4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
1UGQB 2ZCFB 3VYGB 4OB2B 3A8OB 2DXBA 2DPPB 3HHTB 1IREB 1UGPB 2DD5B 2ZZDA 4ZGEB 1UGRB 3VYHB 2ZPFB 1PSFA 2ZPEB 2CZ1B 3QZ9B 3X20B 2ZZDB 2WSFE 2PUKB 2DXCA 4OB1B 4Y28E 2PVOB 4L6V5 3QZ5B 3WVDB 2DXCB 3QYHB 4XK8E 1GXIE 2CZ0B 2PVGB 3WVEB 1JB0E 4KT0E 2DXBB 2DD4A 4OB0B 1UGSB 1QP2A 2PU9B 2CZ7B 2ZPIB 3X26B 1DJ7B 4ZGJB 2WSEE 5L8RE 2QDYB 2PUOB 2ZPHB 3A8GB 4FM4B 3QYGB 2ZPGB 2CYZB 2D0QB 2WSCE 3X25B 3VYGA 2DD4B 2AHJB 3X28B 4ZGDB 4OB3B 1AHJB 2DD5A 2O01E 3A8LB 3LW5E 1QP3A 4RKUE 3A8MB 3QXEB 2CZ6B 2ZPBB 3X24B 1V29B 3A8HB 1PSEA 2PVDB
chains in the Genus database with same CATH superfamily
3OW2A 1RUWA 2BTTA 3QKJA 3LGFA 4DBFA 4OGCA 2EBPA 1M1KC 2R5AA 1OPLA 3RGFB 2K4YA 1P5EB 5GAN5 2YUOA 5CR2A 3BDUA 2LW4A 2K6DA 3PO3S 3QJYA 3SWNC 5I22A 2DD5B 2GQVA 4FW2A 5LJ3g 2DIGA 2KT8A 4ELYC 1PRMC 1GCPA 1AOJA 2ECZA 3CCRT 5IHIA 5FGKB 3E2UA 2WEVB 1MUZA 3M0PA 5LJ5d 2VXEA 3E9FA 4C8QE 3EGXA 3EFOA 4M77A 1WLPB 1GXIE 2XU8A 2KT1A 3WVEB 1GBQA 3LWIA 4JS4A 1M1KU 2QAZA 2VXFA 4BCQB 2VVKA 1UGSB 3NMZC 5I11A 5KYXB 4KUDK 5HBEB 1PRLC 1G3YA 2WHBB 3J7AF 3CC7T 3G6EQ 2KDSA 2D9TA 1MMAA 1FXXA 2CP6A 4M77G 4XAXB 5C6SA 4J6XA 1UG1A 3THKA 1UE9A 1WHMA 3QPHA 1VQPT 3EG1A 1NE8A 1OKWB 4JLIA 4EC9B 3DKMA 2R5MA 4FL6A 3HTRA 5LJ3d 4PNOA 2WSCE 3H8ZA 2EJFA 3VS1A 2LJ3A 1FX7A 1TU0B 3ER0A 1YBYA 4PFPA 1GH6B 4OMNA 1VQMT 2LQ8A 4DA4A 5GAOq 4AG2C 1AHJB 4E7SA 4EC8B 5C0MA 2JGZB 3DLLA 4PJLA 3MP1A 1K76A 3MEAA 4HVVA 1U8RA 2IVWA 4ZNXA 4F7UF 3BY7A 5CQYA 1TOVA 2CP3A 5FW9A 2CZ6B 4K11A 3MPUB 2ZPBB 1W6XA 2K5FA 1AD5A 3G4ST 2HSPA 1GBRA 1PG5B 1VQ8A 1G3SA 2P0KA 2FPFA 3N5BB 1OPKA 2R58A 2EGCA 4N4HA 4N0AA 5FWBA 1O9KA 3G4SQ 3I56T 5ECAA 1BKBA 3PFSA 4X34A 4PJOF 4LE9A 3OA6A 2A3LA 1YITT 2F1LA 4BCKB 4R0KA 1RAIB 3X20B 2M9UA 2DYIA 2WSFE 1E7OA 1HYOA 1LCKA 1X2KA 2RA2A 4GBQA 1SHFA 4RTUA 5GANf 4RTTA 2PVOB 3I56Q 3DL1A 4M75F 2K57A 2DXCB 3FEOA 4E7KA 1YITQ 5CKBA 3EGUA 2JXBA 4BBRM 2QDLA 1UHFA 5IT9E 2GBQA 1H92A 3NGPA 1M8VA 1XOVA 3EG9A 2NUTB 3D7SB 3H0FA 3UDCA 1VQ7A 2EVRA 2E41A 1M90C 5KYUB 2PK2A 3V7SA 2RK1A 4HCZA 2QDJA 4P5NA 2XG8D 9ATCB 5DLOA 4XTYA 3UT1A 4FX3B 3J81E 3OYBA 4FU6A 1MNEA 4QQDA 2DL7A 1W2BA 3TSZA 3S6WA 3FIFA 2EGEA 3L2UA 4OMFB 1KIKA 1VIFA 5A0DA 2PK9B 5HVYB 4QVDA 1ZBJA 1WHHA 4QVCA 1KSWA 1ZUYA 4C0DC 5HKCA 2XDPA 2EJ9A 4KUIA 2X35A 5IHYA 2MAMA 2QXFA 2BE9B 2DD5A 1VQ8Q 3DDPB 4HA8A 4CC2A 1GCQA 3A8MB 4BE0A 1RAEB 4IUPA 5GMKe 1WIEA 2E5QA 4MFDA 1M3CA 1IGQA 1BU1A 5IDPB 3EAEA 3L2QA 1WHJA 1Q7YR 4HL4A 1YJ9A 1VQLA 1X01A 3CCVT 2X4XA 1JSUB 1QVGP 2V22B 1OL1B 3H0HA 1J3TA 1M1KR 2LCLA 1Q82R 4C0ZA 2CT3A 1UJ0A 2DX1A 1PC0A 1IREB 3TEEA 4EOMB 2EUFA 1BYMA 4Z6YA 1WZOA 2HBWA 4M77E 3URGA 5KYXA 3TN8B 3S3OA 2MI6A 2K3BA 2XD0A 1P92A 2KI7A 2PHGA 2RB6A 4J9HA 3UA7A 1AWOA 5LJ3h 4II5B 1VQ7Q 1OZ2A 1SPKA 4Y28E 1ARKA 2VB6A 3LX7A 3UATA 3H6ZA 2E3HA 2JS0A 7AT1B 3UPUA 2AK5A 2LJ0A 4BY7X 3SWNB 4CFNB 2DXBB 3QHSA 4M7DF 4JJBA 1SSHA 4C5GA 1QP2A 3DB4A 1GRIA 4BI4A 4MZTA 4EMKC 5IH2A 1UB4A 3JCMc 4CI0C 5LQFB 1YNZA 4FYXB 5L8RE 2C5VB 4XQ3A 4ZN3A 3MI9B 2I40B 3CBOA 2DL5A 2FB7A 1RAFB 4DOVA 2DLPA 1N8RU 5FU6B 4PJOC 2KGTA 4BCOB 3FJ5A 1RABB 3VUZA 3OBWA 4NL2A 1B34B 1A0NB 4BE1A 3SB2A 5EC7A 2JVVA 5KYNA 1NEBA 2JM8A 3ZL7C 1QMCA 2PJQA 4M75C 2LTOA 1TUCA 1X6BA 4LDWA 2QGSA 3TCJA 1YJ9Q 2GCXA 3MEVA 1VQLQ 2J05A 1S1NA 4LXCA 3AT1B 3VKHA 3CPWS 4Y92A 2J6OA 2MYSA 1K1ZA 1YFNA 1IB8A 2ZAEA 3LH0A 3CC4T 1LJOA 1R0BG 4PL6A 1WDXA 2F2WA 4HKEA 1BI3A 1R0CB 2FL7A 1OX9A 3JCMe 4R55A 3RERA 4JJNK 4A63B 1D3UB 2DPPB 2CP7A 5GAOn 2K79A 2QA4T 1T3LA 2IIMA 2EJGA 3BLRB 2DMOA 4F7JB 4XU2A 3S3NA 2ZZDA 4BUGA 5LJ5f 1W2BS 2L3PA 4GLKA 1WJSA 1W98B 2HZYA 4ME7A 4PKCC 3QIIA 4D6WA 3OYMA 2RQTA 1JO8A 3MEUA 2O9VA 1RAHB 1VYUA 3HB9A 3G71A 3QZ5B 1QVGA 4BCPB 1OQKA 3CMAT 1HSQA 4E47A 4HNVA 4EDUA 2V26A 2DETA 2ENMA 3L2ZA 2BS2A 2EWNA 1PKSA 3OY9A 3CMAQ 1JQQA 2UUEB 2CUDA 1XJWB 4QVZA 3FJPA 5HK0A 3HL8A 1KC8U 4CC7A 4J9EA 5GMKi 1UDLA 1G3TA 4HLQA 2LX9A 2YWWA 3NDQA 1RLQC 1OZ3A 4YOOA 2EQKA 5GJVB 4FM4B 1VYWB 4NS5A 2CH4A 5I5ZB 2PTKA 1PCXA 1TSFA 1OI9B 1ZSGA 4M7AG 1BBZA 3CBMA 1T0HA 5GAN8 4F6SB 4ANJA 3DOGB 2O2OA 3EGDA 4XTXA 2DXUA 4M78G 2IW9B 3GF5A 4XU0A 3M59A 2LT1A 3A8LB 1YJWT 2V1RA 3TNHB 3OB9A 4EONB 2RI2A 2BZYA 1BIAA 1EX4A 2NLUA 5GAMj 1TD6A 2MPXC 3M0TA 5I2MA 4M7DC 2FVUA 1X75C 1UECA 1TFBA 2WIPB 3CXCP 2DERA 3QHRB 3CCSA 4LDVA 3CPFA 1YJWQ 5GAN3 3OW2P 5DLQE 1UGQB 3CMET 4IKFA 3G71T 2C0TA 2OTLA 2ESWA 1I0CA 3SWNA 1T0JA 2H3EB 4B9WA 3A8OB 2DXBA 2NUPA 1K9MC 1D1BA 3CCQA 2EIFA 1IHWA 2C06A 2E65A 4PLLA 4D8KA 1ZLMA 1ZA1B 3OSVA 2XI9A 3PIPA 1H25B 5CIUA 3G71Q 1PHTA 4MZMA 1OU8A 2YLCA 2RHYA 3QZ9B 2G6FX 3OS5A 3I55A 1QVFS 4RTZA 2Y4YA 5D6XA 4JRIA 4PK4A 1RAAB 4NL3A 3A5ZB 1NJIC 2O88A 2L2PA 4LDXA 2F5KA 1C1AA 2OX7A 1Y7XA 1BB9A 2RJCA 3OYEA 1N8RR 2QI2A 1VYTA 3CEYA 3L2RA 5AYFA 1M30A 1KXUA 4E2FB 5GMKj 2QF7A 4J9FA 5KH6A 5I21A 2RK2A 1B34A 4JJCA 1KHIA 3OYKA 1Y96B 2RQUA 3ASKA 1K9MU 5KE3A 4YOSA 4BCHB 3OYAA 2FYKA 4EOIB 1FINB 1Q81U 2HKNA 4EOSB 2W0ZA 1FMKA 1C0MA 2LQWA 2X4WA 3GP8A 1YWPA 2JMCA 2QEXT 1VQ6T 1NZ9A 3QWLA 3NTHA 1YJNT 2DL3A 3SEMA 1OULA 4AKIA 2ZPHB 3BFMA 1VQ4T 4N4IA 4XTZA 3INZA 2L3SA 3PVLA 1KG1A 2W96A 2E10A 4JX4A 3P8DA 2QEXQ 2A36A 1K0XA 1YJNQ 5LMKB 3JAME 3PIOA 4EMKB 3CCRA 2DXTA 5CEIB 1FYNA 5GMKl 1JEGA 4Y91A 1VQ4Q 5KYYB 5FRNA 4IUQA 1E6GA 3JB9D 4ZTJA 4EMHA 3IQLA 4AT1B 3PTAA 3UA6A 3A98A 3X24B 1Y0MA 3T9NA 2HSEB 2LP5A 2OTLQ 1H1RB 2CP5A 2D0NA 4PJOB 2EYZA 2A37A 4JPBW 4E6RA 2HL3A 1FWZA 4CFUD 6AT1B 2P0QA 3CC7A 2WPAB 4J8OA 2RHUA 4M75B 2RF0A 1U3OA 2LT4A 1M9SA 1B07A 4MFEA 5J3BA 1VQPA 1ZA2B 4MDXA 4F6UB 2EQIA 2QGGA 5CYIB 4ZGEB 1PSFA 1H641 1M8MA 3KXTA 2UZEB 1Y71A 3UF4A 1Q86R 4KRDB 2O4XA 1KC8R 3HP9A 4E7ZA 4J83A 5KYWA 4M7AE 1VQMA 4BBSM 4EOQB 1BU2A 1I4K1 3CPWP 2CCIB 1VOLA 5LJ3e 2OAWA 2LQKA 4Y72B 3M55A 3FRNA 4M78E 5HBHB 2YDLA 2ROTA 4BCFB 5CO7A 3G4SA 5GANj 3OYGA 1F1BB 2I2LA 1T3SA 3LWHA 1W2BP 4G6LB 1MNDA 3FDRA 4ROEA 3CD6T 2ED0A 2EQJA 2KEAA 3REBB 3MY1B 1QKXA 5I2SA 2ZGWA 3CCRQ 1AWJA 1X43A 2COYA 1WXUA 3VKIA 2ABLA 1UEBA 5FU6C 3I56A 1UNHD 1YITA 2F2XA 3QO3A 1SKUB 3CD6Q 2DBMA 5AT1B 1KHCA 3FLGA 2DJQA 1SF9A 3X28B 3K7AM 4J5YA 2RD1A 4DBQA 2X51A 3HBLA 4C5HA 4LDYA 3G7ZA 1WQWA 5GAN6 1EFNA 3CC7Q 1M2OA 1PD1A 4PFZA 4OP0A 2DVJA 2LQNA 4C92F 1KQSS 5IAYA 1OL2B 2RMOA 2KXDA 2PVDB 3CC2T 1VQPQ 3VYGB 2C5NB 1M3AA 5IHKA 3EG2A 4C0FA 2E4HA 3M9QA 3VUBA 4KH0B 3BLQB 5CCAA 3Q1JA 1K9MR 1Y96A 3CC2Q 4PJOD 3PMIA 2L89A 3BHVB 1GL5A 1VQMQ 4M7DB 2ZPEB 1D0ZA 3HRTA 1Q81R 1LPLA 3H4CA 1N9RA 2V1QA 3NTIA 2QGFB 5D7UA 4M75D 4TTHA 1ZSZC 3OYJA 4CFVB 4QQ6A 1RI9A 5DY9A 4F7UA 3AHUA 1X27A 1VYVA 2RJEA 3CCJT 4JRQA 4LUEA 1WGSA 1JXOA 2CDTA 3VS3A 2M51A 4EMKA 2M0YA 1QCNA 2P4TA 4AFUC 1O75A 1WQ7A 2YRDA 1H3ZA 4QT7A 3CCJQ 1X6GA 4F7UG 2KR6A 3CCVA 3JCMf 5FROA 2CJMB 2B86A 4F17A 3CPWA 2LC4A 3KBGA 3GTMS 4FCYA 1M27C 5J26A 4PJOA 1QVFP 3O5ZA 3A8GB 4KRTA 1TWBA 1UTIA 3EH1A 3OBYA 2ROLA 4FIBA 2CH4W 1IO6A 2DEQA 5J39A 4YOZA 2NUZA 4F70B 1CKAA 4M75A 4E7LA 4J6YA 3G33B 2HCKA 2JJ9A 2HQXA 2O01E 3O0GD 1OEBA 1QP3A 2MOXA 4BCQD 2FPDA 4NC6A 1WFWA 2MMPA 2W10A 3EFRA 4ATOA 1I5LA 2KK4A 4J7FA 1N6AA 5HCKA 4J6WA 1ENWA 2ZPGB 2P0PA 2RPNA 5GAMg 1YHQT 1IZ6A 4F14A 1M90U 1AT1B 2IPOB 4X9CA 2YHTA 2WFYB 2LVMA 4IIOA 3DB3A 2RQVA 2B8AA 2W99A 2DIQA 4HVUA 1YHQQ 2VGNA 4RG8A 2LZ6B 1MMNA 4RTXA 4EOOB 1I1JA 3JV3A 3CCET 2L8DA 2XICA 2XK0A 3VS2A 8ATCB 3C0CA 4FW1A 4L6V5 5KE2A 1NLPC 4XU1A 4HNUA 3QYBA 3CCEQ 2W9ZA 4JX5A 1QCOA 4YC3B 3ZEHA 4M7DD 1OKVB 5LJ5j 2L3RA 2B9RA 1D3BB 2KQWA 3CCVQ 3HFNA 4A4HA 4C0GA 4AFSC 4WTOB 4C92C 2QFZA 2A7YA 4JS5A 3M5AA 3CC4A 2ZPIB 5GAMd 4E7JA 2C5OB 2WMBB 2XKOC 2IVXA 3JSCA 2H3JA 1WNLA 2PUOB 1XQHA 4R56A 1NBEB 1YN8A 2QA4A 2OTJA 2PZ1A 1EZZB 2EQMA 3RBBB 1Q95G 3TW7A 3P8BB 3VYGA 1XO2A 4AFQC 1X2QA 3VKGA 2G3RA 2WACA 4F7SB 1K4US 4CFWB 3RDVA 1VQ9T 2GTJA 4JZ4A 2BKZB 1WHGA 3L2WA 3CMAA 2BPMB 4M7DA 1BCOA 1MGQA 4B9XA 1QVFA 3VS4A 1YWOA 2KXCA 2BE7D 4LN2A 3EJ1B 4A4FA 2YSQA 4RUGA 4F6WB 1AZEA 4NSTB 4EMGA 3U23A 1GUXB 1NYGA 4OMQA 4CRLB 4Z02A 2KRNA 2M0OA 2NYSA 3EG0A 2UZDB 4Z88A 4IUTA 4M7DG 3GIBA 1R77A 1QW1A 4KRCB 3RUXA 4IURA 4UC4A 4LD9K 5A0LA 4X1VA 2DL4A 3JB9J 4F7UE 2AT1B 4A4KA 3HFOA 4KULA 1H3HA 4F7LB 4QKUA 4BY1X 2CZ1B 2K9GA 3ULRB 3LGLA 1KQ2A 1M1GA 2DXCA 1RAGB 4ELLA 2EPDA 2K5IA 3E19A 1OI1A 2YUQA 3E1SA 4Q5WA 4OR5B 2M16A 1UUEA 2NUTA 4JX6A 3BG9A 1MMGA 5KYUA 1YJWA 4V2SA 2OTJT 3CC4Q 1G5VA 2DBKA 1U1SA 1K8AC 1UFFA 3VS5A 1TG0A 4RODA 1VQOT 1YIJT 3M58A 2LX7A 2QA4Q 4E7IA 2OTJQ 1TS9A 4O5VA 2MWPA 3CQTA 3CMEA 2DK3A 4UN0A 1ZSZB 1B3QA 2HD0A 4M75E 2ATCB 3MIAB 1YCYA 2YLBA 4F04B 1WXBA 2BZ8A 3OQ5A 4BD3A 4EORB 3OS1A 1QVPA 1M90R 2VYTA 1H4LD 4ZN1A 3I5RA 1VQNT 3M0SA 4M7AF 1ZUUA 1YP5A 1YCSB 2AZSA 2QG9B 2R7GA 2Z0WA 3JB9H 4EOJB 2X3WD 4QW2A 3R6NA 1OIUB 4MIMA 1OIYB 1G3WA 3REAB 1K8AU 4PJJA 4DQ2A 2FZCB 3QDFA 1M1FA 4RCCA 3MHXA 5CKEA 5LJ3f 2BIVA 2A28A 4M78F 1VQNQ 3QWXX 2CS7A 1QWFA 4KBMB 1ZQ1A 1VQ5T 2CGHA 2EFIA 2FO0A 1V29B 4LUDA 1PD0A 2KE9A 3EOCB 2RQWA 3JCMQ 4TVRA 2DA9A 4C8QF 2JUFA 3HSBA 1E7PA 1BCMA 3VV0A 3C95A 2BUDA 4BCNB 4EIKA 3EHQA 5GAMh 1AD6A 1D3BA 2KMGA 2QEXA 1VQ6A 3HZJA 1YJNA 5GAOl 2CP2A 2L5QA 3MP6A 5ICPB 4RTYA 1WI7A 1VQ4A 1UGRB 4ROCA 3M0UA 3E9GA 3C94A 1FMWA 4KGVB 2DILA 2K2MA 8AT1B 4HCBA 3BLHB 2HQEA 2GQIA 1NLOC 3RMSA 3JCMX 1IGUA 2PVGB 4PLIA 3SFMA 1G83A 3EFOB 3EGXB 2HNIA 3CMEQ 2LRQA 4I3ZB 5GMKm 4DBHA 1BK2A 2JT4A 2QQBA 4X9DA 2HMAA 1IXDA 3TNWB 1VA7A 4OMPA 4LDUA 2F2CA 2KR3A 4CC4B 1NEGA 5GMKh 4OGEA 1W70A 1ABQA 1PWTA 2V8KA 1AEYA 1X6OA 1WA7A 2DTHA 2LJ1A 3PVQA 2KSSA 1ZBXA 2JS2A 2LCCA 1KQSA 1WPYA 2WIHB 2XDBA 1PKDB 3KUFA 1KD1C 4M7DE 2GGRA 4BDYA 2DKGA 1GUXA 2F5TX 2DTOA 2FRWA 2X4YA 4C92B 2F69A 2WXVB 4J9BA 2IG0A 3JCMV 4J7IA 2NWMA 2LNVA 2VGMA 3H41A 4HT8A 3MP8A 4HCCA 1HXDA 1NJIU 4KH1B 2H8HA 3CCLT 5HQ0B 4EPCA 3SHWA 3META 3PMTA 2G77A 5CK9A 1VQ6Q 2X9HA 2QQ8A 2LDMA 2XHCA 1U06A 3NTKA 1G2BA 3CCLQ 1K73C 1KD1U 1FKMA 2D6FA 3QUIA 3QSUA 2G9XB 1U1TA 2X1NB 3LYIA 4FSSA 3HHTB 1O9KB 3CD6A 1H24B 1UGPB 3NPFA 3CCUT 3P8HA 2RHXA 2DL8A 3VYHB 2JNGA 3V8JA 1G8XA 2KNBB 3MO8A 1B7TA 1ZSZA 1JJ2S 2V8IA 1OOTA 4M7AC 2RHZA 1OX8A 2QQRA 3CCUQ 1JSTB 2VASA 2QASA 1ACMB 3PGGA 3R6OA 3QDRB 3CCMT 2CP0A 4A54A 2YXYA 4HNTA 4M78C 2CT4A 2SEMA 1K73U 1D09B 2JOYA 3VS6A 1NPRA 2DFUA 2J7IA 2YT6A 3CCMQ 2PU9B 5D6WA 1K8AR 5CKFA 1FMVA 3HRSA 3CC2A 2OJ2A 4C8QC 1H8KA 1G3NC 4MMKA 4WCIA 2RI5A 2MIOA 1CSKA 1C6VX 2DMEA 2E70A 2EKHA 1Q7YC 3QG1A 3M57A 5GANh 1H1SB 2JMAA 1NM7A 4A4EA 2DD4B 3PNWC 3M4GA 2PMIB 2C0IA 4ZGDB 1Q82C 3JB9G 3M53A 2BKDN 4BI3A 1JOWA 2RI3A 4JRKA 4M77F 2V8JA 1H26B 3OYYA 3VS0A 3CCJA 3BG3A 2KMTA 3QXEB 3BW1A 3OMCA 3JCMJ 1S72A 4C92D 4F7NB 3G1JA 2KAFA 1ZHIA 5GAN7 2JN0A 1Q7YU 2CREA 2ZCFB 4LOCA 2JTMA 3RKYA 1NG2A 1H1QB 2E1HA 2D8JA 3L2VA 1RL2A 3NHNA 3QJ6A 2DM1A 2VV5A 1IRXA 3G6ET 1Q82U 3JCMW 4EOKB 1I81A 2K5LA 2KYBA 1JU5C 2RNAA 4OMOA 2ZPFB 2HDAA 4BB7A 2YUPA 3ME9A 4ZTFA 2I53A 1OU9A 3HKSA 4YTLA 4FT2A 5FRMA 4OMMA 4OB1B 4BCGB 2EYYA 1TUGB 3WVDB 1D1CA 2LMJA 3TW6A 3FB9A 3M56A 4XK8E 3PE0A 4BACA 2WMAB 2Y90A 5L23A 1K9AA 3ZBDA 4JLGA 3RKXA 3VJPA 4C92A 1VQKT 3EH2A 4IUUA 5ACBA 1D0YA 3WXMB 3LQ5B 2HAXA 2BZXA 3OS0A 2IW6B 2X4JA 2DRKA 5CAIA 2EQUA 3SDZA 1TTHB 5GAOp 2CZ7B 3MKDA 2DJZA 5L2WB 1I8FA 1DJ7B 2CSQA 1YHQA 1VQKQ 2LCSA 2UZBB 1Y57A 2Y4XA 1NJIR 3OSSC 4OVAA 4A4GA 2GNCA 4C92G 5IHNA 4J9GA 3BHTB 1JKWA 4CFMB 3V8LA 1S72T 2EKOA 4AI6A 5EG2A 1KD1R 4J9DA 5KYYA 1OV3A 2A08A 2OI3A 3CCEA 2DNUA 5GAN2 1Z9QA 3MY5B 2QK0A 1S72Q 4BCIB 2DE0X 1LNXA 4DOWA 1W4SA 2C5XB 1ZX6A 5FU7C 4JRPA 4HCKA 1PNJA 2FRYA 2JTFA 2JM9A 3GLXA 4FYVB 3A1PA 4ELZC 1KFZA 1MV0B 4VUBA 5EFQB 1K73R 2F2VA 1HD3A 2FZGB 2MWOA 4Z8AA 2E64A 2XDDA 4PJOG 2EGAA 3JCMP 4GY5A 3DJBA 3BG5A 1I07A 4B6MA 2YRVA 1IHVA 3GBQA 1SG5A 5LL6S 1ZP2A 1AZGB 5GAMe 2VWFA 2ZZDB 2O31A 4M75G 4MMLA 1TUDA 4MZPA 2W2HA 2QQ9A 2C6TB 2KVQG 3C12A 3CXCS 3H0IA 1EIFA 3V8KA 1VQ9A 1RI0A 3OW2S 3ZFJA 3M4YA 3SD4A 1TH7A 1K0SA 1M2VB 2DF6A 2HKQB 4DBRA 4M77C 4HVWA 4KT0E 2ED1A 2K7AA 2DD4A 3VS7A 2KRMA 2RH2A 4CFXB 3OYDA 1VQ8T 4KGXB 4L59A 5GJWB 3POMA 1X69A 3RR6A 1WXTA 1GFDA 2P4RA 4AKGA 2HBPA 4M7AB 4L5GA 2X3XD 3VU3C 2RN8A 1FVVB 1V1CA 2HL5C 1QKWA 5LJ5h 2J6KA 1SRLA 2E12A 3GPLA 4CXAB 4BY6C 3JB9I 4M78B 1JJ2P 1WJRA 1QLBA 4FYYB 1F5QB 2DTIA 1RACB 2MF2A 2VKNA 3F5XB 3CBPA 2D0QB 1KJWA 4AKHA 2AHJB 1QCFA 1O9SA 1M4ZA 2UZLB 2E5KA 2YUNA 5GAOr 4C8QB 3OYFA 5HK3A 1AVZC 3EGDB 2AZVA 4F16A 4RKUE 1VQ7T 1VINA 3HO8A 2AIRB 5GAN4 1QQJA 2QQSA 3TVTA 4HT9A 5IF1B 1AWXA 1E6HA 4O6JA 1QLYA 2RQRA 1WHLA 1VQOA 1W1FA 1YIJA 4RG2A 2MCNA 3OYLA 1MHNA 1N8RC 1SHGA 5LJ3j 2KY9A 4BXXX 4PJNA 2CCHB 3OYIA 4N0AC 4WF2A 4N4GA 1XNIA 1QMZB 2NUPB 1N4MA 2FHDA 4E7HA 3GOXA 3RESA 1VQ9Q 1LVKA 4XTUA 1ZUKA 4C92E 2K3XA 3TQ7P 3OS2A 4J9IA 1VQNA 1QWEA 1LOJA 1OGUB 1HJDA 1VOMA 1C9BA 1KQ1A 5IXFA 2HQHA 5CQXA 1I5OB 1N5ZA 1M3BA 1VUBA 1R8OB 4DEYA 3M03A 1AISB 3I5SA 1YJ9T 1VQ5A 2QTVA 1MV3A 1VQLT 4FT4A 1SRMA 1UNLD 1N27A 4C5EA 2DO3A 1H1PB 5M9OA 2DZCA 3X26B 2L3QA 2WSEE 2FPEA 1KK7A 1KQSP 2C0OA 4BI8B 3LLRA 2K2VA 2GF7A 5D6YA 2CYZB 2FG0A 4PJOE 4M7AD 3QWYA 5GANe 3EIDB 3V7RA 5GAOm 3KHIA 1H28B 2XIDA 3RIRA 2P84A 4AG1C 4IIMA 4DEXA 4XU3A 3QBYA 4M78D 3LW5E 4EOLB 2J06A 3EG3A 2DAQA 3BE3A 5GANg 1BI0A 1YIJQ 1VQOQ 3JCMg 2K3YA 3OYHA 1Q86C 1JJ2A 1GCQC 2O9SA 1D1AA 1KC8C 4ELJA 1VIEA 1E9HB 4RCBA 2A0FB 1UGVA 3A8HB 1PSEA 5DM7R 4FSXA 4C8QD 1SSFA 1XTDA 4BE2A 2DRMA 1PM3A 2M02A 4BCMB 1M2VA 3UWNA 2CUBA 2C4GB 3H9NA 5FU7B 1U5SA 3HRUA 5HY6A 3BHUB 2YRCA 2FEIA 4OMLA 4ESRA 4RMOA 3DTOA 3EFSA 2L0AA 5A0GA 4M7AA 4JZ3A 2DEUA 1CKBA 3O8VA 5IXBA 2DZ9A 2PUKB 1AWWA 5HBJB 2DVEA 2AKKA 2XMFA 4RTVA 4RTWA 1Q86U 2O4XB 4HXJA 2BS3A 2CSIA 4XTVA 3RKWA 3QYHB 2GTOA 3FC3A 4M78A 1VQ5Q 3TSWA 5KYWB 2IW8B 1D0XA 4NOYA 2E6NA 3VRYA 5GANd 2JTEA 3JCMd 2CKKA 3CCLA 2RJFA 4C5IA 4JUVA 5KCOA 4JJDA 1BI1A 4C8QA 4J9CA 4MDWA 3JRZA 3GNFB 1OYXA 1RADB 3NFCA 4CFUB 2KBTA 2R57A 2WJ9A 2GFAA 2PNIA 3B57A 2QDYB 2BS4A 1BI2A 4JDSA 5CVIA 2EW3A 4M77B 2KYMA 2QYZA 2VC8A 3I9QA 5CKHA 3CCUA 2QTXA 1TXQA 3L1AA 4C8QG 1H27B 3X25B 4ORZA 4C0DB 1URCB 5EJCA 1YI2A 1GFCA 2AKLA 3F70A 2RO0A 3RMQA 3QYEA 1N9SA 3M54A 4LD6A 3CCMA 4BDZA 4AFZC 4BY6B 1Q81C 1BIBA 5FWCA 4PFOA 2E6ZA 4A53A 5IN1A 4M6VA 1WHKA 4M4ZA 1ABOA 3DLMA 1Y07A 3MCAB 3MJXA 5A2QE 3J80E 2DYBA 1V76A 4OF1A 2MK5A 2LNHB 4CRIA 3HPWA 4OB2B 4Z89A 3TREA 3PT9A 2FZKB 4QQGA 4QSHA 2M1HA 2RHIA 1PKTA 1Z9ZA 1RLPC 4AMCA 2EAYA 1JBMA 3LH5A 3TNIB 4BCJB 5CKDA 5DQVA 4BCMD 2E3IA 3M0RA 5KCHA 2RM4A 4IMYB 2D8HA 2EYQA 3L42A 2KRSA 2CZ0B 3OMGA 4D8DA 3JCMb 4CC3A 2HEQA 4KGZB 4F7UB 5IDNB 4IUVA 1JB0E 5BNJB 2W9FA 2EYXA 2EYWA 4OB0B 3KFVA 1WJQA 1UNGD 3CCST 2RJDA 3I35A 1YI2T 2SRCA 4BCND 2OTLT 2D1XA 2I0NA 2GFUA 2JW4A 3M0QA 4ZGJB 3C4SA 3CCSQ 3CCQT 3BDLA 1M5Q1 3OYNA 2COWA 3MEWA 1QVGS 1YI2Q 3G6EA 1WX6A 2VUBA 3V7CA 2COZA 5LJ5e 1JXMA 5GAMf 3S3MA 3QYGB 3EG9B 4OGRB 3I55T 3RNJA 3CCQQ 4FYWB 3TU4K 2J6FA 4II1A 3QHWB 2OAUA 2IN3A 1JRIA 5LJ5g 4XTWA 2JZ2A 4OB3B 1UHCA 4PJMA 3I55Q 1SEMA 4M77D 4GLMA 3DDQB 1HK9A 3OYCA 3JB9F 5FLXE 4EOPB 1MMDA 1NYFA 2QQAA 3GNGA 5HNBB 3VRZA 2PQWA 3EHRA 1NPPA 1VQKA 4LNPA 1GY3B 3JCMh 1UJYA 3CXCA 1WYXA 2KROA 5DQWA
chains in the Genus database with same CATH topology
3OW2A 4EMGA 3QKJA 5DLQE 1UGQB 3CMET 4IKFA 3LGFA 4OGCA 4Z02A 3G71T 2M0OA 4VUBA 1M1KC 2R5AA 2OTLA 2K4YA 3SWNA 4IUTA 4B9WA 5GAN5 3GIBA 4M7DG 3A8OB 2MWOA 1QW1A 2DXBA 2E64A 3BDUA 4PJOG 3RUXA 5CR2A 2EIFA 2XDDA 3CCQA 3QJYA 1K9MC 2E65A 4IURA 4GY5A 4PLLA 3BG5A 4UC4A 3SWNC 3JCMP 4LD9K 2DD5B 5A0LA 3JB9J 4F7UE 2YRVA 2GQVA 5LL6S 3HFOA 3OSVA 4A4KA 2XI9A 4KULA 5GAMe 5CIUA 3PIPA 5LJ3g 4MZMA 2DIGA 2YLCA 2CZ1B 2C06A 2RHYA 4ELYC 3QZ9B 3OS5A 2ZZDB 3I55A 1QVFS 4M75G 3LGLA 4MMLA 3CCRT 2Y4YA 5D6XA 1KQ2A 1M1GA 2DXCA 4JRIA 4MZPA 4NL3A 2QQ9A 2KVQG 3A5ZB 3C12A 1NJIC 2K5IA 3E19A 3CXCS 1OI1A 3E1SA 4Q5WA 5LJ5d 2VXEA 1EIFA 4LDXA 3E9FA 2F5KA 4C8QE 2M16A 4R56A 3V8KA 1VQ9A 1RI0A 1Y7XA 3OW2S 4M77A 4JX6A 3ZFJA 2RJCA 3OYEA 1GXIE 2XU8A 3BG9A 2QI2A 3M4YA 1TH7A 3CEYA 3SD4A 3WVEB 5AYFA 5GMKj 3L2RA 1YJWA 4V2SA 4M77C 3LWIA 2OTJT 4JS4A 1G5VA 1M1KU 4KT0E 2VXFA 2DD4A 2QF7A 5KH6A 5I21A 2RK2A 1B34A 2RH2A 1U1SA 1UGSB 1KHIA 3OYDA 3OYKA 1VQ8T 1K8AC 1Y96B 4L59A 3ASKA 1K9MU 4KUDK 5KE3A 1VQOT 1YIJT 3OYAA 1G3YA 3J7AF 3M58A 2FYKA 3CC7T 4AKGA 2HBPA 4E7IA 1Q81U 2KDSA 4M7AB 4O5VA 2D9TA 2MWPA 1FXXA 4L5GA 3CMEA 4M77G 2DK3A 4XAXB 3VU3C 5C6SA 4J6XA 2X4WA 3GP8A 2HD0A 4M75E 5LJ5h 2QEXT 1VQ6T 1NZ9A 3QWLA 3NTHA 1YJNT 1YCYA 2E12A 2YLBA 3GPLA 3QPHA 1VQPT 4AKIA 2ZPHB 4BY6C 1NE8A 3BFMA 4M78B 3JB9I 1VQ4T 4N4IA 1WJRA 4JLIA 1QLBA 2DTIA 4XTZA 3OQ5A 2MF2A 3INZA 3DKMA 2R5MA 4FL6A 5LJ3d 4BD3A 3CBPA 4PNOA 2D0QB 2E10A 3OS1A 4JX4A 1QVPA 4AKHA 2WSCE 3H8ZA 2EJFA 3P8DA 2VYTA 4ZN1A 2AHJB 1VQNT 1O9SA 1FX7A 1M4ZA 3JAME 3ER0A 1YBYA 4EMKB 3PIOA 2DXTA 5GMKl 3CCRA 4M7AF 4Y91A 1VQMT 2LQ8A 4DA4A 5FRNA 5GAOq 1AHJB 5GAOr 4QW2A 4C8QB 3OYFA 3JB9H 1G3WA 4MIMA 5HK3A 1K8AU 5C0MA 3DLLA 4DQ2A 3MP1A 1M1FA 4IUQA 3MHXA 4RCCA 5CKEA 5LJ3f 3MEAA 2BIVA 3JB9D 1U8RA 2IVWA 4ZTJA 4RKUE 4EMHA 1VQ7T 4F7UF 4M78F 3BY7A 5CQYA 3HO8A 2CS7A 3PTAA 2CZ6B 5GAN4 2K5FA 2ZPBB 3X24B 3T9NA 4KBMB 2QQSA 1ZQ1A 1VQ5T 4HT9A 2CGHA 2EFIA 3G4ST 4PJOB 1V29B 4O6JA 1VQ8A 1G3SA 2P0KA 3JCMQ 3N5BB 1VQOA 1FWZA 4TVRA 1YIJA 2P0QA 4RG2A 2R58A 3OYLA 3CC7A 4C8QF 2JUFA 3HSBA 1E7PA 4N4HA 4J8OA 1MHNA 4N0AA 2RHUA 3C95A 3VV0A 1N8RC 2BUDA 5LJ3j 4M75B 2KY9A 5GAMh 2LT4A 1D3BA 1M9SA 2KMGA 3OYIA 4N0AC 2QEXA 1VQ6A 4WF2A 4N4GA 3HZJA 4MFEA 1XNIA 5J3BA 5GAOl 1YJNA 2L5QA 3MP6A 1VQPA 4MDXA 3I56T 2FHDA 4E7HA 1BKBA 3PFSA 4X34A 1VQ4A 4ZGEB 1UGRB 4PJOF 3OA6A 3GOXA 1PSFA 1H641 2A3LA 1YITT 3KXTA 3RESA 1Y71A 3E9GA 3X20B 4XTUA 2M9UA 2WSFE 2O4XA 4C92E 2K3XA 3HP9A 2RA2A 3C94A 3OS2A 1VQNA 4J83A 5GANf 2PVOB 1LOJA 3DL1A 2HQEA 4HCBA 4M7AE 4M75F 2K57A 1VQMA 2DXCB 3FEOA 4BBSM 3RMSA 4E7KA 1I4K1 5CKBA 3JCMX 5LJ3e 4BBRM 5IT9E 1KQ1A 2PVGB 4PLIA 3SFMA 1M8VA 5CQXA 1XOVA 2LQKA 1VQ7A 3M55A 3UDCA 2HNIA 2E41A 3FRNA 1VUBA 4M78E 2LRQA 1M90C 1R8OB 5GMKm 3V7SA 1YJ9T 1VQ5A 2RK1A 4HCZA 5CO7A 2QQBA 3G4SA 2QDJA 4X9DA 1VQLT 4FT4A 4P5NA 5GANj 1N27A 4C5EA 2DO3A 2XG8D 5DLOA 4XTYA 3UT1A 4LDUA 5M9OA 3OYGA 2DZCA 3X26B 2I2LA 3J81E 3OYBA 5GMKh 4FU6A 4OGEA 4QQDA 3LWHA 1W2BA 2WSEE 3FDRA 2V8KA 1X6OA 3S6WA 3FIFA 3CD6T 3L2UA 2EQJA 4OMFB 2DTHA 2KSSA 5I2SA 1ZBXA 2ZGWA 2LCCA 1KQSA 1WPYA 4BI8B 1VIFA 2XDBA 3LLRA 2K2VA 5A0DA 2GF7A 3KUFA 3VKIA 5D6YA 1UEBA 5FU6C 3I56A 1KD1C 4M7DE 4QVDA 4BDYA 2CYZB 2DKGA 2F5TX 4QVCA 1YITA 4PJOE 3QO3A 2DTOA 4M7AD 2X4YA 4C0DC 4C92B 5HKCA 2F69A 1KHCA 3FLGA 2XDPA 2EJ9A 4KUIA 3X28B 5GANe 2IG0A 3JCMV 4J7IA 3V7RA 2X35A 3KHIA 2XIDA 2MAMA 4J5YA 3RIRA 2QXFA 5GAOm 2RD1A 3HBLA 2DD5A 4XU3A 4C5HA 2LNVA 2VGMA 4HT8A 3QBYA 4M78D 4LDYA 4HA8A 3LW5E 3G7ZA 1WQWA 5GAN6 3A8MB 2DAQA 3MP8A 1YHQT 1KG1A 5GANg 1BI0A 4BE0A 4HCCA 1HXDA 3JCMg 4IUPA 2K3YA 3OYHA 1NJIU 3CCLT 1Q86C 1JJ2A 5GMKe 2E5QA 4EPCA 4MFDA 4ELJA 3META 1KC8C 1VIEA 3PMTA 2G77A 4OP0A 5CK9A 3EAEA 4RCBA 4C92F 3L2QA 3A8HB 1PSEA 5DM7R 1KQSS 4HL4A 1YJ9A 5IAYA 2PVDB 4FSXA 1VQLA 2QQ8A 1X01A 2LDMA 2XHCA 4C8QD 3CC2T 1SSFA 3NTKA 3CCVT 1XTDA 2X4XA 4BE2A 1K73C 3VYGB 1FKMA 1KD1U 2D6FA 3QUIA 3QSUA 3UWNA 4C0FA 1U1TA 2LCLA 3LYIA 4C0ZA 3M9QA 3VUBA 5FU7B 3HHTB 1IREB 3TEEA 5CCAA 1UGPB 3HRUA 3CD6A 3Q1JA 1Y96A 1BYMA 4Z6YA 3CCUT 3PMIA 3P8HA 5HY6A 2L89A 4M77E 3URGA 4PJOD 3S3OA 2MI6A 2RHXA 4RMOA 3VYHB 2JNGA 3V8JA 4M7DB 2ZPEB 2XD0A 1P92A 3HRTA 3EFSA 3MO8A 5A0GA 4M7AA 2RB6A 1JJ2S 3H4CA 1N9RA 2DZ9A 3O8VA 2PUKB 5LJ3h 2DVEA 2V8IA 1OZ2A 3NTIA 4Y28E 1Q86U 4M7AC 2RHZA 4M75D 2O4XB 2QQRA 2BS3A 3LX7A 3H6ZA 4XTVA 3RKWA 3OYJA 4QQ6A 5DY9A 3QYHB 3PGGA 4F7UA 3FC3A 4M78A 3UPUA 3AHUA 3R6OA 3QDRB 3CCMT 4A54A 2RJEA 3CCJT 4NOYA 4JRQA 3SWNB 4HNTA 1WGSA 2E6NA 4M78C 5GANd 1K73U 2JOYA 2DXBB 3QHSA 3JCMd 4M7DF 2CKKA 3CCLA 4C5GA 2RJFA 4C5IA 1NPRA 1QP2A 4JUVA 3DB4A 4EMKA 5KCOA 2P4TA 1O75A 1WQ7A 4BI4A 4MZTA 1H3ZA 1BI1A 2PU9B 5D6WA 4C8QA 5CKFA 4EMKC 4MDWA 3JRZA 3GNFB 3HRSA 1OYXA 4F7UG 3CC2A 3NFCA 2KR6A 3CCVA 4C8QC 1UB4A 3JCMf 3JCMc 4CI0C 2R57A 4MMKA 5FROA 2RI5A 2WJ9A 2GFAA 2LC4A 3CPWA 5L8RE 3KBGA 4XQ3A 4ZN3A 2QDYB 2BS4A 1BI2A 5J26A 3CBOA 4PJOA 4JDSA 5CVIA 3A8GB 2E70A 4M77B 2FB7A 2VC8A 5CKHA 1Q7YC 3QG1A 4DOVA 3M57A 3CCUA 2QTXA 5FU6B 3OBYA 5GANh 1N8RU 4FIBA 4PJOC 2DEQA 3L1AA 4C8QG 5J39A 3X25B 4A4EA 3VUZA 3OBWA 2DD4B 3PNWC 4NL2A 4C0DB 3M4GA 1B34B 4BE1A 3SB2A 4M75A 5EJCA 4E7LA 4ZGDB 4J6YA 1YI2A 2JVVA 1Q82C 3F70A 3JB9G 4M75C 2LTOA 3M53A 2BKDN 2HQXA 2O01E 3QYEA 1N9SA 2RO0A 4LDWA 3RMQA 3TCJA 3M54A 4BI3A 4LD6A 2GCXA 1QP3A 3MEVA 2RI3A 4JRKA 3CCMA 4BDZA 4M77F 2V8JA 4NC6A 2MMPA 3OYYA 3CCJA 3BG3A 4BY6B 1BIBA 3QXEB 2KMTA 3EFRA 3BW1A 1Q81C 4ATOA 3VKHA 2E6ZA 3CPWS 1I5LA 4A53A 3OMCA 5IN1A 3JCMJ 4C92D 1S72A 4M6VA 2KK4A 3DLMA 4J7FA 1N6AA 1Y07A 3MCAB 4J6WA 2KAFA 3LH0A 1ZHIA 2ZPGB 5GAN7 3CC4T 1LJOA 2P0PA 5A2QE 2JN0A 4PL6A 5GAMg 3J80E 1Q7YU 4HKEA 1BI3A 2ZCFB 4OF1A 1IZ6A 4LOCA 2FL7A 2JTMA 3RKYA 3JCMe 4R55A 1M90U 4CRIA 2E1HA 3RERA 3HPWA 4OB2B 3L2VA 4JJNK 1RL2A 4X9CA 2YHTA 3PT9A 2DPPB 2LVMA 3TREA 3QJ6A 5GAOn 2VV5A 3G6ET 2QA4T 3DB3A 4QQGA 2B8AA 2EJGA 4QSHA 2DIQA 2M1HA 1I81A 2K5LA 2RHIA 4XU2A 3JCMW 1Q82U 2VGNA 2ZZDA 4RG8A 4BUGA 3S3NA 5LJ5f 1W2BS 2ZPFB 2EAYA 1JBMA 4BB7A 3ME9A 4GLKA 4ZTFA 1WJSA 4ME7A 5CKDA 4PKCC 3HKSA 3QIIA 4D6WA 2L8DA 4YTLA 2XICA 3OYMA 4FT2A 2XK0A 3CCET 5FRMA 4OB1B 3MEUA 3HB9A 4L6V5 3G71A 5KCHA 3QZ5B 1QVGA 3WVDB 5KE2A 2RM4A 3TW6A 3FB9A 3M56A 4XK8E 3CMAT 2EYQA 4E47A 4XU1A 3L42A 4HNUA 4HNVA 4BACA 2CZ0B 3OMGA 3QYBA 4EDUA 3JCMb 2Y90A 4JX5A 4F7UB 4M7DD 3ZEHA 4IUVA 1JB0E 5LJ5j 2L3RA 3ZBDA 1D3BB 2KQWA 3L2ZA 4JLGA 4OB0B 3RKXA 3VJPA 1WJQA 4C92A 2BS2A 1VQKT 3HFNA 4IUUA 4A4HA 2EWNA 3WXMB 3CCST 4C0GA 3OY9A 2HAXA 3OS0A 4C92C 2QFZA 2A7YA 2X4JA 4JS5A 3M5AA 5CAIA 2RJDA 2EQUA 1YI2T 4QVZA 3SDZA 5GAOp 3CC4A 2CZ7B 2DJZA 3FJPA 5HK0A 2OTLT 2ZPIB 3HL8A 5GAMd 1I8FA 1DJ7B 4E7JA 1YHQA 1KC8U 2GFUA 4ZGJB 3C4SA 2Y4XA 5GMKi 2XKOC 3CCQT 1G3TA 3BDLA 1M5Q1 3JSCA 3OYNA 2H3JA 4HLQA 1WNLA 2LX9A 1XQHA 2PUOB 3OSSC 4OVAA 1OZ3A 3MEWA 4A4GA 4C92G 2EQKA 1QVGS 3G6EA 2VUBA 2QA4A 2OTJA 4FM4B 4NS5A 3V7CA 3V8LA 2EQMA 5LJ5e 1S72T 5GAMf 4M7AG 2EKOA 3S3MA 3QYGB 3CBMA 4AI6A 5EG2A 3I55T 5GAN8 3TW7A 3P8BB 3VYGA 3TU4K 3VKGA 2OAUA 4II1A 3CCEA 2G3RA 1JRIA 2WACA 4XTXA 5LJ5g 4XTWA 2JZ2A 5GAN2 4OB3B 2DXUA 4M78G 1VQ9T 3GF5A 4XU0A 1LNXA 2LT1A 3M59A 1W4SA 4DOWA 3A8LB 3L2WA 5FU7C 4M77D 3CMAA 4JRPA 1YJWT 4M7DA 1HK9A 3OYCA 3JB9F 5FLXE 1MGQA 2JTFA 3OB9A 2QQAA 2RI2A 4B9XA 1BIAA 2NLUA 3GNGA 5GAMj 1QVFA 2PQWA 5I2MA 4M7DC 1NPPA 2FVUA 1VQKA 1X75C 3GLXA 4A4FA 3JCMh 3CXCA 3CCSA 4LDVA 3CPFA 4ELZC 5GAN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGQ B;  2ZCF B;  3VYG B;  4OB2 B;  3A8O B;  2DXB A;  2DPP B;  3HHT B;  1IRE B;  1UGP B;  2DD5 B;  2ZZD A;  4ZGE B;  1UGR B;  3VYH B;  2ZPF B;  1PSF A;  2ZPE B;  2CZ1 B;  3QZ9 B;  3X20 B;  2ZZD B;  2WSF E;  2PUK B;  2DXC A;  4OB1 B;  4Y28 E;  2PVO B;  4L6V 5;  3QZ5 B;  3WVD B;  2DXC B;  3QYH B;  4XK8 E;  1GXI E;  2CZ0 B;  2PVG B;  3WVE B;  1JB0 E;  4KT0 E;  2DXB B;  2DD4 A;  4OB0 B;  1UGS B;  1QP2 A;  2PU9 B;  2CZ7 B;  2ZPI B;  3X26 B;  1DJ7 B;  4ZGJ B;  2WSE E;  5L8R E;  2QDY B;  2PUO B;  2ZPH B;  3A8G B;  4FM4 B;  3QYG B;  2ZPG B;  2CYZ B;  2D0Q B;  2WSC E;  3X25 B;  3VYG A;  2DD4 B;  2AHJ B;  3X28 B;  4ZGD B;  4OB3 B;  1AHJ B;  2DD5 A;  2O01 E;  3A8L B;  3LW5 E;  1QP3 A;  4RKU E;  3A8M B;  3QXE B;  2CZ6 B;  2ZPB B;  3X24 B;  1V29 B;  3A8H B;  1PSE A;  2PVD B; 
#chains in the Genus database with same CATH topology
 3OW2 A;  1RUW A;  2BTT A;  3QKJ A;  3LGF A;  4DBF A;  4OGC A;  2EBP A;  1M1K C;  2R5A A;  1OPL A;  3RGF B;  2K4Y A;  1P5E B;  5GAN 5;  2YUO A;  5CR2 A;  3BDU A;  2LW4 A;  2K6D A;  3PO3 S;  3QJY A;  3SWN C;  5I22 A;  2DD5 B;  2GQV A;  4FW2 A;  5LJ3 g;  2DIG A;  2KT8 A;  4ELY C;  1PRM C;  1GCP A;  1AOJ A;  2ECZ A;  3CCR T;  5IHI A;  5FGK B;  3E2U A;  2WEV B;  1MUZ A;  3M0P A;  5LJ5 d;  2VXE A;  3E9F A;  4C8Q E;  3EGX A;  3EFO A;  4M77 A;  1WLP B;  1GXI E;  2XU8 A;  2KT1 A;  3WVE B;  1GBQ A;  3LWI A;  4JS4 A;  1M1K U;  2QAZ A;  2VXF A;  4BCQ B;  2VVK A;  1UGS B;  3NMZ C;  5I11 A;  5KYX B;  4KUD K;  5HBE B;  1PRL C;  1G3Y A;  2WHB B;  3J7A F;  3CC7 T;  3G6E Q;  2KDS A;  2D9T A;  1MMA A;  1FXX A;  2CP6 A;  4M77 G;  4XAX B;  5C6S A;  4J6X A;  1UG1 A;  3THK A;  1UE9 A;  1WHM A;  3QPH A;  1VQP T;  3EG1 A;  1NE8 A;  1OKW B;  4JLI A;  4EC9 B;  3DKM A;  2R5M A;  4FL6 A;  3HTR A;  5LJ3 d;  4PNO A;  2WSC E;  3H8Z A;  2EJF A;  3VS1 A;  2LJ3 A;  1FX7 A;  1TU0 B;  3ER0 A;  1YBY A;  4PFP A;  1GH6 B;  4OMN A;  1VQM T;  2LQ8 A;  4DA4 A;  5GAO q;  4AG2 C;  1AHJ B;  4E7S A;  4EC8 B;  5C0M A;  2JGZ B;  3DLL A;  4PJL A;  3MP1 A;  1K76 A;  3MEA A;  4HVV A;  1U8R A;  2IVW A;  4ZNX A;  4F7U F;  3BY7 A;  5CQY A;  1TOV A;  2CP3 A;  5FW9 A;  2CZ6 B;  4K11 A;  3MPU B;  2ZPB B;  1W6X A;  2K5F A;  1AD5 A;  3G4S T;  2HSP A;  1GBR A;  1PG5 B;  1VQ8 A;  1G3S A;  2P0K A;  2FPF A;  3N5B B;  1OPK A;  2R58 A;  2EGC A;  4N4H A;  4N0A A;  5FWB A;  1O9K A;  3G4S Q;  3I56 T;  5ECA A;  1BKB A;  3PFS A;  4X34 A;  4PJO F;  4LE9 A;  3OA6 A;  2A3L A;  1YIT T;  2F1L A;  4BCK B;  4R0K A;  1RAI B;  3X20 B;  2M9U A;  2DYI A;  2WSF E;  1E7O A;  1HYO A;  1LCK A;  1X2K A;  2RA2 A;  4GBQ A;  1SHF A;  4RTU A;  5GAN f;  4RTT A;  2PVO B;  3I56 Q;  3DL1 A;  4M75 F;  2K57 A;  2DXC B;  3FEO A;  4E7K A;  1YIT Q;  5CKB A;  3EGU A;  2JXB A;  4BBR M;  2QDL A;  1UHF A;  5IT9 E;  2GBQ A;  1H92 A;  3NGP A;  1M8V A;  1XOV A;  3EG9 A;  2NUT B;  3D7S B;  3H0F A;  3UDC A;  1VQ7 A;  2EVR A;  2E41 A;  1M90 C;  5KYU B;  2PK2 A;  3V7S A;  2RK1 A;  4HCZ A;  2QDJ A;  4P5N A;  2XG8 D;  9ATC B;  5DLO A;  4XTY A;  3UT1 A;  4FX3 B;  3J81 E;  3OYB A;  4FU6 A;  1MNE A;  4QQD A;  2DL7 A;  1W2B A;  3TSZ A;  3S6W A;  3FIF A;  2EGE A;  3L2U A;  4OMF B;  1KIK A;  1VIF A;  5A0D A;  2PK9 B;  5HVY B;  4QVD A;  1ZBJ A;  1WHH A;  4QVC A;  1KSW A;  1ZUY A;  4C0D C;  5HKC A;  2XDP A;  2EJ9 A;  4KUI A;  2X35 A;  5IHY A;  2MAM A;  2QXF A;  2BE9 B;  2DD5 A;  1VQ8 Q;  3DDP B;  4HA8 A;  4CC2 A;  1GCQ A;  3A8M B;  4BE0 A;  1RAE B;  4IUP A;  5GMK e;  1WIE A;  2E5Q A;  4MFD A;  1M3C A;  1IGQ A;  1BU1 A;  5IDP B;  3EAE A;  3L2Q A;  1WHJ A;  1Q7Y R;  4HL4 A;  1YJ9 A;  1VQL A;  1X01 A;  3CCV T;  2X4X A;  1JSU B;  1QVG P;  2V22 B;  1OL1 B;  3H0H A;  1J3T A;  1M1K R;  2LCL A;  1Q82 R;  4C0Z A;  2CT3 A;  1UJ0 A;  2DX1 A;  1PC0 A;  1IRE B;  3TEE A;  4EOM B;  2EUF A;  1BYM A;  4Z6Y A;  1WZO A;  2HBW A;  4M77 E;  3URG A;  5KYX A;  3TN8 B;  3S3O A;  2MI6 A;  2K3B A;  2XD0 A;  1P92 A;  2KI7 A;  2PHG A;  2RB6 A;  4J9H A;  3UA7 A;  1AWO A;  5LJ3 h;  4II5 B;  1VQ7 Q;  1OZ2 A;  1SPK A;  4Y28 E;  1ARK A;  2VB6 A;  3LX7 A;  3UAT A;  3H6Z A;  2E3H A;  2JS0 A;  7AT1 B;  3UPU A;  2AK5 A;  2LJ0 A;  4BY7 X;  3SWN B;  4CFN B;  2DXB B;  3QHS A;  4M7D F;  4JJB A;  1SSH A;  4C5G A;  1QP2 A;  3DB4 A;  1GRI A;  4BI4 A;  4MZT A;  4EMK C;  5IH2 A;  1UB4 A;  3JCM c;  4CI0 C;  5LQF B;  1YNZ A;  4FYX B;  5L8R E;  2C5V B;  4XQ3 A;  4ZN3 A;  3MI9 B;  2I40 B;  3CBO A;  2DL5 A;  2FB7 A;  1RAF B;  4DOV A;  2DLP A;  1N8R U;  5FU6 B;  4PJO C;  2KGT A;  4BCO B;  3FJ5 A;  1RAB B;  3VUZ A;  3OBW A;  4NL2 A;  1B34 B;  1A0N B;  4BE1 A;  3SB2 A;  5EC7 A;  2JVV A;  5KYN A;  1NEB A;  2JM8 A;  3ZL7 C;  1QMC A;  2PJQ A;  4M75 C;  2LTO A;  1TUC A;  1X6B A;  4LDW A;  2QGS A;  3TCJ A;  1YJ9 Q;  2GCX A;  3MEV A;  1VQL Q;  2J05 A;  1S1N A;  4LXC A;  3AT1 B;  3VKH A;  3CPW S;  4Y92 A;  2J6O A;  2MYS A;  1K1Z A;  1YFN A;  1IB8 A;  2ZAE A;  3LH0 A;  3CC4 T;  1LJO A;  1R0B G;  4PL6 A;  1WDX A;  2F2W A;  4HKE A;  1BI3 A;  1R0C B;  2FL7 A;  1OX9 A;  3JCM e;  4R55 A;  3RER A;  4JJN K;  4A63 B;  1D3U B;  2DPP B;  2CP7 A;  5GAO n;  2K79 A;  2QA4 T;  1T3L A;  2IIM A;  2EJG A;  3BLR B;  2DMO A;  4F7J B;  4XU2 A;  3S3N A;  2ZZD A;  4BUG A;  5LJ5 f;  1W2B S;  2L3P A;  4GLK A;  1WJS A;  1W98 B;  2HZY A;  4ME7 A;  4PKC C;  3QII A;  4D6W A;  3OYM A;  2RQT A;  1JO8 A;  3MEU A;  2O9V A;  1RAH B;  1VYU A;  3HB9 A;  3G71 A;  3QZ5 B;  1QVG A;  4BCP B;  1OQK A;  3CMA T;  1HSQ A;  4E47 A;  4HNV A;  4EDU A;  2V26 A;  2DET A;  2ENM A;  3L2Z A;  2BS2 A;  2EWN A;  1PKS A;  3OY9 A;  3CMA Q;  1JQQ A;  2UUE B;  2CUD A;  1XJW B;  4QVZ A;  3FJP A;  5HK0 A;  3HL8 A;  1KC8 U;  4CC7 A;  4J9E A;  5GMK i;  1UDL A;  1G3T A;  4HLQ A;  2LX9 A;  2YWW A;  3NDQ A;  1RLQ C;  1OZ3 A;  4YOO A;  2EQK A;  5GJV B;  4FM4 B;  1VYW B;  4NS5 A;  2CH4 A;  5I5Z B;  2PTK A;  1PCX A;  1TSF A;  1OI9 B;  1ZSG A;  4M7A G;  1BBZ A;  3CBM A;  1T0H A;  5GAN 8;  4F6S B;  4ANJ A;  3DOG B;  2O2O A;  3EGD A;  4XTX A;  2DXU A;  4M78 G;  2IW9 B;  3GF5 A;  4XU0 A;  3M59 A;  2LT1 A;  3A8L B;  1YJW T;  2V1R A;  3TNH B;  3OB9 A;  4EON B;  2RI2 A;  2BZY A;  1BIA A;  1EX4 A;  2NLU A;  5GAM j;  1TD6 A;  2MPX C;  3M0T A;  5I2M A;  4M7D C;  2FVU A;  1X75 C;  1UEC A;  1TFB A;  2WIP B;  3CXC P;  2DER A;  3QHR B;  3CCS A;  4LDV A;  3CPF A;  1YJW Q;  5GAN 3;  3OW2 P;  5DLQ E;  1UGQ B;  3CME T;  4IKF A;  3G71 T;  2C0T A;  2OTL A;  2ESW A;  1I0C A;  3SWN A;  1T0J A;  2H3E B;  4B9W A;  3A8O B;  2DXB A;  2NUP A;  1K9M C;  1D1B A;  3CCQ A;  2EIF A;  1IHW A;  2C06 A;  2E65 A;  4PLL A;  4D8K A;  1ZLM A;  1ZA1 B;  3OSV A;  2XI9 A;  3PIP A;  1H25 B;  5CIU A;  3G71 Q;  1PHT A;  4MZM A;  1OU8 A;  2YLC A;  2RHY A;  3QZ9 B;  2G6F X;  3OS5 A;  3I55 A;  1QVF S;  4RTZ A;  2Y4Y A;  5D6X A;  4JRI A;  4PK4 A;  1RAA B;  4NL3 A;  3A5Z B;  1NJI C;  2O88 A;  2L2P A;  4LDX A;  2F5K A;  1C1A A;  2OX7 A;  1Y7X A;  1BB9 A;  2RJC A;  3OYE A;  1N8R R;  2QI2 A;  1VYT A;  3CEY A;  3L2R A;  5AYF A;  1M30 A;  1KXU A;  4E2F B;  5GMK j;  2QF7 A;  4J9F A;  5KH6 A;  5I21 A;  2RK2 A;  1B34 A;  4JJC A;  1KHI A;  3OYK A;  1Y96 B;  2RQU A;  3ASK A;  1K9M U;  5KE3 A;  4YOS A;  4BCH B;  3OYA A;  2FYK A;  4EOI B;  1FIN B;  1Q81 U;  2HKN A;  4EOS B;  2W0Z A;  1FMK A;  1C0M A;  2LQW A;  2X4W A;  3GP8 A;  1YWP A;  2JMC A;  2QEX T;  1VQ6 T;  1NZ9 A;  3QWL A;  3NTH A;  1YJN T;  2DL3 A;  3SEM A;  1OUL A;  4AKI A;  2ZPH B;  3BFM A;  1VQ4 T;  4N4I A;  4XTZ A;  3INZ A;  2L3S A;  3PVL A;  1KG1 A;  2W96 A;  2E10 A;  4JX4 A;  3P8D A;  2QEX Q;  2A36 A;  1K0X A;  1YJN Q;  5LMK B;  3JAM E;  3PIO A;  4EMK B;  3CCR A;  2DXT A;  5CEI B;  1FYN A;  5GMK l;  1JEG A;  4Y91 A;  1VQ4 Q;  5KYY B;  5FRN A;  4IUQ A;  1E6G A;  3JB9 D;  4ZTJ A;  4EMH A;  3IQL A;  4AT1 B;  3PTA A;  3UA6 A;  3A98 A;  3X24 B;  1Y0M A;  3T9N A;  2HSE B;  2LP5 A;  2OTL Q;  1H1R B;  2CP5 A;  2D0N A;  4PJO B;  2EYZ A;  2A37 A;  4JPB W;  4E6R A;  2HL3 A;  1FWZ A;  4CFU D;  6AT1 B;  2P0Q A;  3CC7 A;  2WPA B;  4J8O A;  2RHU A;  4M75 B;  2RF0 A;  1U3O A;  2LT4 A;  1M9S A;  1B07 A;  4MFE A;  5J3B A;  1VQP A;  1ZA2 B;  4MDX A;  4F6U B;  2EQI A;  2QGG A;  5CYI B;  4ZGE B;  1PSF A;  1H64 1;  1M8M A;  3KXT A;  2UZE B;  1Y71 A;  3UF4 A;  1Q86 R;  4KRD B;  2O4X A;  1KC8 R;  3HP9 A;  4E7Z A;  4J83 A;  5KYW A;  4M7A E;  1VQM A;  4BBS M;  4EOQ B;  1BU2 A;  1I4K 1;  3CPW P;  2CCI B;  1VOL A;  5LJ3 e;  2OAW A;  2LQK A;  4Y72 B;  3M55 A;  3FRN A;  4M78 E;  5HBH B;  2YDL A;  2ROT A;  4BCF B;  5CO7 A;  3G4S A;  5GAN j;  3OYG A;  1F1B B;  2I2L A;  1T3S A;  3LWH A;  1W2B P;  4G6L B;  1MND A;  3FDR A;  4ROE A;  3CD6 T;  2ED0 A;  2EQJ A;  2KEA A;  3REB B;  3MY1 B;  1QKX A;  5I2S A;  2ZGW A;  3CCR Q;  1AWJ A;  1X43 A;  2COY A;  1WXU A;  3VKI A;  2ABL A;  1UEB A;  5FU6 C;  3I56 A;  1UNH D;  1YIT A;  2F2X A;  3QO3 A;  1SKU B;  3CD6 Q;  2DBM A;  5AT1 B;  1KHC A;  3FLG A;  2DJQ A;  1SF9 A;  3X28 B;  3K7A M;  4J5Y A;  2RD1 A;  4DBQ A;  2X51 A;  3HBL A;  4C5H A;  4LDY A;  3G7Z A;  1WQW A;  5GAN 6;  1EFN A;  3CC7 Q;  1M2O A;  1PD1 A;  4PFZ A;  4OP0 A;  2DVJ A;  2LQN A;  4C92 F;  1KQS S;  5IAY A;  1OL2 B;  2RMO A;  2KXD A;  2PVD B;  3CC2 T;  1VQP Q;  3VYG B;  2C5N B;  1M3A A;  5IHK A;  3EG2 A;  4C0F A;  2E4H A;  3M9Q A;  3VUB A;  4KH0 B;  3BLQ B;  5CCA A;  3Q1J A;  1K9M R;  1Y96 A;  3CC2 Q;  4PJO D;  3PMI A;  2L89 A;  3BHV B;  1GL5 A;  1VQM Q;  4M7D B;  2ZPE B;  1D0Z A;  3HRT A;  1Q81 R;  1LPL A;  3H4C A;  1N9R A;  2V1Q A;  3NTI A;  2QGF B;  5D7U A;  4M75 D;  4TTH A;  1ZSZ C;  3OYJ A;  4CFV B;  4QQ6 A;  1RI9 A;  5DY9 A;  4F7U A;  3AHU A;  1X27 A;  1VYV A;  2RJE A;  3CCJ T;  4JRQ A;  4LUE A;  1WGS A;  1JXO A;  2CDT A;  3VS3 A;  2M51 A;  4EMK A;  2M0Y A;  1QCN A;  2P4T A;  4AFU C;  1O75 A;  1WQ7 A;  2YRD A;  1H3Z A;  4QT7 A;  3CCJ Q;  1X6G A;  4F7U G;  2KR6 A;  3CCV A;  3JCM f;  5FRO A;  2CJM B;  2B86 A;  4F17 A;  3CPW A;  2LC4 A;  3KBG A;  3GTM S;  4FCY A;  1M27 C;  5J26 A;  4PJO A;  1QVF P;  3O5Z A;  3A8G B;  4KRT A;  1TWB A;  1UTI A;  3EH1 A;  3OBY A;  2ROL A;  4FIB A;  2CH4 W;  1IO6 A;  2DEQ A;  5J39 A;  4YOZ A;  2NUZ A;  4F70 B;  1CKA A;  4M75 A;  4E7L A;  4J6Y A;  3G33 B;  2HCK A;  2JJ9 A;  2HQX A;  2O01 E;  3O0G D;  1OEB A;  1QP3 A;  2MOX A;  4BCQ D;  2FPD A;  4NC6 A;  1WFW A;  2MMP A;  2W10 A;  3EFR A;  4ATO A;  1I5L A;  2KK4 A;  4J7F A;  1N6A A;  5HCK A;  4J6W A;  1ENW A;  2ZPG B;  2P0P A;  2RPN A;  5GAM g;  1YHQ T;  1IZ6 A;  4F14 A;  1M90 U;  1AT1 B;  2IPO B;  4X9C A;  2YHT A;  2WFY B;  2LVM A;  4IIO A;  3DB3 A;  2RQV A;  2B8A A;  2W99 A;  2DIQ A;  4HVU A;  1YHQ Q;  2VGN A;  4RG8 A;  2LZ6 B;  1MMN A;  4RTX A;  4EOO B;  1I1J A;  3JV3 A;  3CCE T;  2L8D A;  2XIC A;  2XK0 A;  3VS2 A;  8ATC B;  3C0C A;  4FW1 A;  4L6V 5;  5KE2 A;  1NLP C;  4XU1 A;  4HNU A;  3QYB A;  3CCE Q;  2W9Z A;  4JX5 A;  1QCO A;  4YC3 B;  3ZEH A;  4M7D D;  1OKV B;  5LJ5 j;  2L3R A;  2B9R A;  1D3B B;  2KQW A;  3CCV Q;  3HFN A;  4A4H A;  4C0G A;  4AFS C;  4WTO B;  4C92 C;  2QFZ A;  2A7Y A;  4JS5 A;  3M5A A;  3CC4 A;  2ZPI B;  5GAM d;  4E7J A;  2C5O B;  2WMB B;  2XKO C;  2IVX A;  3JSC A;  2H3J A;  1WNL A;  2PUO B;  1XQH A;  4R56 A;  1NBE B;  1YN8 A;  2QA4 A;  2OTJ A;  2PZ1 A;  1EZZ B;  2EQM A;  3RBB B;  1Q95 G;  3TW7 A;  3P8B B;  3VYG A;  1XO2 A;  4AFQ C;  1X2Q A;  3VKG A;  2G3R A;  2WAC A;  4F7S B;  1K4U S;  4CFW B;  3RDV A;  1VQ9 T;  2GTJ A;  4JZ4 A;  2BKZ B;  1WHG A;  3L2W A;  3CMA A;  2BPM B;  4M7D A;  1BCO A;  1MGQ A;  4B9X A;  1QVF A;  3VS4 A;  1YWO A;  2KXC A;  2BE7 D;  4LN2 A;  3EJ1 B;  4A4F A;  2YSQ A;  4RUG A;  4F6W B;  1AZE A;  4NST B;  4EMG A;  3U23 A;  1GUX B;  1NYG A;  4OMQ A;  4CRL B;  4Z02 A;  2KRN A;  2M0O A;  2NYS A;  3EG0 A;  2UZD B;  4Z88 A;  4IUT A;  4M7D G;  3GIB A;  1R77 A;  1QW1 A;  4KRC B;  3RUX A;  4IUR A;  4UC4 A;  4LD9 K;  5A0L A;  4X1V A;  2DL4 A;  3JB9 J;  4F7U E;  2AT1 B;  4A4K A;  3HFO A;  4KUL A;  1H3H A;  4F7L B;  4QKU A;  4BY1 X;  2CZ1 B;  2K9G A;  3ULR B;  3LGL A;  1KQ2 A;  1M1G A;  2DXC A;  1RAG B;  4ELL A;  2EPD A;  2K5I A;  3E19 A;  1OI1 A;  2YUQ A;  3E1S A;  4Q5W A;  4OR5 B;  2M16 A;  1UUE A;  2NUT A;  4JX6 A;  3BG9 A;  1MMG A;  5KYU A;  1YJW A;  4V2S A;  2OTJ T;  3CC4 Q;  1G5V A;  2DBK A;  1U1S A;  1K8A C;  1UFF A;  3VS5 A;  1TG0 A;  4ROD A;  1VQO T;  1YIJ T;  3M58 A;  2LX7 A;  2QA4 Q;  4E7I A;  2OTJ Q;  1TS9 A;  4O5V A;  2MWP A;  3CQT A;  3CME A;  2DK3 A;  4UN0 A;  1ZSZ B;  1B3Q A;  2HD0 A;  4M75 E;  2ATC B;  3MIA B;  1YCY A;  2YLB A;  4F04 B;  1WXB A;  2BZ8 A;  3OQ5 A;  4BD3 A;  4EOR B;  3OS1 A;  1QVP A;  1M90 R;  2VYT A;  1H4L D;  4ZN1 A;  3I5R A;  1VQN T;  3M0S A;  4M7A F;  1ZUU A;  1YP5 A;  1YCS B;  2AZS A;  2QG9 B;  2R7G A;  2Z0W A;  3JB9 H;  4EOJ B;  2X3W D;  4QW2 A;  3R6N A;  1OIU B;  4MIM A;  1OIY B;  1G3W A;  3REA B;  1K8A U;  4PJJ A;  4DQ2 A;  2FZC B;  3QDF A;  1M1F A;  4RCC A;  3MHX A;  5CKE A;  5LJ3 f;  2BIV A;  2A28 A;  4M78 F;  1VQN Q;  3QWX X;  2CS7 A;  1QWF A;  4KBM B;  1ZQ1 A;  1VQ5 T;  2CGH A;  2EFI A;  2FO0 A;  1V29 B;  4LUD A;  1PD0 A;  2KE9 A;  3EOC B;  2RQW A;  3JCM Q;  4TVR A;  2DA9 A;  4C8Q F;  2JUF A;  3HSB A;  1E7P A;  1BCM A;  3VV0 A;  3C95 A;  2BUD A;  4BCN B;  4EIK A;  3EHQ A;  5GAM h;  1AD6 A;  1D3B A;  2KMG A;  2QEX A;  1VQ6 A;  3HZJ A;  1YJN A;  5GAO l;  2CP2 A;  2L5Q A;  3MP6 A;  5ICP B;  4RTY A;  1WI7 A;  1VQ4 A;  1UGR B;  4ROC A;  3M0U A;  3E9G A;  3C94 A;  1FMW A;  4KGV B;  2DIL A;  2K2M A;  8AT1 B;  4HCB A;  3BLH B;  2HQE A;  2GQI A;  1NLO C;  3RMS A;  3JCM X;  1IGU A;  2PVG B;  4PLI A;  3SFM A;  1G83 A;  3EFO B;  3EGX B;  2HNI A;  3CME Q;  2LRQ A;  4I3Z B;  5GMK m;  4DBH A;  1BK2 A;  2JT4 A;  2QQB A;  4X9D A;  2HMA A;  1IXD A;  3TNW B;  1VA7 A;  4OMP A;  4LDU A;  2F2C A;  2KR3 A;  4CC4 B;  1NEG A;  5GMK h;  4OGE A;  1W70 A;  1ABQ A;  1PWT A;  2V8K A;  1AEY A;  1X6O A;  1WA7 A;  2DTH A;  2LJ1 A;  3PVQ A;  2KSS A;  1ZBX A;  2JS2 A;  2LCC A;  1KQS A;  1WPY A;  2WIH B;  2XDB A;  1PKD B;  3KUF A;  1KD1 C;  4M7D E;  2GGR A;  4BDY A;  2DKG A;  1GUX A;  2F5T X;  2DTO A;  2FRW A;  2X4Y A;  4C92 B;  2F69 A;  2WXV B;  4J9B A;  2IG0 A;  3JCM V;  4J7I A;  2NWM A;  2LNV A;  2VGM A;  3H41 A;  4HT8 A;  3MP8 A;  4HCC A;  1HXD A;  1NJI U;  4KH1 B;  2H8H A;  3CCL T;  5HQ0 B;  4EPC A;  3SHW A;  3MET A;  3PMT A;  2G77 A;  5CK9 A;  1VQ6 Q;  2X9H A;  2QQ8 A;  2LDM A;  2XHC A;  1U06 A;  3NTK A;  1G2B A;  3CCL Q;  1K73 C;  1KD1 U;  1FKM A;  2D6F A;  3QUI A;  3QSU A;  2G9X B;  1U1T A;  2X1N B;  3LYI A;  4FSS A;  3HHT B;  1O9K B;  3CD6 A;  1H24 B;  1UGP B;  3NPF A;  3CCU T;  3P8H A;  2RHX A;  2DL8 A;  3VYH B;  2JNG A;  3V8J A;  1G8X A;  2KNB B;  3MO8 A;  1B7T A;  1ZSZ A;  1JJ2 S;  2V8I A;  1OOT A;  4M7A C;  2RHZ A;  1OX8 A;  2QQR A;  3CCU Q;  1JST B;  2VAS A;  2QAS A;  1ACM B;  3PGG A;  3R6O A;  3QDR B;  3CCM T;  2CP0 A;  4A54 A;  2YXY A;  4HNT A;  4M78 C;  2CT4 A;  2SEM A;  1K73 U;  1D09 B;  2JOY A;  3VS6 A;  1NPR A;  2DFU A;  2J7I A;  2YT6 A;  3CCM Q;  2PU9 B;  5D6W A;  1K8A R;  5CKF A;  1FMV A;  3HRS A;  3CC2 A;  2OJ2 A;  4C8Q C;  1H8K A;  1G3N C;  4MMK A;  4WCI A;  2RI5 A;  2MIO A;  1CSK A;  1C6V X;  2DME A;  2E70 A;  2EKH A;  1Q7Y C;  3QG1 A;  3M57 A;  5GAN h;  1H1S B;  2JMA A;  1NM7 A;  4A4E A;  2DD4 B;  3PNW C;  3M4G A;  2PMI B;  2C0I A;  4ZGD B;  1Q82 C;  3JB9 G;  3M53 A;  2BKD N;  4BI3 A;  1JOW A;  2RI3 A;  4JRK A;  4M77 F;  2V8J A;  1H26 B;  3OYY A;  3VS0 A;  3CCJ A;  3BG3 A;  2KMT A;  3QXE B;  3BW1 A;  3OMC A;  3JCM J;  1S72 A;  4C92 D;  4F7N B;  3G1J A;  2KAF A;  1ZHI A;  5GAN 7;  2JN0 A;  1Q7Y U;  2CRE A;  2ZCF B;  4LOC A;  2JTM A;  3RKY A;  1NG2 A;  1H1Q B;  2E1H A;  2D8J A;  3L2V A;  1RL2 A;  3NHN A;  3QJ6 A;  2DM1 A;  2VV5 A;  1IRX A;  3G6E T;  1Q82 U;  3JCM W;  4EOK B;  1I81 A;  2K5L A;  2KYB A;  1JU5 C;  2RNA A;  4OMO A;  2ZPF B;  2HDA A;  4BB7 A;  2YUP A;  3ME9 A;  4ZTF A;  2I53 A;  1OU9 A;  3HKS A;  4YTL A;  4FT2 A;  5FRM A;  4OMM A;  4OB1 B;  4BCG B;  2EYY A;  1TUG B;  3WVD B;  1D1C A;  2LMJ A;  3TW6 A;  3FB9 A;  3M56 A;  4XK8 E;  3PE0 A;  4BAC A;  2WMA B;  2Y90 A;  5L23 A;  1K9A A;  3ZBD A;  4JLG A;  3RKX A;  3VJP A;  4C92 A;  1VQK T;  3EH2 A;  4IUU A;  5ACB A;  1D0Y A;  3WXM B;  3LQ5 B;  2HAX A;  2BZX A;  3OS0 A;  2IW6 B;  2X4J A;  2DRK A;  5CAI A;  2EQU A;  3SDZ A;  1TTH B;  5GAO p;  2CZ7 B;  3MKD A;  2DJZ A;  5L2W B;  1I8F A;  1DJ7 B;  2CSQ A;  1YHQ A;  1VQK Q;  2LCS A;  2UZB B;  1Y57 A;  2Y4X A;  1NJI R;  3OSS C;  4OVA A;  4A4G A;  2GNC A;  4C92 G;  5IHN A;  4J9G A;  3BHT B;  1JKW A;  4CFM B;  3V8L A;  1S72 T;  2EKO A;  4AI6 A;  5EG2 A;  1KD1 R;  4J9D A;  5KYY A;  1OV3 A;  2A08 A;  2OI3 A;  3CCE A;  2DNU A;  5GAN 2;  1Z9Q A;  3MY5 B;  2QK0 A;  1S72 Q;  4BCI B;  2DE0 X;  1LNX A;  4DOW A;  1W4S A;  2C5X B;  1ZX6 A;  5FU7 C;  4JRP A;  4HCK A;  1PNJ A;  2FRY A;  2JTF A;  2JM9 A;  3GLX A;  4FYV B;  3A1P A;  4ELZ C;  1KFZ A;  1MV0 B;  4VUB A;  5EFQ B;  1K73 R;  2F2V A;  1HD3 A;  2FZG B;  2MWO A;  4Z8A A;  2E64 A;  2XDD A;  4PJO G;  2EGA A;  3JCM P;  4GY5 A;  3DJB A;  3BG5 A;  1I07 A;  4B6M A;  2YRV A;  1IHV A;  3GBQ A;  1SG5 A;  5LL6 S;  1ZP2 A;  1AZG B;  5GAM e;  2VWF A;  2ZZD B;  2O31 A;  4M75 G;  4MML A;  1TUD A;  4MZP A;  2W2H A;  2QQ9 A;  2C6T B;  2KVQ G;  3C12 A;  3CXC S;  3H0I A;  1EIF A;  3V8K A;  1VQ9 A;  1RI0 A;  3OW2 S;  3ZFJ A;  3M4Y A;  3SD4 A;  1TH7 A;  1K0S A;  1M2V B;  2DF6 A;  2HKQ B;  4DBR A;  4M77 C;  4HVW A;  4KT0 E;  2ED1 A;  2K7A A;  2DD4 A;  3VS7 A;  2KRM A;  2RH2 A;  4CFX B;  3OYD A;  1VQ8 T;  4KGX B;  4L59 A;  5GJW B;  3POM A;  1X69 A;  3RR6 A;  1WXT A;  1GFD A;  2P4R A;  4AKG A;  2HBP A;  4M7A B;  4L5G A;  2X3X D;  3VU3 C;  2RN8 A;  1FVV B;  1V1C A;  2HL5 C;  1QKW A;  5LJ5 h;  2J6K A;  1SRL A;  2E12 A;  3GPL A;  4CXA B;  4BY6 C;  3JB9 I;  4M78 B;  1JJ2 P;  1WJR A;  1QLB A;  4FYY B;  1F5Q B;  2DTI A;  1RAC B;  2MF2 A;  2VKN A;  3F5X B;  3CBP A;  2D0Q B;  1KJW A;  4AKH A;  2AHJ B;  1QCF A;  1O9S A;  1M4Z A;  2UZL B;  2E5K A;  2YUN A;  5GAO r;  4C8Q B;  3OYF A;  5HK3 A;  1AVZ C;  3EGD B;  2AZV A;  4F16 A;  4RKU E;  1VQ7 T;  1VIN A;  3HO8 A;  2AIR B;  5GAN 4;  1QQJ A;  2QQS A;  3TVT A;  4HT9 A;  5IF1 B;  1AWX A;  1E6H A;  4O6J A;  1QLY A;  2RQR A;  1WHL A;  1VQO A;  1W1F A;  1YIJ A;  4RG2 A;  2MCN A;  3OYL A;  1MHN A;  1N8R C;  1SHG A;  5LJ3 j;  2KY9 A;  4BXX X;  4PJN A;  2CCH B;  3OYI A;  4N0A C;  4WF2 A;  4N4G A;  1XNI A;  1QMZ B;  2NUP B;  1N4M A;  2FHD A;  4E7H A;  3GOX A;  3RES A;  1VQ9 Q;  1LVK A;  4XTU A;  1ZUK A;  4C92 E;  2K3X A;  3TQ7 P;  3OS2 A;  4J9I A;  1VQN A;  1QWE A;  1LOJ A;  1OGU B;  1HJD A;  1VOM A;  1C9B A;  1KQ1 A;  5IXF A;  2HQH A;  5CQX A;  1I5O B;  1N5Z A;  1M3B A;  1VUB A;  1R8O B;  4DEY A;  3M03 A;  1AIS B;  3I5S A;  1YJ9 T;  1VQ5 A;  2QTV A;  1MV3 A;  1VQL T;  4FT4 A;  1SRM A;  1UNL D;  1N27 A;  4C5E A;  2DO3 A;  1H1P B;  5M9O A;  2DZC A;  3X26 B;  2L3Q A;  2WSE E;  2FPE A;  1KK7 A;  1KQS P;  2C0O A;  4BI8 B;  3LLR A;  2K2V A;  2GF7 A;  5D6Y A;  2CYZ B;  2FG0 A;  4PJO E;  4M7A D;  3QWY A;  5GAN e;  3EID B;  3V7R A;  5GAO m;  3KHI A;  1H28 B;  2XID A;  3RIR A;  2P84 A;  4AG1 C;  4IIM A;  4DEX A;  4XU3 A;  3QBY A;  4M78 D;  3LW5 E;  4EOL B;  2J06 A;  3EG3 A;  2DAQ A;  3BE3 A;  5GAN g;  1BI0 A;  1YIJ Q;  1VQO Q;  3JCM g;  2K3Y A;  3OYH A;  1Q86 C;  1JJ2 A;  1GCQ C;  2O9S A;  1D1A A;  1KC8 C;  4ELJ A;  1VIE A;  1E9H B;  4RCB A;  2A0F B;  1UGV A;  3A8H B;  1PSE A;  5DM7 R;  4FSX A;  4C8Q D;  1SSF A;  1XTD A;  4BE2 A;  2DRM A;  1PM3 A;  2M02 A;  4BCM B;  1M2V A;  3UWN A;  2CUB A;  2C4G B;  3H9N A;  5FU7 B;  1U5S A;  3HRU A;  5HY6 A;  3BHU B;  2YRC A;  2FEI A;  4OML A;  4ESR A;  4RMO A;  3DTO A;  3EFS A;  2L0A A;  5A0G A;  4M7A A;  4JZ3 A;  2DEU A;  1CKB A;  3O8V A;  5IXB A;  2DZ9 A;  2PUK B;  1AWW A;  5HBJ B;  2DVE A;  2AKK A;  2XMF A;  4RTV A;  4RTW A;  1Q86 U;  2O4X B;  4HXJ A;  2BS3 A;  2CSI A;  4XTV A;  3RKW A;  3QYH B;  2GTO A;  3FC3 A;  4M78 A;  1VQ5 Q;  3TSW A;  5KYW B;  2IW8 B;  1D0X A;  4NOY A;  2E6N A;  3VRY A;  5GAN d;  2JTE A;  3JCM d;  2CKK A;  3CCL A;  2RJF A;  4C5I A;  4JUV A;  5KCO A;  4JJD A;  1BI1 A;  4C8Q A;  4J9C A;  4MDW A;  3JRZ A;  3GNF B;  1OYX A;  1RAD B;  3NFC A;  4CFU B;  2KBT A;  2R57 A;  2WJ9 A;  2GFA A;  2PNI A;  3B57 A;  2QDY B;  2BS4 A;  1BI2 A;  4JDS A;  5CVI A;  2EW3 A;  4M77 B;  2KYM A;  2QYZ A;  2VC8 A;  3I9Q A;  5CKH A;  3CCU A;  2QTX A;  1TXQ A;  3L1A A;  4C8Q G;  1H27 B;  3X25 B;  4ORZ A;  4C0D B;  1URC B;  5EJC A;  1YI2 A;  1GFC A;  2AKL A;  3F70 A;  2RO0 A;  3RMQ A;  3QYE A;  1N9S A;  3M54 A;  4LD6 A;  3CCM A;  4BDZ A;  4AFZ C;  4BY6 B;  1Q81 C;  1BIB A;  5FWC A;  4PFO A;  2E6Z A;  4A53 A;  5IN1 A;  4M6V A;  1WHK A;  4M4Z A;  1ABO A;  3DLM A;  1Y07 A;  3MCA B;  3MJX A;  5A2Q E;  3J80 E;  2DYB A;  1V76 A;  4OF1 A;  2MK5 A;  2LNH B;  4CRI A;  3HPW A;  4OB2 B;  4Z89 A;  3TRE A;  3PT9 A;  2FZK B;  4QQG A;  4QSH A;  2M1H A;  2RHI A;  1PKT A;  1Z9Z A;  1RLP C;  4AMC A;  2EAY A;  1JBM A;  3LH5 A;  3TNI B;  4BCJ B;  5CKD A;  5DQV A;  4BCM D;  2E3I A;  3M0R A;  5KCH A;  2RM4 A;  4IMY B;  2D8H A;  2EYQ A;  3L42 A;  2KRS A;  2CZ0 B;  3OMG A;  4D8D A;  3JCM b;  4CC3 A;  2HEQ A;  4KGZ B;  4F7U B;  5IDN B;  4IUV A;  1JB0 E;  5BNJ B;  2W9F A;  2EYX A;  2EYW A;  4OB0 B;  3KFV A;  1WJQ A;  1UNG D;  3CCS T;  2RJD A;  3I35 A;  1YI2 T;  2SRC A;  4BCN D;  2OTL T;  2D1X A;  2I0N A;  2GFU A;  2JW4 A;  3M0Q A;  4ZGJ B;  3C4S A;  3CCS Q;  3CCQ T;  3BDL A;  1M5Q 1;  3OYN A;  2COW A;  3MEW A;  1QVG S;  1YI2 Q;  3G6E A;  1WX6 A;  2VUB A;  3V7C A;  2COZ A;  5LJ5 e;  1JXM A;  5GAM f;  3S3M A;  3QYG B;  3EG9 B;  4OGR B;  3I55 T;  3RNJ A;  3CCQ Q;  4FYW B;  3TU4 K;  2J6F A;  4II1 A;  3QHW B;  2OAU A;  2IN3 A;  1JRI A;  5LJ5 g;  4XTW A;  2JZ2 A;  4OB3 B;  1UHC A;  4PJM A;  3I55 Q;  1SEM A;  4M77 D;  4GLM A;  3DDQ B;  1HK9 A;  3OYC A;  3JB9 F;  5FLX E;  4EOP B;  1MMD A;  1NYF A;  2QQA A;  3GNG A;  5HNB B;  3VRZ A;  2PQW A;  3EHR A;  1NPP A;  1VQK A;  4LNP A;  1GY3 B;  3JCM h;  1UJY A;  3CXC A;  1WYX A;  2KRO A;  5DQW A; 
#chains in the Genus database with same CATH homology
 3OW2 A;  4EMG A;  3QKJ A;  5DLQ E;  1UGQ B;  3CME T;  4IKF A;  3LGF A;  4OGC A;  4Z02 A;  3G71 T;  2M0O A;  4VUB A;  1M1K C;  2R5A A;  2OTL A;  2K4Y A;  3SWN A;  4IUT A;  4B9W A;  5GAN 5;  3GIB A;  4M7D G;  3A8O B;  2MWO A;  1QW1 A;  2DXB A;  2E64 A;  3BDU A;  4PJO G;  3RUX A;  5CR2 A;  2EIF A;  2XDD A;  3CCQ A;  3QJY A;  1K9M C;  2E65 A;  4IUR A;  4GY5 A;  4PLL A;  3BG5 A;  4UC4 A;  3SWN C;  3JCM P;  4LD9 K;  2DD5 B;  5A0L A;  3JB9 J;  4F7U E;  2YRV A;  2GQV A;  5LL6 S;  3HFO A;  3OSV A;  4A4K A;  2XI9 A;  4KUL A;  5GAM e;  5CIU A;  3PIP A;  5LJ3 g;  4MZM A;  2DIG A;  2YLC A;  2CZ1 B;  2C06 A;  2RHY A;  4ELY C;  3QZ9 B;  3OS5 A;  2ZZD B;  3I55 A;  1QVF S;  4M75 G;  3LGL A;  4MML A;  3CCR T;  2Y4Y A;  5D6X A;  1KQ2 A;  1M1G A;  2DXC A;  4JRI A;  4MZP A;  4NL3 A;  2QQ9 A;  2KVQ G;  3A5Z B;  3C12 A;  1NJI C;  2K5I A;  3E19 A;  3CXC S;  1OI1 A;  3E1S A;  4Q5W A;  5LJ5 d;  2VXE A;  1EIF A;  4LDX A;  3E9F A;  2F5K A;  4C8Q E;  2M16 A;  4R56 A;  3V8K A;  1VQ9 A;  1RI0 A;  1Y7X A;  3OW2 S;  4M77 A;  4JX6 A;  3ZFJ A;  2RJC A;  3OYE A;  1GXI E;  2XU8 A;  3BG9 A;  2QI2 A;  3M4Y A;  1TH7 A;  3CEY A;  3SD4 A;  3WVE B;  5AYF A;  5GMK j;  3L2R A;  1YJW A;  4V2S A;  4M77 C;  3LWI A;  2OTJ T;  4JS4 A;  1G5V A;  1M1K U;  4KT0 E;  2VXF A;  2DD4 A;  2QF7 A;  5KH6 A;  5I21 A;  2RK2 A;  1B34 A;  2RH2 A;  1U1S A;  1UGS B;  1KHI A;  3OYD A;  3OYK A;  1VQ8 T;  1K8A C;  1Y96 B;  4L59 A;  3ASK A;  1K9M U;  4KUD K;  5KE3 A;  1VQO T;  1YIJ T;  3OYA A;  1G3Y A;  3J7A F;  3M58 A;  2FYK A;  3CC7 T;  4AKG A;  2HBP A;  4E7I A;  1Q81 U;  2KDS A;  4M7A B;  4O5V A;  2D9T A;  2MWP A;  1FXX A;  4L5G A;  3CME A;  4M77 G;  2DK3 A;  4XAX B;  3VU3 C;  5C6S A;  4J6X A;  2X4W A;  3GP8 A;  2HD0 A;  4M75 E;  5LJ5 h;  2QEX T;  1VQ6 T;  1NZ9 A;  3QWL A;  3NTH A;  1YJN T;  1YCY A;  2E12 A;  2YLB A;  3GPL A;  3QPH A;  1VQP T;  4AKI A;  2ZPH B;  4BY6 C;  1NE8 A;  3BFM A;  4M78 B;  3JB9 I;  1VQ4 T;  4N4I A;  1WJR A;  4JLI A;  1QLB A;  2DTI A;  4XTZ A;  3OQ5 A;  2MF2 A;  3INZ A;  3DKM A;  2R5M A;  4FL6 A;  5LJ3 d;  4BD3 A;  3CBP A;  4PNO A;  2D0Q B;  2E10 A;  3OS1 A;  4JX4 A;  1QVP A;  4AKH A;  2WSC E;  3H8Z A;  2EJF A;  3P8D A;  2VYT A;  4ZN1 A;  2AHJ B;  1VQN T;  1O9S A;  1FX7 A;  1M4Z A;  3JAM E;  3ER0 A;  1YBY A;  4EMK B;  3PIO A;  2DXT A;  5GMK l;  3CCR A;  4M7A F;  4Y91 A;  1VQM T;  2LQ8 A;  4DA4 A;  5FRN A;  5GAO q;  1AHJ B;  5GAO r;  4QW2 A;  4C8Q B;  3OYF A;  3JB9 H;  1G3W A;  4MIM A;  5HK3 A;  1K8A U;  5C0M A;  3DLL A;  4DQ2 A;  3MP1 A;  1M1F A;  4IUQ A;  3MHX A;  4RCC A;  5CKE A;  5LJ3 f;  3MEA A;  2BIV A;  3JB9 D;  1U8R A;  2IVW A;  4ZTJ A;  4RKU E;  4EMH A;  1VQ7 T;  4F7U F;  4M78 F;  3BY7 A;  5CQY A;  3HO8 A;  2CS7 A;  3PTA A;  2CZ6 B;  5GAN 4;  2K5F A;  2ZPB B;  3X24 B;  3T9N A;  4KBM B;  2QQS A;  1ZQ1 A;  1VQ5 T;  4HT9 A;  2CGH A;  2EFI A;  3G4S T;  4PJO B;  1V29 B;  4O6J A;  1VQ8 A;  1G3S A;  2P0K A;  3JCM Q;  3N5B B;  1VQO A;  1FWZ A;  4TVR A;  1YIJ A;  2P0Q A;  4RG2 A;  2R58 A;  3OYL A;  3CC7 A;  4C8Q F;  2JUF A;  3HSB A;  1E7P A;  4N4H A;  4J8O A;  1MHN A;  4N0A A;  2RHU A;  3C95 A;  3VV0 A;  1N8R C;  2BUD A;  5LJ3 j;  4M75 B;  2KY9 A;  5GAM h;  2LT4 A;  1D3B A;  1M9S A;  2KMG A;  3OYI A;  4N0A C;  2QEX A;  1VQ6 A;  4WF2 A;  4N4G A;  3HZJ A;  4MFE A;  1XNI A;  5J3B A;  5GAO l;  1YJN A;  2L5Q A;  3MP6 A;  1VQP A;  4MDX A;  3I56 T;  2FHD A;  4E7H A;  1BKB A;  3PFS A;  4X34 A;  1VQ4 A;  4ZGE B;  1UGR B;  4PJO F;  3OA6 A;  3GOX A;  1PSF A;  1H64 1;  2A3L A;  1YIT T;  3KXT A;  3RES A;  1Y71 A;  3E9G A;  3X20 B;  4XTU A;  2M9U A;  2WSF E;  2O4X A;  4C92 E;  2K3X A;  3HP9 A;  2RA2 A;  3C94 A;  3OS2 A;  1VQN A;  4J83 A;  5GAN f;  2PVO B;  1LOJ A;  3DL1 A;  2HQE A;  4HCB A;  4M7A E;  4M75 F;  2K57 A;  1VQM A;  2DXC B;  3FEO A;  4BBS M;  3RMS A;  4E7K A;  1I4K 1;  5CKB A;  3JCM X;  5LJ3 e;  4BBR M;  5IT9 E;  1KQ1 A;  2PVG B;  4PLI A;  3SFM A;  1M8V A;  5CQX A;  1XOV A;  2LQK A;  1VQ7 A;  3M55 A;  3UDC A;  2HNI A;  2E41 A;  3FRN A;  1VUB A;  4M78 E;  2LRQ A;  1M90 C;  1R8O B;  5GMK m;  3V7S A;  1YJ9 T;  1VQ5 A;  2RK1 A;  4HCZ A;  5CO7 A;  2QQB A;  3G4S A;  2QDJ A;  4X9D A;  1VQL T;  4FT4 A;  4P5N A;  5GAN j;  1N27 A;  4C5E A;  2DO3 A;  2XG8 D;  5DLO A;  4XTY A;  3UT1 A;  4LDU A;  5M9O A;  3OYG A;  2DZC A;  3X26 B;  2I2L A;  3J81 E;  3OYB A;  5GMK h;  4FU6 A;  4OGE A;  4QQD A;  3LWH A;  1W2B A;  2WSE E;  3FDR A;  2V8K A;  1X6O A;  3S6W A;  3FIF A;  3CD6 T;  3L2U A;  2EQJ A;  4OMF B;  2DTH A;  2KSS A;  5I2S A;  1ZBX A;  2ZGW A;  2LCC A;  1KQS A;  1WPY A;  4BI8 B;  1VIF A;  2XDB A;  3LLR A;  2K2V A;  5A0D A;  2GF7 A;  3KUF A;  3VKI A;  5D6Y A;  1UEB A;  5FU6 C;  3I56 A;  1KD1 C;  4M7D E;  4QVD A;  4BDY A;  2CYZ B;  2DKG A;  2F5T X;  4QVC A;  1YIT A;  4PJO E;  3QO3 A;  2DTO A;  4M7A D;  2X4Y A;  4C0D C;  4C92 B;  5HKC A;  2F69 A;  1KHC A;  3FLG A;  2XDP A;  2EJ9 A;  4KUI A;  3X28 B;  5GAN e;  2IG0 A;  3JCM V;  4J7I A;  3V7R A;  2X35 A;  3KHI A;  2XID A;  2MAM A;  4J5Y A;  3RIR A;  2QXF A;  5GAO m;  2RD1 A;  3HBL A;  2DD5 A;  4XU3 A;  4C5H A;  2LNV A;  2VGM A;  4HT8 A;  3QBY A;  4M78 D;  4LDY A;  4HA8 A;  3LW5 E;  3G7Z A;  1WQW A;  5GAN 6;  3A8M B;  2DAQ A;  3MP8 A;  1YHQ T;  1KG1 A;  5GAN g;  1BI0 A;  4BE0 A;  4HCC A;  1HXD A;  3JCM g;  4IUP A;  2K3Y A;  3OYH A;  1NJI U;  3CCL T;  1Q86 C;  1JJ2 A;  5GMK e;  2E5Q A;  4EPC A;  4MFD A;  4ELJ A;  3MET A;  1KC8 C;  1VIE A;  3PMT A;  2G77 A;  4OP0 A;  5CK9 A;  3EAE A;  4RCB A;  4C92 F;  3L2Q A;  3A8H B;  1PSE A;  5DM7 R;  1KQS S;  4HL4 A;  1YJ9 A;  5IAY A;  2PVD B;  4FSX A;  1VQL A;  2QQ8 A;  1X01 A;  2LDM A;  2XHC A;  4C8Q D;  3CC2 T;  1SSF A;  3NTK A;  3CCV T;  1XTD A;  2X4X A;  4BE2 A;  1K73 C;  3VYG B;  1FKM A;  1KD1 U;  2D6F A;  3QUI A;  3QSU A;  3UWN A;  4C0F A;  1U1T A;  2LCL A;  3LYI A;  4C0Z A;  3M9Q A;  3VUB A;  5FU7 B;  3HHT B;  1IRE B;  3TEE A;  5CCA A;  1UGP B;  3HRU A;  3CD6 A;  3Q1J A;  1Y96 A;  1BYM A;  4Z6Y A;  3CCU T;  3PMI A;  3P8H A;  5HY6 A;  2L89 A;  4M77 E;  3URG A;  4PJO D;  3S3O A;  2MI6 A;  2RHX A;  4RMO A;  3VYH B;  2JNG A;  3V8J A;  4M7D B;  2ZPE B;  2XD0 A;  1P92 A;  3HRT A;  3EFS A;  3MO8 A;  5A0G A;  4M7A A;  2RB6 A;  1JJ2 S;  3H4C A;  1N9R A;  2DZ9 A;  3O8V A;  2PUK B;  5LJ3 h;  2DVE A;  2V8I A;  1OZ2 A;  3NTI A;  4Y28 E;  1Q86 U;  4M7A C;  2RHZ A;  4M75 D;  2O4X B;  2QQR A;  2BS3 A;  3LX7 A;  3H6Z A;  4XTV A;  3RKW A;  3OYJ A;  4QQ6 A;  5DY9 A;  3QYH B;  3PGG A;  4F7U A;  3FC3 A;  4M78 A;  3UPU A;  3AHU A;  3R6O A;  3QDR B;  3CCM T;  4A54 A;  2RJE A;  3CCJ T;  4NOY A;  4JRQ A;  3SWN B;  4HNT A;  1WGS A;  2E6N A;  4M78 C;  5GAN d;  1K73 U;  2JOY A;  2DXB B;  3QHS A;  3JCM d;  4M7D F;  2CKK A;  3CCL A;  4C5G A;  2RJF A;  4C5I A;  1NPR A;  1QP2 A;  4JUV A;  3DB4 A;  4EMK A;  5KCO A;  2P4T A;  1O75 A;  1WQ7 A;  4BI4 A;  4MZT A;  1H3Z A;  1BI1 A;  2PU9 B;  5D6W A;  4C8Q A;  5CKF A;  4EMK C;  4MDW A;  3JRZ A;  3GNF B;  3HRS A;  1OYX A;  4F7U G;  3CC2 A;  3NFC A;  2KR6 A;  3CCV A;  4C8Q C;  1UB4 A;  3JCM f;  3JCM c;  4CI0 C;  2R57 A;  4MMK A;  5FRO A;  2RI5 A;  2WJ9 A;  2GFA A;  2LC4 A;  3CPW A;  5L8R E;  3KBG A;  4XQ3 A;  4ZN3 A;  2QDY B;  2BS4 A;  1BI2 A;  5J26 A;  3CBO A;  4PJO A;  4JDS A;  5CVI A;  3A8G B;  2E70 A;  4M77 B;  2FB7 A;  2VC8 A;  5CKH A;  1Q7Y C;  3QG1 A;  4DOV A;  3M57 A;  3CCU A;  2QTX A;  5FU6 B;  3OBY A;  5GAN h;  1N8R U;  4FIB A;  4PJO C;  2DEQ A;  3L1A A;  4C8Q G;  5J39 A;  3X25 B;  4A4E A;  3VUZ A;  3OBW A;  2DD4 B;  3PNW C;  4NL2 A;  4C0D B;  3M4G A;  1B34 B;  4BE1 A;  3SB2 A;  4M75 A;  5EJC A;  4E7L A;  4ZGD B;  4J6Y A;  1YI2 A;  2JVV A;  1Q82 C;  3F70 A;  3JB9 G;  4M75 C;  2LTO A;  3M53 A;  2BKD N;  2HQX A;  2O01 E;  3QYE A;  1N9S A;  2RO0 A;  4LDW A;  3RMQ A;  3TCJ A;  3M54 A;  4BI3 A;  4LD6 A;  2GCX A;  1QP3 A;  3MEV A;  2RI3 A;  4JRK A;  3CCM A;  4BDZ A;  4M77 F;  2V8J A;  4NC6 A;  2MMP A;  3OYY A;  3CCJ A;  3BG3 A;  4BY6 B;  1BIB A;  3QXE B;  2KMT A;  3EFR A;  3BW1 A;  1Q81 C;  4ATO A;  3VKH A;  2E6Z A;  3CPW S;  1I5L A;  4A53 A;  3OMC A;  5IN1 A;  3JCM J;  4C92 D;  1S72 A;  4M6V A;  2KK4 A;  3DLM A;  4J7F A;  1N6A A;  1Y07 A;  3MCA B;  4J6W A;  2KAF A;  3LH0 A;  1ZHI A;  2ZPG B;  5GAN 7;  3CC4 T;  1LJO A;  2P0P A;  5A2Q E;  2JN0 A;  4PL6 A;  5GAM g;  3J80 E;  1Q7Y U;  4HKE A;  1BI3 A;  2ZCF B;  4OF1 A;  1IZ6 A;  4LOC A;  2FL7 A;  2JTM A;  3RKY A;  3JCM e;  4R55 A;  1M90 U;  4CRI A;  2E1H A;  3RER A;  3HPW A;  4OB2 B;  3L2V A;  4JJN K;  1RL2 A;  4X9C A;  2YHT A;  3PT9 A;  2DPP B;  2LVM A;  3TRE A;  3QJ6 A;  5GAO n;  2VV5 A;  3G6E T;  2QA4 T;  3DB3 A;  4QQG A;  2B8A A;  2EJG A;  4QSH A;  2DIQ A;  2M1H A;  1I81 A;  2K5L A;  2RHI A;  4XU2 A;  3JCM W;  1Q82 U;  2VGN A;  2ZZD A;  4RG8 A;  4BUG A;  3S3N A;  5LJ5 f;  1W2B S;  2ZPF B;  2EAY A;  1JBM A;  4BB7 A;  3ME9 A;  4GLK A;  4ZTF A;  1WJS A;  4ME7 A;  5CKD A;  4PKC C;  3HKS A;  3QII A;  4D6W A;  2L8D A;  4YTL A;  2XIC A;  3OYM A;  4FT2 A;  2XK0 A;  3CCE T;  5FRM A;  4OB1 B;  3MEU A;  3HB9 A;  4L6V 5;  3G71 A;  5KCH A;  3QZ5 B;  1QVG A;  3WVD B;  5KE2 A;  2RM4 A;  3TW6 A;  3FB9 A;  3M56 A;  4XK8 E;  3CMA T;  2EYQ A;  4E47 A;  4XU1 A;  3L42 A;  4HNU A;  4HNV A;  4BAC A;  2CZ0 B;  3OMG A;  3QYB A;  4EDU A;  3JCM b;  2Y90 A;  4JX5 A;  4F7U B;  4M7D D;  3ZEH A;  4IUV A;  1JB0 E;  5LJ5 j;  2L3R A;  3ZBD A;  1D3B B;  2KQW A;  3L2Z A;  4JLG A;  4OB0 B;  3RKX A;  3VJP A;  1WJQ A;  4C92 A;  2BS2 A;  1VQK T;  3HFN A;  4IUU A;  4A4H A;  2EWN A;  3WXM B;  3CCS T;  4C0G A;  3OY9 A;  2HAX A;  3OS0 A;  4C92 C;  2QFZ A;  2A7Y A;  2X4J A;  4JS5 A;  3M5A A;  5CAI A;  2RJD A;  2EQU A;  1YI2 T;  4QVZ A;  3SDZ A;  5GAO p;  3CC4 A;  2CZ7 B;  2DJZ A;  3FJP A;  5HK0 A;  2OTL T;  2ZPI B;  3HL8 A;  5GAM d;  1I8F A;  1DJ7 B;  4E7J A;  1YHQ A;  1KC8 U;  2GFU A;  4ZGJ B;  3C4S A;  2Y4X A;  5GMK i;  2XKO C;  3CCQ T;  1G3T A;  3BDL A;  1M5Q 1;  3JSC A;  3OYN A;  2H3J A;  4HLQ A;  1WNL A;  2LX9 A;  1XQH A;  2PUO B;  3OSS C;  4OVA A;  1OZ3 A;  3MEW A;  4A4G A;  4C92 G;  2EQK A;  1QVG S;  3G6E A;  2VUB A;  2QA4 A;  2OTJ A;  4FM4 B;  4NS5 A;  3V7C A;  3V8L A;  2EQM A;  5LJ5 e;  1S72 T;  5GAM f;  4M7A G;  2EKO A;  3S3M A;  3QYG B;  3CBM A;  4AI6 A;  5EG2 A;  3I55 T;  5GAN 8;  3TW7 A;  3P8B B;  3VYG A;  3TU4 K;  3VKG A;  2OAU A;  4II1 A;  3CCE A;  2G3R A;  1JRI A;  2WAC A;  4XTX A;  5LJ5 g;  4XTW A;  2JZ2 A;  5GAN 2;  4OB3 B;  2DXU A;  4M78 G;  1VQ9 T;  3GF5 A;  4XU0 A;  1LNX A;  2LT1 A;  3M59 A;  1W4S A;  4DOW A;  3A8L B;  3L2W A;  5FU7 C;  4M77 D;  3CMA A;  4JRP A;  1YJW T;  4M7D A;  1HK9 A;  3OYC A;  3JB9 F;  5FLX E;  1MGQ A;  2JTF A;  3OB9 A;  2QQA A;  2RI2 A;  4B9X A;  1BIA A;  2NLU A;  3GNG A;  5GAM j;  1QVF A;  2PQW A;  5I2M A;  4M7D C;  1NPP A;  2FVU A;  1VQK A;  1X75 C;  3GLX A;  4A4F A;  3JCM h;  3CXC A;  3CCS A;  4LDV A;  3CPF A;  4ELZ C;  5GAN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...