4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
2AHJB 3X20B 3VYGB 2ZZDA 4FM4B 1PSFA 4L6V5 2ZZDB 1AHJB 2QDYB 3VYHB 3X24B 3A8LB 4RKUE 2PUKB 2ZPHB 2O01E 1GXIE 3QYHB 3A8MB 2ZPGB 2PUOB 2WSCE 1DJ7B 1IREB 2WSEE 1QP2A 3QZ5B 4ZGJB 3WVDB 3HHTB 2CZ0B 4XK8E 3QYGB 2PU9B 3QXEB 2CZ1B 2DD4A 4Y28E 3X28B 4OB3B 2CZ6B 3A8OB 2DD4B 2ZPFB 1QP3A 2PVOB 1UGRB 2PVDB 3LW5E 2ZPEB 2WSFE 4ZGDB 4OB1B 2ZCFB 4ZGEB 3A8HB 3X26B 2D0QB 3A8GB 1UGSB 1JB0E 2DXBA 2DD5A 2ZPBB 2DXBB 2DD5B 1UGPB 2DPPB 1UGQB 2CYZB 2CZ7B 3X25B 4OB0B 2DXCA 5L8RE 4KT0E 1PSEA 1V29B 2DXCB 3QZ9B 2PVGB 3WVEB 3VYGA 2ZPIB 4OB2B
chains in the Genus database with same CATH superfamily
1TH7A 3I55Q 4X1VA 3OS5A 3CCRQ 3RERA 3JB9D 2GF7A 4AMCA 5C0MA 4M77F 5I11A 1VYUA 4MIMA 4TTHA 3VS7A 1TXQA 3H8ZA 5D6YA 2FO0A 1G3YA 4L5GA 5J3BA 4C8QD 1WJRA 1Y96A 4GLKA 2D8HA 2RF0A 4QVDA 3RNJA 3DOGB 1PKTA 2HNIA 2XD0A 1RAFB 2KBTA 4CFMB 5KH6A 2FEIA 4BCKB 2I2LA 4PKCC 4LDXA 3OYHA 4JUVA 3V8KA 2K3YA 1D3UB 1FYNA 3QDRB 2F5KA 2Y4YA 2EW3A 5GANe 4KGZB 2Y4XA 2HKQB 2LW4A 3NGPA 4PJNA 1K73R 2QQRA 2X4YA 1E7OA 3HRTA 5LQFB 1P5EB 1E6HA 3EGDA 2ZPFB 3RBBB 1HJDA 5HVYB 3MI9B 4BI8B 2C0TA 1XTDA 3HB9A 3UDCA 2XIDA 5CEIB 1JBMA 4C8QA 2ZCFB 3OQ5A 3BLHB 4M78E 1OX9A 4M77B 5CR2A 1VQKT 3SEMA 1WHKA 4NSTB 1ABQA 1SRMA 4EDUA 1PNJA 2H3JA 3CXCS 1YNZA 1JJ2A 5I5ZB 2O4XA 2BUDA 3FLGA 4BXXX 2LC4A 5LJ3d 2DXBB 1W4SA 4RG2A 3U23A 3DLMA 2QQAA 2K79A 1YJWQ 2K4YA 1WXBA 1XJWB 3M54A 1CKAA 3L42A 4AKIA 1VOMA 4EMKA 4OMOA 5CKBA 3OYBA 4J6YA 4C92G 3E9GA 4I3ZB 4HNVA 2DE0X 1WHLA 4XU3A 4M78A 1YJ9A 2LRQA 3VS5A 3JCMb 5D7UA 3QDFA 1WLPB 3BG3A 3AT1B 5HKCA 3F70A 5GAN4 2WIPB 3H0FA 2DETA 2HQHA 3BDLA 5HBEB 1VQ7A 4CFWB 3QWLA 2DRMA 5KCHA 4BCMD 1GFCA 2L3SA 5IHKA 5IN1A 1O9KA 2E12A 5IHNA 4E7JA 4M75D 4LOCA 3OYMA 1OGUB 1Q81C 1ZSZA 2K9GA 4M7DE 2R5AA 2RNAA 4J9FA 3PT9A 1FWZA 4Z89A 1M3BA 3EOCB 1NPPA 2QGFB 1Q86R 5DQWA 2DF6A 5FU7B 3TW7A 2RQWA 1K9MR 1H25B 4JS4A 3HHTB 4PJOF 3MEUA 4LDUA 3H0IA 3QYGB 3SWNC 4NC6A 1WNLA 1BI1A 2HZYA 1PD1A 1LCKA 3POMA 1Q7YU 2EKOA 3S3MA 2O88A 2X3XD 3PFSA 4E7HA 2FYKA 4WCIA 3BG5A 2KQWA 1RL2A 3FIFA 2LCSA 1W2BS 4HCKA 4M7DA 1YJ9T 2CCIB 3PGGA 1FMKA 3NTHA 3X26B 3OSSC 1LOJA 4DEXA 3EG0A 3M9QA 2CH4W 3QUIA 5GAN7 3HKSA 4R56A 3V8LA 2M02A 2JXBA 1VQ7T 5IHIA 4B9WA 4BUGA 2KY9A 2CH4A 3I9QA 3OW2P 1M3AA 1W70A 4X34A 4A4HA 1ZLMA 1PSEA 3HFNA 2B86A 3UPUA 4PJOB 3JCMh 3VYGA 1VQ7Q 3UATA 1Q82U 1PSFA 2J05A 5IAYA 2JM9A 2LCLA 1SG5A 1OI9B 1I4K1 2MAMA 2RI2A 1BU2A 2KMTA 4VUBA 2EFIA 2YUQA 3BHVB 1BBZA 2DAQA 3OB9A 3L2RA 3ZEHA 3DB3A 1AD5A 4FSXA 9ATCB 1WFWA 1G3WA 4EOQB 4K11A 2CSQA 2QQ8A 1GL5A 1QCNA 5KE2A 1K0XA 1ZHIA 1EZZB 2HMAA 2WACA 1NLOC 1RABB 2FRWA 1VIFA 3VKIA 1SPKA 4BDYA 1NG2A 3BFMA 2DYIA 2HSEB 3CMEQ 3FRNA 5HK0A 2JT4A 1VQMA 3GBQA 4JPBW 5KYUA 2BKDN 4M77D 2X35A 1MNDA 5A0LA 1X6GA 4R55A 2EKHA 1RLQC 2JJ9A 4Z88A 3QHRB 1AWJA 3QPHA 3PIOA 4CXAB 4Q5WA 1PM3A 3CCLA 4OMNA 4WF2A 3DTOA 1OU9A 3SHWA 3OYFA 2ZAEA 2DZCA 2GNCA 4M7AG 4C5HA 1NJIU 3O5ZA 2DD5A 4EONB 2G77A 5I2SA 3HFOA 2DPPB 2FG0A 2DVEA 3CPWS 2COWA 1FMWA 4CFUB 2L0AA 4ROEA 3CCEQ 4OB0B 1G3SA 1URCB 2LZ6B 5LJ5h 1YP5A 2K5IA 5IT9E 1D1BA 3MEAA 4BCPB 2ENMA 1OULA 1QWEA 2DA9A 2IIMA 3OBWA 2M16A 2LJ1A 5HCKA 3BHUB 2E5QA 2DERA 1BYMA 3CCSA 2W9ZA 1N4MA 2VYTA 1D0YA 1YCSB 5CK9A 2PNIA 4C8QF 2MCNA 3OA6A 2JTEA 2OX7A 3A98A 3PMIA 2F2CA 1IHVA 6AT1B 3CCMA 1KQSS 1KFZA 4AKHA 4FU6A 4PFZA 1VQMT 3JCMX 1U1SA 1GH6B 2RJFA 2EJFA 5GAOm 3MO8A 3VRYA 1UNGD 1VOLA 4QQGA 4C5GA 5GMKh 3I5SA 1DJ7B 4HCZA 4RCCA 4ME7A 4FYYB 4J5YA 1Y96B 3CCLT 2JZ2A 2MMPA 3M0TA 3R6OA 4F7UF 3FC3A 3VS0A 1Q81R 3JCMe 4RTYA 3EIDB 4M6VA 3OS0A 2KVQG 2QG9B 4ROCA 2GCXA 2VWFA 1HXDA 3VS3A 2CP5A 4M78F 2DBKA 4Y28E 5EG2A 1H27B 2GGRA 1S72A 4F7LB 4BB7A 3CC7Q 3M0UA 1JJ2P 2GTJA 1H3ZA 1RACB 2ED1A 3EGDB 3CCLQ 2EWNA 3G71A 5CKDA 1YBYA 2JUFA 4C8QB 1QCFA 3CCST 2C4GB 2BE9B 3LWIA 3CC2Q 1K9AA 2XG8D 1YHQA 1M90C 2KI7A 2VGNA 1XQHA 1D09B 4L59A 2O4XB 4MZMA 1G8XA 5HK3A 3VS4A 3URGA 5CYIB 4PJOD 1VQ5A 4CC4B 5D6WA 5GAMd 2A3LA 1ZUKA 5KYWA 1QVFS 4YOSA 4YC3B 2A7YA 3CCSQ 1R0CB 2DXCA 2BKZB 2KMGA 4EMKB 2ROLA 4O6JA 4C0DB 3OYKA 1OIYB 1XNIA 1MMNA 1D1CA 3HRUA 3CCMQ 4IUQA 1RAGB 1QMZB 4M78B 4M75F 4AFSC 3G6EQ 1MNEA 3H4CA 2LJ3A 2D6FA 3M57A 4KGVB 2QDYB 2YWWA 3X24B 4M7DF 1QVGS 2SRCA 2A36A 2PUKB 1S72T 4IURA 2DL4A 3HRSA 2ZPHB 5DQVA 4FYVB 1FMVA 2QGGA 1YIJA 5FU6B 1O9KB 3V7RA 4Y91A 1SEMA 1JO8A 1UJ0A 4PJMA 1ZSZB 2D8JA 1JOWA 1PC0A 2G3RA 4EORB 1D1AA 2YUOA 3BE3A 5LJ5e 3CD6A 3L2QA 4BY1X 1YHQT 2EGCA 1S72Q 4FX3B 1KHIA 1SRLA 4OVAA 3META 1F5QB 5DLQE 3KXTA 5GAOl 2CZ1B 3G71Q 1GBRA 2O2OA 3QYBA 4E7SA 1VQ5T 1MMGA 1Y0MA 3I56A 3CBPA 4KH1B 1QP3A 2RPNA 2I53A 1IHWA 2EYZA 2E6NA 1M4ZA 5GAN6 5GAOr 1YHQQ 1NEBA 4FIBA 2YLBA 3O0GD 1D0ZA 2JNGA 4F70B 5GMKe 4M7DB 2L89A 4FYWB 2DMEA 1X6BA 2BS2A 3OS2A 3OY9A 1KD1U 4MFEA 4F7JB 4M77C 5EJCA 1SSHA 1JU5C 1OL1B 2P0KA 4CFUD 2MYSA 1VQ5Q 2PZ1A 2FRYA 4Y72B 4HLQA 1OZ3A 5IXFA 2DJQA 2EQMA 2UZDB 1AZEA 4RCBA 1XOVA 1Y07A 2GQIA 1GCQA 2YUPA 2WMBB 3OYNA 1YIJT 5FLXE 2J6FA 1Q95G 1JRIA 3M59A 3OYDA 4CFXB 1X75C 2OAWA 2P0QA 4JX5A 5L8RE 4B9XA 2K5LA 2L2PA 4XU1A 2EYXA 1KSWA 1R0BG 3HL8A 3CD6T 3C4SA 4BY6B 3S3OA 2EJ9A 3VYGB 2A37A 2DIGA 4FM4B 2C5VB 2XI9A 5GAMj 3ULRB 4CRLB 1MMDA 4EOOB 3VUZA 2E70A 1WX6A 3NMZC 2DXTA 4JJCA 3I56T 4BBSM 3A1PA 3EG9A 3JB9G 2KXDA 4IIOA 2O01E 4HKEA 1K8AC 3CD6Q 1IRXA 1OI1A 2NUPA 2QASA 1YITA 2WSEE 2JVVA 5HQ0B 5LJ3f 1VQKA 2KK4A 3H6ZA 1LNXA 1SHFA 3JB9J 3RKXA 3WVDB 3FJPA 3NTKA 3OMGA 5FRMA 3I56Q 4ZNXA 5FU7C 5KE3A 4F6UB 2CP0A 3LX7A 2B8AA 1N9RA 3VKGA 2RK1A 4NL2A 1VINA 4FW2A 1GFDA 4MMLA 1B07A 1O75A 5LJ3g 2WPAB 2XHCA 1J3TA 4ESRA 1ENWA 3QG1A 3EFOA 1M1KU 5KYUB 3TSZA 1H1RB 3G1JA 1G5VA 2EQUA 4BBRM 4XAXB 3UA7A 2WSFE 4F7UG 3QWXX 4J9IA 2KT8A 4QKUA 4JZ3A 2EYYA 5LJ3e 3A8HB 3F5XB 3TN8B 1KC8R 3EGUA 2MI6A 3INZA 4F17A 1ZBJA 5GJVB 2X4JA 3MCAB 4FSSA 3OYCA 2DD5B 2R57A 3ASKA 4QVZA 5GAOp 1QVGA 2HDAA 3GNGA 1QMCA 3HSBA 4DBQA 2CDTA 3DKMA 1M3CA 4CC2A 4HT9A 1CSKA 4M78D 2QDJA 1YITT 3JB9H 4B6MA 2V8JA 3C95A 3MY1B 3UA6A 1U1TA 4CFVB 4PJOC 2HCKA 2VASA 4AI6A 2K2MA 1OQKA 3EH2A 4XTUA 2D9TA 4XQ3A 3EFRA 8AT1B 1UECA 2X4WA 3TVTA 3E1SA 1ZQ1A 2X9HA 2MF2A 4EOSB 3PVLA 1YITQ 1FKMA 2QTXA 2NWMA 1VQKQ 4BCOB 4C5IA 1RI9A 2ED0A 1D3BA 2FPFA 1QLBA 3GPLA 1IREB 3CPFA 2LTOA 3CQTA 2COYA 2EYWA 4A4GA 4M75G 5GANd 1UGVA 2QK0A 1BCOA 4HA8A 2D1XA 5DLOA 2KYMA 5CKEA 2FB7A 3OSVA 3PO3S 2VXEA 4IUPA 3BDUA 4CC3A 2JS0A 4HT8A 1N9SA 2FHDA 2RQUA 4ZN1A 3E2UA 4KULA 4OB3B 3QJYA 4NOYA 3GP8A 2I0NA 2CS7A 1KHCA 4M7DD 4ELJA 1KQ1A 4DBHA 1EIFA 1BIAA 2AKKA 2FZCB 4X9CA 3LQ5B 1AD6A 1B34A 2E3HA 2J7IA 2UUEB 2L3PA 4C92E 2IW9B 2DRKA 4C0ZA 5GMKm 2XICA 1JQQA 4AKGA 1KXUA 2J6OA 4N4GA 2C5XB 4EMGA 2LDMA 3BW1A 1PKSA 4HCCA 1FINB 2RJCA 4J7IA 1Q7YC 2P0PA 3GF5A 3CCQT 3CCUA 5LMKB 1AWXA 2EPDA 2F5TX 2DL5A 3H0HA 3TNIB 5KYWB 4QQDA 1GCPA 2C5OB 2DXCB 3LH5A 4BI4A 2KRMA 5A0GA 2ATCB 3LH0A 4LD9K 3QSUA 3TQ7P 4EC9B 4F6SB 4C92A 4OB2B 4HL4A 1YN8A 1TFBA 2ROTA 1K1ZA 1Y7XA 5A0DA 1MMAA 3P8HA 3LWHA 4BY7X 4J9BA 2EJGA 2OJ2A 3L2VA 3S3NA 3G7ZA 2WIHB 4JLIA 1CKBA 4E47A 2EUFA 2RA2A 4YTLA 1YJ9Q 1PCXA 1M8VA 2IW8B 3QKJA 1I1JA 2NLUA 1NBEB 2CCHB 1TOVA 2PUOB 3J7AF 4KBMB 3HPWA 4JDSA 2VC8A 4JRPA 1K8AR 1E7PA 1P92A 4N4IA 5L23A 1Q82C 2YSQA 4J9DA 4QQ6A 4EIKA 2HL3A 2E10A 2PU9B 3RUXA 3HO8A 3FB9A 3P8BB 4JX4A 2FPDA 5AYFA 3CCUT 3REBB 4MFDA 3RKYA 3KBGA 3A8OB 2EAYA 4BCNB 3WXMB 5GANj 2BZ8A 1T3SA 2RI3A 3KFVA 2HAXA 2JGZB 3EHRA 1YWOA 2YLCA 2HKNA 3M5AA 4JRQA 4DEYA 2LX7A 2G6FX 1TS9A 3QIIA 4M77G 4IUTA 5CVIA 1SF9A 2VVKA 1VQPA 1C1AA 3HBLA 4C8QC 1N8RU 3CXCA 3CCUQ 1YI2A 1PD0A 5AT1B 4A4FA 4Z6YA 3M56A 3JCMc 2YDLA 3CC4A 1ZX6A 4G6LB 4UC4A 1RAEB 3JCMV 1WJQA 2RQRA 1M5Q1 1ZA1B 1HYOA 5ECAA 3JV3A 3X25B 2H8HA 2E3IA 2DIQA 3JAME 4NS5A 2DM1A 1PWTA 3BY7A 3DLLA 2FZKB 4KT0E 4C5EA 3A5ZB 5GMKl 1QQJA 4D8DA 4RMOA 3JCMW 4EMKC 3VV0A 1I5OB 2EQKA 1UNHD 4DOWA 4Z02A 1RADB 2AZVA 4M78C 3OW2S 2X3WD 1KIKA 3D7SB 3EG9B 2NYSA 4J6WA 2FVUA 2QXFA 2LCCA 4QSHA 1I07A 1Y57A 1UEBA 4X9DA 3OYIA 5GAN8 5FU6C 3GLXA 1QP2A 2P84A 2NUPB 1VQPT 2VXFA 2KR3A 2NUTA 3DJBA 5GAMf 1YI2T 2JTMA 2F2XA 2ABLA 2KROA 1G2BA 1B7TA 3GNFB 4M7AE 3CC4T 1H1PB 2WMAB 5HBHB 2DVJA 3MP6A 3E19A 1FX7A 1NLPC 2XDPA 3QJ6A 3VS2A 2CP3A 4PFPA 2DEUA 2G9XB 2A28A 1VQOA 2CZ6B 2RN8A 2X51A 2JMCA 4BE0A 2IVXA 4J9HA 1WJSA 1VQPQ 2H3EB 3EFOB 5GAMg 3JRZA 2RJDA 1QVGP 1WGSA 1W2BA 3TEEA 1AISB 1M2OA 2QQBA 3J81E 2EGEA 1VQMQ 1BU1A 3V7CA 5KYXA 4M75C 4CFNB 4Y92A 3CC4Q 2JS2A 2KDSA 4QT7A 3REAB 1WDXA 2KE9A 4M7DC 1H4LD 4ZN3A 2CP6A 2LQWA 1U8RA 1C6VX 3FJ5A 2RK2A 4N0AA 3DB4A 4M7AA 1YCYA 4LXCA 1M9SA 3RMSA 2ZPBB 3VS1A 3M4YA 4OMLA 3UF4A 5CIUA 5CCAA 2IVWA 2EIFA 1TUDA 4IMYB 3JB9I 2P4RA 2A0FB 2LT4A 4PJOG 1M1GA 3QWYA 3R6NA 2VB6A 3JCMQ 1WHMA 3MJXA 2SEMA 5EC7A 2PVGB 2BIVA 2ZPIB 1VQ6A 1VQNA 2LX9A 1KC8U 5DM7R 3X20B 4XTZA 1ZUUA 2JMAA 4E2FB 1K73U 3PVQA 1UFFA 2M0OA 1LJOA 3NFCA 2R7GA 2QFZA 1WHJA 1S1NA 3MPUB 2QQSA 2MPXC 1VQOT 2O31A 1M27C 3MEVA 4F7SB 3TCJA 1VQ8A 4LUEA 2MOXA 1X6OA 4RODA 1H1QB 1D3BB 3OYYA 3OMCA 3JCMd 1JSTB 4LN2A 3EFSA 5KYNA 4JS5A 3CCJA 1EFNA 3QO3A 3QZ5B 3OS1A 2RH2A 3C94A 2CP2A 4BCND 1VQOQ 1VQ4T 3ZBDA 1VQ9A 1YFNA 3NHNA 4IKFA 2CZ0B 5CQYA 4V2SA 5KCOA 1YJNA 4EMHA 4C92F 4JJNK 5IDPB 1Q82R 1VYWB 4BACA 5IH2A 3PNWC 3VJPA 5LJ3h 2YXYA 4N4HA 5KYYA 1Z9ZA 2V1QA 4PLLA 1AT1B 1UGRB 4BDZA 3NTIA 2ZPEB 3EGXA 2QTVA 2CUBA 4KUDK 1B34B 4A4KA 1NYFA 1VQ6T 2GFUA 4IUVA 1VQNT 1WXUA 3H9NA 4IIMA 3RESA 4FL6A 1WPYA 4F6WB 1QVPA 2UZEB 1RLPC 3VKHA 3MY5B 1WQWA 1JJ2S 3RKWA 1RAHB 3CPWA 2LQKA 3S6WA 1VQ8T 4EC8B 2HEQA 2WJ9A 3M55A 2R58A 1H8KA 1VQ6Q 2LT1A 1SHGA 4D6WA 1VQNQ 1Q86U 2VV5A 2RO0A 3ZL7C 2P4TA 3CCJT 1K9MU 2RB6A 1E6GA 5CAIA 1TU0B 1C9BA 2AHJB 2UZBB 2YHTA 3QHWB 4C92B 3TU4K 1KD1C 2OI3A 1VQ9T 1KK7A 3MP8A 2L8DA 1JKWA 1VQ8Q 1YJNT 2BE7D 4PL6A 4JLGA 1KQSA 2K6DA 1BI2A 4LE9A 4LD6A 2D0NA 3CCJQ 3MP1A 1AWOA 5LJ5d 2A08A 1UHFA 2ZPGB 2WSCE 4XU0A 5M9OA 5GAN3 2GFAA 1T3LA 3TREA 5IHYA 2K7AA 3MKDA 1GUXA 1VYVA 2KNBB 4J83A 1YJNQ 2HBPA 3SWNA 3DDPB 1YIJQ 4J9GA 2EQJA 3VU3C 1Y71A 4LNPA 4EOPB 2JW4A 2F69A 1LVKA 1BIBA 5GAN5 2IW6B 4MDXA 4PK4A 2WHBB 5CO7A 2CKKA 2KYBA 3X28B 3CXCP 3I55T 2RHIA 2EGAA 4F7NB 2M9UA 2QGSA 4RTUA 2PVOB 3OYAA 2DTOA 2QA4A 4XTXA 1ACMB 2C06A 1X69A 2PVDB 1WI7A 1K8AU 4C8QG 4LUDA 2XKOC 4RUGA 1NE8A 3CBMA 4A53A 4AT1B 1JEGA 1H92A 2DTHA 2MIOA 3M58A 3ME9A 5ACBA 5ICPB 4HXJA 4MDWA 2QEXA 5LL6S 5FROA 2C0IA 1C0MA 2K3BA 3L2ZA 1M2VA 3ER0A 3VS6A 2KR6A 1OU8A 1TUGB 5GANf 1KJWA 1FXXA 1BB9A 2BZXA 2V1RA 2DMOA 4ORZA 5CKFA 3JCMP 2CZ7B 1M1KC 1QVFA 1OL2B 1W6XA 4II1A 2XU8A 2DL7A 1I8FA 3HTRA 2GQVA 4A54A 3PTAA 1V29B 4E7IA 2DKGA 3M03A 3T9NA 3BLQB 4OP0A 5FRNA 4M78G 3H41A 2F2VA 3EHQA 4C8QE 3EH1A 1IZ6A 5GANg 2ZZDA 4F14A 1OV3A 4F16A 1W98B 2CT4A 3THKA 4FT2A 2DK3A 2IN3A 2QF7A 4BE2A 1AHJB 3M53A 3QBYA 1M90R 4RKUE 2C0OA 3M0QA 2AIRB 2WEVB 3P8DA 2PTKA 1GRIA 1OIUB 3HP9A 2RI5A 1AWWA 1GY3B 2QA4T 4M7AF 4YOOA 5GMKi 4MZTA 1E9HB 1NPRA 2M1HA 4F7UE 3NPFA 2XDDA 2X1NB 5IF1B 2V22B 2LQ8A 2DX1A 1YJWT 3TW6A 1M30A 8ATCB 2NUTB 2PK9B 2QEXT 2RQVA 3L2UA 3EG2A 5LJ5j 1W2BP 2OTJA 1NM7A 1PG5B 1RAIB 2DLPA 1WYXA 2HQEA 1MV3A 3UT1A 4E7ZA 3CCQA 2W10A 2QA4Q 2K2VA 3RMQA 5D6XA 2IG0A 5I22A 4EOLB 3MIAB 1SSFA 2PHGA 2DO3A 1VUBA 3TNWB 3C0CA 5GAOq 1RI0A 1NYGA 3M0SA 4D8KA 4F7UA 2QEXQ 4M7DG 4OB1B 1ZP2A 2V8KA 4LDWA 1TD6A 3GIBA 1N27A 2AT1B 2GTOA 4NL3A 1UB4A 5KYXB 1K76A 5GMKj 1U5SA 3LGFA 4YOZA 1AVZC 2DTIA 1M1FA 2HQXA 4M7AB 1UGPB 2CYZB 1AOJA 4BCJB 4PNOA 1WIEA 4C92D 4EOJB 1OYXA 1MUZA 4BCQB 1GCQC 4E6RA 4C0GA 4E7LA 1Q81U 1TWBA 1PKDB 4M75E 1VQLA 5FGKB 5FWBA 1H641 2UZLB 3K7AM 2I40B 1JXOA 2C6TB 1N5ZA 1QKWA 2OTJT 3SDZA 4JRKA 3OYJA 4HNUA 3MHXA 4EPCA 4OF1A 2DEQA 3TSWA 2E65A 4KUIA 3A8LB 2QI2A 2W96A 2DJZA 1KD1R 3VRZA 1I5LA 3PE0A 3M0PA 2NUZA 1GXIE 2KSSA 2O9VA 4XTYA 2KAFA 3A8MB 4XU2A 1UE9A 1OPLA 2Y90A 3LGLA 1OKWB 2J06A 2OTJQ 2LMJA 3LYIA 4II5B 1QLYA 1HK9A 1KG1A 1QW1A 2QDLA 2LQNA 4OGRB 5GAN2 3CMEA 4M75A 3EG1A 2K57A 3CCQQ 2DNUA 3BG9A 1TUCA 2CT3A 4FW1A 4OMFB 2RJEA 4JRIA 4J9EA 4XK8E 3PIPA 2E4HA 3TNHB 5I21A 5IXBA 1O9SA 3NDQA 2K5FA 2R5MA 2DD4A 5J39A 2J6KA 1X27A 3RIRA 3CCVA 2PQWA 4DBRA 5GAMh 5KYYB 5J26A 2L5QA 3LW5E 1G3TA 2YUNA 3M4GA 3CPWP 1VQLT 1UNLD 2MWPA 4ZGEB 3EGXB 3G33B 1IO6A 3G4SA 3O8VA 2BZYA 2LJ0A 2D0QB 5LJ3j 2X4XA 4OMPA 5A2QE 2E1HA 4GBQA 2EVRA 4HVVA 2RM4A 3CCEA 4JJBA 1WZOA 2L3QA 1W1FA 1U3OA 1KQ2A 1VQLQ 4AG2C 4KRTA 4FCYA 1G83A 1KQSP 4XTVA 4IUUA 4DA4A 4OGCA 2BPMB 4J8OA 2DZ9A 2LP5A 3QZ9B 3CMET 2YRCA 3JCMJ 1M1KR 4LDVA 4AFZC 4WTOB 4QW2A 1N8RC 2QAZA 1WHHA 1H28B 3Q1JA 4L6V5 1BKBA 2VKNA 3CBOA 2IPOB 4R0KA 1UDLA 4EOIB 1MGQA 2WXVB 2RHYA 1V76A 4OGEA 1G3NC 1LPLA 1WQ7A 2DILA 1H24B 1PHTA 3CMAA 3AHUA 3CCVT 3RR6A 3QYHB 2M0YA 2PMIB 4MMKA 1JSUB 3OYLA 3V8JA 4RTVA 1IGUA 4RTWA 3DL1A 3M0RA 2PK2A 4C0DC 4M77E 2ECZA 4E7KA 1B3QA 1OKVB 1WHGA 2Z0WA 1BK2A 2AZSA 4DOVA 3G4ST 1GUXB 1NJIC 1VYTA 4J9CA 3CC7A 2AK5A 3SWNB 5EFQB 4JZ4A 1ZA2B 3CCET 4PJJA 4HVUA 2DL3A 3OYGA 3KUFA 1ZUYA 2E64A 4DQ2A 3CCVQ 1F1BB 1H3HA 3C12A 1SKUB 4FT4A 1BI0A 2KT1A 2HD0A 1HSQA 2EQIA 4AFUC 4KRCB 4AFQC 2KEAA 2AKLA 1QCOA 4HCBA 3CC2A 3G4SQ 2OTLA 2COZA 2LNHB 3GOXA 1ZSZC 3VUBA 4OMQA 1ARKA 4M77A 3JB9F 1K4US 1R8OB 1QVFP 2JTFA 2FPEA 5HBJB 3EJ1B 4M7AD 1YWPA 2V26A 1VA7A 5IDNB 1UUEA 2RMOA 4JX6A 2DXBA 2CSIA 3JCMf 2YT6A 2MK5A 4BCQD 2LNVA 2RD1A 3I5RA 3CMAT 1M2VB 4CI0C 1YI2Q 4RG8A 2EYQA 3G6EA 5DY9A 2BS3A 3JCMg 1RAAB 1JXMA 3WVEB 4RTTA 2E41A 5GAMe 1TG0A 1VQ4A 3CC7T 2F1LA 4QVCA 3PMTA 4ATOA 3CMAQ 4ZTJA 4C92C 2ZZDB 4J6XA 3VYHB 3HZJA 2PJQA 3I35A 3L1AA 1N6AA 5BNJB 1AEYA 1X2KA 1Q7YR 3CC2T 2OTLT 2KRSA 4JJDA 2F2WA 4BCFB 3IQLA 4GY5A 5C6SA 2FZGB 1ZSGA 1R77A 2GBQA 2RHZA 4BY6C 2MWOA 4A63B 1KC8C 1IB8A 4BE1A 4TVRA 1UTIA 1K73C 3JSCA 1GBQA 4EOKB 1NZ9A 1OX8A 3MEWA 1M90U 1ZBXA 5HY6A 1I0CA 4KRDB 3QXEB 3SFMA 1XO2A 2OTLQ 5GJWB 3CEYA 3E9FA 2QYZA 2HL5C 3CCMT 5CKHA 2YRVA 2M51A 4CRIA 5GAOn 2JN0A 3G6ET 1BI3A 1OEBA 1I81A 4Z8AA 4PJOE 2JOYA 2DFUA 3N5BB 1PRLC 4ZGDB 1OPKA 4PLIA 2XDBA 4F7UB 2O9SA 3QHSA 2YRDA 4GLMA 2ESWA 2CUDA 1TTHB 1OOTA 5LJ5f 3RDVA 5HNBB 2E5KA 1UGSB 4XTWA 2BS4A 4BD3A 4DBFA 3KHIA 4PJLA 4MZPA 4KGXB 2RQTA 1OZ2A 3V7SA 2WFYB 4LDYA 4F04B 2V8IA 1MV0B 2DXUA 3SD4A 1H26B 3DDQB 1VQ4Q 5LJ5g 1K0SA 2BTTA 1VIEA 4PJOA 5FW9A 4O5VA 1T0HA 2E6ZA 3G71T 2KGTA 1T0JA 1UG1A 2RHUA 5L2WB 4AG1C 5GANh 4ELYC 4HNTA 1AZGB 3EAEA 3OW2A 2CJMB 1MHNA 4RTXA 2W0ZA 3I55A 4J7FA 4A4EA 1N8RR 1QWFA 1A0NB 4BI3A 3CCRA 3OYEA 3GTMS 2DYBA 1Q86C 4ANJA 4UN0A 4CC7A 1IGQA 1K9MC 2VGMA 3B57A 2L3RA 2B9RA 1X01A 2CGHA 4BCMB 4OR5B 2XK0A 3BLRB 3ZFJA 1FVVB 4PFOA 3RGFB 4M75B 4EOMB 4ZGJB 2CP7A 2DL8A 1X43A 4BCIB 1TSFA 2RHXA 1U06A 2W2HA 3SB2A 1NJIR 2KXCA 2OAUA 2FL7A 2W9FA 5I2MA 2DD4B 1BCMA 2KRNA 1X2QA 2HSPA 3LLRA 5FWCA 2DBMA 2C5NB 1VQ9Q 5CQXA 1WXTA 2HBWA 4FYXB 1D0XA 3UWNA 3BHTB 1RUWA 4RTZA 1UJYA 3FDRA 4OMMA 4C0FA 1IXDA 1H1SB 2CREA 2QQ9A 4BCHB 3OBYA 1V1CA 3A8GB 2ZGWA 2EBPA 4BCGB 1HD3A 1UHCA 1JB0E 2W99A 1NEGA 3FEOA 1WA7A 1Z9QA 3QYEA 7AT1B 3CCRT 2K3XA 4P5NA 1UGQB 1ABOA 4N0AC 2LVMA 4ELZC 4M7AC 1EX4A 3J80E 3EG3A 2JM8A 1PRMC 3L2WA 4KH0B 1M8MA 4ELLA 1QKXA 4ZTFA 4M4ZA 4HVWA 1YJWA 2XMFA 2VUBA
chains in the Genus database with same CATH topology
1TH7A 4IUQA 3VV0A 2OTJT 3SDZA 4JRKA 3OYJA 4HNUA 4M75F 4M78B 2EQKA 3MHXA 3OS5A 4EPCA 4OF1A 2DEQA 4DOWA 3H4CA 4Z02A 3RERA 2D6FA 3M57A 3OW2S 4M78C 2E65A 2QDYB 2GF7A 3X24B 3JB9D 5C0MA 4M7DF 4KUIA 4M77F 1QVGS 3A8LB 2QI2A 4MIMA 2DJZA 2PUKB 1S72T 4IURA 1I5LA 3HRSA 2ZPHB 1GXIE 2KSSA 3H8ZA 5D6YA 4XTYA 4J6WA 1YIJA 2FVUA 2KAFA 2QXFA 3A8MB 2LCCA 4QSHA 4XU2A 5FU6B 3V7RA 1UEBA 2Y90A 3LGLA 4Y91A 1G3YA 4L5GA 4X9DA 5J3BA 4C8QD 3LYIA 5GAN8 5FU6C 3OYIA 3GLXA 1HK9A 1WJRA 1QP2A 1QW1A 1Y96A 4GLKA 1KG1A 4QVDA 2HNIA 5GAN2 4M75A 3CMEA 1VQPT 2XD0A 2K57A 2G3RA 2VXFA 3CD6A 5LJ5e 3L2QA 5KH6A 3BG9A 2I2LA 1YHQT 5GAMf 1YI2T 2JTMA 4PKCC 4LDXA 4OMFB 3OYHA 1KHIA 2RJEA 4JRIA 4JUVA 3V8KA 4OVAA 2K3YA 3GNFB 3META 3QDRB 4XK8E 3PIPA 3CC4T 4M7AE 2F5KA 2Y4YA 5DLQE 3KXTA 5I21A 3MP6A 5GANe 1O9SA 2CZ1B 2K5FA 1FX7A 2R5MA 2Y4XA 2XDPA 3E19A 3QJ6A 2DD4A 2QQRA 2X4YA 3QYBA 3HRTA 5J39A 1VQ5T 1VQOA 2CZ6B 3I56A 3CBPA 4BE0A 2ZPFB 1QP3A 1WJSA 3RIRA 3CCVA 2PQWA 4BI8B 2E6NA 1M4ZA 5GAN6 5GAMg 5GAMh 3JRZA 5GAOr 1XTDA 2RJDA 5J26A 2L5QA 3HB9A 3LW5E 1G3TA 1WGSA 3M4GA 2XIDA 4FIBA 3TEEA 3UDCA 1W2BA 1JBMA 2MWPA 2QQBA 2YLBA 4C8QA 3J81E 2ZCFB 4ZGEB 2JNGA 3OQ5A 3V7CA 4M78E 4M75C 5GMKe 4M7DB 2KDSA 2L89A 4M77B 5CR2A 1VQKT 2BS2A 3G4SA 3O8VA 3OS2A 3OY9A 1KD1U 4M7DC 2D0QB 4MFEA 4M77C 5LJ3j 2X4XA 5A2QE 5EJCA 2E1HA 2H3JA 4EDUA 2P0KA 2RM4A 4ZN3A 3CXCS 1U8RA 1JJ2A 3CCEA 2RK2A 2O4XA 2BUDA 4N0AA 3DB4A 4M7AA 1YCYA 4HLQA 3FLGA 1M9SA 1VQNA 3RMSA 2ZPBB 5LJ3d 2LC4A 2DXBB 1OZ3A 1W4SA 4RG2A 3M4YA 3DLMA 2EQMA 1KQ2A 5CIUA 2QQAA 4RCBA 1XOVA 1Y07A 3OYNA 2K4YA 1YIJT 5FLXE 3M54A 5CCAA 2IVWA 3L42A 1JRIA 2EIFA 4XTVA 3M59A 4IUUA 3OYDA 4AKIA 1X75C 2P0QA 4DA4A 4EMKA 3JB9I 4OGCA 4JX5A 2LT4A 4J8OA 1M1GA 5L8RE 4PJOG 4B9XA 2K5LA 2DZ9A 4XU1A 5CKBA 3OYBA 3QZ9B 3JCMQ 3HL8A 3CMET 4J6YA 3CD6T 4C92G 2PVGB 3E9GA 3JCMJ 2BIVA 4LDVA 2ZPIB 3C4SA 4HNVA 4BY6B 2LX9A 3S3OA 4XU3A 4M78A 3X20B 5DM7R 2LRQA 4QW2A 4XTZA 2EJ9A 1YJ9A 1N8RC 3VYGB 3JCMb 1K73U 2DIGA 4FM4B 2XI9A 3Q1JA 4L6V5 5GAMj 3BG3A 1BKBA 1LJOA 2M0OA 3CBOA 3NFCA 5HKCA 3F70A 5GAN4 2QFZA 3VUZA 2E70A 1MGQA 3BDLA 2DXTA 2RHYA 4OGEA 1VQ7A 2QQSA 1WQ7A 1VQOT 3QWLA 5KCHA 3I56T 4BBSM 3JB9G 3MEVA 3CMAA 2O01E 4HKEA 3TCJA 5IN1A 1K8AC 3CCVT 3AHUA 3QYHB 1VQ8A 2E12A 4MMKA 4E7JA 3OYLA 4M75D 4LOCA 3V8JA 3OYMA 3DL1A 1X6OA 3OYYA 1D3BB 1OI1A 3OMCA 1Q81C 1VQ6A 3JCMd 1YITA 2WSEE 3EFSA 4C0DC 2JVVA 4M77E 2R5AA 3CCJA 4JS5A 4M7DE 4E7KA 3QO3A 5LJ3f 1VQKA 3PT9A 3QZ5B 2KK4A 1FWZA 3OS1A 3H6ZA 1LNXA 1NPPA 4DOVA 3G4ST 3JB9J 2RH2A 1NJIC 5FU7B 3RKXA 3C94A 3CC7A 3TW7A 3WVDB 3FJPA 3NTKA 3OMGA 3SWNB 5FRMA 4JS4A 1VQ4T 3CCET 5FU7C 3HHTB 4PJOF 3ZBDA 3MEUA 1VQ9A 2CZ0B 4LDUA 5KE3A 3SWNC 3QYGB 3KUFA 3LX7A 5CQYA 2B8AA 2E64A 4DQ2A 4NC6A 3OYGA 1WNLA 1N9RA 5KCOA 4V2SA 1BI1A 1YJNA 3VKGA 4EMHA 4C92F 4JJNK 2RK1A 3C12A 4NL2A 4FT4A 4BACA 1BI0A 4MMLA 3PNWC 1O75A 3VJPA 2HD0A 5LJ3g 1Q7YU 5LJ3h 2XHCA 2EKOA 3S3MA 3QG1A 4N4HA 1M1KU 1G5VA 3PFSA 4E7HA 4PLLA 3CC2A 2EQUA 2FYKA 3BG5A 2KQWA 2OTLA 4BBRM 1RL2A 4XAXB 1UGRB 3GOXA 4BDZA 3NTIA 2ZPEB 2WSFE 3FIFA 4F7UG 1W2BS 3VUBA 4KUDK 1B34B 4M7DA 4M77A 4A4KA 1VQ6T 2GFUA 4IUVA 1VQNT 1YJ9T 3JB9F 1R8OB 2JTFA 5LJ3e 3A8HB 3PGGA 4M7AD 3NTHA 3X26B 3OSSC 1LOJA 3RESA 3M9QA 4FL6A 3QUIA 5GAN7 1WPYA 3HKSA 4R56A 1QVPA 2MI6A 3INZA 3VKHA 1WQWA 4JX6A 3V8LA 1JJ2S 2DXBA 3JCMf 2X4JA 3MCAB 1VQ7T 3OYCA 4B9WA 4BUGA 2LNVA 2RD1A 3RKWA 2DD5B 2R57A 3CMAT 2KY9A 3ASKA 4QVZA 5GAOp 3CPWA 1QVGA 2LQKA 3S6WA 1VQ8T 3GNGA 3HSBA 2WJ9A 3DKMA 2R58A 3M55A 4CI0C 2LT1A 4D6WA 1Q86U 2VV5A 4HT9A 4RG8A 2EYQA 4M78D 2RO0A 2QDJA 4X34A 3G6EA 1YITT 3JB9H 5DY9A 4A4HA 3CCJT 2P4TA 1K9MU 2V8JA 2RB6A 1PSEA 3HFNA 2BS3A 3JCMg 3UPUA 3JCMh 3C95A 5CAIA 4PJOB 3WVEB 3VYGA 1U1TA 2E41A 2AHJB 2YHTA 5GAMe 1VQ4A 3CC7T 4PJOC 1Q82U 4C92B 3TU4K 1KD1C 4QVCA 4AI6A 3PMTA 1VQ9T 1PSFA 4XTUA 4ATOA 2D9TA 3MP8A 2L8DA 3EFRA 4XQ3A 2LCLA 5IAYA 4C92C 2ZZDB 4J6XA 4ZTJA 1I4K1 2X4WA 1YJNT 3VYHB 3HZJA 2MAMA 3E1SA 4PL6A 1ZQ1A 4JLGA 2RI2A 1KQSA 2KMTA 2MF2A 4VUBA 1BI2A 4LD6A 2EFIA 3L1AA 1FKMA 2QTXA 1N6AA 4C5IA 3MP1A 2DAQA 3OB9A 5LJ5d 3L2RA 3ZEHA 3DB3A 1D3BA 3CC2T 2OTLT 4FSXA 2ZPGB 1G3WA 1QLBA 2WSCE 4XU0A 3GPLA 4GY5A 5C6SA 1IREB 5M9OA 2QQ8A 5GAN3 2GFAA 3CPFA 2LTOA 3TREA 2RHZA 4A4GA 4M75G 4BY6C 5KE2A 2MWOA 1ZHIA 5GANd 1KC8C 4J83A 4BE1A 2HBPA 4TVRA 3SWNA 2WACA 1K73C 3JSCA 4HA8A 5DLOA 1VIFA 3VKIA 2EQJA 3VU3C 1NZ9A 5CKEA 1Y71A 2FB7A 3MEWA 3OSVA 1M90U 1ZBXA 2VXEA 3BDUA 4IUPA 5HY6A 4BDYA 3BFMA 2F69A 4HT8A 3QXEB 3SFMA 1BIBA 5GAN5 1N9SA 2FHDA 3FRNA 3CEYA 3E9FA 4ZN1A 5HK0A 4MDXA 5CO7A 2CKKA 4KULA 3X28B 1VQMA 3I55T 3CCMT 4OB3B 3QJYA 5CKHA 4NOYA 2YRVA 3GP8A 2CS7A 2BKDN 2RHIA 4CRIA 1KHCA 5GAOn 4M7DD 4ELJA 1KQ1A 2JN0A 1EIFA 4M77D 2X35A 3G6ET 2M9UA 1BI3A 1BIAA 4X9CA 5A0LA 4R55A 2PVOB 3OYAA 1I81A 2DTOA 4XTXA 2QA4A 2C06A 4PJOE 1B34A 2JOYA 2PVDB 3N5BB 1K8AU 4C8QG 4ZGDB 4PLIA 2XDBA 2XKOC 1NE8A 3CBMA 3QPHA 4C92E 4A53A 3PIOA 4F7UB 3QHSA 3CCLA 4Q5WA 4C0ZA 2DTHA 5GMKm 2XICA 3M58A 3ME9A 4WF2A 5LJ5f 4AKGA 4MDWA 2QEXA 1UGSB 4XTWA 4N4GA 5LL6S 3OYFA 2BS4A 4EMGA 2DZCA 2LDMA 5FROA 3BW1A 4C5HA 4M7AG 4BD3A 1NJIU 2DD5A 3KHIA 3L2ZA 4HCCA 3ER0A 2G77A 2RJCA 5I2SA 4J7IA 2KR6A 3HFOA 4MZPA 1Q7YC 2P0PA 1OZ2A 3V7SA 2DPPB 5GANf 3GF5A 4LDYA 3CCQT 3CCUA 1FXXA 2DVEA 2V8IA 3CPWS 2DXUA 2F5TX 5CKFA 3JCMP 2CZ7B 1M1KC 3SD4A 1QVFA 4II1A 4OB0B 1G3SA 5LJ5g 2XU8A 5LJ5h 5GAOl 4QQDA 1I8FA 2GQVA 1VIEA 2K5IA 4A54A 3PTAA 5IT9E 4O5VA 1V29B 4PJOA 4BI4A 2DXCB 3MEAA 5A0GA 2E6ZA 3G71T 3LH0A 4E7IA 4LD9K 2DKGA 3QSUA 3OBWA 3T9NA 2M16A 4OP0A 5FRNA 4C92A 4OB2B 4M78G 4HL4A 2E5QA 4C8QE 1BYMA 2RHUA 3CCSA 1IZ6A 1Y7XA 5GANg 5GANh 2ZZDA 4ELYC 2VYTA 5A0DA 4HNTA 3P8HA 3LWHA 3EAEA 4FT2A 2DK3A 3OW2A 2QF7A 2EJGA 5CK9A 4BE2A 1AHJB 4C8QF 3OA6A 1MHNA 3PMIA 3M53A 3QBYA 3I55A 3CCMA 4J7FA 4RKUE 3L2VA 1KQSS 3S3NA 4AKHA 3G7ZA 4FU6A 4JLIA 4A4EA 1VQMT 4E47A 1U1SA 3JCMX 2RA2A 3P8DA 4YTLA 2RJFA 4BI3A 2EJFA 5GAOm 3CCRA 1M8VA 3QKJA 3OYEA 2NLUA 3MO8A 3HP9A 4QQGA 4C5GA 2RI5A 1Q86C 2QA4T 5GMKh 2PUOB 4M7AF 3J7AF 4KBMB 1DJ7B 4MZTA 5GMKi 2VGMA 3HPWA 4HCZA 1K9MC 1NPRA 2M1HA 4RCCA 4JDSA 4F7UE 2L3RA 1X01A 2CGHA 2VC8A 4ME7A 2XDDA 2XK0A 4J5YA 4JRPA 1Y96B 1E7PA 1P92A 2JZ2A 2LQ8A 3ZFJA 3CCLT 2MMPA 3R6OA 4N4IA 1YJWT 1Q82C 4F7UF 4M75B 3TW6A 3FC3A 4ZGJB 4QQ6A 2OTJA 2QEXT 3L2UA 5LJ5j 3JCMe 2RHXA 4M6VA 2E10A 2HQEA 2PU9B 3RUXA 3HO8A 3OS0A 3FB9A 2KVQG 3UT1A 3CCQA 2GCXA 3SB2A 3P8BB 4JX4A 1HXDA 1VQLT 2K2VA 4M78F 5AYFA 3RMQA 3CCUT 2OAUA 4Y28E 5D6XA 5EG2A 2IG0A 4MFDA 3RKYA 1S72A 2FL7A 3A8OB 2EAYA 3KBGA 5I2MA 2DD4B 3WXMB 4BB7A 5GANj 2RI3A 3LLRA 1SSFA 2HAXA 1H3ZA 2DO3A 5CQXA 2YLCA 1VUBA 2EWNA 3G71A 5GAOq 3M5AA 4JRQA 3UWNA 1RI0A 4M7DG 4F7UA 3QIIA 4M77G 4IUTA 4OB1B 5CVIA 5CKDA 1YBYA 3FDRA 2JUFA 2V8KA 4C0FA 4LDWA 4C8QB 3GIBA 1N27A 3CCST 1VQPA 4NL3A 2QQ9A 1UB4A 3OBYA 3HBLA 4C8QC 1N8RU 3LWIA 5GMKj 3CXCA 2XG8D 3A8GB 2ZGWA 1YHQA 1YI2A 1M90C 1XQHA 2VGNA 3LGFA 2DTIA 1JB0E 1M1FA 4L59A 2HQXA 4Z6YA 3M56A 3JCMc 3FEOA 4A4FA 4HCBA 3CC4A 3QYEA 2O4XB 4MZMA 1KC8U 4UC4A 4M7AB 5HK3A 4IKFA 3CCRT 3JCMV 1UGPB 3URGA 1WJQA 2K3XA 4P5NA 1UGQB 2CYZB 4N0AC 4PJOD 2LVMA 1M5Q1 4ELZC 1VQ5A 4M7AC 5D6WA 5GAMd 3J80E 2A3LA 3X25B 4PNOA 1QVFS 2DIQA 3JAME 4C92D 2A7YA 4NS5A 1OYXA 3BY7A 2DXCA 3L2WA 4C0GA 3DLLA 4E7LA 4KT0E 1Q81U 2KMGA 4C5EA 4ZTFA 4EMKB 1YJWA 3A5ZB 4M75E 4O6JA 1VQLA 4C0DB 2VUBA 5GMKl 3OYKA 1H641 1XNIA 4RMOA 3JCMW 4EMKC 3HRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHJ B;  3X20 B;  3VYG B;  2ZZD A;  4FM4 B;  1PSF A;  4L6V 5;  2ZZD B;  1AHJ B;  2QDY B;  3VYH B;  3X24 B;  3A8L B;  4RKU E;  2PUK B;  2ZPH B;  2O01 E;  1GXI E;  3QYH B;  3A8M B;  2ZPG B;  2PUO B;  2WSC E;  1DJ7 B;  1IRE B;  2WSE E;  1QP2 A;  3QZ5 B;  4ZGJ B;  3WVD B;  3HHT B;  2CZ0 B;  4XK8 E;  3QYG B;  2PU9 B;  3QXE B;  2CZ1 B;  2DD4 A;  4Y28 E;  3X28 B;  4OB3 B;  2CZ6 B;  3A8O B;  2DD4 B;  2ZPF B;  1QP3 A;  2PVO B;  1UGR B;  2PVD B;  3LW5 E;  2ZPE B;  2WSF E;  4ZGD B;  4OB1 B;  2ZCF B;  4ZGE B;  3A8H B;  3X26 B;  2D0Q B;  3A8G B;  1UGS B;  1JB0 E;  2DXB A;  2DD5 A;  2ZPB B;  2DXB B;  2DD5 B;  1UGP B;  2DPP B;  1UGQ B;  2CYZ B;  2CZ7 B;  3X25 B;  4OB0 B;  2DXC A;  5L8R E;  4KT0 E;  1PSE A;  1V29 B;  2DXC B;  3QZ9 B;  2PVG B;  3WVE B;  3VYG A;  2ZPI B;  4OB2 B; 
#chains in the Genus database with same CATH topology
 1TH7 A;  3I55 Q;  4X1V A;  3OS5 A;  3CCR Q;  3RER A;  3JB9 D;  2GF7 A;  4AMC A;  5C0M A;  4M77 F;  5I11 A;  1VYU A;  4MIM A;  4TTH A;  3VS7 A;  1TXQ A;  3H8Z A;  5D6Y A;  2FO0 A;  1G3Y A;  4L5G A;  5J3B A;  4C8Q D;  1WJR A;  1Y96 A;  4GLK A;  2D8H A;  2RF0 A;  4QVD A;  3RNJ A;  3DOG B;  1PKT A;  2HNI A;  2XD0 A;  1RAF B;  2KBT A;  4CFM B;  5KH6 A;  2FEI A;  4BCK B;  2I2L A;  4PKC C;  4LDX A;  3OYH A;  4JUV A;  3V8K A;  2K3Y A;  1D3U B;  1FYN A;  3QDR B;  2F5K A;  2Y4Y A;  2EW3 A;  5GAN e;  4KGZ B;  2Y4X A;  2HKQ B;  2LW4 A;  3NGP A;  4PJN A;  1K73 R;  2QQR A;  2X4Y A;  1E7O A;  3HRT A;  5LQF B;  1P5E B;  1E6H A;  3EGD A;  2ZPF B;  3RBB B;  1HJD A;  5HVY B;  3MI9 B;  4BI8 B;  2C0T A;  1XTD A;  3HB9 A;  3UDC A;  2XID A;  5CEI B;  1JBM A;  4C8Q A;  2ZCF B;  3OQ5 A;  3BLH B;  4M78 E;  1OX9 A;  4M77 B;  5CR2 A;  1VQK T;  3SEM A;  1WHK A;  4NST B;  1ABQ A;  1SRM A;  4EDU A;  1PNJ A;  2H3J A;  3CXC S;  1YNZ A;  1JJ2 A;  5I5Z B;  2O4X A;  2BUD A;  3FLG A;  4BXX X;  2LC4 A;  5LJ3 d;  2DXB B;  1W4S A;  4RG2 A;  3U23 A;  3DLM A;  2QQA A;  2K79 A;  1YJW Q;  2K4Y A;  1WXB A;  1XJW B;  3M54 A;  1CKA A;  3L42 A;  4AKI A;  1VOM A;  4EMK A;  4OMO A;  5CKB A;  3OYB A;  4J6Y A;  4C92 G;  3E9G A;  4I3Z B;  4HNV A;  2DE0 X;  1WHL A;  4XU3 A;  4M78 A;  1YJ9 A;  2LRQ A;  3VS5 A;  3JCM b;  5D7U A;  3QDF A;  1WLP B;  3BG3 A;  3AT1 B;  5HKC A;  3F70 A;  5GAN 4;  2WIP B;  3H0F A;  2DET A;  2HQH A;  3BDL A;  5HBE B;  1VQ7 A;  4CFW B;  3QWL A;  2DRM A;  5KCH A;  4BCM D;  1GFC A;  2L3S A;  5IHK A;  5IN1 A;  1O9K A;  2E12 A;  5IHN A;  4E7J A;  4M75 D;  4LOC A;  3OYM A;  1OGU B;  1Q81 C;  1ZSZ A;  2K9G A;  4M7D E;  2R5A A;  2RNA A;  4J9F A;  3PT9 A;  1FWZ A;  4Z89 A;  1M3B A;  3EOC B;  1NPP A;  2QGF B;  1Q86 R;  5DQW A;  2DF6 A;  5FU7 B;  3TW7 A;  2RQW A;  1K9M R;  1H25 B;  4JS4 A;  3HHT B;  4PJO F;  3MEU A;  4LDU A;  3H0I A;  3QYG B;  3SWN C;  4NC6 A;  1WNL A;  1BI1 A;  2HZY A;  1PD1 A;  1LCK A;  3POM A;  1Q7Y U;  2EKO A;  3S3M A;  2O88 A;  2X3X D;  3PFS A;  4E7H A;  2FYK A;  4WCI A;  3BG5 A;  2KQW A;  1RL2 A;  3FIF A;  2LCS A;  1W2B S;  4HCK A;  4M7D A;  1YJ9 T;  2CCI B;  3PGG A;  1FMK A;  3NTH A;  3X26 B;  3OSS C;  1LOJ A;  4DEX A;  3EG0 A;  3M9Q A;  2CH4 W;  3QUI A;  5GAN 7;  3HKS A;  4R56 A;  3V8L A;  2M02 A;  2JXB A;  1VQ7 T;  5IHI A;  4B9W A;  4BUG A;  2KY9 A;  2CH4 A;  3I9Q A;  3OW2 P;  1M3A A;  1W70 A;  4X34 A;  4A4H A;  1ZLM A;  1PSE A;  3HFN A;  2B86 A;  3UPU A;  4PJO B;  3JCM h;  3VYG A;  1VQ7 Q;  3UAT A;  1Q82 U;  1PSF A;  2J05 A;  5IAY A;  2JM9 A;  2LCL A;  1SG5 A;  1OI9 B;  1I4K 1;  2MAM A;  2RI2 A;  1BU2 A;  2KMT A;  4VUB A;  2EFI A;  2YUQ A;  3BHV B;  1BBZ A;  2DAQ A;  3OB9 A;  3L2R A;  3ZEH A;  3DB3 A;  1AD5 A;  4FSX A;  9ATC B;  1WFW A;  1G3W A;  4EOQ B;  4K11 A;  2CSQ A;  2QQ8 A;  1GL5 A;  1QCN A;  5KE2 A;  1K0X A;  1ZHI A;  1EZZ B;  2HMA A;  2WAC A;  1NLO C;  1RAB B;  2FRW A;  1VIF A;  3VKI A;  1SPK A;  4BDY A;  1NG2 A;  3BFM A;  2DYI A;  2HSE B;  3CME Q;  3FRN A;  5HK0 A;  2JT4 A;  1VQM A;  3GBQ A;  4JPB W;  5KYU A;  2BKD N;  4M77 D;  2X35 A;  1MND A;  5A0L A;  1X6G A;  4R55 A;  2EKH A;  1RLQ C;  2JJ9 A;  4Z88 A;  3QHR B;  1AWJ A;  3QPH A;  3PIO A;  4CXA B;  4Q5W A;  1PM3 A;  3CCL A;  4OMN A;  4WF2 A;  3DTO A;  1OU9 A;  3SHW A;  3OYF A;  2ZAE A;  2DZC A;  2GNC A;  4M7A G;  4C5H A;  1NJI U;  3O5Z A;  2DD5 A;  4EON B;  2G77 A;  5I2S A;  3HFO A;  2DPP B;  2FG0 A;  2DVE A;  3CPW S;  2COW A;  1FMW A;  4CFU B;  2L0A A;  4ROE A;  3CCE Q;  4OB0 B;  1G3S A;  1URC B;  2LZ6 B;  5LJ5 h;  1YP5 A;  2K5I A;  5IT9 E;  1D1B A;  3MEA A;  4BCP B;  2ENM A;  1OUL A;  1QWE A;  2DA9 A;  2IIM A;  3OBW A;  2M16 A;  2LJ1 A;  5HCK A;  3BHU B;  2E5Q A;  2DER A;  1BYM A;  3CCS A;  2W9Z A;  1N4M A;  2VYT A;  1D0Y A;  1YCS B;  5CK9 A;  2PNI A;  4C8Q F;  2MCN A;  3OA6 A;  2JTE A;  2OX7 A;  3A98 A;  3PMI A;  2F2C A;  1IHV A;  6AT1 B;  3CCM A;  1KQS S;  1KFZ A;  4AKH A;  4FU6 A;  4PFZ A;  1VQM T;  3JCM X;  1U1S A;  1GH6 B;  2RJF A;  2EJF A;  5GAO m;  3MO8 A;  3VRY A;  1UNG D;  1VOL A;  4QQG A;  4C5G A;  5GMK h;  3I5S A;  1DJ7 B;  4HCZ A;  4RCC A;  4ME7 A;  4FYY B;  4J5Y A;  1Y96 B;  3CCL T;  2JZ2 A;  2MMP A;  3M0T A;  3R6O A;  4F7U F;  3FC3 A;  3VS0 A;  1Q81 R;  3JCM e;  4RTY A;  3EID B;  4M6V A;  3OS0 A;  2KVQ G;  2QG9 B;  4ROC A;  2GCX A;  2VWF A;  1HXD A;  3VS3 A;  2CP5 A;  4M78 F;  2DBK A;  4Y28 E;  5EG2 A;  1H27 B;  2GGR A;  1S72 A;  4F7L B;  4BB7 A;  3CC7 Q;  3M0U A;  1JJ2 P;  2GTJ A;  1H3Z A;  1RAC B;  2ED1 A;  3EGD B;  3CCL Q;  2EWN A;  3G71 A;  5CKD A;  1YBY A;  2JUF A;  4C8Q B;  1QCF A;  3CCS T;  2C4G B;  2BE9 B;  3LWI A;  3CC2 Q;  1K9A A;  2XG8 D;  1YHQ A;  1M90 C;  2KI7 A;  2VGN A;  1XQH A;  1D09 B;  4L59 A;  2O4X B;  4MZM A;  1G8X A;  5HK3 A;  3VS4 A;  3URG A;  5CYI B;  4PJO D;  1VQ5 A;  4CC4 B;  5D6W A;  5GAM d;  2A3L A;  1ZUK A;  5KYW A;  1QVF S;  4YOS A;  4YC3 B;  2A7Y A;  3CCS Q;  1R0C B;  2DXC A;  2BKZ B;  2KMG A;  4EMK B;  2ROL A;  4O6J A;  4C0D B;  3OYK A;  1OIY B;  1XNI A;  1MMN A;  1D1C A;  3HRU A;  3CCM Q;  4IUQ A;  1RAG B;  1QMZ B;  4M78 B;  4M75 F;  4AFS C;  3G6E Q;  1MNE A;  3H4C A;  2LJ3 A;  2D6F A;  3M57 A;  4KGV B;  2QDY B;  2YWW A;  3X24 B;  4M7D F;  1QVG S;  2SRC A;  2A36 A;  2PUK B;  1S72 T;  4IUR A;  2DL4 A;  3HRS A;  2ZPH B;  5DQV A;  4FYV B;  1FMV A;  2QGG A;  1YIJ A;  5FU6 B;  1O9K B;  3V7R A;  4Y91 A;  1SEM A;  1JO8 A;  1UJ0 A;  4PJM A;  1ZSZ B;  2D8J A;  1JOW A;  1PC0 A;  2G3R A;  4EOR B;  1D1A A;  2YUO A;  3BE3 A;  5LJ5 e;  3CD6 A;  3L2Q A;  4BY1 X;  1YHQ T;  2EGC A;  1S72 Q;  4FX3 B;  1KHI A;  1SRL A;  4OVA A;  3MET A;  1F5Q B;  5DLQ E;  3KXT A;  5GAO l;  2CZ1 B;  3G71 Q;  1GBR A;  2O2O A;  3QYB A;  4E7S A;  1VQ5 T;  1MMG A;  1Y0M A;  3I56 A;  3CBP A;  4KH1 B;  1QP3 A;  2RPN A;  2I53 A;  1IHW A;  2EYZ A;  2E6N A;  1M4Z A;  5GAN 6;  5GAO r;  1YHQ Q;  1NEB A;  4FIB A;  2YLB A;  3O0G D;  1D0Z A;  2JNG A;  4F70 B;  5GMK e;  4M7D B;  2L89 A;  4FYW B;  2DME A;  1X6B A;  2BS2 A;  3OS2 A;  3OY9 A;  1KD1 U;  4MFE A;  4F7J B;  4M77 C;  5EJC A;  1SSH A;  1JU5 C;  1OL1 B;  2P0K A;  4CFU D;  2MYS A;  1VQ5 Q;  2PZ1 A;  2FRY A;  4Y72 B;  4HLQ A;  1OZ3 A;  5IXF A;  2DJQ A;  2EQM A;  2UZD B;  1AZE A;  4RCB A;  1XOV A;  1Y07 A;  2GQI A;  1GCQ A;  2YUP A;  2WMB B;  3OYN A;  1YIJ T;  5FLX E;  2J6F A;  1Q95 G;  1JRI A;  3M59 A;  3OYD A;  4CFX B;  1X75 C;  2OAW A;  2P0Q A;  4JX5 A;  5L8R E;  4B9X A;  2K5L A;  2L2P A;  4XU1 A;  2EYX A;  1KSW A;  1R0B G;  3HL8 A;  3CD6 T;  3C4S A;  4BY6 B;  3S3O A;  2EJ9 A;  3VYG B;  2A37 A;  2DIG A;  4FM4 B;  2C5V B;  2XI9 A;  5GAM j;  3ULR B;  4CRL B;  1MMD A;  4EOO B;  3VUZ A;  2E70 A;  1WX6 A;  3NMZ C;  2DXT A;  4JJC A;  3I56 T;  4BBS M;  3A1P A;  3EG9 A;  3JB9 G;  2KXD A;  4IIO A;  2O01 E;  4HKE A;  1K8A C;  3CD6 Q;  1IRX A;  1OI1 A;  2NUP A;  2QAS A;  1YIT A;  2WSE E;  2JVV A;  5HQ0 B;  5LJ3 f;  1VQK A;  2KK4 A;  3H6Z A;  1LNX A;  1SHF A;  3JB9 J;  3RKX A;  3WVD B;  3FJP A;  3NTK A;  3OMG A;  5FRM A;  3I56 Q;  4ZNX A;  5FU7 C;  5KE3 A;  4F6U B;  2CP0 A;  3LX7 A;  2B8A A;  1N9R A;  3VKG A;  2RK1 A;  4NL2 A;  1VIN A;  4FW2 A;  1GFD A;  4MML A;  1B07 A;  1O75 A;  5LJ3 g;  2WPA B;  2XHC A;  1J3T A;  4ESR A;  1ENW A;  3QG1 A;  3EFO A;  1M1K U;  5KYU B;  3TSZ A;  1H1R B;  3G1J A;  1G5V A;  2EQU A;  4BBR M;  4XAX B;  3UA7 A;  2WSF E;  4F7U G;  3QWX X;  4J9I A;  2KT8 A;  4QKU A;  4JZ3 A;  2EYY A;  5LJ3 e;  3A8H B;  3F5X B;  3TN8 B;  1KC8 R;  3EGU A;  2MI6 A;  3INZ A;  4F17 A;  1ZBJ A;  5GJV B;  2X4J A;  3MCA B;  4FSS A;  3OYC A;  2DD5 B;  2R57 A;  3ASK A;  4QVZ A;  5GAO p;  1QVG A;  2HDA A;  3GNG A;  1QMC A;  3HSB A;  4DBQ A;  2CDT A;  3DKM A;  1M3C A;  4CC2 A;  4HT9 A;  1CSK A;  4M78 D;  2QDJ A;  1YIT T;  3JB9 H;  4B6M A;  2V8J A;  3C95 A;  3MY1 B;  3UA6 A;  1U1T A;  4CFV B;  4PJO C;  2HCK A;  2VAS A;  4AI6 A;  2K2M A;  1OQK A;  3EH2 A;  4XTU A;  2D9T A;  4XQ3 A;  3EFR A;  8AT1 B;  1UEC A;  2X4W A;  3TVT A;  3E1S A;  1ZQ1 A;  2X9H A;  2MF2 A;  4EOS B;  3PVL A;  1YIT Q;  1FKM A;  2QTX A;  2NWM A;  1VQK Q;  4BCO B;  4C5I A;  1RI9 A;  2ED0 A;  1D3B A;  2FPF A;  1QLB A;  3GPL A;  1IRE B;  3CPF A;  2LTO A;  3CQT A;  2COY A;  2EYW A;  4A4G A;  4M75 G;  5GAN d;  1UGV A;  2QK0 A;  1BCO A;  4HA8 A;  2D1X A;  5DLO A;  2KYM A;  5CKE A;  2FB7 A;  3OSV A;  3PO3 S;  2VXE A;  4IUP A;  3BDU A;  4CC3 A;  2JS0 A;  4HT8 A;  1N9S A;  2FHD A;  2RQU A;  4ZN1 A;  3E2U A;  4KUL A;  4OB3 B;  3QJY A;  4NOY A;  3GP8 A;  2I0N A;  2CS7 A;  1KHC A;  4M7D D;  4ELJ A;  1KQ1 A;  4DBH A;  1EIF A;  1BIA A;  2AKK A;  2FZC B;  4X9C A;  3LQ5 B;  1AD6 A;  1B34 A;  2E3H A;  2J7I A;  2UUE B;  2L3P A;  4C92 E;  2IW9 B;  2DRK A;  4C0Z A;  5GMK m;  2XIC A;  1JQQ A;  4AKG A;  1KXU A;  2J6O A;  4N4G A;  2C5X B;  4EMG A;  2LDM A;  3BW1 A;  1PKS A;  4HCC A;  1FIN B;  2RJC A;  4J7I A;  1Q7Y C;  2P0P A;  3GF5 A;  3CCQ T;  3CCU A;  5LMK B;  1AWX A;  2EPD A;  2F5T X;  2DL5 A;  3H0H A;  3TNI B;  5KYW B;  4QQD A;  1GCP A;  2C5O B;  2DXC B;  3LH5 A;  4BI4 A;  2KRM A;  5A0G A;  2ATC B;  3LH0 A;  4LD9 K;  3QSU A;  3TQ7 P;  4EC9 B;  4F6S B;  4C92 A;  4OB2 B;  4HL4 A;  1YN8 A;  1TFB A;  2ROT A;  1K1Z A;  1Y7X A;  5A0D A;  1MMA A;  3P8H A;  3LWH A;  4BY7 X;  4J9B A;  2EJG A;  2OJ2 A;  3L2V A;  3S3N A;  3G7Z A;  2WIH B;  4JLI A;  1CKB A;  4E47 A;  2EUF A;  2RA2 A;  4YTL A;  1YJ9 Q;  1PCX A;  1M8V A;  2IW8 B;  3QKJ A;  1I1J A;  2NLU A;  1NBE B;  2CCH B;  1TOV A;  2PUO B;  3J7A F;  4KBM B;  3HPW A;  4JDS A;  2VC8 A;  4JRP A;  1K8A R;  1E7P A;  1P92 A;  4N4I A;  5L23 A;  1Q82 C;  2YSQ A;  4J9D A;  4QQ6 A;  4EIK A;  2HL3 A;  2E10 A;  2PU9 B;  3RUX A;  3HO8 A;  3FB9 A;  3P8B B;  4JX4 A;  2FPD A;  5AYF A;  3CCU T;  3REB B;  4MFD A;  3RKY A;  3KBG A;  3A8O B;  2EAY A;  4BCN B;  3WXM B;  5GAN j;  2BZ8 A;  1T3S A;  2RI3 A;  3KFV A;  2HAX A;  2JGZ B;  3EHR A;  1YWO A;  2YLC A;  2HKN A;  3M5A A;  4JRQ A;  4DEY A;  2LX7 A;  2G6F X;  1TS9 A;  3QII A;  4M77 G;  4IUT A;  5CVI A;  1SF9 A;  2VVK A;  1VQP A;  1C1A A;  3HBL A;  4C8Q C;  1N8R U;  3CXC A;  3CCU Q;  1YI2 A;  1PD0 A;  5AT1 B;  4A4F A;  4Z6Y A;  3M56 A;  3JCM c;  2YDL A;  3CC4 A;  1ZX6 A;  4G6L B;  4UC4 A;  1RAE B;  3JCM V;  1WJQ A;  2RQR A;  1M5Q 1;  1ZA1 B;  1HYO A;  5ECA A;  3JV3 A;  3X25 B;  2H8H A;  2E3I A;  2DIQ A;  3JAM E;  4NS5 A;  2DM1 A;  1PWT A;  3BY7 A;  3DLL A;  2FZK B;  4KT0 E;  4C5E A;  3A5Z B;  5GMK l;  1QQJ A;  4D8D A;  4RMO A;  3JCM W;  4EMK C;  3VV0 A;  1I5O B;  2EQK A;  1UNH D;  4DOW A;  4Z02 A;  1RAD B;  2AZV A;  4M78 C;  3OW2 S;  2X3W D;  1KIK A;  3D7S B;  3EG9 B;  2NYS A;  4J6W A;  2FVU A;  2QXF A;  2LCC A;  4QSH A;  1I07 A;  1Y57 A;  1UEB A;  4X9D A;  3OYI A;  5GAN 8;  5FU6 C;  3GLX A;  1QP2 A;  2P84 A;  2NUP B;  1VQP T;  2VXF A;  2KR3 A;  2NUT A;  3DJB A;  5GAM f;  1YI2 T;  2JTM A;  2F2X A;  2ABL A;  2KRO A;  1G2B A;  1B7T A;  3GNF B;  4M7A E;  3CC4 T;  1H1P B;  2WMA B;  5HBH B;  2DVJ A;  3MP6 A;  3E19 A;  1FX7 A;  1NLP C;  2XDP A;  3QJ6 A;  3VS2 A;  2CP3 A;  4PFP A;  2DEU A;  2G9X B;  2A28 A;  1VQO A;  2CZ6 B;  2RN8 A;  2X51 A;  2JMC A;  4BE0 A;  2IVX A;  4J9H A;  1WJS A;  1VQP Q;  2H3E B;  3EFO B;  5GAM g;  3JRZ A;  2RJD A;  1QVG P;  1WGS A;  1W2B A;  3TEE A;  1AIS B;  1M2O A;  2QQB A;  3J81 E;  2EGE A;  1VQM Q;  1BU1 A;  3V7C A;  5KYX A;  4M75 C;  4CFN B;  4Y92 A;  3CC4 Q;  2JS2 A;  2KDS A;  4QT7 A;  3REA B;  1WDX A;  2KE9 A;  4M7D C;  1H4L D;  4ZN3 A;  2CP6 A;  2LQW A;  1U8R A;  1C6V X;  3FJ5 A;  2RK2 A;  4N0A A;  3DB4 A;  4M7A A;  1YCY A;  4LXC A;  1M9S A;  3RMS A;  2ZPB B;  3VS1 A;  3M4Y A;  4OML A;  3UF4 A;  5CIU A;  5CCA A;  2IVW A;  2EIF A;  1TUD A;  4IMY B;  3JB9 I;  2P4R A;  2A0F B;  2LT4 A;  4PJO G;  1M1G A;  3QWY A;  3R6N A;  2VB6 A;  3JCM Q;  1WHM A;  3MJX A;  2SEM A;  5EC7 A;  2PVG B;  2BIV A;  2ZPI B;  1VQ6 A;  1VQN A;  2LX9 A;  1KC8 U;  5DM7 R;  3X20 B;  4XTZ A;  1ZUU A;  2JMA A;  4E2F B;  1K73 U;  3PVQ A;  1UFF A;  2M0O A;  1LJO A;  3NFC A;  2R7G A;  2QFZ A;  1WHJ A;  1S1N A;  3MPU B;  2QQS A;  2MPX C;  1VQO T;  2O31 A;  1M27 C;  3MEV A;  4F7S B;  3TCJ A;  1VQ8 A;  4LUE A;  2MOX A;  1X6O A;  4ROD A;  1H1Q B;  1D3B B;  3OYY A;  3OMC A;  3JCM d;  1JST B;  4LN2 A;  3EFS A;  5KYN A;  4JS5 A;  3CCJ A;  1EFN A;  3QO3 A;  3QZ5 B;  3OS1 A;  2RH2 A;  3C94 A;  2CP2 A;  4BCN D;  1VQO Q;  1VQ4 T;  3ZBD A;  1VQ9 A;  1YFN A;  3NHN A;  4IKF A;  2CZ0 B;  5CQY A;  4V2S A;  5KCO A;  1YJN A;  4EMH A;  4C92 F;  4JJN K;  5IDP B;  1Q82 R;  1VYW B;  4BAC A;  5IH2 A;  3PNW C;  3VJP A;  5LJ3 h;  2YXY A;  4N4H A;  5KYY A;  1Z9Z A;  2V1Q A;  4PLL A;  1AT1 B;  1UGR B;  4BDZ A;  3NTI A;  2ZPE B;  3EGX A;  2QTV A;  2CUB A;  4KUD K;  1B34 B;  4A4K A;  1NYF A;  1VQ6 T;  2GFU A;  4IUV A;  1VQN T;  1WXU A;  3H9N A;  4IIM A;  3RES A;  4FL6 A;  1WPY A;  4F6W B;  1QVP A;  2UZE B;  1RLP C;  3VKH A;  3MY5 B;  1WQW A;  1JJ2 S;  3RKW A;  1RAH B;  3CPW A;  2LQK A;  3S6W A;  1VQ8 T;  4EC8 B;  2HEQ A;  2WJ9 A;  3M55 A;  2R58 A;  1H8K A;  1VQ6 Q;  2LT1 A;  1SHG A;  4D6W A;  1VQN Q;  1Q86 U;  2VV5 A;  2RO0 A;  3ZL7 C;  2P4T A;  3CCJ T;  1K9M U;  2RB6 A;  1E6G A;  5CAI A;  1TU0 B;  1C9B A;  2AHJ B;  2UZB B;  2YHT A;  3QHW B;  4C92 B;  3TU4 K;  1KD1 C;  2OI3 A;  1VQ9 T;  1KK7 A;  3MP8 A;  2L8D A;  1JKW A;  1VQ8 Q;  1YJN T;  2BE7 D;  4PL6 A;  4JLG A;  1KQS A;  2K6D A;  1BI2 A;  4LE9 A;  4LD6 A;  2D0N A;  3CCJ Q;  3MP1 A;  1AWO A;  5LJ5 d;  2A08 A;  1UHF A;  2ZPG B;  2WSC E;  4XU0 A;  5M9O A;  5GAN 3;  2GFA A;  1T3L A;  3TRE A;  5IHY A;  2K7A A;  3MKD A;  1GUX A;  1VYV A;  2KNB B;  4J83 A;  1YJN Q;  2HBP A;  3SWN A;  3DDP B;  1YIJ Q;  4J9G A;  2EQJ A;  3VU3 C;  1Y71 A;  4LNP A;  4EOP B;  2JW4 A;  2F69 A;  1LVK A;  1BIB A;  5GAN 5;  2IW6 B;  4MDX A;  4PK4 A;  2WHB B;  5CO7 A;  2CKK A;  2KYB A;  3X28 B;  3CXC P;  3I55 T;  2RHI A;  2EGA A;  4F7N B;  2M9U A;  2QGS A;  4RTU A;  2PVO B;  3OYA A;  2DTO A;  2QA4 A;  4XTX A;  1ACM B;  2C06 A;  1X69 A;  2PVD B;  1WI7 A;  1K8A U;  4C8Q G;  4LUD A;  2XKO C;  4RUG A;  1NE8 A;  3CBM A;  4A53 A;  4AT1 B;  1JEG A;  1H92 A;  2DTH A;  2MIO A;  3M58 A;  3ME9 A;  5ACB A;  5ICP B;  4HXJ A;  4MDW A;  2QEX A;  5LL6 S;  5FRO A;  2C0I A;  1C0M A;  2K3B A;  3L2Z A;  1M2V A;  3ER0 A;  3VS6 A;  2KR6 A;  1OU8 A;  1TUG B;  5GAN f;  1KJW A;  1FXX A;  1BB9 A;  2BZX A;  2V1R A;  2DMO A;  4ORZ A;  5CKF A;  3JCM P;  2CZ7 B;  1M1K C;  1QVF A;  1OL2 B;  1W6X A;  4II1 A;  2XU8 A;  2DL7 A;  1I8F A;  3HTR A;  2GQV A;  4A54 A;  3PTA A;  1V29 B;  4E7I A;  2DKG A;  3M03 A;  3T9N A;  3BLQ B;  4OP0 A;  5FRN A;  4M78 G;  3H41 A;  2F2V A;  3EHQ A;  4C8Q E;  3EH1 A;  1IZ6 A;  5GAN g;  2ZZD A;  4F14 A;  1OV3 A;  4F16 A;  1W98 B;  2CT4 A;  3THK A;  4FT2 A;  2DK3 A;  2IN3 A;  2QF7 A;  4BE2 A;  1AHJ B;  3M53 A;  3QBY A;  1M90 R;  4RKU E;  2C0O A;  3M0Q A;  2AIR B;  2WEV B;  3P8D A;  2PTK A;  1GRI A;  1OIU B;  3HP9 A;  2RI5 A;  1AWW A;  1GY3 B;  2QA4 T;  4M7A F;  4YOO A;  5GMK i;  4MZT A;  1E9H B;  1NPR A;  2M1H A;  4F7U E;  3NPF A;  2XDD A;  2X1N B;  5IF1 B;  2V22 B;  2LQ8 A;  2DX1 A;  1YJW T;  3TW6 A;  1M30 A;  8ATC B;  2NUT B;  2PK9 B;  2QEX T;  2RQV A;  3L2U A;  3EG2 A;  5LJ5 j;  1W2B P;  2OTJ A;  1NM7 A;  1PG5 B;  1RAI B;  2DLP A;  1WYX A;  2HQE A;  1MV3 A;  3UT1 A;  4E7Z A;  3CCQ A;  2W10 A;  2QA4 Q;  2K2V A;  3RMQ A;  5D6X A;  2IG0 A;  5I22 A;  4EOL B;  3MIA B;  1SSF A;  2PHG A;  2DO3 A;  1VUB A;  3TNW B;  3C0C A;  5GAO q;  1RI0 A;  1NYG A;  3M0S A;  4D8K A;  4F7U A;  2QEX Q;  4M7D G;  4OB1 B;  1ZP2 A;  2V8K A;  4LDW A;  1TD6 A;  3GIB A;  1N27 A;  2AT1 B;  2GTO A;  4NL3 A;  1UB4 A;  5KYX B;  1K76 A;  5GMK j;  1U5S A;  3LGF A;  4YOZ A;  1AVZ C;  2DTI A;  1M1F A;  2HQX A;  4M7A B;  1UGP B;  2CYZ B;  1AOJ A;  4BCJ B;  4PNO A;  1WIE A;  4C92 D;  4EOJ B;  1OYX A;  1MUZ A;  4BCQ B;  1GCQ C;  4E6R A;  4C0G A;  4E7L A;  1Q81 U;  1TWB A;  1PKD B;  4M75 E;  1VQL A;  5FGK B;  5FWB A;  1H64 1;  2UZL B;  3K7A M;  2I40 B;  1JXO A;  2C6T B;  1N5Z A;  1QKW A;  2OTJ T;  3SDZ A;  4JRK A;  3OYJ A;  4HNU A;  3MHX A;  4EPC A;  4OF1 A;  2DEQ A;  3TSW A;  2E65 A;  4KUI A;  3A8L B;  2QI2 A;  2W96 A;  2DJZ A;  1KD1 R;  3VRZ A;  1I5L A;  3PE0 A;  3M0P A;  2NUZ A;  1GXI E;  2KSS A;  2O9V A;  4XTY A;  2KAF A;  3A8M B;  4XU2 A;  1UE9 A;  1OPL A;  2Y90 A;  3LGL A;  1OKW B;  2J06 A;  2OTJ Q;  2LMJ A;  3LYI A;  4II5 B;  1QLY A;  1HK9 A;  1KG1 A;  1QW1 A;  2QDL A;  2LQN A;  4OGR B;  5GAN 2;  3CME A;  4M75 A;  3EG1 A;  2K57 A;  3CCQ Q;  2DNU A;  3BG9 A;  1TUC A;  2CT3 A;  4FW1 A;  4OMF B;  2RJE A;  4JRI A;  4J9E A;  4XK8 E;  3PIP A;  2E4H A;  3TNH B;  5I21 A;  5IXB A;  1O9S A;  3NDQ A;  2K5F A;  2R5M A;  2DD4 A;  5J39 A;  2J6K A;  1X27 A;  3RIR A;  3CCV A;  2PQW A;  4DBR A;  5GAM h;  5KYY B;  5J26 A;  2L5Q A;  3LW5 E;  1G3T A;  2YUN A;  3M4G A;  3CPW P;  1VQL T;  1UNL D;  2MWP A;  4ZGE B;  3EGX B;  3G33 B;  1IO6 A;  3G4S A;  3O8V A;  2BZY A;  2LJ0 A;  2D0Q B;  5LJ3 j;  2X4X A;  4OMP A;  5A2Q E;  2E1H A;  4GBQ A;  2EVR A;  4HVV A;  2RM4 A;  3CCE A;  4JJB A;  1WZO A;  2L3Q A;  1W1F A;  1U3O A;  1KQ2 A;  1VQL Q;  4AG2 C;  4KRT A;  4FCY A;  1G83 A;  1KQS P;  4XTV A;  4IUU A;  4DA4 A;  4OGC A;  2BPM B;  4J8O A;  2DZ9 A;  2LP5 A;  3QZ9 B;  3CME T;  2YRC A;  3JCM J;  1M1K R;  4LDV A;  4AFZ C;  4WTO B;  4QW2 A;  1N8R C;  2QAZ A;  1WHH A;  1H28 B;  3Q1J A;  4L6V 5;  1BKB A;  2VKN A;  3CBO A;  2IPO B;  4R0K A;  1UDL A;  4EOI B;  1MGQ A;  2WXV B;  2RHY A;  1V76 A;  4OGE A;  1G3N C;  1LPL A;  1WQ7 A;  2DIL A;  1H24 B;  1PHT A;  3CMA A;  3AHU A;  3CCV T;  3RR6 A;  3QYH B;  2M0Y A;  2PMI B;  4MMK A;  1JSU B;  3OYL A;  3V8J A;  4RTV A;  1IGU A;  4RTW A;  3DL1 A;  3M0R A;  2PK2 A;  4C0D C;  4M77 E;  2ECZ A;  4E7K A;  1B3Q A;  1OKV B;  1WHG A;  2Z0W A;  1BK2 A;  2AZS A;  4DOV A;  3G4S T;  1GUX B;  1NJI C;  1VYT A;  4J9C A;  3CC7 A;  2AK5 A;  3SWN B;  5EFQ B;  4JZ4 A;  1ZA2 B;  3CCE T;  4PJJ A;  4HVU A;  2DL3 A;  3OYG A;  3KUF A;  1ZUY A;  2E64 A;  4DQ2 A;  3CCV Q;  1F1B B;  1H3H A;  3C12 A;  1SKU B;  4FT4 A;  1BI0 A;  2KT1 A;  2HD0 A;  1HSQ A;  2EQI A;  4AFU C;  4KRC B;  4AFQ C;  2KEA A;  2AKL A;  1QCO A;  4HCB A;  3CC2 A;  3G4S Q;  2OTL A;  2COZ A;  2LNH B;  3GOX A;  1ZSZ C;  3VUB A;  4OMQ A;  1ARK A;  4M77 A;  3JB9 F;  1K4U S;  1R8O B;  1QVF P;  2JTF A;  2FPE A;  5HBJ B;  3EJ1 B;  4M7A D;  1YWP A;  2V26 A;  1VA7 A;  5IDN B;  1UUE A;  2RMO A;  4JX6 A;  2DXB A;  2CSI A;  3JCM f;  2YT6 A;  2MK5 A;  4BCQ D;  2LNV A;  2RD1 A;  3I5R A;  3CMA T;  1M2V B;  4CI0 C;  1YI2 Q;  4RG8 A;  2EYQ A;  3G6E A;  5DY9 A;  2BS3 A;  3JCM g;  1RAA B;  1JXM A;  3WVE B;  4RTT A;  2E41 A;  5GAM e;  1TG0 A;  1VQ4 A;  3CC7 T;  2F1L A;  4QVC A;  3PMT A;  4ATO A;  3CMA Q;  4ZTJ A;  4C92 C;  2ZZD B;  4J6X A;  3VYH B;  3HZJ A;  2PJQ A;  3I35 A;  3L1A A;  1N6A A;  5BNJ B;  1AEY A;  1X2K A;  1Q7Y R;  3CC2 T;  2OTL T;  2KRS A;  4JJD A;  2F2W A;  4BCF B;  3IQL A;  4GY5 A;  5C6S A;  2FZG B;  1ZSG A;  1R77 A;  2GBQ A;  2RHZ A;  4BY6 C;  2MWO A;  4A63 B;  1KC8 C;  1IB8 A;  4BE1 A;  4TVR A;  1UTI A;  1K73 C;  3JSC A;  1GBQ A;  4EOK B;  1NZ9 A;  1OX8 A;  3MEW A;  1M90 U;  1ZBX A;  5HY6 A;  1I0C A;  4KRD B;  3QXE B;  3SFM A;  1XO2 A;  2OTL Q;  5GJW B;  3CEY A;  3E9F A;  2QYZ A;  2HL5 C;  3CCM T;  5CKH A;  2YRV A;  2M51 A;  4CRI A;  5GAO n;  2JN0 A;  3G6E T;  1BI3 A;  1OEB A;  1I81 A;  4Z8A A;  4PJO E;  2JOY A;  2DFU A;  3N5B B;  1PRL C;  4ZGD B;  1OPK A;  4PLI A;  2XDB A;  4F7U B;  2O9S A;  3QHS A;  2YRD A;  4GLM A;  2ESW A;  2CUD A;  1TTH B;  1OOT A;  5LJ5 f;  3RDV A;  5HNB B;  2E5K A;  1UGS B;  4XTW A;  2BS4 A;  4BD3 A;  4DBF A;  3KHI A;  4PJL A;  4MZP A;  4KGX B;  2RQT A;  1OZ2 A;  3V7S A;  2WFY B;  4LDY A;  4F04 B;  2V8I A;  1MV0 B;  2DXU A;  3SD4 A;  1H26 B;  3DDQ B;  1VQ4 Q;  5LJ5 g;  1K0S A;  2BTT A;  1VIE A;  4PJO A;  5FW9 A;  4O5V A;  1T0H A;  2E6Z A;  3G71 T;  2KGT A;  1T0J A;  1UG1 A;  2RHU A;  5L2W B;  4AG1 C;  5GAN h;  4ELY C;  4HNT A;  1AZG B;  3EAE A;  3OW2 A;  2CJM B;  1MHN A;  4RTX A;  2W0Z A;  3I55 A;  4J7F A;  4A4E A;  1N8R R;  1QWF A;  1A0N B;  4BI3 A;  3CCR A;  3OYE A;  3GTM S;  2DYB A;  1Q86 C;  4ANJ A;  4UN0 A;  4CC7 A;  1IGQ A;  1K9M C;  2VGM A;  3B57 A;  2L3R A;  2B9R A;  1X01 A;  2CGH A;  4BCM B;  4OR5 B;  2XK0 A;  3BLR B;  3ZFJ A;  1FVV B;  4PFO A;  3RGF B;  4M75 B;  4EOM B;  4ZGJ B;  2CP7 A;  2DL8 A;  1X43 A;  4BCI B;  1TSF A;  2RHX A;  1U06 A;  2W2H A;  3SB2 A;  1NJI R;  2KXC A;  2OAU A;  2FL7 A;  2W9F A;  5I2M A;  2DD4 B;  1BCM A;  2KRN A;  1X2Q A;  2HSP A;  3LLR A;  5FWC A;  2DBM A;  2C5N B;  1VQ9 Q;  5CQX A;  1WXT A;  2HBW A;  4FYX B;  1D0X A;  3UWN A;  3BHT B;  1RUW A;  4RTZ A;  1UJY A;  3FDR A;  4OMM A;  4C0F A;  1IXD A;  1H1S B;  2CRE A;  2QQ9 A;  4BCH B;  3OBY A;  1V1C A;  3A8G B;  2ZGW A;  2EBP A;  4BCG B;  1HD3 A;  1UHC A;  1JB0 E;  2W99 A;  1NEG A;  3FEO A;  1WA7 A;  1Z9Q A;  3QYE A;  7AT1 B;  3CCR T;  2K3X A;  4P5N A;  1UGQ B;  1ABO A;  4N0A C;  2LVM A;  4ELZ C;  4M7A C;  1EX4 A;  3J80 E;  3EG3 A;  2JM8 A;  1PRM C;  3L2W A;  4KH0 B;  1M8M A;  4ELL A;  1QKX A;  4ZTF A;  4M4Z A;  4HVW A;  1YJW A;  2XMF A;  2VUB A; 
#chains in the Genus database with same CATH homology
 1TH7 A;  4IUQ A;  3VV0 A;  2OTJ T;  3SDZ A;  4JRK A;  3OYJ A;  4HNU A;  4M75 F;  4M78 B;  2EQK A;  3MHX A;  3OS5 A;  4EPC A;  4OF1 A;  2DEQ A;  4DOW A;  3H4C A;  4Z02 A;  3RER A;  2D6F A;  3M57 A;  3OW2 S;  4M78 C;  2E65 A;  2QDY B;  2GF7 A;  3X24 B;  3JB9 D;  5C0M A;  4M7D F;  4KUI A;  4M77 F;  1QVG S;  3A8L B;  2QI2 A;  4MIM A;  2DJZ A;  2PUK B;  1S72 T;  4IUR A;  1I5L A;  3HRS A;  2ZPH B;  1GXI E;  2KSS A;  3H8Z A;  5D6Y A;  4XTY A;  4J6W A;  1YIJ A;  2FVU A;  2KAF A;  2QXF A;  3A8M B;  2LCC A;  4QSH A;  4XU2 A;  5FU6 B;  3V7R A;  1UEB A;  2Y90 A;  3LGL A;  4Y91 A;  1G3Y A;  4L5G A;  4X9D A;  5J3B A;  4C8Q D;  3LYI A;  5GAN 8;  5FU6 C;  3OYI A;  3GLX A;  1HK9 A;  1WJR A;  1QP2 A;  1QW1 A;  1Y96 A;  4GLK A;  1KG1 A;  4QVD A;  2HNI A;  5GAN 2;  4M75 A;  3CME A;  1VQP T;  2XD0 A;  2K57 A;  2G3R A;  2VXF A;  3CD6 A;  5LJ5 e;  3L2Q A;  5KH6 A;  3BG9 A;  2I2L A;  1YHQ T;  5GAM f;  1YI2 T;  2JTM A;  4PKC C;  4LDX A;  4OMF B;  3OYH A;  1KHI A;  2RJE A;  4JRI A;  4JUV A;  3V8K A;  4OVA A;  2K3Y A;  3GNF B;  3MET A;  3QDR B;  4XK8 E;  3PIP A;  3CC4 T;  4M7A E;  2F5K A;  2Y4Y A;  5DLQ E;  3KXT A;  5I21 A;  3MP6 A;  5GAN e;  1O9S A;  2CZ1 B;  2K5F A;  1FX7 A;  2R5M A;  2Y4X A;  2XDP A;  3E19 A;  3QJ6 A;  2DD4 A;  2QQR A;  2X4Y A;  3QYB A;  3HRT A;  5J39 A;  1VQ5 T;  1VQO A;  2CZ6 B;  3I56 A;  3CBP A;  4BE0 A;  2ZPF B;  1QP3 A;  1WJS A;  3RIR A;  3CCV A;  2PQW A;  4BI8 B;  2E6N A;  1M4Z A;  5GAN 6;  5GAM g;  5GAM h;  3JRZ A;  5GAO r;  1XTD A;  2RJD A;  5J26 A;  2L5Q A;  3HB9 A;  3LW5 E;  1G3T A;  1WGS A;  3M4G A;  2XID A;  4FIB A;  3TEE A;  3UDC A;  1W2B A;  1JBM A;  2MWP A;  2QQB A;  2YLB A;  4C8Q A;  3J81 E;  2ZCF B;  4ZGE B;  2JNG A;  3OQ5 A;  3V7C A;  4M78 E;  4M75 C;  5GMK e;  4M7D B;  2KDS A;  2L89 A;  4M77 B;  5CR2 A;  1VQK T;  2BS2 A;  3G4S A;  3O8V A;  3OS2 A;  3OY9 A;  1KD1 U;  4M7D C;  2D0Q B;  4MFE A;  4M77 C;  5LJ3 j;  2X4X A;  5A2Q E;  5EJC A;  2E1H A;  2H3J A;  4EDU A;  2P0K A;  2RM4 A;  4ZN3 A;  3CXC S;  1U8R A;  1JJ2 A;  3CCE A;  2RK2 A;  2O4X A;  2BUD A;  4N0A A;  3DB4 A;  4M7A A;  1YCY A;  4HLQ A;  3FLG A;  1M9S A;  1VQN A;  3RMS A;  2ZPB B;  5LJ3 d;  2LC4 A;  2DXB B;  1OZ3 A;  1W4S A;  4RG2 A;  3M4Y A;  3DLM A;  2EQM A;  1KQ2 A;  5CIU A;  2QQA A;  4RCB A;  1XOV A;  1Y07 A;  3OYN A;  2K4Y A;  1YIJ T;  5FLX E;  3M54 A;  5CCA A;  2IVW A;  3L42 A;  1JRI A;  2EIF A;  4XTV A;  3M59 A;  4IUU A;  3OYD A;  4AKI A;  1X75 C;  2P0Q A;  4DA4 A;  4EMK A;  3JB9 I;  4OGC A;  4JX5 A;  2LT4 A;  4J8O A;  1M1G A;  5L8R E;  4PJO G;  4B9X A;  2K5L A;  2DZ9 A;  4XU1 A;  5CKB A;  3OYB A;  3QZ9 B;  3JCM Q;  3HL8 A;  3CME T;  4J6Y A;  3CD6 T;  4C92 G;  2PVG B;  3E9G A;  3JCM J;  2BIV A;  4LDV A;  2ZPI B;  3C4S A;  4HNV A;  4BY6 B;  2LX9 A;  3S3O A;  4XU3 A;  4M78 A;  3X20 B;  5DM7 R;  2LRQ A;  4QW2 A;  4XTZ A;  2EJ9 A;  1YJ9 A;  1N8R C;  3VYG B;  3JCM b;  1K73 U;  2DIG A;  4FM4 B;  2XI9 A;  3Q1J A;  4L6V 5;  5GAM j;  3BG3 A;  1BKB A;  1LJO A;  2M0O A;  3CBO A;  3NFC A;  5HKC A;  3F70 A;  5GAN 4;  2QFZ A;  3VUZ A;  2E70 A;  1MGQ A;  3BDL A;  2DXT A;  2RHY A;  4OGE A;  1VQ7 A;  2QQS A;  1WQ7 A;  1VQO T;  3QWL A;  5KCH A;  3I56 T;  4BBS M;  3JB9 G;  3MEV A;  3CMA A;  2O01 E;  4HKE A;  3TCJ A;  5IN1 A;  1K8A C;  3CCV T;  3AHU A;  3QYH B;  1VQ8 A;  2E12 A;  4MMK A;  4E7J A;  3OYL A;  4M75 D;  4LOC A;  3V8J A;  3OYM A;  3DL1 A;  1X6O A;  3OYY A;  1D3B B;  1OI1 A;  3OMC A;  1Q81 C;  1VQ6 A;  3JCM d;  1YIT A;  2WSE E;  3EFS A;  4C0D C;  2JVV A;  4M77 E;  2R5A A;  3CCJ A;  4JS5 A;  4M7D E;  4E7K A;  3QO3 A;  5LJ3 f;  1VQK A;  3PT9 A;  3QZ5 B;  2KK4 A;  1FWZ A;  3OS1 A;  3H6Z A;  1LNX A;  1NPP A;  4DOV A;  3G4S T;  3JB9 J;  2RH2 A;  1NJI C;  5FU7 B;  3RKX A;  3C94 A;  3CC7 A;  3TW7 A;  3WVD B;  3FJP A;  3NTK A;  3OMG A;  3SWN B;  5FRM A;  4JS4 A;  1VQ4 T;  3CCE T;  5FU7 C;  3HHT B;  4PJO F;  3ZBD A;  3MEU A;  1VQ9 A;  2CZ0 B;  4LDU A;  5KE3 A;  3SWN C;  3QYG B;  3KUF A;  3LX7 A;  5CQY A;  2B8A A;  2E64 A;  4DQ2 A;  4NC6 A;  3OYG A;  1WNL A;  1N9R A;  5KCO A;  4V2S A;  1BI1 A;  1YJN A;  3VKG A;  4EMH A;  4C92 F;  4JJN K;  2RK1 A;  3C12 A;  4NL2 A;  4FT4 A;  4BAC A;  1BI0 A;  4MML A;  3PNW C;  1O75 A;  3VJP A;  2HD0 A;  5LJ3 g;  1Q7Y U;  5LJ3 h;  2XHC A;  2EKO A;  3S3M A;  3QG1 A;  4N4H A;  1M1K U;  1G5V A;  3PFS A;  4E7H A;  4PLL A;  3CC2 A;  2EQU A;  2FYK A;  3BG5 A;  2KQW A;  2OTL A;  4BBR M;  1RL2 A;  4XAX B;  1UGR B;  3GOX A;  4BDZ A;  3NTI A;  2ZPE B;  2WSF E;  3FIF A;  4F7U G;  1W2B S;  3VUB A;  4KUD K;  1B34 B;  4M7D A;  4M77 A;  4A4K A;  1VQ6 T;  2GFU A;  4IUV A;  1VQN T;  1YJ9 T;  3JB9 F;  1R8O B;  2JTF A;  5LJ3 e;  3A8H B;  3PGG A;  4M7A D;  3NTH A;  3X26 B;  3OSS C;  1LOJ A;  3RES A;  3M9Q A;  4FL6 A;  3QUI A;  5GAN 7;  1WPY A;  3HKS A;  4R56 A;  1QVP A;  2MI6 A;  3INZ A;  3VKH A;  1WQW A;  4JX6 A;  3V8L A;  1JJ2 S;  2DXB A;  3JCM f;  2X4J A;  3MCA B;  1VQ7 T;  3OYC A;  4B9W A;  4BUG A;  2LNV A;  2RD1 A;  3RKW A;  2DD5 B;  2R57 A;  3CMA T;  2KY9 A;  3ASK A;  4QVZ A;  5GAO p;  3CPW A;  1QVG A;  2LQK A;  3S6W A;  1VQ8 T;  3GNG A;  3HSB A;  2WJ9 A;  3DKM A;  2R58 A;  3M55 A;  4CI0 C;  2LT1 A;  4D6W A;  1Q86 U;  2VV5 A;  4HT9 A;  4RG8 A;  2EYQ A;  4M78 D;  2RO0 A;  2QDJ A;  4X34 A;  3G6E A;  1YIT T;  3JB9 H;  5DY9 A;  4A4H A;  3CCJ T;  2P4T A;  1K9M U;  2V8J A;  2RB6 A;  1PSE A;  3HFN A;  2BS3 A;  3JCM g;  3UPU A;  3JCM h;  3C95 A;  5CAI A;  4PJO B;  3WVE B;  3VYG A;  1U1T A;  2E41 A;  2AHJ B;  2YHT A;  5GAM e;  1VQ4 A;  3CC7 T;  4PJO C;  1Q82 U;  4C92 B;  3TU4 K;  1KD1 C;  4QVC A;  4AI6 A;  3PMT A;  1VQ9 T;  1PSF A;  4XTU A;  4ATO A;  2D9T A;  3MP8 A;  2L8D A;  3EFR A;  4XQ3 A;  2LCL A;  5IAY A;  4C92 C;  2ZZD B;  4J6X A;  4ZTJ A;  1I4K 1;  2X4W A;  1YJN T;  3VYH B;  3HZJ A;  2MAM A;  3E1S A;  4PL6 A;  1ZQ1 A;  4JLG A;  2RI2 A;  1KQS A;  2KMT A;  2MF2 A;  4VUB A;  1BI2 A;  4LD6 A;  2EFI A;  3L1A A;  1FKM A;  2QTX A;  1N6A A;  4C5I A;  3MP1 A;  2DAQ A;  3OB9 A;  5LJ5 d;  3L2R A;  3ZEH A;  3DB3 A;  1D3B A;  3CC2 T;  2OTL T;  4FSX A;  2ZPG B;  1G3W A;  1QLB A;  2WSC E;  4XU0 A;  3GPL A;  4GY5 A;  5C6S A;  1IRE B;  5M9O A;  2QQ8 A;  5GAN 3;  2GFA A;  3CPF A;  2LTO A;  3TRE A;  2RHZ A;  4A4G A;  4M75 G;  4BY6 C;  5KE2 A;  2MWO A;  1ZHI A;  5GAN d;  1KC8 C;  4J83 A;  4BE1 A;  2HBP A;  4TVR A;  3SWN A;  2WAC A;  1K73 C;  3JSC A;  4HA8 A;  5DLO A;  1VIF A;  3VKI A;  2EQJ A;  3VU3 C;  1NZ9 A;  5CKE A;  1Y71 A;  2FB7 A;  3MEW A;  3OSV A;  1M90 U;  1ZBX A;  2VXE A;  3BDU A;  4IUP A;  5HY6 A;  4BDY A;  3BFM A;  2F69 A;  4HT8 A;  3QXE B;  3SFM A;  1BIB A;  5GAN 5;  1N9S A;  2FHD A;  3FRN A;  3CEY A;  3E9F A;  4ZN1 A;  5HK0 A;  4MDX A;  5CO7 A;  2CKK A;  4KUL A;  3X28 B;  1VQM A;  3I55 T;  3CCM T;  4OB3 B;  3QJY A;  5CKH A;  4NOY A;  2YRV A;  3GP8 A;  2CS7 A;  2BKD N;  2RHI A;  4CRI A;  1KHC A;  5GAO n;  4M7D D;  4ELJ A;  1KQ1 A;  2JN0 A;  1EIF A;  4M77 D;  2X35 A;  3G6E T;  2M9U A;  1BI3 A;  1BIA A;  4X9C A;  5A0L A;  4R55 A;  2PVO B;  3OYA A;  1I81 A;  2DTO A;  4XTX A;  2QA4 A;  2C06 A;  4PJO E;  1B34 A;  2JOY A;  2PVD B;  3N5B B;  1K8A U;  4C8Q G;  4ZGD B;  4PLI A;  2XDB A;  2XKO C;  1NE8 A;  3CBM A;  3QPH A;  4C92 E;  4A53 A;  3PIO A;  4F7U B;  3QHS A;  3CCL A;  4Q5W A;  4C0Z A;  2DTH A;  5GMK m;  2XIC A;  3M58 A;  3ME9 A;  4WF2 A;  5LJ5 f;  4AKG A;  4MDW A;  2QEX A;  1UGS B;  4XTW A;  4N4G A;  5LL6 S;  3OYF A;  2BS4 A;  4EMG A;  2DZC A;  2LDM A;  5FRO A;  3BW1 A;  4C5H A;  4M7A G;  4BD3 A;  1NJI U;  2DD5 A;  3KHI A;  3L2Z A;  4HCC A;  3ER0 A;  2G77 A;  2RJC A;  5I2S A;  4J7I A;  2KR6 A;  3HFO A;  4MZP A;  1Q7Y C;  2P0P A;  1OZ2 A;  3V7S A;  2DPP B;  5GAN f;  3GF5 A;  4LDY A;  3CCQ T;  3CCU A;  1FXX A;  2DVE A;  2V8I A;  3CPW S;  2DXU A;  2F5T X;  5CKF A;  3JCM P;  2CZ7 B;  1M1K C;  3SD4 A;  1QVF A;  4II1 A;  4OB0 B;  1G3S A;  5LJ5 g;  2XU8 A;  5LJ5 h;  5GAO l;  4QQD A;  1I8F A;  2GQV A;  1VIE A;  2K5I A;  4A54 A;  3PTA A;  5IT9 E;  4O5V A;  1V29 B;  4PJO A;  4BI4 A;  2DXC B;  3MEA A;  5A0G A;  2E6Z A;  3G71 T;  3LH0 A;  4E7I A;  4LD9 K;  2DKG A;  3QSU A;  3OBW A;  3T9N A;  2M16 A;  4OP0 A;  5FRN A;  4C92 A;  4OB2 B;  4M78 G;  4HL4 A;  2E5Q A;  4C8Q E;  1BYM A;  2RHU A;  3CCS A;  1IZ6 A;  1Y7X A;  5GAN g;  5GAN h;  2ZZD A;  4ELY C;  2VYT A;  5A0D A;  4HNT A;  3P8H A;  3LWH A;  3EAE A;  4FT2 A;  2DK3 A;  3OW2 A;  2QF7 A;  2EJG A;  5CK9 A;  4BE2 A;  1AHJ B;  4C8Q F;  3OA6 A;  1MHN A;  3PMI A;  3M53 A;  3QBY A;  3I55 A;  3CCM A;  4J7F A;  4RKU E;  3L2V A;  1KQS S;  3S3N A;  4AKH A;  3G7Z A;  4FU6 A;  4JLI A;  4A4E A;  1VQM T;  4E47 A;  1U1S A;  3JCM X;  2RA2 A;  3P8D A;  4YTL A;  2RJF A;  4BI3 A;  2EJF A;  5GAO m;  3CCR A;  1M8V A;  3QKJ A;  3OYE A;  2NLU A;  3MO8 A;  3HP9 A;  4QQG A;  4C5G A;  2RI5 A;  1Q86 C;  2QA4 T;  5GMK h;  2PUO B;  4M7A F;  3J7A F;  4KBM B;  1DJ7 B;  4MZT A;  5GMK i;  2VGM A;  3HPW A;  4HCZ A;  1K9M C;  1NPR A;  2M1H A;  4RCC A;  4JDS A;  4F7U E;  2L3R A;  1X01 A;  2CGH A;  2VC8 A;  4ME7 A;  2XDD A;  2XK0 A;  4J5Y A;  4JRP A;  1Y96 B;  1E7P A;  1P92 A;  2JZ2 A;  2LQ8 A;  3ZFJ A;  3CCL T;  2MMP A;  3R6O A;  4N4I A;  1YJW T;  1Q82 C;  4F7U F;  4M75 B;  3TW6 A;  3FC3 A;  4ZGJ B;  4QQ6 A;  2OTJ A;  2QEX T;  3L2U A;  5LJ5 j;  3JCM e;  2RHX A;  4M6V A;  2E10 A;  2HQE A;  2PU9 B;  3RUX A;  3HO8 A;  3OS0 A;  3FB9 A;  2KVQ G;  3UT1 A;  3CCQ A;  2GCX A;  3SB2 A;  3P8B B;  4JX4 A;  1HXD A;  1VQL T;  2K2V A;  4M78 F;  5AYF A;  3RMQ A;  3CCU T;  2OAU A;  4Y28 E;  5D6X A;  5EG2 A;  2IG0 A;  4MFD A;  3RKY A;  1S72 A;  2FL7 A;  3A8O B;  2EAY A;  3KBG A;  5I2M A;  2DD4 B;  3WXM B;  4BB7 A;  5GAN j;  2RI3 A;  3LLR A;  1SSF A;  2HAX A;  1H3Z A;  2DO3 A;  5CQX A;  2YLC A;  1VUB A;  2EWN A;  3G71 A;  5GAO q;  3M5A A;  4JRQ A;  3UWN A;  1RI0 A;  4M7D G;  4F7U A;  3QII A;  4M77 G;  4IUT A;  4OB1 B;  5CVI A;  5CKD A;  1YBY A;  3FDR A;  2JUF A;  2V8K A;  4C0F A;  4LDW A;  4C8Q B;  3GIB A;  1N27 A;  3CCS T;  1VQP A;  4NL3 A;  2QQ9 A;  1UB4 A;  3OBY A;  3HBL A;  4C8Q C;  1N8R U;  3LWI A;  5GMK j;  3CXC A;  2XG8 D;  3A8G B;  2ZGW A;  1YHQ A;  1YI2 A;  1M90 C;  1XQH A;  2VGN A;  3LGF A;  2DTI A;  1JB0 E;  1M1F A;  4L59 A;  2HQX A;  4Z6Y A;  3M56 A;  3JCM c;  3FEO A;  4A4F A;  4HCB A;  3CC4 A;  3QYE A;  2O4X B;  4MZM A;  1KC8 U;  4UC4 A;  4M7A B;  5HK3 A;  4IKF A;  3CCR T;  3JCM V;  1UGP B;  3URG A;  1WJQ A;  2K3X A;  4P5N A;  1UGQ B;  2CYZ B;  4N0A C;  4PJO D;  2LVM A;  1M5Q 1;  4ELZ C;  1VQ5 A;  4M7A C;  5D6W A;  5GAM d;  3J80 E;  2A3L A;  3X25 B;  4PNO A;  1QVF S;  2DIQ A;  3JAM E;  4C92 D;  2A7Y A;  4NS5 A;  1OYX A;  3BY7 A;  2DXC A;  3L2W A;  4C0G A;  3DLL A;  4E7L A;  4KT0 E;  1Q81 U;  2KMG A;  4C5E A;  4ZTF A;  4EMK B;  1YJW A;  3A5Z B;  4M75 E;  4O6J A;  1VQL A;  4C0D B;  2VUB A;  5GMK l;  3OYK A;  1H64 1;  1XNI A;  4RMO A;  3JCM W;  4EMK C;  3HRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...