4OB2B

Crystal structure of nitrile hydratase from pseudonocardia thermophila bound to butaneboronic acid via crystal soaking
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
228
structure length
228
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELVDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Cobalt-containing nitrile hydratase subunit alpha
total genus 69
structure length 228
sequence length 228
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2014-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4ob2B01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ob2B02
2ZZDB 3HHTB 3A8GB 2DD4A 2ZCFB 3A8MB 3A8OB 2CZ7B 2DD4B 1DJ7B 2DXCA 4XK8E 4FM4B 3QYHB 2DD5A 3X26B 3A8HB 2CZ1B 4OB3B 2DD5B 2ZPIB 4KT0E 4RKUE 2ZPBB 1V29B 3QZ5B 3X28B 1UGRB 2ZPFB 4ZGDB 1IREB 2CZ6B 2PUKB 3X25B 2QDYB 3QYGB 5L8RE 3LW5E 4OB1B 3X24B 2ZZDA 4L6V5 2AHJB 2O01E 2D0QB 2WSFE 3VYGB 2PVOB 4OB0B 2ZPHB 2ZPGB 2DXCB 3X20B 3QXEB 1QP3A 3WVDB 4Y28E 1UGSB 2DPPB 2CZ0B 2CYZB 2WSEE 2PVGB 2DXBA 3A8LB 2WSCE 1UGPB 2DXBB 2PUOB 1PSFA 3QZ9B 1AHJB 4ZGJB 1QP2A 4OB2B 2PU9B 3WVEB 2ZPEB 1JB0E 2PVDB 4ZGEB 1UGQB 3VYGA 3VYHB 1PSEA 1GXIE
chains in the Genus database with same CATH superfamily
3EGXA 2JOYA 1BBZA 1PKSA 1ZUYA 5LJ5j 3HO8A 3PVQA 2LVMA 3HRTA 2L89A 4PJOC 3OQ5A 3BHUB 1BCOA 3FJPA 1VYTA 3RR6A 1VQMT 2J6KA 3OSSC 3ER0A 3TNIB 1N4MA 3CCUT 2EGAA 5C6SA 1OL1B 3SFMA 4JX6A 1Q7YR 4MDWA 3VS4A 2H3EB 1G3WA 4BACA 3TSZA 2K79A 4HCKA 5DM7R 2BZYA 2QFZA 3CC4T 3HL8A 4Z02A 2PK9B 1ABQA 4JJDA 4E7HA 4HL4A 1K9MR 1I4K1 1WLPB 4IUQA 2W96A 2CH4W 3J80E 1O75A 3OW2P 4V2SA 2RMOA 1IO6A 4BBSM 5L8RE 3L2VA 2DRKA 1VQ4A 4J9HA 2IW9B 2EAYA 2WSFE 5GAOq 3A98A 1RLQC 3M58A 4IUVA 3CCMT 1JJ2P 3KFVA 1LPLA 1KSWA 4EOJB 3CCVA 4J8OA 4ELZC 1JKWA 4B9WA 1BI3A 1H24B 4OVAA 3QSUA 1B3QA 1V76A 2ROTA 4M4ZA 1H27B 2V8JA 1HSQA 2RB6A 1QVFP 3DDQB 5EC7A 3NTIA 2BS4A 1WXBA 2G77A 2R7GA 4A4GA 4EOOB 2YLBA 1VIFA 5IHIA 1PSFA 3DJBA 2KXCA 1RL2A 2BTTA 2RQRA 1H25B 1AHJB 3V7RA 1U06A 2F1LA 2NWMA 3DOGB 3OBWA 1LOJA 1G5VA 3M55A 1OIYB 3O5ZA 2C0IA 1MV0B 1YITQ 2OI3A 1XO2A 5LL6S 1UNLD 1UG1A 1VINA 2WMAB 4A54A 2RK2A 4OMQA 4MDXA 2O9SA 4OMFB 3QJYA 2LDMA 1VQNQ 4IUPA 3ZFJA 4LDWA 4MIMA 2M02A 4AI6A 4XK8E 5D7UA 1BI0A 3OYMA 2RQWA 4J5YA 4EOKB 1E6GA 4EMKA 5IDNB 1N9SA 4RTWA 1X6BA 4EOMB 3I5RA 5A0LA 1K9MU 1Z9ZA 2HDAA 2NUTB 2RI5A 2RK1A 2MPXC 1OU8A 2YSQA 1RAAB 4RTUA 3QYBA 4HXJA 1VQ5A 1HJDA 2LRQA 1Q7YU 1G3NC 1M3AA 1OEBA 1OOTA 3RKYA 4HVVA 6AT1B 3C94A 5I2MA 1Q82C 2O4XB 3H0HA 2O31A 3I35A 1WA7A 5LJ3f 2ZPHB 4DOWA 4ROEA 3HRUA 4XU0A 4M77A 1BCMA 4Z88A 2QQBA 2CZ0B 2COZA 2LT4A 1QLYA 4HNVA 2WSEE 1NEGA 2QGFB 2EYXA 1M5Q1 2MK5A 5HKCA 5CQXA 1C6VX 5CKDA 1QWEA 4EOLB 4CC7A 1YCSB 3QIIA 1TXQA 2WJ9A 1JXOA 2X4YA 2XDBA 1VQMQ 4R0KA 4ZN3A 3CD6A 4JS4A 4FCYA 1QCNA 4BCMB 1YN8A 2GTJA 4EC8B 4KGZB 2QQSA 4EDUA 2LJ1A 3M59A 4XTUA 4M7DD 3SEMA 2CJMB 1TH7A 3BHTB 5GAMf 3EGUA 5I5ZB 5ICPB 3J7AF 3L2UA 1Q82U 3VUZA 1VQKA 3V8KA 2W99A 1VYWB 2X9HA 4A4EA 5M9OA 2D0NA 4BCMD 3HHTB 3PTAA 2BUDA 4JLIA 3JCMQ 3EGXB 1IHVA 3SDZA 4BCNB 3NDQA 3CCRQ 4M77E 3TQ7P 4IIOA 2IVXA 1MNEA 1T0JA 5KYWA 1Y07A 3CXCP 3O8VA 1SSFA 4E47A 4FYVB 1PD0A 3RERA 4WCIA 2DIQA 4BCOB 2G6FX 2KRMA 2KR3A 3LWIA 1OL2B 2HQXA 4Q5WA 4LUDA 3M0UA 1ZA2B 2JM8A 1OKVB 2VKNA 4A53A 2AIRB 4M77F 4BI3A 1GCQC 4XTZA 4GLKA 4RMOA 4BCHB 1NZ9A 2HD0A 2O4XA 1FWZA 4EMHA 2WIHB 4QVZA 2EJGA 4DBQA 1JQQA 2YRDA 2DEUA 2EYWA 1UHCA 2CREA 1UECA 3G1JA 4M77C 2LNVA 1Q86R 2HAXA 5FGKB 3RMSA 4M78D 4F16A 2AHJB 4DA4A 4F6SB 4FYXB 4HLQA 2ZPGB 4BE2A 4JZ4A 1Q81R 3IQLA 1D1BA 4C8QC 4PJLA 4ROCA 4HT8A 1R8OB 1D3BA 2XMFA 3EAEA 1YBYA 1WXTA 1RAFB 1VQPT 1WIEA 4Y28E 1M90U 1YITT 1N8RU 3M9QA 2RF0A 3L2WA 4M6VA 5GMKj 2ED0A 4PLLA 2DL8A 3GTMS 4M78F 4G6LB 2VB6A 2BS2A 2OX7A 4JRQA 3EH1A 4D8DA 2EQMA 1FINB 2DL5A 4BDYA 1HK9A 2A7YA 1ZUUA 4IIMA 2QAZA 4RTVA 3RESA 2A37A 1AEYA 4OR5B 3NMZC 4ELLA 1YFNA 5DQVA 5HCKA 1U3OA 4QVCA 4C8QE 3JCMb 4FSSA 2UUEB 1PRLC 1ZP2A 5GANg 2RHZA 1YWPA 1KHCA 3PMIA 1WZOA 3M0QA 4YTLA 1H641 2AZSA 1H1SB 2WMBB 3VRZA 2K3XA 2FPDA 7AT1B 4EOSB 2DD4A 2DX1A 1BIAA 4Y91A 2J06A 3MY1B 5AT1B 1S72Q 4X9CA 1PD1A 2M1HA 2DA9A 4DOVA 2JT4A 4CFUB 1MMGA 5IXBA 4AG2C 2UZBB 3NTKA 1ZLMA 4F04B 2X3WD 3OA6A 1VQ6T 1NLPC 2MF2A 1Y0MA 2O2OA 1JBMA 2BE7D 3OYEA 3TCJA 2PJQA 3CMET 5GMKh 2HKQB 5IDPB 4C8QF 1OPKA 5LJ5g 2KYBA 4C5IA 1YJ9Q 3C95A 1YIJA 1WI7A 2DYIA 1KQ1A 2D8JA 4PFOA 3RIRA 2OTJA 1G3SA 1AISB 3DLMA 3QO3A 1W98B 4BY7X 4M78A 2DL7A 1ZA1B 3LWHA 2G3RA 3TW7A 5IN1A 4UC4A 1OYXA 3PFSA 4RG8A 1KXUA 3JB9H 1RACB 5GAN3 1K8AR 1NLOC 3CBPA 3DLLA 4PK4A 3G33B 2XDPA 4JRKA 1RLPC 3CPWS 1QVFA 3JB9G 3OW2S 2DXBA 3RGFB 1E7OA 2EQIA 2PHGA 4F7UE 3CC2T 1X69A 4EIKA 1GUXB 3CC2Q 3LX7A 2E65A 2F2CA 2DLPA 3CEYA 1Q81U 1H26B 4OB2B 2LX9A 1R0CB 3GOXA 4PJOD 3CMEQ 2KDSA 1VIEA 1NE8A 1W4SA 2B8AA 4RCBA 4E7IA 2MI6A 3E19A 5FROA 4II1A 1VQ6A 2GBQA 2QXFA 1IRXA 5GAMh 1MNDA 4DEYA 2K3BA 2K5LA 4ME7A 3OYNA 4M7AE 1M1KC 1JO8A 2AK5A 1NJIU 4C8QA 5KYXB 2EYZA 1OIUB 3M0PA 2DVEA 2K4YA 4HA8A 3C0CA 1WFWA 2KE9A 2QQ8A 1OI9B 2DD5A 2KVQG 3G71T 2FZCB 2CGHA 2GGRA 1QLBA 1VQ8A 1PG5B 1B34B 2Y90A 4OP0A 1MUZA 4RCCA 1X2KA 3CCQT 5GAMe 3S3OA 2KMTA 4DEXA 4EOIB 1V29B 1D3UB 2CP5A 1GBQA 4J9CA 5FU7B 3EG3A 5CVIA 2JS0A 1G3YA 1AT1B 1VQ4Q 2P4TA 3OBYA 2DL3A 3S6WA 1YHQQ 2EGEA 2XICA 3H6ZA 3OW2A 4DBFA 1YJ9A 1JOWA 3CCLQ 1VA7A 3EIDB 2JS2A 3MEVA 1GFDA 2HNIA 1RABB 2M0YA 3WXMB 1JSTB 5HY6A 3QWXX 3GNGA 1AOJA 2I40B 3H8ZA 2FZKB 2QASA 2QGSA 4TTHA 2J6FA 2EQJA 1RI0A 1KK7A 1B34A 1MMAA 1QP2A 1TSFA 4CFWB 1TTHB 2Y4XA 5I11A 2HZYA 3DKMA 1GY3B 4BCGB 3BG5A 4CC4B 2EVRA 3WVEB 1VQ6Q 1VQPQ 1AVZC 4ZGEB 4CRIA 1W1FA 4C92E 1YI2A 5FU6C 1UJYA 1ZBJA 1WJQA 2QQAA 3VS0A 3VYHB 2RN8A 2AKKA 1EZZB 2NUPA 5HQ0B 1XOVA 3MHXA 4CI0C 4CC2A 5FW9A 3CCVQ 3JB9D 2ZCFB 3HZJA 4CFNB 1CKAA 3ZL7C 1OGUB 1AWOA 3CCLA 2DD4B 3MI9B 3RDVA 1BU1A 3POMA 2E1HA 3ASKA 4XTYA 3MIAB 2XIDA 4FYWB 2IN3A 1WGSA 4IUTA 5GAN8 3RKXA 1LVKA 4EMKB 2RPNA 5CCAA 1UNHD 2VC8A 4CFXB 5KYYA 2BE9B 5J3BA 1T3SA 3BHVB 2I2LA 2YT6A 5IT9E 2K5FA 1WJRA 3Q1JA 1YJNT 2DAQA 1SF9A 4A63B 5D6XA 3CC7Q 4HCZA 5IHYA 4MFDA 1Q95G 4LDYA 1M3CA 4N0AC 2KSSA 4F7JB 1H28B 3BLQB 1Q81C 1FVVB 2JVVA 3HFOA 5DLQE 2DVJA 3CD6T 4J6YA 1KFZA 3KBGA 3O0GD 1TD6A 2YUNA 4PL6A 1UDLA 1QW1A 1W6XA 2ED1A 4JLGA 5LQFB 3QPHA 4MZTA 2GNCA 3QBYA 1M90C 4JJNK 1YCYA 3S3MA 1IGUA 4O6JA 4FT2A 2JNGA 2L3RA 4N4GA 4JUVA 4JJBA 2DFUA 4QKUA 3QDRB 2EWNA 4FSXA 4R55A 3NGPA 2QGGA 4C92G 3QZ9B 2P0KA 3CMAQ 3VUBA 2EUFA 4J7FA 1YIJQ 1H3ZA 2OTLT 5I22A 2PU9B 2L2PA 2X3XD 1GBRA 4N4HA 4KGXB 4IKFA 2YDLA 5LJ3h 1PC0A 3M53A 2KAFA 4NL2A 2FRYA 3OYCA 4MFEA 2OAWA 2UZLB 1NYFA 3BLHB 1YJ9T 2D8HA 3FDRA 1X2QA 2JXBA 4R56A 4CFVB 3L2QA 5IAYA 5GAN4 1XNIA 3G4SQ 5GANh 2RQTA 4YOSA 1FMWA 2L0AA 3C12A 1W2BA 2C6TB 2W10A 2DXCA 2HBPA 5BNJB 3PO3S 1P92A 4OMLA 4QQGA 3QYHB 2LQKA 3M0RA 4PFZA 1TUCA 1WHLA 1OPLA 4FU6A 2FRWA 2H3JA 3EG1A 3OB9A 2CUBA 1KQ2A 4KH1B 3AT1B 5KYUA 3D7SB 4KRDB 2WHBB 4X9DA 2UZDB 2H8HA 1ZSZA 4KBMB 3AHUA 2V26A 1A0NB 1NJIR 3HBLA 1WPYA 1KQSA 4E6RA 1LNXA 2GQVA 4PJNA 3SWNB 4RTTA 3CPWP 2X1NB 2QI2A 3RKWA 4KGVB 3UATA 2QDLA 3LW5E 2B86A 1QKXA 4OB1B 3TW6A 3PNWC 4NS5A 4ORZA 2CP7A 4OGEA 5GAN6 5HK0A 3QWLA 3TSWA 5FWCA 3VJPA 3OYYA 1VQ9Q 1VYVA 2KT8A 4NOYA 5IXFA 2DXTA 5KE2A 1S72T 2NYSA 3CBOA 2VASA 4BBRM 4J9IA 5GAN7 1PKDB 5D6YA 3CCET 1F5QB 2DPPB 3FLGA 4OMNA 5D6WA 4XU1A 5DY9A 3OYGA 5GMKl 4F70B 2X35A 2VWFA 2RO0A 2RHIA 1ZUKA 4EC9B 2HQEA 4AFUC 1ZQ1A 2GQIA 4M7AF 2KI7A 2IW6B 2RQVA 2M0OA 1K4US 2G9XB 1M1FA 4J7IA 2KYMA 2LCLA 2L5QA 4RTYA 5I21A 2DEQA 1QMZB 3CCRA 1PRMC 2EGCA 1UFFA 3CC7A 2FHDA 3B57A 2YHTA 1JJ2A 4LDXA 1WHJA 1OKWB 1W70A 1BB9A 1MV3A 4M7AB 2CCIB 1VQPA 4BCIB 2W9ZA 3BDUA 2M51A 2F69A 1D09B 4F7UG 2P4RA 2X4JA 5IHNA 3CCEQ 1GXIE 3K7AM 4OMOA 1J3TA 1WJSA 3EFSA 4RG2A 5CK9A 1VQKT 1VQ9A 4OGRB 5GJVB 4YOZA 2QA4A 2C0OA 5LJ3j 4NC6A 2CH4A 4M75D 5LJ3e 1R0BG 3JB9J 2QEXT 2GFAA 4BDZA 4FW1A 1K8AU 2K2MA 5GAMd 1YJNA 4KT0E 5GAN5 2GTOA 3V7CA 2HL3A 2X51A 2C0TA 3QZ5B 4L5GA 3JV3A 3FC3A 2RHYA 1UGRB 3M56A 1N8RC 2IW8B 2HBWA 3A1PA 4X34A 5GAMj 3L42A 2HSPA 3EG9A 1F1BB 3VS6A 4JX4A 4EOPB 2R58A 4ELYC 3X24B 3LLRA 1UE9A 4JPBW 4D6WA 4QW2A 3BE3A 2D0QB 2E3IA 4M78G 3TREA 4M7AA 2CP6A 1LJOA 2D6FA 3LYIA 4C5EA 3BW1A 4M7DC 3QUIA 2JJ9A 5EJCA 1OI1A 3X20B 1JRIA 5CKBA 2MWPA 5GMKi 4GLMA 2RQUA 4YC3B 3G71Q 1H1PB 2LTOA 2LZ6B 2QQ9A 1KG1A 2PVGB 1OULA 1OV3A 4RTZA 2YUPA 4F14A 1PWTA 2ENMA 2K6DA 2KY9A 5A2QE 4LUEA 3MO8A 3QDFA 2DXBB 4J9EA 4LXCA 1H92A 2R57A 3CCMA 2F5KA 4J9BA 1YIJT 1HXDA 2RD1A 2CP2A 1WXUA 1K73R 4BUGA 1KD1U 2V1RA 4FIBA 2E6ZA 4IURA 1UEBA 3VYGA 1SRMA 3OS0A 4EOQB 3GF5A 2JN0A 2DTHA 2F2XA 1PM3A 4HNUA 4LOCA 3P8DA 3MEWA 1M2VA 3I55T 1PHTA 2C5VB 4OMMA 1M2OA 1M8MA 1RUWA 4NL3A 4QQ6A 2CZ7B 1NYGA 2CDTA 4HKEA 1NJIC 1FYNA 1QKWA 1TS9A 5IF1B 1AD6A 1N9RA 1Y96B 2COYA 3BG3A 2YRVA 4YOOA 1GRIA 2CUDA 1ZSZB 3CXCA 3G71A 1CKBA 5FRMA 2MAMA 3JCMf 2BIVA 2COWA 3BDLA 2V8KA 1TOVA 3FJ5A 2CT4A 1MHNA 2EKOA 1SRLA 3EG9B 3ULRB 3RBBB 4C5HA 2C5NB 2QTVA 1QMCA 3HP9A 1Q82R 2KXDA 5IHKA 2RH2A 2VUBA 5FU7C 1YP5A 1ZHIA 5HNBB 1ENWA 2HMAA 3QHRB 5DLOA 1I8FA 3THKA 1OZ3A 2ZZDA 1GCQA 3FEOA 3VS3A 4JRIA 1RAGB 2KRSA 1YJWA 4AKHA 5GAN2 2QYZA 1X6OA 3T9NA 3OYHA 1M4ZA 3QXEB 2E5QA 1W2BP 2IPOB 2E70A 2HCKA 3CMEA 5GJWB 4XTWA 3QHSA 1PNJA 2DKGA 1HYOA 1Y96A 3NFCA 4EMGA 4ESRA 1VQLQ 3L2RA 1I0CA 5FLXE 2LX7A 3JCMV 4C0DB 3DL1A 3MP1A 5CO7A 1EIFA 3R6OA 3I56T 3OYFA 2DNUA 4M75C 2VXFA 3CC2A 4Y92A 3M57A 3OY9A 1WHGA 2V22B 2UZEB 1YHQT 1G8XA 1K1ZA 4OMPA 3FRNA 2MOXA 1SKUB 3BG9A 4E7LA 1M2VB 2K57A 4VUBA 1YJNQ 3VKGA 1UTIA 4C92A 3CXCS 2QK0A 1Y71A 1I5OB 4ZN1A 3GNFB 2RA2A 3C4SA 3RMQA 4ZNXA 4O5VA 2J05A 1IZ6A 4Z6YA 1XTDA 4FM4B 2LQWA 5KCHA 5CEIB 2ABLA 2DJQA 1UUEA 4HNTA 2KROA 2PZ1A 1EFNA 2DXUA 2LJ0A 4BY6C 2AZVA 1ACMB 5C0MA 2MIOA 2C5OB 5HVYB 3MY5B 4F6UB 3JCMX 4BY1X 2YWWA 4EONB 1X43A 1MMNA 5LJ5e 3QKJA 3X28B 2FYKA 4GY5A 2BZ8A 1QVFS 1KJWA 1KD1C 1M27C 5GANe 1KC8C 2L3SA 3X25B 2C4GB 3BY7A 3QYGB 3HPWA 5FWBA 3CCEA 3OYJA 1I07A 2PVOB 2AT1B 1FMKA 4XU3A 2ZGWA 1D1AA 1AWJA 5HBEB 2Z0WA 3REAB 1OX8A 2VGMA 5KE3A 2O9VA 2RJFA 1UGSB 1Q86U 3LGFA 5LMKB 2JZ2A 2M16A 2DO3A 3DB3A 2ATCB 4Z8AA 2E64A 1ABOA 4PFPA 2RI2A 1M9SA 4C92F 4ZGJB 2JGZB 1VQ5T 3G4SA 1Q86C 3MP8A 3RUXA 3ZEHA 2QEXQ 1E9HB 3CCSA 3EG0A 2KNBB 1K0SA 1BK2A 2WFYB 1KQSS 4FW2A 2WIPB 3L1AA 3I9QA 4KRCB 1TUDA 1S1NA 4A4KA 1U8RA 2E41A 3OYIA 2IG0A 2DETA 3PIPA 5J26A 1YJWT 4M75F 3A8GB 2BPMB 2PTKA 3UWNA 5CIUA 4LNPA 3A8OB 3JSCA 4C0GA 3M5AA 3TU4K 4PJJA 4Z89A 1NEBA 4PJMA 4XQ3A 1LCKA 3CQTA 2DM1A 4DBRA 2HL5C 3PT9A 4F7UA 3GBQA 5LJ5h 3CBMA 5CYIB 3V8JA 2YLCA 1D1CA 4HCCA 4RKUE 3QHWB 2F5TX 2KK4A 3S3NA 5ACBA 3E1SA 1AWWA 4F7SB 3EGDB 2KRNA 1IREB 2PUKB 2W0ZA 2QDYB 4KUDK 1N5ZA 4M78E 2E4HA 2KR6A 5A0GA 3GP8A 3M4YA 4C92D 4OB0B 2A36A 3P8BB 1VQOA 1WHKA 4KULA 1M3BA 1TWBA 4BCFB 3G7ZA 4D8KA 4ZTJA 4BCQB 3URGA 5GANj 4E7KA 3CMAT 2ZAEA 4ANJA 3BLRB 3OSVA 2V1QA 4JRPA 1UGPB 4J83A 2JTFA 1VQNT 5HK3A 5CR2A 2D9TA 3I5SA 3VS1A 4M75A 2DJZA 3CCSQ 3MEUA 2P84A 2EQUA 4BY6B 3PGGA 2XHCA 1VQKQ 1MMDA 1TUGB 1VOMA 2MYSA 4IMYB 4N0AA 1UGQB 2DIGA 1C1AA 2PNIA 3VRYA 5FRNA 3EFOB 4AFQC 4AG1C 1B7TA 4F7UF 3RNJA 3VV0A 2FB7A 2L8DA 2DE0X 3G6EQ 1VQMA 2EQKA 2RJCA 4J6WA 3TNHB 2JM9A 1U1TA 3LGLA 9ATCB 4LD9K 3GIBA 2SEMA 2I53A 1SHGA 2A0FB 3HKSA 4AMCA 1Y7XA 2A3LA 5CAIA 5EFQB 4UN0A 2CP0A 2EFIA 2QEXA 1JU5C 2Y4YA 3EG2A 3GPLA 3JB9F 2LW4A 2CZ1B 3FB9A 2ZPIB 3OYDA 3JRZA 3INZA 3FIFA 3HTRA 1W2BS 4BE1A 3JCMP 5KYUB 4PJOE 2X4XA 2ZPBB 1FKMA 1E6HA 1RAIB 4HT9A 4MZMA 1I5LA 2CSQA 4F17A 3H41A 3M54A 4JX5A 3EGDA 5J39A 3CMAA 4C8QD 2DZCA 4FX3B 3VKHA 1VQ7Q 2VYTA 1IGQA 1UB4A 2J7IA 4BI8B 3SB2A 2O01E 1U1SA 1UNGD 1K73U 8ATCB 3N5BB 1WHMA 1YI2Q 1AZEA 3KHIA 2E12A 3META 4ATOA 2PK2A 4C92B 1JXMA 4I3ZB 3WVDB 4M77G 2RI3A 4MZPA 1VYUA 5KYWB 2VXEA 2FEIA 4DQ2A 1NM7A 3V7SA 1BI1A 2VGNA 1OX9A 5KYYB 2XDDA 3CC7T 4MMLA 2HEQA 3V8LA 5ECAA 4BCPB 1XJWB 3KXTA 2NUZA 2PUOB 3EJ1B 2EJ9A 2KGTA 5LJ3g 5HBJB 2KT1A 1K76A 2RJEA 3CC4Q 4FT4A 4BI4A 1KC8U 1Z9QA 1D0XA 1UHFA 3PMTA 3CCLT 1JB0E 4J9GA 2A28A 4CFMB 3PE0A 2EYQA 2QA4T 5GMKe 2LC4A 4CRLB 1TU0B 3OMGA 1PSEA 4M7AD 3EFOA 2ZZDB 2WEVB 1VUBA 3ZBDA 2DMEA 3OYLA 2I0NA 2V8IA 2D1XA 1OU9A 1WDXA 1KIKA 4QT7A 1I1JA 2FL7A 4C8QB 5KYXA 3CCQQ 2MWOA 2EIFA 1M1KU 2GFUA 1VQ8T 3OYAA 3UPUA 4LD6A 3JCMJ 2DD5B 1WQWA 2C5XB 1GFCA 2LCCA 1C9BA 2WACA 4EPCA 4E7SA 2K2VA 5LJ3d 2E10A 8AT1B 4LE9A 1QVPA 2QTXA 1VQLT 4M7DE 3KUFA 3H9NA 2JMAA 1BU2A 1RAHB 3JCMe 4TVRA 1VQ7A 3M4GA 2OTJQ 4JS5A 3EHRA 2DZ9A 1M1GA 4IUUA 4M7AC 1O9SA 1VOLA 2MCNA 5GANf 1K0XA 3H0IA 4C92C 2FZGB 3MEAA 3NPFA 1H1RB 4LN2A 2DXCB 2JW4A 4II5B 1U5SA 1QP3A 3CC4A 4QSHA 2NLUA 4J9DA 3F5XB 1OZ2A 1R77A 2YXYA 3U23A 4AFZC 1K73C 3A8LB 1KD1R 2OTLQ 3VU3C 2P0QA 3CCQA 1I81A 4F6WB 3CCST 2RM4A 4M7AG 4BE0A 4M75E 3L2ZA 2FG0A 4FL6A 4F7UB 4HVUA 3OS2A 4CFUD 1G3TA 4PLIA 1N6AA 4C8QG 4M75B 3CCMQ 4JZ3A 2RNAA 2YUOA 2ZPEB 3UA7A 2EYYA 3NHNA 1H4LD 5FU6B 2DBKA 3SD4A 2DL4A 3H4CA 4GBQA 4KRTA 4OGCA 1K8AC 2W9FA 2XD0A 3OS1A 3A5ZB 3I55Q 1IB8A 2BZXA 1AZGB 2ECZA 2K7AA 1WX6A 1D3BB 2FPFA 2CS7A 2FO0A 3M03A 1SHFA 2NUPB 2PMIB 3J81E 1YWOA 5L23A 3A8MB 3BFMA 2IIMA 1KHIA 1XQHA 1QQJA 3I56A 2KMGA 3JCMc 2DERA 2DF6A 1H3HA 2QQRA 1H8KA 4LDVA 3E2UA 5LJ5f 4OB3B 4F7LB 4MMKA 3JCMW 1GUXA 4BCKB 4A4HA 1WYXA 2E5KA 1WQ7A 2DTOA 1PKTA 2CSIA 4DBHA 5GAOp 3QYEA 3QWYA 1NBEB 2HQHA 2ZPFB 3LQ5B 5GAOn 3OYBA 4C0ZA 1X01A 2QDJA 2CZ6B 4FYYB 4RTXA 5GAOr 1WNLA 1O9KB 3SWNC 1VQOT 1ZSGA 1K9AA 3G4ST 1B07A 4L6V5 2HSEB 4A4FA 1M8VA 4QQDA 1QCFA 3E9GA 2K5IA 4M77B 1E7PA 3UF4A 1VQ4T 3MKDA 4M7DA 1CSKA 2XU8A 2HKNA 3CCRT 3LH0A 4PJOG 4ELJA 1FMVA 4HVWA 2GCXA 3JCMh 2DTIA 3H0FA 4PJOB 2P0PA 2CT3A 3HFNA 1OQKA 3CCJT 2KBTA 2QA4Q 4E7JA 4K11A 2NUTA 2QF7A 5AYFA 3CCUQ 1ZSZC 1URCB 1C0MA 5KYNA 5I2SA 2EPDA 3QG1A 2KQWA 2OTJT 1VQ7T 2DK3A 3VS5A 1RAEB 2L3QA 1VQ9T 4AKGA 3VS7A 2OJ2A 4M77D 4JDSA 2PVDB 4BCND 1KQSP 4CXAB 2O88A 1BKBA 3PVLA 4Y72B 3CPWA 4WF2A 3GLXA 3HRSA 3OMCA 1MGQA 3CD6Q 3REBB 4BB7A 3TEEA 2J6OA 1YNZA 1NPPA 2LP5A 4C0FA 2ROLA 4X1VA 1YI2T 3X26B 2LJ3A 2IVWA 1PCXA 4BCJB 2EJFA 3UDCA 4E7ZA 1KC8R 4AFSC 2LNHB 1X6GA 2JTEA 1N27A 4HCBA 4WTOB 4C0DC 1QVGP 2DYBA 4EORB 3SWNA 3EH2A 4M7DF 4M7DG 2A08A 1QCOA 3TVTA 4BXXX 4ZGDB 3LH5A 2W2HA 2EBPA 1AD5A 3CCJQ 2F2WA 1M1KR 3UT1A 2CCHB 4LDUA 4ZTFA 3SHWA 3EOCB 5LJ5d 1JJ2S 2PQWA 1JSUB 2E3HA 2EW3A 1RI9A 3DB4A 1O9KA 3VYGB 1T0HA 5CKHA 1GCPA 3MP6A 1S72A 3UA6A 4B9XA 1UJ0A 2DMOA 3G6EA 4C5GA 3DTOA 3EHQA 4E2FB 3G6ET 4PNOA 1HD3A 2R5AA 4B6MA 2OAUA 2BKZB 2JUFA 5KH6A 1IHWA 1VQOQ 2XI9A 1D0ZA 2CKKA 1X75C 3CCUA 1N8RR 1G2BA 2GF7A 5GMKm 2JMCA 4M75G 4XTXA 2LQNA 2RHUA 1Q7YC 1AWXA 5KCOA 1V1CA 3CPFA 1NG2A 2QG9B 3TN8B 2LQ8A 2DILA 4OF1A 2JTMA 4PJOF 2WPAB 1X27A 3ME9A 2X4WA 5CKFA 3R6NA 1M30A 4J6XA 3MCAB 4AKIA 3QJ6A 1NPRA 1SEMA 3JAME 2C06A 1IXDA 1H1QB 4F7NB 5CKEA 3MJXA 2AKLA 1ZBXA 1TFBA 1DJ7B 2YUQA 1D0YA 4KUIA 2VV5A 1ARKA 3A8HB 3DDPB 4JJCA 3CCJA 1P5EB 4KH0B 1EX4A 2FVUA 5A0DA 1VQLA 5L2WB 1JEGA 2ESWA 4N4IA 2SRCA 4AT1B 5CQYA 3I55A 2WXVB 4PKCC 2K3YA 2E6NA 1SG5A 1YJWQ 4BCQD 1ZX6A 3EFRA 2RHXA 5IH2A 3CCVT 2XK0A 3I56Q 1FXXA 4RUGA 3JCMd 1YHQA 2CP3A 2F2VA 3VKIA 4XU2A 4L59A 1SPKA 1BI2A 1SSHA 1WHHA 1BIBA 1T3LA 3M0SA 3HSBA 1BYMA 2LMJA 4M7DB 2OTLA 1Y57A 1FX7A 2LCSA 5DQWA 3JB9I 1VQNA 1TG0A 4NSTB 1QVGS 5HBHB 4QVDA 2M9UA 4RODA 5GAOl 2KEAA 2RJDA 3F70A 2XG8D 4PJOA 2BS3A 4XAXB 2CYZB 2R5MA 2FPEA 3OYKA 4EMKC 3HB9A 3M0TA 3OS5A 2YRCA 3VS2A 1VQ8Q 2L3PA 5EG2A 3P8HA 2DBMA 2MMPA 1G83A 4P5NA 2WSCE 1UGVA 2LT1A 1YITA 3MPUB 1RADB 3NTHA 2XKOC 5GAMg 2B9RA 5GANd 2VVKA 5GAOm 1QWFA 2K9GA 1VQ5Q 4XTVA 2EKHA 1QVGA 2BKDN 3JCMg 4M78C 3PIOA 4M78B 4CC3A 1M90R 2DRMA 4BD3A 1K9MC 1GL5A 1GH6B 3TNWB 4J9FA 3E9FA
chains in the Genus database with same CATH topology
1M1KC 3I55T 2ZZDB 2JOYA 1VUBA 3ZBDA 1NJIU 4C8QA 4NL3A 3OYLA 4M7DD 2V8IA 4QQ6A 5LJ5j 3HO8A 2CZ7B 2LVMA 3HRTA 2L89A 4PJOC 3OQ5A 2DVEA 2FL7A 2K4YA 3FJPA 4HA8A 4C8QB 1VQMT 4HKEA 1NJIC 2QQ8A 2KVQG 2DD5A 3OSSC 3ER0A 3G71T 2MWOA 2EIFA 1M1KU 2GFUA 1VQ8T 2CGHA 3CCUT 5C6SA 3OYAA 1N9RA 1Y96B 1QLBA 4LD6A 4JX6A 3BG3A 2YRVA 2DD5B 3SFMA 3UPUA 3JCMJ 4MDWA 1VQ8A 1B34B 2Y90A 1G3WA 4OP0A 3CXCA 3G71A 4BACA 1WQWA 4RCCA 5FRMA 5DM7R 2MAMA 3JCMf 2BIVA 2LCCA 2QFZA 5GAMe 3CC4T 3HL8A 4Z02A 3BDLA 2WACA 3CCQT 4E7HA 4EPCA 3S3OA 2K2VA 5LJ3d 2V8KA 2E10A 1MHNA 4HL4A 2EKOA 2KMTA 1I4K1 1V29B 1QVPA 4IUQA 2QTXA 3J80E 1VQLT 1O75A 4M7DE 3KUFA 4C5HA 5FU7B 4V2SA 3HP9A 5CVIA 1G3YA 2RH2A 2VUBA 5FU7C 3JCMe 4TVRA 1VQ7A 2P4TA 1ZHIA 4BBSM 3M4GA 3OBYA 4JS5A 5L8RE 2DZ9A 1M1GA 3S6WA 3L2VA 1VQ4A 5DLOA 1I8FA 4IUUA 2XICA 3H6ZA 4M7AC 1O9SA 3OW2A 1OZ3A 5GANf 2ZZDA 3FEOA 2EAYA 4JRIA 2WSFE 4C92C 5GAOq 3MEAA 1YJ9A 3M58A 4IUVA 3CCMT 3MEVA 2DXCB 4AKHA 2HNIA 5GAN2 3CCVA 1YJWA 4J8OA 1X6OA 3T9NA 3OYHA 1M4ZA 3QXEB 2E5QA 4ELZC 1QP3A 2E70A 3WXMB 3CMEA 4B9WA 1BI3A 4XTWA 3QHSA 4OVAA 2DKGA 3CC4A 4QSHA 2NLUA 3QSUA 1Y96A 5HY6A 3NFCA 3GNGA 4EMGA 2V8JA 3L2RA 1OZ2A 2RB6A 3H8ZA 1K73C 3NTIA 3A8LB 2BS4A 3VU3C 2P0QA 2G77A 5FLXE 1I81A 2EQJA 3CCQA 3JCMV 2RM4A 3CCST 4M7AG 1RI0A 4M75E 4A4GA 2YLBA 4C0DB 3DL1A 1VIFA 4BE0A 1PSFA 3MP1A 5CO7A 1RL2A 3L2ZA 1EIFA 3R6OA 1B34A 3V7RA 3I56T 1AHJB 4FL6A 3OYFA 4F7UB 1QP2A 3OS2A 4M75C 1G3TA 2Y4XA 4PLIA 3OBWA 2HAXA 2VXFA 1LOJA 1N6AA 4C8QG 4M75B 3CC2A 3M55A 1G5VA 3M57A 3OY9A 3DKMA 3BG5A 1YHQT 3WVEB 2ZPEB 5LL6S 4ZGEB 5FU6B 4CRIA 3SD4A 4C92E 3FRNA 4E7LA 3BG9A 3H4CA 4OGCA 5FU6C 1YI2A 1K8AC 2XD0A 1WJQA 2QQAA 2K57A 4VUBA 3OS1A 3VYHB 3A5ZB 4A54A 3VKGA 2RK2A 4MDXA 4C92A 3CXCS 1Y71A 1D3BB 1XOVA 2CS7A 3MHXA 4ZN1A 4CI0C 4OMFB 3GNFB 3QJYA 2LDMA 2RA2A 3C4SA 4IUPA 3RMQA 3J81E 3JB9D 2ZCFB 3ZFJA 4LDWA 3A8MB 3HZJA 4MIMA 4O5VA 3BFMA 4AI6A 3CCLA 2DD4B 4Z6YA 1IZ6A 1KHIA 1XQHA 4XK8E 3I56A 1XTDA 2E1HA 3ASKA 4FM4B 4XTYA 1BI0A 2KMGA 3JCMc 5KCHA 2XIDA 3OYMA 4J5YA 4EMKA 2QQRA 4HNTA 4LDVA 1WGSA 1N9SA 5LJ5f 4OB3B 4IUTA 2DXUA 4MMKA 5GAN8 3RKXA 4EMKB 3JCMW 5CCAA 2VC8A 4BY6C 4A4HA 5C0MA 3P8DA 5J3BA 2I2LA 5A0LA 1K9MU 2RI5A 2RK1A 5IT9E 1WQ7A 2K5FA 1WJRA 3Q1JA 2DTOA 3JCMX 1YJNT 2DAQA 5GAOp 3QYEA 3QYBA 5LJ5e 3QKJA 5D6XA 3X28B 2FYKA 4GY5A 1VQ5A 1QVFS 4HCZA 2ZPFB 2LRQA 4MFDA 4LDYA 5GAOn 3OYBA 1KD1C 4C0ZA 1X01A 5GANe 2QDJA 2CZ6B 1Q7YU 1KC8C 3X25B 3BY7A 5GAOr 1WNLA 4N0AC 3QYGB 3RKYA 2KSSA 3HPWA 3SWNC 1VQOT 1Q81C 2JVVA 3C94A 3HFOA 5I2MA 5DLQE 1Q82C 2O4XB 3G4ST 3CCEA 3CD6T 4J6YA 4L6V5 3KBGA 4PL6A 4A4FA 3OYJA 1M8VA 2PVOB 4QQDA 3E9GA 1QW1A 5LJ3f 2K5IA 4XU3A 2ZPHB 4M77B 1E7PA 2ZGWA 1VQ4T 4DOWA 4JLGA 3HRUA 3QPHA 4MZTA 3QBYA 1M90C 4M7DA 4JJNK 4XU0A 1KD1U 1YCYA 4M77A 2VGMA 5KE3A 2XU8A 3S3MA 2RJFA 2QQBA 1UGSB 1Q86U 3LGFA 4O6JA 2CZ0B 4FT2A 3CCRT 3LH0A 2JZ2A 2LT4A 2M16A 4ELJA 2JNGA 4PJOG 2L3RA 4HNVA 2GCXA 2WSEE 4N4GA 2DO3A 3JCMh 2DTIA 4JUVA 3DB3A 4PJOB 1M5Q1 2P0PA 5HKCA 3HFNA 3CCJT 4E7JA 2E64A 3QDRB 5CQXA 5CKDA 2EWNA 2QF7A 4FSXA 2RI2A 5AYFA 1M9SA 4R55A 4C92F 3QIIA 4C92G 3QZ9B 2P0KA 4ZGJB 2WJ9A 2X4YA 2XDBA 3VUBA 1VQ5T 4ZN3A 5I2SA 3G4SA 3CD6A 1Q86C 4J7FA 3QG1A 3MP8A 3RUXA 3ZEHA 3CCSA 4JS4A 1H3ZA 2KQWA 2OTLT 2OTJT 1KQSS 2PU9B 1VQ7T 2DK3A 3L1AA 4N4HA 1VQ9T 4AKGA 4IKFA 2QQSA 4EDUA 4M77D 4JDSA 2PVDB 5LJ3h 3M59A 4XTUA 4NL2A 3M53A 2KAFA 4A4KA 1TH7A 2E41A 3OYIA 1U8RA 5GAMf 1BKBA 4MFEA 2IG0A 3OYCA 3PIPA 1YJ9T 3J7AF 3CPWA 4WF2A 5J26A 3FDRA 3GLXA 3L2UA 3VUZA 1Q82U 1VQKA 3HRSA 3V8KA 4R56A 3L2QA 4A4EA 5IAYA 5M9OA 1YJWT 4M75F 5GAN4 3OMCA 1MGQA 3HHTB 3A8GB 1XNIA 5GANh 3PTAA 3UWNA 5CIUA 2BUDA 4BB7A 3C12A 1W2BA 4JLIA 3JCMQ 3TEEA 3A8OB 3JSCA 4C0GA 3M5AA 3TU4K 2DXCA 3SDZA 1NPPA 2HBPA 4C0FA 1P92A 4XQ3A 4QQGA 1YI2T 3QYHB 2LQKA 3X26B 4M77E 4FU6A 2H3JA 2IVWA 3OB9A 1Y07A 3PT9A 2EJFA 3UDCA 3O8VA 1SSFA 1KQ2A 4E47A 4F7UA 5LJ5h 3CBMA 3RERA 3V8JA 2DIQA 2YLCA 4X9DA 1N27A 4HCBA 3LWIA 4KBMB 4C0DC 2HQXA 4Q5WA 4RKUE 4HCCA 3AHUA 2KK4A 2F5TX 3S3NA 3SWNA 3HBLA 1WPYA 1KQSA 3E1SA 4A53A 4M7DF 4M7DG 4M77F 4BI3A 1LNXA 2GQVA 3SWNB 4XTZA 4ZGDB 4GLKA 4RMOA 1IREB 2PUKB 1NZ9A 2HD0A 2O4XA 2QI2A 1FWZA 3RKWA 4EMHA 3UT1A 2QDYB 4QVZA 2EJGA 4LDUA 4KUDK 3LW5E 4OGEA 4NS5A 4OB1B 3TW6A 3PNWC 5GAN6 5HK0A 5LJ5d 4M78E 2PQWA 4ZTFA 1JJ2S 4M77C 2LNVA 3QWLA 3GP8A 2KR6A 3RMSA 4M78D 3M4YA 5A0GA 2AHJB 3DB4A 4DA4A 3VYGB 4C92D 3VJPA 3OYYA 4OB0B 5CKHA 3P8BB 4HLQA 3MP6A 1S72A 4NOYA 2ZPGB 1VQOA 2DXTA 5KE2A 4BE2A 4B9XA 4C8QC 4KULA 1S72T 3CBOA 4HT8A 3G6EA 1R8OB 4C5GA 1D3BA 3EAEA 4BBRM 1YBYA 5GAN7 3G6ET 1VQPT 5D6YA 4PNOA 4Y28E 3G7ZA 4ZTJA 1M90U 2R5AA 3CCET 2DPPB 3FLGA 5DY9A 5D6WA 4XU1A 3OYGA 1YITT 3URGA 5GANj 1N8RU 4E7KA 3M9QA 3CMAT 5GMKl 2OAUA 5KH6A 2JUFA 3OSVA 2XI9A 2X35A 2CKKA 3L2WA 4M6VA 1X75C 2RO0A 2RHIA 5GMKj 3CCUA 4PLLA 4JRPA 1UGPB 4J83A 2HQEA 2GF7A 1ZQ1A 2JTFA 4M78F 5HK3A 1VQNT 2BS2A 4M7AF 5CR2A 2D9TA 5GMKm 4JRQA 2EQMA 4M75G 4BDYA 2M0OA 4M75A 2DJZA 1HK9A 4XTXA 3MEUA 2RHUA 1M1FA 2A7YA 4J7IA 2EQUA 2LCLA 2L5QA 4BY6B 3PGGA 1Q7YC 5I21A 2DEQA 3RESA 5KCOA 2XHCA 3CPFA 3CCRA 2LQ8A 4OF1A 4QVCA 4C8QE 3JCMb 2FHDA 3CC7A 2JTMA 4PJOF 2YHTA 1JJ2A 5GANg 3ME9A 2X4WA 4N0AA 5CKFA 4LDXA 2RHZA 1UGQB 1KHCA 2DIGA 3PMIA 4J6XA 3MCAB 4M7AB 5FRNA 4AKIA 3QJ6A 1VQPA 3BDUA 4YTLA 1NPRA 1H641 2F69A 4F7UF 4F7UG 3VV0A 2K3XA 2FB7A 2X4JA 3JAME 2C06A 2L8DA 1GXIE 1VQMA 2DD4A 2EQKA 2RJCA 4J6WA 3LGLA 1U1TA 1BIAA 1WJSA 3EFSA 5CKEA 4Y91A 4RG2A 1ZBXA 4X9CA 5CK9A 4LD9K 1VQKT 3GIBA 1VQ9A 1DJ7B 3HKSA 2M1HA 1Y7XA 4DOVA 2QA4A 2A3LA 5CAIA 2EFIA 4KUIA 2VV5A 2QEXA 5LJ3j 3A8HB 2Y4YA 4NC6A 4M75D 3NTKA 5LJ3e 3CCJA 3GPLA 3JB9F 2FVUA 2CZ1B 5A0DA 3JB9J 3FB9A 1VQLA 2ZPIB 3OYDA 3OA6A 2GFAA 3JRZA 4N4IA 2QEXT 2MF2A 4BDZA 1VQ6T 5CQYA 3I55A 3INZA 5GAMd 1YJNA 1K8AU 3FIFA 4KT0E 1JBMA 2K3YA 4PKCC 3OYEA 2E6NA 5GAN5 3TCJA 1W2BS 4BE1A 3JCMP 3CMET 5GMKh 3V7CA 4PJOE 2X4XA 2ZPBB 1FKMA 4C8QF 3EFRA 2RHXA 5LJ5g 4HT9A 3QZ5B 4L5GA 4MZMA 1I5LA 3FC3A 2RHYA 2XK0A 1UGRB 1FXXA 3M56A 3M54A 4C5IA 3CCVT 1N8RC 3C95A 1YIJA 3JCMd 5GAMj 4X34A 1YHQA 3L42A 4JX5A 1KQ1A 5J39A 3RIRA 3CMAA 2OTJA 4C8QD 4JX4A 3VKIA 1G3SA 2DZCA 4XU2A 2R58A 4ELYC 3X24B 3VKHA 3DLMA 2VYTA 3LLRA 3QO3A 1UB4A 4L59A 4BI8B 4D6WA 4QW2A 1BI2A 4M78A 3SB2A 1BIBA 2O01E 2D0QB 4M78G 3LWHA 2G3RA 3TREA 4M7AA 1U1SA 1K73U 3TW7A 3HSBA 1BYMA 5IN1A 4M7DB 3N5BB 2OTLA 1LJOA 4UC4A 2D6FA 1FX7A 3LYIA 3KHIA 2E12A 3BW1A 3META 4C5EA 4M7DC 3QUIA 3JB9I 1VQNA 4ATOA 5EJCA 4C92B 1OI1A 3X20B 1JRIA 1OYXA 5CKBA 2MWPA 1QVGS 3PFSA 4ME7A 4RG8A 5GMKi 4QVDA 2M9UA 5GAOl 3WVDB 3JB9H 4M77G 2RJDA 3F70A 2RI3A 4MZPA 5GAN3 3CBPA 2XG8D 3DLLA 4PJOA 2BS3A 4XAXB 2CYZB 2R5MA 2LTOA 3OYKA 2XDPA 4JRKA 3HB9A 2VXEA 3OS5A 2QQ9A 4EMKC 4DQ2A 3CPWS 3V7SA 1QVFA 5EG2A 3P8HA 3JB9G 3OW2S 1BI1A 2PVGB 2VGNA 1KG1A 2XDDA 2MMPA 2DXBA 3CC7T 4MMLA 4F7UE 4P5NA 2WSCE 3V8LA 2LT1A 2KY9A 5A2QE 1YITA 3KXTA 3CC2T 3MO8A 2DXBB 2PUOB 3MEWA 2XKOC 3NTHA 5GAMg 2EJ9A 2R57A 3CCMA 3LX7A 2F5KA 5LJ3g 5GANd 2E65A 1YIJT 1HXDA 2RD1A 3CEYA 1Q81U 5GAOm 2RJEA 4OB2B 2LX9A 4FT4A 4BI4A 3GOXA 1KC8U 4XTVA 4PJOD 2KDSA 4BUGA 3PMTA 1QVGA 1VIEA 4FIBA 2BKDN 3JCMg 1JB0E 1NE8A 1W4SA 4M78C 3PIOA 3CCLT 2E6ZA 2B8AA 4M78B 4IURA 1UEBA 4RCBA 4E7IA 2MI6A 3E19A 3VYGA 2EYQA 4II1A 5FROA 3OS0A 2QA4T 1VQ6A 3GF5A 5GMKe 2LC4A 2JN0A 2DTHA 4BD3A 1K9MC 2QXFA 3OMGA 5GAMh 1PSEA 4HNUA 4M7AD 4LOCA 2K5LA 3OYNA 3E9FA 4M7AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZD B;  3HHT B;  3A8G B;  2DD4 A;  2ZCF B;  3A8M B;  3A8O B;  2CZ7 B;  2DD4 B;  1DJ7 B;  2DXC A;  4XK8 E;  4FM4 B;  3QYH B;  2DD5 A;  3X26 B;  3A8H B;  2CZ1 B;  4OB3 B;  2DD5 B;  2ZPI B;  4KT0 E;  4RKU E;  2ZPB B;  1V29 B;  3QZ5 B;  3X28 B;  1UGR B;  2ZPF B;  4ZGD B;  1IRE B;  2CZ6 B;  2PUK B;  3X25 B;  2QDY B;  3QYG B;  5L8R E;  3LW5 E;  4OB1 B;  3X24 B;  2ZZD A;  4L6V 5;  2AHJ B;  2O01 E;  2D0Q B;  2WSF E;  3VYG B;  2PVO B;  4OB0 B;  2ZPH B;  2ZPG B;  2DXC B;  3X20 B;  3QXE B;  1QP3 A;  3WVD B;  4Y28 E;  1UGS B;  2DPP B;  2CZ0 B;  2CYZ B;  2WSE E;  2PVG B;  2DXB A;  3A8L B;  2WSC E;  1UGP B;  2DXB B;  2PUO B;  1PSF A;  3QZ9 B;  1AHJ B;  4ZGJ B;  1QP2 A;  4OB2 B;  2PU9 B;  3WVE B;  2ZPE B;  1JB0 E;  2PVD B;  4ZGE B;  1UGQ B;  3VYG A;  3VYH B;  1PSE A;  1GXI E; 
#chains in the Genus database with same CATH topology
 3EGX A;  2JOY A;  1BBZ A;  1PKS A;  1ZUY A;  5LJ5 j;  3HO8 A;  3PVQ A;  2LVM A;  3HRT A;  2L89 A;  4PJO C;  3OQ5 A;  3BHU B;  1BCO A;  3FJP A;  1VYT A;  3RR6 A;  1VQM T;  2J6K A;  3OSS C;  3ER0 A;  3TNI B;  1N4M A;  3CCU T;  2EGA A;  5C6S A;  1OL1 B;  3SFM A;  4JX6 A;  1Q7Y R;  4MDW A;  3VS4 A;  2H3E B;  1G3W A;  4BAC A;  3TSZ A;  2K79 A;  4HCK A;  5DM7 R;  2BZY A;  2QFZ A;  3CC4 T;  3HL8 A;  4Z02 A;  2PK9 B;  1ABQ A;  4JJD A;  4E7H A;  4HL4 A;  1K9M R;  1I4K 1;  1WLP B;  4IUQ A;  2W96 A;  2CH4 W;  3J80 E;  1O75 A;  3OW2 P;  4V2S A;  2RMO A;  1IO6 A;  4BBS M;  5L8R E;  3L2V A;  2DRK A;  1VQ4 A;  4J9H A;  2IW9 B;  2EAY A;  2WSF E;  5GAO q;  3A98 A;  1RLQ C;  3M58 A;  4IUV A;  3CCM T;  1JJ2 P;  3KFV A;  1LPL A;  1KSW A;  4EOJ B;  3CCV A;  4J8O A;  4ELZ C;  1JKW A;  4B9W A;  1BI3 A;  1H24 B;  4OVA A;  3QSU A;  1B3Q A;  1V76 A;  2ROT A;  4M4Z A;  1H27 B;  2V8J A;  1HSQ A;  2RB6 A;  1QVF P;  3DDQ B;  5EC7 A;  3NTI A;  2BS4 A;  1WXB A;  2G77 A;  2R7G A;  4A4G A;  4EOO B;  2YLB A;  1VIF A;  5IHI A;  1PSF A;  3DJB A;  2KXC A;  1RL2 A;  2BTT A;  2RQR A;  1H25 B;  1AHJ B;  3V7R A;  1U06 A;  2F1L A;  2NWM A;  3DOG B;  3OBW A;  1LOJ A;  1G5V A;  3M55 A;  1OIY B;  3O5Z A;  2C0I A;  1MV0 B;  1YIT Q;  2OI3 A;  1XO2 A;  5LL6 S;  1UNL D;  1UG1 A;  1VIN A;  2WMA B;  4A54 A;  2RK2 A;  4OMQ A;  4MDX A;  2O9S A;  4OMF B;  3QJY A;  2LDM A;  1VQN Q;  4IUP A;  3ZFJ A;  4LDW A;  4MIM A;  2M02 A;  4AI6 A;  4XK8 E;  5D7U A;  1BI0 A;  3OYM A;  2RQW A;  4J5Y A;  4EOK B;  1E6G A;  4EMK A;  5IDN B;  1N9S A;  4RTW A;  1X6B A;  4EOM B;  3I5R A;  5A0L A;  1K9M U;  1Z9Z A;  2HDA A;  2NUT B;  2RI5 A;  2RK1 A;  2MPX C;  1OU8 A;  2YSQ A;  1RAA B;  4RTU A;  3QYB A;  4HXJ A;  1VQ5 A;  1HJD A;  2LRQ A;  1Q7Y U;  1G3N C;  1M3A A;  1OEB A;  1OOT A;  3RKY A;  4HVV A;  6AT1 B;  3C94 A;  5I2M A;  1Q82 C;  2O4X B;  3H0H A;  2O31 A;  3I35 A;  1WA7 A;  5LJ3 f;  2ZPH B;  4DOW A;  4ROE A;  3HRU A;  4XU0 A;  4M77 A;  1BCM A;  4Z88 A;  2QQB A;  2CZ0 B;  2COZ A;  2LT4 A;  1QLY A;  4HNV A;  2WSE E;  1NEG A;  2QGF B;  2EYX A;  1M5Q 1;  2MK5 A;  5HKC A;  5CQX A;  1C6V X;  5CKD A;  1QWE A;  4EOL B;  4CC7 A;  1YCS B;  3QII A;  1TXQ A;  2WJ9 A;  1JXO A;  2X4Y A;  2XDB A;  1VQM Q;  4R0K A;  4ZN3 A;  3CD6 A;  4JS4 A;  4FCY A;  1QCN A;  4BCM B;  1YN8 A;  2GTJ A;  4EC8 B;  4KGZ B;  2QQS A;  4EDU A;  2LJ1 A;  3M59 A;  4XTU A;  4M7D D;  3SEM A;  2CJM B;  1TH7 A;  3BHT B;  5GAM f;  3EGU A;  5I5Z B;  5ICP B;  3J7A F;  3L2U A;  1Q82 U;  3VUZ A;  1VQK A;  3V8K A;  2W99 A;  1VYW B;  2X9H A;  4A4E A;  5M9O A;  2D0N A;  4BCM D;  3HHT B;  3PTA A;  2BUD A;  4JLI A;  3JCM Q;  3EGX B;  1IHV A;  3SDZ A;  4BCN B;  3NDQ A;  3CCR Q;  4M77 E;  3TQ7 P;  4IIO A;  2IVX A;  1MNE A;  1T0J A;  5KYW A;  1Y07 A;  3CXC P;  3O8V A;  1SSF A;  4E47 A;  4FYV B;  1PD0 A;  3RER A;  4WCI A;  2DIQ A;  4BCO B;  2G6F X;  2KRM A;  2KR3 A;  3LWI A;  1OL2 B;  2HQX A;  4Q5W A;  4LUD A;  3M0U A;  1ZA2 B;  2JM8 A;  1OKV B;  2VKN A;  4A53 A;  2AIR B;  4M77 F;  4BI3 A;  1GCQ C;  4XTZ A;  4GLK A;  4RMO A;  4BCH B;  1NZ9 A;  2HD0 A;  2O4X A;  1FWZ A;  4EMH A;  2WIH B;  4QVZ A;  2EJG A;  4DBQ A;  1JQQ A;  2YRD A;  2DEU A;  2EYW A;  1UHC A;  2CRE A;  1UEC A;  3G1J A;  4M77 C;  2LNV A;  1Q86 R;  2HAX A;  5FGK B;  3RMS A;  4M78 D;  4F16 A;  2AHJ B;  4DA4 A;  4F6S B;  4FYX B;  4HLQ A;  2ZPG B;  4BE2 A;  4JZ4 A;  1Q81 R;  3IQL A;  1D1B A;  4C8Q C;  4PJL A;  4ROC A;  4HT8 A;  1R8O B;  1D3B A;  2XMF A;  3EAE A;  1YBY A;  1WXT A;  1RAF B;  1VQP T;  1WIE A;  4Y28 E;  1M90 U;  1YIT T;  1N8R U;  3M9Q A;  2RF0 A;  3L2W A;  4M6V A;  5GMK j;  2ED0 A;  4PLL A;  2DL8 A;  3GTM S;  4M78 F;  4G6L B;  2VB6 A;  2BS2 A;  2OX7 A;  4JRQ A;  3EH1 A;  4D8D A;  2EQM A;  1FIN B;  2DL5 A;  4BDY A;  1HK9 A;  2A7Y A;  1ZUU A;  4IIM A;  2QAZ A;  4RTV A;  3RES A;  2A37 A;  1AEY A;  4OR5 B;  3NMZ C;  4ELL A;  1YFN A;  5DQV A;  5HCK A;  1U3O A;  4QVC A;  4C8Q E;  3JCM b;  4FSS A;  2UUE B;  1PRL C;  1ZP2 A;  5GAN g;  2RHZ A;  1YWP A;  1KHC A;  3PMI A;  1WZO A;  3M0Q A;  4YTL A;  1H64 1;  2AZS A;  1H1S B;  2WMB B;  3VRZ A;  2K3X A;  2FPD A;  7AT1 B;  4EOS B;  2DD4 A;  2DX1 A;  1BIA A;  4Y91 A;  2J06 A;  3MY1 B;  5AT1 B;  1S72 Q;  4X9C A;  1PD1 A;  2M1H A;  2DA9 A;  4DOV A;  2JT4 A;  4CFU B;  1MMG A;  5IXB A;  4AG2 C;  2UZB B;  3NTK A;  1ZLM A;  4F04 B;  2X3W D;  3OA6 A;  1VQ6 T;  1NLP C;  2MF2 A;  1Y0M A;  2O2O A;  1JBM A;  2BE7 D;  3OYE A;  3TCJ A;  2PJQ A;  3CME T;  5GMK h;  2HKQ B;  5IDP B;  4C8Q F;  1OPK A;  5LJ5 g;  2KYB A;  4C5I A;  1YJ9 Q;  3C95 A;  1YIJ A;  1WI7 A;  2DYI A;  1KQ1 A;  2D8J A;  4PFO A;  3RIR A;  2OTJ A;  1G3S A;  1AIS B;  3DLM A;  3QO3 A;  1W98 B;  4BY7 X;  4M78 A;  2DL7 A;  1ZA1 B;  3LWH A;  2G3R A;  3TW7 A;  5IN1 A;  4UC4 A;  1OYX A;  3PFS A;  4RG8 A;  1KXU A;  3JB9 H;  1RAC B;  5GAN 3;  1K8A R;  1NLO C;  3CBP A;  3DLL A;  4PK4 A;  3G33 B;  2XDP A;  4JRK A;  1RLP C;  3CPW S;  1QVF A;  3JB9 G;  3OW2 S;  2DXB A;  3RGF B;  1E7O A;  2EQI A;  2PHG A;  4F7U E;  3CC2 T;  1X69 A;  4EIK A;  1GUX B;  3CC2 Q;  3LX7 A;  2E65 A;  2F2C A;  2DLP A;  3CEY A;  1Q81 U;  1H26 B;  4OB2 B;  2LX9 A;  1R0C B;  3GOX A;  4PJO D;  3CME Q;  2KDS A;  1VIE A;  1NE8 A;  1W4S A;  2B8A A;  4RCB A;  4E7I A;  2MI6 A;  3E19 A;  5FRO A;  4II1 A;  1VQ6 A;  2GBQ A;  2QXF A;  1IRX A;  5GAM h;  1MND A;  4DEY A;  2K3B A;  2K5L A;  4ME7 A;  3OYN A;  4M7A E;  1M1K C;  1JO8 A;  2AK5 A;  1NJI U;  4C8Q A;  5KYX B;  2EYZ A;  1OIU B;  3M0P A;  2DVE A;  2K4Y A;  4HA8 A;  3C0C A;  1WFW A;  2KE9 A;  2QQ8 A;  1OI9 B;  2DD5 A;  2KVQ G;  3G71 T;  2FZC B;  2CGH A;  2GGR A;  1QLB A;  1VQ8 A;  1PG5 B;  1B34 B;  2Y90 A;  4OP0 A;  1MUZ A;  4RCC A;  1X2K A;  3CCQ T;  5GAM e;  3S3O A;  2KMT A;  4DEX A;  4EOI B;  1V29 B;  1D3U B;  2CP5 A;  1GBQ A;  4J9C A;  5FU7 B;  3EG3 A;  5CVI A;  2JS0 A;  1G3Y A;  1AT1 B;  1VQ4 Q;  2P4T A;  3OBY A;  2DL3 A;  3S6W A;  1YHQ Q;  2EGE A;  2XIC A;  3H6Z A;  3OW2 A;  4DBF A;  1YJ9 A;  1JOW A;  3CCL Q;  1VA7 A;  3EID B;  2JS2 A;  3MEV A;  1GFD A;  2HNI A;  1RAB B;  2M0Y A;  3WXM B;  1JST B;  5HY6 A;  3QWX X;  3GNG A;  1AOJ A;  2I40 B;  3H8Z A;  2FZK B;  2QAS A;  2QGS A;  4TTH A;  2J6F A;  2EQJ A;  1RI0 A;  1KK7 A;  1B34 A;  1MMA A;  1QP2 A;  1TSF A;  4CFW B;  1TTH B;  2Y4X A;  5I11 A;  2HZY A;  3DKM A;  1GY3 B;  4BCG B;  3BG5 A;  4CC4 B;  2EVR A;  3WVE B;  1VQ6 Q;  1VQP Q;  1AVZ C;  4ZGE B;  4CRI A;  1W1F A;  4C92 E;  1YI2 A;  5FU6 C;  1UJY A;  1ZBJ A;  1WJQ A;  2QQA A;  3VS0 A;  3VYH B;  2RN8 A;  2AKK A;  1EZZ B;  2NUP A;  5HQ0 B;  1XOV A;  3MHX A;  4CI0 C;  4CC2 A;  5FW9 A;  3CCV Q;  3JB9 D;  2ZCF B;  3HZJ A;  4CFN B;  1CKA A;  3ZL7 C;  1OGU B;  1AWO A;  3CCL A;  2DD4 B;  3MI9 B;  3RDV A;  1BU1 A;  3POM A;  2E1H A;  3ASK A;  4XTY A;  3MIA B;  2XID A;  4FYW B;  2IN3 A;  1WGS A;  4IUT A;  5GAN 8;  3RKX A;  1LVK A;  4EMK B;  2RPN A;  5CCA A;  1UNH D;  2VC8 A;  4CFX B;  5KYY A;  2BE9 B;  5J3B A;  1T3S A;  3BHV B;  2I2L A;  2YT6 A;  5IT9 E;  2K5F A;  1WJR A;  3Q1J A;  1YJN T;  2DAQ A;  1SF9 A;  4A63 B;  5D6X A;  3CC7 Q;  4HCZ A;  5IHY A;  4MFD A;  1Q95 G;  4LDY A;  1M3C A;  4N0A C;  2KSS A;  4F7J B;  1H28 B;  3BLQ B;  1Q81 C;  1FVV B;  2JVV A;  3HFO A;  5DLQ E;  2DVJ A;  3CD6 T;  4J6Y A;  1KFZ A;  3KBG A;  3O0G D;  1TD6 A;  2YUN A;  4PL6 A;  1UDL A;  1QW1 A;  1W6X A;  2ED1 A;  4JLG A;  5LQF B;  3QPH A;  4MZT A;  2GNC A;  3QBY A;  1M90 C;  4JJN K;  1YCY A;  3S3M A;  1IGU A;  4O6J A;  4FT2 A;  2JNG A;  2L3R A;  4N4G A;  4JUV A;  4JJB A;  2DFU A;  4QKU A;  3QDR B;  2EWN A;  4FSX A;  4R55 A;  3NGP A;  2QGG A;  4C92 G;  3QZ9 B;  2P0K A;  3CMA Q;  3VUB A;  2EUF A;  4J7F A;  1YIJ Q;  1H3Z A;  2OTL T;  5I22 A;  2PU9 B;  2L2P A;  2X3X D;  1GBR A;  4N4H A;  4KGX B;  4IKF A;  2YDL A;  5LJ3 h;  1PC0 A;  3M53 A;  2KAF A;  4NL2 A;  2FRY A;  3OYC A;  4MFE A;  2OAW A;  2UZL B;  1NYF A;  3BLH B;  1YJ9 T;  2D8H A;  3FDR A;  1X2Q A;  2JXB A;  4R56 A;  4CFV B;  3L2Q A;  5IAY A;  5GAN 4;  1XNI A;  3G4S Q;  5GAN h;  2RQT A;  4YOS A;  1FMW A;  2L0A A;  3C12 A;  1W2B A;  2C6T B;  2W10 A;  2DXC A;  2HBP A;  5BNJ B;  3PO3 S;  1P92 A;  4OML A;  4QQG A;  3QYH B;  2LQK A;  3M0R A;  4PFZ A;  1TUC A;  1WHL A;  1OPL A;  4FU6 A;  2FRW A;  2H3J A;  3EG1 A;  3OB9 A;  2CUB A;  1KQ2 A;  4KH1 B;  3AT1 B;  5KYU A;  3D7S B;  4KRD B;  2WHB B;  4X9D A;  2UZD B;  2H8H A;  1ZSZ A;  4KBM B;  3AHU A;  2V26 A;  1A0N B;  1NJI R;  3HBL A;  1WPY A;  1KQS A;  4E6R A;  1LNX A;  2GQV A;  4PJN A;  3SWN B;  4RTT A;  3CPW P;  2X1N B;  2QI2 A;  3RKW A;  4KGV B;  3UAT A;  2QDL A;  3LW5 E;  2B86 A;  1QKX A;  4OB1 B;  3TW6 A;  3PNW C;  4NS5 A;  4ORZ A;  2CP7 A;  4OGE A;  5GAN 6;  5HK0 A;  3QWL A;  3TSW A;  5FWC A;  3VJP A;  3OYY A;  1VQ9 Q;  1VYV A;  2KT8 A;  4NOY A;  5IXF A;  2DXT A;  5KE2 A;  1S72 T;  2NYS A;  3CBO A;  2VAS A;  4BBR M;  4J9I A;  5GAN 7;  1PKD B;  5D6Y A;  3CCE T;  1F5Q B;  2DPP B;  3FLG A;  4OMN A;  5D6W A;  4XU1 A;  5DY9 A;  3OYG A;  5GMK l;  4F70 B;  2X35 A;  2VWF A;  2RO0 A;  2RHI A;  1ZUK A;  4EC9 B;  2HQE A;  4AFU C;  1ZQ1 A;  2GQI A;  4M7A F;  2KI7 A;  2IW6 B;  2RQV A;  2M0O A;  1K4U S;  2G9X B;  1M1F A;  4J7I A;  2KYM A;  2LCL A;  2L5Q A;  4RTY A;  5I21 A;  2DEQ A;  1QMZ B;  3CCR A;  1PRM C;  2EGC A;  1UFF A;  3CC7 A;  2FHD A;  3B57 A;  2YHT A;  1JJ2 A;  4LDX A;  1WHJ A;  1OKW B;  1W70 A;  1BB9 A;  1MV3 A;  4M7A B;  2CCI B;  1VQP A;  4BCI B;  2W9Z A;  3BDU A;  2M51 A;  2F69 A;  1D09 B;  4F7U G;  2P4R A;  2X4J A;  5IHN A;  3CCE Q;  1GXI E;  3K7A M;  4OMO A;  1J3T A;  1WJS A;  3EFS A;  4RG2 A;  5CK9 A;  1VQK T;  1VQ9 A;  4OGR B;  5GJV B;  4YOZ A;  2QA4 A;  2C0O A;  5LJ3 j;  4NC6 A;  2CH4 A;  4M75 D;  5LJ3 e;  1R0B G;  3JB9 J;  2QEX T;  2GFA A;  4BDZ A;  4FW1 A;  1K8A U;  2K2M A;  5GAM d;  1YJN A;  4KT0 E;  5GAN 5;  2GTO A;  3V7C A;  2HL3 A;  2X51 A;  2C0T A;  3QZ5 B;  4L5G A;  3JV3 A;  3FC3 A;  2RHY A;  1UGR B;  3M56 A;  1N8R C;  2IW8 B;  2HBW A;  3A1P A;  4X34 A;  5GAM j;  3L42 A;  2HSP A;  3EG9 A;  1F1B B;  3VS6 A;  4JX4 A;  4EOP B;  2R58 A;  4ELY C;  3X24 B;  3LLR A;  1UE9 A;  4JPB W;  4D6W A;  4QW2 A;  3BE3 A;  2D0Q B;  2E3I A;  4M78 G;  3TRE A;  4M7A A;  2CP6 A;  1LJO A;  2D6F A;  3LYI A;  4C5E A;  3BW1 A;  4M7D C;  3QUI A;  2JJ9 A;  5EJC A;  1OI1 A;  3X20 B;  1JRI A;  5CKB A;  2MWP A;  5GMK i;  4GLM A;  2RQU A;  4YC3 B;  3G71 Q;  1H1P B;  2LTO A;  2LZ6 B;  2QQ9 A;  1KG1 A;  2PVG B;  1OUL A;  1OV3 A;  4RTZ A;  2YUP A;  4F14 A;  1PWT A;  2ENM A;  2K6D A;  2KY9 A;  5A2Q E;  4LUE A;  3MO8 A;  3QDF A;  2DXB B;  4J9E A;  4LXC A;  1H92 A;  2R57 A;  3CCM A;  2F5K A;  4J9B A;  1YIJ T;  1HXD A;  2RD1 A;  2CP2 A;  1WXU A;  1K73 R;  4BUG A;  1KD1 U;  2V1R A;  4FIB A;  2E6Z A;  4IUR A;  1UEB A;  3VYG A;  1SRM A;  3OS0 A;  4EOQ B;  3GF5 A;  2JN0 A;  2DTH A;  2F2X A;  1PM3 A;  4HNU A;  4LOC A;  3P8D A;  3MEW A;  1M2V A;  3I55 T;  1PHT A;  2C5V B;  4OMM A;  1M2O A;  1M8M A;  1RUW A;  4NL3 A;  4QQ6 A;  2CZ7 B;  1NYG A;  2CDT A;  4HKE A;  1NJI C;  1FYN A;  1QKW A;  1TS9 A;  5IF1 B;  1AD6 A;  1N9R A;  1Y96 B;  2COY A;  3BG3 A;  2YRV A;  4YOO A;  1GRI A;  2CUD A;  1ZSZ B;  3CXC A;  3G71 A;  1CKB A;  5FRM A;  2MAM A;  3JCM f;  2BIV A;  2COW A;  3BDL A;  2V8K A;  1TOV A;  3FJ5 A;  2CT4 A;  1MHN A;  2EKO A;  1SRL A;  3EG9 B;  3ULR B;  3RBB B;  4C5H A;  2C5N B;  2QTV A;  1QMC A;  3HP9 A;  1Q82 R;  2KXD A;  5IHK A;  2RH2 A;  2VUB A;  5FU7 C;  1YP5 A;  1ZHI A;  5HNB B;  1ENW A;  2HMA A;  3QHR B;  5DLO A;  1I8F A;  3THK A;  1OZ3 A;  2ZZD A;  1GCQ A;  3FEO A;  3VS3 A;  4JRI A;  1RAG B;  2KRS A;  1YJW A;  4AKH A;  5GAN 2;  2QYZ A;  1X6O A;  3T9N A;  3OYH A;  1M4Z A;  3QXE B;  2E5Q A;  1W2B P;  2IPO B;  2E70 A;  2HCK A;  3CME A;  5GJW B;  4XTW A;  3QHS A;  1PNJ A;  2DKG A;  1HYO A;  1Y96 A;  3NFC A;  4EMG A;  4ESR A;  1VQL Q;  3L2R A;  1I0C A;  5FLX E;  2LX7 A;  3JCM V;  4C0D B;  3DL1 A;  3MP1 A;  5CO7 A;  1EIF A;  3R6O A;  3I56 T;  3OYF A;  2DNU A;  4M75 C;  2VXF A;  3CC2 A;  4Y92 A;  3M57 A;  3OY9 A;  1WHG A;  2V22 B;  2UZE B;  1YHQ T;  1G8X A;  1K1Z A;  4OMP A;  3FRN A;  2MOX A;  1SKU B;  3BG9 A;  4E7L A;  1M2V B;  2K57 A;  4VUB A;  1YJN Q;  3VKG A;  1UTI A;  4C92 A;  3CXC S;  2QK0 A;  1Y71 A;  1I5O B;  4ZN1 A;  3GNF B;  2RA2 A;  3C4S A;  3RMQ A;  4ZNX A;  4O5V A;  2J05 A;  1IZ6 A;  4Z6Y A;  1XTD A;  4FM4 B;  2LQW A;  5KCH A;  5CEI B;  2ABL A;  2DJQ A;  1UUE A;  4HNT A;  2KRO A;  2PZ1 A;  1EFN A;  2DXU A;  2LJ0 A;  4BY6 C;  2AZV A;  1ACM B;  5C0M A;  2MIO A;  2C5O B;  5HVY B;  3MY5 B;  4F6U B;  3JCM X;  4BY1 X;  2YWW A;  4EON B;  1X43 A;  1MMN A;  5LJ5 e;  3QKJ A;  3X28 B;  2FYK A;  4GY5 A;  2BZ8 A;  1QVF S;  1KJW A;  1KD1 C;  1M27 C;  5GAN e;  1KC8 C;  2L3S A;  3X25 B;  2C4G B;  3BY7 A;  3QYG B;  3HPW A;  5FWB A;  3CCE A;  3OYJ A;  1I07 A;  2PVO B;  2AT1 B;  1FMK A;  4XU3 A;  2ZGW A;  1D1A A;  1AWJ A;  5HBE B;  2Z0W A;  3REA B;  1OX8 A;  2VGM A;  5KE3 A;  2O9V A;  2RJF A;  1UGS B;  1Q86 U;  3LGF A;  5LMK B;  2JZ2 A;  2M16 A;  2DO3 A;  3DB3 A;  2ATC B;  4Z8A A;  2E64 A;  1ABO A;  4PFP A;  2RI2 A;  1M9S A;  4C92 F;  4ZGJ B;  2JGZ B;  1VQ5 T;  3G4S A;  1Q86 C;  3MP8 A;  3RUX A;  3ZEH A;  2QEX Q;  1E9H B;  3CCS A;  3EG0 A;  2KNB B;  1K0S A;  1BK2 A;  2WFY B;  1KQS S;  4FW2 A;  2WIP B;  3L1A A;  3I9Q A;  4KRC B;  1TUD A;  1S1N A;  4A4K A;  1U8R A;  2E41 A;  3OYI A;  2IG0 A;  2DET A;  3PIP A;  5J26 A;  1YJW T;  4M75 F;  3A8G B;  2BPM B;  2PTK A;  3UWN A;  5CIU A;  4LNP A;  3A8O B;  3JSC A;  4C0G A;  3M5A A;  3TU4 K;  4PJJ A;  4Z89 A;  1NEB A;  4PJM A;  4XQ3 A;  1LCK A;  3CQT A;  2DM1 A;  4DBR A;  2HL5 C;  3PT9 A;  4F7U A;  3GBQ A;  5LJ5 h;  3CBM A;  5CYI B;  3V8J A;  2YLC A;  1D1C A;  4HCC A;  4RKU E;  3QHW B;  2F5T X;  2KK4 A;  3S3N A;  5ACB A;  3E1S A;  1AWW A;  4F7S B;  3EGD B;  2KRN A;  1IRE B;  2PUK B;  2W0Z A;  2QDY B;  4KUD K;  1N5Z A;  4M78 E;  2E4H A;  2KR6 A;  5A0G A;  3GP8 A;  3M4Y A;  4C92 D;  4OB0 B;  2A36 A;  3P8B B;  1VQO A;  1WHK A;  4KUL A;  1M3B A;  1TWB A;  4BCF B;  3G7Z A;  4D8K A;  4ZTJ A;  4BCQ B;  3URG A;  5GAN j;  4E7K A;  3CMA T;  2ZAE A;  4ANJ A;  3BLR B;  3OSV A;  2V1Q A;  4JRP A;  1UGP B;  4J83 A;  2JTF A;  1VQN T;  5HK3 A;  5CR2 A;  2D9T A;  3I5S A;  3VS1 A;  4M75 A;  2DJZ A;  3CCS Q;  3MEU A;  2P84 A;  2EQU A;  4BY6 B;  3PGG A;  2XHC A;  1VQK Q;  1MMD A;  1TUG B;  1VOM A;  2MYS A;  4IMY B;  4N0A A;  1UGQ B;  2DIG A;  1C1A A;  2PNI A;  3VRY A;  5FRN A;  3EFO B;  4AFQ C;  4AG1 C;  1B7T A;  4F7U F;  3RNJ A;  3VV0 A;  2FB7 A;  2L8D A;  2DE0 X;  3G6E Q;  1VQM A;  2EQK A;  2RJC A;  4J6W A;  3TNH B;  2JM9 A;  1U1T A;  3LGL A;  9ATC B;  4LD9 K;  3GIB A;  2SEM A;  2I53 A;  1SHG A;  2A0F B;  3HKS A;  4AMC A;  1Y7X A;  2A3L A;  5CAI A;  5EFQ B;  4UN0 A;  2CP0 A;  2EFI A;  2QEX A;  1JU5 C;  2Y4Y A;  3EG2 A;  3GPL A;  3JB9 F;  2LW4 A;  2CZ1 B;  3FB9 A;  2ZPI B;  3OYD A;  3JRZ A;  3INZ A;  3FIF A;  3HTR A;  1W2B S;  4BE1 A;  3JCM P;  5KYU B;  4PJO E;  2X4X A;  2ZPB B;  1FKM A;  1E6H A;  1RAI B;  4HT9 A;  4MZM A;  1I5L A;  2CSQ A;  4F17 A;  3H41 A;  3M54 A;  4JX5 A;  3EGD A;  5J39 A;  3CMA A;  4C8Q D;  2DZC A;  4FX3 B;  3VKH A;  1VQ7 Q;  2VYT A;  1IGQ A;  1UB4 A;  2J7I A;  4BI8 B;  3SB2 A;  2O01 E;  1U1S A;  1UNG D;  1K73 U;  8ATC B;  3N5B B;  1WHM A;  1YI2 Q;  1AZE A;  3KHI A;  2E12 A;  3MET A;  4ATO A;  2PK2 A;  4C92 B;  1JXM A;  4I3Z B;  3WVD B;  4M77 G;  2RI3 A;  4MZP A;  1VYU A;  5KYW B;  2VXE A;  2FEI A;  4DQ2 A;  1NM7 A;  3V7S A;  1BI1 A;  2VGN A;  1OX9 A;  5KYY B;  2XDD A;  3CC7 T;  4MML A;  2HEQ A;  3V8L A;  5ECA A;  4BCP B;  1XJW B;  3KXT A;  2NUZ A;  2PUO B;  3EJ1 B;  2EJ9 A;  2KGT A;  5LJ3 g;  5HBJ B;  2KT1 A;  1K76 A;  2RJE A;  3CC4 Q;  4FT4 A;  4BI4 A;  1KC8 U;  1Z9Q A;  1D0X A;  1UHF A;  3PMT A;  3CCL T;  1JB0 E;  4J9G A;  2A28 A;  4CFM B;  3PE0 A;  2EYQ A;  2QA4 T;  5GMK e;  2LC4 A;  4CRL B;  1TU0 B;  3OMG A;  1PSE A;  4M7A D;  3EFO A;  2ZZD B;  2WEV B;  1VUB A;  3ZBD A;  2DME A;  3OYL A;  2I0N A;  2V8I A;  2D1X A;  1OU9 A;  1WDX A;  1KIK A;  4QT7 A;  1I1J A;  2FL7 A;  4C8Q B;  5KYX A;  3CCQ Q;  2MWO A;  2EIF A;  1M1K U;  2GFU A;  1VQ8 T;  3OYA A;  3UPU A;  4LD6 A;  3JCM J;  2DD5 B;  1WQW A;  2C5X B;  1GFC A;  2LCC A;  1C9B A;  2WAC A;  4EPC A;  4E7S A;  2K2V A;  5LJ3 d;  2E10 A;  8AT1 B;  4LE9 A;  1QVP A;  2QTX A;  1VQL T;  4M7D E;  3KUF A;  3H9N A;  2JMA A;  1BU2 A;  1RAH B;  3JCM e;  4TVR A;  1VQ7 A;  3M4G A;  2OTJ Q;  4JS5 A;  3EHR A;  2DZ9 A;  1M1G A;  4IUU A;  4M7A C;  1O9S A;  1VOL A;  2MCN A;  5GAN f;  1K0X A;  3H0I A;  4C92 C;  2FZG B;  3MEA A;  3NPF A;  1H1R B;  4LN2 A;  2DXC B;  2JW4 A;  4II5 B;  1U5S A;  1QP3 A;  3CC4 A;  4QSH A;  2NLU A;  4J9D A;  3F5X B;  1OZ2 A;  1R77 A;  2YXY A;  3U23 A;  4AFZ C;  1K73 C;  3A8L B;  1KD1 R;  2OTL Q;  3VU3 C;  2P0Q A;  3CCQ A;  1I81 A;  4F6W B;  3CCS T;  2RM4 A;  4M7A G;  4BE0 A;  4M75 E;  3L2Z A;  2FG0 A;  4FL6 A;  4F7U B;  4HVU A;  3OS2 A;  4CFU D;  1G3T A;  4PLI A;  1N6A A;  4C8Q G;  4M75 B;  3CCM Q;  4JZ3 A;  2RNA A;  2YUO A;  2ZPE B;  3UA7 A;  2EYY A;  3NHN A;  1H4L D;  5FU6 B;  2DBK A;  3SD4 A;  2DL4 A;  3H4C A;  4GBQ A;  4KRT A;  4OGC A;  1K8A C;  2W9F A;  2XD0 A;  3OS1 A;  3A5Z B;  3I55 Q;  1IB8 A;  2BZX A;  1AZG B;  2ECZ A;  2K7A A;  1WX6 A;  1D3B B;  2FPF A;  2CS7 A;  2FO0 A;  3M03 A;  1SHF A;  2NUP B;  2PMI B;  3J81 E;  1YWO A;  5L23 A;  3A8M B;  3BFM A;  2IIM A;  1KHI A;  1XQH A;  1QQJ A;  3I56 A;  2KMG A;  3JCM c;  2DER A;  2DF6 A;  1H3H A;  2QQR A;  1H8K A;  4LDV A;  3E2U A;  5LJ5 f;  4OB3 B;  4F7L B;  4MMK A;  3JCM W;  1GUX A;  4BCK B;  4A4H A;  1WYX A;  2E5K A;  1WQ7 A;  2DTO A;  1PKT A;  2CSI A;  4DBH A;  5GAO p;  3QYE A;  3QWY A;  1NBE B;  2HQH A;  2ZPF B;  3LQ5 B;  5GAO n;  3OYB A;  4C0Z A;  1X01 A;  2QDJ A;  2CZ6 B;  4FYY B;  4RTX A;  5GAO r;  1WNL A;  1O9K B;  3SWN C;  1VQO T;  1ZSG A;  1K9A A;  3G4S T;  1B07 A;  4L6V 5;  2HSE B;  4A4F A;  1M8V A;  4QQD A;  1QCF A;  3E9G A;  2K5I A;  4M77 B;  1E7P A;  3UF4 A;  1VQ4 T;  3MKD A;  4M7D A;  1CSK A;  2XU8 A;  2HKN A;  3CCR T;  3LH0 A;  4PJO G;  4ELJ A;  1FMV A;  4HVW A;  2GCX A;  3JCM h;  2DTI A;  3H0F A;  4PJO B;  2P0P A;  2CT3 A;  3HFN A;  1OQK A;  3CCJ T;  2KBT A;  2QA4 Q;  4E7J A;  4K11 A;  2NUT A;  2QF7 A;  5AYF A;  3CCU Q;  1ZSZ C;  1URC B;  1C0M A;  5KYN A;  5I2S A;  2EPD A;  3QG1 A;  2KQW A;  2OTJ T;  1VQ7 T;  2DK3 A;  3VS5 A;  1RAE B;  2L3Q A;  1VQ9 T;  4AKG A;  3VS7 A;  2OJ2 A;  4M77 D;  4JDS A;  2PVD B;  4BCN D;  1KQS P;  4CXA B;  2O88 A;  1BKB A;  3PVL A;  4Y72 B;  3CPW A;  4WF2 A;  3GLX A;  3HRS A;  3OMC A;  1MGQ A;  3CD6 Q;  3REB B;  4BB7 A;  3TEE A;  2J6O A;  1YNZ A;  1NPP A;  2LP5 A;  4C0F A;  2ROL A;  4X1V A;  1YI2 T;  3X26 B;  2LJ3 A;  2IVW A;  1PCX A;  4BCJ B;  2EJF A;  3UDC A;  4E7Z A;  1KC8 R;  4AFS C;  2LNH B;  1X6G A;  2JTE A;  1N27 A;  4HCB A;  4WTO B;  4C0D C;  1QVG P;  2DYB A;  4EOR B;  3SWN A;  3EH2 A;  4M7D F;  4M7D G;  2A08 A;  1QCO A;  3TVT A;  4BXX X;  4ZGD B;  3LH5 A;  2W2H A;  2EBP A;  1AD5 A;  3CCJ Q;  2F2W A;  1M1K R;  3UT1 A;  2CCH B;  4LDU A;  4ZTF A;  3SHW A;  3EOC B;  5LJ5 d;  1JJ2 S;  2PQW A;  1JSU B;  2E3H A;  2EW3 A;  1RI9 A;  3DB4 A;  1O9K A;  3VYG B;  1T0H A;  5CKH A;  1GCP A;  3MP6 A;  1S72 A;  3UA6 A;  4B9X A;  1UJ0 A;  2DMO A;  3G6E A;  4C5G A;  3DTO A;  3EHQ A;  4E2F B;  3G6E T;  4PNO A;  1HD3 A;  2R5A A;  4B6M A;  2OAU A;  2BKZ B;  2JUF A;  5KH6 A;  1IHW A;  1VQO Q;  2XI9 A;  1D0Z A;  2CKK A;  1X75 C;  3CCU A;  1N8R R;  1G2B A;  2GF7 A;  5GMK m;  2JMC A;  4M75 G;  4XTX A;  2LQN A;  2RHU A;  1Q7Y C;  1AWX A;  5KCO A;  1V1C A;  3CPF A;  1NG2 A;  2QG9 B;  3TN8 B;  2LQ8 A;  2DIL A;  4OF1 A;  2JTM A;  4PJO F;  2WPA B;  1X27 A;  3ME9 A;  2X4W A;  5CKF A;  3R6N A;  1M30 A;  4J6X A;  3MCA B;  4AKI A;  3QJ6 A;  1NPR A;  1SEM A;  3JAM E;  2C06 A;  1IXD A;  1H1Q B;  4F7N B;  5CKE A;  3MJX A;  2AKL A;  1ZBX A;  1TFB A;  1DJ7 B;  2YUQ A;  1D0Y A;  4KUI A;  2VV5 A;  1ARK A;  3A8H B;  3DDP B;  4JJC A;  3CCJ A;  1P5E B;  4KH0 B;  1EX4 A;  2FVU A;  5A0D A;  1VQL A;  5L2W B;  1JEG A;  2ESW A;  4N4I A;  2SRC A;  4AT1 B;  5CQY A;  3I55 A;  2WXV B;  4PKC C;  2K3Y A;  2E6N A;  1SG5 A;  1YJW Q;  4BCQ D;  1ZX6 A;  3EFR A;  2RHX A;  5IH2 A;  3CCV T;  2XK0 A;  3I56 Q;  1FXX A;  4RUG A;  3JCM d;  1YHQ A;  2CP3 A;  2F2V A;  3VKI A;  4XU2 A;  4L59 A;  1SPK A;  1BI2 A;  1SSH A;  1WHH A;  1BIB A;  1T3L A;  3M0S A;  3HSB A;  1BYM A;  2LMJ A;  4M7D B;  2OTL A;  1Y57 A;  1FX7 A;  2LCS A;  5DQW A;  3JB9 I;  1VQN A;  1TG0 A;  4NST B;  1QVG S;  5HBH B;  4QVD A;  2M9U A;  4ROD A;  5GAO l;  2KEA A;  2RJD A;  3F70 A;  2XG8 D;  4PJO A;  2BS3 A;  4XAX B;  2CYZ B;  2R5M A;  2FPE A;  3OYK A;  4EMK C;  3HB9 A;  3M0T A;  3OS5 A;  2YRC A;  3VS2 A;  1VQ8 Q;  2L3P A;  5EG2 A;  3P8H A;  2DBM A;  2MMP A;  1G83 A;  4P5N A;  2WSC E;  1UGV A;  2LT1 A;  1YIT A;  3MPU B;  1RAD B;  3NTH A;  2XKO C;  5GAM g;  2B9R A;  5GAN d;  2VVK A;  5GAO m;  1QWF A;  2K9G A;  1VQ5 Q;  4XTV A;  2EKH A;  1QVG A;  2BKD N;  3JCM g;  4M78 C;  3PIO A;  4M78 B;  4CC3 A;  1M90 R;  2DRM A;  4BD3 A;  1K9M C;  1GL5 A;  1GH6 B;  3TNW B;  4J9F A;  3E9F A; 
#chains in the Genus database with same CATH homology
 1M1K C;  3I55 T;  2ZZD B;  2JOY A;  1VUB A;  3ZBD A;  1NJI U;  4C8Q A;  4NL3 A;  3OYL A;  4M7D D;  2V8I A;  4QQ6 A;  5LJ5 j;  3HO8 A;  2CZ7 B;  2LVM A;  3HRT A;  2L89 A;  4PJO C;  3OQ5 A;  2DVE A;  2FL7 A;  2K4Y A;  3FJP A;  4HA8 A;  4C8Q B;  1VQM T;  4HKE A;  1NJI C;  2QQ8 A;  2KVQ G;  2DD5 A;  3OSS C;  3ER0 A;  3G71 T;  2MWO A;  2EIF A;  1M1K U;  2GFU A;  1VQ8 T;  2CGH A;  3CCU T;  5C6S A;  3OYA A;  1N9R A;  1Y96 B;  1QLB A;  4LD6 A;  4JX6 A;  3BG3 A;  2YRV A;  2DD5 B;  3SFM A;  3UPU A;  3JCM J;  4MDW A;  1VQ8 A;  1B34 B;  2Y90 A;  1G3W A;  4OP0 A;  3CXC A;  3G71 A;  4BAC A;  1WQW A;  4RCC A;  5FRM A;  5DM7 R;  2MAM A;  3JCM f;  2BIV A;  2LCC A;  2QFZ A;  5GAM e;  3CC4 T;  3HL8 A;  4Z02 A;  3BDL A;  2WAC A;  3CCQ T;  4E7H A;  4EPC A;  3S3O A;  2K2V A;  5LJ3 d;  2V8K A;  2E10 A;  1MHN A;  4HL4 A;  2EKO A;  2KMT A;  1I4K 1;  1V29 B;  1QVP A;  4IUQ A;  2QTX A;  3J80 E;  1VQL T;  1O75 A;  4M7D E;  3KUF A;  4C5H A;  5FU7 B;  4V2S A;  3HP9 A;  5CVI A;  1G3Y A;  2RH2 A;  2VUB A;  5FU7 C;  3JCM e;  4TVR A;  1VQ7 A;  2P4T A;  1ZHI A;  4BBS M;  3M4G A;  3OBY A;  4JS5 A;  5L8R E;  2DZ9 A;  1M1G A;  3S6W A;  3L2V A;  1VQ4 A;  5DLO A;  1I8F A;  4IUU A;  2XIC A;  3H6Z A;  4M7A C;  1O9S A;  3OW2 A;  1OZ3 A;  5GAN f;  2ZZD A;  3FEO A;  2EAY A;  4JRI A;  2WSF E;  4C92 C;  5GAO q;  3MEA A;  1YJ9 A;  3M58 A;  4IUV A;  3CCM T;  3MEV A;  2DXC B;  4AKH A;  2HNI A;  5GAN 2;  3CCV A;  1YJW A;  4J8O A;  1X6O A;  3T9N A;  3OYH A;  1M4Z A;  3QXE B;  2E5Q A;  4ELZ C;  1QP3 A;  2E70 A;  3WXM B;  3CME A;  4B9W A;  1BI3 A;  4XTW A;  3QHS A;  4OVA A;  2DKG A;  3CC4 A;  4QSH A;  2NLU A;  3QSU A;  1Y96 A;  5HY6 A;  3NFC A;  3GNG A;  4EMG A;  2V8J A;  3L2R A;  1OZ2 A;  2RB6 A;  3H8Z A;  1K73 C;  3NTI A;  3A8L B;  2BS4 A;  3VU3 C;  2P0Q A;  2G77 A;  5FLX E;  1I81 A;  2EQJ A;  3CCQ A;  3JCM V;  2RM4 A;  3CCS T;  4M7A G;  1RI0 A;  4M75 E;  4A4G A;  2YLB A;  4C0D B;  3DL1 A;  1VIF A;  4BE0 A;  1PSF A;  3MP1 A;  5CO7 A;  1RL2 A;  3L2Z A;  1EIF A;  3R6O A;  1B34 A;  3V7R A;  3I56 T;  1AHJ B;  4FL6 A;  3OYF A;  4F7U B;  1QP2 A;  3OS2 A;  4M75 C;  1G3T A;  2Y4X A;  4PLI A;  3OBW A;  2HAX A;  2VXF A;  1LOJ A;  1N6A A;  4C8Q G;  4M75 B;  3CC2 A;  3M55 A;  1G5V A;  3M57 A;  3OY9 A;  3DKM A;  3BG5 A;  1YHQ T;  3WVE B;  2ZPE B;  5LL6 S;  4ZGE B;  5FU6 B;  4CRI A;  3SD4 A;  4C92 E;  3FRN A;  4E7L A;  3BG9 A;  3H4C A;  4OGC A;  5FU6 C;  1YI2 A;  1K8A C;  2XD0 A;  1WJQ A;  2QQA A;  2K57 A;  4VUB A;  3OS1 A;  3VYH B;  3A5Z B;  4A54 A;  3VKG A;  2RK2 A;  4MDX A;  4C92 A;  3CXC S;  1Y71 A;  1D3B B;  1XOV A;  2CS7 A;  3MHX A;  4ZN1 A;  4CI0 C;  4OMF B;  3GNF B;  3QJY A;  2LDM A;  2RA2 A;  3C4S A;  4IUP A;  3RMQ A;  3J81 E;  3JB9 D;  2ZCF B;  3ZFJ A;  4LDW A;  3A8M B;  3HZJ A;  4MIM A;  4O5V A;  3BFM A;  4AI6 A;  3CCL A;  2DD4 B;  4Z6Y A;  1IZ6 A;  1KHI A;  1XQH A;  4XK8 E;  3I56 A;  1XTD A;  2E1H A;  3ASK A;  4FM4 B;  4XTY A;  1BI0 A;  2KMG A;  3JCM c;  5KCH A;  2XID A;  3OYM A;  4J5Y A;  4EMK A;  2QQR A;  4HNT A;  4LDV A;  1WGS A;  1N9S A;  5LJ5 f;  4OB3 B;  4IUT A;  2DXU A;  4MMK A;  5GAN 8;  3RKX A;  4EMK B;  3JCM W;  5CCA A;  2VC8 A;  4BY6 C;  4A4H A;  5C0M A;  3P8D A;  5J3B A;  2I2L A;  5A0L A;  1K9M U;  2RI5 A;  2RK1 A;  5IT9 E;  1WQ7 A;  2K5F A;  1WJR A;  3Q1J A;  2DTO A;  3JCM X;  1YJN T;  2DAQ A;  5GAO p;  3QYE A;  3QYB A;  5LJ5 e;  3QKJ A;  5D6X A;  3X28 B;  2FYK A;  4GY5 A;  1VQ5 A;  1QVF S;  4HCZ A;  2ZPF B;  2LRQ A;  4MFD A;  4LDY A;  5GAO n;  3OYB A;  1KD1 C;  4C0Z A;  1X01 A;  5GAN e;  2QDJ A;  2CZ6 B;  1Q7Y U;  1KC8 C;  3X25 B;  3BY7 A;  5GAO r;  1WNL A;  4N0A C;  3QYG B;  3RKY A;  2KSS A;  3HPW A;  3SWN C;  1VQO T;  1Q81 C;  2JVV A;  3C94 A;  3HFO A;  5I2M A;  5DLQ E;  1Q82 C;  2O4X B;  3G4S T;  3CCE A;  3CD6 T;  4J6Y A;  4L6V 5;  3KBG A;  4PL6 A;  4A4F A;  3OYJ A;  1M8V A;  2PVO B;  4QQD A;  3E9G A;  1QW1 A;  5LJ3 f;  2K5I A;  4XU3 A;  2ZPH B;  4M77 B;  1E7P A;  2ZGW A;  1VQ4 T;  4DOW A;  4JLG A;  3HRU A;  3QPH A;  4MZT A;  3QBY A;  1M90 C;  4M7D A;  4JJN K;  4XU0 A;  1KD1 U;  1YCY A;  4M77 A;  2VGM A;  5KE3 A;  2XU8 A;  3S3M A;  2RJF A;  2QQB A;  1UGS B;  1Q86 U;  3LGF A;  4O6J A;  2CZ0 B;  4FT2 A;  3CCR T;  3LH0 A;  2JZ2 A;  2LT4 A;  2M16 A;  4ELJ A;  2JNG A;  4PJO G;  2L3R A;  4HNV A;  2GCX A;  2WSE E;  4N4G A;  2DO3 A;  3JCM h;  2DTI A;  4JUV A;  3DB3 A;  4PJO B;  1M5Q 1;  2P0P A;  5HKC A;  3HFN A;  3CCJ T;  4E7J A;  2E64 A;  3QDR B;  5CQX A;  5CKD A;  2EWN A;  2QF7 A;  4FSX A;  2RI2 A;  5AYF A;  1M9S A;  4R55 A;  4C92 F;  3QII A;  4C92 G;  3QZ9 B;  2P0K A;  4ZGJ B;  2WJ9 A;  2X4Y A;  2XDB A;  3VUB A;  1VQ5 T;  4ZN3 A;  5I2S A;  3G4S A;  3CD6 A;  1Q86 C;  4J7F A;  3QG1 A;  3MP8 A;  3RUX A;  3ZEH A;  3CCS A;  4JS4 A;  1H3Z A;  2KQW A;  2OTL T;  2OTJ T;  1KQS S;  2PU9 B;  1VQ7 T;  2DK3 A;  3L1A A;  4N4H A;  1VQ9 T;  4AKG A;  4IKF A;  2QQS A;  4EDU A;  4M77 D;  4JDS A;  2PVD B;  5LJ3 h;  3M59 A;  4XTU A;  4NL2 A;  3M53 A;  2KAF A;  4A4K A;  1TH7 A;  2E41 A;  3OYI A;  1U8R A;  5GAM f;  1BKB A;  4MFE A;  2IG0 A;  3OYC A;  3PIP A;  1YJ9 T;  3J7A F;  3CPW A;  4WF2 A;  5J26 A;  3FDR A;  3GLX A;  3L2U A;  3VUZ A;  1Q82 U;  1VQK A;  3HRS A;  3V8K A;  4R56 A;  3L2Q A;  4A4E A;  5IAY A;  5M9O A;  1YJW T;  4M75 F;  5GAN 4;  3OMC A;  1MGQ A;  3HHT B;  3A8G B;  1XNI A;  5GAN h;  3PTA A;  3UWN A;  5CIU A;  2BUD A;  4BB7 A;  3C12 A;  1W2B A;  4JLI A;  3JCM Q;  3TEE A;  3A8O B;  3JSC A;  4C0G A;  3M5A A;  3TU4 K;  2DXC A;  3SDZ A;  1NPP A;  2HBP A;  4C0F A;  1P92 A;  4XQ3 A;  4QQG A;  1YI2 T;  3QYH B;  2LQK A;  3X26 B;  4M77 E;  4FU6 A;  2H3J A;  2IVW A;  3OB9 A;  1Y07 A;  3PT9 A;  2EJF A;  3UDC A;  3O8V A;  1SSF A;  1KQ2 A;  4E47 A;  4F7U A;  5LJ5 h;  3CBM A;  3RER A;  3V8J A;  2DIQ A;  2YLC A;  4X9D A;  1N27 A;  4HCB A;  3LWI A;  4KBM B;  4C0D C;  2HQX A;  4Q5W A;  4RKU E;  4HCC A;  3AHU A;  2KK4 A;  2F5T X;  3S3N A;  3SWN A;  3HBL A;  1WPY A;  1KQS A;  3E1S A;  4A53 A;  4M7D F;  4M7D G;  4M77 F;  4BI3 A;  1LNX A;  2GQV A;  3SWN B;  4XTZ A;  4ZGD B;  4GLK A;  4RMO A;  1IRE B;  2PUK B;  1NZ9 A;  2HD0 A;  2O4X A;  2QI2 A;  1FWZ A;  3RKW A;  4EMH A;  3UT1 A;  2QDY B;  4QVZ A;  2EJG A;  4LDU A;  4KUD K;  3LW5 E;  4OGE A;  4NS5 A;  4OB1 B;  3TW6 A;  3PNW C;  5GAN 6;  5HK0 A;  5LJ5 d;  4M78 E;  2PQW A;  4ZTF A;  1JJ2 S;  4M77 C;  2LNV A;  3QWL A;  3GP8 A;  2KR6 A;  3RMS A;  4M78 D;  3M4Y A;  5A0G A;  2AHJ B;  3DB4 A;  4DA4 A;  3VYG B;  4C92 D;  3VJP A;  3OYY A;  4OB0 B;  5CKH A;  3P8B B;  4HLQ A;  3MP6 A;  1S72 A;  4NOY A;  2ZPG B;  1VQO A;  2DXT A;  5KE2 A;  4BE2 A;  4B9X A;  4C8Q C;  4KUL A;  1S72 T;  3CBO A;  4HT8 A;  3G6E A;  1R8O B;  4C5G A;  1D3B A;  3EAE A;  4BBR M;  1YBY A;  5GAN 7;  3G6E T;  1VQP T;  5D6Y A;  4PNO A;  4Y28 E;  3G7Z A;  4ZTJ A;  1M90 U;  2R5A A;  3CCE T;  2DPP B;  3FLG A;  5DY9 A;  5D6W A;  4XU1 A;  3OYG A;  1YIT T;  3URG A;  5GAN j;  1N8R U;  4E7K A;  3M9Q A;  3CMA T;  5GMK l;  2OAU A;  5KH6 A;  2JUF A;  3OSV A;  2XI9 A;  2X35 A;  2CKK A;  3L2W A;  4M6V A;  1X75 C;  2RO0 A;  2RHI A;  5GMK j;  3CCU A;  4PLL A;  4JRP A;  1UGP B;  4J83 A;  2HQE A;  2GF7 A;  1ZQ1 A;  2JTF A;  4M78 F;  5HK3 A;  1VQN T;  2BS2 A;  4M7A F;  5CR2 A;  2D9T A;  5GMK m;  4JRQ A;  2EQM A;  4M75 G;  4BDY A;  2M0O A;  4M75 A;  2DJZ A;  1HK9 A;  4XTX A;  3MEU A;  2RHU A;  1M1F A;  2A7Y A;  4J7I A;  2EQU A;  2LCL A;  2L5Q A;  4BY6 B;  3PGG A;  1Q7Y C;  5I21 A;  2DEQ A;  3RES A;  5KCO A;  2XHC A;  3CPF A;  3CCR A;  2LQ8 A;  4OF1 A;  4QVC A;  4C8Q E;  3JCM b;  2FHD A;  3CC7 A;  2JTM A;  4PJO F;  2YHT A;  1JJ2 A;  5GAN g;  3ME9 A;  2X4W A;  4N0A A;  5CKF A;  4LDX A;  2RHZ A;  1UGQ B;  1KHC A;  2DIG A;  3PMI A;  4J6X A;  3MCA B;  4M7A B;  5FRN A;  4AKI A;  3QJ6 A;  1VQP A;  3BDU A;  4YTL A;  1NPR A;  1H64 1;  2F69 A;  4F7U F;  4F7U G;  3VV0 A;  2K3X A;  2FB7 A;  2X4J A;  3JAM E;  2C06 A;  2L8D A;  1GXI E;  1VQM A;  2DD4 A;  2EQK A;  2RJC A;  4J6W A;  3LGL A;  1U1T A;  1BIA A;  1WJS A;  3EFS A;  5CKE A;  4Y91 A;  4RG2 A;  1ZBX A;  4X9C A;  5CK9 A;  4LD9 K;  1VQK T;  3GIB A;  1VQ9 A;  1DJ7 B;  3HKS A;  2M1H A;  1Y7X A;  4DOV A;  2QA4 A;  2A3L A;  5CAI A;  2EFI A;  4KUI A;  2VV5 A;  2QEX A;  5LJ3 j;  3A8H B;  2Y4Y A;  4NC6 A;  4M75 D;  3NTK A;  5LJ3 e;  3CCJ A;  3GPL A;  3JB9 F;  2FVU A;  2CZ1 B;  5A0D A;  3JB9 J;  3FB9 A;  1VQL A;  2ZPI B;  3OYD A;  3OA6 A;  2GFA A;  3JRZ A;  4N4I A;  2QEX T;  2MF2 A;  4BDZ A;  1VQ6 T;  5CQY A;  3I55 A;  3INZ A;  5GAM d;  1YJN A;  1K8A U;  3FIF A;  4KT0 E;  1JBM A;  2K3Y A;  4PKC C;  3OYE A;  2E6N A;  5GAN 5;  3TCJ A;  1W2B S;  4BE1 A;  3JCM P;  3CME T;  5GMK h;  3V7C A;  4PJO E;  2X4X A;  2ZPB B;  1FKM A;  4C8Q F;  3EFR A;  2RHX A;  5LJ5 g;  4HT9 A;  3QZ5 B;  4L5G A;  4MZM A;  1I5L A;  3FC3 A;  2RHY A;  2XK0 A;  1UGR B;  1FXX A;  3M56 A;  3M54 A;  4C5I A;  3CCV T;  1N8R C;  3C95 A;  1YIJ A;  3JCM d;  5GAM j;  4X34 A;  1YHQ A;  3L42 A;  4JX5 A;  1KQ1 A;  5J39 A;  3RIR A;  3CMA A;  2OTJ A;  4C8Q D;  4JX4 A;  3VKI A;  1G3S A;  2DZC A;  4XU2 A;  2R58 A;  4ELY C;  3X24 B;  3VKH A;  3DLM A;  2VYT A;  3LLR A;  3QO3 A;  1UB4 A;  4L59 A;  4BI8 B;  4D6W A;  4QW2 A;  1BI2 A;  4M78 A;  3SB2 A;  1BIB A;  2O01 E;  2D0Q B;  4M78 G;  3LWH A;  2G3R A;  3TRE A;  4M7A A;  1U1S A;  1K73 U;  3TW7 A;  3HSB A;  1BYM A;  5IN1 A;  4M7D B;  3N5B B;  2OTL A;  1LJO A;  4UC4 A;  2D6F A;  1FX7 A;  3LYI A;  3KHI A;  2E12 A;  3BW1 A;  3MET A;  4C5E A;  4M7D C;  3QUI A;  3JB9 I;  1VQN A;  4ATO A;  5EJC A;  4C92 B;  1OI1 A;  3X20 B;  1JRI A;  1OYX A;  5CKB A;  2MWP A;  1QVG S;  3PFS A;  4ME7 A;  4RG8 A;  5GMK i;  4QVD A;  2M9U A;  5GAO l;  3WVD B;  3JB9 H;  4M77 G;  2RJD A;  3F70 A;  2RI3 A;  4MZP A;  5GAN 3;  3CBP A;  2XG8 D;  3DLL A;  4PJO A;  2BS3 A;  4XAX B;  2CYZ B;  2R5M A;  2LTO A;  3OYK A;  2XDP A;  4JRK A;  3HB9 A;  2VXE A;  3OS5 A;  2QQ9 A;  4EMK C;  4DQ2 A;  3CPW S;  3V7S A;  1QVF A;  5EG2 A;  3P8H A;  3JB9 G;  3OW2 S;  1BI1 A;  2PVG B;  2VGN A;  1KG1 A;  2XDD A;  2MMP A;  2DXB A;  3CC7 T;  4MML A;  4F7U E;  4P5N A;  2WSC E;  3V8L A;  2LT1 A;  2KY9 A;  5A2Q E;  1YIT A;  3KXT A;  3CC2 T;  3MO8 A;  2DXB B;  2PUO B;  3MEW A;  2XKO C;  3NTH A;  5GAM g;  2EJ9 A;  2R57 A;  3CCM A;  3LX7 A;  2F5K A;  5LJ3 g;  5GAN d;  2E65 A;  1YIJ T;  1HXD A;  2RD1 A;  3CEY A;  1Q81 U;  5GAO m;  2RJE A;  4OB2 B;  2LX9 A;  4FT4 A;  4BI4 A;  3GOX A;  1KC8 U;  4XTV A;  4PJO D;  2KDS A;  4BUG A;  3PMT A;  1QVG A;  1VIE A;  4FIB A;  2BKD N;  3JCM g;  1JB0 E;  1NE8 A;  1W4S A;  4M78 C;  3PIO A;  3CCL T;  2E6Z A;  2B8A A;  4M78 B;  4IUR A;  1UEB A;  4RCB A;  4E7I A;  2MI6 A;  3E19 A;  3VYG A;  2EYQ A;  4II1 A;  5FRO A;  3OS0 A;  2QA4 T;  1VQ6 A;  3GF5 A;  5GMK e;  2LC4 A;  2JN0 A;  2DTH A;  4BD3 A;  1K9M C;  2QXF A;  3OMG A;  5GAM h;  1PSE A;  4HNU A;  4M7A D;  4LOC A;  2K5L A;  3OYN A;  3E9F A;  4M7A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...