXB 4M78G 2XKOC 4TVRA 1H641 1D1CA 2IG0A 1UG1A 4CI0C 4CFWB 2CSQA 5IDPB 3LWIA 1M30A 1VQKA 1QMZB 1JEGA 1HXDA 5DQVA 2HNIA 3JCMX 2RH2A 4IMYB 2ROTA 4BY1X 2QQ9A 4M7DG 1WYXA 1Z9ZA 1X43A 1TOVA 4UN0A 5IHKA 1WI7A 4R0KA 3FLGA 4OMLA 2D8HA 2DNUA 1KC8R 4IIMA 2CJMB 4BDYA 2DL5A 3C0CA 5CKDA 5GAOq 3OYYA 3L2QA 1W98B 3META 4R56A 4LD6A 3CPWA 2EGAA 2LT1A 3A8HB 3L2RA 2GF7A 1RL2A 1U8RA 1NEGA 2AIRB 2DBKA 4M77G 3CCMA 5CK9A 4RUGA 2JTMA 4KULA 3A8OB 1WJRA 1RAGB 3O5ZA 4ANJA 3V7SA 2DERA 2B9RA 4YOSA 2K2VA 4XTUA 2WMAB 4C0FA 2FRYA 4D8KA 1N9RA 1FMWA 4JJDA 3OBWA 3KBGA 1X2QA 3CCEA 1QQJA 2J6OA 1M1FA 2L3QA 2FB7A 4FW2A 4C5HA 4C8QG 1AT1B 2LNHB 1I8FA 5FWCA 6AT1B 4FYYB 3FDRA 4GLKA 2FZGB 2DD5A 1YHQT 4CC2A 3OW2S 5LMKB 2ZZDA 3JCMb 3VV0A 1M3AA 3HO8A 4D6WA 5I21A 4FIBA 2V22B 4MDXA 1PC0A 4NOYA 2CP7A 1WXTA 3I5RA 5GAN2 3MY5B 5DLQE 4PK4A 2O2OA 4Z02A 3M5AA 4BBSM 1VQ4T 1WA7A 3RMQA 5GAN8 3MEUA 2X51A 5GANe 3JCMQ 2ZPGB 4F6UB 4EPCA 1HJDA 2VC8A 3QG1A 4ZNXA 4ZTJA 1YJWA 3CCLT 2F2XA 1QCNA 2FPEA 2FG0A 4Z88A 1VYUA 4EMKC 3SFMA 4JX6A 1PCXA 4E7KA 3EHQA 2K5IA 3M55A 4FM4B 2JUFA 2LNVA 3CMAT 3P8DA 3EGUA 5A0GA 2F5TX 2DFUA 3CCUT 1QVFS 1RACB 5KYYB 1QW1A 4A54A 2EW3A 5FU6C 2RD1A 3NFCA 2DL3A 3CBOA 2RPNA 3LX7A 4QT7A 1GL5A 1YCSB 1OPKA 3BY7A 2VV5A 2E6ZA 2D0NA 4F7UF 4BY7X 3J7AF 3UWNA 2EWNA 4PKCC 4EMHA 3CCVQ 4OMMA 1JBMA 1I07A 2GQIA 3EG9B 1MV3A 3QIIA 1UJ0A 5C6SA 2AT1B 1OZ3A 2RJEA 2I40B 4JJBA 4JRIA 3RBBB 3JB9I 2KT8A 2QEXQ 5J39A 1Q86U 4J9BA 3JCMW 1Y0MA 1UFFA 4AG2C 4C5IA 5D7UA 3KFVA 2YUQA 3TQ7P 1QMCA 2G3RA 3OSSC 3QHWB 4F7JB 2E12A 3EG0A 4BY6C 4MIMA 5GAMe 4JS4A 2BKDN 2UZBB 4BACA 2FHDA 2RN8A 2JVVA 1JJ2A 2RB6A 1KHCA 1T3LA 1UGVA 1QVGA 1GFCA 4E7JA 1YJNT 2C06A 2GCXA 2GFAA 1IB8A 2RHXA 5GAOp 3M03A 2CZ7B 4M75E 3POMA 2JS0A 3M53A 3M0PA 5LJ5d 4FL6A 3QDFA 2H3EB 1ZP2A 3GLXA 4DA4A 3X24B 3I56A 1UHCA 3LH0A 2X3WD 3T9NA 1YITA 4LUDA 2PK2A 4M75D 2PZ1A 3TREA 4XU3A 2LW4A 3RGFB 4FT4A 3I55Q 3CPWP 1AD5A 3MY1B 1E6GA 4M7AC 1VQ7Q 3VYGB 2WSCE 3CCRQ 4DOVA 1S72Q 2YUNA 5CVIA 1U1TA 3MEWA 2YUOA 1H1PB 2ED1A 2KK4A 2CP5A 2CZ1B 3PIPA 4EOPB 2DRKA 3JB9J 4N4GA 2HAXA 2ABLA 4A4EA 3SWNC 2FL7A 4WTOB 2OTLA 1MUZA 2DM1A 2VASA 5GANh 2LJ3A 2KAFA 2RA2A 4BBRM 5HBEB 4M77C 5GAMf 4ZGJB 2E70A 4JRKA 1BU2A 2XMFA 3M0TA 1VQ9A 1NYGA 2CUBA 1KD1R 2F5KA 2NYSA 2KE9A 3ULRB 3OYIA 4Z6YA 2A28A 1M90U 5GANj 1UHFA 4YC3B 1NJIC 1OI1A 1WQWA 4C8QC 4YTLA 3IQLA 4KBMB 1AVZC 1W70A 4BCOB 3CD6T 1B07A 3X25B 3M0UA 1QP2A 4LDYA 1YI2Q 4PLIA 2CSIA 2KVQG 4BI8B 2QQAA 3SHWA 2EKOA 1OI9B 5CKBA 1P5EB 1Q81R 5HK0A 2CDTA 3B57A 1QWFA 4BCNB 4EOJB 1WHLA 2ROLA 1X6BA 4DOWA 3DB4A 1K9MC 5BNJB 2DLPA 1P92A 2PU9B 4GBQA 2IW9B 4QVCA 1K8AR 3CC4Q 4OB3B 2C5NB 1WJQA 3EGXA 3CCLA 4KH0B 4FT2A 4PJOE 4XTYA 4JX5A 2RJFA 3FC3A 2C4GB 5DQWA 1AD6A 4OMFB 1VQ5Q 2XDPA 1RAAB 2XU8A 3NTKA 2O88A 1GH6B 4C0ZA 1VQLA 1O75A 1R77A 4HNUA 3PO3S 3NPFA 3HSBA 4F6SB 2FZCB 4BCND 1AOJA 1CKBA 2PHGA 1Q7YU 1GUXB 5GMKe 2HMAA 2Z0WA 3GOXA 4PJOD 2G6FX 4QQDA 1K4US 3OW2A 2K2MA 5GAMh 1ZX6A 8ATCB 5CKEA 3PMTA 4DBRA 2K6DA 2EQIA 3NGPA 2JMCA 4A53A 5KCOA 2M1HA 3QYGB 3RKWA 4IUTA 4BXXX 4BCQB 1OZ2A 2X4WA 3AHUA 5GAMj 1GXIE 1WZOA 1VQMQ 4X1VA 5KE2A 2EYXA 4F16A 1URCB 1E6HA 1NZ9A 4EMKA 4ESRA 2LQ8A 2DVJA 2QQSA 1PKTA 1X01A 4M78B 3VKHA 2HZYA 5KCHA 1NEBA 3R6OA 4CXAB 1LPLA 2PVOB 5D6WA 3DJBA 4J9FA 4HNTA 4M78E 1UGQB 1VQ8A 2IW8B 3QHSA 4MFEA 2GNCA 2YT6A 4M7DB 4ELZC 1TUGB 2FO0A 2D0QB 1SHGA 1M3BA 2EPDA 4OMPA 2BZXA 2AKKA 2C6TB 1TUDA 2DL4A 2RK2A 2EYZA 1WHKA 3MEAA 1JJ2P 3PGGA 3VRYA 1QVGP 1HYOA 4M78D 2QGSA 4ZGEB 2PJQA 1RLPC 2JS2A 5GAOl 3EFSA 5GAN3 3EIDB 3EFOA 3MKDA 1XOVA 2LX7A 2NLUA 3KUFA 5CAIA 4TTHA 1Q95G 3CMEQ 2LCSA 1VYVA 1K9MR 2BKZB 2I0NA 4Y92A 5KYUA 4N0AC 4M7DD 4OGRB 2KI7A 1BYMA 3EH2A 4N4HA 2DIQA 2WXVB 2XDBA 2I53A 4M77E 3HBLA 4E7HA 2WHBB 4QSHA 2Y4XA 2J06A 4HCZA 1PSFA 3QJ6A 3QSUA 3EOCB 1OGUB 1UNLD 3G33B 3OY9A 2FPDA 3CCVT 2L3SA 1JO8A 1B34A 5FGKB 4CC3A 3THKA 5LJ3d 4ELYC 1WLPB 4V2SA 1AISB 4M77D 4XU1A 2M02A 4HVUA 3JCMV 3M54A 4C8QE 1YBYA 3J81E 2NWMA 5CQYA 3I5SA 3C94A 5KYWB 4HNVA 3ZL7C 3M58A 1BCOA 2QEXT 3RERA 1PKSA 3UT1A 4LXCA 3U23A 1JOWA 3JB9G 1KC8U 3GTMS 4C8QD 3MIAB 1M2OA 1H26B 1N27A 2EGCA 1MGQA 3R6NA 3PNWC 1XQHA 4GY5A 4OMQA 3KHIA 1ACMB 1LNXA 3G71A 2K3XA 4MFDA 3OYDA 2P0PA 3JCMJ 3CC7A 4EOIB 4KRCB 4M7AA 1JXOA 3DKMA 1Y07A 4AG1C 4RKUE 2LC4A 1OKVB 4C92F 1TTHB 5GMKh 4EC8B 4BCKB 5HVYB 2BE9B 2X4JA 1TS9A 1I0CA 2O31A 4MMLA 3EJ1B 4CRIA 3OYGA 2LQKA 2EYYA 3SWNA 2RM4A 3I9QA 1N6AA 1R8OB 2ZCFB 4M77A 2DVEA 2EAYA 3L1AA 2QA4Q 5CIUA 3GP8A 4PJNA 2CP6A 5GMKj 3OYBA 2LCLA 3DTOA 2K3BA 4YOOA 2CGHA 3I55T 2HSPA 1IZ6A 4OR5B 3TNIB 3MP6A 2DXUA 1VQ7T 4CFNB 3VS0A 4KRTA 3CCRT 2DE0X 1S72T 2A0FB 3OYNA 1VIFA 5L8RE 4C8QA 1LVKA 4RTVA 4DBQA 1VOMA 2X35A 1JKWA 2DD5B 2V8IA 3M0RA 2ZZDB 3CPFA 3VUZA 3BFMA 1KQSS 5KE3A 5DM7R 1OX9A 3CCQT 3OW2P 2VXFA 3LGLA 1KJWA 2YRCA 1GCQC 3TNWB 1Q82C 2GFUA 2O4XA 2DXBB 1SF9A 2K5LA 2L0AA 3OYJA 3S3OA 3OYHA 1C9BA 2LQNA 2F2CA 2MOXA 4CFXB 1RAFB 1A0NB 1M3CA 2K4YA 4LNPA 3PTAA 3CD6Q 1IREB 3QBYA 1VQNQ 2WSFE 1BCMA 1OL1B 3E19A 3BE3A 1WDXA 2OTJT 1QKXA 1O9KB 1I1JA 5LJ5e 4M7AG 1U5SA 4Z8AA 1G3TA 1Y57A 2JXBA 3HRTA 2YRVA 1TWBA 2XK0A 2EUFA 1YI2T 1K76A 4IUQA 1FWZA 1RI0A 2PQWA 2KR6A 4EIKA 1LOJA 2LTOA 4RG8A 2RJDA 1BKBA 4JS5A 2C5XB 3LQ5B 3GNFB 3VS1A 2KBTA 4ZGDB 2JW4A 1JB0E 1H8KA 1QVFP 4ATOA 3A5ZB 2MCNA 2V1RA 3G4SQ 4KRDB 1W2BS 5IHYA 5GJVB 2COZA 3CC4T 3MCAB 1M1KC 4BI3A 4LDUA 1M27C 4IURA 1UGRB 1BIBA 2HQEA 1XJWB 1YIJQ 1D1BA 1VQ5T 2KT1A 2L3RA 1Y7XA 1NPPA 4VUBA 3X26B 2WJ9A 2RI5A 3M4YA 4RTUA 3EGDA 3JCMd 3UF4A 1KIKA 1BI1A 3C12A 3QHRB 1YJ9Q 2DKGA 1G3YA 1VQ6Q 1JSUB 1QCFA 2KR3A 3CBMA 2KRNA 4J9EA 2Y4YA 3FB9A 2CZ6B 4L5GA 2M51A 1OIUB 4JDSA 2VGNA 1W1FA 4FCYA 1VQOT 3X28B 1H27B 1OU8A 5LJ5f 5KYXB 1ZUUA 3V7CA 2NUTA 3SB2A 4PFPA 4LOCA 4RMOA 1VQMT 2QQ8A 1SEMA 2DTHA 2EYQA 4F70B 3M0QA 5EC7A 3PFSA 3X20B 2XDDA 1WQ7A 1C6VX 5IHNA 2PK9B 2O01E 2KYBA 1ZBXA 2C0OA 5D6YA 3RMSA 4BDZA 2COWA 4N0AA 1OKWB 1SRMA 5FRNA 4JLIA 3NTIA 1ZA2B 4EDUA 2QDLA 2HBWA 4ZN3A 1YWPA 4Y91A 2BPMB 2ECZA 2B86A 2KQWA 5CCAA 2Y90A 4ZTFA 2K57A 2W2HA 3CCMQ 3CCST 3TN8B 3OMGA 2X1NB 3A1PA 5IHIA 4CFUB 2M0OA 2RMOA 3QZ5B 1OPLA 4JX4A 7AT1B 3HRSA 3CBPA 2MAMA 3CMET 4MMKA 5GMKi 1KD1U 2DRMA 4EOKB 3SD4A 3PVQA 1YWOA 5A0DA 3LH5A 3UA6A 2LP5A 4E47A 3F70A 4AT1B 1M1KR 4J9IA 1NLPC 3PVLA 1NLOC 3URGA 5GANg 1D3UB 4FSSA 4A4FA 3CCJA 4CFUD 2DD4A 1U06A 3OMCA 4LN2A 2KDSA 5LJ5h 3RR6A 1K73C 2YRDA 5GAOm 3RIRA 5GAN5 3TVTA 4M75F 4WCIA 2DMEA 5GANf 4JZ3A 2F2WA 5HNBB 3O0GD 4A4GA 2EJGA 2KYMA 4ROEA 2GQVA 3UATA 1Q81U 4AFSC 1SRLA 3OSVA 3OYMA 1WIEA 4CC7A 1F5QB 3M0SA 1WPYA 1JRIA 5LJ5j 2WIHB 2RQUA 1DJ7B 4HCBA 5I2SA 5GAN6 2R58A 4LUEA 1YJWQ 1K8AU 4F04B 8AT1B 4M75B 4KUDK 1K0XA 3OS2A 4HVWA 4XU2A 2E65A 2WACA 2LJ0A 3VJPA 3P8BB 3G6ET 4C5GA 1Q86C 1VQPA 3ASKA 2RO0A 3D7SB 5I22A 2X4XA 3VRZA 1O9SA 1YN8A 3OYAA 4XK8E 4J6WA 2GTJA 4A63B 3MJXA 4PJLA 1GBQA 3EGXB 2VKNA 1ZSZB 3OS1A 2DO3A 1G5VA 2CCIB 3HKSA 1X75C 4PL6A 2FPFA 4DBHA 2EIFA 2IVWA 1VUBA 5LJ3e 3EHRA 3M59A 1GY3B 2LCCA 4IIOA 2XICA 2WMBB 1GCQA 3FRNA 1KQ1A 2QA4T 2NUPB 4BE1A 3JCMP 5DY9A 5GMKl 5GAMg 4ROCA 1OQKA 1KQSA 1D3BA 3DLLA 4JRQA 4YOZA 3HB9A 5HBJB 3ZBDA 3CC4A 3CCQQ 3NDQA 4DQ2A 3S3NA 2EYWA 1TUCA 3PE0A 3PT9A 3CXCS 2BZ8A 1H3ZA 2J6KA 1SSHA 1M4ZA 1IGQA 1Y96A 2E6NA 2A36A 1QWEA 2HDAA 4EMKB 3RKXA 4C0DC 1AZEA 1R0CB 1WHHA 2KROA 1QLBA 1AWWA 1K73R 3H6ZA 3TW7A 4EOOB 1FYNA 2YLBA 4II1A 1T3SA 2IW6B 2H8HA 2PMIB 2OTJQ 1YHQA 3MEVA 4PJOF 4BI4A 3CC2T 1M9SA 2F69A 2KRMA 4F7LB 4XTXA 3DOGB 4F7UA 3H4CA 2BUDA 2JOYA 3DB3A 1VQNT 4F17A 2PTKA 2X9HA 1K9MU 3OYLA 3LLRA 2DTOA 1XTDA 1IHWA 4EOLB 2D9TA 4O5VA 3QJYA 2M9UA 4BCHB 2YWWA 1VQ4A 2JM8A 3JB9D 2DZCA 5LJ3f 3WVEB 2E3IA 1OEBA 3I56Q 4QVDA 4PJOB 1M90C 4J9GA 1YITQ 1W2BA 3EFOB 1AWOA 4CC4B 1GBRA 5GAN7 3E2UA 2PVDB 3H41A 5KYUB 3F5XB 2DYIA 1VINA 5I11A 5HK3A 4F14A 1XNIA 2C0IA 4L59A 3RDVA 3EH1A 5LQFB 3G4ST 3BHUB 5AYFA 3CMAA 2QGGA 4OMOA 3CCUA 4DEXA 3FEOA 2R7GA 2DJQA 3TW6A 3OQ5A 3K7AM 1PG5B 5CO7A 2UZLB 1B34B 2IN3A 1YIJT 1HSQA 3WVDB 2J7IA 4EOSB 2YXYA 4M78F 4D8DA 3HHTB 1D0YA 1M8VA 2NUZA 3MHXA 2QTXA 1N8RC 2DEQA 1QLYA 3VKIA 2DK3A 1VQOQ 4AI6A 1YJ9T 1KHIA 1VQ6T 1OX8A 2RQWA 5L23A 3FJPA 4M7DF 2K5FA 5CQXA 1OOTA 3VYHB 3BLRB 1LJOA 2EQKA 2L2PA 5C0MA 1AWXA 1WHGA 1FKMA 5FLXE 4F7UG 3QUIA 2QXFA 3V8JA 5GAN4 3ME9A 1VQKT 3JSCA 4C0GA 2ZPEB 2FVUA 3OB9A 2VVKA 2F2VA 1NJIR 4F6WB 4C5EA 1E9HB 4C92C 3HFNA 5LJ3h 3H8ZA 2XI9A 1MNDA 1ZA1B 3GIBA 4PNOA 2JGZB 5FU7B 3BW1A 1AZGB 3CCSQ 4O6JA 2CP0A 4KH1B 4M7AE 2H3JA 5I2MA 1OV3A 2E5KA 1JXMA 2QYZA 5LJ3j 3QZ9B 4OP0A 3CCMT 1BBZA 1NG2A 4M77B 1YJNA 5L2WB 4X9DA 2E41A 1UDLA 3NHNA 4NS5A 1K0SA 3DDPB 4PFOA 1VQLQ 4M7AD 3JCMe 2CH4A 2DEUA 4XTZA 1WHMA 1YP5A 1NE8A 3CCET 2IVXA 4MDWA 1TH7A 1ZBJA 4LD9K 2BS3A 4C8QB 5ECAA 1H1SB 2CREA 1KXUA 4GLMA 1PKDB 1G3SA 1G3WA 5HCKA 3OS0A 2FRWA 3G7ZA 3OYCA 1E7OA 4Y28E 2CCHB 1U3OA 2OAWA 4G6LB 2QA4A 3ER0A 2VYTA 2VUBA 3MPUB 1KQSP 4OB2B 2EGEA 1K9AA 2DJZA 4FX3B 2WIPB 1RUWA 1D09B 3QWYA 1N8RR 2W96A 4J6XA 2YSQA 1M2VA 3WXMB 3LW5E 2YLCA 2EJ9A 1PRLC 2KMGA 3GNGA 1ZQ1A 1VOLA 5D6XA 4K11A 1WFWA 1AHJB 3M9QA 3G6EQ 2FEIA 3HPWA 4HCKA 4J6YA 1BIAA 1YJWT 4AKHA 1FXXA 3GF5A 2K79A 1IHVA 4I3ZB 3H9NA 2UUEB 2EQJA 2E64A 3MP8A 1X6OA 4FU6A 5A0LA 4HXJA 3JCMf 4E6RA 4PLLA 1X2KA 3CD6A 3O8VA 4ORZA 4BB7A 3A98A 3QDRB 1SPKA 5KH6A 4J8OA 1N9SA 1RABB 1UEBA 3MO8A 5IN1A 3V8LA 1UB4A 3C4SA 4HL4A 1W2BP 2L3PA 2SEMA 1ARKA 2A37A 2MIOA 1PNJA 3LWHA 2A3LA 2ZGWA 1GRIA 2CYZB 4JRPA 1D0ZA 4BCMB 2EBPA 1FMVA 3EGDB 3M4GA 2CT4A 3CXCA 1YFNA 1LCKA 3EAEA 2JZ2A 4EC9B 4BE0A 2K3YA 5CR2A 5IH2A 1R0BG 1EFNA 2J6FA 4OB0B 2RI2A 4Z89A 3VS5A 3LGFA 2NUTB 2QI2A 3NTHA 1N4MA 3UDCA 1MHNA 4IUPA 2DYBA 2WSEE 2DIGA 4BCMD 5EG2A 3CC2Q 1ENWA 5CKFA 3BDUA 3G71Q 2MWPA 2RNAA 5EFQB 5GMKm 3HFOA 4BCGB 4FYXB 3CC7Q 2DXCA 2JT4A 3BHVB 3JCMh 1C1AA 4MZTA 4NL3A 2VB6A 1OIYB 2L5QA 2CP3A 4RCCA 2RHYA 3INZA 4OF1A 5CKHA 1BI0A 1WNLA 1JSTB 3MP1A 5FW9A 1M1KU 5ICPB 3RUXA 2P84A 3I56T 1WXBA 9ATCB 5IXFA 2JMAA 1YITT 3CEYA 2FYKA 5CYIB 1MMAA 1TU0B 3A8GB 4JJCA 4RTWA 4EOMB 2JN0A 3NMZC 2V26A 1IO6A 2X4YA 1UGPB 5FRMA 5EJCA 3V8KA 1ZUKA 4JLGA 2P4TA 2RHIA 4QKUA 2DD4B 1I5OB 3OS5A 2DMOA 5LJ5g 2OTLT 4M75C 4A4HA 4XTVA 4L6V5 2E10A 1VYTA 1QP3A 4J5YA 1VQ9T 2DETA 3QYEA 1IGUA 4C92A 4CRLB 4ELJA 2QG9B 3L2ZA 4PJMA 2DAQA 3CCVA 4JZ4A 4RODA 2W9FA 3N5BB 2BIVA 1NPRA 1VQKQ 2ZPFB 1H24B 3JRZA 2MWOA 4II5B 1G2BA 1ZSZC 2E3HA 1NYFA 1Q82R 2HKQB 2G9XB 4Y72B 3BLQB 1H3HA 4JJNK 1BB9A 2DF6A 1VIEA 4R55A 1IRXA 4F7NB 3QWLA 4LDWA 3VUBA 5A2QE 2QEXA 2EFIA 2RHUA 4E7SA 2P0KA 1TD6A 4QQGA 3OBYA 2DXBA 2RI3A 4J83A 3JB9H 3HRUA 4DBFA 3A8LB 2ZPIB 1PD0A 3RNJA 2XD0A 1UUEA 1OYXA 2BS4A 4XQ3A
chains in the Genus database with same CATH topology
3BG3A 2LRQA 4A4KA 2QDYB 1M1GA 4DQ2A 3S3NA 4KT0E 4E7IA 2CKKA 3PMIA 1YIJA 2RK2A 3PT9A 3CXCS 4C92E 3L2UA 1H3ZA 2M16A 2VGMA 3MEAA 2CS7A 4WF2A 1I5LA 3PGGA 1M4ZA 1FX7A 4X34A 4M78D 5J3BA 4ZN1A 1Y96A 2E6NA 4EMKB 4ZGEB 3RKXA 4C0DC 5GAOl 3EFSA 1QLBA 5GAN3 1YJ9A 3H6ZA 3TW7A 2YLBA 2CZ0B 4II1A 1XOVA 4HT9A 1WJSA 2NLUA 3KUFA 2QFZA 5CAIA 1VQ6A 1VQLT 4C92D 3L2VA 3P8HA 2AHJB 1YHQA 5GAOn 3MEVA 2V8JA 4PJOF 4BI4A 3QKJA 4N0AC 3CC2T 3QYHB 1M9SA 2F69A 4QW2A 4M7DD 1D3BB 1BYMA 4N4HA 1VQPT 4XTXA 1K73U 4XAXB 4AKIA 3H4CA 2DIQA 2BUDA 2P0QA 4M78G 4F7UA 3JAME 2JOYA 2XKOC 3DB3A 1H641 4M77E 4TVRA 1VQNT 3HBLA 4OB1B 2IG0A 4E7HA 2LT4A 4CI0C 3OYLA 1K9MU 3LLRA 4QSHA 2Y4XA 2DTOA 4HCZA 1PSFA 3QJ6A 1XTDA 4MZMA 2D9TA 3LWIA 2DZ9A 1VQKA 4O5VA 3QSUA 3BG9A 3QJYA 1HXDA 4C92G 2M9UA 3OY9A 3CCVT 1YCYA 3I55A 1B34A 2HNIA 3JCMX 2RH2A 3RESA 1VQ4A 5LJ3d 3JB9D 2DZCA 2QQ9A 4ELYC 4HT8A 1Y96B 4M7DG 5LJ3f 1VQ7A 4V2SA 3WVEB 3HP9A 4M77D 4QVDA 4PJOB 4XU1A 3JCMV 1M90C 3M56A 3M54A 3CCRA 4C8QE 1YBYA 3J81E 1SSFA 3FLGA 1S72A 1W2BA 4PJOC 1KD1C 2I2LA 5CQYA 5GAN7 3C94A 4BDYA 5CKDA 4HNVA 5GAOq 2QF7A 2HQXA 3OYYA 2PVDB 3M58A 3META 4R56A 3L2QA 2QEXT 3RERA 3UT1A 4LD6A 3CPWA 1ZHIA 2LT1A 5HK3A 1KQ2A 4M6VA 1XNIA 3A8HB 2DTIA 4L59A 3L2RA 4F7UB 3JB9G 2GF7A 1RL2A 1U8RA 2XG8D 3CCQA 3BDLA 4C8QD 3G4ST 4M77G 3CCMA 1N27A 1KC8U 5CK9A 5AYFA 2JTMA 1MGQA 4KULA 3A8OB 3CMAA 1VQ8T 1WJRA 3V7SA 2K2VA 3PNWC 4XTUA 3CCUA 4C0FA 2HD0A 3FEOA 1V29B 1XQHA 2MF2A 4GY5A 3TW6A 3OQ5A 1N9RA 4HLQA 5CO7A 4F7UE 1B34B 3SDZA 1YIJT 3KHIA 1LNXA 3G71A 3WVDB 2L8DA 2K3XA 4MFDA 3OBWA 3OYDA 2P0PA 3JCMJ 3KBGA 4M78F 3CC7A 3CCEA 1M1FA 3HHTB 1Q81C 2L89A 3J80E 2FB7A 4M7AA 4C5HA 4C8QG 1M8VA 3MHXA 1I8FA 4BUGA 2QTXA 3DKMA 1Y07A 2DEQA 3UPUA 1N8RC 3FDRA 3VKIA 2OTJA 2DK3A 4RG2A 4AI6A 4X9CA 4RKUE 1YJ9T 3S6WA 2LC4A 4C92F 1KHIA 5GMKh 1VQ6T 4GLKA 1Y71A 2X4JA 2V8KA 3FJPA 2DD5A 1YHQT 1YI2A 4NL2A 2K5FA 5CQXA 3OW2S 2ZZDA 4MMLA 3Q1JA 5J26A 3JCMb 4XTWA 1K8AC 4CRIA 3OYGA 2LQKA 3VYHB 3VV0A 3SWNA 2RM4A 3HO8A 1LJOA 4D6WA 5I21A 4FIBA 4QVZA 2EQKA 4MDXA 1N6AA 1R8OB 2ZCFB 2EJFA 4M77A 5C0MA 4NOYA 2DVEA 2EAYA 3L1AA 1FKMA 4M78C 5CIUA 5FLXE 3GP8A 5GMKj 5GAN2 4F7UG 3OYBA 3QUIA 2E5QA 2QXFA 2LCLA 3V8JA 5DLQE 3ME9A 5GAN4 1VQKT 3JSCA 4C0GA 3LYIA 2ZPEB 2FVUA 3OB9A 4Z02A 2CGHA 3M5AA 4N4IA 3JB9F 4BBSM 3I55T 1IZ6A 1VQ4T 3MP6A 4C5EA 2DXUA 1VQ7T 4C92C 3HFNA 5LJ3h 3H8ZA 3RMQA 3TCJA 5GAN8 3MEUA 1BI3A 2XI9A 3CCRT 4M7DC 5GANe 1S72T 2OAUA 4PNOA 5FU7B 1VIFA 3OYNA 5L8RE 4C8QA 3GIBA 3JCMQ 3BW1A 4JUVA 2ZPGB 4EPCA 1NJIU 2VC8A 4O6JA 5FU7C 1PSEA 3QG1A 4ZTJA 2X35A 2DD5B 2E1HA 2V8IA 1YJWA 1VQ5A 3CCLT 4M7AE 2H3JA 2ZZDB 2RK1A 3CPFA 5I2MA 3VUZA 3V7RA 3BFMA 1KQSS 5KE3A 5DM7R 5LJ3j 4BE2A 3QZ9B 2YHTA 4OP0A 4EMKC 3SFMA 4JX6A 3HZJA 3CCQT 2VXFA 1E7PA 3CCMT 4E7KA 2JNGA 2K5IA 3LGLA 3M55A 4M77B 4X9DA 1YJNA 2E41A 5HKCA 4FM4B 2JUFA 2LNVA 4LDVA 3CMAT 2HBPA 3P8DA 1Q82C 4NS5A 2PUOB 4RCBA 5A0GA 2GFUA 2F5TX 2O4XA 2DXBB 2K5LA 3OYJA 5FU6B 3CCUT 3JCMe 1QVFS 4M7AD 1QW1A 4A54A 3OYHA 3S3OA 5FU6C 4XTZA 3G71T 2RD1A 2K4YA 3NFCA 3CBOA 5LJ3g 3PTAA 1VQOA 1NE8A 3CC7T 3CCET 4MDWA 3LX7A 1IREB 3QBYA 1TH7A 2WSFE 4LD9K 2BS3A 3BY7A 2KMTA 4C8QB 3E19A 2VV5A 2OTJT 2E6ZA 1VQMA 4F7UF 1G3SA 4IUVA 3UWNA 5LJ5e 3J7AF 1G3WA 3GPLA 2DXTA 4IUUA 2EWNA 4PKCC 3OS0A 4EMHA 4M7AG 1G3TA 3G7ZA 3OYCA 3E9GA 3HRTA 2YRVA 4Y28E 1JBMA 2QQRA 2XK0A 3S3MA 1YI2T 2PUKB 4IUQA 1FWZA 1RI0A 2PQWA 3ER0A 2VYTA 2VUBA 2QA4A 3QIIA 2KR6A 2RHZA 5C6SA 4OB2B 5M9OA 1LOJA 2DJZA 1OZ3A 2RJEA 4M75A 3TEEA 2LTOA 4JRIA 4RG8A 2RJDA 3JB9I 1BKBA 3RKYA 4JS5A 3GNFB 4ZGDB 5J39A 1JB0E 1Q86U 4NC6A 4J6XA 3WXMB 3LW5E 5GANd 4ATOA 3A5ZB 2YLCA 2D6FA 2EJ9A 2BS2A 3JCMW 2KMGA 3GNGA 4MZPA 1W2BS 3CCSA 2QQBA 4C5IA 3OYKA 1ZQ1A 3CC4T 5D6XA 3MCAB 1M1KC 2EQUA 4BI3A 1N8RU 4BY6B 4LDUA 2G3RA 3OSSC 1WGSA 1AHJB 3M9QA 2A7YA 2E12A 4IURA 3CPWS 4BY6C 1UGRB 2XIDA 3HPWA 4MIMA 1BIBA 2HQEA 5GAMe 4J6YA 1BIAA 4P5NA 3ZEHA 1YJWT 1VQ5T 1M5Q1 1Y7XA 2L3RA 4AKHA 1FXXA 3GF5A 1NPPA 4JS4A 5FROA 4VUBA 2BKDN 3X26B 3CMEA 2KY9A 1JJ2A 2EQJA 4BACA 2FHDA 2WJ9A 2E64A 3QO3A 3VYGA 3MP8A 2JVVA 2RI5A 3M4YA 1X6OA 2RB6A 4FU6A 1KHCA 5A0LA 3JCMd 3JCMf 1QVGA 1BI1A 3C12A 4J7FA 4E7JA 1YJNT 2C06A 4PLLA 1KG1A 2DKGA 2GCXA 3E9FA 4M7AF 2GFAA 1G3YA 3CD6A 3CBMA 3O8VA 4BB7A 2RHXA 5GAOp 2Y4YA 3FB9A 2CZ6B 4L5GA 3L42A 3QDRB 2CZ7B 2G77A 4M75E 4JDSA 1I4K1 2VGNA 5KH6A 4J8OA 1N9SA 3M53A 4OVAA 3C95A 1VQOT 2QDJA 3X28B 5LJ5d 1UEBA 3MO8A 4FL6A 1Q7YC 5IN1A 3V8LA 5LJ5f 1UB4A 3C4SA 3GLXA 4DA4A 3V7CA 3SB2A 4HL4A 3X24B 4LOCA 3I56A 4RMOA 1VQMT 3LH0A 2QQ8A 3PIOA 1UGSB 3T9NA 2DTHA 2EYQA 4ME7A 5HY6A 1YITA 3TREA 4M75D 3LWHA 4M77F 2A3LA 2ZGWA 4FT4A 4XU3A 2CYZB 3DLMA 4M7AB 4JRPA 2XHCA 3QYBA 3PFSA 4M7AC 3VYGB 3X20B 2XDDA 1WQ7A 2LDMA 2WSCE 5LL6S 2B8AA 3A8MB 3M4GA 2O01E 4DOVA 1ZBXA 3EFRA 3CXCA 5D6YA 3RMSA 4BDZA 5CVIA 4N0AA 1U1TA 3MEWA 3EAEA 2PVGB 2JZ2A 2KK4A 3CCST 4BE0A 3SWNB 5FRNA 4JLIA 2CZ1B 3NTIA 2K3YA 5CR2A 3PIPA 3JB9J 4M75G 4C8QF 4EDUA 4N4GA 4EMGA 4ZN3A 2HAXA 4Y91A 4A4EA 4AKGA 1W4SA 3SWNC 5IT9E 4OB0B 2FL7A 2RI2A 4FSXA 2KQWA 5CCAA 2OTLA 2Y90A 4ZTFA 3LGFA 5GANh 2K57A 4UC4A 3G6EA 2KAFA 2RA2A 3QPHA 4BBRM 4J7IA 2QI2A 3NTHA 4M77C 3OMGA 3UDCA 5IAYA 5GAMd 5GAMf 3OA6A 1HK9A 1MHNA 1QVFA 4IUPA 4ZGJB 2E70A 3M57A 4JRKA 1VQ9A 2WSEE 2DIGA 2F5KA 2M0OA 1I81A 5EG2A 4C0DB 4M7DE 5CKFA 3OYFA 3QZ5B 3BDUA 4JX4A 2JTFA 1EIFA 3OYIA 2MWPA 3TU4K 4PJOA 4Z6YA 3HFOA 3HRSA 5GMKm 1M90U 3CBPA 2MAMA 2ZPHB 3L2WA 5GANj 2DXCA 3CMET 4MMKA 5GMKi 3DL1A 1NJIC 1KD1U 1OI1A 3SD4A 5A0DA 4QQ6A 1WQWA 4C8QC 4OGCA 4YTLA 3JCMh 4E47A 4KBMB 3F70A 3OYEA 4MZTA 3CD6T 3X25B 4NL3A 3URGA 1QP2A 4LDYA 2VXEA 2L5QA 4PLIA 4B9XA 4RCCA 5DLOA 2MMPA 5GANg 3CCJA 4A4FA 2R5AA 2KVQG 2RHYA 3INZA 4OF1A 5CKHA 4BI8B 2DD4A 4HA8A 1BI0A 1WNLA 2EKOA 2QQAA 5CKBA 3OMCA 2O4XB 3MP1A 5HK0A 2KDSA 5LJ5h 2R57A 1M1KU 1K73C 3HL8A 3JCMc 5GAOm 3RUXA 3I56T 3RIRA 5GAN5 4DOWA 4M75F 3DB4A 1YITT 5GANf 1K9MC 1BI2A 2FYKA 3CEYA 2EQMA 4A4GA 2EJGA 2GQVA 1Q81U 3BG5A 3A8GB 3QXEB 2DXCB 3OSVA 3OYMA 2DPPB 1P92A 2PU9B 3KXTA 4QVCA 2KSSA 2LX9A 1WPYA 4OB3B 2JN0A 1JRIA 3JCMg 1WJQA 5LJ5j 3CCLA 1DJ7B 4HCBA 4FT2A 4PJOE 4HCCA 4XTYA 4JX5A 2RJFA 2X4YA 3FC3A 1UGPB 5I2SA 4OMFB 4XU0A 2R58A 5GAN6 4E7LA 1U1SA 2XDPA 5EJCA 2XU8A 1K8AU 5FRMA 3NTKA 4M7DF 3ZFJA 3V8KA 2RJCA 4C0ZA 4JLGA 4M75B 2P4TA 2RHIA 1O75A 4M78A 4HNUA 2DD4B 3OS5A 1VQLA 4KUDK 3HSBA 3OS2A 4XU2A 5LJ5g 2E65A 2WACA 1Q7YU 4M75C 2OTLT 4A4HA 3VJPA 3P8BB 4XTVA 3G6ET 5GMKe 3CC2A 3GOXA 4L6V5 4PJOD 4C5GA 1Q86C 1VQPA 4QQDA 2E10A 1KC8C 3ASKA 2RO0A 3OW2A 1QP3A 4J5YA 5GAMh 1VQNA 1VQ9T 3QYEA 5CKEA 3PMTA 4C92A 2X4XA 4BD3A 4LDXA 3E1SA 2R5MA 1O9SA 4ELJA 4A53A 5KCOA 3VU3C 3OYAA 2M1HA 4XK8E 4M7DA 4OGEA 3QYGB 3L2ZA 4J6WA 1QVPA 3RKWA 4IUTA 1JJ2S 2DAQA 3CCVA 1QVGS 1OZ2A 2X4WA 3AHUA 3N5BB 3OS1A 2DO3A 2BIVA 1NPRA 4PJOG 5GAMj 1G5VA 2ZPFB 3JRZA 1GXIE 2MWOA 3HKSA 1X75C 5KE2A 2LVMA 4PL6A 4IKFA 1NZ9A 4EMKA 2EIFA 2IVWA 1VUBA 5LJ3e 3M59A 2LQ8A 2LCCA 4JJNK 2XDBA 2XICA 3FRNA 2QQSA 1VIEA 1KQ1A 1X01A 4M78B 4R55A 4KUIA 2QA4T 3QWLA 4LDWA 3VKHA 3VUBA 5A2QE 2QEXA 2EFIA 2RHUA 5KCHA 3CCJT 4BE1A 2P0KA 5GAOr 3R6OA 5DY9A 3JCMP 4QQGA 5GMKl 4Q5WA 3OBYA 1Q82U 5GAMg 3FIFA 2DXBA 2RI3A 4J83A 3JB9H 3HRUA 2PVOB 5D6WA 2ZPBB 3A8LB 2MI6A 3G4SA 2ZPIB 1D3BA 4C92B 1KQSA 4HNTA 4M78E 3DLLA 3VKGA 4JRQA 1UGQB 2XD0A 1VQ8A 3HB9A 4B9WA 1OYXA 4MFEA 3QHSA 4HKEA 2BS4A 4M7DB 4ELZC 3ZBDA 2D0QB 3CC4A 4XQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD5 A;  2QDY B;  2ZZD A;  4KT0 E;  3VYH B;  3X25 B;  1AHJ B;  1QP2 A;  1UGR B;  2ZCF B;  2DD4 A;  4ZGE B;  3X26 B;  2ZPE B;  3VYG A;  2CZ0 B;  2AHJ B;  3A8G B;  3QXE B;  2DXC B;  3QYH B;  2DPP B;  2PU9 B;  2CZ6 B;  5L8R E;  2CZ7 B;  2ZPG B;  4OB3 B;  1PSE A;  4OB1 B;  1DJ7 B;  2DD5 B;  3X28 B;  2ZZD B;  1PSF A;  1UGP B;  3X24 B;  3QZ9 B;  1UGS B;  2DD4 B;  4FM4 B;  3WVE B;  2CYZ B;  2PUO B;  2DXB B;  4L6V 5;  3VYG B;  3X20 B;  1QP3 A;  2WSC E;  3A8M B;  2O01 E;  2PVD B;  4XK8 E;  1IRE B;  3QYG B;  2WSF E;  2PVG B;  3A8H B;  2CZ1 B;  4OB0 B;  3A8O B;  1GXI E;  2ZPF B;  4Y28 E;  1V29 B;  2PUK B;  4ZGJ B;  2WSE E;  3WVD B;  4OB2 B;  3QZ5 B;  3HHT B;  2DXB A;  2ZPH B;  4ZGD B;  2PVO B;  2ZPB B;  3A8L B;  1JB0 E;  2DXC A;  2ZPI B;  4RKU E;  3LW5 E;  1UGQ B;  2D0Q B; 
#chains in the Genus database with same CATH topology
 3JV3 A;  2LRQ A;  4EOR B;  3MI9 B;  1M1G A;  4KGZ B;  4KT0 E;  1O9K A;  2W10 A;  1X27 A;  1OUL A;  2M16 A;  1FX7 A;  5J3B A;  4KGV B;  5HQ0 B;  3REA B;  3CCE Q;  2CZ0 B;  4HT9 A;  1WJS A;  2ATC B;  1VQL T;  3L2V A;  2EVR A;  2MK5 A;  3P8H A;  2KNB B;  2AHJ B;  1UNG D;  5GAO n;  2COY A;  2QK0 A;  2AK5 A;  4QW2 A;  1D3B B;  1RAD B;  4F7S B;  1K73 U;  4AKI A;  3JAM E;  2P0Q A;  1V1C A;  4OB1 B;  2LT4 A;  1YNZ A;  4MZM A;  2DZ9 A;  3BG9 A;  4C92 G;  1YCY A;  3I55 A;  3RES A;  1J3T A;  4HT8 A;  1Y96 B;  1VQ7 A;  3HP9 A;  3CXC P;  4JPB W;  3M56 A;  3CCR A;  2YUP A;  1PD1 A;  1S72 A;  1SSF A;  1ZUY A;  1KD1 C;  4PJO C;  1UEC A;  2I2L A;  4KGX B;  1XO2 A;  1V76 A;  4DEY A;  2KGT A;  2QF7 A;  2HQX A;  2ENM A;  3GBQ A;  3DDQ B;  1H1R B;  1ZHI A;  1KQ2 A;  4M6V A;  2DTI A;  2KEA A;  4AFQ C;  4F7U B;  1EX4 A;  2XG8 D;  5FWB A;  2C5O B;  3BDL A;  3CCQ A;  1TFB A;  2C0T A;  1VQ8 T;  2HD0 A;  1V29 B;  2HEQ A;  2MF2 A;  2MYS A;  5KYX A;  4F7U E;  4HLQ A;  4ELL A;  3SDZ A;  2V1Q A;  2L8D A;  2HL5 C;  1WXU A;  1Q81 C;  1RI9 A;  2L89 A;  3J80 E;  4BUG A;  1H28 B;  3UPU A;  4AFU C;  2OTJ A;  4RG2 A;  2CP2 A;  2JTE A;  4PFZ A;  4EON B;  4X9C A;  3S6W A;  3VS2 A;  1GCP A;  1Y71 A;  2V8K A;  1WX6 A;  1QCO A;  1YI2 A;  4NL2 A;  3Q1J A;  5J26 A;  1K8A C;  4XTW A;  2C5V B;  1PM3 A;  4QVZ A;  2ESW A;  2EJF A;  1IXD A;  4M78 C;  4OMN A;  1JQQ A;  2E5Q A;  3CCJ Q;  5CEI B;  3LYI A;  5KYY A;  2QGF B;  4RTZ A;  4N4I A;  3JB9 F;  4RTX A;  1QKW A;  3EG3 A;  1X6G A;  3TCJ A;  4AMC A;  1BI3 A;  4M7D C;  2LZ6 B;  2OAU A;  4EOQ B;  4JUV A;  2PNI A;  1NJI U;  5FU7 C;  1PSE A;  5KYN A;  1CKA A;  1T0H A;  2JJ9 A;  2E1H A;  2RQR A;  1VQ5 A;  2RK1 A;  1B3Q A;  2DL7 A;  3FJ5 A;  3V7R A;  1FMK A;  2EKH A;  4BE2 A;  3EG9 A;  2YHT A;  3HZJ A;  1E7P A;  2JNG A;  2QAZ A;  4FYV B;  2OX7 A;  5HKC A;  4LDV A;  2HBP A;  1X69 A;  1GFD A;  2PUO B;  4RCB A;  5FU6 B;  2UZD B;  2MPX C;  3VS6 A;  2AKL A;  3CQT A;  3G71 T;  1RAI B;  5LJ3 g;  1VQP Q;  1VQO A;  2K9G A;  3CC7 T;  3G1J A;  2KMT A;  3QWX X;  1G83 A;  1VQM A;  2HKN A;  2QTV A;  4IUV A;  1B7T A;  3GPL A;  2DXT A;  4IUU A;  1JU5 C;  3E9G A;  2HSE B;  2QQR A;  2RQV A;  3S3M A;  2PUK B;  1H1Q B;  1MNE A;  1Q86 R;  2RHZ A;  5M9O A;  3VS3 A;  2HCK A;  4M75 A;  2CUD A;  3TEE A;  4BCF B;  3VS7 A;  3RKY A;  3TSW A;  1D1A A;  4NC6 A;  5GAN d;  2D6F A;  2BS2 A;  2RF0 A;  4MZP A;  3CCS A;  2QQB A;  3OYK A;  1EZZ B;  4HVV A;  1OU9 A;  1VA7 A;  2EQU A;  1N8R U;  4BY6 B;  1WGS A;  2OTL Q;  2A7Y A;  3CPW S;  2XID A;  1ZSZ A;  1SG5 A;  2BZY A;  2OJ2 A;  2WFY B;  2F1L A;  4P5N A;  3ZEH A;  2P4R A;  1M5Q 1;  1VQ9 Q;  2W0Z A;  1UTI A;  5FRO A;  3CME A;  2KY9 A;  3QO3 A;  3VYG A;  1PHT A;  4J7F A;  2NUP A;  4BCP B;  1KG1 A;  3E9F A;  5IXB A;  3BLH B;  4M7A F;  1RAE B;  2SRC A;  1M2V B;  1YHQ Q;  4RTT A;  3L42 A;  2G77 A;  1I4K 1;  3I35 A;  4OVA A;  3C95 A;  3AT1 B;  2QDJ A;  1MMN A;  4FYW B;  1Q7Y C;  4B6M A;  2DL8 A;  2AZV A;  2GGR A;  1NM7 A;  2BTT A;  3TSZ A;  1N5Z A;  3PIO A;  1UGS B;  4ME7 A;  5HY6 A;  2DBM A;  4M77 F;  1PWT A;  4M7A B;  3SEM A;  3DLM A;  2DA9 A;  1VQ4 Q;  2XHC A;  3QYB A;  4J9C A;  2LDM A;  5LL6 S;  1OL2 B;  3TNH B;  2B8A A;  3A8M B;  2IPO B;  2LQW A;  2IIM A;  3EFR A;  5AT1 B;  2LJ1 A;  2D8J A;  1T0J A;  3EG1 A;  2PVG B;  1UE9 A;  3SWN B;  3CCL Q;  2A08 A;  4M75 G;  4C8Q F;  4EMG A;  2YDL A;  4AKG A;  1W4S A;  5IT9 E;  4FSX A;  4BCQ D;  1HD3 A;  3G6E A;  4UC4 A;  1C0M A;  3QPH A;  4E7L A;  4J7I A;  5GAM d;  1FVV B;  5IAY A;  1M90 R;  3CMA Q;  3OA6 A;  1HK9 A;  1QVF A;  2K7A A;  3M57 A;  1MV0 B;  3CCU Q;  2UZE B;  2BE7 D;  1I81 A;  4C0D B;  4M7D E;  3OYF A;  1Z9Q A;  2JTF A;  2J05 A;  1EIF A;  3TU4 K;  4PJO A;  2ED0 A;  1KFZ A;  4RTY A;  2ZPH B;  3L2W A;  4M4Z A;  4CFM B;  3DL1 A;  1W6X A;  1ZSG A;  4QQ6 A;  4OGC A;  1SHF A;  1G3N C;  3H0H A;  3OYE A;  2RQT A;  1D0X A;  2HQH A;  2VXE A;  5ACB A;  4B9X A;  3H0I A;  5DLO A;  2MMP A;  2R5A A;  1WHJ A;  1TG0 A;  4HA8 A;  1BU1 A;  2O4X B;  1GUX A;  2R57 A;  5I5Z B;  5GJW B;  2X3X D;  3HL8 A;  1PRM C;  3JCM c;  1ABQ A;  1ABO A;  4J9H A;  2WEV B;  4AFZ C;  1SKU B;  5IF1 B;  1BI2 A;  2EQM A;  2AZS A;  4J9D A;  4BCJ B;  1M8M A;  3BG5 A;  3QXE B;  2DXC B;  2FZK B;  1VQ8 Q;  1RAH B;  1H92 A;  2DPP B;  3BHT B;  2D1X A;  1RLQ C;  2KXC A;  3H0F A;  1ZLM A;  3KXT A;  2KSS A;  2LX9 A;  3JCM g;  3VS4 A;  2W9Z A;  4NST B;  2GTO A;  4HCC A;  1KK7 A;  1Q7Y R;  3UA7 A;  4XU0 A;  1U1S A;  3ZFJ A;  2RJC A;  2VWF A;  4M78 A;  4PJJ A;  3REB B;  1NBE B;  1F1B B;  3CC2 A;  1UJY A;  1YJN Q;  2DX1 A;  1H4L D;  1KC8 C;  2O9S A;  1VQN A;  4LDX A;  4BD3 A;  3E1S A;  2R5M A;  5IDN B;  3VU3 C;  1MMG A;  4M7D A;  4OGE A;  1QVP A;  1JJ2 S;  1QVG S;  5HBH B;  1TXQ A;  2M0Y A;  4FW1 A;  4PJO G;  2OI3 A;  2E4H A;  2LVM A;  4IKF A;  2HL3 A;  2CT3 A;  4KUI A;  4CFV B;  2O9V A;  4BCI B;  1FIN B;  3CCJ T;  2KXD A;  5GAO r;  1K1Z A;  3EG2 A;  4E2F B;  4Q5W A;  1Q82 U;  3FIF A;  1VYW B;  1TSF A;  4E7Z A;  2W99 A;  2ZPB B;  2MI6 A;  3G4S A;  4C92 B;  2KRS A;  3VKG A;  1H25 B;  4B9W A;  2WPA B;  4HKE A;  1S1N A;  2ZAE A;  2GBQ A;  3BG3 A;  4LE9 A;  1BK2 A;  4A4K A;  2QDY B;  4E7I A;  2CKK A;  3PMI A;  1YIJ A;  2QAS A;  4C92 E;  2JM9 A;  3L2U A;  2VGM A;  4WF2 A;  2CS7 A;  1I5L A;  1G8X A;  4X34 A;  4ZN1 A;  1UNH D;  1MMD A;  1AWJ A;  1YJ9 A;  1AEY A;  1CSK A;  1VQ6 A;  2QFZ A;  3HTR A;  5KYW A;  4C92 D;  2DIL A;  1KSW A;  2V8J A;  2CH4 W;  3QKJ A;  3QYH B;  1VQP T;  2LMJ A;  4XAX B;  4M78 G;  2XKO C;  4TVR A;  1H64 1;  1D1C A;  2IG0 A;  1UG1 A;  4CI0 C;  4CFW B;  2CSQ A;  5IDP B;  3LWI A;  1M30 A;  1VQK A;  1QMZ B;  1JEG A;  1HXD A;  5DQV A;  2HNI A;  3JCM X;  2RH2 A;  4IMY B;  2ROT A;  4BY1 X;  2QQ9 A;  4M7D G;  1WYX A;  1Z9Z A;  1X43 A;  1TOV A;  4UN0 A;  5IHK A;  1WI7 A;  4R0K A;  3FLG A;  4OML A;  2D8H A;  2DNU A;  1KC8 R;  4IIM A;  2CJM B;  4BDY A;  2DL5 A;  3C0C A;  5CKD A;  5GAO q;  3OYY A;  3L2Q A;  1W98 B;  3MET A;  4R56 A;  4LD6 A;  3CPW A;  2EGA A;  2LT1 A;  3A8H B;  3L2R A;  2GF7 A;  1RL2 A;  1U8R A;  1NEG A;  2AIR B;  2DBK A;  4M77 G;  3CCM A;  5CK9 A;  4RUG A;  2JTM A;  4KUL A;  3A8O B;  1WJR A;  1RAG B;  3O5Z A;  4ANJ A;  3V7S A;  2DER A;  2B9R A;  4YOS A;  2K2V A;  4XTU A;  2WMA B;  4C0F A;  2FRY A;  4D8K A;  1N9R A;  1FMW A;  4JJD A;  3OBW A;  3KBG A;  1X2Q A;  3CCE A;  1QQJ A;  2J6O A;  1M1F A;  2L3Q A;  2FB7 A;  4FW2 A;  4C5H A;  4C8Q G;  1AT1 B;  2LNH B;  1I8F A;  5FWC A;  6AT1 B;  4FYY B;  3FDR A;  4GLK A;  2FZG B;  2DD5 A;  1YHQ T;  4CC2 A;  3OW2 S;  5LMK B;  2ZZD A;  3JCM b;  3VV0 A;  1M3A A;  3HO8 A;  4D6W A;  5I21 A;  4FIB A;  2V22 B;  4MDX A;  1PC0 A;  4NOY A;  2CP7 A;  1WXT A;  3I5R A;  5GAN 2;  3MY5 B;  5DLQ E;  4PK4 A;  2O2O A;  4Z02 A;  3M5A A;  4BBS M;  1VQ4 T;  1WA7 A;  3RMQ A;  5GAN 8;  3MEU A;  2X51 A;  5GAN e;  3JCM Q;  2ZPG B;  4F6U B;  4EPC A;  1HJD A;  2VC8 A;  3QG1 A;  4ZNX A;  4ZTJ A;  1YJW A;  3CCL T;  2F2X A;  1QCN A;  2FPE A;  2FG0 A;  4Z88 A;  1VYU A;  4EMK C;  3SFM A;  4JX6 A;  1PCX A;  4E7K A;  3EHQ A;  2K5I A;  3M55 A;  4FM4 B;  2JUF A;  2LNV A;  3CMA T;  3P8D A;  3EGU A;  5A0G A;  2F5T X;  2DFU A;  3CCU T;  1QVF S;  1RAC B;  5KYY B;  1QW1 A;  4A54 A;  2EW3 A;  5FU6 C;  2RD1 A;  3NFC A;  2DL3 A;  3CBO A;  2RPN A;  3LX7 A;  4QT7 A;  1GL5 A;  1YCS B;  1OPK A;  3BY7 A;  2VV5 A;  2E6Z A;  2D0N A;  4F7U F;  4BY7 X;  3J7A F;  3UWN A;  2EWN A;  4PKC C;  4EMH A;  3CCV Q;  4OMM A;  1JBM A;  1I07 A;  2GQI A;  3EG9 B;  1MV3 A;  3QII A;  1UJ0 A;  5C6S A;  2AT1 B;  1OZ3 A;  2RJE A;  2I40 B;  4JJB A;  4JRI A;  3RBB B;  3JB9 I;  2KT8 A;  2QEX Q;  5J39 A;  1Q86 U;  4J9B A;  3JCM W;  1Y0M A;  1UFF A;  4AG2 C;  4C5I A;  5D7U A;  3KFV A;  2YUQ A;  3TQ7 P;  1QMC A;  2G3R A;  3OSS C;  3QHW B;  4F7J B;  2E12 A;  3EG0 A;  4BY6 C;  4MIM A;  5GAM e;  4JS4 A;  2BKD N;  2UZB B;  4BAC A;  2FHD A;  2RN8 A;  2JVV A;  1JJ2 A;  2RB6 A;  1KHC A;  1T3L A;  1UGV A;  1QVG A;  1GFC A;  4E7J A;  1YJN T;  2C06 A;  2GCX A;  2GFA A;  1IB8 A;  2RHX A;  5GAO p;  3M03 A;  2CZ7 B;  4M75 E;  3POM A;  2JS0 A;  3M53 A;  3M0P A;  5LJ5 d;  4FL6 A;  3QDF A;  2H3E B;  1ZP2 A;  3GLX A;  4DA4 A;  3X24 B;  3I56 A;  1UHC A;  3LH0 A;  2X3W D;  3T9N A;  1YIT A;  4LUD A;  2PK2 A;  4M75 D;  2PZ1 A;  3TRE A;  4XU3 A;  2LW4 A;  3RGF B;  4FT4 A;  3I55 Q;  3CPW P;  1AD5 A;  3MY1 B;  1E6G A;  4M7A C;  1VQ7 Q;  3VYG B;  2WSC E;  3CCR Q;  4DOV A;  1S72 Q;  2YUN A;  5CVI A;  1U1T A;  3MEW A;  2YUO A;  1H1P B;  2ED1 A;  2KK4 A;  2CP5 A;  2CZ1 B;  3PIP A;  4EOP B;  2DRK A;  3JB9 J;  4N4G A;  2HAX A;  2ABL A;  4A4E A;  3SWN C;  2FL7 A;  4WTO B;  2OTL A;  1MUZ A;  2DM1 A;  2VAS A;  5GAN h;  2LJ3 A;  2KAF A;  2RA2 A;  4BBR M;  5HBE B;  4M77 C;  5GAM f;  4ZGJ B;  2E70 A;  4JRK A;  1BU2 A;  2XMF A;  3M0T A;  1VQ9 A;  1NYG A;  2CUB A;  1KD1 R;  2F5K A;  2NYS A;  2KE9 A;  3ULR B;  3OYI A;  4Z6Y A;  2A28 A;  1M90 U;  5GAN j;  1UHF A;  4YC3 B;  1NJI C;  1OI1 A;  1WQW A;  4C8Q C;  4YTL A;  3IQL A;  4KBM B;  1AVZ C;  1W70 A;  4BCO B;  3CD6 T;  1B07 A;  3X25 B;  3M0U A;  1QP2 A;  4LDY A;  1YI2 Q;  4PLI A;  2CSI A;  2KVQ G;  4BI8 B;  2QQA A;  3SHW A;  2EKO A;  1OI9 B;  5CKB A;  1P5E B;  1Q81 R;  5HK0 A;  2CDT A;  3B57 A;  1QWF A;  4BCN B;  4EOJ B;  1WHL A;  2ROL A;  1X6B A;  4DOW A;  3DB4 A;  1K9M C;  5BNJ B;  2DLP A;  1P92 A;  2PU9 B;  4GBQ A;  2IW9 B;  4QVC A;  1K8A R;  3CC4 Q;  4OB3 B;  2C5N B;  1WJQ A;  3EGX A;  3CCL A;  4KH0 B;  4FT2 A;  4PJO E;  4XTY A;  4JX5 A;  2RJF A;  3FC3 A;  2C4G B;  5DQW A;  1AD6 A;  4OMF B;  1VQ5 Q;  2XDP A;  1RAA B;  2XU8 A;  3NTK A;  2O88 A;  1GH6 B;  4C0Z A;  1VQL A;  1O75 A;  1R77 A;  4HNU A;  3PO3 S;  3NPF A;  3HSB A;  4F6S B;  2FZC B;  4BCN D;  1AOJ A;  1CKB A;  2PHG A;  1Q7Y U;  1GUX B;  5GMK e;  2HMA A;  2Z0W A;  3GOX A;  4PJO D;  2G6F X;  4QQD A;  1K4U S;  3OW2 A;  2K2M A;  5GAM h;  1ZX6 A;  8ATC B;  5CKE A;  3PMT A;  4DBR A;  2K6D A;  2EQI A;  3NGP A;  2JMC A;  4A53 A;  5KCO A;  2M1H A;  3QYG B;  3RKW A;  4IUT A;  4BXX X;  4BCQ B;  1OZ2 A;  2X4W A;  3AHU A;  5GAM j;  1GXI E;  1WZO A;  1VQM Q;  4X1V A;  5KE2 A;  2EYX A;  4F16 A;  1URC B;  1E6H A;  1NZ9 A;  4EMK A;  4ESR A;  2LQ8 A;  2DVJ A;  2QQS A;  1PKT A;  1X01 A;  4M78 B;  3VKH A;  2HZY A;  5KCH A;  1NEB A;  3R6O A;  4CXA B;  1LPL A;  2PVO B;  5D6W A;  3DJB A;  4J9F A;  4HNT A;  4M78 E;  1UGQ B;  1VQ8 A;  2IW8 B;  3QHS A;  4MFE A;  2GNC A;  2YT6 A;  4M7D B;  4ELZ C;  1TUG B;  2FO0 A;  2D0Q B;  1SHG A;  1M3B A;  2EPD A;  4OMP A;  2BZX A;  2AKK A;  2C6T B;  1TUD A;  2DL4 A;  2RK2 A;  2EYZ A;  1WHK A;  3MEA A;  1JJ2 P;  3PGG A;  3VRY A;  1QVG P;  1HYO A;  4M78 D;  2QGS A;  4ZGE B;  2PJQ A;  1RLP C;  2JS2 A;  5GAO l;  3EFS A;  5GAN 3;  3EID B;  3EFO A;  3MKD A;  1XOV A;  2LX7 A;  2NLU A;  3KUF A;  5CAI A;  4TTH A;  1Q95 G;  3CME Q;  2LCS A;  1VYV A;  1K9M R;  2BKZ B;  2I0N A;  4Y92 A;  5KYU A;  4N0A C;  4M7D D;  4OGR B;  2KI7 A;  1BYM A;  3EH2 A;  4N4H A;  2DIQ A;  2WXV B;  2XDB A;  2I53 A;  4M77 E;  3HBL A;  4E7H A;  2WHB B;  4QSH A;  2Y4X A;  2J06 A;  4HCZ A;  1PSF A;  3QJ6 A;  3QSU A;  3EOC B;  1OGU B;  1UNL D;  3G33 B;  3OY9 A;  2FPD A;  3CCV T;  2L3S A;  1JO8 A;  1B34 A;  5FGK B;  4CC3 A;  3THK A;  5LJ3 d;  4ELY C;  1WLP B;  4V2S A;  1AIS B;  4M77 D;  4XU1 A;  2M02 A;  4HVU A;  3JCM V;  3M54 A;  4C8Q E;  1YBY A;  3J81 E;  2NWM A;  5CQY A;  3I5S A;  3C94 A;  5KYW B;  4HNV A;  3ZL7 C;  3M58 A;  1BCO A;  2QEX T;  3RER A;  1PKS A;  3UT1 A;  4LXC A;  3U23 A;  1JOW A;  3JB9 G;  1KC8 U;  3GTM S;  4C8Q D;  3MIA B;  1M2O A;  1H26 B;  1N27 A;  2EGC A;  1MGQ A;  3R6N A;  3PNW C;  1XQH A;  4GY5 A;  4OMQ A;  3KHI A;  1ACM B;  1LNX A;  3G71 A;  2K3X A;  4MFD A;  3OYD A;  2P0P A;  3JCM J;  3CC7 A;  4EOI B;  4KRC B;  4M7A A;  1JXO A;  3DKM A;  1Y07 A;  4AG1 C;  4RKU E;  2LC4 A;  1OKV B;  4C92 F;  1TTH B;  5GMK h;  4EC8 B;  4BCK B;  5HVY B;  2BE9 B;  2X4J A;  1TS9 A;  1I0C A;  2O31 A;  4MML A;  3EJ1 B;  4CRI A;  3OYG A;  2LQK A;  2EYY A;  3SWN A;  2RM4 A;  3I9Q A;  1N6A A;  1R8O B;  2ZCF B;  4M77 A;  2DVE A;  2EAY A;  3L1A A;  2QA4 Q;  5CIU A;  3GP8 A;  4PJN A;  2CP6 A;  5GMK j;  3OYB A;  2LCL A;  3DTO A;  2K3B A;  4YOO A;  2CGH A;  3I55 T;  2HSP A;  1IZ6 A;  4OR5 B;  3TNI B;  3MP6 A;  2DXU A;  1VQ7 T;  4CFN B;  3VS0 A;  4KRT A;  3CCR T;  2DE0 X;  1S72 T;  2A0F B;  3OYN A;  1VIF A;  5L8R E;  4C8Q A;  1LVK A;  4RTV A;  4DBQ A;  1VOM A;  2X35 A;  1JKW A;  2DD5 B;  2V8I A;  3M0R A;  2ZZD B;  3CPF A;  3VUZ A;  3BFM A;  1KQS S;  5KE3 A;  5DM7 R;  1OX9 A;  3CCQ T;  3OW2 P;  2VXF A;  3LGL A;  1KJW A;  2YRC A;  1GCQ C;  3TNW B;  1Q82 C;  2GFU A;  2O4X A;  2DXB B;  1SF9 A;  2K5L A;  2L0A A;  3OYJ A;  3S3O A;  3OYH A;  1C9B A;  2LQN A;  2F2C A;  2MOX A;  4CFX B;  1RAF B;  1A0N B;  1M3C A;  2K4Y A;  4LNP A;  3PTA A;  3CD6 Q;  1IRE B;  3QBY A;  1VQN Q;  2WSF E;  1BCM A;  1OL1 B;  3E19 A;  3BE3 A;  1WDX A;  2OTJ T;  1QKX A;  1O9K B;  1I1J A;  5LJ5 e;  4M7A G;  1U5S A;  4Z8A A;  1G3T A;  1Y57 A;  2JXB A;  3HRT A;  2YRV A;  1TWB A;  2XK0 A;  2EUF A;  1YI2 T;  1K76 A;  4IUQ A;  1FWZ A;  1RI0 A;  2PQW A;  2KR6 A;  4EIK A;  1LOJ A;  2LTO A;  4RG8 A;  2RJD A;  1BKB A;  4JS5 A;  2C5X B;  3LQ5 B;  3GNF B;  3VS1 A;  2KBT A;  4ZGD B;  2JW4 A;  1JB0 E;  1H8K A;  1QVF P;  4ATO A;  3A5Z B;  2MCN A;  2V1R A;  3G4S Q;  4KRD B;  1W2B S;  5IHY A;  5GJV B;  2COZ A;  3CC4 T;  3MCA B;  1M1K C;  4BI3 A;  4LDU A;  1M27 C;  4IUR A;  1UGR B;  1BIB A;  2HQE A;  1XJW B;  1YIJ Q;  1D1B A;  1VQ5 T;  2KT1 A;  2L3R A;  1Y7X A;  1NPP A;  4VUB A;  3X26 B;  2WJ9 A;  2RI5 A;  3M4Y A;  4RTU A;  3EGD A;  3JCM d;  3UF4 A;  1KIK A;  1BI1 A;  3C12 A;  3QHR B;  1YJ9 Q;  2DKG A;  1G3Y A;  1VQ6 Q;  1JSU B;  1QCF A;  2KR3 A;  3CBM A;  2KRN A;  4J9E A;  2Y4Y A;  3FB9 A;  2CZ6 B;  4L5G A;  2M51 A;  1OIU B;  4JDS A;  2VGN A;  1W1F A;  4FCY A;  1VQO T;  3X28 B;  1H27 B;  1OU8 A;  5LJ5 f;  5KYX B;  1ZUU A;  3V7C A;  2NUT A;  3SB2 A;  4PFP A;  4LOC A;  4RMO A;  1VQM T;  2QQ8 A;  1SEM A;  2DTH A;  2EYQ A;  4F70 B;  3M0Q A;  5EC7 A;  3PFS A;  3X20 B;  2XDD A;  1WQ7 A;  1C6V X;  5IHN A;  2PK9 B;  2O01 E;  2KYB A;  1ZBX A;  2C0O A;  5D6Y A;  3RMS A;  4BDZ A;  2COW A;  4N0A A;  1OKW B;  1SRM A;  5FRN A;  4JLI A;  3NTI A;  1ZA2 B;  4EDU A;  2QDL A;  2HBW A;  4ZN3 A;  1YWP A;  4Y91 A;  2BPM B;  2ECZ A;  2B86 A;  2KQW A;  5CCA A;  2Y90 A;  4ZTF A;  2K57 A;  2W2H A;  3CCM Q;  3CCS T;  3TN8 B;  3OMG A;  2X1N B;  3A1P A;  5IHI A;  4CFU B;  2M0O A;  2RMO A;  3QZ5 B;  1OPL A;  4JX4 A;  7AT1 B;  3HRS A;  3CBP A;  2MAM A;  3CME T;  4MMK A;  5GMK i;  1KD1 U;  2DRM A;  4EOK B;  3SD4 A;  3PVQ A;  1YWO A;  5A0D A;  3LH5 A;  3UA6 A;  2LP5 A;  4E47 A;  3F70 A;  4AT1 B;  1M1K R;  4J9I A;  1NLP C;  3PVL A;  1NLO C;  3URG A;  5GAN g;  1D3U B;  4FSS A;  4A4F A;  3CCJ A;  4CFU D;  2DD4 A;  1U06 A;  3OMC A;  4LN2 A;  2KDS A;  5LJ5 h;  3RR6 A;  1K73 C;  2YRD A;  5GAO m;  3RIR A;  5GAN 5;  3TVT A;  4M75 F;  4WCI A;  2DME A;  5GAN f;  4JZ3 A;  2F2W A;  5HNB B;  3O0G D;  4A4G A;  2EJG A;  2KYM A;  4ROE A;  2GQV A;  3UAT A;  1Q81 U;  4AFS C;  1SRL A;  3OSV A;  3OYM A;  1WIE A;  4CC7 A;  1F5Q B;  3M0S A;  1WPY A;  1JRI A;  5LJ5 j;  2WIH B;  2RQU A;  1DJ7 B;  4HCB A;  5I2S A;  5GAN 6;  2R58 A;  4LUE A;  1YJW Q;  1K8A U;  4F04 B;  8AT1 B;  4M75 B;  4KUD K;  1K0X A;  3OS2 A;  4HVW A;  4XU2 A;  2E65 A;  2WAC A;  2LJ0 A;  3VJP A;  3P8B B;  3G6E T;  4C5G A;  1Q86 C;  1VQP A;  3ASK A;  2RO0 A;  3D7S B;  5I22 A;  2X4X A;  3VRZ A;  1O9S A;  1YN8 A;  3OYA A;  4XK8 E;  4J6W A;  2GTJ A;  4A63 B;  3MJX A;  4PJL A;  1GBQ A;  3EGX B;  2VKN A;  1ZSZ B;  3OS1 A;  2DO3 A;  1G5V A;  2CCI B;  3HKS A;  1X75 C;  4PL6 A;  2FPF A;  4DBH A;  2EIF A;  2IVW A;  1VUB A;  5LJ3 e;  3EHR A;  3M59 A;  1GY3 B;  2LCC A;  4IIO A;  2XIC A;  2WMB B;  1GCQ A;  3FRN A;  1KQ1 A;  2QA4 T;  2NUP B;  4BE1 A;  3JCM P;  5DY9 A;  5GMK l;  5GAM g;  4ROC A;  1OQK A;  1KQS A;  1D3B A;  3DLL A;  4JRQ A;  4YOZ A;  3HB9 A;  5HBJ B;  3ZBD A;  3CC4 A;  3CCQ Q;  3NDQ A;  4DQ2 A;  3S3N A;  2EYW A;  1TUC A;  3PE0 A;  3PT9 A;  3CXC S;  2BZ8 A;  1H3Z A;  2J6K A;  1SSH A;  1M4Z A;  1IGQ A;  1Y96 A;  2E6N A;  2A36 A;  1QWE A;  2HDA A;  4EMK B;  3RKX A;  4C0D C;  1AZE A;  1R0C B;  1WHH A;  2KRO A;  1QLB A;  1AWW A;  1K73 R;  3H6Z A;  3TW7 A;  4EOO B;  1FYN A;  2YLB A;  4II1 A;  1T3S A;  2IW6 B;  2H8H A;  2PMI B;  2OTJ Q;  1YHQ A;  3MEV A;  4PJO F;  4BI4 A;  3CC2 T;  1M9S A;  2F69 A;  2KRM A;  4F7L B;  4XTX A;  3DOG B;  4F7U A;  3H4C A;  2BUD A;  2JOY A;  3DB3 A;  1VQN T;  4F17 A;  2PTK A;  2X9H A;  1K9M U;  3OYL A;  3LLR A;  2DTO A;  1XTD A;  1IHW A;  4EOL B;  2D9T A;  4O5V A;  3QJY A;  2M9U A;  4BCH B;  2YWW A;  1VQ4 A;  2JM8 A;  3JB9 D;  2DZC A;  5LJ3 f;  3WVE B;  2E3I A;  1OEB A;  3I56 Q;  4QVD A;  4PJO B;  1M90 C;  4J9G A;  1YIT Q;  1W2B A;  3EFO B;  1AWO A;  4CC4 B;  1GBR A;  5GAN 7;  3E2U A;  2PVD B;  3H41 A;  5KYU B;  3F5X B;  2DYI A;  1VIN A;  5I11 A;  5HK3 A;  4F14 A;  1XNI A;  2C0I A;  4L59 A;  3RDV A;  3EH1 A;  5LQF B;  3G4S T;  3BHU B;  5AYF A;  3CMA A;  2QGG A;  4OMO A;  3CCU A;  4DEX A;  3FEO A;  2R7G A;  2DJQ A;  3TW6 A;  3OQ5 A;  3K7A M;  1PG5 B;  5CO7 A;  2UZL B;  1B34 B;  2IN3 A;  1YIJ T;  1HSQ A;  3WVD B;  2J7I A;  4EOS B;  2YXY A;  4M78 F;  4D8D A;  3HHT B;  1D0Y A;  1M8V A;  2NUZ A;  3MHX A;  2QTX A;  1N8R C;  2DEQ A;  1QLY A;  3VKI A;  2DK3 A;  1VQO Q;  4AI6 A;  1YJ9 T;  1KHI A;  1VQ6 T;  1OX8 A;  2RQW A;  5L23 A;  3FJP A;  4M7D F;  2K5F A;  5CQX A;  1OOT A;  3VYH B;  3BLR B;  1LJO A;  2EQK A;  2L2P A;  5C0M A;  1AWX A;  1WHG A;  1FKM A;  5FLX E;  4F7U G;  3QUI A;  2QXF A;  3V8J A;  5GAN 4;  3ME9 A;  1VQK T;  3JSC A;  4C0G A;  2ZPE B;  2FVU A;  3OB9 A;  2VVK A;  2F2V A;  1NJI R;  4F6W B;  4C5E A;  1E9H B;  4C92 C;  3HFN A;  5LJ3 h;  3H8Z A;  2XI9 A;  1MND A;  1ZA1 B;  3GIB A;  4PNO A;  2JGZ B;  5FU7 B;  3BW1 A;  1AZG B;  3CCS Q;  4O6J A;  2CP0 A;  4KH1 B;  4M7A E;  2H3J A;  5I2M A;  1OV3 A;  2E5K A;  1JXM A;  2QYZ A;  5LJ3 j;  3QZ9 B;  4OP0 A;  3CCM T;  1BBZ A;  1NG2 A;  4M77 B;  1YJN A;  5L2W B;  4X9D A;  2E41 A;  1UDL A;  3NHN A;  4NS5 A;  1K0S A;  3DDP B;  4PFO A;  1VQL Q;  4M7A D;  3JCM e;  2CH4 A;  2DEU A;  4XTZ A;  1WHM A;  1YP5 A;  1NE8 A;  3CCE T;  2IVX A;  4MDW A;  1TH7 A;  1ZBJ A;  4LD9 K;  2BS3 A;  4C8Q B;  5ECA A;  1H1S B;  2CRE A;  1KXU A;  4GLM A;  1PKD B;  1G3S A;  1G3W A;  5HCK A;  3OS0 A;  2FRW A;  3G7Z A;  3OYC A;  1E7O A;  4Y28 E;  2CCH B;  1U3O A;  2OAW A;  4G6L B;  2QA4 A;  3ER0 A;  2VYT A;  2VUB A;  3MPU B;  1KQS P;  4OB2 B;  2EGE A;  1K9A A;  2DJZ A;  4FX3 B;  2WIP B;  1RUW A;  1D09 B;  3QWY A;  1N8R R;  2W96 A;  4J6X A;  2YSQ A;  1M2V A;  3WXM B;  3LW5 E;  2YLC A;  2EJ9 A;  1PRL C;  2KMG A;  3GNG A;  1ZQ1 A;  1VOL A;  5D6X A;  4K11 A;  1WFW A;  1AHJ B;  3M9Q A;  3G6E Q;  2FEI A;  3HPW A;  4HCK A;  4J6Y A;  1BIA A;  1YJW T;  4AKH A;  1FXX A;  3GF5 A;  2K79 A;  1IHV A;  4I3Z B;  3H9N A;  2UUE B;  2EQJ A;  2E64 A;  3MP8 A;  1X6O A;  4FU6 A;  5A0L A;  4HXJ A;  3JCM f;  4E6R A;  4PLL A;  1X2K A;  3CD6 A;  3O8V A;  4ORZ A;  4BB7 A;  3A98 A;  3QDR B;  1SPK A;  5KH6 A;  4J8O A;  1N9S A;  1RAB B;  1UEB A;  3MO8 A;  5IN1 A;  3V8L A;  1UB4 A;  3C4S A;  4HL4 A;  1W2B P;  2L3P A;  2SEM A;  1ARK A;  2A37 A;  2MIO A;  1PNJ A;  3LWH A;  2A3L A;  2ZGW A;  1GRI A;  2CYZ B;  4JRP A;  1D0Z A;  4BCM B;  2EBP A;  1FMV A;  3EGD B;  3M4G A;  2CT4 A;  3CXC A;  1YFN A;  1LCK A;  3EAE A;  2JZ2 A;  4EC9 B;  4BE0 A;  2K3Y A;  5CR2 A;  5IH2 A;  1R0B G;  1EFN A;  2J6F A;  4OB0 B;  2RI2 A;  4Z89 A;  3VS5 A;  3LGF A;  2NUT B;  2QI2 A;  3NTH A;  1N4M A;  3UDC A;  1MHN A;  4IUP A;  2DYB A;  2WSE E;  2DIG A;  4BCM D;  5EG2 A;  3CC2 Q;  1ENW A;  5CKF A;  3BDU A;  3G71 Q;  2MWP A;  2RNA A;  5EFQ B;  5GMK m;  3HFO A;  4BCG B;  4FYX B;  3CC7 Q;  2DXC A;  2JT4 A;  3BHV B;  3JCM h;  1C1A A;  4MZT A;  4NL3 A;  2VB6 A;  1OIY B;  2L5Q A;  2CP3 A;  4RCC A;  2RHY A;  3INZ A;  4OF1 A;  5CKH A;  1BI0 A;  1WNL A;  1JST B;  3MP1 A;  5FW9 A;  1M1K U;  5ICP B;  3RUX A;  2P84 A;  3I56 T;  1WXB A;  9ATC B;  5IXF A;  2JMA A;  1YIT T;  3CEY A;  2FYK A;  5CYI B;  1MMA A;  1TU0 B;  3A8G B;  4JJC A;  4RTW A;  4EOM B;  2JN0 A;  3NMZ C;  2V26 A;  1IO6 A;  2X4Y A;  1UGP B;  5FRM A;  5EJC A;  3V8K A;  1ZUK A;  4JLG A;  2P4T A;  2RHI A;  4QKU A;  2DD4 B;  1I5O B;  3OS5 A;  2DMO A;  5LJ5 g;  2OTL T;  4M75 C;  4A4H A;  4XTV A;  4L6V 5;  2E10 A;  1VYT A;  1QP3 A;  4J5Y A;  1VQ9 T;  2DET A;  3QYE A;  1IGU A;  4C92 A;  4CRL B;  4ELJ A;  2QG9 B;  3L2Z A;  4PJM A;  2DAQ A;  3CCV A;  4JZ4 A;  4ROD A;  2W9F A;  3N5B B;  2BIV A;  1NPR A;  1VQK Q;  2ZPF B;  1H24 B;  3JRZ A;  2MWO A;  4II5 B;  1G2B A;  1ZSZ C;  2E3H A;  1NYF A;  1Q82 R;  2HKQ B;  2G9X B;  4Y72 B;  3BLQ B;  1H3H A;  4JJN K;  1BB9 A;  2DF6 A;  1VIE A;  4R55 A;  1IRX A;  4F7N B;  3QWL A;  4LDW A;  3VUB A;  5A2Q E;  2QEX A;  2EFI A;  2RHU A;  4E7S A;  2P0K A;  1TD6 A;  4QQG A;  3OBY A;  2DXB A;  2RI3 A;  4J83 A;  3JB9 H;  3HRU A;  4DBF A;  3A8L B;  2ZPI B;  1PD0 A;  3RNJ A;  2XD0 A;  1UUE A;  1OYX A;  2BS4 A;  4XQ3 A; 
#chains in the Genus database with same CATH homology
 3BG3 A;  2LRQ A;  4A4K A;  2QDY B;  1M1G A;  4DQ2 A;  3S3N A;  4KT0 E;  4E7I A;  2CKK A;  3PMI A;  1YIJ A;  2RK2 A;  3PT9 A;  3CXC S;  4C92 E;  3L2U A;  1H3Z A;  2M16 A;  2VGM A;  3MEA A;  2CS7 A;  4WF2 A;  1I5L A;  3PGG A;  1M4Z A;  1FX7 A;  4X34 A;  4M78 D;  5J3B A;  4ZN1 A;  1Y96 A;  2E6N A;  4EMK B;  4ZGE B;  3RKX A;  4C0D C;  5GAO l;  3EFS A;  1QLB A;  5GAN 3;  1YJ9 A;  3H6Z A;  3TW7 A;  2YLB A;  2CZ0 B;  4II1 A;  1XOV A;  4HT9 A;  1WJS A;  2NLU A;  3KUF A;  2QFZ A;  5CAI A;  1VQ6 A;  1VQL T;  4C92 D;  3L2V A;  3P8H A;  2AHJ B;  1YHQ A;  5GAO n;  3MEV A;  2V8J A;  4PJO F;  4BI4 A;  3QKJ A;  4N0A C;  3CC2 T;  3QYH B;  1M9S A;  2F69 A;  4QW2 A;  4M7D D;  1D3B B;  1BYM A;  4N4H A;  1VQP T;  4XTX A;  1K73 U;  4XAX B;  4AKI A;  3H4C A;  2DIQ A;  2BUD A;  2P0Q A;  4M78 G;  4F7U A;  3JAM E;  2JOY A;  2XKO C;  3DB3 A;  1H64 1;  4M77 E;  4TVR A;  1VQN T;  3HBL A;  4OB1 B;  2IG0 A;  4E7H A;  2LT4 A;  4CI0 C;  3OYL A;  1K9M U;  3LLR A;  4QSH A;  2Y4X A;  2DTO A;  4HCZ A;  1PSF A;  3QJ6 A;  1XTD A;  4MZM A;  2D9T A;  3LWI A;  2DZ9 A;  1VQK A;  4O5V A;  3QSU A;  3BG9 A;  3QJY A;  1HXD A;  4C92 G;  2M9U A;  3OY9 A;  3CCV T;  1YCY A;  3I55 A;  1B34 A;  2HNI A;  3JCM X;  2RH2 A;  3RES A;  1VQ4 A;  5LJ3 d;  3JB9 D;  2DZC A;  2QQ9 A;  4ELY C;  4HT8 A;  1Y96 B;  4M7D G;  5LJ3 f;  1VQ7 A;  4V2S A;  3WVE B;  3HP9 A;  4M77 D;  4QVD A;  4PJO B;  4XU1 A;  3JCM V;  1M90 C;  3M56 A;  3M54 A;  3CCR A;  4C8Q E;  1YBY A;  3J81 E;  1SSF A;  3FLG A;  1S72 A;  1W2B A;  4PJO C;  1KD1 C;  2I2L A;  5CQY A;  5GAN 7;  3C94 A;  4BDY A;  5CKD A;  4HNV A;  5GAO q;  2QF7 A;  2HQX A;  3OYY A;  2PVD B;  3M58 A;  3MET A;  4R56 A;  3L2Q A;  2QEX T;  3RER A;  3UT1 A;  4LD6 A;  3CPW A;  1ZHI A;  2LT1 A;  5HK3 A;  1KQ2 A;  4M6V A;  1XNI A;  3A8H B;  2DTI A;  4L59 A;  3L2R A;  4F7U B;  3JB9 G;  2GF7 A;  1RL2 A;  1U8R A;  2XG8 D;  3CCQ A;  3BDL A;  4C8Q D;  3G4S T;  4M77 G;  3CCM A;  1N27 A;  1KC8 U;  5CK9 A;  5AYF A;  2JTM A;  1MGQ A;  4KUL A;  3A8O B;  3CMA A;  1VQ8 T;  1WJR A;  3V7S A;  2K2V A;  3PNW C;  4XTU A;  3CCU A;  4C0F A;  2HD0 A;  3FEO A;  1V29 B;  1XQH A;  2MF2 A;  4GY5 A;  3TW6 A;  3OQ5 A;  1N9R A;  4HLQ A;  5CO7 A;  4F7U E;  1B34 B;  3SDZ A;  1YIJ T;  3KHI A;  1LNX A;  3G71 A;  3WVD B;  2L8D A;  2K3X A;  4MFD A;  3OBW A;  3OYD A;  2P0P A;  3JCM J;  3KBG A;  4M78 F;  3CC7 A;  3CCE A;  1M1F A;  3HHT B;  1Q81 C;  2L89 A;  3J80 E;  2FB7 A;  4M7A A;  4C5H A;  4C8Q G;  1M8V A;  3MHX A;  1I8F A;  4BUG A;  2QTX A;  3DKM A;  1Y07 A;  2DEQ A;  3UPU A;  1N8R C;  3FDR A;  3VKI A;  2OTJ A;  2DK3 A;  4RG2 A;  4AI6 A;  4X9C A;  4RKU E;  1YJ9 T;  3S6W A;  2LC4 A;  4C92 F;  1KHI A;  5GMK h;  1VQ6 T;  4GLK A;  1Y71 A;  2X4J A;  2V8K A;  3FJP A;  2DD5 A;  1YHQ T;  1YI2 A;  4NL2 A;  2K5F A;  5CQX A;  3OW2 S;  2ZZD A;  4MML A;  3Q1J A;  5J26 A;  3JCM b;  4XTW A;  1K8A C;  4CRI A;  3OYG A;  2LQK A;  3VYH B;  3VV0 A;  3SWN A;  2RM4 A;  3HO8 A;  1LJO A;  4D6W A;  5I21 A;  4FIB A;  4QVZ A;  2EQK A;  4MDX A;  1N6A A;  1R8O B;  2ZCF B;  2EJF A;  4M77 A;  5C0M A;  4NOY A;  2DVE A;  2EAY A;  3L1A A;  1FKM A;  4M78 C;  5CIU A;  5FLX E;  3GP8 A;  5GMK j;  5GAN 2;  4F7U G;  3OYB A;  3QUI A;  2E5Q A;  2QXF A;  2LCL A;  3V8J A;  5DLQ E;  3ME9 A;  5GAN 4;  1VQK T;  3JSC A;  4C0G A;  3LYI A;  2ZPE B;  2FVU A;  3OB9 A;  4Z02 A;  2CGH A;  3M5A A;  4N4I A;  3JB9 F;  4BBS M;  3I55 T;  1IZ6 A;  1VQ4 T;  3MP6 A;  4C5E A;  2DXU A;  1VQ7 T;  4C92 C;  3HFN A;  5LJ3 h;  3H8Z A;  3RMQ A;  3TCJ A;  5GAN 8;  3MEU A;  1BI3 A;  2XI9 A;  3CCR T;  4M7D C;  5GAN e;  1S72 T;  2OAU A;  4PNO A;  5FU7 B;  1VIF A;  3OYN A;  5L8R E;  4C8Q A;  3GIB A;  3JCM Q;  3BW1 A;  4JUV A;  2ZPG B;  4EPC A;  1NJI U;  2VC8 A;  4O6J A;  5FU7 C;  1PSE A;  3QG1 A;  4ZTJ A;  2X35 A;  2DD5 B;  2E1H A;  2V8I A;  1YJW A;  1VQ5 A;  3CCL T;  4M7A E;  2H3J A;  2ZZD B;  2RK1 A;  3CPF A;  5I2M A;  3VUZ A;  3V7R A;  3BFM A;  1KQS S;  5KE3 A;  5DM7 R;  5LJ3 j;  4BE2 A;  3QZ9 B;  2YHT A;  4OP0 A;  4EMK C;  3SFM A;  4JX6 A;  3HZJ A;  3CCQ T;  2VXF A;  1E7P A;  3CCM T;  4E7K A;  2JNG A;  2K5I A;  3LGL A;  3M55 A;  4M77 B;  4X9D A;  1YJN A;  2E41 A;  5HKC A;  4FM4 B;  2JUF A;  2LNV A;  4LDV A;  3CMA T;  2HBP A;  3P8D A;  1Q82 C;  4NS5 A;  2PUO B;  4RCB A;  5A0G A;  2GFU A;  2F5T X;  2O4X A;  2DXB B;  2K5L A;  3OYJ A;  5FU6 B;  3CCU T;  3JCM e;  1QVF S;  4M7A D;  1QW1 A;  4A54 A;  3OYH A;  3S3O A;  5FU6 C;  4XTZ A;  3G71 T;  2RD1 A;  2K4Y A;  3NFC A;  3CBO A;  5LJ3 g;  3PTA A;  1VQO A;  1NE8 A;  3CC7 T;  3CCE T;  4MDW A;  3LX7 A;  1IRE B;  3QBY A;  1TH7 A;  2WSF E;  4LD9 K;  2BS3 A;  3BY7 A;  2KMT A;  4C8Q B;  3E19 A;  2VV5 A;  2OTJ T;  2E6Z A;  1VQM A;  4F7U F;  1G3S A;  4IUV A;  3UWN A;  5LJ5 e;  3J7A F;  1G3W A;  3GPL A;  2DXT A;  4IUU A;  2EWN A;  4PKC C;  3OS0 A;  4EMH A;  4M7A G;  1G3T A;  3G7Z A;  3OYC A;  3E9G A;  3HRT A;  2YRV A;  4Y28 E;  1JBM A;  2QQR A;  2XK0 A;  3S3M A;  1YI2 T;  2PUK B;  4IUQ A;  1FWZ A;  1RI0 A;  2PQW A;  3ER0 A;  2VYT A;  2VUB A;  2QA4 A;  3QII A;  2KR6 A;  2RHZ A;  5C6S A;  4OB2 B;  5M9O A;  1LOJ A;  2DJZ A;  1OZ3 A;  2RJE A;  4M75 A;  3TEE A;  2LTO A;  4JRI A;  4RG8 A;  2RJD A;  3JB9 I;  1BKB A;  3RKY A;  4JS5 A;  3GNF B;  4ZGD B;  5J39 A;  1JB0 E;  1Q86 U;  4NC6 A;  4J6X A;  3WXM B;  3LW5 E;  5GAN d;  4ATO A;  3A5Z B;  2YLC A;  2D6F A;  2EJ9 A;  2BS2 A;  3JCM W;  2KMG A;  3GNG A;  4MZP A;  1W2B S;  3CCS A;  2QQB A;  4C5I A;  3OYK A;  1ZQ1 A;  3CC4 T;  5D6X A;  3MCA B;  1M1K C;  2EQU A;  4BI3 A;  1N8R U;  4BY6 B;  4LDU A;  2G3R A;  3OSS C;  1WGS A;  1AHJ B;  3M9Q A;  2A7Y A;  2E12 A;  4IUR A;  3CPW S;  4BY6 C;  1UGR B;  2XID A;  3HPW A;  4MIM A;  1BIB A;  2HQE A;  5GAM e;  4J6Y A;  1BIA A;  4P5N A;  3ZEH A;  1YJW T;  1VQ5 T;  1M5Q 1;  1Y7X A;  2L3R A;  4AKH A;  1FXX A;  3GF5 A;  1NPP A;  4JS4 A;  5FRO A;  4VUB A;  2BKD N;  3X26 B;  3CME A;  2KY9 A;  1JJ2 A;  2EQJ A;  4BAC A;  2FHD A;  2WJ9 A;  2E64 A;  3QO3 A;  3VYG A;  3MP8 A;  2JVV A;  2RI5 A;  3M4Y A;  1X6O A;  2RB6 A;  4FU6 A;  1KHC A;  5A0L A;  3JCM d;  3JCM f;  1QVG A;  1BI1 A;  3C12 A;  4J7F A;  4E7J A;  1YJN T;  2C06 A;  4PLL A;  1KG1 A;  2DKG A;  2GCX A;  3E9F A;  4M7A F;  2GFA A;  1G3Y A;  3CD6 A;  3CBM A;  3O8V A;  4BB7 A;  2RHX A;  5GAO p;  2Y4Y A;  3FB9 A;  2CZ6 B;  4L5G A;  3L42 A;  3QDR B;  2CZ7 B;  2G77 A;  4M75 E;  4JDS A;  1I4K 1;  2VGN A;  5KH6 A;  4J8O A;  1N9S A;  3M53 A;  4OVA A;  3C95 A;  1VQO T;  2QDJ A;  3X28 B;  5LJ5 d;  1UEB A;  3MO8 A;  4FL6 A;  1Q7Y C;  5IN1 A;  3V8L A;  5LJ5 f;  1UB4 A;  3C4S A;  3GLX A;  4DA4 A;  3V7C A;  3SB2 A;  4HL4 A;  3X24 B;  4LOC A;  3I56 A;  4RMO A;  1VQM T;  3LH0 A;  2QQ8 A;  3PIO A;  1UGS B;  3T9N A;  2DTH A;  2EYQ A;  4ME7 A;  5HY6 A;  1YIT A;  3TRE A;  4M75 D;  3LWH A;  4M77 F;  2A3L A;  2ZGW A;  4FT4 A;  4XU3 A;  2CYZ B;  3DLM A;  4M7A B;  4JRP A;  2XHC A;  3QYB A;  3PFS A;  4M7A C;  3VYG B;  3X20 B;  2XDD A;  1WQ7 A;  2LDM A;  2WSC E;  5LL6 S;  2B8A A;  3A8M B;  3M4G A;  2O01 E;  4DOV A;  1ZBX A;  3EFR A;  3CXC A;  5D6Y A;  3RMS A;  4BDZ A;  5CVI A;  4N0A A;  1U1T A;  3MEW A;  3EAE A;  2PVG B;  2JZ2 A;  2KK4 A;  3CCS T;  4BE0 A;  3SWN B;  5FRN A;  4JLI A;  2CZ1 B;  3NTI A;  2K3Y A;  5CR2 A;  3PIP A;  3JB9 J;  4M75 G;  4C8Q F;  4EDU A;  4N4G A;  4EMG A;  4ZN3 A;  2HAX A;  4Y91 A;  4A4E A;  4AKG A;  1W4S A;  3SWN C;  5IT9 E;  4OB0 B;  2FL7 A;  2RI2 A;  4FSX A;  2KQW A;  5CCA A;  2OTL A;  2Y90 A;  4ZTF A;  3LGF A;  5GAN h;  2K57 A;  4UC4 A;  3G6E A;  2KAF A;  2RA2 A;  3QPH A;  4BBR M;  4J7I A;  2QI2 A;  3NTH A;  4M77 C;  3OMG A;  3UDC A;  5IAY A;  5GAM d;  5GAM f;  3OA6 A;  1HK9 A;  1MHN A;  1QVF A;  4IUP A;  4ZGJ B;  2E70 A;  3M57 A;  4JRK A;  1VQ9 A;  2WSE E;  2DIG A;  2F5K A;  2M0O A;  1I81 A;  5EG2 A;  4C0D B;  4M7D E;  5CKF A;  3OYF A;  3QZ5 B;  3BDU A;  4JX4 A;  2JTF A;  1EIF A;  3OYI A;  2MWP A;  3TU4 K;  4PJO A;  4Z6Y A;  3HFO A;  3HRS A;  5GMK m;  1M90 U;  3CBP A;  2MAM A;  2ZPH B;  3L2W A;  5GAN j;  2DXC A;  3CME T;  4MMK A;  5GMK i;  3DL1 A;  1NJI C;  1KD1 U;  1OI1 A;  3SD4 A;  5A0D A;  4QQ6 A;  1WQW A;  4C8Q C;  4OGC A;  4YTL A;  3JCM h;  4E47 A;  4KBM B;  3F70 A;  3OYE A;  4MZT A;  3CD6 T;  3X25 B;  4NL3 A;  3URG A;  1QP2 A;  4LDY A;  2VXE A;  2L5Q A;  4PLI A;  4B9X A;  4RCC A;  5DLO A;  2MMP A;  5GAN g;  3CCJ A;  4A4F A;  2R5A A;  2KVQ G;  2RHY A;  3INZ A;  4OF1 A;  5CKH A;  4BI8 B;  2DD4 A;  4HA8 A;  1BI0 A;  1WNL A;  2EKO A;  2QQA A;  5CKB A;  3OMC A;  2O4X B;  3MP1 A;  5HK0 A;  2KDS A;  5LJ5 h;  2R57 A;  1M1K U;  1K73 C;  3HL8 A;  3JCM c;  5GAO m;  3RUX A;  3I56 T;  3RIR A;  5GAN 5;  4DOW A;  4M75 F;  3DB4 A;  1YIT T;  5GAN f;  1K9M C;  1BI2 A;  2FYK A;  3CEY A;  2EQM A;  4A4G A;  2EJG A;  2GQV A;  1Q81 U;  3BG5 A;  3A8G B;  3QXE B;  2DXC B;  3OSV A;  3OYM A;  2DPP B;  1P92 A;  2PU9 B;  3KXT A;  4QVC A;  2KSS A;  2LX9 A;  1WPY A;  4OB3 B;  2JN0 A;  1JRI A;  3JCM g;  1WJQ A;  5LJ5 j;  3CCL A;  1DJ7 B;  4HCB A;  4FT2 A;  4PJO E;  4HCC A;  4XTY A;  4JX5 A;  2RJF A;  2X4Y A;  3FC3 A;  1UGP B;  5I2S A;  4OMF B;  4XU0 A;  2R58 A;  5GAN 6;  4E7L A;  1U1S A;  2XDP A;  5EJC A;  2XU8 A;  1K8A U;  5FRM A;  3NTK A;  4M7D F;  3ZFJ A;  3V8K A;  2RJC A;  4C0Z A;  4JLG A;  4M75 B;  2P4T A;  2RHI A;  1O75 A;  4M78 A;  4HNU A;  2DD4 B;  3OS5 A;  1VQL A;  4KUD K;  3HSB A;  3OS2 A;  4XU2 A;  5LJ5 g;  2E65 A;  2WAC A;  1Q7Y U;  4M75 C;  2OTL T;  4A4H A;  3VJP A;  3P8B B;  4XTV A;  3G6E T;  5GMK e;  3CC2 A;  3GOX A;  4L6V 5;  4PJO D;  4C5G A;  1Q86 C;  1VQP A;  4QQD A;  2E10 A;  1KC8 C;  3ASK A;  2RO0 A;  3OW2 A;  1QP3 A;  4J5Y A;  5GAM h;  1VQN A;  1VQ9 T;  3QYE A;  5CKE A;  3PMT A;  4C92 A;  2X4X A;  4BD3 A;  4LDX A;  3E1S A;  2R5M A;  1O9S A;  4ELJ A;  4A53 A;  5KCO A;  3VU3 C;  3OYA A;  2M1H A;  4XK8 E;  4M7D A;  4OGE A;  3QYG B;  3L2Z A;  4J6W A;  1QVP A;  3RKW A;  4IUT A;  1JJ2 S;  2DAQ A;  3CCV A;  1QVG S;  1OZ2 A;  2X4W A;  3AHU A;  3N5B B;  3OS1 A;  2DO3 A;  2BIV A;  1NPR A;  4PJO G;  5GAM j;  1G5V A;  2ZPF B;  3JRZ A;  1GXI E;  2MWO A;  3HKS A;  1X75 C;  5KE2 A;  2LVM A;  4PL6 A;  4IKF A;  1NZ9 A;  4EMK A;  2EIF A;  2IVW A;  1VUB A;  5LJ3 e;  3M59 A;  2LQ8 A;  2LCC A;  4JJN K;  2XDB A;  2XIC A;  3FRN A;  2QQS A;  1VIE A;  1KQ1 A;  1X01 A;  4M78 B;  4R55 A;  4KUI A;  2QA4 T;  3QWL A;  4LDW A;  3VKH A;  3VUB A;  5A2Q E;  2QEX A;  2EFI A;  2RHU A;  5KCH A;  3CCJ T;  4BE1 A;  2P0K A;  5GAO r;  3R6O A;  5DY9 A;  3JCM P;  4QQG A;  5GMK l;  4Q5W A;  3OBY A;  1Q82 U;  5GAM g;  3FIF A;  2DXB A;  2RI3 A;  4J83 A;  3JB9 H;  3HRU A;  2PVO B;  5D6W A;  2ZPB B;  3A8L B;  2MI6 A;  3G4S A;  2ZPI B;  1D3B A;  4C92 B;  1KQS A;  4HNT A;  4M78 E;  3DLL A;  3VKG A;  4JRQ A;  1UGQ B;  2XD0 A;  1VQ8 A;  3HB9 A;  4B9W A;  1OYX A;  4MFE A;  3QHS A;  4HKE A;  2BS4 A;  4M7D B;  4ELZ C;  3ZBD A;  2D0Q B;  3CC4 A;  4XQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...