2UZDB

Crystal structure of human cdk2 complexed with a thiazolidinone inhibitor
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Discovery of a Potent Cdk2 Inhibitor with a Novel Binding Mode, Using Virtual Screening and Initial, Structure-Guided Lead Scoping.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2uzdB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2uzdB02
4BCPB 2B9RA 4I3ZB 2V22B 4EOJB 4EOLB 1VYWB 4CXAB 3F5XB 3O0GD 4BCQB 4BCIB 4BCNB 4EOKB 4F6WB 1OKWB 3G33B 1JSTB 1P5EB 1OL2B 1GH6B 2W9ZA 4YOOA 3DDQB 3DOGB 5HBJB 2UUEB 1JOWA 4EC8B 1H24B 5EFQB 4CFUB 4F7SB 4Y72B 3BLHB 4IMYB 4BCQD 4BCND 4F6SB 1JSUB 1N4MA 4YOSA 3TNHB 1FVVB 4BCMB 3MIAB 3MY5B 3TN8B 2G9XB 5LQFB 3EJ1B 2IW8B 1XO2A 4EOSB 5IDNB 5IF1B 2UZDB 1O9KB 2W9FA 4CFUD 1OI9B 4BCOB 1VINA 2CCHB 4F7JB 2BKZB 2F2CA 4EC9B 3LQ5B 2R7GA 4BCMD 1E9HB 1OIYB 4YC3B 1GY3B 3DDPB 3RGFB 3TNIB 4BCGB 1H4LD 2I40B 4EONB 1H26B 2C5OB 1VOLA 4OGRB 1H1QB 5HBHB 1OL1B 2WIPB 4EOOB 1F5QB 5FGKB 2EUFA 3BHUB 4EOQB 1H1PB 2PK9B 3BHVB 4BCKB 2WXVB 2C6TB 1C9BA 2X1NB 3H4CA 4CFMB 4BCJB 2UZLB 2W96A 1UNHD 4F7LB 2UZEB 4F7NB 2WEVB 2CJMB 4F6UB 1OGUB 1QMZB 5CYIB 2WMBB 2WMAB 5HNBB 4KRCB 4YOZA 3TNWB 2WHBB 1AD6A 4ELJA 1UNGD 4CFVB 2IW9B 3BLQB 2C5VB 4UN0A 1H1RB 1H27B 2JGZB 2WFYB 5LMKB 4RODA 1G3NC 2PMIB 2UZBB 1TFBA 1PKDB 4KRDB 4CFNB 5CEIB 5ACBA 3EOCB 4G6LB 2W2HA 4ELLA 4EOIB 1H25B 1GUXA 2BPMB 3BHTB 1O9KA 3QHRB 4II5B 4ROEA 5HVYB 2C5XB 3MY1B 2IVXA 2QDJA 4CFWB 1OKVB 4CFXB 3QHWB 1JKWA 5HQ0B 1D3UB 4BCFB 3BLRB 2C5NB 1KXUA 3POMA 5HBEB 1OIUB 4FX3B 4ROCA 4EOPB 5ICPB 1URCB 1BU2A 1ZP2A 2C4GB 3EIDB 4OR5B 4NSTB 5IDPB 2WPAB 1H1SB 2IW6B 1AISB 2PK2A 4EORB 2PHGA 4BCHB 2I53A 2WIHB 5BNJB 3M03A 2W99A 1W98B 2CCIB 5L2WB 1FINB 4CRLB 1GUXB 1H28B 5I5ZB 1UNLD 4TTHA 3K7AM 4EOMB 4F70B 3MI9B
chains in the Genus database with same CATH superfamily
3QYGB 3O0GD 4HL4A 3HBLA 2ZCFB 4F6WB 1QLBA 3G33B 1JSTB 2W9ZA 1OL2B 1GH6B 3DDQB 2UUEB 1H24B 4HLQA 3BLHB 4IMYB 3QWLA 4BCND 3BG9A 4YOSA 3TNHB 4BCMB 3EJ1B 1XO2A 3VYHB 4BBSM 1OI9B 4BCOB 4F7JB 3GTMS 1OIYB 4BCGB 3RGFB 2CZ6B 3WVDB 3PO3S 1VOLA 5HBHB 2WIPB 4EOOB 4ZGJB 1F5QB 2ZPEB 4FM4B 3BHVB 4BCKB 2WXVB 4CFMB 4BCJB 4AKIA 1UNHD 2UZEB 2WEVB 5CYIB 2WMAB 2ZZDB 4ELJA 4CFVB 3BLQB 4OB3B 2C5VB 2JGZB 4RODA 2CZ1B 5ACBA 2ZPBB 2W2HA 1TD6A 1AHJB 1H25B 4ROEA 5HVYB 2QDJA 4MIMA 3X24B 2QGSA 3X28B 1OIUB 4FX3B 5ICPB 2BS4A 2C4GB 1ENWA 4NSTB 2CZ0B 5IDPB 2ZPHB 2QQ8A 2PHGA 3M03A 5L2WB 1W98B 2CCIB 4ZGEB 4M6VA 5DQWA 3DTOA 2B9RA 4I3ZB 3BG3A 4BCIB 4EOKB 3B57A 5HBJB 3VKHA 4Z6YA 4EC8B 4CFUB 3QYHB 2DD5B 1V29B 1UGPB 1N4MA 3HB9A 1FVVB 3TN8B 5LQFB 5IF1B 2G77A 4AKGA 3LQ5B 2R7GA 3A8LB 4BCMD 3TNIB 2I40B 5EJCA 4OGRB 3DJBA 4BBRM 3BHUB 2CYZB 2UZLB 2ZPGB 2WMBB 4KRCB 1UGQB 1AD6A 2D0QB 3QYBA 2CZ7B 1E7PA 3WVEB 1H1RB 1H27B 2WFYB 1G3NC 2PMIB 4BXXX 1PKDB 3EOCB 4G6LB 4EOIB 3BHTB 1O9KA 2C5XB 3QZ9B 3BG5A 4BCFB 3BLRB 3TW7A 5HBEB 4MFDA 1ZP2A 1BU2A 4MFEA 3KHIA 1UGSB 2I53A 3HHTB 5BNJB 4CRLB 3K7AM 4EOMB 4BCPB 2ZPIB 2V22B 3X20B 1VYWB 4CXAB 4BCQB 2DXBB 2DXCB 4OB1B 1OKWB 2AHJB 3DOGB 5EFQB 4Y72B 1JSUB 2KMGA 3MIAB 3MY5B 2G9XB 2KR6A 4AKHA 5IDNB 4CFUD 3A8HB 2PJQA 2F2CA 3VKGA 3DDPB 1H4LD 4EONB 1H26B 2C5OB 1H1QB 2WJ9A 5FGKB 2EUFA 4EOQB 1H1PB 1C9BA 3QZ5B 3H4CA 4ZGDB 2W96A 4F7LB 1OGUB 1QMZB 2IN3A 3TNWB 4HNTA 4UN0A 5LMKB 4KRDB 4CFNB 1GUXA 2BPMB 3QHRB 4II5B 5DQVA 3MY1B 3A8OB 3TW6A 1FKMA 4CFXB 3QHWB 5HQ0B 2C5NB 4ROCA 3X26B 1URCB 3A8MB 3EIDB 4OR5B 2WPAB 3A8GB 2IW6B 4OB2B 4OB0B 2PK2A 4EORB 4BCHB 2QF7A 4HNUA 1GUXB 5I5ZB 1UNLD 4TTHA 4F70B 3MI9B 1IREB 4EOJB 4EOLB 3F5XB 4QSHA 4BY1X 4BCNB 1P5EB 4YOOA 2QFZA 1JOWA 4F7SB 4BCQD 4F6SB 2IW8B 4EOSB 2DMEA 2UZDB 1O9KB 2W9FA 4JX6A 1VINA 2CCHB 2BKZB 4EC9B 5IHYA 1E9HB 4YC3B 1GY3B 2BS2A 1OL1B 2DPPB 4JX4A 2PK9B 4JX5A 2C6TB 2X1NB 3HZJA 4F7NB 4BY7X 2QDYB 2CJMB 4HNVA 2BS3A 2ZPFB 4F6UB 5HNBB 3DL1A 4YOZA 2WHBB 1UNGD 2IW9B 2UZBB 1TFBA 5CEIB 4ELLA 4AI6A 2IVXA 3X25B 4CFWB 1OKVB 1JKWA 4LOCA 1D3UB 1KXUA 3POMA 4NC6A 4EOPB 1H1SB 2LW4A 3QYEA 1AISB 2DD4B 2WIHB 3HO8A 3QXEB 2W99A 1FINB 3VYGB 1H28B 1UGRB 3NDQA
chains in the Genus database with same CATH topology
4BCPB 2B9RA 4I3ZB 2V22B 4EOJB 4EOLB 1VYWB 4CXAB 3F5XB 3O0GD 4BCQB 4BCIB 4BCNB 4EOKB 4F6WB 1OKWB 3G33B 1JSTB 1P5EB 1OL2B 1GH6B 2W9ZA 4YOOA 3DDQB 3DOGB 5HBJB 2UUEB 1JOWA 4EC8B 1H24B 5EFQB 4CFUB 4F7SB 4Y72B 3BLHB 4IMYB 4BCQD 4BCND 4F6SB 1JSUB 1N4MA 4YOSA 3TNHB 1FVVB 4BCMB 3MIAB 3MY5B 3TN8B 2G9XB 5LQFB 3EJ1B 2IW8B 1XO2A 4EOSB 5IDNB 5IF1B 2UZDB 1O9KB 2W9FA 4CFUD 1OI9B 4BCOB 1VINA 2CCHB 4F7JB 2BKZB 2F2CA 4EC9B 3LQ5B 2R7GA 4BCMD 1E9HB 1OIYB 4YC3B 1GY3B 3DDPB 3RGFB 3TNIB 4BCGB 1H4LD 2I40B 4EONB 1H26B 2C5OB 1VOLA 4OGRB 1H1QB 5HBHB 1OL1B 2WIPB 4EOOB 1F5QB 5FGKB 2EUFA 3BHUB 4EOQB 1H1PB 2PK9B 3BHVB 4BCKB 2WXVB 2C6TB 1C9BA 2X1NB 3H4CA 4CFMB 4BCJB 2UZLB 2W96A 1UNHD 4F7LB 2UZEB 4F7NB 2WEVB 2CJMB 4F6UB 1OGUB 1QMZB 5CYIB 2WMBB 2WMAB 5HNBB 4KRCB 4YOZA 3TNWB 2WHBB 1AD6A 4ELJA 1UNGD 4CFVB 2IW9B 3BLQB 2C5VB 4UN0A 1H1RB 1H27B 2JGZB 2WFYB 5LMKB 4RODA 1G3NC 2PMIB 2UZBB 1TFBA 1PKDB 4KRDB 4CFNB 5CEIB 5ACBA 3EOCB 4G6LB 2W2HA 4ELLA 4EOIB 1H25B 1GUXA 2BPMB 3BHTB 1O9KA 3QHRB 4II5B 4ROEA 5HVYB 2C5XB 3MY1B 2IVXA 2QDJA 4CFWB 1OKVB 4CFXB 3QHWB 1JKWA 5HQ0B 1D3UB 4BCFB 3BLRB 2C5NB 1KXUA 3POMA 5HBEB 1OIUB 4FX3B 4ROCA 4EOPB 5ICPB 1URCB 1BU2A 1ZP2A 2C4GB 3EIDB 4OR5B 4NSTB 5IDPB 2WPAB 1H1SB 2IW6B 1AISB 2PK2A 4EORB 2PHGA 4BCHB 2I53A 2WIHB 5BNJB 3M03A 2W99A 1W98B 2CCIB 5L2WB 1FINB 4CRLB 1GUXB 1H28B 5I5ZB 1UNLD 4TTHA 3K7AM 4EOMB 4F70B 3MI9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCP B;  2B9R A;  4I3Z B;  2V22 B;  4EOJ B;  4EOL B;  1VYW B;  4CXA B;  3F5X B;  3O0G D;  4BCQ B;  4BCI B;  4BCN B;  4EOK B;  4F6W B;  1OKW B;  3G33 B;  1JST B;  1P5E B;  1OL2 B;  1GH6 B;  2W9Z A;  4YOO A;  3DDQ B;  3DOG B;  5HBJ B;  2UUE B;  1JOW A;  4EC8 B;  1H24 B;  5EFQ B;  4CFU B;  4F7S B;  4Y72 B;  3BLH B;  4IMY B;  4BCQ D;  4BCN D;  4F6S B;  1JSU B;  1N4M A;  4YOS A;  3TNH B;  1FVV B;  4BCM B;  3MIA B;  3MY5 B;  3TN8 B;  2G9X B;  5LQF B;  3EJ1 B;  2IW8 B;  1XO2 A;  4EOS B;  5IDN B;  5IF1 B;  2UZD B;  1O9K B;  2W9F A;  4CFU D;  1OI9 B;  4BCO B;  1VIN A;  2CCH B;  4F7J B;  2BKZ B;  2F2C A;  4EC9 B;  3LQ5 B;  2R7G A;  4BCM D;  1E9H B;  1OIY B;  4YC3 B;  1GY3 B;  3DDP B;  3RGF B;  3TNI B;  4BCG B;  1H4L D;  2I40 B;  4EON B;  1H26 B;  2C5O B;  1VOL A;  4OGR B;  1H1Q B;  5HBH B;  1OL1 B;  2WIP B;  4EOO B;  1F5Q B;  5FGK B;  2EUF A;  3BHU B;  4EOQ B;  1H1P B;  2PK9 B;  3BHV B;  4BCK B;  2WXV B;  2C6T B;  1C9B A;  2X1N B;  3H4C A;  4CFM B;  4BCJ B;  2UZL B;  2W96 A;  1UNH D;  4F7L B;  2UZE B;  4F7N B;  2WEV B;  2CJM B;  4F6U B;  1OGU B;  1QMZ B;  5CYI B;  2WMB B;  2WMA B;  5HNB B;  4KRC B;  4YOZ A;  3TNW B;  2WHB B;  1AD6 A;  4ELJ A;  1UNG D;  4CFV B;  2IW9 B;  3BLQ B;  2C5V B;  4UN0 A;  1H1R B;  1H27 B;  2JGZ B;  2WFY B;  5LMK B;  4ROD A;  1G3N C;  2PMI B;  2UZB B;  1TFB A;  1PKD B;  4KRD B;  4CFN B;  5CEI B;  5ACB A;  3EOC B;  4G6L B;  2W2H A;  4ELL A;  4EOI B;  1H25 B;  1GUX A;  2BPM B;  3BHT B;  1O9K A;  3QHR B;  4II5 B;  4ROE A;  5HVY B;  2C5X B;  3MY1 B;  2IVX A;  2QDJ A;  4CFW B;  1OKV B;  4CFX B;  3QHW B;  1JKW A;  5HQ0 B;  1D3U B;  4BCF B;  3BLR B;  2C5N B;  1KXU A;  3POM A;  5HBE B;  1OIU B;  4FX3 B;  4ROC A;  4EOP B;  5ICP B;  1URC B;  1BU2 A;  1ZP2 A;  2C4G B;  3EID B;  4OR5 B;  4NST B;  5IDP B;  2WPA B;  1H1S B;  2IW6 B;  1AIS B;  2PK2 A;  4EOR B;  2PHG A;  4BCH B;  2I53 A;  2WIH B;  5BNJ B;  3M03 A;  2W99 A;  1W98 B;  2CCI B;  5L2W B;  1FIN B;  4CRL B;  1GUX B;  1H28 B;  5I5Z B;  1UNL D;  4TTH A;  3K7A M;  4EOM B;  4F70 B;  3MI9 B; 
#chains in the Genus database with same CATH topology
 3QYG B;  3O0G D;  4HL4 A;  3HBL A;  2ZCF B;  4F6W B;  1QLB A;  3G33 B;  1JST B;  2W9Z A;  1OL2 B;  1GH6 B;  3DDQ B;  2UUE B;  1H24 B;  4HLQ A;  3BLH B;  4IMY B;  3QWL A;  4BCN D;  3BG9 A;  4YOS A;  3TNH B;  4BCM B;  3EJ1 B;  1XO2 A;  3VYH B;  4BBS M;  1OI9 B;  4BCO B;  4F7J B;  3GTM S;  1OIY B;  4BCG B;  3RGF B;  2CZ6 B;  3WVD B;  3PO3 S;  1VOL A;  5HBH B;  2WIP B;  4EOO B;  4ZGJ B;  1F5Q B;  2ZPE B;  4FM4 B;  3BHV B;  4BCK B;  2WXV B;  4CFM B;  4BCJ B;  4AKI A;  1UNH D;  2UZE B;  2WEV B;  5CYI B;  2WMA B;  2ZZD B;  4ELJ A;  4CFV B;  3BLQ B;  4OB3 B;  2C5V B;  2JGZ B;  4ROD A;  2CZ1 B;  5ACB A;  2ZPB B;  2W2H A;  1TD6 A;  1AHJ B;  1H25 B;  4ROE A;  5HVY B;  2QDJ A;  4MIM A;  3X24 B;  2QGS A;  3X28 B;  1OIU B;  4FX3 B;  5ICP B;  2BS4 A;  2C4G B;  1ENW A;  4NST B;  2CZ0 B;  5IDP B;  2ZPH B;  2QQ8 A;  2PHG A;  3M03 A;  5L2W B;  1W98 B;  2CCI B;  4ZGE B;  4M6V A;  5DQW A;  3DTO A;  2B9R A;  4I3Z B;  3BG3 A;  4BCI B;  4EOK B;  3B57 A;  5HBJ B;  3VKH A;  4Z6Y A;  4EC8 B;  4CFU B;  3QYH B;  2DD5 B;  1V29 B;  1UGP B;  1N4M A;  3HB9 A;  1FVV B;  3TN8 B;  5LQF B;  5IF1 B;  2G77 A;  4AKG A;  3LQ5 B;  2R7G A;  3A8L B;  4BCM D;  3TNI B;  2I40 B;  5EJC A;  4OGR B;  3DJB A;  4BBR M;  3BHU B;  2CYZ B;  2UZL B;  2ZPG B;  2WMB B;  4KRC B;  1UGQ B;  1AD6 A;  2D0Q B;  3QYB A;  2CZ7 B;  1E7P A;  3WVE B;  1H1R B;  1H27 B;  2WFY B;  1G3N C;  2PMI B;  4BXX X;  1PKD B;  3EOC B;  4G6L B;  4EOI B;  3BHT B;  1O9K A;  2C5X B;  3QZ9 B;  3BG5 A;  4BCF B;  3BLR B;  3TW7 A;  5HBE B;  4MFD A;  1ZP2 A;  1BU2 A;  4MFE A;  3KHI A;  1UGS B;  2I53 A;  3HHT B;  5BNJ B;  4CRL B;  3K7A M;  4EOM B;  4BCP B;  2ZPI B;  2V22 B;  3X20 B;  1VYW B;  4CXA B;  4BCQ B;  2DXB B;  2DXC B;  4OB1 B;  1OKW B;  2AHJ B;  3DOG B;  5EFQ B;  4Y72 B;  1JSU B;  2KMG A;  3MIA B;  3MY5 B;  2G9X B;  2KR6 A;  4AKH A;  5IDN B;  4CFU D;  3A8H B;  2PJQ A;  2F2C A;  3VKG A;  3DDP B;  1H4L D;  4EON B;  1H26 B;  2C5O B;  1H1Q B;  2WJ9 A;  5FGK B;  2EUF A;  4EOQ B;  1H1P B;  1C9B A;  3QZ5 B;  3H4C A;  4ZGD B;  2W96 A;  4F7L B;  1OGU B;  1QMZ B;  2IN3 A;  3TNW B;  4HNT A;  4UN0 A;  5LMK B;  4KRD B;  4CFN B;  1GUX A;  2BPM B;  3QHR B;  4II5 B;  5DQV A;  3MY1 B;  3A8O B;  3TW6 A;  1FKM A;  4CFX B;  3QHW B;  5HQ0 B;  2C5N B;  4ROC A;  3X26 B;  1URC B;  3A8M B;  3EID B;  4OR5 B;  2WPA B;  3A8G B;  2IW6 B;  4OB2 B;  4OB0 B;  2PK2 A;  4EOR B;  4BCH B;  2QF7 A;  4HNU A;  1GUX B;  5I5Z B;  1UNL D;  4TTH A;  4F70 B;  3MI9 B;  1IRE B;  4EOJ B;  4EOL B;  3F5X B;  4QSH A;  4BY1 X;  4BCN B;  1P5E B;  4YOO A;  2QFZ A;  1JOW A;  4F7S B;  4BCQ D;  4F6S B;  2IW8 B;  4EOS B;  2DME A;  2UZD B;  1O9K B;  2W9F A;  4JX6 A;  1VIN A;  2CCH B;  2BKZ B;  4EC9 B;  5IHY A;  1E9H B;  4YC3 B;  1GY3 B;  2BS2 A;  1OL1 B;  2DPP B;  4JX4 A;  2PK9 B;  4JX5 A;  2C6T B;  2X1N B;  3HZJ A;  4F7N B;  4BY7 X;  2QDY B;  2CJM B;  4HNV A;  2BS3 A;  2ZPF B;  4F6U B;  5HNB B;  3DL1 A;  4YOZ A;  2WHB B;  1UNG D;  2IW9 B;  2UZB B;  1TFB A;  5CEI B;  4ELL A;  4AI6 A;  2IVX A;  3X25 B;  4CFW B;  1OKV B;  1JKW A;  4LOC A;  1D3U B;  1KXU A;  3POM A;  4NC6 A;  4EOP B;  1H1S B;  2LW4 A;  3QYE A;  1AIS B;  2DD4 B;  2WIH B;  3HO8 A;  3QXE B;  2W99 A;  1FIN B;  3VYG B;  1H28 B;  1UGR B;  3NDQ A; 
#chains in the Genus database with same CATH homology
 4BCP B;  2B9R A;  4I3Z B;  2V22 B;  4EOJ B;  4EOL B;  1VYW B;  4CXA B;  3F5X B;  3O0G D;  4BCQ B;  4BCI B;  4BCN B;  4EOK B;  4F6W B;  1OKW B;  3G33 B;  1JST B;  1P5E B;  1OL2 B;  1GH6 B;  2W9Z A;  4YOO A;  3DDQ B;  3DOG B;  5HBJ B;  2UUE B;  1JOW A;  4EC8 B;  1H24 B;  5EFQ B;  4CFU B;  4F7S B;  4Y72 B;  3BLH B;  4IMY B;  4BCQ D;  4BCN D;  4F6S B;  1JSU B;  1N4M A;  4YOS A;  3TNH B;  1FVV B;  4BCM B;  3MIA B;  3MY5 B;  3TN8 B;  2G9X B;  5LQF B;  3EJ1 B;  2IW8 B;  1XO2 A;  4EOS B;  5IDN B;  5IF1 B;  2UZD B;  1O9K B;  2W9F A;  4CFU D;  1OI9 B;  4BCO B;  1VIN A;  2CCH B;  4F7J B;  2BKZ B;  2F2C A;  4EC9 B;  3LQ5 B;  2R7G A;  4BCM D;  1E9H B;  1OIY B;  4YC3 B;  1GY3 B;  3DDP B;  3RGF B;  3TNI B;  4BCG B;  1H4L D;  2I40 B;  4EON B;  1H26 B;  2C5O B;  1VOL A;  4OGR B;  1H1Q B;  5HBH B;  1OL1 B;  2WIP B;  4EOO B;  1F5Q B;  5FGK B;  2EUF A;  3BHU B;  4EOQ B;  1H1P B;  2PK9 B;  3BHV B;  4BCK B;  2WXV B;  2C6T B;  1C9B A;  2X1N B;  3H4C A;  4CFM B;  4BCJ B;  2UZL B;  2W96 A;  1UNH D;  4F7L B;  2UZE B;  4F7N B;  2WEV B;  2CJM B;  4F6U B;  1OGU B;  1QMZ B;  5CYI B;  2WMB B;  2WMA B;  5HNB B;  4KRC B;  4YOZ A;  3TNW B;  2WHB B;  1AD6 A;  4ELJ A;  1UNG D;  4CFV B;  2IW9 B;  3BLQ B;  2C5V B;  4UN0 A;  1H1R B;  1H27 B;  2JGZ B;  2WFY B;  5LMK B;  4ROD A;  1G3N C;  2PMI B;  2UZB B;  1TFB A;  1PKD B;  4KRD B;  4CFN B;  5CEI B;  5ACB A;  3EOC B;  4G6L B;  2W2H A;  4ELL A;  4EOI B;  1H25 B;  1GUX A;  2BPM B;  3BHT B;  1O9K A;  3QHR B;  4II5 B;  4ROE A;  5HVY B;  2C5X B;  3MY1 B;  2IVX A;  2QDJ A;  4CFW B;  1OKV B;  4CFX B;  3QHW B;  1JKW A;  5HQ0 B;  1D3U B;  4BCF B;  3BLR B;  2C5N B;  1KXU A;  3POM A;  5HBE B;  1OIU B;  4FX3 B;  4ROC A;  4EOP B;  5ICP B;  1URC B;  1BU2 A;  1ZP2 A;  2C4G B;  3EID B;  4OR5 B;  4NST B;  5IDP B;  2WPA B;  1H1S B;  2IW6 B;  1AIS B;  2PK2 A;  4EOR B;  2PHG A;  4BCH B;  2I53 A;  2WIH B;  5BNJ B;  3M03 A;  2W99 A;  1W98 B;  2CCI B;  5L2W B;  1FIN B;  4CRL B;  1GUX B;  1H28 B;  5I5Z B;  1UNL D;  4TTH A;  3K7A M;  4EOM B;  4F70 B;  3MI9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...