4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
2ZCFB 2ZPEB 4OB0B 3X28B 2CZ7B 2ZZDB 3X20B 2ZPBB 3VYHB 2DPPB 2ZPIB 3HHTB 2PVOB 2WSEE 5L8RE 2DD4B 2DXBB 3QYGB 3VYGB 1JB0E 1UGQB 1PSFA 3X26B 1IREB 2DXBA 3VYGA 2CYZB 1UGRB 3A8GB 2CZ0B 1GXIE 4L6V5 3QZ5B 2CZ1B 2ZPHB 1V29B 2WSCE 3X24B 3A8LB 2DD5B 2ZZDA 4FM4B 3A8OB 4OB3B 2PUOB 1AHJB 3A8HB 2DXCB 4ZGEB 2DD5A 2ZPFB 4RKUE 2DD4A 2PU9B 1PSEA 3QXEB 2AHJB 3A8MB 3WVDB 1UGSB 4ZGDB 1DJ7B 4ZGJB 3WVEB 4XK8E 3LW5E 3QZ9B 4KT0E 4Y28E 3QYHB 4OB2B 1QP3A 2CZ6B 4OB1B 2PVDB 3X25B 2ZPGB 2QDYB 2D0QB 1UGPB 2WSFE 1QP2A 2DXCA 2PVGB 2PUKB 2O01E
chains in the Genus database with same CATH superfamily
1G2BA 1OZ2A 2F5TX 2DL5A 2HL3A 3BHTB 4BE2A 1Q95G 2R5AA 4BE1A 3CC7A 4M77E 2DPPB 2QGGA 3VRZA 3H8ZA 3H9NA 1VQOQ 5FWBA 4A54A 2PTKA 3PIPA 2E6ZA 3HTRA 2JNGA 4BXXX 2LCCA 1JB0E 4LD9K 3OW2P 4PFZA 1M90C 1G83A 3GIBA 2X3WD 4BE0A 2D6FA 4XTYA 2EGEA 2CYZB 4ELYC 1I1JA 2EUFA 4OGRB 3N5BB 1AZGB 2OTJA 4ZTJA 4RTXA 1O9SA 4DOVA 1YI2Q 3UWNA 1RAHB 1UECA 3CMAQ 4RCCA 1M4ZA 4AFUC 4MMLA 5HCKA 4D6WA 1VIFA 3FB9A 3FEOA 2RHUA 1IGUA 1Y07A 1KD1U 2ROLA 3HKSA 1H3ZA 2HKQB 2DRMA 2A36A 1H4LD 4C92B 1YCYA 2FZGB 2RH2A 4BD3A 2K79A 4J6XA 3ZL7C 1RADB 1WHGA 3QWXX 1MMDA 4QQ6A 3WVDB 4C8QB 5IHNA 1HJDA 2OAWA 2KY9A 3P8DA 1OEBA 2QAZA 4AFZC 2KXCA 2EYWA 2RJCA 2M0YA 1IO6A 2WIPB 1B7TA 1OULA 2ZGWA 4BCQD 4O5VA 4OMOA 3UA7A 1X69A 1NM7A 3SWNC 2KQWA 3CCLA 3F70A 3RGFB 2DIGA 5KH6A 1Z9ZA 3HL8A 3JCMf 1X75C 2E5QA 4PJMA 1VIEA 4EPCA 1R77A 1WLPB 3PO3S 3NMZC 4MZMA 1V1CA 2L2PA 3JCMc 2EYXA 4MFEA 2ZPEB 5DLOA 3H4CA 5IHYA 2E6NA 3CCRT 2COWA 5GANe 3H0IA 3EGDA 2FYKA 5CO7A 4BI4A 1NG2A 3DL1A 5KE2A 3SB2A 2QEXQ 4JS4A 3CCMT 3BLHB 2FG0A 5LJ5g 1WXUA 3RKXA 1KD1R 2KI7A 4VUBA 1PHTA 1X2KA 2YUQA 2XKOC 2E3HA 2RB6A 1NLPC 1RACB 5FU7C 4F16A 5GAN7 1D3UB 1IZ6A 2JT4A 3CC4A 2BUDA 2BS2A 2JM9A 2K4YA 4PJNA 4BCFB 2CP2A 1T0JA 4RTYA 2EGAA 1YJ9A 2CDTA 1ENWA 2QASA 1GH6B 1OYXA 4M78F 3TU4K 1D3BB 4F7UB 2FPDA 2LJ0A 2WSCE 3L2QA 3X24B 1EZZB 1RAFB 3BHUB 5GAN3 3SDZA 4FYXB 3POMA 3S3MA 4II1A 5GANh 1YJWT 5HBJB 4E7ZA 1VQMQ 4BCHB 3TSZA 2XDPA 2PU9B 3VJPA 5GMKl 1KD1C 2M51A 1N8RU 4BI3A 3DB3A 1FMWA 2ECZA 3PVQA 2NLUA 1B34A 2A0FB 4M75B 3TSWA 3CC7Q 1G5VA 4BY6B 1SKUB 1KJWA 2YSQA 1R0CB 2GF7A 1BCMA 2HMAA 2D9TA 1OOTA 2QQSA 3A98A 3X25B 1BB9A 1UTIA 2ROTA 3M4YA 3EG9A 4RTZA 1I0CA 4JRKA 4J5YA 2FPEA 3MP8A 4JUVA 3PT9A 1S72T 4HCKA 1QW1A 2QQ9A 1TH7A 2PNIA 4J8OA 1YHQT 4F6SB 1TU0B 3U23A 2LX9A 3VRYA 4M7DD 5IF1B 5GANd 4QT7A 3X28B 1NZ9A 4BBRM 3CMEA 1I07A 1JQQA 3I56A 3MJXA 4P5NA 3OYHA 4JX5A 5KYUB 5DQVA 1AT1B 2ZPIB 2W2HA 4EOJB 1GUXA 4M77F 2DBMA 2V26A 2XI9A 2E64A 1VQ4A 1R8OB 3I55T 2EJFA 3G4ST 4JPBW 1JJ2S 3G71T 4FW2A 4B9WA 2EPDA 2MK5A 3CCSA 1LOJA 3JB9I 4LE9A 1G3WA 3LGFA 1M8MA 2RHXA 2F5KA 1WHJA 1GXIE 1WJRA 1C6VX 3CCLQ 3DDPB 2QQAA 2P4RA 4DBQA 4YTLA 2DD5B 5LMKB 1MGQA 2QXFA 2K5IA 5GANg 3GTMS 2GCXA 2VVKA 2O31A 4EC8B 4ZGEB 1M5Q1 2L89A 3QUIA 2DD4A 4WTOB 2RQUA 2JOYA 4LDWA 5GAOp 1NEGA 1N8RC 3GOXA 2DM1A 3TEEA 2J7IA 1YBYA 2C5VB 1IB8A 3BHVB 1VQKT 2JGZB 2DE0X 1OPKA 3TNHB 2C0IA 3OBYA 2LRQA 3NHNA 4F7UG 3CCQT 4JJNK 4ME7A 2E70A 4KT0E 2YRVA 4OVAA 4IIMA 4JRPA 4E7SA 1OI9B 4ELJA 2QTXA 1UUEA 2KXDA 2EQUA 2JN0A 5IXBA 3M57A 4C5EA 4B6MA 3CC4Q 1FMKA 4JJBA 4CXAB 5GAN4 2P0PA 3MEUA 3CPWP 4XU3A 5FRMA 2CP7A 1JJ2A 1YJ9Q 3PMTA 1VQ7T 1KHCA 4PLLA 1GY3B 1BBZA 1FMVA 4M75G 1H1RB 2VGMA 2E65A 2QFZA 1ZHIA 5CEIB 1H1QB 2KVQG 1RI9A 4EIKA 2LQ8A 4M75C 5CR2A 3S3OA 4BACA 2YHTA 3KUFA 2XK0A 4BCIB 4BY6C 2X51A 1VQ6Q 3FJ5A 2QI2A 1G3YA 3H0HA 3HPWA 3OMGA 3HRTA 4WCIA 1F1BB 4FYYB 2O4XB 4MFDA 1Q86U 2WHBB 2FVUA 2L0AA 4LN2A 5DQWA 3L1AA 2NUZA 4BCQB 8ATCB 2DXUA 4DBRA 2AT1B 4HKEA 3GP8A 1K9MR 2DIQA 1K76A 2EBPA 4HNUA 2RO0A 3SWNA 3MCAB 2DZ9A 2KBTA 1XQHA 3MPUB 3EFRA 3CCUT 4ORZA 3OSVA 3CCEQ 2JTEA 1QVFP 2GTOA 4EOPB 4QVZA 3M5AA 2R7GA 1BI1A 2CT4A 2AHJB 4EMKB 4BCND 4BCJB 3CCVQ 1SSFA 3SD4A 4FX3B 2RI5A 3LQ5B 4C0ZA 1N9SA 4JX4A 2V8JA 3JSCA 3C4SA 2LCSA 4E47A 5I5ZB 4AG1C 4MZPA 2JTMA 1VQ4Q 3FC3A 4RTVA 2JS2A 1RAGB 2DL3A 4M7AE 5GANj 4AFQC 1ZA1B 2HEQA 3CCRA 3PNWC 2WSFE 4XQ3A 2J05A 3DTOA 2PVGB 1Q86R 2COZA 3JCMV 4J6YA 3CCMA 5D6YA 1PCXA 1D0XA 3C95A 1G3SA 1VYUA 2PK2A 3O5ZA 1BI2A 1AWXA 3UATA 4C0DC 1MUZA 3QIIA 2M0OA 1H24B 2E10A 3CC2T 1MV0B 5HBHB 4AMCA 3AHUA 5I11A 4HCZA 2BKDN 3LX7A 4G6LB 3CD6T 4YOOA 2G9XB 1JO8A 3RDVA 2P84A 4UN0A 4QKUA 1KIKA 4RCBA 2DYBA 1VQ8Q 1W4SA 3I5RA 1Q86C 2GFAA 2WEVB 3QPHA 1YJNT 3EH2A 3JB9G 3HRSA 4DEXA 3ASKA 1YJWA 4ZN1A 2V1QA 2GQIA 1MMGA 5KE3A 1W2BA 2JW4A 4FYVB 4L6V5 2CKKA 4NL3A 1KXUA 3RESA 4J9FA 2E12A 2ZZDA 1C1AA 4HNTA 4E7JA 1OU9A 2LVMA 2G77A 2DXTA 4FT2A 2BE7D 1YCSB 2OTLT 2QGFB 3A5ZB 4KULA 4A4HA 4XTXA 2XD0A 2DXCB 3QSUA 3HFOA 1M3AA 1EIFA 2HZYA 2K6DA 2RHIA 3EFSA 2YUOA 4M7DB 4CRLB 2YLBA 2C5XB 1KQ2A 4A4FA 1KFZA 3NTKA 2YT6A 2DO3A 5A0DA 1CKAA 3M54A 2RI2A 1S72A 3LW5E 1UG1A 4KGVB 4BCMD 1YP5A 1HYOA 3QO3A 2AKKA 1YHQA 2MIOA 3EAEA 5FGKB 3VS0A 3ME9A 3SEMA 5CVIA 1X6BA 4J9GA 2QDLA 1JSUB 2UZBB 3WXMB 2MWOA 1U3OA 2E4HA 1Z9QA 2V8KA 3RIRA 2EVRA 2YLCA 2KYMA 4CC7A 1J3TA 2DERA 4F14A 4AKIA 3I55A 1UEBA 3G4SA 5GANf 3L2WA 3G71A 4PFPA 4EOMB 2W10A 1GRIA 1Y0MA 4KRDB 3TW6A 1BI0A 5HVYB 5EC7A 5IDPB 4NL2A 2YRDA 1VQ9Q 5KYYB 1WHMA 1ABOA 4EORB 4BUGA 3DJBA 2QK0A 1T3SA 2K57A 5CKDA 3INZA 2CCIB 4HA8A 4BB7A 2K2MA 1WHKA 2EKHA 1VQNQ 4GLMA 2ZAEA 4EOOB 3EG2A 4OGEA 5KYNA 3BDLA 3A8LB 2KEAA 4PJOG 3CCRQ 1ZQ1A 4F7SB 1JXOA 1BCOA 2QA4T 2JMAA 1VQKA 2EW3A 2HBWA 1AHJB 3BG5A 1D3BA 2ABLA 2BZYA 4F7UA 4E7LA 2HSPA 5HQ0B 2M9UA 3CCMQ 4KRTA 1O9KB 4X34A 4FCYA 4J9EA 1NE8A 4PJOC 5I2SA 3CCQA 4N4IA 4LUEA 5EFQB 1NPPA 5I22A 4M7AG 1M1KR 2OI3A 4ZNXA 4J6WA 1MMNA 4JS5A 1H92A 1UGVA 2M1HA 3META 2EQIA 6AT1B 3L2UA 1TTHB 3CCJT 4M7AC 2DAQA 5C6SA 4M75A 4OMNA 3QDFA 1VQ7A 4RUGA 1Y71A 4IMYB 1ZA2B 1B3QA 4OB2B 4FT4A 1H27B 3D7SB 5I21A 3S3NA 3G6ET 4M7AF 2DTIA 1UNHD 4Z89A 1PC0A 2I53A 4KH0B 3EG0A 3L2RA 2C6TB 2KYBA 4M7DG 3OYAA 4R55A 3LWHA 3M9QA 5DM7R 1VQLQ 1AEYA 2AIRB 3VS6A 2O88A 2DL4A 1M1KC 4MIMA 1JBMA 1TUDA 1JEGA 3TW7A 5J26A 2WMBB 5BNJB 1WYXA 1UHCA 3V8JA 3VS7A 2FZCB 4M7DC 1EX4A 2EQKA 1BU1A 3MIAB 1I5OB 2KK4A 2DNUA 1WA7A 5GAOr 2HNIA 2B9RA 2BZ8A 2FHDA 4F7UE 4BCNB 2UZDB 2QTVA 2LNHB 4OF1A 2RM4A 3FLGA 3H41A 3MY5B 1FWZA 3MKDA 1KQSS 1S72Q 2HAXA 2DL7A 5FRNA 1I5LA 3CCUA 3M03A 1D1CA 3CBPA 4E7IA 5C0MA 3O0GD 4Z6YA 3UA6A 1OV3A 1WIEA 1SG5A 3EOCB 1MNDA 2KRNA 4RMOA 3HSBA 4TTHA 1VQPQ 1VYWB 4M75E 1VQOT 4FM4B 4HCBA 4A4GA 1P92A 2L3PA 1XO2A 3A8HB 1OL1B 2HL5C 3JRZA 3VV0A 1VQ5Q 2JM8A 2DD5A 3EFOB 2DMEA 5CQXA 2JS0A 1ZSZC 1AVZC 2VXFA 2X4XA 2QF7A 1UE9A 4ZGDB 4NSTB 1YITQ 1WZOA 2WPAB 2V8IA 3KBGA 4ZGJB 2X35A 3V8KA 2CJMB 2MMPA 4WF2A 3QHWB 4AT1B 3BLRB 5KCOA 1ACMB 4ESRA 1VYVA 3GLXA 1YI2T 2NUTB 3MY1B 2DKGA 2J06A 3QYHB 1WGSA 2DILA 2F2VA 4ANJA 3CMAT 1SRMA 1PD1A 4HT9A 1M1GA 1SPKA 2E5KA 2KR6A 3RMSA 1VA7A 1X01A 1X27A 4DQ2A 2CH4A 2UUEB 2A28A 3UT1A 3CC2A 3PVLA 5GAMe 2ESWA 2GQVA 1KQSA 1ZUUA 3VU3C 3QWLA 3OYBA 1RABB 2DTOA 1RLQC 1TXQA 3PIOA 3CD6A 3EHRA 3VS5A 4EOQB 2JZ2A 1NYGA 2QYZA 4JLGA 4EDUA 1OU8A 1YNZA 5AYFA 2I40B 3M59A 1YJNA 4X1VA 2DJQA 4C5HA 2RHZA 4C92G 1MNEA 2LC4A 3ZFJA 4XAXB 4CFMB 4J7IA 2E1HA 1GCPA 1ABQA 4C8QG 1QVGA 2CP6A 2OTJQ 1XNIA 2BIVA 4C92C 3I35A 1W70A 1QMZB 3RERA 2OTLA 2C4GB 1K73U 3E9GA 1TOVA 1QCFA 4BCMB 4C8QC 2RQVA 4KUIA 3OY9A 2XDDA 5GAMh 2QEXT 1N8RR 2DL8A 2EYYA 3P8BB 2AK5A 2D8JA 2K3XA 2LQWA 4RTUA 2O9SA 1I4K1 2L5QA 4J9CA 4OP0A 1Q81U 2OX7A 3EIDB 2VKNA 2X1NB 4HCCA 1GCQC 4NC6A 1C9BA 2NWMA 2DVJA 3M0SA 3DKMA 2H3JA 2F2CA 2IIMA 2P0KA 1OKVB 3QXEB 1O75A 3LLRA 5CQYA 2JXBA 4RG8A 1QMCA 3VS2A 4L59A 4Z88A 4QQDA 1NBEB 3EGDB 1M2OA 2KNBB 1QVPA 2PZ1A 1NPRA 1URCB 1WHHA 1JRIA 4E7HA 1AWJA 1YIJT 4OB1B 4TVRA 3EHQA 1WHLA 1JJ2P 3G1JA 1VQMT 4HXJA 4ROCA 3NDQA 2YUPA 2BS3A 3J80E 1WXBA 3I5SA 4A63B 5J39A 3EGXA 5GJWB 5GAMd 1GBRA 4EOLB 4M78D 5IH2A 2F1LA 4ELZC 4I3ZB 1PM3A 4JRQA 5CIUA 5GAN8 2FO0A 4JJCA 1TFBA 4GY5A 4ZN3A 1E7PA 1GBQA 2A08A 3EGUA 5KYWA 3X20B 2MOXA 2L3RA 3OS5A 5HBEB 2OAUA 4D8DA 1E7OA 1NJIU 2VXEA 1K0XA 2DRKA 3KXTA 3VYGB 4CFWB 4PJOA 5M9OA 3GNFB 5HNBB 2HKNA 3R6OA 4E6RA 3LWIA 2Y4YA 4MMKA 4F7UF 1IREB 1B34B 2RK1A 2FRYA 2QA4A 1FINB 4J7FA 4UC4A 5IT9E 5LJ3e 1H26B 4AFSC 1ZP2A 5GAOm 5FLXE 2LT4A 3BW1A 2YWWA 1M1FA 4M7AA 1S1NA 4OMLA 3CBMA 1X6OA 3G7ZA 1V29B 2RD1A 4F7JB 5FROA 2DEUA 1YWPA 2L3SA 3QG1A 1OGUB 1UFFA 4M75F 1Q81C 4RKUE 1H25B 3CCJA 1G3NC 4E2FB 2IVXA 4BDZA 3PTAA 4HVVA 4PJLA 2QG9B 2Y90A 2C5OB 1M9SA 1GFCA 3BDUA 4N4GA 1BI3A 4BBSM 1SHFA 2EJ9A 5CKBA 5KYXB 1SHGA 2KT1A 2KE9A 3G6EA 4M77D 3WVEB 4M7DA 4O6JA 1YJNQ 4XK8E 1HK9A 3BG9A 4F7LB 4HLQA 4CFNB 1ZUYA 1Y96A 3RBBB 2IW8B 5LJ3h 2WJ9A 1GUXB 4CC2A 1QCNA 3BY7A 3VKGA 2G6FX 4KRCB 4EC9B 2D0QB 4LDXA 1QP2A 3I9QA 3CMEQ 1UNGD 2OTLQ 4PJOE 3I56Q 1FKMA 1OL2B 4YC3B 1IRXA 2HQEA 1W2BS 2BTTA 2O9VA 1E9HB 2O01E 1H1PB 2EQJA 4PFOA 2CP3A 2NUPB 3JCMX 4C0FA 4C0GA 4KGXB 2RQWA 1M8VA 2I2LA 1QWEA 2KR3A 2LDMA 3CXCS 4BCOB 3J81E 4QSHA 1U8RA 1PRLC 3OYJA 3CCSQ 1G8XA 2PVOB 1D1AA 3M0QA 2DD4B 4AKHA 1GL5A 4XU1A 1QKWA 2EIFA 1PSFA 2A37A 4IUVA 4RTTA 2NYSA 1ZSZA 4NOYA 1KC8U 1VQOA 5LJ3d 1W2BP 2A3LA 1WQWA 2AZVA 5KYYA 1QVFA 4GBQA 4XU2A 1OPLA 2CZ1B 3DOGB 3M0UA 2VB6A 4M7DE 3IQLA 1PD0A 4Y91A 2WACA 1JOWA 1SRLA 4EOSB 2E41A 5CK9A 1VQ6T 4LDVA 2AKLA 5DLQE 1HXDA 2RJFA 2VV5A 2RJDA 2KRMA 2EJGA 3T9NA 4E7KA 3UDCA 2HQXA 1YI2A 3LYIA 1JXMA 2IG0A 3S6WA 3CMAA 1O9KA 5GAOq 1ZBXA 4MDXA 1RL2A 3OSSC 5FU6B 2CUDA 4F04B 1AZEA 4IUQA 1KHIA 5LJ3g 5GAMj 2XU8A 3GNGA 3HFNA 3QHRB 3VS3A 3JV3A 4Y28E 2HDAA 3M0TA 3CXCA 2LP5A 2CH4W 3H6ZA 4OMPA 4KBMB 1QP3A 3RUXA 4JZ3A 3EH1A 2QDYB 3CCET 3JB9F 4HL4A 2LJ1A 2YDLA 1Q7YU 3DLMA 1IHVA 4LUDA 4JDSA 2DK3A 3M55A 4C92A 3NGPA 1H3HA 2KT8A 1M90U 4CI0C 3CCVT 3FIFA 4C8QA 3V7SA 1F5QB 4FW1A 4PK4A 5GJVB 4F6WB 2D1XA 2JTFA 2RHYA 3REBB 4FU6A 4MZTA 1TUCA 2HQHA 1LJOA 3MI9B 3HHTB 5A0LA 2FZKB 2RQRA 2B86A 2DXBB 4M6VA 4AKGA 2PK9B 1GCQA 2GNCA 2VGNA 2R5MA 2CGHA 4Y92A 2WXVB 3PFSA 2QEXA 3G6EQ 2MCNA 1KC8C 1WJSA 1WX6A 5GAN2 4EMKC 2MPXC 4J9IA 3VKHA 1KK7A 3BLQB 3A8GB 2CZ0B 4F70B 2YUNA 3M56A 3TQ7P 2PMIB 3JB9H 1WXTA 2YRCA 5FWCA 1AISB 1WPYA 4OR5B 1N6AA 5LJ5e 2BE9B 3QBYA 1P5EB 2UZLB 1OI1A 2GTJA 1EFNA 2K7AA 4R0KA 2LMJA 4M78B 5FU7B 4LDYA 2CREA 2ED0A 4V2SA 3OW2S 1VQ8T 3JB9J 2HSEB 4Y72B 3EFOA 3DLLA 2KRSA 3JCMP 1YIJA 4C92E 1ZLMA 2H8HA 2K3BA 1VQMA 3QJYA 1BU2A 2FB7A 4C8QE 3FJPA 1LNXA 3NTIA 3L42A 2Y4XA 2DF6A 4AG2C 1Q82U 3UPUA 4C5GA 5CKHA 1X43A 1CKBA 1ARKA 4EOIB 1HD3A 2QQ8A 2NUTA 1X2QA 3V8LA 1RLPC 2MF2A 4JZ4A 2LCLA 4BI8B 1TUGB 4OMFB 2PUKB 1Q7YC 5LJ5h 1UHFA 3KFVA 3ZBDA 4PJOF 5GAMf 4FL6A 3EJ1B 3OS0A 2EYQA 3OA6A 3RR6A 2SRCA 2R57A 5A2QE 3PMIA 2X9HA 1U06A 4J9BA 2ZZDB 1NEBA 1M2VB 1K9AA 5FU6C 5LJ3j 3JB9D 3TNWB 3BFMA 2WSEE 4YOZA 1YJWQ 2L3QA 5GMKj 1PG5B 2GBQA 3TVTA 3AT1B 4BCGB 2J6OA 4KGZB 3OW2A 3TCJA 1BK2A 4M77B 1H28B 4XU0A 4IURA 2RPNA 2KMGA 2C0TA 2X4YA 1WFWA 1NYFA 1Q82R 2CS7A 5LJ5d 4XTVA 1QLBA 1Y7XA 4RODA 4CFVB 5KYUA 1TWBA 3NPFA 4M7DF 3JAME 3GF5A 1V76A 4IUTA 1E6HA 1WI7A 1ZSGA 3NTHA 1VQ9T 3OYEA 1ZUKA 4C5IA 5IN1A 5DY9A 2FPFA 3QDRB 1JU5C 1YHQQ 1UGSB 1R0BG 3E9FA 3C94A 3OYLA 2K2VA 3OS1A 2CUBA 4FSXA 1VQNT 5EJCA 2E3IA 4IUPA 3EG1A 2XHCA 2P0QA 1UJ0A 5IHKA 1JKWA 1PWTA 5A0GA 1Q82C 1QVGS 1K8AU 1YWOA 2DVEA 5GMKm 4M78G 4YOSA 2LNVA 4LD6A 1OX8A 3I55Q 3G4SQ 1KQSP 1I81A 3G71Q 2MYSA 2V22B 5CYIB 2G3RA 3VKIA 1E6GA 3TN8B 4M78C 1ZBJA 2VASA 2CCHB 4ELLA 3QWYA 3BG3A 2XIDA 3CBOA 2CT3A 4PLIA 2RNAA 1MV3A 3H0FA 3BE3A 1BKBA 2ED1A 2IPOB 1QVGP 2IW6B 2DFUA 3HRUA 4QQGA 3RNJA 4F17A 5HK0A 1YIJQ 5J3BA 5ECAA 4PJOD 2Z0WA 4N0AC 3HBLA 1Y57A 1T3LA 3VYGA 1VQLT 1U5SA 1OX9A 1FX7A 3LGLA 5LJ3f 1VQKQ 3MEWA 1XOVA 1VQ6A 1UGRB 1H1SB 1KQ1A 4J9HA 4CC3A 5CKEA 3NFCA 3CCQQ 4M7AD 5D6WA 2RA2A 1PKDB 1K8AR 4F6UB 2EFIA 2W96A 2RI3A 3A8OB 4OB3B 3MEAA 4M4ZA 3ER0A 2PUOB 3OYCA 2P4TA 1H641 4QVDA 2ZPFB 1G3TA 4CFXB 4DA4A 2M16A 3FRNA 3JCMQ 3M0RA 3PGGA 3OBWA 2LT1A 3REAB 3SFMA 1VQ7Q 4M77G 5CAIA 2O4XA 3F5XB 1VYTA 1JSTB 4HVUA 2RF0A 2X4JA 3CCEA 4LDUA 2AZSA 5GAN6 4C92F 1RI0A 1VUBA 2ATCB 2DLPA 3OB9A 4M77C 2KGTA 4C8QF 1VQPT 4LOCA 2C0OA 5KYXA 1W1FA 2DMOA 3M0PA 2QQRA 2DA9A 1LVKA 2M02A 2MI6A 1NLOC 3CCVA 3QJ6A 4CFUB 2R58A 3L2ZA 1VQ5T 1RAAB 1K8AC 3OS2A 2HBPA 1LPLA 5LL6S 2OJ2A 2WFYB 3OYYA 1UDLA 5GAOn 2CP5A 3JCMe 2K9GA 1AD5A 2J6KA 3OMCA 3VUZA 1YITT 3HZJA 4FYWB 3CEYA 3V7RA 4EMKA 4BY7X 1VINA 3K7AM 1TS9A 3EG3A 4DBFA 2CZ7B 5D6XA 2ZPBB 3QYBA 1WQ7A 2KAFA 5LQFB 4L5GA 2NUPA 4PJJA 1OKWB 1VOMA 4HNVA 1IHWA 2EQMA 3QYGB 3CCUQ 1ZX6A 1K73R 3Q1JA 2BKZB 5LJ5j 3UF4A 2KMTA 3FDRA 3X26B 2LW4A 4OMQA 3CC7T 1C0MA 4EMGA 3RKWA 2MAMA 3CPWS 2WMAB 3PE0A 2W99A 3QKJA 3CPFA 3MP6A 2LJ3A 3JCMh 4C0DB 1D09B 2X4WA 4JJDA 5KCHA 3OQ5A 3QZ5B 1Q81R 3ULRB 1A0NB 4ROEA 4KUDK 5HKCA 1VQ8A 5GMKi 2DX1A 2LX7A 3C0CA 2KROA 1K4US 2UZEB 3RKYA 4HT8A 1QLYA 2I0NA 5ACBA 2IVWA 3LH0A 4EMHA 1K9MU 3B57A 2BS4A 2K5FA 1QKXA 4HVWA 5CKFA 1SF9A 4PNOA 2BPMB 2OTJT 1UJYA 2FEIA 3OYNA 3A8MB 1FXXA 1K73C 5GAMg 4Q5WA 1N9RA 2JJ9A 2IW9B 5GMKe 4X9DA 2DZCA 3HB9A 1D0ZA 2BZXA 2W0ZA 3EG9B 4A53A 4BCPB 3M53A 1I8FA 5IHIA 3CC2Q 2JVVA 1VOLA 3P8HA 2PVDB 4DEYA 2CSQA 4CRIA 2ZPGB 3JCMW 2COYA 4ZTFA 3CD6Q 3JCMd 3VUBA 2FL7A 4IKFA 2DXCA 3QYEA 4FIBA 1QVFS 1UB4A 2RQTA 2F2WA 1SEMA 2DYIA 2VYTA 2F69A 2XICA 4C92D 4DBHA 3CPWA 3CCLT 2ZCFB 2EGCA 1FYNA 4OB0B 2CP0A 1NJIR 3QHSA 1W98B 2QGSA 1QCOA 4C8QD 5GAOl 3LH5A 4BCKB 2B8AA 1WJQA 4LNPA 2RMOA 9ATCB 2GFUA 1AWOA 4MDWA 3VS4A 3M58A 3GBQA 1T0HA 5GMKh 1U1SA 2KSSA 5L8RE 1N4MA 2D8HA 2RN8A 3GPLA 2O2OA 5IAYA 3CQTA 2QQBA 1K1ZA 1RAIB 1UGQB 1D0YA 4Z02A 5EG2A 3RMQA 1CSKA 2DBKA 2C06A 4N4HA 2DXBA 5D7UA 1M3BA 1U1TA 2A7YA 1TD6A 3C12A 3JCMg 2EKOA 2EYZA 3OYKA 1M3CA 3E2UA 1OZ3A 1VQ9A 1B07A 2IN3A 2PQWA 3OYMA 4NS5A 2XDBA 1YFNA 2DTHA 4F7NB 1NJIC 1PRMC 3CC4T 4K11A 1D1BA 1M30A 1AD6A 5LJ5f 4J9DA 4A4EA 2GGRA 5L23A 2QDJA 1OIYB 1KSWA 3JCMJ 1QWFA 1YJ9T 1FVVB 1VQNA 1K9MC 2W9FA 3EGXB 1WDXA 4QVCA 4GLKA 2JUFA 3MO8A 3KHIA 4OMMA 3O8VA 4DOWA 4KH1B 2LQKA 3J7AF 2L8DA 4M78A 1X6GA 1DJ7B 2D0NA 1N27A 4R56A 5CCAA 1M27C 2DETA 2YXYA 3SHWA 3V7CA 5KYWB 3CXCP 2F2XA 4QW2A 1TG0A 4II5B 1BIBA 2EAYA 2LZ6B 5IXFA 2XG8D 1HSQA 3OYFA 4PJOB 1XTDA 3DB4A 1LCKA 1OQKA 1UGPB 3ZEHA 1OIUB 4N0AA 2ENMA 1UNLD 8AT1B 4X9CA 3R6NA 5HK3A 5IDNB 1RAEB 2WIHB 3A1PA 4M7AB 2RJEA 4RG2A 3MEVA 3OYIA 2KDSA 4M75D 2X3XD 2MWPA 3TNIB 1RUWA 3VYHB 2V1RA 3M4GA 4J83A 4CC4B 1VQLA 4XTWA 1MMAA 2QA4Q 1N5ZA 1KC8R 3VS1A 2W9ZA 2K5LA 1M2VA 5I2MA 3G33B 4BY1X 4PL6A 3CMET 2FRWA 3I56T 2J6FA 2VC8A 4IUUA 4EOKB 4OGCA 3L2VA 5GAN5 1BIAA 2VWFA 2HCKA 2LTOA 1PKSA 1GFDA 4M78E 3SWNB 2K3YA 1VQ4T 3CCJQ 4M77A 1IGQA 2ZPHB 1H8KA 1Y96B 3HP9A 4Z8AA 4AI6A 2RK2A 2DEQA 4JX6A 5ICPB 2XMFA 3E19A 2VUBA 1TSFA 3CCST 4CFUD 4XTZA 3E1SA 3THKA 4A4KA 1W6XA 4BDYA 1XJWB 4LXCA 4RTWA 2LQNA 1PSEA 1AOJA 4XTUA 2HD0A 1VQPA 5L2WB 3JCMb 1PNJA 1IXDA 5AT1B 3TREA 4JLIA 1VQ5A 1QQJA 2C5NB 5HY6A 3HO8A 3MP1A 1MHNA 1PKTA 1AWWA 3OYDA 1M1KU 1K0SA 1KG1A 2PHGA 3DDQB 3QZ9B 4EONB 4FSSA 1Q7YR 4B9XA 3URGA 1YITA 2PJQA 2DJZA 2H3EB 4IIOA 2CZ6B 5FW9A 7AT1B 1SSHA 2JMCA 1WNLA 1M90R 2CSIA 1ZSZB 3OYGA 4ATOA 4JRIA 2EWNA 3MHXA 1YN8A 2SEMA 1BYMA 4D8KA 4PKCC
chains in the Genus database with same CATH topology
4M78C 4JRQA 1G3SA 5CIUA 5GAN8 4GY5A 1BI2A 4ZN3A 1OZ2A 2F5TX 1E7PA 3BG3A 2XIDA 4BE2A 3CBOA 4C0DC 3X20B 4PLIA 2R5AA 2L3RA 3OS5A 3CC7A 4BE1A 3QIIA 2M0OA 4M77E 2DPPB 2E10A 3CC2T 1BKBA 3AHUA 2OAUA 3H8ZA 4HCZA 4A54A 2BKDN 1NJIU 3PIPA 3LX7A 2E6ZA 2VXEA 2JNGA 3CD6T 3KXTA 3VYGB 1JB0E 2LCCA 3HRUA 4LD9K 4PJOA 4QQGA 5M9OA 3GNFB 5HK0A 3R6OA 5J3BA 3LWIA 4PJOD 1M90C 2Y4YA 4MMKA 4F7UF 4RCBA 1IREB 1B34B 4N0AC 4BE0A 3GIBA 3HBLA 2RK1A 1W4SA 3VYGA 1VQLT 2D6FA 2QA4A 2GFAA 4XTYA 1Q86C 3QPHA 1YJNT 4J7FA 4UC4A 1FX7A 5IT9E 3JB9G 3LGLA 2CYZB 5LJ3f 4ELYC 5LJ3e 3HRSA 3MEWA 1XOVA 1VQ6A 5GAOm 5FLXE 1UGRB 2LT4A 3ASKA 3BW1A 1M1FA 3N5BB 4ZN1A 1YJWA 1KQ1A 5KE3A 1W2BA 4M7AA 3CBMA 4L6V5 2CKKA 5CKEA 4NL3A 1X6OA 3NFCA 2OTJA 3RESA 3G7ZA 4M7AD 1V29B 5D6WA 4ZTJA 2RA2A 2RD1A 2E12A 1O9SA 5FROA 2ZZDA 4HNTA 4DOVA 2EFIA 2LVMA 3UWNA 4E7JA 2RI3A 2G77A 3A8OB 3QG1A 4OB3B 3MEAA 2DXTA 4FT2A 3ER0A 4RCCA 2PUOB 4M75F 1M4ZA 3OYCA 2OTLT 2P4TA 4MMLA 3A5ZB 4KULA 1H641 4XTXA 4A4HA 4QVDA 2XD0A 2DXCB 4RKUE 1Q81C 2ZPFB 4D6WA 1VIFA 3FB9A 3FEOA 2RHUA 1G3TA 1Y07A 3CCJA 3HKSA 1KD1U 1H3ZA 4DA4A 2M16A 3FRNA 3HFOA 3JCMQ 1EIFA 4BDZA 3PTAA 4C92B 1YCYA 2Y90A 2RHIA 2RH2A 3PGGA 4BD3A 3EFSA 3OBWA 4J6XA 1M9SA 2LT1A 3SFMA 4M7DB 3BDUA 2YLBA 4M77G 5CAIA 2O4XA 4N4GA 4QQ6A 3WVDB 1BI3A 4C8QB 1KQ2A 4BBSM 4A4FA 3NTKA 2X4JA 2KY9A 3P8DA 2EJ9A 3CCEA 5CKBA 4LDUA 5GAN6 2DO3A 5A0DA 3G6EA 2RJCA 4C92F 4M77D 3WVEB 4M7DA 1RI0A 4O6JA 2ZGWA 1VUBA 3M54A 2RI2A 4XK8E 1S72A 3LW5E 1HK9A 3BG9A 3OB9A 4HLQA 4M77C 4O5VA 4C8QF 1Y96A 1VQPT 4LOCA 3QO3A 1YHQA 5LJ3h 2WJ9A 2QQRA 3EAEA 3BY7A 2MI6A 3VKGA 3ME9A 2KQWA 3QJ6A 3SWNC 2R58A 3CCVA 3CCLA 3L2ZA 1VQ5T 1K8AC 3F70A 5CVIA 2D0QB 3OS2A 4LDXA 1KD1C 2DIGA 2HBPA 5KH6A 5LL6S 1QP2A 3OYYA 3HL8A 5GAOn 3JCMe 3JCMf 1X75C 2E5QA 4PJOE 1FKMA 1VIEA 3WXMB 4EPCA 4MZMA 2MWOA 3OMCA 2HQEA 1W2BS 3VUZA 1YITT 3HZJA 2O01E 3CEYA 3V7RA 2V8KA 4EMKA 3JCMc 4MFEA 3RIRA 2ZPEB 2YLCA 5DLOA 2EQJA 3JCMX 3H4CA 2E6NA 3CCRT 4C0FA 4AKIA 3I55A 4C0GA 1UEBA 5GANe 5GANf 3G4SA 2FYKA 5CO7A 3L2WA 4BI4A 3G71A 2CZ7B 3DL1A 5D6XA 2I2LA 1M8VA 2ZPBB 3QYBA 1WQ7A 2KAFA 5KE2A 2LDMA 3SB2A 4JS4A 3CCMT 3CXCS 4L5GA 3J81E 4QSHA 5LJ5g 1U8RA 3TW6A 3OYJA 3RKXA 1BI0A 4HNVA 2PVOB 4VUBA 4NL2A 2DD4B 2EQMA 4AKHA 3QYGB 4XU1A 2EIFA 3Q1JA 1PSFA 2XKOC 5FRMA 2RB6A 5LJ5j 2KMTA 4IUVA 5FU7C 3FDRA 3X26B 5GAN7 3CC7T 1IZ6A 4NOYA 4BUGA 4EMGA 3CC4A 2BUDA 2BS2A 2K4YA 1KC8U 1VQOA 3RKWA 2K57A 2MAMA 5LJ3d 5CKDA 3INZA 3CPWS 2A3LA 1WQWA 4HA8A 3QKJA 3CPFA 4BB7A 1YJ9A 1QVFA 3MP6A 3JCMh 4C0DB 4XU2A 1OYXA 2X4WA 5KCHA 3OQ5A 3QZ5B 4M78F 2CZ1B 4OGEA 1D3BB 4F7UB 3TU4K 2WSCE 3BDLA 3L2QA 3X24B 4KUDK 4M7DE 3A8LB 4PJOG 5HKCA 1VQ8A 4Y91A 1ZQ1A 5GMKi 5GAN3 3SDZA 3S3MA 2WACA 3RKYA 2QA4T 1VQKA 4HT8A 1AHJB 3BG5A 1D3BA 2E41A 2IVWA 4II1A 3LH0A 4EMHA 4F7UA 5CK9A 5GANh 2M9UA 4E7LA 1K9MU 1VQ6T 1YJWT 4LDVA 4X34A 5DLQE 1HXDA 2BS4A 1NE8A 2K5FA 2PU9B 2XDPA 3VJPA 2RJFA 4N4IA 5CKFA 5I2SA 5GMKl 2VV5A 4PNOA 3CCQA 1N8RU 2RJDA 2OTJT 2EJGA 3T9NA 4E7KA 3UDCA 1NPPA 4BI3A 4M7AG 2HQXA 3DB3A 1YI2A 3LYIA 4J6WA 3OYNA 3A8MB 1FXXA 2IG0A 2NLUA 1B34A 3S6WA 5GAMg 5GAOq 3CMAA 4JS5A 2M1HA 3META 4M75B 4Q5WA 1ZBXA 1N9RA 1RL2A 3OSSC 5FU6B 4MDXA 3L2UA 1G5VA 5GMKe 4IUQA 4BY6B 3CCJT 4X9DA 4M7AC 2DAQA 1KHIA 5C6SA 2DZCA 5LJ3g 5GAMj 4M75A 2XU8A 3HB9A 3GNGA 3HFNA 3OYLA 4A53A 1VQ7A 2GF7A 3M53A 4Y28E 1I8FA 1Y71A 2JVVA 3CXCA 3H6ZA 2D9TA 4OB2B 4FT4A 4KBMB 2QQSA 1QP3A 3RUXA 3P8HA 2PVDB 4CRIA 3X25B 2ZPGB 2QDYB 3M4YA 5I21A 3CCET 3JB9F 3JCMW 3S3NA 4HL4A 3G6ET 4ZTFA 4M7AF 2DTIA 3JCMd 4JRKA 4J5YA 3VUBA 2FL7A 3MP8A 4JUVA 3PT9A 2DXCA 4IKFA 1Q7YU 3QYEA 3DLMA 4FIBA 1S72T 4JDSA 3L2RA 2DK3A 1UB4A 1QVFS 3M55A 4M7DG 4C92A 1QW1A 2QQ9A 3OYAA 1TH7A 4R55A 3LWHA 3M9QA 4J8OA 5DM7R 2VYTA 1YHQT 2F69A 2XICA 1M90U 4C92D 4CI0C 3CCVT 3CPWA 3FIFA 3CCLT 2ZCFB 1M1KC 4MIMA 1JBMA 2LX9A 4C8QA 3TW7A 3V7SA 4M7DD 5J26A 5GANd 4OB0B 3X28B 3QHSA 1NZ9A 3V8JA 4C8QD 4BBRM 5GAOl 2RHYA 2B8AA 1WJQA 2JTFA 3CMEA 2EQKA 4M7DC 3I56A 2GFUA 4P5NA 3OYHA 4JX5A 4MDWA 3M58A 4FU6A 4MZTA 2ZPIB 1LJOA 2KK4A 3HHTB 5A0LA 4M77F 5GMKh 1U1SA 2KSSA 5GAOr 5L8RE 2DXBB 4M6VA 2HNIA 3GPLA 2FHDA 2XI9A 4AKGA 2E64A 2QQBA 5IAYA 1VQ4A 1R8OB 1UGQB 2VGNA 4F7UE 3I55T 2R5MA 2EJFA 3G4ST 2CGHA 4Z02A 1JJ2S 4OF1A 3G71T 3PFSA 5EG2A 3RMQA 4B9WA 2QEXA 2RM4A 3FLGA 2C06A 1FWZA 4N4HA 2DXBA 1U1TA 1KQSS 1KC8C 2A7YA 3CCSA 3C12A 1WJSA 3JCMg 1LOJA 3JB9I 2HAXA 5GAN2 5FRNA 2EKOA 3OYKA 4EMKC 1I5LA 3QSUA 3CCUA 3VKHA 1G3WA 3A8GB 1OZ3A 3CBPA 2CZ0B 3LGFA 2RHXA 4E7IA 5C0MA 2F5KA 1VQ9A 3M56A 2PQWA 1GXIE 4Z6YA 1WJRA 3JB9H 3OYMA 2QQAA 4NS5A 2XDBA 2DTHA 4YTLA 1NJIC 2DD5B 4RMOA 3HSBA 1MGQA 1WPYA 2QXFA 3CC4T 2K5IA 4M75E 5GANg 1N6AA 1VQOT 4FM4B 5LJ5e 3QBYA 5LJ5f 4HCBA 4A4EA 1OI1A 2QDJA 1P92A 4A4GA 2GCXA 3JCMJ 3A8HB 1YJ9T 3JRZA 3VV0A 1VQNA 1K9MC 1M5Q1 4ZGEB 2DD5A 2L89A 3QUIA 2DD4A 4M78B 5FU7B 4LDYA 2JOYA 4LDWA 5CQXA 5GAOp 4QVCA 1N8RC 3GOXA 4V2SA 4GLKA 2JUFA 3MO8A 3KHIA 3TEEA 3OW2S 3O8VA 4DOWA 1VQ8T 1YBYA 3JB9J 2LQKA 2VXFA 3J7AF 2L8DA 2X4XA 2QF7A 4M78A 3DLLA 4ZGDB 1DJ7B 3JCMP 1YIJA 4C92E 1VQKT 2V8IA 3KBGA 4ZGJB 2X35A 1N27A 4R56A 3V8KA 2MMPA 1VQMA 4WF2A 5CCAA 3OBYA 3QJYA 2LRQA 2FB7A 3V7CA 4C8QE 4F7UG 3FJPA 1LNXA 3NTIA 5KCOA 3CCQT 4JJNK 3L42A 4QW2A 2Y4XA 4ME7A 2E70A 3GLXA 2YRVA 4KT0E 4OVAA 1YI2T 1BIBA 2EAYA 2DKGA 1Q82U 3QYHB 1WGSA 2XG8D 3CMAT 4JRPA 3UPUA 4C5GA 4ELJA 2QTXA 5CKHA 4HT9A 3OYFA 1M1GA 4PJOB 2EQUA 2JN0A 3M57A 4C5EA 1XTDA 3DB4A 3RMSA 2KR6A 2QQ8A 1UGPB 5GAN4 1X01A 3ZEHA 2P0PA 3MEUA 3V8LA 2MF2A 2LCLA 4BI8B 4N0AA 4OMFB 2PUKB 4XU3A 4DQ2A 5LJ5h 1Q7YC 3PMTA 1JJ2A 1VQ7T 1KHCA 4PLLA 3UT1A 4X9CA 3CC2A 3ZBDA 4PJOF 4M75G 5GAMe 5GAMf 2GQVA 4FL6A 3OS0A 2VGMA 1KQSA 2EYQA 3VU3C 5HK3A 3QWLA 2E65A 3OA6A 3OYBA 2R57A 2QFZA 4M7AB 1ZHIA 2DTOA 2RJEA 3MEVA 4RG2A 5A2QE 3PIOA 3PMIA 3OYIA 2KDSA 3CD6A 2KVQG 4M75D 2MWPA 1K73C 2JZ2A 2LQ8A 2ZZDB 4M75C 5CR2A 4JLGA 3VYHB 5FU6C 4EDUA 4J83A 3M4GA 5LJ3j 3S3OA 1VQLA 4XTWA 5AYFA 4BACA 3M59A 3JB9D 2YHTA 1YJNA 3KUFA 4C5HA 2XK0A 2RHZA 3BFMA 4BY6C 4C92G 2LC4A 2WSEE 3ZFJA 4XAXB 2K5LA 4J7IA 2E1HA 2QI2A 5GMKj 1G3YA 5I2MA 3HPWA 3OMGA 4C8QG 4PL6A 3CMET 1QVGA 3HRTA 3I56T 2VC8A 4IUUA 2O4XB 4MFDA 1XNIA 2BIVA 4OGCA 3L2VA 5GAN5 1BIAA 2FVUA 3TCJA 4C92C 3OW2A 1Q86U 4M77B 2LTOA 3L1AA 3RERA 4XU0A 2OTLA 4IURA 1K73U 3E9GA 4M78E 3SWNB 4C8QC 2K3YA 2KMGA 1VQ4T 2DXUA 4KUIA 2X4YA 4HKEA 3GP8A 2DIQA 4M77A 2ZPHB 1Y96B 3HP9A 4AI6A 2CS7A 3OY9A 4HNUA 5GAMh 2XDDA 2RO0A 2RK2A 5LJ5d 4XTVA 1QLBA 2DEQA 1Y7XA 2QEXT 4JX6A 3P8BB 3E19A 2VUBA 2K3XA 3MCAB 3SWNA 2DZ9A 4M7DF 3JAME 3CCST 3GF5A 1I4K1 4XTZA 4PJOC 2L5QA 4IUTA 1XQHA 3EFRA 3E1SA 4OP0A 4A4KA 3CCUT 1Q81U 3OSVA 4BDYA 3NTHA 1VQ9T 4HCCA 3OYEA 4NC6A 4QVZA 4C5IA 5IN1A 3M5AA 5DY9A 1PSEA 3DKMA 4XTUA 2H3JA 2HD0A 3QDRB 1VQPA 1BI1A 2P0KA 5CQYA 3QXEB 2AHJB 1O75A 3LLRA 4EMKB 3JCMb 4RG8A 1UGSB 3E9FA 3TREA 1SSFA 4JLIA 1VQ5A 3SD4A 3C94A 2RI5A 5HY6A 4C0ZA 4L59A 3HO8A 3MP1A 4QQDA 1MHNA 2K2VA 3OS1A 1N9SA 4FSXA 1VQNT 5EJCA 4JX4A 4IUPA 3OYDA 1M1KU 2V8JA 1KG1A 1QVPA 3JSCA 1NPRA 2XHCA 3QZ9B 2P0QA 3C4SA 4E47A 4MZPA 2JTMA 3FC3A 4B9XA 3URGA 1JRIA 4E7HA 1YITA 5A0GA 1YIJT 1Q82C 1QVGS 2DJZA 4M7AE 5GANj 1K8AU 2CZ6B 4OB1B 2DVEA 4TVRA 1WNLA 5GMKm 3CCRA 1VQMT 4M78G 2LNVA 4LD6A 3PNWC 2WSFE 4XQ3A 2BS3A 2PVGB 3J80E 1I81A 3OYGA 5J39A 4ATOA 3JCMV 5GAMd 4JRIA 4J6YA 2EWNA 2G3RA 4M78D 3MHXA 3CCMA 5D6YA 3VKIA 4ELZC 1BYMA 4PKCC 3C95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCF B;  2ZPE B;  4OB0 B;  3X28 B;  2CZ7 B;  2ZZD B;  3X20 B;  2ZPB B;  3VYH B;  2DPP B;  2ZPI B;  3HHT B;  2PVO B;  2WSE E;  5L8R E;  2DD4 B;  2DXB B;  3QYG B;  3VYG B;  1JB0 E;  1UGQ B;  1PSF A;  3X26 B;  1IRE B;  2DXB A;  3VYG A;  2CYZ B;  1UGR B;  3A8G B;  2CZ0 B;  1GXI E;  4L6V 5;  3QZ5 B;  2CZ1 B;  2ZPH B;  1V29 B;  2WSC E;  3X24 B;  3A8L B;  2DD5 B;  2ZZD A;  4FM4 B;  3A8O B;  4OB3 B;  2PUO B;  1AHJ B;  3A8H B;  2DXC B;  4ZGE B;  2DD5 A;  2ZPF B;  4RKU E;  2DD4 A;  2PU9 B;  1PSE A;  3QXE B;  2AHJ B;  3A8M B;  3WVD B;  1UGS B;  4ZGD B;  1DJ7 B;  4ZGJ B;  3WVE B;  4XK8 E;  3LW5 E;  3QZ9 B;  4KT0 E;  4Y28 E;  3QYH B;  4OB2 B;  1QP3 A;  2CZ6 B;  4OB1 B;  2PVD B;  3X25 B;  2ZPG B;  2QDY B;  2D0Q B;  1UGP B;  2WSF E;  1QP2 A;  2DXC A;  2PVG B;  2PUK B;  2O01 E; 
#chains in the Genus database with same CATH topology
 1G2B A;  1OZ2 A;  2F5T X;  2DL5 A;  2HL3 A;  3BHT B;  4BE2 A;  1Q95 G;  2R5A A;  4BE1 A;  3CC7 A;  4M77 E;  2DPP B;  2QGG A;  3VRZ A;  3H8Z A;  3H9N A;  1VQO Q;  5FWB A;  4A54 A;  2PTK A;  3PIP A;  2E6Z A;  3HTR A;  2JNG A;  4BXX X;  2LCC A;  1JB0 E;  4LD9 K;  3OW2 P;  4PFZ A;  1M90 C;  1G83 A;  3GIB A;  2X3W D;  4BE0 A;  2D6F A;  4XTY A;  2EGE A;  2CYZ B;  4ELY C;  1I1J A;  2EUF A;  4OGR B;  3N5B B;  1AZG B;  2OTJ A;  4ZTJ A;  4RTX A;  1O9S A;  4DOV A;  1YI2 Q;  3UWN A;  1RAH B;  1UEC A;  3CMA Q;  4RCC A;  1M4Z A;  4AFU C;  4MML A;  5HCK A;  4D6W A;  1VIF A;  3FB9 A;  3FEO A;  2RHU A;  1IGU A;  1Y07 A;  1KD1 U;  2ROL A;  3HKS A;  1H3Z A;  2HKQ B;  2DRM A;  2A36 A;  1H4L D;  4C92 B;  1YCY A;  2FZG B;  2RH2 A;  4BD3 A;  2K79 A;  4J6X A;  3ZL7 C;  1RAD B;  1WHG A;  3QWX X;  1MMD A;  4QQ6 A;  3WVD B;  4C8Q B;  5IHN A;  1HJD A;  2OAW A;  2KY9 A;  3P8D A;  1OEB A;  2QAZ A;  4AFZ C;  2KXC A;  2EYW A;  2RJC A;  2M0Y A;  1IO6 A;  2WIP B;  1B7T A;  1OUL A;  2ZGW A;  4BCQ D;  4O5V A;  4OMO A;  3UA7 A;  1X69 A;  1NM7 A;  3SWN C;  2KQW A;  3CCL A;  3F70 A;  3RGF B;  2DIG A;  5KH6 A;  1Z9Z A;  3HL8 A;  3JCM f;  1X75 C;  2E5Q A;  4PJM A;  1VIE A;  4EPC A;  1R77 A;  1WLP B;  3PO3 S;  3NMZ C;  4MZM A;  1V1C A;  2L2P A;  3JCM c;  2EYX A;  4MFE A;  2ZPE B;  5DLO A;  3H4C A;  5IHY A;  2E6N A;  3CCR T;  2COW A;  5GAN e;  3H0I A;  3EGD A;  2FYK A;  5CO7 A;  4BI4 A;  1NG2 A;  3DL1 A;  5KE2 A;  3SB2 A;  2QEX Q;  4JS4 A;  3CCM T;  3BLH B;  2FG0 A;  5LJ5 g;  1WXU A;  3RKX A;  1KD1 R;  2KI7 A;  4VUB A;  1PHT A;  1X2K A;  2YUQ A;  2XKO C;  2E3H A;  2RB6 A;  1NLP C;  1RAC B;  5FU7 C;  4F16 A;  5GAN 7;  1D3U B;  1IZ6 A;  2JT4 A;  3CC4 A;  2BUD A;  2BS2 A;  2JM9 A;  2K4Y A;  4PJN A;  4BCF B;  2CP2 A;  1T0J A;  4RTY A;  2EGA A;  1YJ9 A;  2CDT A;  1ENW A;  2QAS A;  1GH6 B;  1OYX A;  4M78 F;  3TU4 K;  1D3B B;  4F7U B;  2FPD A;  2LJ0 A;  2WSC E;  3L2Q A;  3X24 B;  1EZZ B;  1RAF B;  3BHU B;  5GAN 3;  3SDZ A;  4FYX B;  3POM A;  3S3M A;  4II1 A;  5GAN h;  1YJW T;  5HBJ B;  4E7Z A;  1VQM Q;  4BCH B;  3TSZ A;  2XDP A;  2PU9 B;  3VJP A;  5GMK l;  1KD1 C;  2M51 A;  1N8R U;  4BI3 A;  3DB3 A;  1FMW A;  2ECZ A;  3PVQ A;  2NLU A;  1B34 A;  2A0F B;  4M75 B;  3TSW A;  3CC7 Q;  1G5V A;  4BY6 B;  1SKU B;  1KJW A;  2YSQ A;  1R0C B;  2GF7 A;  1BCM A;  2HMA A;  2D9T A;  1OOT A;  2QQS A;  3A98 A;  3X25 B;  1BB9 A;  1UTI A;  2ROT A;  3M4Y A;  3EG9 A;  4RTZ A;  1I0C A;  4JRK A;  4J5Y A;  2FPE A;  3MP8 A;  4JUV A;  3PT9 A;  1S72 T;  4HCK A;  1QW1 A;  2QQ9 A;  1TH7 A;  2PNI A;  4J8O A;  1YHQ T;  4F6S B;  1TU0 B;  3U23 A;  2LX9 A;  3VRY A;  4M7D D;  5IF1 B;  5GAN d;  4QT7 A;  3X28 B;  1NZ9 A;  4BBR M;  3CME A;  1I07 A;  1JQQ A;  3I56 A;  3MJX A;  4P5N A;  3OYH A;  4JX5 A;  5KYU B;  5DQV A;  1AT1 B;  2ZPI B;  2W2H A;  4EOJ B;  1GUX A;  4M77 F;  2DBM A;  2V26 A;  2XI9 A;  2E64 A;  1VQ4 A;  1R8O B;  3I55 T;  2EJF A;  3G4S T;  4JPB W;  1JJ2 S;  3G71 T;  4FW2 A;  4B9W A;  2EPD A;  2MK5 A;  3CCS A;  1LOJ A;  3JB9 I;  4LE9 A;  1G3W A;  3LGF A;  1M8M A;  2RHX A;  2F5K A;  1WHJ A;  1GXI E;  1WJR A;  1C6V X;  3CCL Q;  3DDP B;  2QQA A;  2P4R A;  4DBQ A;  4YTL A;  2DD5 B;  5LMK B;  1MGQ A;  2QXF A;  2K5I A;  5GAN g;  3GTM S;  2GCX A;  2VVK A;  2O31 A;  4EC8 B;  4ZGE B;  1M5Q 1;  2L89 A;  3QUI A;  2DD4 A;  4WTO B;  2RQU A;  2JOY A;  4LDW A;  5GAO p;  1NEG A;  1N8R C;  3GOX A;  2DM1 A;  3TEE A;  2J7I A;  1YBY A;  2C5V B;  1IB8 A;  3BHV B;  1VQK T;  2JGZ B;  2DE0 X;  1OPK A;  3TNH B;  2C0I A;  3OBY A;  2LRQ A;  3NHN A;  4F7U G;  3CCQ T;  4JJN K;  4ME7 A;  2E70 A;  4KT0 E;  2YRV A;  4OVA A;  4IIM A;  4JRP A;  4E7S A;  1OI9 B;  4ELJ A;  2QTX A;  1UUE A;  2KXD A;  2EQU A;  2JN0 A;  5IXB A;  3M57 A;  4C5E A;  4B6M A;  3CC4 Q;  1FMK A;  4JJB A;  4CXA B;  5GAN 4;  2P0P A;  3MEU A;  3CPW P;  4XU3 A;  5FRM A;  2CP7 A;  1JJ2 A;  1YJ9 Q;  3PMT A;  1VQ7 T;  1KHC A;  4PLL A;  1GY3 B;  1BBZ A;  1FMV A;  4M75 G;  1H1R B;  2VGM A;  2E65 A;  2QFZ A;  1ZHI A;  5CEI B;  1H1Q B;  2KVQ G;  1RI9 A;  4EIK A;  2LQ8 A;  4M75 C;  5CR2 A;  3S3O A;  4BAC A;  2YHT A;  3KUF A;  2XK0 A;  4BCI B;  4BY6 C;  2X51 A;  1VQ6 Q;  3FJ5 A;  2QI2 A;  1G3Y A;  3H0H A;  3HPW A;  3OMG A;  3HRT A;  4WCI A;  1F1B B;  4FYY B;  2O4X B;  4MFD A;  1Q86 U;  2WHB B;  2FVU A;  2L0A A;  4LN2 A;  5DQW A;  3L1A A;  2NUZ A;  4BCQ B;  8ATC B;  2DXU A;  4DBR A;  2AT1 B;  4HKE A;  3GP8 A;  1K9M R;  2DIQ A;  1K76 A;  2EBP A;  4HNU A;  2RO0 A;  3SWN A;  3MCA B;  2DZ9 A;  2KBT A;  1XQH A;  3MPU B;  3EFR A;  3CCU T;  4ORZ A;  3OSV A;  3CCE Q;  2JTE A;  1QVF P;  2GTO A;  4EOP B;  4QVZ A;  3M5A A;  2R7G A;  1BI1 A;  2CT4 A;  2AHJ B;  4EMK B;  4BCN D;  4BCJ B;  3CCV Q;  1SSF A;  3SD4 A;  4FX3 B;  2RI5 A;  3LQ5 B;  4C0Z A;  1N9S A;  4JX4 A;  2V8J A;  3JSC A;  3C4S A;  2LCS A;  4E47 A;  5I5Z B;  4AG1 C;  4MZP A;  2JTM A;  1VQ4 Q;  3FC3 A;  4RTV A;  2JS2 A;  1RAG B;  2DL3 A;  4M7A E;  5GAN j;  4AFQ C;  1ZA1 B;  2HEQ A;  3CCR A;  3PNW C;  2WSF E;  4XQ3 A;  2J05 A;  3DTO A;  2PVG B;  1Q86 R;  2COZ A;  3JCM V;  4J6Y A;  3CCM A;  5D6Y A;  1PCX A;  1D0X A;  3C95 A;  1G3S A;  1VYU A;  2PK2 A;  3O5Z A;  1BI2 A;  1AWX A;  3UAT A;  4C0D C;  1MUZ A;  3QII A;  2M0O A;  1H24 B;  2E10 A;  3CC2 T;  1MV0 B;  5HBH B;  4AMC A;  3AHU A;  5I11 A;  4HCZ A;  2BKD N;  3LX7 A;  4G6L B;  3CD6 T;  4YOO A;  2G9X B;  1JO8 A;  3RDV A;  2P84 A;  4UN0 A;  4QKU A;  1KIK A;  4RCB A;  2DYB A;  1VQ8 Q;  1W4S A;  3I5R A;  1Q86 C;  2GFA A;  2WEV B;  3QPH A;  1YJN T;  3EH2 A;  3JB9 G;  3HRS A;  4DEX A;  3ASK A;  1YJW A;  4ZN1 A;  2V1Q A;  2GQI A;  1MMG A;  5KE3 A;  1W2B A;  2JW4 A;  4FYV B;  4L6V 5;  2CKK A;  4NL3 A;  1KXU A;  3RES A;  4J9F A;  2E12 A;  2ZZD A;  1C1A A;  4HNT A;  4E7J A;  1OU9 A;  2LVM A;  2G77 A;  2DXT A;  4FT2 A;  2BE7 D;  1YCS B;  2OTL T;  2QGF B;  3A5Z B;  4KUL A;  4A4H A;  4XTX A;  2XD0 A;  2DXC B;  3QSU A;  3HFO A;  1M3A A;  1EIF A;  2HZY A;  2K6D A;  2RHI A;  3EFS A;  2YUO A;  4M7D B;  4CRL B;  2YLB A;  2C5X B;  1KQ2 A;  4A4F A;  1KFZ A;  3NTK A;  2YT6 A;  2DO3 A;  5A0D A;  1CKA A;  3M54 A;  2RI2 A;  1S72 A;  3LW5 E;  1UG1 A;  4KGV B;  4BCM D;  1YP5 A;  1HYO A;  3QO3 A;  2AKK A;  1YHQ A;  2MIO A;  3EAE A;  5FGK B;  3VS0 A;  3ME9 A;  3SEM A;  5CVI A;  1X6B A;  4J9G A;  2QDL A;  1JSU B;  2UZB B;  3WXM B;  2MWO A;  1U3O A;  2E4H A;  1Z9Q A;  2V8K A;  3RIR A;  2EVR A;  2YLC A;  2KYM A;  4CC7 A;  1J3T A;  2DER A;  4F14 A;  4AKI A;  3I55 A;  1UEB A;  3G4S A;  5GAN f;  3L2W A;  3G71 A;  4PFP A;  4EOM B;  2W10 A;  1GRI A;  1Y0M A;  4KRD B;  3TW6 A;  1BI0 A;  5HVY B;  5EC7 A;  5IDP B;  4NL2 A;  2YRD A;  1VQ9 Q;  5KYY B;  1WHM A;  1ABO A;  4EOR B;  4BUG A;  3DJB A;  2QK0 A;  1T3S A;  2K57 A;  5CKD A;  3INZ A;  2CCI B;  4HA8 A;  4BB7 A;  2K2M A;  1WHK A;  2EKH A;  1VQN Q;  4GLM A;  2ZAE A;  4EOO B;  3EG2 A;  4OGE A;  5KYN A;  3BDL A;  3A8L B;  2KEA A;  4PJO G;  3CCR Q;  1ZQ1 A;  4F7S B;  1JXO A;  1BCO A;  2QA4 T;  2JMA A;  1VQK A;  2EW3 A;  2HBW A;  1AHJ B;  3BG5 A;  1D3B A;  2ABL A;  2BZY A;  4F7U A;  4E7L A;  2HSP A;  5HQ0 B;  2M9U A;  3CCM Q;  4KRT A;  1O9K B;  4X34 A;  4FCY A;  4J9E A;  1NE8 A;  4PJO C;  5I2S A;  3CCQ A;  4N4I A;  4LUE A;  5EFQ B;  1NPP A;  5I22 A;  4M7A G;  1M1K R;  2OI3 A;  4ZNX A;  4J6W A;  1MMN A;  4JS5 A;  1H92 A;  1UGV A;  2M1H A;  3MET A;  2EQI A;  6AT1 B;  3L2U A;  1TTH B;  3CCJ T;  4M7A C;  2DAQ A;  5C6S A;  4M75 A;  4OMN A;  3QDF A;  1VQ7 A;  4RUG A;  1Y71 A;  4IMY B;  1ZA2 B;  1B3Q A;  4OB2 B;  4FT4 A;  1H27 B;  3D7S B;  5I21 A;  3S3N A;  3G6E T;  4M7A F;  2DTI A;  1UNH D;  4Z89 A;  1PC0 A;  2I53 A;  4KH0 B;  3EG0 A;  3L2R A;  2C6T B;  2KYB A;  4M7D G;  3OYA A;  4R55 A;  3LWH A;  3M9Q A;  5DM7 R;  1VQL Q;  1AEY A;  2AIR B;  3VS6 A;  2O88 A;  2DL4 A;  1M1K C;  4MIM A;  1JBM A;  1TUD A;  1JEG A;  3TW7 A;  5J26 A;  2WMB B;  5BNJ B;  1WYX A;  1UHC A;  3V8J A;  3VS7 A;  2FZC B;  4M7D C;  1EX4 A;  2EQK A;  1BU1 A;  3MIA B;  1I5O B;  2KK4 A;  2DNU A;  1WA7 A;  5GAO r;  2HNI A;  2B9R A;  2BZ8 A;  2FHD A;  4F7U E;  4BCN B;  2UZD B;  2QTV A;  2LNH B;  4OF1 A;  2RM4 A;  3FLG A;  3H41 A;  3MY5 B;  1FWZ A;  3MKD A;  1KQS S;  1S72 Q;  2HAX A;  2DL7 A;  5FRN A;  1I5L A;  3CCU A;  3M03 A;  1D1C A;  3CBP A;  4E7I A;  5C0M A;  3O0G D;  4Z6Y A;  3UA6 A;  1OV3 A;  1WIE A;  1SG5 A;  3EOC B;  1MND A;  2KRN A;  4RMO A;  3HSB A;  4TTH A;  1VQP Q;  1VYW B;  4M75 E;  1VQO T;  4FM4 B;  4HCB A;  4A4G A;  1P92 A;  2L3P A;  1XO2 A;  3A8H B;  1OL1 B;  2HL5 C;  3JRZ A;  3VV0 A;  1VQ5 Q;  2JM8 A;  2DD5 A;  3EFO B;  2DME A;  5CQX A;  2JS0 A;  1ZSZ C;  1AVZ C;  2VXF A;  2X4X A;  2QF7 A;  1UE9 A;  4ZGD B;  4NST B;  1YIT Q;  1WZO A;  2WPA B;  2V8I A;  3KBG A;  4ZGJ B;  2X35 A;  3V8K A;  2CJM B;  2MMP A;  4WF2 A;  3QHW B;  4AT1 B;  3BLR B;  5KCO A;  1ACM B;  4ESR A;  1VYV A;  3GLX A;  1YI2 T;  2NUT B;  3MY1 B;  2DKG A;  2J06 A;  3QYH B;  1WGS A;  2DIL A;  2F2V A;  4ANJ A;  3CMA T;  1SRM A;  1PD1 A;  4HT9 A;  1M1G A;  1SPK A;  2E5K A;  2KR6 A;  3RMS A;  1VA7 A;  1X01 A;  1X27 A;  4DQ2 A;  2CH4 A;  2UUE B;  2A28 A;  3UT1 A;  3CC2 A;  3PVL A;  5GAM e;  2ESW A;  2GQV A;  1KQS A;  1ZUU A;  3VU3 C;  3QWL A;  3OYB A;  1RAB B;  2DTO A;  1RLQ C;  1TXQ A;  3PIO A;  3CD6 A;  3EHR A;  3VS5 A;  4EOQ B;  2JZ2 A;  1NYG A;  2QYZ A;  4JLG A;  4EDU A;  1OU8 A;  1YNZ A;  5AYF A;  2I40 B;  3M59 A;  1YJN A;  4X1V A;  2DJQ A;  4C5H A;  2RHZ A;  4C92 G;  1MNE A;  2LC4 A;  3ZFJ A;  4XAX B;  4CFM B;  4J7I A;  2E1H A;  1GCP A;  1ABQ A;  4C8Q G;  1QVG A;  2CP6 A;  2OTJ Q;  1XNI A;  2BIV A;  4C92 C;  3I35 A;  1W70 A;  1QMZ B;  3RER A;  2OTL A;  2C4G B;  1K73 U;  3E9G A;  1TOV A;  1QCF A;  4BCM B;  4C8Q C;  2RQV A;  4KUI A;  3OY9 A;  2XDD A;  5GAM h;  2QEX T;  1N8R R;  2DL8 A;  2EYY A;  3P8B B;  2AK5 A;  2D8J A;  2K3X A;  2LQW A;  4RTU A;  2O9S A;  1I4K 1;  2L5Q A;  4J9C A;  4OP0 A;  1Q81 U;  2OX7 A;  3EID B;  2VKN A;  2X1N B;  4HCC A;  1GCQ C;  4NC6 A;  1C9B A;  2NWM A;  2DVJ A;  3M0S A;  3DKM A;  2H3J A;  2F2C A;  2IIM A;  2P0K A;  1OKV B;  3QXE B;  1O75 A;  3LLR A;  5CQY A;  2JXB A;  4RG8 A;  1QMC A;  3VS2 A;  4L59 A;  4Z88 A;  4QQD A;  1NBE B;  3EGD B;  1M2O A;  2KNB B;  1QVP A;  2PZ1 A;  1NPR A;  1URC B;  1WHH A;  1JRI A;  4E7H A;  1AWJ A;  1YIJ T;  4OB1 B;  4TVR A;  3EHQ A;  1WHL A;  1JJ2 P;  3G1J A;  1VQM T;  4HXJ A;  4ROC A;  3NDQ A;  2YUP A;  2BS3 A;  3J80 E;  1WXB A;  3I5S A;  4A63 B;  5J39 A;  3EGX A;  5GJW B;  5GAM d;  1GBR A;  4EOL B;  4M78 D;  5IH2 A;  2F1L A;  4ELZ C;  4I3Z B;  1PM3 A;  4JRQ A;  5CIU A;  5GAN 8;  2FO0 A;  4JJC A;  1TFB A;  4GY5 A;  4ZN3 A;  1E7P A;  1GBQ A;  2A08 A;  3EGU A;  5KYW A;  3X20 B;  2MOX A;  2L3R A;  3OS5 A;  5HBE B;  2OAU A;  4D8D A;  1E7O A;  1NJI U;  2VXE A;  1K0X A;  2DRK A;  3KXT A;  3VYG B;  4CFW B;  4PJO A;  5M9O A;  3GNF B;  5HNB B;  2HKN A;  3R6O A;  4E6R A;  3LWI A;  2Y4Y A;  4MMK A;  4F7U F;  1IRE B;  1B34 B;  2RK1 A;  2FRY A;  2QA4 A;  1FIN B;  4J7F A;  4UC4 A;  5IT9 E;  5LJ3 e;  1H26 B;  4AFS C;  1ZP2 A;  5GAO m;  5FLX E;  2LT4 A;  3BW1 A;  2YWW A;  1M1F A;  4M7A A;  1S1N A;  4OML A;  3CBM A;  1X6O A;  3G7Z A;  1V29 B;  2RD1 A;  4F7J B;  5FRO A;  2DEU A;  1YWP A;  2L3S A;  3QG1 A;  1OGU B;  1UFF A;  4M75 F;  1Q81 C;  4RKU E;  1H25 B;  3CCJ A;  1G3N C;  4E2F B;  2IVX A;  4BDZ A;  3PTA A;  4HVV A;  4PJL A;  2QG9 B;  2Y90 A;  2C5O B;  1M9S A;  1GFC A;  3BDU A;  4N4G A;  1BI3 A;  4BBS M;  1SHF A;  2EJ9 A;  5CKB A;  5KYX B;  1SHG A;  2KT1 A;  2KE9 A;  3G6E A;  4M77 D;  3WVE B;  4M7D A;  4O6J A;  1YJN Q;  4XK8 E;  1HK9 A;  3BG9 A;  4F7L B;  4HLQ A;  4CFN B;  1ZUY A;  1Y96 A;  3RBB B;  2IW8 B;  5LJ3 h;  2WJ9 A;  1GUX B;  4CC2 A;  1QCN A;  3BY7 A;  3VKG A;  2G6F X;  4KRC B;  4EC9 B;  2D0Q B;  4LDX A;  1QP2 A;  3I9Q A;  3CME Q;  1UNG D;  2OTL Q;  4PJO E;  3I56 Q;  1FKM A;  1OL2 B;  4YC3 B;  1IRX A;  2HQE A;  1W2B S;  2BTT A;  2O9V A;  1E9H B;  2O01 E;  1H1P B;  2EQJ A;  4PFO A;  2CP3 A;  2NUP B;  3JCM X;  4C0F A;  4C0G A;  4KGX B;  2RQW A;  1M8V A;  2I2L A;  1QWE A;  2KR3 A;  2LDM A;  3CXC S;  4BCO B;  3J81 E;  4QSH A;  1U8R A;  1PRL C;  3OYJ A;  3CCS Q;  1G8X A;  2PVO B;  1D1A A;  3M0Q A;  2DD4 B;  4AKH A;  1GL5 A;  4XU1 A;  1QKW A;  2EIF A;  1PSF A;  2A37 A;  4IUV A;  4RTT A;  2NYS A;  1ZSZ A;  4NOY A;  1KC8 U;  1VQO A;  5LJ3 d;  1W2B P;  2A3L A;  1WQW A;  2AZV A;  5KYY A;  1QVF A;  4GBQ A;  4XU2 A;  1OPL A;  2CZ1 B;  3DOG B;  3M0U A;  2VB6 A;  4M7D E;  3IQL A;  1PD0 A;  4Y91 A;  2WAC A;  1JOW A;  1SRL A;  4EOS B;  2E41 A;  5CK9 A;  1VQ6 T;  4LDV A;  2AKL A;  5DLQ E;  1HXD A;  2RJF A;  2VV5 A;  2RJD A;  2KRM A;  2EJG A;  3T9N A;  4E7K A;  3UDC A;  2HQX A;  1YI2 A;  3LYI A;  1JXM A;  2IG0 A;  3S6W A;  3CMA A;  1O9K A;  5GAO q;  1ZBX A;  4MDX A;  1RL2 A;  3OSS C;  5FU6 B;  2CUD A;  4F04 B;  1AZE A;  4IUQ A;  1KHI A;  5LJ3 g;  5GAM j;  2XU8 A;  3GNG A;  3HFN A;  3QHR B;  3VS3 A;  3JV3 A;  4Y28 E;  2HDA A;  3M0T A;  3CXC A;  2LP5 A;  2CH4 W;  3H6Z A;  4OMP A;  4KBM B;  1QP3 A;  3RUX A;  4JZ3 A;  3EH1 A;  2QDY B;  3CCE T;  3JB9 F;  4HL4 A;  2LJ1 A;  2YDL A;  1Q7Y U;  3DLM A;  1IHV A;  4LUD A;  4JDS A;  2DK3 A;  3M55 A;  4C92 A;  3NGP A;  1H3H A;  2KT8 A;  1M90 U;  4CI0 C;  3CCV T;  3FIF A;  4C8Q A;  3V7S A;  1F5Q B;  4FW1 A;  4PK4 A;  5GJV B;  4F6W B;  2D1X A;  2JTF A;  2RHY A;  3REB B;  4FU6 A;  4MZT A;  1TUC A;  2HQH A;  1LJO A;  3MI9 B;  3HHT B;  5A0L A;  2FZK B;  2RQR A;  2B86 A;  2DXB B;  4M6V A;  4AKG A;  2PK9 B;  1GCQ A;  2GNC A;  2VGN A;  2R5M A;  2CGH A;  4Y92 A;  2WXV B;  3PFS A;  2QEX A;  3G6E Q;  2MCN A;  1KC8 C;  1WJS A;  1WX6 A;  5GAN 2;  4EMK C;  2MPX C;  4J9I A;  3VKH A;  1KK7 A;  3BLQ B;  3A8G B;  2CZ0 B;  4F70 B;  2YUN A;  3M56 A;  3TQ7 P;  2PMI B;  3JB9 H;  1WXT A;  2YRC A;  5FWC A;  1AIS B;  1WPY A;  4OR5 B;  1N6A A;  5LJ5 e;  2BE9 B;  3QBY A;  1P5E B;  2UZL B;  1OI1 A;  2GTJ A;  1EFN A;  2K7A A;  4R0K A;  2LMJ A;  4M78 B;  5FU7 B;  4LDY A;  2CRE A;  2ED0 A;  4V2S A;  3OW2 S;  1VQ8 T;  3JB9 J;  2HSE B;  4Y72 B;  3EFO A;  3DLL A;  2KRS A;  3JCM P;  1YIJ A;  4C92 E;  1ZLM A;  2H8H A;  2K3B A;  1VQM A;  3QJY A;  1BU2 A;  2FB7 A;  4C8Q E;  3FJP A;  1LNX A;  3NTI A;  3L42 A;  2Y4X A;  2DF6 A;  4AG2 C;  1Q82 U;  3UPU A;  4C5G A;  5CKH A;  1X43 A;  1CKB A;  1ARK A;  4EOI B;  1HD3 A;  2QQ8 A;  2NUT A;  1X2Q A;  3V8L A;  1RLP C;  2MF2 A;  4JZ4 A;  2LCL A;  4BI8 B;  1TUG B;  4OMF B;  2PUK B;  1Q7Y C;  5LJ5 h;  1UHF A;  3KFV A;  3ZBD A;  4PJO F;  5GAM f;  4FL6 A;  3EJ1 B;  3OS0 A;  2EYQ A;  3OA6 A;  3RR6 A;  2SRC A;  2R57 A;  5A2Q E;  3PMI A;  2X9H A;  1U06 A;  4J9B A;  2ZZD B;  1NEB A;  1M2V B;  1K9A A;  5FU6 C;  5LJ3 j;  3JB9 D;  3TNW B;  3BFM A;  2WSE E;  4YOZ A;  1YJW Q;  2L3Q A;  5GMK j;  1PG5 B;  2GBQ A;  3TVT A;  3AT1 B;  4BCG B;  2J6O A;  4KGZ B;  3OW2 A;  3TCJ A;  1BK2 A;  4M77 B;  1H28 B;  4XU0 A;  4IUR A;  2RPN A;  2KMG A;  2C0T A;  2X4Y A;  1WFW A;  1NYF A;  1Q82 R;  2CS7 A;  5LJ5 d;  4XTV A;  1QLB A;  1Y7X A;  4ROD A;  4CFV B;  5KYU A;  1TWB A;  3NPF A;  4M7D F;  3JAM E;  3GF5 A;  1V76 A;  4IUT A;  1E6H A;  1WI7 A;  1ZSG A;  3NTH A;  1VQ9 T;  3OYE A;  1ZUK A;  4C5I A;  5IN1 A;  5DY9 A;  2FPF A;  3QDR B;  1JU5 C;  1YHQ Q;  1UGS B;  1R0B G;  3E9F A;  3C94 A;  3OYL A;  2K2V A;  3OS1 A;  2CUB A;  4FSX A;  1VQN T;  5EJC A;  2E3I A;  4IUP A;  3EG1 A;  2XHC A;  2P0Q A;  1UJ0 A;  5IHK A;  1JKW A;  1PWT A;  5A0G A;  1Q82 C;  1QVG S;  1K8A U;  1YWO A;  2DVE A;  5GMK m;  4M78 G;  4YOS A;  2LNV A;  4LD6 A;  1OX8 A;  3I55 Q;  3G4S Q;  1KQS P;  1I81 A;  3G71 Q;  2MYS A;  2V22 B;  5CYI B;  2G3R A;  3VKI A;  1E6G A;  3TN8 B;  4M78 C;  1ZBJ A;  2VAS A;  2CCH B;  4ELL A;  3QWY A;  3BG3 A;  2XID A;  3CBO A;  2CT3 A;  4PLI A;  2RNA A;  1MV3 A;  3H0F A;  3BE3 A;  1BKB A;  2ED1 A;  2IPO B;  1QVG P;  2IW6 B;  2DFU A;  3HRU A;  4QQG A;  3RNJ A;  4F17 A;  5HK0 A;  1YIJ Q;  5J3B A;  5ECA A;  4PJO D;  2Z0W A;  4N0A C;  3HBL A;  1Y57 A;  1T3L A;  3VYG A;  1VQL T;  1U5S A;  1OX9 A;  1FX7 A;  3LGL A;  5LJ3 f;  1VQK Q;  3MEW A;  1XOV A;  1VQ6 A;  1UGR B;  1H1S B;  1KQ1 A;  4J9H A;  4CC3 A;  5CKE A;  3NFC A;  3CCQ Q;  4M7A D;  5D6W A;  2RA2 A;  1PKD B;  1K8A R;  4F6U B;  2EFI A;  2W96 A;  2RI3 A;  3A8O B;  4OB3 B;  3MEA A;  4M4Z A;  3ER0 A;  2PUO B;  3OYC A;  2P4T A;  1H64 1;  4QVD A;  2ZPF B;  1G3T A;  4CFX B;  4DA4 A;  2M16 A;  3FRN A;  3JCM Q;  3M0R A;  3PGG A;  3OBW A;  2LT1 A;  3REA B;  3SFM A;  1VQ7 Q;  4M77 G;  5CAI A;  2O4X A;  3F5X B;  1VYT A;  1JST B;  4HVU A;  2RF0 A;  2X4J A;  3CCE A;  4LDU A;  2AZS A;  5GAN 6;  4C92 F;  1RI0 A;  1VUB A;  2ATC B;  2DLP A;  3OB9 A;  4M77 C;  2KGT A;  4C8Q F;  1VQP T;  4LOC A;  2C0O A;  5KYX A;  1W1F A;  2DMO A;  3M0P A;  2QQR A;  2DA9 A;  1LVK A;  2M02 A;  2MI6 A;  1NLO C;  3CCV A;  3QJ6 A;  4CFU B;  2R58 A;  3L2Z A;  1VQ5 T;  1RAA B;  1K8A C;  3OS2 A;  2HBP A;  1LPL A;  5LL6 S;  2OJ2 A;  2WFY B;  3OYY A;  1UDL A;  5GAO n;  2CP5 A;  3JCM e;  2K9G A;  1AD5 A;  2J6K A;  3OMC A;  3VUZ A;  1YIT T;  3HZJ A;  4FYW B;  3CEY A;  3V7R A;  4EMK A;  4BY7 X;  1VIN A;  3K7A M;  1TS9 A;  3EG3 A;  4DBF A;  2CZ7 B;  5D6X A;  2ZPB B;  3QYB A;  1WQ7 A;  2KAF A;  5LQF B;  4L5G A;  2NUP A;  4PJJ A;  1OKW B;  1VOM A;  4HNV A;  1IHW A;  2EQM A;  3QYG B;  3CCU Q;  1ZX6 A;  1K73 R;  3Q1J A;  2BKZ B;  5LJ5 j;  3UF4 A;  2KMT A;  3FDR A;  3X26 B;  2LW4 A;  4OMQ A;  3CC7 T;  1C0M A;  4EMG A;  3RKW A;  2MAM A;  3CPW S;  2WMA B;  3PE0 A;  2W99 A;  3QKJ A;  3CPF A;  3MP6 A;  2LJ3 A;  3JCM h;  4C0D B;  1D09 B;  2X4W A;  4JJD A;  5KCH A;  3OQ5 A;  3QZ5 B;  1Q81 R;  3ULR B;  1A0N B;  4ROE A;  4KUD K;  5HKC A;  1VQ8 A;  5GMK i;  2DX1 A;  2LX7 A;  3C0C A;  2KRO A;  1K4U S;  2UZE B;  3RKY A;  4HT8 A;  1QLY A;  2I0N A;  5ACB A;  2IVW A;  3LH0 A;  4EMH A;  1K9M U;  3B57 A;  2BS4 A;  2K5F A;  1QKX A;  4HVW A;  5CKF A;  1SF9 A;  4PNO A;  2BPM B;  2OTJ T;  1UJY A;  2FEI A;  3OYN A;  3A8M B;  1FXX A;  1K73 C;  5GAM g;  4Q5W A;  1N9R A;  2JJ9 A;  2IW9 B;  5GMK e;  4X9D A;  2DZC A;  3HB9 A;  1D0Z A;  2BZX A;  2W0Z A;  3EG9 B;  4A53 A;  4BCP B;  3M53 A;  1I8F A;  5IHI A;  3CC2 Q;  2JVV A;  1VOL A;  3P8H A;  2PVD B;  4DEY A;  2CSQ A;  4CRI A;  2ZPG B;  3JCM W;  2COY A;  4ZTF A;  3CD6 Q;  3JCM d;  3VUB A;  2FL7 A;  4IKF A;  2DXC A;  3QYE A;  4FIB A;  1QVF S;  1UB4 A;  2RQT A;  2F2W A;  1SEM A;  2DYI A;  2VYT A;  2F69 A;  2XIC A;  4C92 D;  4DBH A;  3CPW A;  3CCL T;  2ZCF B;  2EGC A;  1FYN A;  4OB0 B;  2CP0 A;  1NJI R;  3QHS A;  1W98 B;  2QGS A;  1QCO A;  4C8Q D;  5GAO l;  3LH5 A;  4BCK B;  2B8A A;  1WJQ A;  4LNP A;  2RMO A;  9ATC B;  2GFU A;  1AWO A;  4MDW A;  3VS4 A;  3M58 A;  3GBQ A;  1T0H A;  5GMK h;  1U1S A;  2KSS A;  5L8R E;  1N4M A;  2D8H A;  2RN8 A;  3GPL A;  2O2O A;  5IAY A;  3CQT A;  2QQB A;  1K1Z A;  1RAI B;  1UGQ B;  1D0Y A;  4Z02 A;  5EG2 A;  3RMQ A;  1CSK A;  2DBK A;  2C06 A;  4N4H A;  2DXB A;  5D7U A;  1M3B A;  1U1T A;  2A7Y A;  1TD6 A;  3C12 A;  3JCM g;  2EKO A;  2EYZ A;  3OYK A;  1M3C A;  3E2U A;  1OZ3 A;  1VQ9 A;  1B07 A;  2IN3 A;  2PQW A;  3OYM A;  4NS5 A;  2XDB A;  1YFN A;  2DTH A;  4F7N B;  1NJI C;  1PRM C;  3CC4 T;  4K11 A;  1D1B A;  1M30 A;  1AD6 A;  5LJ5 f;  4J9D A;  4A4E A;  2GGR A;  5L23 A;  2QDJ A;  1OIY B;  1KSW A;  3JCM J;  1QWF A;  1YJ9 T;  1FVV B;  1VQN A;  1K9M C;  2W9F A;  3EGX B;  1WDX A;  4QVC A;  4GLK A;  2JUF A;  3MO8 A;  3KHI A;  4OMM A;  3O8V A;  4DOW A;  4KH1 B;  2LQK A;  3J7A F;  2L8D A;  4M78 A;  1X6G A;  1DJ7 B;  2D0N A;  1N27 A;  4R56 A;  5CCA A;  1M27 C;  2DET A;  2YXY A;  3SHW A;  3V7C A;  5KYW B;  3CXC P;  2F2X A;  4QW2 A;  1TG0 A;  4II5 B;  1BIB A;  2EAY A;  2LZ6 B;  5IXF A;  2XG8 D;  1HSQ A;  3OYF A;  4PJO B;  1XTD A;  3DB4 A;  1LCK A;  1OQK A;  1UGP B;  3ZEH A;  1OIU B;  4N0A A;  2ENM A;  1UNL D;  8AT1 B;  4X9C A;  3R6N A;  5HK3 A;  5IDN B;  1RAE B;  2WIH B;  3A1P A;  4M7A B;  2RJE A;  4RG2 A;  3MEV A;  3OYI A;  2KDS A;  4M75 D;  2X3X D;  2MWP A;  3TNI B;  1RUW A;  3VYH B;  2V1R A;  3M4G A;  4J83 A;  4CC4 B;  1VQL A;  4XTW A;  1MMA A;  2QA4 Q;  1N5Z A;  1KC8 R;  3VS1 A;  2W9Z A;  2K5L A;  1M2V A;  5I2M A;  3G33 B;  4BY1 X;  4PL6 A;  3CME T;  2FRW A;  3I56 T;  2J6F A;  2VC8 A;  4IUU A;  4EOK B;  4OGC A;  3L2V A;  5GAN 5;  1BIA A;  2VWF A;  2HCK A;  2LTO A;  1PKS A;  1GFD A;  4M78 E;  3SWN B;  2K3Y A;  1VQ4 T;  3CCJ Q;  4M77 A;  1IGQ A;  2ZPH B;  1H8K A;  1Y96 B;  3HP9 A;  4Z8A A;  4AI6 A;  2RK2 A;  2DEQ A;  4JX6 A;  5ICP B;  2XMF A;  3E19 A;  2VUB A;  1TSF A;  3CCS T;  4CFU D;  4XTZ A;  3E1S A;  3THK A;  4A4K A;  1W6X A;  4BDY A;  1XJW B;  4LXC A;  4RTW A;  2LQN A;  1PSE A;  1AOJ A;  4XTU A;  2HD0 A;  1VQP A;  5L2W B;  3JCM b;  1PNJ A;  1IXD A;  5AT1 B;  3TRE A;  4JLI A;  1VQ5 A;  1QQJ A;  2C5N B;  5HY6 A;  3HO8 A;  3MP1 A;  1MHN A;  1PKT A;  1AWW A;  3OYD A;  1M1K U;  1K0S A;  1KG1 A;  2PHG A;  3DDQ B;  3QZ9 B;  4EON B;  4FSS A;  1Q7Y R;  4B9X A;  3URG A;  1YIT A;  2PJQ A;  2DJZ A;  2H3E B;  4IIO A;  2CZ6 B;  5FW9 A;  7AT1 B;  1SSH A;  2JMC A;  1WNL A;  1M90 R;  2CSI A;  1ZSZ B;  3OYG A;  4ATO A;  4JRI A;  2EWN A;  3MHX A;  1YN8 A;  2SEM A;  1BYM A;  4D8K A;  4PKC C; 
#chains in the Genus database with same CATH homology
 4M78 C;  4JRQ A;  1G3S A;  5CIU A;  5GAN 8;  4GY5 A;  1BI2 A;  4ZN3 A;  1OZ2 A;  2F5T X;  1E7P A;  3BG3 A;  2XID A;  4BE2 A;  3CBO A;  4C0D C;  3X20 B;  4PLI A;  2R5A A;  2L3R A;  3OS5 A;  3CC7 A;  4BE1 A;  3QII A;  2M0O A;  4M77 E;  2DPP B;  2E10 A;  3CC2 T;  1BKB A;  3AHU A;  2OAU A;  3H8Z A;  4HCZ A;  4A54 A;  2BKD N;  1NJI U;  3PIP A;  3LX7 A;  2E6Z A;  2VXE A;  2JNG A;  3CD6 T;  3KXT A;  3VYG B;  1JB0 E;  2LCC A;  3HRU A;  4LD9 K;  4PJO A;  4QQG A;  5M9O A;  3GNF B;  5HK0 A;  3R6O A;  5J3B A;  3LWI A;  4PJO D;  1M90 C;  2Y4Y A;  4MMK A;  4F7U F;  4RCB A;  1IRE B;  1B34 B;  4N0A C;  4BE0 A;  3GIB A;  3HBL A;  2RK1 A;  1W4S A;  3VYG A;  1VQL T;  2D6F A;  2QA4 A;  2GFA A;  4XTY A;  1Q86 C;  3QPH A;  1YJN T;  4J7F A;  4UC4 A;  1FX7 A;  5IT9 E;  3JB9 G;  3LGL A;  2CYZ B;  5LJ3 f;  4ELY C;  5LJ3 e;  3HRS A;  3MEW A;  1XOV A;  1VQ6 A;  5GAO m;  5FLX E;  1UGR B;  2LT4 A;  3ASK A;  3BW1 A;  1M1F A;  3N5B B;  4ZN1 A;  1YJW A;  1KQ1 A;  5KE3 A;  1W2B A;  4M7A A;  3CBM A;  4L6V 5;  2CKK A;  5CKE A;  4NL3 A;  1X6O A;  3NFC A;  2OTJ A;  3RES A;  3G7Z A;  4M7A D;  1V29 B;  5D6W A;  4ZTJ A;  2RA2 A;  2RD1 A;  2E12 A;  1O9S A;  5FRO A;  2ZZD A;  4HNT A;  4DOV A;  2EFI A;  2LVM A;  3UWN A;  4E7J A;  2RI3 A;  2G77 A;  3A8O B;  3QG1 A;  4OB3 B;  3MEA A;  2DXT A;  4FT2 A;  3ER0 A;  4RCC A;  2PUO B;  4M75 F;  1M4Z A;  3OYC A;  2OTL T;  2P4T A;  4MML A;  3A5Z B;  4KUL A;  1H64 1;  4XTX A;  4A4H A;  4QVD A;  2XD0 A;  2DXC B;  4RKU E;  1Q81 C;  2ZPF B;  4D6W A;  1VIF A;  3FB9 A;  3FEO A;  2RHU A;  1G3T A;  1Y07 A;  3CCJ A;  3HKS A;  1KD1 U;  1H3Z A;  4DA4 A;  2M16 A;  3FRN A;  3HFO A;  3JCM Q;  1EIF A;  4BDZ A;  3PTA A;  4C92 B;  1YCY A;  2Y90 A;  2RHI A;  2RH2 A;  3PGG A;  4BD3 A;  3EFS A;  3OBW A;  4J6X A;  1M9S A;  2LT1 A;  3SFM A;  4M7D B;  3BDU A;  2YLB A;  4M77 G;  5CAI A;  2O4X A;  4N4G A;  4QQ6 A;  3WVD B;  1BI3 A;  4C8Q B;  1KQ2 A;  4BBS M;  4A4F A;  3NTK A;  2X4J A;  2KY9 A;  3P8D A;  2EJ9 A;  3CCE A;  5CKB A;  4LDU A;  5GAN 6;  2DO3 A;  5A0D A;  3G6E A;  2RJC A;  4C92 F;  4M77 D;  3WVE B;  4M7D A;  1RI0 A;  4O6J A;  2ZGW A;  1VUB A;  3M54 A;  2RI2 A;  4XK8 E;  1S72 A;  3LW5 E;  1HK9 A;  3BG9 A;  3OB9 A;  4HLQ A;  4M77 C;  4O5V A;  4C8Q F;  1Y96 A;  1VQP T;  4LOC A;  3QO3 A;  1YHQ A;  5LJ3 h;  2WJ9 A;  2QQR A;  3EAE A;  3BY7 A;  2MI6 A;  3VKG A;  3ME9 A;  2KQW A;  3QJ6 A;  3SWN C;  2R58 A;  3CCV A;  3CCL A;  3L2Z A;  1VQ5 T;  1K8A C;  3F70 A;  5CVI A;  2D0Q B;  3OS2 A;  4LDX A;  1KD1 C;  2DIG A;  2HBP A;  5KH6 A;  5LL6 S;  1QP2 A;  3OYY A;  3HL8 A;  5GAO n;  3JCM e;  3JCM f;  1X75 C;  2E5Q A;  4PJO E;  1FKM A;  1VIE A;  3WXM B;  4EPC A;  4MZM A;  2MWO A;  3OMC A;  2HQE A;  1W2B S;  3VUZ A;  1YIT T;  3HZJ A;  2O01 E;  3CEY A;  3V7R A;  2V8K A;  4EMK A;  3JCM c;  4MFE A;  3RIR A;  2ZPE B;  2YLC A;  5DLO A;  2EQJ A;  3JCM X;  3H4C A;  2E6N A;  3CCR T;  4C0F A;  4AKI A;  3I55 A;  4C0G A;  1UEB A;  5GAN e;  5GAN f;  3G4S A;  2FYK A;  5CO7 A;  3L2W A;  4BI4 A;  3G71 A;  2CZ7 B;  3DL1 A;  5D6X A;  2I2L A;  1M8V A;  2ZPB B;  3QYB A;  1WQ7 A;  2KAF A;  5KE2 A;  2LDM A;  3SB2 A;  4JS4 A;  3CCM T;  3CXC S;  4L5G A;  3J81 E;  4QSH A;  5LJ5 g;  1U8R A;  3TW6 A;  3OYJ A;  3RKX A;  1BI0 A;  4HNV A;  2PVO B;  4VUB A;  4NL2 A;  2DD4 B;  2EQM A;  4AKH A;  3QYG B;  4XU1 A;  2EIF A;  3Q1J A;  1PSF A;  2XKO C;  5FRM A;  2RB6 A;  5LJ5 j;  2KMT A;  4IUV A;  5FU7 C;  3FDR A;  3X26 B;  5GAN 7;  3CC7 T;  1IZ6 A;  4NOY A;  4BUG A;  4EMG A;  3CC4 A;  2BUD A;  2BS2 A;  2K4Y A;  1KC8 U;  1VQO A;  3RKW A;  2K57 A;  2MAM A;  5LJ3 d;  5CKD A;  3INZ A;  3CPW S;  2A3L A;  1WQW A;  4HA8 A;  3QKJ A;  3CPF A;  4BB7 A;  1YJ9 A;  1QVF A;  3MP6 A;  3JCM h;  4C0D B;  4XU2 A;  1OYX A;  2X4W A;  5KCH A;  3OQ5 A;  3QZ5 B;  4M78 F;  2CZ1 B;  4OGE A;  1D3B B;  4F7U B;  3TU4 K;  2WSC E;  3BDL A;  3L2Q A;  3X24 B;  4KUD K;  4M7D E;  3A8L B;  4PJO G;  5HKC A;  1VQ8 A;  4Y91 A;  1ZQ1 A;  5GMK i;  5GAN 3;  3SDZ A;  3S3M A;  2WAC A;  3RKY A;  2QA4 T;  1VQK A;  4HT8 A;  1AHJ B;  3BG5 A;  1D3B A;  2E41 A;  2IVW A;  4II1 A;  3LH0 A;  4EMH A;  4F7U A;  5CK9 A;  5GAN h;  2M9U A;  4E7L A;  1K9M U;  1VQ6 T;  1YJW T;  4LDV A;  4X34 A;  5DLQ E;  1HXD A;  2BS4 A;  1NE8 A;  2K5F A;  2PU9 B;  2XDP A;  3VJP A;  2RJF A;  4N4I A;  5CKF A;  5I2S A;  5GMK l;  2VV5 A;  4PNO A;  3CCQ A;  1N8R U;  2RJD A;  2OTJ T;  2EJG A;  3T9N A;  4E7K A;  3UDC A;  1NPP A;  4BI3 A;  4M7A G;  2HQX A;  3DB3 A;  1YI2 A;  3LYI A;  4J6W A;  3OYN A;  3A8M B;  1FXX A;  2IG0 A;  2NLU A;  1B34 A;  3S6W A;  5GAM g;  5GAO q;  3CMA A;  4JS5 A;  2M1H A;  3MET A;  4M75 B;  4Q5W A;  1ZBX A;  1N9R A;  1RL2 A;  3OSS C;  5FU6 B;  4MDX A;  3L2U A;  1G5V A;  5GMK e;  4IUQ A;  4BY6 B;  3CCJ T;  4X9D A;  4M7A C;  2DAQ A;  1KHI A;  5C6S A;  2DZC A;  5LJ3 g;  5GAM j;  4M75 A;  2XU8 A;  3HB9 A;  3GNG A;  3HFN A;  3OYL A;  4A53 A;  1VQ7 A;  2GF7 A;  3M53 A;  4Y28 E;  1I8F A;  1Y71 A;  2JVV A;  3CXC A;  3H6Z A;  2D9T A;  4OB2 B;  4FT4 A;  4KBM B;  2QQS A;  1QP3 A;  3RUX A;  3P8H A;  2PVD B;  4CRI A;  3X25 B;  2ZPG B;  2QDY B;  3M4Y A;  5I21 A;  3CCE T;  3JB9 F;  3JCM W;  3S3N A;  4HL4 A;  3G6E T;  4ZTF A;  4M7A F;  2DTI A;  3JCM d;  4JRK A;  4J5Y A;  3VUB A;  2FL7 A;  3MP8 A;  4JUV A;  3PT9 A;  2DXC A;  4IKF A;  1Q7Y U;  3QYE A;  3DLM A;  4FIB A;  1S72 T;  4JDS A;  3L2R A;  2DK3 A;  1UB4 A;  1QVF S;  3M55 A;  4M7D G;  4C92 A;  1QW1 A;  2QQ9 A;  3OYA A;  1TH7 A;  4R55 A;  3LWH A;  3M9Q A;  4J8O A;  5DM7 R;  2VYT A;  1YHQ T;  2F69 A;  2XIC A;  1M90 U;  4C92 D;  4CI0 C;  3CCV T;  3CPW A;  3FIF A;  3CCL T;  2ZCF B;  1M1K C;  4MIM A;  1JBM A;  2LX9 A;  4C8Q A;  3TW7 A;  3V7S A;  4M7D D;  5J26 A;  5GAN d;  4OB0 B;  3X28 B;  3QHS A;  1NZ9 A;  3V8J A;  4C8Q D;  4BBR M;  5GAO l;  2RHY A;  2B8A A;  1WJQ A;  2JTF A;  3CME A;  2EQK A;  4M7D C;  3I56 A;  2GFU A;  4P5N A;  3OYH A;  4JX5 A;  4MDW A;  3M58 A;  4FU6 A;  4MZT A;  2ZPI B;  1LJO A;  2KK4 A;  3HHT B;  5A0L A;  4M77 F;  5GMK h;  1U1S A;  2KSS A;  5GAO r;  5L8R E;  2DXB B;  4M6V A;  2HNI A;  3GPL A;  2FHD A;  2XI9 A;  4AKG A;  2E64 A;  2QQB A;  5IAY A;  1VQ4 A;  1R8O B;  1UGQ B;  2VGN A;  4F7U E;  3I55 T;  2R5M A;  2EJF A;  3G4S T;  2CGH A;  4Z02 A;  1JJ2 S;  4OF1 A;  3G71 T;  3PFS A;  5EG2 A;  3RMQ A;  4B9W A;  2QEX A;  2RM4 A;  3FLG A;  2C06 A;  1FWZ A;  4N4H A;  2DXB A;  1U1T A;  1KQS S;  1KC8 C;  2A7Y A;  3CCS A;  3C12 A;  1WJS A;  3JCM g;  1LOJ A;  3JB9 I;  2HAX A;  5GAN 2;  5FRN A;  2EKO A;  3OYK A;  4EMK C;  1I5L A;  3QSU A;  3CCU A;  3VKH A;  1G3W A;  3A8G B;  1OZ3 A;  3CBP A;  2CZ0 B;  3LGF A;  2RHX A;  4E7I A;  5C0M A;  2F5K A;  1VQ9 A;  3M56 A;  2PQW A;  1GXI E;  4Z6Y A;  1WJR A;  3JB9 H;  3OYM A;  2QQA A;  4NS5 A;  2XDB A;  2DTH A;  4YTL A;  1NJI C;  2DD5 B;  4RMO A;  3HSB A;  1MGQ A;  1WPY A;  2QXF A;  3CC4 T;  2K5I A;  4M75 E;  5GAN g;  1N6A A;  1VQO T;  4FM4 B;  5LJ5 e;  3QBY A;  5LJ5 f;  4HCB A;  4A4E A;  1OI1 A;  2QDJ A;  1P92 A;  4A4G A;  2GCX A;  3JCM J;  3A8H B;  1YJ9 T;  3JRZ A;  3VV0 A;  1VQN A;  1K9M C;  1M5Q 1;  4ZGE B;  2DD5 A;  2L89 A;  3QUI A;  2DD4 A;  4M78 B;  5FU7 B;  4LDY A;  2JOY A;  4LDW A;  5CQX A;  5GAO p;  4QVC A;  1N8R C;  3GOX A;  4V2S A;  4GLK A;  2JUF A;  3MO8 A;  3KHI A;  3TEE A;  3OW2 S;  3O8V A;  4DOW A;  1VQ8 T;  1YBY A;  3JB9 J;  2LQK A;  2VXF A;  3J7A F;  2L8D A;  2X4X A;  2QF7 A;  4M78 A;  3DLL A;  4ZGD B;  1DJ7 B;  3JCM P;  1YIJ A;  4C92 E;  1VQK T;  2V8I A;  3KBG A;  4ZGJ B;  2X35 A;  1N27 A;  4R56 A;  3V8K A;  2MMP A;  1VQM A;  4WF2 A;  5CCA A;  3OBY A;  3QJY A;  2LRQ A;  2FB7 A;  3V7C A;  4C8Q E;  4F7U G;  3FJP A;  1LNX A;  3NTI A;  5KCO A;  3CCQ T;  4JJN K;  3L42 A;  4QW2 A;  2Y4X A;  4ME7 A;  2E70 A;  3GLX A;  2YRV A;  4KT0 E;  4OVA A;  1YI2 T;  1BIB A;  2EAY A;  2DKG A;  1Q82 U;  3QYH B;  1WGS A;  2XG8 D;  3CMA T;  4JRP A;  3UPU A;  4C5G A;  4ELJ A;  2QTX A;  5CKH A;  4HT9 A;  3OYF A;  1M1G A;  4PJO B;  2EQU A;  2JN0 A;  3M57 A;  4C5E A;  1XTD A;  3DB4 A;  3RMS A;  2KR6 A;  2QQ8 A;  1UGP B;  5GAN 4;  1X01 A;  3ZEH A;  2P0P A;  3MEU A;  3V8L A;  2MF2 A;  2LCL A;  4BI8 B;  4N0A A;  4OMF B;  2PUK B;  4XU3 A;  4DQ2 A;  5LJ5 h;  1Q7Y C;  3PMT A;  1JJ2 A;  1VQ7 T;  1KHC A;  4PLL A;  3UT1 A;  4X9C A;  3CC2 A;  3ZBD A;  4PJO F;  4M75 G;  5GAM e;  5GAM f;  2GQV A;  4FL6 A;  3OS0 A;  2VGM A;  1KQS A;  2EYQ A;  3VU3 C;  5HK3 A;  3QWL A;  2E65 A;  3OA6 A;  3OYB A;  2R57 A;  2QFZ A;  4M7A B;  1ZHI A;  2DTO A;  2RJE A;  3MEV A;  4RG2 A;  5A2Q E;  3PIO A;  3PMI A;  3OYI A;  2KDS A;  3CD6 A;  2KVQ G;  4M75 D;  2MWP A;  1K73 C;  2JZ2 A;  2LQ8 A;  2ZZD B;  4M75 C;  5CR2 A;  4JLG A;  3VYH B;  5FU6 C;  4EDU A;  4J83 A;  3M4G A;  5LJ3 j;  3S3O A;  1VQL A;  4XTW A;  5AYF A;  4BAC A;  3M59 A;  3JB9 D;  2YHT A;  1YJN A;  3KUF A;  4C5H A;  2XK0 A;  2RHZ A;  3BFM A;  4BY6 C;  4C92 G;  2LC4 A;  2WSE E;  3ZFJ A;  4XAX B;  2K5L A;  4J7I A;  2E1H A;  2QI2 A;  5GMK j;  1G3Y A;  5I2M A;  3HPW A;  3OMG A;  4C8Q G;  4PL6 A;  3CME T;  1QVG A;  3HRT A;  3I56 T;  2VC8 A;  4IUU A;  2O4X B;  4MFD A;  1XNI A;  2BIV A;  4OGC A;  3L2V A;  5GAN 5;  1BIA A;  2FVU A;  3TCJ A;  4C92 C;  3OW2 A;  1Q86 U;  4M77 B;  2LTO A;  3L1A A;  3RER A;  4XU0 A;  2OTL A;  4IUR A;  1K73 U;  3E9G A;  4M78 E;  3SWN B;  4C8Q C;  2K3Y A;  2KMG A;  1VQ4 T;  2DXU A;  4KUI A;  2X4Y A;  4HKE A;  3GP8 A;  2DIQ A;  4M77 A;  2ZPH B;  1Y96 B;  3HP9 A;  4AI6 A;  2CS7 A;  3OY9 A;  4HNU A;  5GAM h;  2XDD A;  2RO0 A;  2RK2 A;  5LJ5 d;  4XTV A;  1QLB A;  2DEQ A;  1Y7X A;  2QEX T;  4JX6 A;  3P8B B;  3E19 A;  2VUB A;  2K3X A;  3MCA B;  3SWN A;  2DZ9 A;  4M7D F;  3JAM E;  3CCS T;  3GF5 A;  1I4K 1;  4XTZ A;  4PJO C;  2L5Q A;  4IUT A;  1XQH A;  3EFR A;  3E1S A;  4OP0 A;  4A4K A;  3CCU T;  1Q81 U;  3OSV A;  4BDY A;  3NTH A;  1VQ9 T;  4HCC A;  3OYE A;  4NC6 A;  4QVZ A;  4C5I A;  5IN1 A;  3M5A A;  5DY9 A;  1PSE A;  3DKM A;  4XTU A;  2H3J A;  2HD0 A;  3QDR B;  1VQP A;  1BI1 A;  2P0K A;  5CQY A;  3QXE B;  2AHJ B;  1O75 A;  3LLR A;  4EMK B;  3JCM b;  4RG8 A;  1UGS B;  3E9F A;  3TRE A;  1SSF A;  4JLI A;  1VQ5 A;  3SD4 A;  3C94 A;  2RI5 A;  5HY6 A;  4C0Z A;  4L59 A;  3HO8 A;  3MP1 A;  4QQD A;  1MHN A;  2K2V A;  3OS1 A;  1N9S A;  4FSX A;  1VQN T;  5EJC A;  4JX4 A;  4IUP A;  3OYD A;  1M1K U;  2V8J A;  1KG1 A;  1QVP A;  3JSC A;  1NPR A;  2XHC A;  3QZ9 B;  2P0Q A;  3C4S A;  4E47 A;  4MZP A;  2JTM A;  3FC3 A;  4B9X A;  3URG A;  1JRI A;  4E7H A;  1YIT A;  5A0G A;  1YIJ T;  1Q82 C;  1QVG S;  2DJZ A;  4M7A E;  5GAN j;  1K8A U;  2CZ6 B;  4OB1 B;  2DVE A;  4TVR A;  1WNL A;  5GMK m;  3CCR A;  1VQM T;  4M78 G;  2LNV A;  4LD6 A;  3PNW C;  2WSF E;  4XQ3 A;  2BS3 A;  2PVG B;  3J80 E;  1I81 A;  3OYG A;  5J39 A;  4ATO A;  3JCM V;  5GAM d;  4JRI A;  4J6Y A;  2EWN A;  2G3R A;  4M78 D;  3MHX A;  3CCM A;  5D6Y A;  3VKI A;  4ELZ C;  1BYM A;  4PKC C;  3C95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...