1H24B

Cdk2/cyclina in complex with a 9 residue recruitment peptide from e2f
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h24B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h24B02
1ZP2A 1H1PB 4BCIB 2PMIB 4ROCA 2IW6B 2C5XB 1AD6A 1W98B 5FGKB 3DDQB 1VYWB 2V22B 3BHVB 3F5XB 4EORB 2IW8B 4ELJA 4OGRB 2G9XB 2C5NB 3DOGB 2W99A 3TNWB 1H27B 1VINA 3MIAB 2UUEB 4ROEA 4EONB 3MY5B 4BCOB 3TN8B 5HBHB 4IMYB 1H26B 4ELLA 5CEIB 2C4GB 2I53A 4BCJB 4EOPB 3POMA 1D3UB 4NSTB 4BCQB 3EJ1B 4CFXB 2W9FA 1H24B 1N4MA 2C5VB 4KRCB 4BCHB 4EOKB 4FX3B 5IF1B 4EOQB 4BCMB 2C5OB 4F70B 1QMZB 1C9BA 5HBJB 1E9HB 5IDPB 3EIDB 2F2CA 1GUXB 4G6LB 3QHWB 4BCGB 4F6WB 1GY3B 1OIYB 2PHGA 4F7LB 1JSTB 5EFQB 3LQ5B 4II5B 3O0GD 5I5ZB 2WMAB 2R7GA 5LQFB 1H28B 2B9RA 1H1SB 3BLQB 1OIUB 2CCIB 1H1RB 2WEVB 1OL1B 4F7JB 5BNJB 1H1QB 4TTHA 1GUXA 2WPAB 2X1NB 2CJMB 4BCPB 4CFUB 2PK9B 5HVYB 1OKWB 3DDPB 4YOZA 4YC3B 4EOMB 3H4CA 4YOOA 4BCNB 4EC8B 3MY1B 2JGZB 2PK2A 4EOLB 4EOJB 4F7SB 4F7NB 3TNIB 1H4LD 5LMKB 3BLHB 5CYIB 1UNHD 1AISB 2EUFA 2UZDB 2WMBB 3TNHB 2BPMB 4KRDB 2IW9B 3BHUB 1F5QB 3EOCB 4EC9B 1KXUA 4RODA 4BCQD 4BCFB 4CRLB 1FVVB 1O9KB 3G33B 1G3NC 1PKDB 1GH6B 1OI9B 2W96A 3BHTB 3M03A 4CFWB 1OKVB 4CFUD 4EOIB 5HBEB 1JKWA 4Y72B 4BCMD 5ICPB 1OGUB 1P5EB 4I3ZB 4BCKB 2W2HA 1VOLA 4CFNB 1XO2A 4BCND 3K7AM 1JOWA 1URCB 2WHBB 4CXAB 2WFYB 2UZEB 4UN0A 1UNGD 4F6SB 2I40B 4F6UB 3MI9B 2WIPB 2UZBB 2CCHB 3RGFB 1BU2A 2BKZB 5IDNB 1H25B 2W9ZA 5HQ0B 2C6TB 4CFMB 1JSUB 1O9KA 4EOSB 5L2WB 1UNLD 4OR5B 2UZLB 1FINB 2WXVB 3BLRB 2QDJA 4YOSA 5HNBB 2IVXA 3QHRB 2WIHB 4EOOB 4CFVB 1TFBA 5ACBA 1OL2B
chains in the Genus database with same CATH superfamily
1W98B 3GTMS 3DDQB 3F5XB 3X24B 3X25B 3A8OB 1E7PA 4OB1B 3DOGB 4HNUA 3TNWB 1H27B 3MIAB 4EONB 2UUEB 4IMYB 4BXXX 2C4GB 2I53A 4BCJB 5CEIB 4Z6YA 4CFXB 4KRCB 1H24B 1N4MA 2C5VB 4BCHB 4FX3B 4QSHA 2KMGA 3HO8A 3QXEB 5IDPB 2DD5B 3QHWB 4BCGB 4F6WB 1GY3B 4F7LB 4HL4A 4HNVA 4II5B 2CYZB 1H1SB 2DXCB 4F7JB 4OB2B 1AHJB 3A8LB 4YOZA 3X26B 2ZPIB 2DPPB 2PK2A 4EOJB 4F7SB 2ZZDB 3QZ9B 5IHYA 4JX4A 2G77A 3BHUB 3HHTB 4RODA 4CRLB 1FVVB 1O9KB 3TW6A 1PKDB 2BS3A 2ZPFB 1ENWA 5ICPB 4BCKB 1XO2A 4CXAB 2WJ9A 2WFYB 4LOCA 3MI9B 2WIPB 1FKMA 1H25B 2C6TB 1FINB 2WIHB 4EOOB 1TFBA 5EJCA 3WVEB 4BBSM 2IW6B 4JX5A 5FGKB 2PJQA 2IW8B 2QDYB 1V29B 4ROEA 4BCOB 3QZ5B 1H26B 4MFDA 4ELLA 4NSTB 3EJ1B 2W9FA 4EOKB 5IF1B 2DD4B 3B57A 4F70B 3QYEA 5HBJB 4OB3B 1GUXB 3PO3S 2B9RA 3BLQB 4M6VA 2CZ0B 1OIUB 2WEVB 2X1NB 4CFUB 4EC8B 4BCNB 3MY1B 2JGZB 3VYHB 3QYGB 3TNIB 2EUFA 2UZDB 2WMBB 2BPMB 3A8MB 3X28B 3EOCB 3A8GB 4HNTA 4BCQD 4BCFB 3QYBA 3VKHA 1OI9B 2W96A 3BHTB 4EOIB 1JKWA 4BCMD 4MIMA 1OGUB 1P5EB 4I3ZB 1VOLA 4AKIA 2WHBB 4F6SB 4BBRM 5DQVA 2UZEB 1IREB 4JX6A 2CCHB 1BU2A 4MFEA 5IDNB 4CFMB 1O9KA 4YOSA 4CFVB 3BG9A 1OL2B 1ZP2A 1H1PB 4BCIB 2PMIB 4ROCA 2C5XB 3HBLA 1AD6A 2LW4A 2V22B 4OGRB 2CZ1B 2QQ8A 2G9XB 3A8HB 3MY5B 2ZPHB 3TN8B 5HBHB 1D3UB 4EOPB 4BY1X 4AI6A 2IN3A 4HLQA 2ZCFB 2ZPEB 2BS2A 1OIYB 3BG3A 3LQ5B 3O0GD 2WMAB 2R7GA 5LQFB 1OL1B 1GUXA 2WPAB 4ZGEB 2CJMB 2PK9B 5HVYB 2QGSA 4FM4B 4YC3B 4F7NB 1H4LD 3DJBA 4AKGA 2QF7A 3TNHB 4KRDB 2IW9B 3VKGA 1F5QB 4EC9B 1G3NC 1GH6B 4CFWB 3M03A 1OKVB 4CFUD 4CFNB 1UGPB 4BCND 3K7AM 1UNGD 2I40B 2D0QB 4OB0B 3RGFB 2BKZB 5HQ0B 1JSUB 4OR5B 2IVXA 4ZGJB 5ACBA 5DQWA 2DXBB 1VYWB 3BHVB 3DL1A 4EORB 4ELJA 2QFZA 2C5NB 2W99A 1VINA 2DMEA 1TD6A 4AKHA 1UGSB 3POMA 4BCQB 3BG5A 4EOQB 4BCMB 2C5OB 3HB9A 3KHIA 4NC6A 1QMZB 1C9BA 3TW7A 3QYHB 1E9HB 3EIDB 2F2CA 4G6LB 2PHGA 1UGQB 1JSTB 5EFQB 5I5ZB 2KR6A 3VYGB 1H28B 2CCIB 2ZPGB 1H1RB 3X20B 5BNJB 1H1QB 4TTHA 4BCPB 1UGRB 1OKWB 3DDPB 4EOMB 3H4CA 4YOOA 4BY7X 4EOLB 2AHJB 5LMKB 3BLHB 5CYIB 1UNHD 3DTOA 1AISB 1KXUA 3G33B 5HBEB 2CZ7B 4Y72B 2W2HA 3WVDB 4F6UB 1JOWA 1URCB 3NDQA 4UN0A 2UZBB 2W9ZA 4EOSB 1QLBA 5L2WB 1UNLD 2UZLB 2WXVB 3BLRB 2QDJA 2ZPBB 5HNBB 2CZ6B 3QHRB 4ZGDB 3QWLA 2BS4A 3HZJA
chains in the Genus database with same CATH topology
1ZP2A 1H1PB 4BCIB 2PMIB 4ROCA 2IW6B 2C5XB 1AD6A 1W98B 5FGKB 3DDQB 1VYWB 2V22B 3BHVB 3F5XB 4EORB 2IW8B 4ELJA 4OGRB 2G9XB 2C5NB 3DOGB 2W99A 3TNWB 1H27B 1VINA 3MIAB 2UUEB 4ROEA 4EONB 3MY5B 4BCOB 3TN8B 5HBHB 4IMYB 1H26B 4ELLA 5CEIB 2C4GB 2I53A 4BCJB 4EOPB 3POMA 1D3UB 4NSTB 4BCQB 3EJ1B 4CFXB 2W9FA 1H24B 1N4MA 2C5VB 4KRCB 4BCHB 4EOKB 4FX3B 5IF1B 4EOQB 4BCMB 2C5OB 4F70B 1QMZB 1C9BA 5HBJB 1E9HB 5IDPB 3EIDB 2F2CA 1GUXB 4G6LB 3QHWB 4BCGB 4F6WB 1GY3B 1OIYB 2PHGA 4F7LB 1JSTB 5EFQB 3LQ5B 4II5B 3O0GD 5I5ZB 2WMAB 2R7GA 5LQFB 1H28B 2B9RA 1H1SB 3BLQB 1OIUB 2CCIB 1H1RB 2WEVB 1OL1B 4F7JB 5BNJB 1H1QB 4TTHA 1GUXA 2WPAB 2X1NB 2CJMB 4BCPB 4CFUB 2PK9B 5HVYB 1OKWB 3DDPB 4YOZA 4YC3B 4EOMB 3H4CA 4YOOA 4BCNB 4EC8B 3MY1B 2JGZB 2PK2A 4EOLB 4EOJB 4F7SB 4F7NB 3TNIB 1H4LD 5LMKB 3BLHB 5CYIB 1UNHD 1AISB 2EUFA 2UZDB 2WMBB 3TNHB 2BPMB 4KRDB 2IW9B 3BHUB 1F5QB 3EOCB 4EC9B 1KXUA 4RODA 4BCQD 4BCFB 4CRLB 1FVVB 1O9KB 3G33B 1G3NC 1PKDB 1GH6B 1OI9B 2W96A 3BHTB 3M03A 4CFWB 1OKVB 4CFUD 4EOIB 5HBEB 1JKWA 4Y72B 4BCMD 5ICPB 1OGUB 1P5EB 4I3ZB 4BCKB 2W2HA 1VOLA 4CFNB 1XO2A 4BCND 3K7AM 1JOWA 1URCB 2WHBB 4CXAB 2WFYB 2UZEB 4UN0A 1UNGD 4F6SB 2I40B 4F6UB 3MI9B 2WIPB 2UZBB 2CCHB 3RGFB 1BU2A 2BKZB 5IDNB 1H25B 2W9ZA 5HQ0B 2C6TB 4CFMB 1JSUB 1O9KA 4EOSB 5L2WB 1UNLD 4OR5B 2UZLB 1FINB 2WXVB 3BLRB 2QDJA 4YOSA 5HNBB 2IVXA 3QHRB 2WIHB 4EOOB 4CFVB 1TFBA 5ACBA 1OL2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP2 A;  1H1P B;  4BCI B;  2PMI B;  4ROC A;  2IW6 B;  2C5X B;  1AD6 A;  1W98 B;  5FGK B;  3DDQ B;  1VYW B;  2V22 B;  3BHV B;  3F5X B;  4EOR B;  2IW8 B;  4ELJ A;  4OGR B;  2G9X B;  2C5N B;  3DOG B;  2W99 A;  3TNW B;  1H27 B;  1VIN A;  3MIA B;  2UUE B;  4ROE A;  4EON B;  3MY5 B;  4BCO B;  3TN8 B;  5HBH B;  4IMY B;  1H26 B;  4ELL A;  5CEI B;  2C4G B;  2I53 A;  4BCJ B;  4EOP B;  3POM A;  1D3U B;  4NST B;  4BCQ B;  3EJ1 B;  4CFX B;  2W9F A;  1H24 B;  1N4M A;  2C5V B;  4KRC B;  4BCH B;  4EOK B;  4FX3 B;  5IF1 B;  4EOQ B;  4BCM B;  2C5O B;  4F70 B;  1QMZ B;  1C9B A;  5HBJ B;  1E9H B;  5IDP B;  3EID B;  2F2C A;  1GUX B;  4G6L B;  3QHW B;  4BCG B;  4F6W B;  1GY3 B;  1OIY B;  2PHG A;  4F7L B;  1JST B;  5EFQ B;  3LQ5 B;  4II5 B;  3O0G D;  5I5Z B;  2WMA B;  2R7G A;  5LQF B;  1H28 B;  2B9R A;  1H1S B;  3BLQ B;  1OIU B;  2CCI B;  1H1R B;  2WEV B;  1OL1 B;  4F7J B;  5BNJ B;  1H1Q B;  4TTH A;  1GUX A;  2WPA B;  2X1N B;  2CJM B;  4BCP B;  4CFU B;  2PK9 B;  5HVY B;  1OKW B;  3DDP B;  4YOZ A;  4YC3 B;  4EOM B;  3H4C A;  4YOO A;  4BCN B;  4EC8 B;  3MY1 B;  2JGZ B;  2PK2 A;  4EOL B;  4EOJ B;  4F7S B;  4F7N B;  3TNI B;  1H4L D;  5LMK B;  3BLH B;  5CYI B;  1UNH D;  1AIS B;  2EUF A;  2UZD B;  2WMB B;  3TNH B;  2BPM B;  4KRD B;  2IW9 B;  3BHU B;  1F5Q B;  3EOC B;  4EC9 B;  1KXU A;  4ROD A;  4BCQ D;  4BCF B;  4CRL B;  1FVV B;  1O9K B;  3G33 B;  1G3N C;  1PKD B;  1GH6 B;  1OI9 B;  2W96 A;  3BHT B;  3M03 A;  4CFW B;  1OKV B;  4CFU D;  4EOI B;  5HBE B;  1JKW A;  4Y72 B;  4BCM D;  5ICP B;  1OGU B;  1P5E B;  4I3Z B;  4BCK B;  2W2H A;  1VOL A;  4CFN B;  1XO2 A;  4BCN D;  3K7A M;  1JOW A;  1URC B;  2WHB B;  4CXA B;  2WFY B;  2UZE B;  4UN0 A;  1UNG D;  4F6S B;  2I40 B;  4F6U B;  3MI9 B;  2WIP B;  2UZB B;  2CCH B;  3RGF B;  1BU2 A;  2BKZ B;  5IDN B;  1H25 B;  2W9Z A;  5HQ0 B;  2C6T B;  4CFM B;  1JSU B;  1O9K A;  4EOS B;  5L2W B;  1UNL D;  4OR5 B;  2UZL B;  1FIN B;  2WXV B;  3BLR B;  2QDJ A;  4YOS A;  5HNB B;  2IVX A;  3QHR B;  2WIH B;  4EOO B;  4CFV B;  1TFB A;  5ACB A;  1OL2 B; 
#chains in the Genus database with same CATH topology
 1W98 B;  3GTM S;  3DDQ B;  3F5X B;  3X24 B;  3X25 B;  3A8O B;  1E7P A;  4OB1 B;  3DOG B;  4HNU A;  3TNW B;  1H27 B;  3MIA B;  4EON B;  2UUE B;  4IMY B;  4BXX X;  2C4G B;  2I53 A;  4BCJ B;  5CEI B;  4Z6Y A;  4CFX B;  4KRC B;  1H24 B;  1N4M A;  2C5V B;  4BCH B;  4FX3 B;  4QSH A;  2KMG A;  3HO8 A;  3QXE B;  5IDP B;  2DD5 B;  3QHW B;  4BCG B;  4F6W B;  1GY3 B;  4F7L B;  4HL4 A;  4HNV A;  4II5 B;  2CYZ B;  1H1S B;  2DXC B;  4F7J B;  4OB2 B;  1AHJ B;  3A8L B;  4YOZ A;  3X26 B;  2ZPI B;  2DPP B;  2PK2 A;  4EOJ B;  4F7S B;  2ZZD B;  3QZ9 B;  5IHY A;  4JX4 A;  2G77 A;  3BHU B;  3HHT B;  4ROD A;  4CRL B;  1FVV B;  1O9K B;  3TW6 A;  1PKD B;  2BS3 A;  2ZPF B;  1ENW A;  5ICP B;  4BCK B;  1XO2 A;  4CXA B;  2WJ9 A;  2WFY B;  4LOC A;  3MI9 B;  2WIP B;  1FKM A;  1H25 B;  2C6T B;  1FIN B;  2WIH B;  4EOO B;  1TFB A;  5EJC A;  3WVE B;  4BBS M;  2IW6 B;  4JX5 A;  5FGK B;  2PJQ A;  2IW8 B;  2QDY B;  1V29 B;  4ROE A;  4BCO B;  3QZ5 B;  1H26 B;  4MFD A;  4ELL A;  4NST B;  3EJ1 B;  2W9F A;  4EOK B;  5IF1 B;  2DD4 B;  3B57 A;  4F70 B;  3QYE A;  5HBJ B;  4OB3 B;  1GUX B;  3PO3 S;  2B9R A;  3BLQ B;  4M6V A;  2CZ0 B;  1OIU B;  2WEV B;  2X1N B;  4CFU B;  4EC8 B;  4BCN B;  3MY1 B;  2JGZ B;  3VYH B;  3QYG B;  3TNI B;  2EUF A;  2UZD B;  2WMB B;  2BPM B;  3A8M B;  3X28 B;  3EOC B;  3A8G B;  4HNT A;  4BCQ D;  4BCF B;  3QYB A;  3VKH A;  1OI9 B;  2W96 A;  3BHT B;  4EOI B;  1JKW A;  4BCM D;  4MIM A;  1OGU B;  1P5E B;  4I3Z B;  1VOL A;  4AKI A;  2WHB B;  4F6S B;  4BBR M;  5DQV A;  2UZE B;  1IRE B;  4JX6 A;  2CCH B;  1BU2 A;  4MFE A;  5IDN B;  4CFM B;  1O9K A;  4YOS A;  4CFV B;  3BG9 A;  1OL2 B;  1ZP2 A;  1H1P B;  4BCI B;  2PMI B;  4ROC A;  2C5X B;  3HBL A;  1AD6 A;  2LW4 A;  2V22 B;  4OGR B;  2CZ1 B;  2QQ8 A;  2G9X B;  3A8H B;  3MY5 B;  2ZPH B;  3TN8 B;  5HBH B;  1D3U B;  4EOP B;  4BY1 X;  4AI6 A;  2IN3 A;  4HLQ A;  2ZCF B;  2ZPE B;  2BS2 A;  1OIY B;  3BG3 A;  3LQ5 B;  3O0G D;  2WMA B;  2R7G A;  5LQF B;  1OL1 B;  1GUX A;  2WPA B;  4ZGE B;  2CJM B;  2PK9 B;  5HVY B;  2QGS A;  4FM4 B;  4YC3 B;  4F7N B;  1H4L D;  3DJB A;  4AKG A;  2QF7 A;  3TNH B;  4KRD B;  2IW9 B;  3VKG A;  1F5Q B;  4EC9 B;  1G3N C;  1GH6 B;  4CFW B;  3M03 A;  1OKV B;  4CFU D;  4CFN B;  1UGP B;  4BCN D;  3K7A M;  1UNG D;  2I40 B;  2D0Q B;  4OB0 B;  3RGF B;  2BKZ B;  5HQ0 B;  1JSU B;  4OR5 B;  2IVX A;  4ZGJ B;  5ACB A;  5DQW A;  2DXB B;  1VYW B;  3BHV B;  3DL1 A;  4EOR B;  4ELJ A;  2QFZ A;  2C5N B;  2W99 A;  1VIN A;  2DME A;  1TD6 A;  4AKH A;  1UGS B;  3POM A;  4BCQ B;  3BG5 A;  4EOQ B;  4BCM B;  2C5O B;  3HB9 A;  3KHI A;  4NC6 A;  1QMZ B;  1C9B A;  3TW7 A;  3QYH B;  1E9H B;  3EID B;  2F2C A;  4G6L B;  2PHG A;  1UGQ B;  1JST B;  5EFQ B;  5I5Z B;  2KR6 A;  3VYG B;  1H28 B;  2CCI B;  2ZPG B;  1H1R B;  3X20 B;  5BNJ B;  1H1Q B;  4TTH A;  4BCP B;  1UGR B;  1OKW B;  3DDP B;  4EOM B;  3H4C A;  4YOO A;  4BY7 X;  4EOL B;  2AHJ B;  5LMK B;  3BLH B;  5CYI B;  1UNH D;  3DTO A;  1AIS B;  1KXU A;  3G33 B;  5HBE B;  2CZ7 B;  4Y72 B;  2W2H A;  3WVD B;  4F6U B;  1JOW A;  1URC B;  3NDQ A;  4UN0 A;  2UZB B;  2W9Z A;  4EOS B;  1QLB A;  5L2W B;  1UNL D;  2UZL B;  2WXV B;  3BLR B;  2QDJ A;  2ZPB B;  5HNB B;  2CZ6 B;  3QHR B;  4ZGD B;  3QWL A;  2BS4 A;  3HZJ A; 
#chains in the Genus database with same CATH homology
 1ZP2 A;  1H1P B;  4BCI B;  2PMI B;  4ROC A;  2IW6 B;  2C5X B;  1AD6 A;  1W98 B;  5FGK B;  3DDQ B;  1VYW B;  2V22 B;  3BHV B;  3F5X B;  4EOR B;  2IW8 B;  4ELJ A;  4OGR B;  2G9X B;  2C5N B;  3DOG B;  2W99 A;  3TNW B;  1H27 B;  1VIN A;  3MIA B;  2UUE B;  4ROE A;  4EON B;  3MY5 B;  4BCO B;  3TN8 B;  5HBH B;  4IMY B;  1H26 B;  4ELL A;  5CEI B;  2C4G B;  2I53 A;  4BCJ B;  4EOP B;  3POM A;  1D3U B;  4NST B;  4BCQ B;  3EJ1 B;  4CFX B;  2W9F A;  1H24 B;  1N4M A;  2C5V B;  4KRC B;  4BCH B;  4EOK B;  4FX3 B;  5IF1 B;  4EOQ B;  4BCM B;  2C5O B;  4F70 B;  1QMZ B;  1C9B A;  5HBJ B;  1E9H B;  5IDP B;  3EID B;  2F2C A;  1GUX B;  4G6L B;  3QHW B;  4BCG B;  4F6W B;  1GY3 B;  1OIY B;  2PHG A;  4F7L B;  1JST B;  5EFQ B;  3LQ5 B;  4II5 B;  3O0G D;  5I5Z B;  2WMA B;  2R7G A;  5LQF B;  1H28 B;  2B9R A;  1H1S B;  3BLQ B;  1OIU B;  2CCI B;  1H1R B;  2WEV B;  1OL1 B;  4F7J B;  5BNJ B;  1H1Q B;  4TTH A;  1GUX A;  2WPA B;  2X1N B;  2CJM B;  4BCP B;  4CFU B;  2PK9 B;  5HVY B;  1OKW B;  3DDP B;  4YOZ A;  4YC3 B;  4EOM B;  3H4C A;  4YOO A;  4BCN B;  4EC8 B;  3MY1 B;  2JGZ B;  2PK2 A;  4EOL B;  4EOJ B;  4F7S B;  4F7N B;  3TNI B;  1H4L D;  5LMK B;  3BLH B;  5CYI B;  1UNH D;  1AIS B;  2EUF A;  2UZD B;  2WMB B;  3TNH B;  2BPM B;  4KRD B;  2IW9 B;  3BHU B;  1F5Q B;  3EOC B;  4EC9 B;  1KXU A;  4ROD A;  4BCQ D;  4BCF B;  4CRL B;  1FVV B;  1O9K B;  3G33 B;  1G3N C;  1PKD B;  1GH6 B;  1OI9 B;  2W96 A;  3BHT B;  3M03 A;  4CFW B;  1OKV B;  4CFU D;  4EOI B;  5HBE B;  1JKW A;  4Y72 B;  4BCM D;  5ICP B;  1OGU B;  1P5E B;  4I3Z B;  4BCK B;  2W2H A;  1VOL A;  4CFN B;  1XO2 A;  4BCN D;  3K7A M;  1JOW A;  1URC B;  2WHB B;  4CXA B;  2WFY B;  2UZE B;  4UN0 A;  1UNG D;  4F6S B;  2I40 B;  4F6U B;  3MI9 B;  2WIP B;  2UZB B;  2CCH B;  3RGF B;  1BU2 A;  2BKZ B;  5IDN B;  1H25 B;  2W9Z A;  5HQ0 B;  2C6T B;  4CFM B;  1JSU B;  1O9K A;  4EOS B;  5L2W B;  1UNL D;  4OR5 B;  2UZL B;  1FIN B;  2WXV B;  3BLR B;  2QDJ A;  4YOS A;  5HNB B;  2IVX A;  3QHR B;  2WIH B;  4EOO B;  4CFV B;  1TFB A;  5ACB A;  1OL2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...