2UUEB

Replace: a strategy for iterative design of cyclin binding groove inhibitors
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Replace: A Strategy for Iterative Design of Cyclin- Binding Groove Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2uueB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2uueB02
4Y72B 4YOSA 4OGRB 2BKZB 1JOWA 5EFQB 2I53A 1UNGD 2PK9B 4BCKB 5LQFB 2W99A 1TFBA 1GUXB 2WHBB 2WIHB 4EORB 5HBEB 1BU2A 3TNIB 2UZLB 4BCMB 3BHVB 1OL1B 4CXAB 2G9XB 1PKDB 1H1SB 1OKVB 5IDPB 2W2HA 2CCHB 3DOGB 3BLHB 3M03A 2C5VB 2IW8B 3TNHB 4BCNB 5HQ0B 4EOLB 4I3ZB 4CFUD 5LMKB 3TNWB 1O9KA 2UZBB 2WEVB 2UZEB 1W98B 4YOZA 4BCPB 4KRCB 2WFYB 4F7JB 5BNJB 2CCIB 2WXVB 1QMZB 1OL2B 5CEIB 3EJ1B 4EOKB 4F6SB 5ICPB 1GUXA 4EOOB 4ROCA 1H1QB 1VOLA 4CFUB 3BHUB 2IW6B 2C4GB 3BLQB 4F6UB 2W9FA 1GY3B 4FX3B 4EC9B 1KXUA 5HBJB 2PK2A 4BCOB 1JSUB 1E9HB 1OIYB 4BCGB 1JKWA 3EOCB 1H1PB 3MY5B 1OIUB 1H1RB 3H4CA 4KRDB 4BCJB 2BPMB 4ELJA 1UNLD 1C9BA 1H28B 1N4MA 3RGFB 4F6WB 4BCHB 4ELLA 5HNBB 5HVYB 2EUFA 1OI9B 4YC3B 4CFVB 3EIDB 3QHRB 1FINB 2F2CA 1AISB 4EOPB 1H25B 1AD6A 4RODA 1H24B 1FVVB 1VYWB 2QDJA 4F70B 4CRLB 2UZDB 1P5EB 2C5NB 4EOMB 5FGKB 2C5XB 3BHTB 3G33B 4CFNB 4CFWB 4CFMB 3K7AM 2WMBB 4YOOA 4EOIB 2W9ZA 1D3UB 1H26B 3TN8B 2CJMB 2V22B 4BCIB 4EOJB 5ACBA 2UUEB 1JSTB 1ZP2A 2W96A 5HBHB 4G6LB 5I5ZB 2WIPB 4ROEA 1XO2A 3F5XB 4EONB 2R7GA 3MY1B 1URCB 3DDPB 1H27B 2C6TB 2C5OB 3LQ5B 3QHWB 4BCQD 4BCFB 3POMA 4EOQB 4BCND 4F7SB 3BLRB 5CYIB 2B9RA 2WPAB 1F5QB 2IW9B 4TTHA 3MI9B 2IVXA 5L2WB 5IDNB 1OGUB 1VINA 1GH6B 2PMIB 2X1NB 4IMYB 4EC8B 3DDQB 1UNHD 2WMAB 1G3NC 4EOSB 4NSTB 5IF1B 1H4LD 1OKWB 4OR5B 2I40B 4II5B 3O0GD 3MIAB 2PHGA 4BCQB 4F7LB 4F7NB 4CFXB 2JGZB 4UN0A 1O9KB 4BCMD
chains in the Genus database with same CATH superfamily
2BKZB 1JOWA 4BXXX 4BY1X 3QXEB 1GUXB 4ZGDB 5HBEB 1BU2A 3QYBA 4CXAB 2G9XB 1E7PA 1PKDB 1H1SB 5IDPB 4OB2B 2DMEA 2BS3A 4I3ZB 4HNUA 4CFUD 2QDYB 2CYZB 4YOZA 5BNJB 4OB0B 4OB3B 4BY7X 3A8GB 4EOOB 1H1QB 4CFUB 2W9FA 3X28B 2D0QB 5HBJB 1UGSB 3TW7A 3QWLA 4BCGB 1JKWA 4HLQA 4HNVA 1H1RB 3DJBA 4F6WB 4AKIA 5HNBB 5HVYB 3QZ5B 4CFVB 1H25B 4RODA 4QSHA 2QDJA 4CRLB 2ZPGB 3HO8A 2C5XB 4CFNB 4EOIB 2V22B 2LW4A 5HBHB 2WJ9A 4G6LB 5I5ZB 2WIPB 4JX5A 4AKGA 4F7SB 2DD4B 4M6VA 5IDNB 1OGUB 4NSTB 2DXBB 4F7NB 2DD5B 4YOSA 2QF7A 2DPPB 3QYGB 2I53A 1UNGD 1UGPB 3VKGA 2WHBB 2WIHB 4EORB 3TNIB 2UZLB 1OL1B 2CCHB 3DOGB 3QZ9B 3B57A 2CZ1B 3TNWB 2WEVB 3A8LB 2WXVB 1QMZB 3A8HB 3EJ1B 4EOKB 3NDQA 2IW6B 2C4GB 3BLQB 4F6UB 4FX3B 2PK2A 4BCOB 4HNTA 1JSUB 3EOCB 1H1PB 3MY5B 4BCJB 1AHJB 1IREB 4BCHB 4ZGEB 4EOPB 1V29B 1VYWB 2KR6A 2UZDB 2C5NB 4EOMB 5FGKB 3G33B 5DQVA 1D3UB 4BCIB 4HL4A 1JSTB 4AI6A 2AHJB 1XO2A 3F5XB 3HZJA 4EONB 1H27B 2ZPIB 3POMA 4BCND 3TW6A 2IW9B 2IVXA 4EC8B 1GH6B 4IMYB 2WMAB 4ZGJB 4OR5B 2PHGA 3HHTB 2ZPEB 4F7LB 2JGZB 4OB1B 1UGRB 4BBSM 2QQ8A 2PK9B 1TFBA 3X20B 2ZZDB 1OKVB 3VYHB 2C5VB 2BS2A 3TNHB 3KHIA 5LMKB 1O9KA 2UZBB 2UZEB 1W98B 3X25B 4KRCB 3DTOA 4Z6YA 3HBLA 4MFEA 5ICPB 1GUXA 1VOLA 3BHUB 1GY3B 4EC9B 2CZ7B 1E9HB 4ELJA 1UNLD 1C9BA 1H28B 4ELLA 4YC3B 2G77A 3QHRB 2F2CA 2BS4A 1AISB 1FVVB 4F70B 1P5EB 3BHTB 3BG5A 4CFWB 4CFMB 4YOOA 1H26B 3TN8B 2CJMB 4EOJB 1FKMA 2W96A 2ZPHB 4NC6A 2QGSA 2PJQA 2R7GA 3MY1B 1URCB 2C6TB 2C5OB 3QYHB 2WPAB 5L2WB 3MI9B 2DXCB 1VINA 2PMIB 2X1NB 3DDQB 1UNHD 1QLBA 5IF1B 1OKWB 1UGQB 4II5B 3O0GD 3MIAB 2KMGA 3X24B 4CFXB 3GTMS 2ZPBB 4UN0A 4BCMD 4Y72B 4OGRB 1TD6A 4JX4A 2CZ0B 5EFQB 4BCKB 5LQFB 2W99A 4BCMB 2ZPFB 3BHVB 4MIMA 3PO3S 3WVEB 2W2HA 3M03A 3BLHB 2IW8B 4BCNB 5HQ0B 4EOLB 5IHYA 3VYGB 4BCPB 2WFYB 4F7JB 2CCIB 1OL2B 5CEIB 4MFDA 4BBRM 4F6SB 4ROCA 3DL1A 1KXUA 1OIYB 5DQWA 1OIUB 3H4CA 4KRDB 2BPMB 2IN3A 3RGFB 1N4MA 2EUFA 1OI9B 3HB9A 3EIDB 1ENWA 1FINB 2CZ6B 1AD6A 1H24B 3VKHA 3A8MB 3BG3A 3K7AM 2WMBB 4JX6A 2W9ZA 3A8OB 5ACBA 2QFZA 4LOCA 2UUEB 1ZP2A 4ROEA 3DDPB 3LQ5B 4EOQB 3QHWB 4BCQD 4BCFB 3BLRB 5CYIB 2B9RA 1F5QB 5EJCA 4TTHA 4AKHA 4FM4B 1G3NC 3X26B 4EOSB 1H4LD 3QYEA 2I40B 3BG9A 2ZCFB 4BCQB 3WVDB 1O9KB
chains in the Genus database with same CATH topology
4Y72B 4YOSA 4OGRB 2BKZB 1JOWA 5EFQB 2I53A 1UNGD 2PK9B 4BCKB 5LQFB 2W99A 1TFBA 1GUXB 2WHBB 2WIHB 4EORB 5HBEB 1BU2A 3TNIB 2UZLB 4BCMB 3BHVB 1OL1B 4CXAB 2G9XB 1PKDB 1H1SB 1OKVB 5IDPB 2W2HA 2CCHB 3DOGB 3BLHB 3M03A 2C5VB 2IW8B 3TNHB 4BCNB 5HQ0B 4EOLB 4I3ZB 4CFUD 5LMKB 3TNWB 1O9KA 2UZBB 2WEVB 2UZEB 1W98B 4YOZA 4BCPB 4KRCB 2WFYB 4F7JB 5BNJB 2CCIB 2WXVB 1QMZB 1OL2B 5CEIB 3EJ1B 4EOKB 4F6SB 5ICPB 1GUXA 4EOOB 4ROCA 1H1QB 1VOLA 4CFUB 3BHUB 2IW6B 2C4GB 3BLQB 4F6UB 2W9FA 1GY3B 4FX3B 4EC9B 1KXUA 5HBJB 2PK2A 4BCOB 1JSUB 1E9HB 1OIYB 4BCGB 1JKWA 3EOCB 1H1PB 3MY5B 1OIUB 1H1RB 3H4CA 4KRDB 4BCJB 2BPMB 4ELJA 1UNLD 1C9BA 1H28B 1N4MA 3RGFB 4F6WB 4BCHB 4ELLA 5HNBB 5HVYB 2EUFA 1OI9B 4YC3B 4CFVB 3EIDB 3QHRB 1FINB 2F2CA 1AISB 4EOPB 1H25B 1AD6A 4RODA 1H24B 1FVVB 1VYWB 2QDJA 4F70B 4CRLB 2UZDB 1P5EB 2C5NB 4EOMB 5FGKB 2C5XB 3BHTB 3G33B 4CFNB 4CFWB 4CFMB 3K7AM 2WMBB 4YOOA 4EOIB 2W9ZA 1D3UB 1H26B 3TN8B 2CJMB 2V22B 4BCIB 4EOJB 5ACBA 2UUEB 1JSTB 1ZP2A 2W96A 5HBHB 4G6LB 5I5ZB 2WIPB 4ROEA 1XO2A 3F5XB 4EONB 2R7GA 3MY1B 1URCB 3DDPB 1H27B 2C6TB 2C5OB 3LQ5B 3QHWB 4BCQD 4BCFB 3POMA 4EOQB 4BCND 4F7SB 3BLRB 5CYIB 2B9RA 2WPAB 1F5QB 2IW9B 4TTHA 3MI9B 2IVXA 5L2WB 5IDNB 1OGUB 1VINA 1GH6B 2PMIB 2X1NB 4IMYB 4EC8B 3DDQB 1UNHD 2WMAB 1G3NC 4EOSB 4NSTB 5IF1B 1H4LD 1OKWB 4OR5B 2I40B 4II5B 3O0GD 3MIAB 2PHGA 4BCQB 4F7LB 4F7NB 4CFXB 2JGZB 4UN0A 1O9KB 4BCMD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y72 B;  4YOS A;  4OGR B;  2BKZ B;  1JOW A;  5EFQ B;  2I53 A;  1UNG D;  2PK9 B;  4BCK B;  5LQF B;  2W99 A;  1TFB A;  1GUX B;  2WHB B;  2WIH B;  4EOR B;  5HBE B;  1BU2 A;  3TNI B;  2UZL B;  4BCM B;  3BHV B;  1OL1 B;  4CXA B;  2G9X B;  1PKD B;  1H1S B;  1OKV B;  5IDP B;  2W2H A;  2CCH B;  3DOG B;  3BLH B;  3M03 A;  2C5V B;  2IW8 B;  3TNH B;  4BCN B;  5HQ0 B;  4EOL B;  4I3Z B;  4CFU D;  5LMK B;  3TNW B;  1O9K A;  2UZB B;  2WEV B;  2UZE B;  1W98 B;  4YOZ A;  4BCP B;  4KRC B;  2WFY B;  4F7J B;  5BNJ B;  2CCI B;  2WXV B;  1QMZ B;  1OL2 B;  5CEI B;  3EJ1 B;  4EOK B;  4F6S B;  5ICP B;  1GUX A;  4EOO B;  4ROC A;  1H1Q B;  1VOL A;  4CFU B;  3BHU B;  2IW6 B;  2C4G B;  3BLQ B;  4F6U B;  2W9F A;  1GY3 B;  4FX3 B;  4EC9 B;  1KXU A;  5HBJ B;  2PK2 A;  4BCO B;  1JSU B;  1E9H B;  1OIY B;  4BCG B;  1JKW A;  3EOC B;  1H1P B;  3MY5 B;  1OIU B;  1H1R B;  3H4C A;  4KRD B;  4BCJ B;  2BPM B;  4ELJ A;  1UNL D;  1C9B A;  1H28 B;  1N4M A;  3RGF B;  4F6W B;  4BCH B;  4ELL A;  5HNB B;  5HVY B;  2EUF A;  1OI9 B;  4YC3 B;  4CFV B;  3EID B;  3QHR B;  1FIN B;  2F2C A;  1AIS B;  4EOP B;  1H25 B;  1AD6 A;  4ROD A;  1H24 B;  1FVV B;  1VYW B;  2QDJ A;  4F70 B;  4CRL B;  2UZD B;  1P5E B;  2C5N B;  4EOM B;  5FGK B;  2C5X B;  3BHT B;  3G33 B;  4CFN B;  4CFW B;  4CFM B;  3K7A M;  2WMB B;  4YOO A;  4EOI B;  2W9Z A;  1D3U B;  1H26 B;  3TN8 B;  2CJM B;  2V22 B;  4BCI B;  4EOJ B;  5ACB A;  2UUE B;  1JST B;  1ZP2 A;  2W96 A;  5HBH B;  4G6L B;  5I5Z B;  2WIP B;  4ROE A;  1XO2 A;  3F5X B;  4EON B;  2R7G A;  3MY1 B;  1URC B;  3DDP B;  1H27 B;  2C6T B;  2C5O B;  3LQ5 B;  3QHW B;  4BCQ D;  4BCF B;  3POM A;  4EOQ B;  4BCN D;  4F7S B;  3BLR B;  5CYI B;  2B9R A;  2WPA B;  1F5Q B;  2IW9 B;  4TTH A;  3MI9 B;  2IVX A;  5L2W B;  5IDN B;  1OGU B;  1VIN A;  1GH6 B;  2PMI B;  2X1N B;  4IMY B;  4EC8 B;  3DDQ B;  1UNH D;  2WMA B;  1G3N C;  4EOS B;  4NST B;  5IF1 B;  1H4L D;  1OKW B;  4OR5 B;  2I40 B;  4II5 B;  3O0G D;  3MIA B;  2PHG A;  4BCQ B;  4F7L B;  4F7N B;  4CFX B;  2JGZ B;  4UN0 A;  1O9K B;  4BCM D; 
#chains in the Genus database with same CATH topology
 2BKZ B;  1JOW A;  4BXX X;  4BY1 X;  3QXE B;  1GUX B;  4ZGD B;  5HBE B;  1BU2 A;  3QYB A;  4CXA B;  2G9X B;  1E7P A;  1PKD B;  1H1S B;  5IDP B;  4OB2 B;  2DME A;  2BS3 A;  4I3Z B;  4HNU A;  4CFU D;  2QDY B;  2CYZ B;  4YOZ A;  5BNJ B;  4OB0 B;  4OB3 B;  4BY7 X;  3A8G B;  4EOO B;  1H1Q B;  4CFU B;  2W9F A;  3X28 B;  2D0Q B;  5HBJ B;  1UGS B;  3TW7 A;  3QWL A;  4BCG B;  1JKW A;  4HLQ A;  4HNV A;  1H1R B;  3DJB A;  4F6W B;  4AKI A;  5HNB B;  5HVY B;  3QZ5 B;  4CFV B;  1H25 B;  4ROD A;  4QSH A;  2QDJ A;  4CRL B;  2ZPG B;  3HO8 A;  2C5X B;  4CFN B;  4EOI B;  2V22 B;  2LW4 A;  5HBH B;  2WJ9 A;  4G6L B;  5I5Z B;  2WIP B;  4JX5 A;  4AKG A;  4F7S B;  2DD4 B;  4M6V A;  5IDN B;  1OGU B;  4NST B;  2DXB B;  4F7N B;  2DD5 B;  4YOS A;  2QF7 A;  2DPP B;  3QYG B;  2I53 A;  1UNG D;  1UGP B;  3VKG A;  2WHB B;  2WIH B;  4EOR B;  3TNI B;  2UZL B;  1OL1 B;  2CCH B;  3DOG B;  3QZ9 B;  3B57 A;  2CZ1 B;  3TNW B;  2WEV B;  3A8L B;  2WXV B;  1QMZ B;  3A8H B;  3EJ1 B;  4EOK B;  3NDQ A;  2IW6 B;  2C4G B;  3BLQ B;  4F6U B;  4FX3 B;  2PK2 A;  4BCO B;  4HNT A;  1JSU B;  3EOC B;  1H1P B;  3MY5 B;  4BCJ B;  1AHJ B;  1IRE B;  4BCH B;  4ZGE B;  4EOP B;  1V29 B;  1VYW B;  2KR6 A;  2UZD B;  2C5N B;  4EOM B;  5FGK B;  3G33 B;  5DQV A;  1D3U B;  4BCI B;  4HL4 A;  1JST B;  4AI6 A;  2AHJ B;  1XO2 A;  3F5X B;  3HZJ A;  4EON B;  1H27 B;  2ZPI B;  3POM A;  4BCN D;  3TW6 A;  2IW9 B;  2IVX A;  4EC8 B;  1GH6 B;  4IMY B;  2WMA B;  4ZGJ B;  4OR5 B;  2PHG A;  3HHT B;  2ZPE B;  4F7L B;  2JGZ B;  4OB1 B;  1UGR B;  4BBS M;  2QQ8 A;  2PK9 B;  1TFB A;  3X20 B;  2ZZD B;  1OKV B;  3VYH B;  2C5V B;  2BS2 A;  3TNH B;  3KHI A;  5LMK B;  1O9K A;  2UZB B;  2UZE B;  1W98 B;  3X25 B;  4KRC B;  3DTO A;  4Z6Y A;  3HBL A;  4MFE A;  5ICP B;  1GUX A;  1VOL A;  3BHU B;  1GY3 B;  4EC9 B;  2CZ7 B;  1E9H B;  4ELJ A;  1UNL D;  1C9B A;  1H28 B;  4ELL A;  4YC3 B;  2G77 A;  3QHR B;  2F2C A;  2BS4 A;  1AIS B;  1FVV B;  4F70 B;  1P5E B;  3BHT B;  3BG5 A;  4CFW B;  4CFM B;  4YOO A;  1H26 B;  3TN8 B;  2CJM B;  4EOJ B;  1FKM A;  2W96 A;  2ZPH B;  4NC6 A;  2QGS A;  2PJQ A;  2R7G A;  3MY1 B;  1URC B;  2C6T B;  2C5O B;  3QYH B;  2WPA B;  5L2W B;  3MI9 B;  2DXC B;  1VIN A;  2PMI B;  2X1N B;  3DDQ B;  1UNH D;  1QLB A;  5IF1 B;  1OKW B;  1UGQ B;  4II5 B;  3O0G D;  3MIA B;  2KMG A;  3X24 B;  4CFX B;  3GTM S;  2ZPB B;  4UN0 A;  4BCM D;  4Y72 B;  4OGR B;  1TD6 A;  4JX4 A;  2CZ0 B;  5EFQ B;  4BCK B;  5LQF B;  2W99 A;  4BCM B;  2ZPF B;  3BHV B;  4MIM A;  3PO3 S;  3WVE B;  2W2H A;  3M03 A;  3BLH B;  2IW8 B;  4BCN B;  5HQ0 B;  4EOL B;  5IHY A;  3VYG B;  4BCP B;  2WFY B;  4F7J B;  2CCI B;  1OL2 B;  5CEI B;  4MFD A;  4BBR M;  4F6S B;  4ROC A;  3DL1 A;  1KXU A;  1OIY B;  5DQW A;  1OIU B;  3H4C A;  4KRD B;  2BPM B;  2IN3 A;  3RGF B;  1N4M A;  2EUF A;  1OI9 B;  3HB9 A;  3EID B;  1ENW A;  1FIN B;  2CZ6 B;  1AD6 A;  1H24 B;  3VKH A;  3A8M B;  3BG3 A;  3K7A M;  2WMB B;  4JX6 A;  2W9Z A;  3A8O B;  5ACB A;  2QFZ A;  4LOC A;  2UUE B;  1ZP2 A;  4ROE A;  3DDP B;  3LQ5 B;  4EOQ B;  3QHW B;  4BCQ D;  4BCF B;  3BLR B;  5CYI B;  2B9R A;  1F5Q B;  5EJC A;  4TTH A;  4AKH A;  4FM4 B;  1G3N C;  3X26 B;  4EOS B;  1H4L D;  3QYE A;  2I40 B;  3BG9 A;  2ZCF B;  4BCQ B;  3WVD B;  1O9K B; 
#chains in the Genus database with same CATH homology
 4Y72 B;  4YOS A;  4OGR B;  2BKZ B;  1JOW A;  5EFQ B;  2I53 A;  1UNG D;  2PK9 B;  4BCK B;  5LQF B;  2W99 A;  1TFB A;  1GUX B;  2WHB B;  2WIH B;  4EOR B;  5HBE B;  1BU2 A;  3TNI B;  2UZL B;  4BCM B;  3BHV B;  1OL1 B;  4CXA B;  2G9X B;  1PKD B;  1H1S B;  1OKV B;  5IDP B;  2W2H A;  2CCH B;  3DOG B;  3BLH B;  3M03 A;  2C5V B;  2IW8 B;  3TNH B;  4BCN B;  5HQ0 B;  4EOL B;  4I3Z B;  4CFU D;  5LMK B;  3TNW B;  1O9K A;  2UZB B;  2WEV B;  2UZE B;  1W98 B;  4YOZ A;  4BCP B;  4KRC B;  2WFY B;  4F7J B;  5BNJ B;  2CCI B;  2WXV B;  1QMZ B;  1OL2 B;  5CEI B;  3EJ1 B;  4EOK B;  4F6S B;  5ICP B;  1GUX A;  4EOO B;  4ROC A;  1H1Q B;  1VOL A;  4CFU B;  3BHU B;  2IW6 B;  2C4G B;  3BLQ B;  4F6U B;  2W9F A;  1GY3 B;  4FX3 B;  4EC9 B;  1KXU A;  5HBJ B;  2PK2 A;  4BCO B;  1JSU B;  1E9H B;  1OIY B;  4BCG B;  1JKW A;  3EOC B;  1H1P B;  3MY5 B;  1OIU B;  1H1R B;  3H4C A;  4KRD B;  4BCJ B;  2BPM B;  4ELJ A;  1UNL D;  1C9B A;  1H28 B;  1N4M A;  3RGF B;  4F6W B;  4BCH B;  4ELL A;  5HNB B;  5HVY B;  2EUF A;  1OI9 B;  4YC3 B;  4CFV B;  3EID B;  3QHR B;  1FIN B;  2F2C A;  1AIS B;  4EOP B;  1H25 B;  1AD6 A;  4ROD A;  1H24 B;  1FVV B;  1VYW B;  2QDJ A;  4F70 B;  4CRL B;  2UZD B;  1P5E B;  2C5N B;  4EOM B;  5FGK B;  2C5X B;  3BHT B;  3G33 B;  4CFN B;  4CFW B;  4CFM B;  3K7A M;  2WMB B;  4YOO A;  4EOI B;  2W9Z A;  1D3U B;  1H26 B;  3TN8 B;  2CJM B;  2V22 B;  4BCI B;  4EOJ B;  5ACB A;  2UUE B;  1JST B;  1ZP2 A;  2W96 A;  5HBH B;  4G6L B;  5I5Z B;  2WIP B;  4ROE A;  1XO2 A;  3F5X B;  4EON B;  2R7G A;  3MY1 B;  1URC B;  3DDP B;  1H27 B;  2C6T B;  2C5O B;  3LQ5 B;  3QHW B;  4BCQ D;  4BCF B;  3POM A;  4EOQ B;  4BCN D;  4F7S B;  3BLR B;  5CYI B;  2B9R A;  2WPA B;  1F5Q B;  2IW9 B;  4TTH A;  3MI9 B;  2IVX A;  5L2W B;  5IDN B;  1OGU B;  1VIN A;  1GH6 B;  2PMI B;  2X1N B;  4IMY B;  4EC8 B;  3DDQ B;  1UNH D;  2WMA B;  1G3N C;  4EOS B;  4NST B;  5IF1 B;  1H4L D;  1OKW B;  4OR5 B;  2I40 B;  4II5 B;  3O0G D;  3MIA B;  2PHG A;  4BCQ B;  4F7L B;  4F7N B;  4CFX B;  2JGZ B;  4UN0 A;  1O9K B;  4BCM D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...