4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
2ZPHB 3QYGB 4OB3B 3A8HB 2DD5B 2DD5A 1IREB 3A8OB 2CYZB 3QZ9B 2ZZDA 3A8GB 2DXBA 2ZZDB 1UGPB 4ZGJB 2PUOB 2DPPB 2PVGB 4RKUE 2ZPIB 4XK8E 4FM4B 2ZPBB 1V29B 4L6V5 3A8MB 1GXIE 3WVEB 4OB2B 1QP2A 1UGQB 2PU9B 3QZ5B 1AHJB 3QXEB 2D0QB 3X24B 3X20B 1PSFA 3WVDB 1UGSB 2WSFE 1QP3A 2PVOB 1PSEA 4KT0E 2ZCFB 4ZGDB 2DXCB 2WSCE 2CZ0B 2PUKB 2O01E 3X25B 4Y28E 3VYGB 2ZPGB 4OB1B 2CZ7B 2WSEE 3X28B 2DXCA 1UGRB 2AHJB 3A8LB 2ZPFB 2ZPEB 3VYHB 3QYHB 2CZ1B 3LW5E 3VYGA 3HHTB 2DD4B 3X26B 4ZGEB 2CZ6B 2DXBB 2PVDB 5L8RE 2DD4A 1DJ7B 2QDYB 1JB0E 4OB0B
chains in the Genus database with same CATH superfamily
5HK0A 1IHVA 1X01A 1BYMA 3QDFA 3EGUA 2DMOA 3UT1A 3QIIA 5D6YA 1BCOA 3CMAT 2MI6A 2DF6A 2DPPB 2PUOB 4FW2A 2WIHB 3CPWS 1FYNA 4J9GA 2CGHA 1G5VA 2RHXA 2QGGA 2B8AA 4LXCA 1YCYA 1D1BA 4CC3A 3PFSA 4HA8A 3O5ZA 1OPKA 3GP8A 3IQLA 3OB9A 1Q7YR 2QA4Q 4BXXX 2X4XA 3FB9A 1GBQA 1NJIC 2DK3A 4LDXA 3RKYA 4AFSC 2YT6A 3ASKA 3CEYA 2KMTA 2WSFE 2DZ9A 1PWTA 4OMNA 1Q86R 4M75D 1S72Q 4ELYC 2KR6A 1M9SA 1HYOA 1H3ZA 2HSPA 4MFDA 4EOPB 1UE9A 2RO0A 3VRYA 2KNBB 4EC9B 2EYXA 5KYNA 2BE7D 4M77F 2W9ZA 4XAXB 1O9SA 2VGNA 2JM9A 1EIFA 4ATOA 2VKNA 4RTTA 2GFUA 1PM3A 2G77A 5FW9A 4M4ZA 2D8HA 2YRCA 1QVFS 2W10A 1NG2A 5FU7B 3X26B 1ZP2A 2FRYA 5GAOl 1MNEA 2DD4A 1ARKA 1NLPC 1OU9A 3BDUA 1AZEA 2VV5A 1YITT 1OZ2A 1TU0B 1R8OB 2MWOA 2LQKA 3H4CA 2QQSA 3V8JA 5HBHB 1F5QB 2FG0A 4M7DC 3QYBA 1E6GA 2EYWA 3VKIA 1PRMC 1U06A 2ECZA 9ATCB 3H0HA 2RHIA 3M0TA 3A8GB 1Z9QA 4KH0B 4C8QE 5IHKA 5HNBB 2XDDA 1PC0A 3CMEA 1M3AA 2COZA 3EG2A 1FX7A 3FC3A 3E19A 4ZN1A 1QCOA 1BIBA 3EGXB 4L5GA 2E5QA 4CI0C 1PHTA 1I5OB 4JJDA 2QG9B 4RTXA 4IUVA 3CXCA 4MMLA 3MEUA 4M7AB 3LGLA 4E6RA 2BKDN 4M75B 2CP0A 3TW7A 4GLKA 4XTYA 2IW6B 3TSWA 2QGFB 1MNDA 4MZTA 2VYTA 1YI2T 4MZPA 4C0DB 4BCHB 5GAMf 2RQUA 3KHIA 2P0QA 2E6ZA 2EGEA 2E64A 2HQXA 3MP8A 5IAYA 2DO3A 1FVVB 1WFWA 4QKUA 3NTIA 2Y90A 4R55A 2RHZA 2HKQB 1VQKT 2HBPA 1GL5A 4PJOB 3RR6A 1YP5A 4BCIB 4E7HA 4M7DD 3VUBA 1ZLMA 1VQPT 2DBMA 4PFOA 4PJOE 2A3LA 2W9FA 2DL5A 1VQ5A 2QI2A 5GAOq 3NGPA 5HKCA 3MP6A 1K8AU 2RHUA 1G8XA 4C5IA 2OI3A 1AWWA 2JOYA 3M57A 2HBWA 2LJ0A 3EG1A 1C9BA 4WF2A 2V8IA 2D8JA 1WHHA 5IHYA 4PJOG 5LL6S 5LJ3h 1OQKA 3CQTA 4ZNXA 3CCUQ 4RTWA 2UZDB 1VQ9T 1FMVA 5KE2A 3QWYA 3CCQA 5GAOp 4C8QB 5KYUA 3QZ9B 2JTFA 4CFMB 1X2QA 3SB2A 4LDUA 3OS2A 1OZ3A 1S1NA 4M77E 5IXFA 4RKUE 1N8RC 1VQNQ 3EFOA 1YWPA 4M7AG 2LJ1A 4B9XA 2Y4YA 1E7PA 1E7OA 1TOVA 4CC7A 3DTOA 5FWBA 1UHFA 1K73U 1WHJA 4FU6A 4RMOA 3FEOA 2X1NB 3EHRA 3JCMP 1WIEA 1M5Q1 5A0DA 1OU8A 1KQSS 3X20B 3B57A 2DL4A 3NPFA 3GOXA 1FKMA 1GCPA 4CFWB 5A0GA 2RB6A 5IH2A 4AG2C 1BI3A 1WYXA 1VOMA 2R7GA 3HO8A 3ME9A 2DNUA 2OTLQ 3JSCA 1PNJA 3M4GA 5GAMd 3HFNA 1JXMA 1AD6A 4EMGA 2DAQA 2O31A 4QQDA 3CC7T 4MFEA 3CCSA 3NDQA 1JSUB 2H8HA 2L2PA 4LNPA 1LJOA 3LH0A 2NUPA 3VU3C 4DEYA 4VUBA 3OMCA 3ULRB 2WJ9A 2KR3A 4HNTA 3VJPA 3I55A 1PD0A 2DJQA 1VQPQ 2YXYA 4B6MA 3WXMB 1H28B 2OX7A 2MAMA 2P0PA 4PLLA 5J3BA 1HJDA 1C1AA 2MMPA 3LW5E 3QWLA 4J9EA 3VV0A 3H41A 2JUFA 5GANd 2PVDB 1DJ7B 2WPAB 4PJOA 3LWHA 2AZSA 1I0CA 1RLPC 5GAOm 4KUIA 2ZPHB 4FYYB 4EOJB 4M77D 4Y91A 1VQOA 3RMSA 2DD5A 1VQ6A 2WMAB 1MV3A 1ZUUA 3M0SA 1VQ6T 3G1JA 1QVGA 4EMKC 3I56T 4I3ZB 2K5FA 2QK0A 4Z8AA 1FMWA 4C8QG 1GH6B 3EFRA 5KYUB 1GCQC 1SKUB 1RI0A 1S72A 1G3YA 1OEBA 2NUTB 4YOZA 3CC4T 4OP0A 2EQKA 3MKDA 1YWOA 2J6OA 1YFNA 3UF4A 4PFPA 4FM4B 2YLCA 1HK9A 1PD1A 1GUXB 2ZPBB 3NHNA 2J7IA 5LJ3f 4OMLA 1ZBXA 2FVUA 3I9QA 2VVKA 1VQ7Q 2BE9B 4AT1B 2A36A 1QP2A 4B9WA 1OL1B 5CIUA 2D6FA 4N4HA 4BBSM 5KYXA 2E5KA 2KMGA 2XD0A 4QQ6A 4CFNB 1PSFA 1K73C 4M77B 4Q5WA 4HCCA 3PVQA 2IVWA 4EOKB 5FGKB 4F70B 2QYZA 3L2VA 2CCIB 4F04B 1X27A 1N8RR 1GY3B 1U8RA 4F7LB 2ZCFB 5CVIA 3MEVA 3FDRA 2COYA 2H3JA 3E9GA 1I5LA 2DIGA 1YITQ 2X4WA 1N8RU 2XICA 1K4US 2HQHA 1UDLA 5GAN7 4FL6A 2RD1A 4EOMB 5I11A 1OL2B 2CZ7B 2LQWA 4ZTFA 4IIMA 2FZCB 2GFAA 2MK5A 2WSEE 4ROEA 2EW3A 3CMEQ 1UGRB 3NTHA 1H1SB 1NM7A 2QXFA 2NUTA 2BS4A 5LJ5d 5CYIB 3CCLA 4ZGEB 4KGXB 3HP9A 2C0IA 3G6EQ 3RKXA 1GUXA 2PMIB 1JB0E 4Z6YA 2JM8A 4EC8B 3PMTA 1UFFA 1D3UB 2DKGA 3BE3A 3PMIA 1SHGA 2KT1A 3OY9A 3A8OB 5CKFA 5FWCA 3PNWC 1GFCA 2ABLA 2KYBA 4KRTA 4LD6A 1CKAA 3CCVT 5L23A 1RI9A 3TU4K 2PVGB 3SD4A 4IURA 1VQ4T 2AZVA 3C0CA 3ZBDA 2FRWA 2C0OA 3HBLA 4M7AE 3OS5A 3MY1B 1X6OA 1AZGB 1OX9A 2VASA 2V22B 5HQ0B 2JNGA 3HRUA 2IG0A 3RNJA 1QVPA 5LQFB 2FPFA 2VGMA 3UPUA 3G4SQ 1VQMA 2CP3A 1AHJB 1VQ5Q 1TXQA 2LRQA 1V76A 4JX6A 4BCND 1RAGB 4RTYA 1VIFA 1WJRA 5IXBA 3WVDB 3VS7A 1UGSB 2QF7A 5HBJB 1N5ZA 3DKMA 1B3QA 2DYBA 2RQVA 3QJ6A 1I4K1 2AKLA 4E47A 1H641 4M77A 3SEMA 4XTUA 4XTXA 4WTOB 2EAYA 2UZBB 5FU7C 5KYXB 4J9HA 3BLHB 1W98B 4MIMA 3HTRA 2PHGA 4HLQA 5GMKj 2PUKB 1TTHB 1Y96B 4HT9A 1WJSA 1PKDB 3SWNA 2W2HA 5GANe 4LOCA 1H1RB 1RAHB 2JTEA 2K5LA 2JJ9A 3E1SA 4JRPA 2CH4A 3CPWA 4FYVB 3CCMT 1UGVA 3VYHB 4C0FA 1VQNT 1PCXA 3VKHA 3EG9A 1SSHA 1D09B 3CXCS 1TG0A 5L8RE 1X6BA 1YN8A 2L5QA 1WGSA 3BDLA 2PTKA 2RI5A 2D1XA 4OMQA 2RA2A 2EWNA 2HNIA 1M30A 2DL8A 3U23A 3P8DA 8ATCB 5FRNA 4M7AD 2Z0WA 4LN2A 3MY5B 1JOWA 4Y72B 2CSQA 6AT1B 2ROLA 2E3HA 2V26A 3QHSA 3CC4A 2JT4A 3QWXX 4R0KA 2AIRB 1KC8U 2YUQA 5CKDA 2ZPIB 3JB9D 2COWA 2KDSA 4M78E 3TSZA 1J3TA 1T3LA 2F2XA 2GQVA 2NUPB 3L2QA 4PJOC 2K6DA 1RAIB 2RF0A 3PIOA 3G33B 3QBYA 4XTVA 2ROTA 1NJIU 2ED1A 1FXXA 2LZ6B 5GANj 3C4SA 2V8KA 2OJ2A 2M0OA 1K76A 4AMCA 5AT1B 1OIYB 2EJ9A 1M90C 4PNOA 1VYVA 2SEMA 4QVZA 1K9MC 3CCMA 1WDXA 1QKXA 4GBQA 1WQWA 1FMKA 1H26B 1T0HA 3GF5A 4C0DC 1QLYA 2LVMA 3KBGA 2J05A 1G3WA 2K7AA 4E7ZA 1KFZA 1VQOT 1MV0B 5IHNA 2FZGB 1BBZA 1TS9A 2DEUA 3CCET 1YHQA 2L8DA 2DIQA 4PLIA 2DEQA 2O4XA 2BS2A 4M78F 2O9SA 4HT8A 1QWFA 2RK1A 2BKZB 4BDYA 5BNJB 2MIOA 4L59A 2L0AA 3FRNA 1BI0A 2G6FX 1KD1R 1YNZA 4Z88A 3ZFJA 4LUDA 2KRNA 4RUGA 3INZA 4HNUA 4II1A 2GBQA 2CZ1B 1U5SA 1VQ8T 5DM7R 3NTKA 4CRIA 1NPPA 1Y96A 1KQSP 2PNIA 5DQVA 4FW1A 3M53A 2W96A 4F7NB 2A0FB 2VC8A 4X9DA 5KYYB 1UTIA 2EQMA 4UC4A 4OMMA 3JCMb 4M78D 1Y07A 2WXVB 3EG3A 2QA4A 2CYZB 4LDYA 5CKBA 4D8KA 2RJEA 2CS7A 4E7KA 2LNVA 1UGPB 2NUZA 1VA7A 5GAOr 3QHWB 8AT1B 4JJNK 1K0SA 2BIVA 3HFOA 3CCEQ 2KY9A 5DLOA 1D1CA 3L2RA 1H8KA 1HSQA 2HL5C 3VUZA 2RQWA 3EFOB 4IUUA 4M78A 3FJPA 2GTJA 2MOXA 3CCRT 1H1QB 4AKIA 1AWXA 4F7SB 1E9HB 1OIUB 2YSQA 4KUDK 4ELZC 4FX3B 2RJFA 1YJNA 3A5ZB 1VINA 1NPRA 1M3BA 1TUDA 4M75C 2QQAA 2C0TA 1VQKQ 5GMKe 2PVOB 2LX9A 3JCMc 4J7IA 3JCMg 5KYWA 1AEYA 3G71A 1YIJT 3LYIA 3CCVA 2WHBB 2M16A 1TFBA 2QA4T 3GBQA 1Y57A 4M7AF 3G7ZA 2EGCA 3I5RA 1X2KA 5J26A 3UDCA 2X4YA 4XTZA 1UHCA 1M8MA 2A08A 2YDLA 2DL3A 3MCAB 2FEIA 4YOOA 3O8VA 1VOLA 2DYIA 4C8QA 1Q7YU 1KG1A 5A0LA 5GJVB 2OTLT 4F7UG 4F7UB 5CAIA 3UA7A 4FYXB 5LJ5g 5IN1A 1QVFP 2EQUA 3OBWA 4DQ2A 4DOWA 3BHTB 3CMET 3BLQB 3JB9F 4HVUA 4AG1C 2CZ6B 3R6NA 1QCNA 3H6ZA 2CH4W 2F2WA 5GAMj 2O88A 1UNGD 1ZUKA 5CCAA 3DLLA 1UJ0A 4MMKA 2IVXA 1O9KB 3M0RA 1K1ZA 1TWBA 1X75C 2DVJA 1IREB 3S3OA 2W99A 1UECA 2YUOA 2HKNA 2JVVA 3MEAA 1RUWA 1WJQA 3CBOA 1Y71A 4A63B 2RHYA 1EZZB 4O6JA 1JJ2A 2C5NB 1W6XA 1ZQ1A 3MP1A 2EFIA 1ABQA 2R57A 1URCB 3OYNA 1YHQT 3NFCA 3PO3S 4FYWB 1YJWQ 3CCUT 1JO8A 4PJNA 3L2ZA 3THKA 1ZSZC 2C5VB 2E65A 5GAN5 4ME7A 3OYKA 2V1QA 1IO6A 2SRCA 4CXAB 1NYFA 5FLXE 3DB4A 4MZMA 3QZ5B 1ABOA 2CP7A 2IW9B 2QAZA 4BY7X 3EOCB 4KRDB 3TCJA 2V8JA 3X24B 4JS4A 3PTAA 2QEXT 3VS5A 1D0ZA 1H24B 4F6SB 2JS2A 1YCSB 4V2SA 2CP2A 5GAN8 3M56A 5GJWB 3H0IA 4IUPA 3JCMW 4RODA 5FRMA 4DOVA 3G4ST 4KT0E 2RMOA 4HL4A 2OAWA 3G71Q 1UNHD 3PT9A 3DDQB 2WSCE 4LDWA 4OMFB 2F2CA 2EQJA 4D6WA 3OYGA 1EX4A 3KFVA 3VYGB 4OB1B 2DXTA 4X34A 3L1AA 3DB3A 2VB6A 2CDTA 4TVRA 5D7UA 3X28B 1KD1U 1B7TA 1WZOA 3H0FA 3NMZC 1VQNA 5M9OA 1G3NC 1RL2A 5C6SA 4BCJB 5LMKB 2IN3A 2EJFA 2AKKA 3AHUA 2JGZB 1Q82R 3VS2A 3SWNB 4JZ3A 1AWOA 3CMAA 4OB0B 3HRSA 2QDJA 3V7CA 1BU1A 3HPWA 5CKEA 3JCMd 2RJDA 4ZN3A 1RACB 2RQRA 2RM4A 1ENWA 2BTTA 1BB9A 4BCGB 4C92E 3CC2T 4PL6A 3CCLQ 3VS4A 1ZX6A 3CPWP 1R77A 4ROCA 2ZZDA 1QVGS 3OW2S 3QO3A 1SG5A 1XQHA 3PIPA 1ZUYA 1MGQA 4M77G 1GFDA 1BI1A 4BCOB 3HZJA 5CQYA 2PK2A 3BHUB 3F5XB 1NLOC 1YHQQ 1Q82C 2I2LA 3HSBA 3J81E 2A7YA 1GBRA 2YLBA 1LNXA 4M7DB 1NBEB 4NOYA 3TVTA 2DETA 1V29B 4L6V5 5D6XA 1K9MR 3A8MB 4BE2A 3LQ5B 1GXIE 4JJBA 3N5BB 3CC7A 3QSUA 4OVAA 3CBPA 3QKJA 2A28A 1UB4A 1KC8R 2WIPB 1UGQB 4ZTJA 2D0QB 3H8ZA 3BHVB 1ZSZB 4UN0A 2DJZA 4M77C 1VQ5T 2YHTA 1AWJA 2RK2A 2CP5A 4BDZA 1JSTB 2P4RA 5HY6A 3RESA 3CCQT 2K2MA 1PKTA 2XKOC 4KULA 2HZYA 1QP3A 3S3NA 2ZAEA 1VQKA 1MMGA 1N6AA 4RG8A 1EFNA 1VQMQ 2KRMA 1M27C 2DTHA 4P5NA 2E1HA 3E9FA 4LE9A 1M1KC 2UZLB 3JCMh 5HK3A 2E41A 3X25B 5LJ5h 2OTJA 5DY9A 5D6WA 4D8DA 1IHWA 3CC4Q 1BK2A 4AKGA 1D0YA 2DXCA 3META 1JKWA 3MEWA 4AFZC 4BI8B 1M4ZA 5GAMe 3PGGA 2ZPFB 3VS0A 2KK4A 4DBFA 4EOSB 2FZKB 5CO7A 2XDPA 2LMJA 3VYGA 2LT4A 2L3SA 1KXUA 4IIOA 1AT1B 1M2VA 3TREA 1QMZB 1WHLA 1K8AR 3BG5A 4OB3B 1AOJA 4E7JA 3A8HB 4O5VA 4A4FA 2J06A 1WX6A 4A54A 3G71T 3RDVA 1R0CB 1YJNQ 2CREA 3G6ET 3TNIB 4CC2A 1M3CA 3EGXA 1TUGB 1YI2Q 3SFMA 1JJ2P 5I5ZB 4HXJA 1RAFB 2LT1A 2VXEA 2CJMB 3EAEA 2EGAA 4C8QF 2F5TX 2O2OA 1OYXA 3C95A 1U1TA 5CQXA 2QEXQ 3M9QA 2LW4A 2M1HA 1QLBA 2E12A 1IXDA 3VRZA 2YUNA 4JLIA 4BY1X 2CP6A 3RMQA 4JRIA 2DTIA 2JZ2A 1B07A 2ZGWA 3ZL7C 3CCJA 1H1PB 4BE0A 4X9CA 1WLPB 4OR5B 1KHCA 4FSXA 1UEBA 3CD6T 5HCKA 4PJOD 3QG1A 1ZA2B 3RUXA 3F70A 2C06A 2RI3A 1IRXA 4A4KA 5LJ3d 1OI9B 2QTXA 4NC6A 4C0ZA 1PSEA 3A1PA 3KUFA 3BY7A 2DXCB 2JMAA 3CCMQ 3DJBA 1M1KR 4M78B 2GTOA 2BZYA 4KH1B 3URGA 1N9SA 4C92B 3CCST 1YJ9T 2MCNA 3I35A 1D3BB 2EBPA 2EKHA 1Y0MA 5EG2A 3E2UA 2FYKA 4X1VA 1GCQA 2AHJB 3SDZA 3JCMV 3A8LB 1H4LD 2C4GB 3JB9I 4NS5A 1BCMA 2HEQA 2R5MA 3VS6A 2DD4B 3S6WA 4RCCA 1KQ1A 1Z9ZA 2KXCA 1JQQA 4XU3A 3CD6A 3TNHB 4XU0A 1XO2A 2R58A 1S72T 3EG0A 4M78G 2KROA 1VYUA 2YWWA 3G4SA 3L2WA 1AD5A 1RLQC 2EPDA 3I56A 2LDMA 1V1CA 2XIDA 4OMOA 4YC3B 4A53A 5FU6C 1VQ4Q 1LOJA 1U3OA 2EYQA 2NYSA 1ZSZA 2HCKA 1W2BA 2M9UA 2UZEB 2WMBB 3GLXA 5IHIA 4BB7A 3CCVQ 4J9IA 3D7SB 4QW2A 5EFQB 5FROA 3FLGA 2RNAA 1RABB 3EIDB 5KYWB 1Q86U 5GMKi 1SRLA 3OYLA 2B86A 4C5EA 2GQIA 2XU8A 4EDUA 1QVFA 1H92A 1KSWA 4A4HA 3OYFA 4C92F 1OGUB 5I2SA 3CC7Q 1SF9A 2XG8D 2KRSA 2CT3A 2A37A 2PU9B 2IIMA 1UUEA 1OI1A 2VWFA 2K79A 2KT8A 2E70A 4BACA 5IF1B 2LCLA 2AK5A 2RN8A 4HKEA 2E4HA 4EOOB 1I81A 2GF7A 3BFMA 2JW4A 4QVDA 3CMAQ 4HNVA 4PJOF 2EVRA 4M75G 2GNCA 4J9DA 1IZ6A 3I55Q 4EOIB 1M2OA 2O01E 4BCFB 1R0BG 1VQLT 2WFYB 2E3IA 3OYYA 4BCQD 2WEVB 2C6TB 2QQRA 4DA4A 1VQMT 2OTJT 5GMKm 3P8BB 2KQWA 1TSFA 2XMFA 3M0QA 5IDPB 4Z02A 3RERA 2P84A 2OTLA 4KGZB 3HB9A 1C0MA 2DRKA 2P4TA 2B9RA 4JJCA 4FCYA 2JMCA 3CCSQ 4PKCC 2LJ3A 3EGDB 4OGEA 1VQ8Q 2L89A 4CFUD 1QW1A 3OW2P 1VIEA 5CR2A 3QYGB 4M75A 2XHCA 4KBMB 2DD5B 5CEIB 4JRKA 5KH6A 2HAXA 3M03A 3CCRA 1B34A 2BUDA 4J9FA 1N9RA 7AT1B 3OYDA 3A98A 2K3XA 4AKHA 2X9HA 3EH2A 5AYFA 4EMKB 1VQ4A 4F6UB 2DILA 5ECAA 1ZHIA 1H3HA 4RTUA 1ZA1B 2GGRA 2KGTA 1VQOQ 1CKBA 1K73R 5CK9A 3LGFA 1TD6A 1VQ6Q 3CCLT 2AT1B 2DE0X 1AISB 4E2FB 2BZ8A 2LQ8A 3GNFB 4DEXA 2QQBA 3OYIA 2I40B 3RKWA 1BU2A 4AFUC 4EIKA 1M8VA 2PZ1A 2KSSA 1IGQA 4MDWA 3V7SA 4J6WA 5KCOA 3OYCA 1MHNA 2QASA 4N0AC 4J8OA 1OPLA 5LJ5j 5GAN4 1YITA 5GAN3 2CKKA 2DM1A 1D3BA 2HDAA 2K5IA 2KVQG 4OF1A 2DFUA 4BCMD 3MPUB 2PQWA 4E7SA 1Q86C 1RAEB 1KJWA 1FWZA 4G6LB 4C0GA 4ZGDB 2RH2A 1QVGP 1XOVA 1SRMA 3M59A 4XQ3A 4JLGA 2M0YA 3QYEA 2DERA 4BCPB 3T9NA 1KK7A 1UJYA 1WXTA 4Y28E 3CC2A 3V8KA 2KBTA 2QDLA 1WA7A 3DLMA 4M7DF 4M75F 1NZ9A 2NLUA 2XDBA 4ESRA 4F7UA 1KHIA 1IGUA 5A2QE 4PJJA 4NSTB 4RCBA 2DVEA 3PVLA 1MMDA 2DBKA 4C5HA 1WXBA 3M4YA 4II5B 1X69A 2KXDA 1PRLC 2E6NA 3UATA 3OYBA 2VUBA 2DXBB 2CUBA 3V7RA 5I22A 4K11A 2EYYA 1VYTA 4HVVA 4M7DA 4OGRB 3OA6A 1QWEA 4JUVA 3S3MA 3JB9J 4PK4A 3C94A 4QQGA 4PFZA 3P8HA 4LUEA 1SHFA 3LX7A 2D9TA 2W0ZA 4GLMA 4CFUB 5LJ5e 1KQ2A 4EONB 1VQ7A 1A0NB 5I2MA 1Q82U 2DXBA 1B34B 2LP5A 3M0PA 2KI7A 4DBRA 4ZGJB 3OS0A 3OYMA 3GNGA 3MI9B 3R6OA 1XTDA 1MMAA 1PKSA 2HL3A 3REBB 3C12A 4CFVB 3OYJA 2I53A 1VQ7T 5GAN6 4YTLA 1OKVB 1WHMA 3OMGA 2K2VA 5KCHA 2X3WD 2OTJQ 5LJ5f 2XK0A 4BCQB 3CCUA 1GRIA 2KYMA 3LWIA 2GCXA 2K4YA 1P5EB 1YJ9A 1CSKA 3TQ7P 1G83A 4BE1A 4FIBA 3L2UA 3JAME 2LCCA 2PK9B 3CPFA 3SHWA 4BI3A 1KD1C 4E7IA 5GAOn 3CXCP 3FIFA 1MMNA 4M75E 5EC7A 1W4SA 1WNLA 2EQIA 2EYZA 2CZ0B 2ATCB 2QTVA 4J6XA 4OGCA 2CT4A 1N4MA 1JJ2S 5HBEB 1M1GA 3ZEHA 3FJ5A 2QQ8A 2ZPGB 2BZXA 3MJXA 4N4GA 5J39A 4BCNB 5IT9E 4EOQB 2DTOA 2KAFA 2L3RA 3DL1A 1U1SA 3DDPB 1BI2A 2HSEB 4J9BA 4QT7A 1RAAB 3JB9H 4N0AA 2BPMB 4KRCB 2J6KA 1KIKA 4EMKA 2DLPA 2JS0A 1OX8A 2UUEB 4M7DG 4EMHA 3GPLA 1LVKA 1QQJA 5HVYB 2QGSA 3QJYA 5GMKh 4BCMB 4JZ4A 5GANh 3CCJQ 3UA6A 1H27B 1W1FA 3M55A 1QKWA 2YUPA 2DL7A 2FB7A 3OS1A 4HCZA 4FSSA 4JDSA 4TTHA 4M7DE 2G9XB 2K9GA 4JX4A 3KXTA 1WPYA 1M1KU 1I07A 1JU5C 2MF2A 3PE0A 3JCMQ 5C0MA 4XTWA 2F2VA 4XK8E 4E7LA 1I1JA 3JCMJ 2R5AA 3JCMe 2I0NA 3MO8A 2K57A 1WI7A 2F69A 1VQ9A 1YI2A 4OB2B 1SEMA 5ACBA 4M78C 3K7AM 4F7UF 1WXUA 3QXEB 2IW8B 1T3SA 2CSIA 3POMA 4AFQC 4CFXB 2X51A 5ICPB 1MUZA 2FL7A 1JRIA 2FHDA 1PG5B 1X43A 2HQEA 4EPCA 4Z89A 2MYSA 5CKHA 3CD6Q 1VQ8A 4A4EA 4A4GA 5GAMg 1K8AC 2WACA 4OMPA 1Q95G 2C5OB 2KE9A 4BY6C 5GAN2 1Y7XA 2YRDA 3L42A 4F14A 1Q81R 3I56Q 4RTZA 2M02A 4ANJA 2X3XD 3REAB 3EGDA 1BKBA 1VQLA 4CC4B 1TH7A 2MWPA 4F17A 1SPKA 3CC2Q 2F1LA 3TNWB 1T0JA 4JRQA 2VXFA 2JN0A 2ZPEB 3DOGB 1OV3A 4FT4A 3BG3A 4CRLB 3HL8A 1M90R 3HHTB 5LJ3e 1VUBA 4IKFA 4WCIA 2O9VA 1NEGA 1RADB 3M58A 1JXOA 1UNLD 3BLRB 1ACMB 4QSHA 3TW6A 1YIJQ 3MIAB 2QQ9A 4C5GA 3M0UA 3CCEA 3TN8B 1OOTA 2X35A 1G3SA 1M2VB 2K3BA 2FPEA 4XU1A 2ZZDB 2JTMA 2OAUA 2QFZA 1G3TA 4IUQA 3OW2A 4BY6B 1OKWB 2HD0A 2EKOA 5KYYA 3ER0A 1QMCA 2KEAA 4JS5A 2M51A 1NJIR 3EJ1B 2EJGA 3HKSA 2PJQA 3O0GD 2L3QA 2LC4A 3OYEA 2P0KA 4J83A 1P92A 1WQ7A 2EIFA 1YJWT 4M7AC 2NWMA 1YJ9Q 3H9NA 1NYGA 4QVCA 1HXDA 4PJLA 2LQNA 3CCQQ 4NL3A 4JX5A 3QDRB 3CBMA 3EH1A 3AT1B 5DQWA 4BCKB 3LLRA 1I8FA 2RJCA 2X4JA 3J7AF 4C8QC 4LDVA 2ESWA 4NL2A 1E6HA 1YJWA 2DA9A 2J6FA 1LCKA 1D1AA 3OYAA 2CUDA 4XU2A 1NE8A 1M1FA 1W2BS 1YBYA 4M7AA 1WHKA 4HCBA 4J5YA 3OQ5A 1VQLQ 1K9AA 5GANg 2ENMA 2RQTA 4HCKA 3I55T 1H25B 4GY5A 4IMYB 4BBRM 4C92D 2IPOB 5EJCA 1O75A 5L2WB 1NEBA 4BI4A 3OBYA 4KGVB 5IDNB 2DXUA 4C92A 1K9MU 3JB9G 2FPDA 4PJMA 2DZCA 1M90U 1KQSA 4N4IA 2QEXA 4MDXA 3CCJT 1W2BP 3UWNA 4F7UE 1C6VX 2JXBA 3QUIA 1IB8A 2DMEA 3GIBA 1ZSGA 4ELJA 2YRVA 4BUGA 1O9KA 3HRTA 1VYWB 4FT2A 1YIJA 2RPNA 1Q7YC 1TUCA 3SWNC 4DBQA 4R56A 4BD3A 1FINB 3GTMS 2D0NA 3OSVA 1KC8C 1YJNT 1G2BA 1W70A 4RG2A 1ZBJA 1HD3A 2G3RA 3M5AA 2MPXC 2DX1A 2E10A 3J80E 1XJWB 2FO0A 3JRZA 1F1BB 2K3YA 1VQPA 3CCRQ 2L3PA 5GMKl 2LTOA 2HMAA 5GAMh 1LPLA 3V8LA 1JBMA 1AVZC 3WVEB 4EORB 3EG9B 5FU6B 3VS1A 4F16A 5KE3A 1OULA 5GANf 4F7JB 3RGFB 2DRMA 3QPHA 4M6VA 3RIRA 2BS3A 2Y4XA 4HVWA 2LCSA 5DLQE 4JPBW 1JEGA 1Q81C 5I21A 3RBBB 3BG9A 2EUFA 3MHXA 1UG1A 3TEEA 3JCMf 1BIAA 2O4XB 3VS3A 3JV3A 4DBHA 4IUTA 4F6WB 1D0XA 4J9CA 3Q1JA 4ORZA 1N27A 4C92C 4AI6A 4J6YA 1K0XA 2LX7A 4EOLB 1XNIA 4J7FA 3QHRB 4ELLA 4C8QD 2CCHB 4YOSA 1X6GA 3JCMX 3G6EA 1SSFA 4RTVA 3OYHA 5LJ3j 2C5XB 3LH5A 3I5SA 3VKGA 1QCFA 2H3EB 4Y92A 2XI9A 2V1RA 5LJ3g 3QYHB 3BW1A 3EFSA 2F5KA 4C92G 3OSSC 2ED0A 3EHQA 1WHGA 3M54A 1Q81U 1VQ9Q 2RI2A 2QDYB 4LD9K 2LNHB
chains in the Genus database with same CATH topology
5HK0A 3HPWA 3PMTA 3C94A 4QQGA 1X01A 5CKEA 3JCMd 1BYMA 2RJDA 4ZN3A 2DKGA 2RM4A 3PMIA 3P8HA 3LX7A 4C92E 3UT1A 2D9TA 3OY9A 3CC2T 3A8OB 4PL6A 3QIIA 5D6YA 5CKFA 3PNWC 5LJ5e 2ZZDA 1QVGS 1KQ2A 1VQ7A 3OW2S 5I2MA 4LD6A 3QO3A 1Q82U 3CCVT 2DXBA 3CMAT 1B34B 1XQHA 2MI6A 3PIPA 3TU4K 3OS0A 4ZGJB 3OYMA 2PUOB 2DPPB 1MGQA 2PVGB 3SD4A 3GNGA 4M77G 1BI1A 4IURA 3HZJA 1VQ4T 5CQYA 3CPWS 3ZBDA 1Q82C 2I2LA 3HBLA 3R6OA 2CGHA 1G5VA 1XTDA 3HSBA 4M7AE 3C12A 3OS5A 3J81E 2A7YA 3OYJA 2YLBA 2RHXA 1VQ7T 1X6OA 1LNXA 5GAN6 4M7DB 2B8AA 3OMGA 1YCYA 4NOYA 4YTLA 2K2VA 5KCHA 1V29B 4L6V5 5D6XA 5LJ5f 3A8MB 2XK0A 4BE2A 1GXIE 3PFSA 3N5BB 3CC7A 3QSUA 4HA8A 4OVAA 3CBPA 3QKJA 2JNGA 3CCUA 1UB4A 3LWIA 3HRUA 2GCXA 2IG0A 1QVPA 2K4YA 1UGQB 2VGMA 3UPUA 1YJ9A 3GP8A 4ZTJA 1VQMA 3OB9A 4BE1A 1AHJB 2LRQA 2D0QB 3H8ZA 4FIBA 3L2UA 4JX6A 4M77C 2DJZA 1VQ5T 2X4XA 3FB9A 3JAME 1VIFA 1WJRA 2YHTA 2LCCA 2RK2A 3WVDB 2DK3A 1NJIC 4LDXA 3RKYA 1UGSB 2QF7A 4BDZA 3ASKA 5HY6A 3RESA 3CEYA 3CCQT 2XKOC 2KMTA 3CPFA 3DKMA 2WSFE 3QJ6A 4KULA 4BI3A 1I4K1 2DZ9A 1KD1C 1QP3A 4E47A 1H641 3S3NA 1VQKA 1N6AA 4M77A 4E7IA 4M75D 4RG8A 5GAOn 4XTUA 3FIFA 4XTXA 4ELYC 2KR6A 2EAYA 2DTHA 4M75E 4P5NA 5FU7C 1M9SA 1W4SA 2E1HA 4MIMA 1WNLA 3E9FA 4HLQA 1H3ZA 5GMKj 2CZ0B 2PUKB 4MFDA 1Y96B 4J6XA 4OGCA 1M1KC 4HT9A 2RO0A 1WJSA 3JCMh 5HK3A 1JJ2S 2E41A 3X25B 3SWNA 5LJ5h 1M1GA 5GANe 3ZEHA 4M77F 4XAXB 2QQ8A 2OTJA 1O9SA 4LOCA 2ZPGB 5DY9A 5D6WA 2K5LA 2VGNA 3E1SA 1EIFA 4JRPA 4ATOA 4N4GA 5J39A 5IT9E 2DTOA 2GFUA 3CPWA 3CCMT 4AKGA 2KAFA 2L3RA 2DXCA 3DL1A 3META 3MEWA 1U1SA 2G77A 1BI2A 4BI8B 1M4ZA 5GAMe 3JB9D 3PGGA 3JB9H 2ZPFB 4N0AA 3VYHB 2KK4A 4C0FA 1VQNT 1QVFS 3VKHA 5CO7A 2XDPA 5FU7B 3VYGA 2LT4A 4EMKA 3X26B 4C0GA 3CXCS 5GAOl 5L8RE 4M7DG 3TREA 2DD4A 2L5QA 1WGSA 4EMHA 3GPLA 3BDUA 3BDLA 2VV5A 1YITT 2RI5A 1OZ2A 3BG5A 4OB3B 3QJYA 4E7JA 3A8HB 2RA2A 1R8OB 2EWNA 4O5VA 2HNIA 2MWOA 5GMKh 2LQKA 5GANh 3H4CA 4A4FA 2QQSA 3V8JA 4M7DC 4A54A 3G71T 3M55A 3P8DA 2FB7A 3OS1A 3QYBA 4HCZA 3VKIA 5FRNA 4M7AD 4JDSA 3G6ET 4M7DE 2RHIA 3A8GB 4JX4A 4C8QE 3KXTA 1WPYA 3QHSA 1M1KU 3CC4A 3SFMA 2MF2A 2XDDA 2LT1A 3JCMQ 1KC8U 5C0MA 3CMEA 2VXEA 4XTWA 2ZPIB 3EAEA 4XK8E 4C8QF 2KDSA 2F5TX 4M78E 5CKDA 4E7LA 3JCMJ 2R5AA 1FX7A 3FC3A 1OYXA 3E19A 3C95A 4ZN1A 1U1TA 5CQXA 3JCMe 1BIBA 4L5GA 2GQVA 2E5QA 3MO8A 3M9QA 4JUVA 4CI0C 3L2QA 2K57A 4PJOC 2M1HA 1QLBA 2E12A 2F69A 1VQ9A 3PIOA 1YI2A 3QBYA 4OB2B 4IUVA 4XTVA 1NJIU 3CXCA 1FXXA 4JLIA 4M78C 5GANj 3C4SA 2V8KA 4MMLA 3RMQA 4JRIA 2DTIA 2JZ2A 2M0OA 3MEUA 4F7UF 2EJ9A 2ZGWA 3LGLA 4PNOA 3QXEB 2BKDN 4M7AB 3CCJA 4M75B 4BE0A 1M90C 4X9CA 4QVZA 4GLKA 3TW7A 4XTYA 1K9MC 1KHCA 3CCMA 1WQWA 4FSXA 3J7AF 1UEBA 4MZTA 3GF5A 4C0DC 2VYTA 3CD6T 2LVMA 1YI2T 4MZPA 4PJOD 3KBGA 3QG1A 2FL7A 1JRIA 2FHDA 2HQEA 1G3WA 3RUXA 4EPCA 4C0DB 3F70A 2C06A 2RI3A 1VQOT 5GAMf 4A4KA 5CKHA 5LJ3d 2QTXA 4NC6A 4A4EA 4A4GA 3KHIA 2P0QA 4C0ZA 1PSEA 5GAMg 1VQ8A 1K8AC 2WACA 3KUFA 3CCET 2E6ZA 5GAN2 4BY6C 3BY7A 2DXCB 1YHQA 2L8DA 2E64A 2HQXA 2DIQA 3MP8A 4PLIA 5IAYA 1Y7XA 3L42A 2DEQA 2DO3A 2O4XA 2BS2A 4M78B 4M78F 4HT8A 3NTIA 2RK1A 2Y90A 4R55A 2RHZA 3V7CA 1BKBA 3URGA 2HBPA 1VQKT 1VQLA 4PJOB 1N9SA 1TH7A 4C92B 2MWPA 3CCST 1YJ9T 4BDYA 1D3BB 4E7HA 4L59A 4M7DD 3VUBA 3FRNA 1BI0A 5EG2A 1VQPT 3ZFJA 4PJOE 2A3LA 3INZA 2FYKA 1VQ5A 4HNUA 4JRQA 4II1A 2QI2A 5GAOq 2AHJB 2VXFA 2JN0A 3SDZA 3MP6A 3A8LB 3JCMV 2RHUA 5HKCA 3JB9I 1K8AU 2ZPEB 4FT4A 4NS5A 3BG3A 4C5IA 2CZ1B 2JOYA 3HL8A 3M57A 2R5MA 3HHTB 5LJ3e 1VUBA 4IKFA 2DD4B 3S6WA 1VQ8T 5DM7R 4WF2A 4LD9K 3NTKA 4RCCA 2V8IA 4CRIA 1KQ1A 1NPPA 1Y96A 4PJOG 3M58A 5LL6S 4XU3A 5LJ3h 3CD6A 4XU0A 2R58A 1VQ9T 4QSHA 3TW6A 1S72T 5KE2A 4M78G 3M53A 2VC8A 4X9DA 2QQ9A 4C5GA 3G4SA 2EQMA 3CCQA 3L2WA 5GAOp 4UC4A 3CCEA 3JCMb 4M78D 3I56A 2X35A 1Y07A 4C8QB 1G3SA 2QA4A 2CYZB 3QZ9B 2JTFA 2LDMA 4LDYA 5CKBA 3SB2A 2RJEA 2XIDA 4LDUA 4A53A 2CS7A 4XU1A 2ZZDB 2JTMA 5FU6C 3OS2A 1LOJA 1OZ3A 2OAUA 2QFZA 2EYQA 2LNVA 1G3TA 1UGPB 4E7KA 4IUQA 3OW2A 4M77E 5GAOr 1W2BA 4BY6B 2M9UA 2HD0A 3GLXA 4BB7A 4RKUE 1N8RC 2EKOA 3ER0A 4JJNK 4QW2A 4JS5A 5FROA 2BIVA 2EJGA 3HKSA 3HFOA 4M7AG 3FLGA 2LC4A 1Q86U 3OA6A 3OYEA 5GMKi 4B9XA 2Y4YA 2KY9A 1E7PA 4C5EA 2P0KA 2XU8A 4EDUA 5DLOA 3OYLA 1QVFA 4J83A 3L2RA 4A4HA 3OYFA 4C92F 5I2SA 1P92A 1WQ7A 2EIFA 1YJWT 1K73U 4M7AC 3VUZA 2XG8D 4FU6A 4RMOA 3FEOA 4IUUA 4M78A 2PU9B 3FJPA 3JCMP 4QVCA 3CCRT 1HXDA 1M5Q1 4AKIA 1OI1A 2E70A 5A0DA 4BACA 1KQSS 2LCLA 4JX5A 3QDRB 3X20B 4NL3A 4KUDK 3CBMA 4ELZC 2RJFA 3GOXA 1FKMA 1YJNA 3LLRA 1I8FA 2RJCA 2X4JA 1NPRA 3A5ZB 4HKEA 4C8QC 4LDVA 4M75C 4NL2A 1YJWA 2QQAA 5A0GA 1I81A 2GF7A 2RB6A 3BFMA 4QVDA 5GMKe 2PVOB 2LX9A 3JCMc 1BI3A 4HNVA 4J7IA 3JCMg 3G71A 1YIJT 3LYIA 3OYAA 4PJOF 3CCVA 3HO8A 3ME9A 2M16A 4XU2A 1NE8A 4M75G 2QA4T 1IZ6A 1M1FA 3JSCA 1YBYA 3M4GA 5GAMd 1W2BS 4M7AA 3HFNA 4M7AF 2O01E 3G7ZA 4EMGA 2DAQA 1VQLT 4HCBA 4QQDA 3CC7T 4MFEA 3CCSA 5J26A 3OYYA 3UDCA 4J5YA 2X4YA 4XTZA 3OQ5A 1LJOA 3LH0A 2QQRA 3MCAB 4DA4A 3VU3C 5GANg 1VQMT 2OTJT 3O8VA 5GMKm 4VUBA 3P8BB 4C8QA 1Q7YU 1KG1A 3OMCA 5A0LA 3I55T 2OTLT 2WJ9A 4F7UB 4GY5A 2KQWA 4F7UG 5CAIA 4HNTA 4Z02A 5LJ5g 3VJPA 3S3MA 3RERA 4BBRM 3I55A 4C92D 2OTLA 5IN1A 5EJCA 1O75A 3HB9A 3WXMB 2EQUA 3OBWA 4DQ2A 2MAMA 2P4TA 4DOWA 2P0PA 4PLLA 5J3BA 4BI4A 3OBYA 3CMET 3LW5E 2MMPA 2DXUA 4C92A 1K9MU 3JB9F 3JB9G 3QWLA 4PKCC 3VV0A 2DZCA 2CZ6B 4OGEA 2JUFA 3H6ZA 2PVDB 5GANd 1M90U 1KQSA 4N4IA 2QEXA 4MDXA 1DJ7B 5GAMj 3LWHA 4PJOA 3CCJT 2L89A 3UWNA 4F7UE 1QW1A 3QUIA 5GAOm 1VIEA 2ZPHB 4KUIA 3QYGB 4M75A 5CCAA 5CR2A 3DLLA 2XHCA 4MMKA 4M77D 3GIBA 4ELJA 2YRVA 2DD5B 4KBMB 4Y91A 3RMSA 4BUGA 1VQOA 2DD5A 1X75C 3HRTA 4JRKA 1VQ6A 1IREB 5KH6A 3S3OA 4FT2A 1YIJA 2HAXA 1Q7YC 3SWNC 1VQ6T 3CCRA 1QVGA 1B34A 2BUDA 1N9RA 4EMKC 3OYDA 4R56A 4BD3A 3I56T 2K3XA 4AKHA 2JVVA 2K5FA 5AYFA 3MEAA 3OSVA 1KC8C 4C8QG 1WJQA 3EFRA 4EMKB 1YJNT 3CBOA 1VQ4A 1RI0A 1S72A 1G3YA 4RG2A 1ZHIA 1Y71A 3HRSA 2G3RA 2RHYA 3M5AA 2E10A 3J80E 4O6JA 3CC4T 4OP0A 1ZQ1A 3MP1A 1JJ2A 2EFIA 2EQKA 5CK9A 3LGFA 3JRZA 2K3YA 2R57A 3CCLT 1VQPA 4FM4B 2YLCA 1HK9A 5GMKl 2ZPBB 2LQ8A 3GNFB 3NFCA 5LJ3f 3OYNA 1YHQT 1ZBXA 2FVUA 2LTOA 2QQBA 3OYIA 3CCUT 5GAMh 3V8LA 3L2ZA 3RKWA 2E65A 5GAN5 4ME7A 1JBMA 5KE3A 3WVEB 1M8VA 5FU6B 3OYKA 2KSSA 1QP2A 4B9WA 5CIUA 2D6FA 4MDWA 4N4HA 4J6WA 3V7SA 5FLXE 3DB4A 1MHNA 5KCOA 5GANf 3OYCA 4BBSM 3QPHA 4MZMA 3QZ5B 4N0AC 4J8OA 4M6VA 3RIRA 5LJ5j 5GAN4 1YITA 3TCJA 2BS3A 2V8JA 5GAN3 3X24B 2KMGA 2CKKA 2XD0A 4QQ6A 3PTAA 1D3BA 1PSFA 2Y4XA 2QEXT 4JS4A 5DLQE 1K73C 2K5IA 2KVQG 4M77B 4Q5WA 1Q81C 5I21A 2IVWA 4HCCA 4OF1A 4V2SA 3BG9A 3L2VA 5GAN8 3MHXA 3M56A 3TEEA 2PQWA 4IUPA 3JCMf 3JCMW 1BIAA 1Q86C 2O4XB 4DOVA 3G4ST 1U8RA 1FWZA 5FRMA 4IUTA 4KT0E 2ZCFB 5CVIA 4HL4A 2H3JA 4ZGDB 2RH2A 3FDRA 3E9GA 3MEVA 3Q1JA 1N27A 1XOVA 2DIGA 4C92C 4AI6A 4J6YA 1I5LA 3PT9A 4OMFB 2WSCE 2X4WA 4LDWA 2XICA 1N8RU 3M59A 2EQJA 4XQ3A 4D6WA 3OYGA 4JLGA 3QYEA 1XNIA 4J7FA 4C8QD 5GAN7 3T9NA 3CC2A 4FL6A 4Y28E 3VYGB 2RD1A 3V8KA 4OB1B 3JCMX 2DXTA 4X34A 3L1AA 2CZ7B 3DB3A 4ZTFA 3G6EA 1SSFA 2GFAA 3DLMA 2WSEE 4TVRA 3OYHA 4M75F 1NZ9A 2NLUA 5LJ3j 2XDBA 4M7DF 3X28B 1KD1U 4F7UA 1KHIA 5A2QE 1UGRB 3VKGA 3NTHA 4RCBA 1VQNA 2DVEA 2XI9A 5M9OA 4C5HA 1RL2A 2QXFA 5LJ3g 3QYHB 3BW1A 2BS4A 3EFSA 3M4YA 2F5KA 4C92G 5C6SA 5LJ5d 2E6NA 3OYBA 3CCLA 4ZGEB 2VUBA 2DXBB 2EJFA 3OSSC 3V7RA 3AHUA 3HP9A 3M54A 3RKXA 1Q81U 2RI2A 4M7DA 2QDYB 1JB0E 3SWNB 3CMAA 4OB0B 2QDJA 4Z6YA 3JB9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  3QYG B;  4OB3 B;  3A8H B;  2DD5 B;  2DD5 A;  1IRE B;  3A8O B;  2CYZ B;  3QZ9 B;  2ZZD A;  3A8G B;  2DXB A;  2ZZD B;  1UGP B;  4ZGJ B;  2PUO B;  2DPP B;  2PVG B;  4RKU E;  2ZPI B;  4XK8 E;  4FM4 B;  2ZPB B;  1V29 B;  4L6V 5;  3A8M B;  1GXI E;  3WVE B;  4OB2 B;  1QP2 A;  1UGQ B;  2PU9 B;  3QZ5 B;  1AHJ B;  3QXE B;  2D0Q B;  3X24 B;  3X20 B;  1PSF A;  3WVD B;  1UGS B;  2WSF E;  1QP3 A;  2PVO B;  1PSE A;  4KT0 E;  2ZCF B;  4ZGD B;  2DXC B;  2WSC E;  2CZ0 B;  2PUK B;  2O01 E;  3X25 B;  4Y28 E;  3VYG B;  2ZPG B;  4OB1 B;  2CZ7 B;  2WSE E;  3X28 B;  2DXC A;  1UGR B;  2AHJ B;  3A8L B;  2ZPF B;  2ZPE B;  3VYH B;  3QYH B;  2CZ1 B;  3LW5 E;  3VYG A;  3HHT B;  2DD4 B;  3X26 B;  4ZGE B;  2CZ6 B;  2DXB B;  2PVD B;  5L8R E;  2DD4 A;  1DJ7 B;  2QDY B;  1JB0 E;  4OB0 B; 
#chains in the Genus database with same CATH topology
 5HK0 A;  1IHV A;  1X01 A;  1BYM A;  3QDF A;  3EGU A;  2DMO A;  3UT1 A;  3QII A;  5D6Y A;  1BCO A;  3CMA T;  2MI6 A;  2DF6 A;  2DPP B;  2PUO B;  4FW2 A;  2WIH B;  3CPW S;  1FYN A;  4J9G A;  2CGH A;  1G5V A;  2RHX A;  2QGG A;  2B8A A;  4LXC A;  1YCY A;  1D1B A;  4CC3 A;  3PFS A;  4HA8 A;  3O5Z A;  1OPK A;  3GP8 A;  3IQL A;  3OB9 A;  1Q7Y R;  2QA4 Q;  4BXX X;  2X4X A;  3FB9 A;  1GBQ A;  1NJI C;  2DK3 A;  4LDX A;  3RKY A;  4AFS C;  2YT6 A;  3ASK A;  3CEY A;  2KMT A;  2WSF E;  2DZ9 A;  1PWT A;  4OMN A;  1Q86 R;  4M75 D;  1S72 Q;  4ELY C;  2KR6 A;  1M9S A;  1HYO A;  1H3Z A;  2HSP A;  4MFD A;  4EOP B;  1UE9 A;  2RO0 A;  3VRY A;  2KNB B;  4EC9 B;  2EYX A;  5KYN A;  2BE7 D;  4M77 F;  2W9Z A;  4XAX B;  1O9S A;  2VGN A;  2JM9 A;  1EIF A;  4ATO A;  2VKN A;  4RTT A;  2GFU A;  1PM3 A;  2G77 A;  5FW9 A;  4M4Z A;  2D8H A;  2YRC A;  1QVF S;  2W10 A;  1NG2 A;  5FU7 B;  3X26 B;  1ZP2 A;  2FRY A;  5GAO l;  1MNE A;  2DD4 A;  1ARK A;  1NLP C;  1OU9 A;  3BDU A;  1AZE A;  2VV5 A;  1YIT T;  1OZ2 A;  1TU0 B;  1R8O B;  2MWO A;  2LQK A;  3H4C A;  2QQS A;  3V8J A;  5HBH B;  1F5Q B;  2FG0 A;  4M7D C;  3QYB A;  1E6G A;  2EYW A;  3VKI A;  1PRM C;  1U06 A;  2ECZ A;  9ATC B;  3H0H A;  2RHI A;  3M0T A;  3A8G B;  1Z9Q A;  4KH0 B;  4C8Q E;  5IHK A;  5HNB B;  2XDD A;  1PC0 A;  3CME A;  1M3A A;  2COZ A;  3EG2 A;  1FX7 A;  3FC3 A;  3E19 A;  4ZN1 A;  1QCO A;  1BIB A;  3EGX B;  4L5G A;  2E5Q A;  4CI0 C;  1PHT A;  1I5O B;  4JJD A;  2QG9 B;  4RTX A;  4IUV A;  3CXC A;  4MML A;  3MEU A;  4M7A B;  3LGL A;  4E6R A;  2BKD N;  4M75 B;  2CP0 A;  3TW7 A;  4GLK A;  4XTY A;  2IW6 B;  3TSW A;  2QGF B;  1MND A;  4MZT A;  2VYT A;  1YI2 T;  4MZP A;  4C0D B;  4BCH B;  5GAM f;  2RQU A;  3KHI A;  2P0Q A;  2E6Z A;  2EGE A;  2E64 A;  2HQX A;  3MP8 A;  5IAY A;  2DO3 A;  1FVV B;  1WFW A;  4QKU A;  3NTI A;  2Y90 A;  4R55 A;  2RHZ A;  2HKQ B;  1VQK T;  2HBP A;  1GL5 A;  4PJO B;  3RR6 A;  1YP5 A;  4BCI B;  4E7H A;  4M7D D;  3VUB A;  1ZLM A;  1VQP T;  2DBM A;  4PFO A;  4PJO E;  2A3L A;  2W9F A;  2DL5 A;  1VQ5 A;  2QI2 A;  5GAO q;  3NGP A;  5HKC A;  3MP6 A;  1K8A U;  2RHU A;  1G8X A;  4C5I A;  2OI3 A;  1AWW A;  2JOY A;  3M57 A;  2HBW A;  2LJ0 A;  3EG1 A;  1C9B A;  4WF2 A;  2V8I A;  2D8J A;  1WHH A;  5IHY A;  4PJO G;  5LL6 S;  5LJ3 h;  1OQK A;  3CQT A;  4ZNX A;  3CCU Q;  4RTW A;  2UZD B;  1VQ9 T;  1FMV A;  5KE2 A;  3QWY A;  3CCQ A;  5GAO p;  4C8Q B;  5KYU A;  3QZ9 B;  2JTF A;  4CFM B;  1X2Q A;  3SB2 A;  4LDU A;  3OS2 A;  1OZ3 A;  1S1N A;  4M77 E;  5IXF A;  4RKU E;  1N8R C;  1VQN Q;  3EFO A;  1YWP A;  4M7A G;  2LJ1 A;  4B9X A;  2Y4Y A;  1E7P A;  1E7O A;  1TOV A;  4CC7 A;  3DTO A;  5FWB A;  1UHF A;  1K73 U;  1WHJ A;  4FU6 A;  4RMO A;  3FEO A;  2X1N B;  3EHR A;  3JCM P;  1WIE A;  1M5Q 1;  5A0D A;  1OU8 A;  1KQS S;  3X20 B;  3B57 A;  2DL4 A;  3NPF A;  3GOX A;  1FKM A;  1GCP A;  4CFW B;  5A0G A;  2RB6 A;  5IH2 A;  4AG2 C;  1BI3 A;  1WYX A;  1VOM A;  2R7G A;  3HO8 A;  3ME9 A;  2DNU A;  2OTL Q;  3JSC A;  1PNJ A;  3M4G A;  5GAM d;  3HFN A;  1JXM A;  1AD6 A;  4EMG A;  2DAQ A;  2O31 A;  4QQD A;  3CC7 T;  4MFE A;  3CCS A;  3NDQ A;  1JSU B;  2H8H A;  2L2P A;  4LNP A;  1LJO A;  3LH0 A;  2NUP A;  3VU3 C;  4DEY A;  4VUB A;  3OMC A;  3ULR B;  2WJ9 A;  2KR3 A;  4HNT A;  3VJP A;  3I55 A;  1PD0 A;  2DJQ A;  1VQP Q;  2YXY A;  4B6M A;  3WXM B;  1H28 B;  2OX7 A;  2MAM A;  2P0P A;  4PLL A;  5J3B A;  1HJD A;  1C1A A;  2MMP A;  3LW5 E;  3QWL A;  4J9E A;  3VV0 A;  3H41 A;  2JUF A;  5GAN d;  2PVD B;  1DJ7 B;  2WPA B;  4PJO A;  3LWH A;  2AZS A;  1I0C A;  1RLP C;  5GAO m;  4KUI A;  2ZPH B;  4FYY B;  4EOJ B;  4M77 D;  4Y91 A;  1VQO A;  3RMS A;  2DD5 A;  1VQ6 A;  2WMA B;  1MV3 A;  1ZUU A;  3M0S A;  1VQ6 T;  3G1J A;  1QVG A;  4EMK C;  3I56 T;  4I3Z B;  2K5F A;  2QK0 A;  4Z8A A;  1FMW A;  4C8Q G;  1GH6 B;  3EFR A;  5KYU B;  1GCQ C;  1SKU B;  1RI0 A;  1S72 A;  1G3Y A;  1OEB A;  2NUT B;  4YOZ A;  3CC4 T;  4OP0 A;  2EQK A;  3MKD A;  1YWO A;  2J6O A;  1YFN A;  3UF4 A;  4PFP A;  4FM4 B;  2YLC A;  1HK9 A;  1PD1 A;  1GUX B;  2ZPB B;  3NHN A;  2J7I A;  5LJ3 f;  4OML A;  1ZBX A;  2FVU A;  3I9Q A;  2VVK A;  1VQ7 Q;  2BE9 B;  4AT1 B;  2A36 A;  1QP2 A;  4B9W A;  1OL1 B;  5CIU A;  2D6F A;  4N4H A;  4BBS M;  5KYX A;  2E5K A;  2KMG A;  2XD0 A;  4QQ6 A;  4CFN B;  1PSF A;  1K73 C;  4M77 B;  4Q5W A;  4HCC A;  3PVQ A;  2IVW A;  4EOK B;  5FGK B;  4F70 B;  2QYZ A;  3L2V A;  2CCI B;  4F04 B;  1X27 A;  1N8R R;  1GY3 B;  1U8R A;  4F7L B;  2ZCF B;  5CVI A;  3MEV A;  3FDR A;  2COY A;  2H3J A;  3E9G A;  1I5L A;  2DIG A;  1YIT Q;  2X4W A;  1N8R U;  2XIC A;  1K4U S;  2HQH A;  1UDL A;  5GAN 7;  4FL6 A;  2RD1 A;  4EOM B;  5I11 A;  1OL2 B;  2CZ7 B;  2LQW A;  4ZTF A;  4IIM A;  2FZC B;  2GFA A;  2MK5 A;  2WSE E;  4ROE A;  2EW3 A;  3CME Q;  1UGR B;  3NTH A;  1H1S B;  1NM7 A;  2QXF A;  2NUT A;  2BS4 A;  5LJ5 d;  5CYI B;  3CCL A;  4ZGE B;  4KGX B;  3HP9 A;  2C0I A;  3G6E Q;  3RKX A;  1GUX A;  2PMI B;  1JB0 E;  4Z6Y A;  2JM8 A;  4EC8 B;  3PMT A;  1UFF A;  1D3U B;  2DKG A;  3BE3 A;  3PMI A;  1SHG A;  2KT1 A;  3OY9 A;  3A8O B;  5CKF A;  5FWC A;  3PNW C;  1GFC A;  2ABL A;  2KYB A;  4KRT A;  4LD6 A;  1CKA A;  3CCV T;  5L23 A;  1RI9 A;  3TU4 K;  2PVG B;  3SD4 A;  4IUR A;  1VQ4 T;  2AZV A;  3C0C A;  3ZBD A;  2FRW A;  2C0O A;  3HBL A;  4M7A E;  3OS5 A;  3MY1 B;  1X6O A;  1AZG B;  1OX9 A;  2VAS A;  2V22 B;  5HQ0 B;  2JNG A;  3HRU A;  2IG0 A;  3RNJ A;  1QVP A;  5LQF B;  2FPF A;  2VGM A;  3UPU A;  3G4S Q;  1VQM A;  2CP3 A;  1AHJ B;  1VQ5 Q;  1TXQ A;  2LRQ A;  1V76 A;  4JX6 A;  4BCN D;  1RAG B;  4RTY A;  1VIF A;  1WJR A;  5IXB A;  3WVD B;  3VS7 A;  1UGS B;  2QF7 A;  5HBJ B;  1N5Z A;  3DKM A;  1B3Q A;  2DYB A;  2RQV A;  3QJ6 A;  1I4K 1;  2AKL A;  4E47 A;  1H64 1;  4M77 A;  3SEM A;  4XTU A;  4XTX A;  4WTO B;  2EAY A;  2UZB B;  5FU7 C;  5KYX B;  4J9H A;  3BLH B;  1W98 B;  4MIM A;  3HTR A;  2PHG A;  4HLQ A;  5GMK j;  2PUK B;  1TTH B;  1Y96 B;  4HT9 A;  1WJS A;  1PKD B;  3SWN A;  2W2H A;  5GAN e;  4LOC A;  1H1R B;  1RAH B;  2JTE A;  2K5L A;  2JJ9 A;  3E1S A;  4JRP A;  2CH4 A;  3CPW A;  4FYV B;  3CCM T;  1UGV A;  3VYH B;  4C0F A;  1VQN T;  1PCX A;  3VKH A;  3EG9 A;  1SSH A;  1D09 B;  3CXC S;  1TG0 A;  5L8R E;  1X6B A;  1YN8 A;  2L5Q A;  1WGS A;  3BDL A;  2PTK A;  2RI5 A;  2D1X A;  4OMQ A;  2RA2 A;  2EWN A;  2HNI A;  1M30 A;  2DL8 A;  3U23 A;  3P8D A;  8ATC B;  5FRN A;  4M7A D;  2Z0W A;  4LN2 A;  3MY5 B;  1JOW A;  4Y72 B;  2CSQ A;  6AT1 B;  2ROL A;  2E3H A;  2V26 A;  3QHS A;  3CC4 A;  2JT4 A;  3QWX X;  4R0K A;  2AIR B;  1KC8 U;  2YUQ A;  5CKD A;  2ZPI B;  3JB9 D;  2COW A;  2KDS A;  4M78 E;  3TSZ A;  1J3T A;  1T3L A;  2F2X A;  2GQV A;  2NUP B;  3L2Q A;  4PJO C;  2K6D A;  1RAI B;  2RF0 A;  3PIO A;  3G33 B;  3QBY A;  4XTV A;  2ROT A;  1NJI U;  2ED1 A;  1FXX A;  2LZ6 B;  5GAN j;  3C4S A;  2V8K A;  2OJ2 A;  2M0O A;  1K76 A;  4AMC A;  5AT1 B;  1OIY B;  2EJ9 A;  1M90 C;  4PNO A;  1VYV A;  2SEM A;  4QVZ A;  1K9M C;  3CCM A;  1WDX A;  1QKX A;  4GBQ A;  1WQW A;  1FMK A;  1H26 B;  1T0H A;  3GF5 A;  4C0D C;  1QLY A;  2LVM A;  3KBG A;  2J05 A;  1G3W A;  2K7A A;  4E7Z A;  1KFZ A;  1VQO T;  1MV0 B;  5IHN A;  2FZG B;  1BBZ A;  1TS9 A;  2DEU A;  3CCE T;  1YHQ A;  2L8D A;  2DIQ A;  4PLI A;  2DEQ A;  2O4X A;  2BS2 A;  4M78 F;  2O9S A;  4HT8 A;  1QWF A;  2RK1 A;  2BKZ B;  4BDY A;  5BNJ B;  2MIO A;  4L59 A;  2L0A A;  3FRN A;  1BI0 A;  2G6F X;  1KD1 R;  1YNZ A;  4Z88 A;  3ZFJ A;  4LUD A;  2KRN A;  4RUG A;  3INZ A;  4HNU A;  4II1 A;  2GBQ A;  2CZ1 B;  1U5S A;  1VQ8 T;  5DM7 R;  3NTK A;  4CRI A;  1NPP A;  1Y96 A;  1KQS P;  2PNI A;  5DQV A;  4FW1 A;  3M53 A;  2W96 A;  4F7N B;  2A0F B;  2VC8 A;  4X9D A;  5KYY B;  1UTI A;  2EQM A;  4UC4 A;  4OMM A;  3JCM b;  4M78 D;  1Y07 A;  2WXV B;  3EG3 A;  2QA4 A;  2CYZ B;  4LDY A;  5CKB A;  4D8K A;  2RJE A;  2CS7 A;  4E7K A;  2LNV A;  1UGP B;  2NUZ A;  1VA7 A;  5GAO r;  3QHW B;  8AT1 B;  4JJN K;  1K0S A;  2BIV A;  3HFO A;  3CCE Q;  2KY9 A;  5DLO A;  1D1C A;  3L2R A;  1H8K A;  1HSQ A;  2HL5 C;  3VUZ A;  2RQW A;  3EFO B;  4IUU A;  4M78 A;  3FJP A;  2GTJ A;  2MOX A;  3CCR T;  1H1Q B;  4AKI A;  1AWX A;  4F7S B;  1E9H B;  1OIU B;  2YSQ A;  4KUD K;  4ELZ C;  4FX3 B;  2RJF A;  1YJN A;  3A5Z B;  1VIN A;  1NPR A;  1M3B A;  1TUD A;  4M75 C;  2QQA A;  2C0T A;  1VQK Q;  5GMK e;  2PVO B;  2LX9 A;  3JCM c;  4J7I A;  3JCM g;  5KYW A;  1AEY A;  3G71 A;  1YIJ T;  3LYI A;  3CCV A;  2WHB B;  2M16 A;  1TFB A;  2QA4 T;  3GBQ A;  1Y57 A;  4M7A F;  3G7Z A;  2EGC A;  3I5R A;  1X2K A;  5J26 A;  3UDC A;  2X4Y A;  4XTZ A;  1UHC A;  1M8M A;  2A08 A;  2YDL A;  2DL3 A;  3MCA B;  2FEI A;  4YOO A;  3O8V A;  1VOL A;  2DYI A;  4C8Q A;  1Q7Y U;  1KG1 A;  5A0L A;  5GJV B;  2OTL T;  4F7U G;  4F7U B;  5CAI A;  3UA7 A;  4FYX B;  5LJ5 g;  5IN1 A;  1QVF P;  2EQU A;  3OBW A;  4DQ2 A;  4DOW A;  3BHT B;  3CME T;  3BLQ B;  3JB9 F;  4HVU A;  4AG1 C;  2CZ6 B;  3R6N A;  1QCN A;  3H6Z A;  2CH4 W;  2F2W A;  5GAM j;  2O88 A;  1UNG D;  1ZUK A;  5CCA A;  3DLL A;  1UJ0 A;  4MMK A;  2IVX A;  1O9K B;  3M0R A;  1K1Z A;  1TWB A;  1X75 C;  2DVJ A;  1IRE B;  3S3O A;  2W99 A;  1UEC A;  2YUO A;  2HKN A;  2JVV A;  3MEA A;  1RUW A;  1WJQ A;  3CBO A;  1Y71 A;  4A63 B;  2RHY A;  1EZZ B;  4O6J A;  1JJ2 A;  2C5N B;  1W6X A;  1ZQ1 A;  3MP1 A;  2EFI A;  1ABQ A;  2R57 A;  1URC B;  3OYN A;  1YHQ T;  3NFC A;  3PO3 S;  4FYW B;  1YJW Q;  3CCU T;  1JO8 A;  4PJN A;  3L2Z A;  3THK A;  1ZSZ C;  2C5V B;  2E65 A;  5GAN 5;  4ME7 A;  3OYK A;  2V1Q A;  1IO6 A;  2SRC A;  4CXA B;  1NYF A;  5FLX E;  3DB4 A;  4MZM A;  3QZ5 B;  1ABO A;  2CP7 A;  2IW9 B;  2QAZ A;  4BY7 X;  3EOC B;  4KRD B;  3TCJ A;  2V8J A;  3X24 B;  4JS4 A;  3PTA A;  2QEX T;  3VS5 A;  1D0Z A;  1H24 B;  4F6S B;  2JS2 A;  1YCS B;  4V2S A;  2CP2 A;  5GAN 8;  3M56 A;  5GJW B;  3H0I A;  4IUP A;  3JCM W;  4ROD A;  5FRM A;  4DOV A;  3G4S T;  4KT0 E;  2RMO A;  4HL4 A;  2OAW A;  3G71 Q;  1UNH D;  3PT9 A;  3DDQ B;  2WSC E;  4LDW A;  4OMF B;  2F2C A;  2EQJ A;  4D6W A;  3OYG A;  1EX4 A;  3KFV A;  3VYG B;  4OB1 B;  2DXT A;  4X34 A;  3L1A A;  3DB3 A;  2VB6 A;  2CDT A;  4TVR A;  5D7U A;  3X28 B;  1KD1 U;  1B7T A;  1WZO A;  3H0F A;  3NMZ C;  1VQN A;  5M9O A;  1G3N C;  1RL2 A;  5C6S A;  4BCJ B;  5LMK B;  2IN3 A;  2EJF A;  2AKK A;  3AHU A;  2JGZ B;  1Q82 R;  3VS2 A;  3SWN B;  4JZ3 A;  1AWO A;  3CMA A;  4OB0 B;  3HRS A;  2QDJ A;  3V7C A;  1BU1 A;  3HPW A;  5CKE A;  3JCM d;  2RJD A;  4ZN3 A;  1RAC B;  2RQR A;  2RM4 A;  1ENW A;  2BTT A;  1BB9 A;  4BCG B;  4C92 E;  3CC2 T;  4PL6 A;  3CCL Q;  3VS4 A;  1ZX6 A;  3CPW P;  1R77 A;  4ROC A;  2ZZD A;  1QVG S;  3OW2 S;  3QO3 A;  1SG5 A;  1XQH A;  3PIP A;  1ZUY A;  1MGQ A;  4M77 G;  1GFD A;  1BI1 A;  4BCO B;  3HZJ A;  5CQY A;  2PK2 A;  3BHU B;  3F5X B;  1NLO C;  1YHQ Q;  1Q82 C;  2I2L A;  3HSB A;  3J81 E;  2A7Y A;  1GBR A;  2YLB A;  1LNX A;  4M7D B;  1NBE B;  4NOY A;  3TVT A;  2DET A;  1V29 B;  4L6V 5;  5D6X A;  1K9M R;  3A8M B;  4BE2 A;  3LQ5 B;  1GXI E;  4JJB A;  3N5B B;  3CC7 A;  3QSU A;  4OVA A;  3CBP A;  3QKJ A;  2A28 A;  1UB4 A;  1KC8 R;  2WIP B;  1UGQ B;  4ZTJ A;  2D0Q B;  3H8Z A;  3BHV B;  1ZSZ B;  4UN0 A;  2DJZ A;  4M77 C;  1VQ5 T;  2YHT A;  1AWJ A;  2RK2 A;  2CP5 A;  4BDZ A;  1JST B;  2P4R A;  5HY6 A;  3RES A;  3CCQ T;  2K2M A;  1PKT A;  2XKO C;  4KUL A;  2HZY A;  1QP3 A;  3S3N A;  2ZAE A;  1VQK A;  1MMG A;  1N6A A;  4RG8 A;  1EFN A;  1VQM Q;  2KRM A;  1M27 C;  2DTH A;  4P5N A;  2E1H A;  3E9F A;  4LE9 A;  1M1K C;  2UZL B;  3JCM h;  5HK3 A;  2E41 A;  3X25 B;  5LJ5 h;  2OTJ A;  5DY9 A;  5D6W A;  4D8D A;  1IHW A;  3CC4 Q;  1BK2 A;  4AKG A;  1D0Y A;  2DXC A;  3MET A;  1JKW A;  3MEW A;  4AFZ C;  4BI8 B;  1M4Z A;  5GAM e;  3PGG A;  2ZPF B;  3VS0 A;  2KK4 A;  4DBF A;  4EOS B;  2FZK B;  5CO7 A;  2XDP A;  2LMJ A;  3VYG A;  2LT4 A;  2L3S A;  1KXU A;  4IIO A;  1AT1 B;  1M2V A;  3TRE A;  1QMZ B;  1WHL A;  1K8A R;  3BG5 A;  4OB3 B;  1AOJ A;  4E7J A;  3A8H B;  4O5V A;  4A4F A;  2J06 A;  1WX6 A;  4A54 A;  3G71 T;  3RDV A;  1R0C B;  1YJN Q;  2CRE A;  3G6E T;  3TNI B;  4CC2 A;  1M3C A;  3EGX A;  1TUG B;  1YI2 Q;  3SFM A;  1JJ2 P;  5I5Z B;  4HXJ A;  1RAF B;  2LT1 A;  2VXE A;  2CJM B;  3EAE A;  2EGA A;  4C8Q F;  2F5T X;  2O2O A;  1OYX A;  3C95 A;  1U1T A;  5CQX A;  2QEX Q;  3M9Q A;  2LW4 A;  2M1H A;  1QLB A;  2E12 A;  1IXD A;  3VRZ A;  2YUN A;  4JLI A;  4BY1 X;  2CP6 A;  3RMQ A;  4JRI A;  2DTI A;  2JZ2 A;  1B07 A;  2ZGW A;  3ZL7 C;  3CCJ A;  1H1P B;  4BE0 A;  4X9C A;  1WLP B;  4OR5 B;  1KHC A;  4FSX A;  1UEB A;  3CD6 T;  5HCK A;  4PJO D;  3QG1 A;  1ZA2 B;  3RUX A;  3F70 A;  2C06 A;  2RI3 A;  1IRX A;  4A4K A;  5LJ3 d;  1OI9 B;  2QTX A;  4NC6 A;  4C0Z A;  1PSE A;  3A1P A;  3KUF A;  3BY7 A;  2DXC B;  2JMA A;  3CCM Q;  3DJB A;  1M1K R;  4M78 B;  2GTO A;  2BZY A;  4KH1 B;  3URG A;  1N9S A;  4C92 B;  3CCS T;  1YJ9 T;  2MCN A;  3I35 A;  1D3B B;  2EBP A;  2EKH A;  1Y0M A;  5EG2 A;  3E2U A;  2FYK A;  4X1V A;  1GCQ A;  2AHJ B;  3SDZ A;  3JCM V;  3A8L B;  1H4L D;  2C4G B;  3JB9 I;  4NS5 A;  1BCM A;  2HEQ A;  2R5M A;  3VS6 A;  2DD4 B;  3S6W A;  4RCC A;  1KQ1 A;  1Z9Z A;  2KXC A;  1JQQ A;  4XU3 A;  3CD6 A;  3TNH B;  4XU0 A;  1XO2 A;  2R58 A;  1S72 T;  3EG0 A;  4M78 G;  2KRO A;  1VYU A;  2YWW A;  3G4S A;  3L2W A;  1AD5 A;  1RLQ C;  2EPD A;  3I56 A;  2LDM A;  1V1C A;  2XID A;  4OMO A;  4YC3 B;  4A53 A;  5FU6 C;  1VQ4 Q;  1LOJ A;  1U3O A;  2EYQ A;  2NYS A;  1ZSZ A;  2HCK A;  1W2B A;  2M9U A;  2UZE B;  2WMB B;  3GLX A;  5IHI A;  4BB7 A;  3CCV Q;  4J9I A;  3D7S B;  4QW2 A;  5EFQ B;  5FRO A;  3FLG A;  2RNA A;  1RAB B;  3EID B;  5KYW B;  1Q86 U;  5GMK i;  1SRL A;  3OYL A;  2B86 A;  4C5E A;  2GQI A;  2XU8 A;  4EDU A;  1QVF A;  1H92 A;  1KSW A;  4A4H A;  3OYF A;  4C92 F;  1OGU B;  5I2S A;  3CC7 Q;  1SF9 A;  2XG8 D;  2KRS A;  2CT3 A;  2A37 A;  2PU9 B;  2IIM A;  1UUE A;  1OI1 A;  2VWF A;  2K79 A;  2KT8 A;  2E70 A;  4BAC A;  5IF1 B;  2LCL A;  2AK5 A;  2RN8 A;  4HKE A;  2E4H A;  4EOO B;  1I81 A;  2GF7 A;  3BFM A;  2JW4 A;  4QVD A;  3CMA Q;  4HNV A;  4PJO F;  2EVR A;  4M75 G;  2GNC A;  4J9D A;  1IZ6 A;  3I55 Q;  4EOI B;  1M2O A;  2O01 E;  4BCF B;  1R0B G;  1VQL T;  2WFY B;  2E3I A;  3OYY A;  4BCQ D;  2WEV B;  2C6T B;  2QQR A;  4DA4 A;  1VQM T;  2OTJ T;  5GMK m;  3P8B B;  2KQW A;  1TSF A;  2XMF A;  3M0Q A;  5IDP B;  4Z02 A;  3RER A;  2P84 A;  2OTL A;  4KGZ B;  3HB9 A;  1C0M A;  2DRK A;  2P4T A;  2B9R A;  4JJC A;  4FCY A;  2JMC A;  3CCS Q;  4PKC C;  2LJ3 A;  3EGD B;  4OGE A;  1VQ8 Q;  2L89 A;  4CFU D;  1QW1 A;  3OW2 P;  1VIE A;  5CR2 A;  3QYG B;  4M75 A;  2XHC A;  4KBM B;  2DD5 B;  5CEI B;  4JRK A;  5KH6 A;  2HAX A;  3M03 A;  3CCR A;  1B34 A;  2BUD A;  4J9F A;  1N9R A;  7AT1 B;  3OYD A;  3A98 A;  2K3X A;  4AKH A;  2X9H A;  3EH2 A;  5AYF A;  4EMK B;  1VQ4 A;  4F6U B;  2DIL A;  5ECA A;  1ZHI A;  1H3H A;  4RTU A;  1ZA1 B;  2GGR A;  2KGT A;  1VQO Q;  1CKB A;  1K73 R;  5CK9 A;  3LGF A;  1TD6 A;  1VQ6 Q;  3CCL T;  2AT1 B;  2DE0 X;  1AIS B;  4E2F B;  2BZ8 A;  2LQ8 A;  3GNF B;  4DEX A;  2QQB A;  3OYI A;  2I40 B;  3RKW A;  1BU2 A;  4AFU C;  4EIK A;  1M8V A;  2PZ1 A;  2KSS A;  1IGQ A;  4MDW A;  3V7S A;  4J6W A;  5KCO A;  3OYC A;  1MHN A;  2QAS A;  4N0A C;  4J8O A;  1OPL A;  5LJ5 j;  5GAN 4;  1YIT A;  5GAN 3;  2CKK A;  2DM1 A;  1D3B A;  2HDA A;  2K5I A;  2KVQ G;  4OF1 A;  2DFU A;  4BCM D;  3MPU B;  2PQW A;  4E7S A;  1Q86 C;  1RAE B;  1KJW A;  1FWZ A;  4G6L B;  4C0G A;  4ZGD B;  2RH2 A;  1QVG P;  1XOV A;  1SRM A;  3M59 A;  4XQ3 A;  4JLG A;  2M0Y A;  3QYE A;  2DER A;  4BCP B;  3T9N A;  1KK7 A;  1UJY A;  1WXT A;  4Y28 E;  3CC2 A;  3V8K A;  2KBT A;  2QDL A;  1WA7 A;  3DLM A;  4M7D F;  4M75 F;  1NZ9 A;  2NLU A;  2XDB A;  4ESR A;  4F7U A;  1KHI A;  1IGU A;  5A2Q E;  4PJJ A;  4NST B;  4RCB A;  2DVE A;  3PVL A;  1MMD A;  2DBK A;  4C5H A;  1WXB A;  3M4Y A;  4II5 B;  1X69 A;  2KXD A;  1PRL C;  2E6N A;  3UAT A;  3OYB A;  2VUB A;  2DXB B;  2CUB A;  3V7R A;  5I22 A;  4K11 A;  2EYY A;  1VYT A;  4HVV A;  4M7D A;  4OGR B;  3OA6 A;  1QWE A;  4JUV A;  3S3M A;  3JB9 J;  4PK4 A;  3C94 A;  4QQG A;  4PFZ A;  3P8H A;  4LUE A;  1SHF A;  3LX7 A;  2D9T A;  2W0Z A;  4GLM A;  4CFU B;  5LJ5 e;  1KQ2 A;  4EON B;  1VQ7 A;  1A0N B;  5I2M A;  1Q82 U;  2DXB A;  1B34 B;  2LP5 A;  3M0P A;  2KI7 A;  4DBR A;  4ZGJ B;  3OS0 A;  3OYM A;  3GNG A;  3MI9 B;  3R6O A;  1XTD A;  1MMA A;  1PKS A;  2HL3 A;  3REB B;  3C12 A;  4CFV B;  3OYJ A;  2I53 A;  1VQ7 T;  5GAN 6;  4YTL A;  1OKV B;  1WHM A;  3OMG A;  2K2V A;  5KCH A;  2X3W D;  2OTJ Q;  5LJ5 f;  2XK0 A;  4BCQ B;  3CCU A;  1GRI A;  2KYM A;  3LWI A;  2GCX A;  2K4Y A;  1P5E B;  1YJ9 A;  1CSK A;  3TQ7 P;  1G83 A;  4BE1 A;  4FIB A;  3L2U A;  3JAM E;  2LCC A;  2PK9 B;  3CPF A;  3SHW A;  4BI3 A;  1KD1 C;  4E7I A;  5GAO n;  3CXC P;  3FIF A;  1MMN A;  4M75 E;  5EC7 A;  1W4S A;  1WNL A;  2EQI A;  2EYZ A;  2CZ0 B;  2ATC B;  2QTV A;  4J6X A;  4OGC A;  2CT4 A;  1N4M A;  1JJ2 S;  5HBE B;  1M1G A;  3ZEH A;  3FJ5 A;  2QQ8 A;  2ZPG B;  2BZX A;  3MJX A;  4N4G A;  5J39 A;  4BCN B;  5IT9 E;  4EOQ B;  2DTO A;  2KAF A;  2L3R A;  3DL1 A;  1U1S A;  3DDP B;  1BI2 A;  2HSE B;  4J9B A;  4QT7 A;  1RAA B;  3JB9 H;  4N0A A;  2BPM B;  4KRC B;  2J6K A;  1KIK A;  4EMK A;  2DLP A;  2JS0 A;  1OX8 A;  2UUE B;  4M7D G;  4EMH A;  3GPL A;  1LVK A;  1QQJ A;  5HVY B;  2QGS A;  3QJY A;  5GMK h;  4BCM B;  4JZ4 A;  5GAN h;  3CCJ Q;  3UA6 A;  1H27 B;  1W1F A;  3M55 A;  1QKW A;  2YUP A;  2DL7 A;  2FB7 A;  3OS1 A;  4HCZ A;  4FSS A;  4JDS A;  4TTH A;  4M7D E;  2G9X B;  2K9G A;  4JX4 A;  3KXT A;  1WPY A;  1M1K U;  1I07 A;  1JU5 C;  2MF2 A;  3PE0 A;  3JCM Q;  5C0M A;  4XTW A;  2F2V A;  4XK8 E;  4E7L A;  1I1J A;  3JCM J;  2R5A A;  3JCM e;  2I0N A;  3MO8 A;  2K57 A;  1WI7 A;  2F69 A;  1VQ9 A;  1YI2 A;  4OB2 B;  1SEM A;  5ACB A;  4M78 C;  3K7A M;  4F7U F;  1WXU A;  3QXE B;  2IW8 B;  1T3S A;  2CSI A;  3POM A;  4AFQ C;  4CFX B;  2X51 A;  5ICP B;  1MUZ A;  2FL7 A;  1JRI A;  2FHD A;  1PG5 B;  1X43 A;  2HQE A;  4EPC A;  4Z89 A;  2MYS A;  5CKH A;  3CD6 Q;  1VQ8 A;  4A4E A;  4A4G A;  5GAM g;  1K8A C;  2WAC A;  4OMP A;  1Q95 G;  2C5O B;  2KE9 A;  4BY6 C;  5GAN 2;  1Y7X A;  2YRD A;  3L42 A;  4F14 A;  1Q81 R;  3I56 Q;  4RTZ A;  2M02 A;  4ANJ A;  2X3X D;  3REA B;  3EGD A;  1BKB A;  1VQL A;  4CC4 B;  1TH7 A;  2MWP A;  4F17 A;  1SPK A;  3CC2 Q;  2F1L A;  3TNW B;  1T0J A;  4JRQ A;  2VXF A;  2JN0 A;  2ZPE B;  3DOG B;  1OV3 A;  4FT4 A;  3BG3 A;  4CRL B;  3HL8 A;  1M90 R;  3HHT B;  5LJ3 e;  1VUB A;  4IKF A;  4WCI A;  2O9V A;  1NEG A;  1RAD B;  3M58 A;  1JXO A;  1UNL D;  3BLR B;  1ACM B;  4QSH A;  3TW6 A;  1YIJ Q;  3MIA B;  2QQ9 A;  4C5G A;  3M0U A;  3CCE A;  3TN8 B;  1OOT A;  2X35 A;  1G3S A;  1M2V B;  2K3B A;  2FPE A;  4XU1 A;  2ZZD B;  2JTM A;  2OAU A;  2QFZ A;  1G3T A;  4IUQ A;  3OW2 A;  4BY6 B;  1OKW B;  2HD0 A;  2EKO A;  5KYY A;  3ER0 A;  1QMC A;  2KEA A;  4JS5 A;  2M51 A;  1NJI R;  3EJ1 B;  2EJG A;  3HKS A;  2PJQ A;  3O0G D;  2L3Q A;  2LC4 A;  3OYE A;  2P0K A;  4J83 A;  1P92 A;  1WQ7 A;  2EIF A;  1YJW T;  4M7A C;  2NWM A;  1YJ9 Q;  3H9N A;  1NYG A;  4QVC A;  1HXD A;  4PJL A;  2LQN A;  3CCQ Q;  4NL3 A;  4JX5 A;  3QDR B;  3CBM A;  3EH1 A;  3AT1 B;  5DQW A;  4BCK B;  3LLR A;  1I8F A;  2RJC A;  2X4J A;  3J7A F;  4C8Q C;  4LDV A;  2ESW A;  4NL2 A;  1E6H A;  1YJW A;  2DA9 A;  2J6F A;  1LCK A;  1D1A A;  3OYA A;  2CUD A;  4XU2 A;  1NE8 A;  1M1F A;  1W2B S;  1YBY A;  4M7A A;  1WHK A;  4HCB A;  4J5Y A;  3OQ5 A;  1VQL Q;  1K9A A;  5GAN g;  2ENM A;  2RQT A;  4HCK A;  3I55 T;  1H25 B;  4GY5 A;  4IMY B;  4BBR M;  4C92 D;  2IPO B;  5EJC A;  1O75 A;  5L2W B;  1NEB A;  4BI4 A;  3OBY A;  4KGV B;  5IDN B;  2DXU A;  4C92 A;  1K9M U;  3JB9 G;  2FPD A;  4PJM A;  2DZC A;  1M90 U;  1KQS A;  4N4I A;  2QEX A;  4MDX A;  3CCJ T;  1W2B P;  3UWN A;  4F7U E;  1C6V X;  2JXB A;  3QUI A;  1IB8 A;  2DME A;  3GIB A;  1ZSG A;  4ELJ A;  2YRV A;  4BUG A;  1O9K A;  3HRT A;  1VYW B;  4FT2 A;  1YIJ A;  2RPN A;  1Q7Y C;  1TUC A;  3SWN C;  4DBQ A;  4R56 A;  4BD3 A;  1FIN B;  3GTM S;  2D0N A;  3OSV A;  1KC8 C;  1YJN T;  1G2B A;  1W70 A;  4RG2 A;  1ZBJ A;  1HD3 A;  2G3R A;  3M5A A;  2MPX C;  2DX1 A;  2E10 A;  3J80 E;  1XJW B;  2FO0 A;  3JRZ A;  1F1B B;  2K3Y A;  1VQP A;  3CCR Q;  2L3P A;  5GMK l;  2LTO A;  2HMA A;  5GAM h;  1LPL A;  3V8L A;  1JBM A;  1AVZ C;  3WVE B;  4EOR B;  3EG9 B;  5FU6 B;  3VS1 A;  4F16 A;  5KE3 A;  1OUL A;  5GAN f;  4F7J B;  3RGF B;  2DRM A;  3QPH A;  4M6V A;  3RIR A;  2BS3 A;  2Y4X A;  4HVW A;  2LCS A;  5DLQ E;  4JPB W;  1JEG A;  1Q81 C;  5I21 A;  3RBB B;  3BG9 A;  2EUF A;  3MHX A;  1UG1 A;  3TEE A;  3JCM f;  1BIA A;  2O4X B;  3VS3 A;  3JV3 A;  4DBH A;  4IUT A;  4F6W B;  1D0X A;  4J9C A;  3Q1J A;  4ORZ A;  1N27 A;  4C92 C;  4AI6 A;  4J6Y A;  1K0X A;  2LX7 A;  4EOL B;  1XNI A;  4J7F A;  3QHR B;  4ELL A;  4C8Q D;  2CCH B;  4YOS A;  1X6G A;  3JCM X;  3G6E A;  1SSF A;  4RTV A;  3OYH A;  5LJ3 j;  2C5X B;  3LH5 A;  3I5S A;  3VKG A;  1QCF A;  2H3E B;  4Y92 A;  2XI9 A;  2V1R A;  5LJ3 g;  3QYH B;  3BW1 A;  3EFS A;  2F5K A;  4C92 G;  3OSS C;  2ED0 A;  3EHQ A;  1WHG A;  3M54 A;  1Q81 U;  1VQ9 Q;  2RI2 A;  2QDY B;  4LD9 K;  2LNH B; 
#chains in the Genus database with same CATH homology
 5HK0 A;  3HPW A;  3PMT A;  3C94 A;  4QQG A;  1X01 A;  5CKE A;  3JCM d;  1BYM A;  2RJD A;  4ZN3 A;  2DKG A;  2RM4 A;  3PMI A;  3P8H A;  3LX7 A;  4C92 E;  3UT1 A;  2D9T A;  3OY9 A;  3CC2 T;  3A8O B;  4PL6 A;  3QII A;  5D6Y A;  5CKF A;  3PNW C;  5LJ5 e;  2ZZD A;  1QVG S;  1KQ2 A;  1VQ7 A;  3OW2 S;  5I2M A;  4LD6 A;  3QO3 A;  1Q82 U;  3CCV T;  2DXB A;  3CMA T;  1B34 B;  1XQH A;  2MI6 A;  3PIP A;  3TU4 K;  3OS0 A;  4ZGJ B;  3OYM A;  2PUO B;  2DPP B;  1MGQ A;  2PVG B;  3SD4 A;  3GNG A;  4M77 G;  1BI1 A;  4IUR A;  3HZJ A;  1VQ4 T;  5CQY A;  3CPW S;  3ZBD A;  1Q82 C;  2I2L A;  3HBL A;  3R6O A;  2CGH A;  1G5V A;  1XTD A;  3HSB A;  4M7A E;  3C12 A;  3OS5 A;  3J81 E;  2A7Y A;  3OYJ A;  2YLB A;  2RHX A;  1VQ7 T;  1X6O A;  1LNX A;  5GAN 6;  4M7D B;  2B8A A;  3OMG A;  1YCY A;  4NOY A;  4YTL A;  2K2V A;  5KCH A;  1V29 B;  4L6V 5;  5D6X A;  5LJ5 f;  3A8M B;  2XK0 A;  4BE2 A;  1GXI E;  3PFS A;  3N5B B;  3CC7 A;  3QSU A;  4HA8 A;  4OVA A;  3CBP A;  3QKJ A;  2JNG A;  3CCU A;  1UB4 A;  3LWI A;  3HRU A;  2GCX A;  2IG0 A;  1QVP A;  2K4Y A;  1UGQ B;  2VGM A;  3UPU A;  1YJ9 A;  3GP8 A;  4ZTJ A;  1VQM A;  3OB9 A;  4BE1 A;  1AHJ B;  2LRQ A;  2D0Q B;  3H8Z A;  4FIB A;  3L2U A;  4JX6 A;  4M77 C;  2DJZ A;  1VQ5 T;  2X4X A;  3FB9 A;  3JAM E;  1VIF A;  1WJR A;  2YHT A;  2LCC A;  2RK2 A;  3WVD B;  2DK3 A;  1NJI C;  4LDX A;  3RKY A;  1UGS B;  2QF7 A;  4BDZ A;  3ASK A;  5HY6 A;  3RES A;  3CEY A;  3CCQ T;  2XKO C;  2KMT A;  3CPF A;  3DKM A;  2WSF E;  3QJ6 A;  4KUL A;  4BI3 A;  1I4K 1;  2DZ9 A;  1KD1 C;  1QP3 A;  4E47 A;  1H64 1;  3S3N A;  1VQK A;  1N6A A;  4M77 A;  4E7I A;  4M75 D;  4RG8 A;  5GAO n;  4XTU A;  3FIF A;  4XTX A;  4ELY C;  2KR6 A;  2EAY A;  2DTH A;  4M75 E;  4P5N A;  5FU7 C;  1M9S A;  1W4S A;  2E1H A;  4MIM A;  1WNL A;  3E9F A;  4HLQ A;  1H3Z A;  5GMK j;  2CZ0 B;  2PUK B;  4MFD A;  1Y96 B;  4J6X A;  4OGC A;  1M1K C;  4HT9 A;  2RO0 A;  1WJS A;  3JCM h;  5HK3 A;  1JJ2 S;  2E41 A;  3X25 B;  3SWN A;  5LJ5 h;  1M1G A;  5GAN e;  3ZEH A;  4M77 F;  4XAX B;  2QQ8 A;  2OTJ A;  1O9S A;  4LOC A;  2ZPG B;  5DY9 A;  5D6W A;  2K5L A;  2VGN A;  3E1S A;  1EIF A;  4JRP A;  4ATO A;  4N4G A;  5J39 A;  5IT9 E;  2DTO A;  2GFU A;  3CPW A;  3CCM T;  4AKG A;  2KAF A;  2L3R A;  2DXC A;  3DL1 A;  3MET A;  3MEW A;  1U1S A;  2G77 A;  1BI2 A;  4BI8 B;  1M4Z A;  5GAM e;  3JB9 D;  3PGG A;  3JB9 H;  2ZPF B;  4N0A A;  3VYH B;  2KK4 A;  4C0F A;  1VQN T;  1QVF S;  3VKH A;  5CO7 A;  2XDP A;  5FU7 B;  3VYG A;  2LT4 A;  4EMK A;  3X26 B;  4C0G A;  3CXC S;  5GAO l;  5L8R E;  4M7D G;  3TRE A;  2DD4 A;  2L5Q A;  1WGS A;  4EMH A;  3GPL A;  3BDU A;  3BDL A;  2VV5 A;  1YIT T;  2RI5 A;  1OZ2 A;  3BG5 A;  4OB3 B;  3QJY A;  4E7J A;  3A8H B;  2RA2 A;  1R8O B;  2EWN A;  4O5V A;  2HNI A;  2MWO A;  5GMK h;  2LQK A;  5GAN h;  3H4C A;  4A4F A;  2QQS A;  3V8J A;  4M7D C;  4A54 A;  3G71 T;  3M55 A;  3P8D A;  2FB7 A;  3OS1 A;  3QYB A;  4HCZ A;  3VKI A;  5FRN A;  4M7A D;  4JDS A;  3G6E T;  4M7D E;  2RHI A;  3A8G B;  4JX4 A;  4C8Q E;  3KXT A;  1WPY A;  3QHS A;  1M1K U;  3CC4 A;  3SFM A;  2MF2 A;  2XDD A;  2LT1 A;  3JCM Q;  1KC8 U;  5C0M A;  3CME A;  2VXE A;  4XTW A;  2ZPI B;  3EAE A;  4XK8 E;  4C8Q F;  2KDS A;  2F5T X;  4M78 E;  5CKD A;  4E7L A;  3JCM J;  2R5A A;  1FX7 A;  3FC3 A;  1OYX A;  3E19 A;  3C95 A;  4ZN1 A;  1U1T A;  5CQX A;  3JCM e;  1BIB A;  4L5G A;  2GQV A;  2E5Q A;  3MO8 A;  3M9Q A;  4JUV A;  4CI0 C;  3L2Q A;  2K57 A;  4PJO C;  2M1H A;  1QLB A;  2E12 A;  2F69 A;  1VQ9 A;  3PIO A;  1YI2 A;  3QBY A;  4OB2 B;  4IUV A;  4XTV A;  1NJI U;  3CXC A;  1FXX A;  4JLI A;  4M78 C;  5GAN j;  3C4S A;  2V8K A;  4MML A;  3RMQ A;  4JRI A;  2DTI A;  2JZ2 A;  2M0O A;  3MEU A;  4F7U F;  2EJ9 A;  2ZGW A;  3LGL A;  4PNO A;  3QXE B;  2BKD N;  4M7A B;  3CCJ A;  4M75 B;  4BE0 A;  1M90 C;  4X9C A;  4QVZ A;  4GLK A;  3TW7 A;  4XTY A;  1K9M C;  1KHC A;  3CCM A;  1WQW A;  4FSX A;  3J7A F;  1UEB A;  4MZT A;  3GF5 A;  4C0D C;  2VYT A;  3CD6 T;  2LVM A;  1YI2 T;  4MZP A;  4PJO D;  3KBG A;  3QG1 A;  2FL7 A;  1JRI A;  2FHD A;  2HQE A;  1G3W A;  3RUX A;  4EPC A;  4C0D B;  3F70 A;  2C06 A;  2RI3 A;  1VQO T;  5GAM f;  4A4K A;  5CKH A;  5LJ3 d;  2QTX A;  4NC6 A;  4A4E A;  4A4G A;  3KHI A;  2P0Q A;  4C0Z A;  1PSE A;  5GAM g;  1VQ8 A;  1K8A C;  2WAC A;  3KUF A;  3CCE T;  2E6Z A;  5GAN 2;  4BY6 C;  3BY7 A;  2DXC B;  1YHQ A;  2L8D A;  2E64 A;  2HQX A;  2DIQ A;  3MP8 A;  4PLI A;  5IAY A;  1Y7X A;  3L42 A;  2DEQ A;  2DO3 A;  2O4X A;  2BS2 A;  4M78 B;  4M78 F;  4HT8 A;  3NTI A;  2RK1 A;  2Y90 A;  4R55 A;  2RHZ A;  3V7C A;  1BKB A;  3URG A;  2HBP A;  1VQK T;  1VQL A;  4PJO B;  1N9S A;  1TH7 A;  4C92 B;  2MWP A;  3CCS T;  1YJ9 T;  4BDY A;  1D3B B;  4E7H A;  4L59 A;  4M7D D;  3VUB A;  3FRN A;  1BI0 A;  5EG2 A;  1VQP T;  3ZFJ A;  4PJO E;  2A3L A;  3INZ A;  2FYK A;  1VQ5 A;  4HNU A;  4JRQ A;  4II1 A;  2QI2 A;  5GAO q;  2AHJ B;  2VXF A;  2JN0 A;  3SDZ A;  3MP6 A;  3A8L B;  3JCM V;  2RHU A;  5HKC A;  3JB9 I;  1K8A U;  2ZPE B;  4FT4 A;  4NS5 A;  3BG3 A;  4C5I A;  2CZ1 B;  2JOY A;  3HL8 A;  3M57 A;  2R5M A;  3HHT B;  5LJ3 e;  1VUB A;  4IKF A;  2DD4 B;  3S6W A;  1VQ8 T;  5DM7 R;  4WF2 A;  4LD9 K;  3NTK A;  4RCC A;  2V8I A;  4CRI A;  1KQ1 A;  1NPP A;  1Y96 A;  4PJO G;  3M58 A;  5LL6 S;  4XU3 A;  5LJ3 h;  3CD6 A;  4XU0 A;  2R58 A;  1VQ9 T;  4QSH A;  3TW6 A;  1S72 T;  5KE2 A;  4M78 G;  3M53 A;  2VC8 A;  4X9D A;  2QQ9 A;  4C5G A;  3G4S A;  2EQM A;  3CCQ A;  3L2W A;  5GAO p;  4UC4 A;  3CCE A;  3JCM b;  4M78 D;  3I56 A;  2X35 A;  1Y07 A;  4C8Q B;  1G3S A;  2QA4 A;  2CYZ B;  3QZ9 B;  2JTF A;  2LDM A;  4LDY A;  5CKB A;  3SB2 A;  2RJE A;  2XID A;  4LDU A;  4A53 A;  2CS7 A;  4XU1 A;  2ZZD B;  2JTM A;  5FU6 C;  3OS2 A;  1LOJ A;  1OZ3 A;  2OAU A;  2QFZ A;  2EYQ A;  2LNV A;  1G3T A;  1UGP B;  4E7K A;  4IUQ A;  3OW2 A;  4M77 E;  5GAO r;  1W2B A;  4BY6 B;  2M9U A;  2HD0 A;  3GLX A;  4BB7 A;  4RKU E;  1N8R C;  2EKO A;  3ER0 A;  4JJN K;  4QW2 A;  4JS5 A;  5FRO A;  2BIV A;  2EJG A;  3HKS A;  3HFO A;  4M7A G;  3FLG A;  2LC4 A;  1Q86 U;  3OA6 A;  3OYE A;  5GMK i;  4B9X A;  2Y4Y A;  2KY9 A;  1E7P A;  4C5E A;  2P0K A;  2XU8 A;  4EDU A;  5DLO A;  3OYL A;  1QVF A;  4J83 A;  3L2R A;  4A4H A;  3OYF A;  4C92 F;  5I2S A;  1P92 A;  1WQ7 A;  2EIF A;  1YJW T;  1K73 U;  4M7A C;  3VUZ A;  2XG8 D;  4FU6 A;  4RMO A;  3FEO A;  4IUU A;  4M78 A;  2PU9 B;  3FJP A;  3JCM P;  4QVC A;  3CCR T;  1HXD A;  1M5Q 1;  4AKI A;  1OI1 A;  2E70 A;  5A0D A;  4BAC A;  1KQS S;  2LCL A;  4JX5 A;  3QDR B;  3X20 B;  4NL3 A;  4KUD K;  3CBM A;  4ELZ C;  2RJF A;  3GOX A;  1FKM A;  1YJN A;  3LLR A;  1I8F A;  2RJC A;  2X4J A;  1NPR A;  3A5Z B;  4HKE A;  4C8Q C;  4LDV A;  4M75 C;  4NL2 A;  1YJW A;  2QQA A;  5A0G A;  1I81 A;  2GF7 A;  2RB6 A;  3BFM A;  4QVD A;  5GMK e;  2PVO B;  2LX9 A;  3JCM c;  1BI3 A;  4HNV A;  4J7I A;  3JCM g;  3G71 A;  1YIJ T;  3LYI A;  3OYA A;  4PJO F;  3CCV A;  3HO8 A;  3ME9 A;  2M16 A;  4XU2 A;  1NE8 A;  4M75 G;  2QA4 T;  1IZ6 A;  1M1F A;  3JSC A;  1YBY A;  3M4G A;  5GAM d;  1W2B S;  4M7A A;  3HFN A;  4M7A F;  2O01 E;  3G7Z A;  4EMG A;  2DAQ A;  1VQL T;  4HCB A;  4QQD A;  3CC7 T;  4MFE A;  3CCS A;  5J26 A;  3OYY A;  3UDC A;  4J5Y A;  2X4Y A;  4XTZ A;  3OQ5 A;  1LJO A;  3LH0 A;  2QQR A;  3MCA B;  4DA4 A;  3VU3 C;  5GAN g;  1VQM T;  2OTJ T;  3O8V A;  5GMK m;  4VUB A;  3P8B B;  4C8Q A;  1Q7Y U;  1KG1 A;  3OMC A;  5A0L A;  3I55 T;  2OTL T;  2WJ9 A;  4F7U B;  4GY5 A;  2KQW A;  4F7U G;  5CAI A;  4HNT A;  4Z02 A;  5LJ5 g;  3VJP A;  3S3M A;  3RER A;  4BBR M;  3I55 A;  4C92 D;  2OTL A;  5IN1 A;  5EJC A;  1O75 A;  3HB9 A;  3WXM B;  2EQU A;  3OBW A;  4DQ2 A;  2MAM A;  2P4T A;  4DOW A;  2P0P A;  4PLL A;  5J3B A;  4BI4 A;  3OBY A;  3CME T;  3LW5 E;  2MMP A;  2DXU A;  4C92 A;  1K9M U;  3JB9 F;  3JB9 G;  3QWL A;  4PKC C;  3VV0 A;  2DZC A;  2CZ6 B;  4OGE A;  2JUF A;  3H6Z A;  2PVD B;  5GAN d;  1M90 U;  1KQS A;  4N4I A;  2QEX A;  4MDX A;  1DJ7 B;  5GAM j;  3LWH A;  4PJO A;  3CCJ T;  2L89 A;  3UWN A;  4F7U E;  1QW1 A;  3QUI A;  5GAO m;  1VIE A;  2ZPH B;  4KUI A;  3QYG B;  4M75 A;  5CCA A;  5CR2 A;  3DLL A;  2XHC A;  4MMK A;  4M77 D;  3GIB A;  4ELJ A;  2YRV A;  2DD5 B;  4KBM B;  4Y91 A;  3RMS A;  4BUG A;  1VQO A;  2DD5 A;  1X75 C;  3HRT A;  4JRK A;  1VQ6 A;  1IRE B;  5KH6 A;  3S3O A;  4FT2 A;  1YIJ A;  2HAX A;  1Q7Y C;  3SWN C;  1VQ6 T;  3CCR A;  1QVG A;  1B34 A;  2BUD A;  1N9R A;  4EMK C;  3OYD A;  4R56 A;  4BD3 A;  3I56 T;  2K3X A;  4AKH A;  2JVV A;  2K5F A;  5AYF A;  3MEA A;  3OSV A;  1KC8 C;  4C8Q G;  1WJQ A;  3EFR A;  4EMK B;  1YJN T;  3CBO A;  1VQ4 A;  1RI0 A;  1S72 A;  1G3Y A;  4RG2 A;  1ZHI A;  1Y71 A;  3HRS A;  2G3R A;  2RHY A;  3M5A A;  2E10 A;  3J80 E;  4O6J A;  3CC4 T;  4OP0 A;  1ZQ1 A;  3MP1 A;  1JJ2 A;  2EFI A;  2EQK A;  5CK9 A;  3LGF A;  3JRZ A;  2K3Y A;  2R57 A;  3CCL T;  1VQP A;  4FM4 B;  2YLC A;  1HK9 A;  5GMK l;  2ZPB B;  2LQ8 A;  3GNF B;  3NFC A;  5LJ3 f;  3OYN A;  1YHQ T;  1ZBX A;  2FVU A;  2LTO A;  2QQB A;  3OYI A;  3CCU T;  5GAM h;  3V8L A;  3L2Z A;  3RKW A;  2E65 A;  5GAN 5;  4ME7 A;  1JBM A;  5KE3 A;  3WVE B;  1M8V A;  5FU6 B;  3OYK A;  2KSS A;  1QP2 A;  4B9W A;  5CIU A;  2D6F A;  4MDW A;  4N4H A;  4J6W A;  3V7S A;  5FLX E;  3DB4 A;  1MHN A;  5KCO A;  5GAN f;  3OYC A;  4BBS M;  3QPH A;  4MZM A;  3QZ5 B;  4N0A C;  4J8O A;  4M6V A;  3RIR A;  5LJ5 j;  5GAN 4;  1YIT A;  3TCJ A;  2BS3 A;  2V8J A;  5GAN 3;  3X24 B;  2KMG A;  2CKK A;  2XD0 A;  4QQ6 A;  3PTA A;  1D3B A;  1PSF A;  2Y4X A;  2QEX T;  4JS4 A;  5DLQ E;  1K73 C;  2K5I A;  2KVQ G;  4M77 B;  4Q5W A;  1Q81 C;  5I21 A;  2IVW A;  4HCC A;  4OF1 A;  4V2S A;  3BG9 A;  3L2V A;  5GAN 8;  3MHX A;  3M56 A;  3TEE A;  2PQW A;  4IUP A;  3JCM f;  3JCM W;  1BIA A;  1Q86 C;  2O4X B;  4DOV A;  3G4S T;  1U8R A;  1FWZ A;  5FRM A;  4IUT A;  4KT0 E;  2ZCF B;  5CVI A;  4HL4 A;  2H3J A;  4ZGD B;  2RH2 A;  3FDR A;  3E9G A;  3MEV A;  3Q1J A;  1N27 A;  1XOV A;  2DIG A;  4C92 C;  4AI6 A;  4J6Y A;  1I5L A;  3PT9 A;  4OMF B;  2WSC E;  2X4W A;  4LDW A;  2XIC A;  1N8R U;  3M59 A;  2EQJ A;  4XQ3 A;  4D6W A;  3OYG A;  4JLG A;  3QYE A;  1XNI A;  4J7F A;  4C8Q D;  5GAN 7;  3T9N A;  3CC2 A;  4FL6 A;  4Y28 E;  3VYG B;  2RD1 A;  3V8K A;  4OB1 B;  3JCM X;  2DXT A;  4X34 A;  3L1A A;  2CZ7 B;  3DB3 A;  4ZTF A;  3G6E A;  1SSF A;  2GFA A;  3DLM A;  2WSE E;  4TVR A;  3OYH A;  4M75 F;  1NZ9 A;  2NLU A;  5LJ3 j;  2XDB A;  4M7D F;  3X28 B;  1KD1 U;  4F7U A;  1KHI A;  5A2Q E;  1UGR B;  3VKG A;  3NTH A;  4RCB A;  1VQN A;  2DVE A;  2XI9 A;  5M9O A;  4C5H A;  1RL2 A;  2QXF A;  5LJ3 g;  3QYH B;  3BW1 A;  2BS4 A;  3EFS A;  3M4Y A;  2F5K A;  4C92 G;  5C6S A;  5LJ5 d;  2E6N A;  3OYB A;  3CCL A;  4ZGE B;  2VUB A;  2DXB B;  2EJF A;  3OSS C;  3V7R A;  3AHU A;  3HP9 A;  3M54 A;  3RKX A;  1Q81 U;  2RI2 A;  4M7D A;  2QDY B;  1JB0 E;  3SWN B;  3CMA A;  4OB0 B;  2QDJ A;  4Z6Y A;  3JB9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...