1H24B

Cdk2/cyclina in complex with a 9 residue recruitment peptide from e2f
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Specificity Determinants of Recruitment Peptides Bound to Phospho-Cdk2/Cyclin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h24B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1h24B02
2V22B 5L2WB 1VOLA 1GUXB 4YOZA 4CFWB 2UUEB 3MY1B 4EONB 1GY3B 4ROCA 5ACBA 5LMKB 2IVXA 1UNLD 2IW8B 4UN0A 4NSTB 5IF1B 5FGKB 4EOOB 4F6UB 2C4GB 4EOSB 1OL1B 2WXVB 4KRCB 4EOPB 1GH6B 2QDJA 4IMYB 4BCKB 4BCMB 5HBHB 2C6TB 2IW9B 4YOSA 2B9RA 3TNHB 4YC3B 5CYIB 1P5EB 3O0GD 1OKWB 2X1NB 5HQ0B 4F7SB 3H4CA 1W98B 4CFVB 1VINA 4BCGB 3BLHB 4BCQD 4F6WB 3M03A 1H27B 4F70B 1JOWA 4CXAB 2CCIB 5IDNB 4EOIB 3MI9B 3LQ5B 3MY5B 3QHRB 3BLRB 5HBJB 2F2CA 2BPMB 1O9KB 4EORB 4EOMB 2W9FA 1C9BA 3TN8B 1OI9B 1VYWB 1OIUB 1ZP2A 2JGZB 3EIDB 1OKVB 4BCPB 4OGRB 3DOGB 2UZBB 4BCQB 3BLQB 1D3UB 2CCHB 1JKWA 1OIYB 4CFXB 1GUXA 2WIPB 2WHBB 5HNBB 1AISB 2W99A 2WEVB 1UNHD 2BKZB 1H24B 1FINB 2C5NB 2PMIB 4TTHA 3POMA 4F7JB 2IW6B 3TNIB 2PK9B 2W96A 2WFYB 2I40B 4EOKB 5CEIB 1JSUB 5EFQB 4CRLB 4FX3B 2C5XB 4II5B 4F6SB 2C5VB 4YOOA 4F7LB 2UZLB 2R7GA 4KRDB 4BCFB 3EJ1B 1URCB 2C5OB 4OR5B 2WMBB 4BCND 2W2HA 2W9ZA 1UNGD 1E9HB 4CFMB 4ELLA 4ELJA 1H25B 1H1RB 1KXUA 3DDPB 1F5QB 2UZDB 4EC8B 5LQFB 5HVYB 5IDPB 3BHUB 4EOQB 3F5XB 4CFUD 1O9KA 2WPAB 1OL2B 2I53A 2CJMB 4G6LB 4ROEA 1JSTB 3MIAB 4BCOB 3BHVB 4RODA 5ICPB 1H1PB 3K7AM 1G3NC 4EC9B 5BNJB 5I5ZB 1H26B 2WMAB 1N4MA 4BCNB 2EUFA 1AD6A 3RGFB 4I3ZB 1XO2A 3TNWB 3EOCB 1H4LD 4BCHB 3G33B 4EOLB 1H1SB 1OGUB 4BCIB 4F7NB 1TFBA 1H1QB 2PHGA 4Y72B 4CFUB 2UZEB 2PK2A 3BHTB 3DDQB 3QHWB 1QMZB 1BU2A 5HBEB 4EOJB 1H28B 2G9XB 4BCJB 4CFNB 1FVVB 1PKDB 4BCMD 2WIHB
chains in the Genus database with same CATH superfamily
4YOZA 4CFWB 4UN0A 3VKHA 4HLQA 4LOCA 3HZJA 4BCKB 3VKGA 1OKWB 3H4CA 3A8OB 4ZGJB 4F6WB 4OB3B 2ZPIB 2CCIB 4HNVA 3LQ5B 3BLRB 2BPMB 1O9KB 2LW4A 1C9BA 4AKIA 1OIUB 1ZP2A 2D0QB 4AKGA 2CCHB 2WEVB 1UNHD 1E7PA 1FINB 4OB1B 4TTHA 4F7JB 2I40B 2KR6A 3HBLA 4F6SB 5DQWA 5EJCA 2UZLB 1URCB 4OR5B 4BCND 2DPPB 4ELJA 1H1RB 4OB2B 1KXUA 1FKMA 2DXBB 4EOQB 3F5XB 1O9KA 3KHIA 4JX4A 1JSTB 3K7AM 3X25B 3HO8A 3RGFB 3EOCB 1H4LD 4BCHB 3G33B 2ZPBB 2DMEA 4NC6A 4BCIB 4F7NB 1H1QB 4CFUB 4Y72B 3BHTB 5DQVA 3QXEB 4AI6A 4CFNB 3QYBA 2WIHB 2V22B 5L2WB 5LMKB 2IVXA 1UNLD 2IW8B 4NSTB 2QF7A 4F6UB 1OL1B 4KRCB 4EOPB 3DTOA 4BCMB 4BY1X 2C6TB 2IW9B 4F7SB 3DJBA 5HQ0B 2AHJB 3BG9A 1VINA 4HNTA 3BLHB 4CXAB 3MY5B 3QHRB 3QZ5B 4EORB 4EOMB 2W9FA 3TN8B 1OI9B 2ZPFB 1VYWB 2JGZB 2QGSA 3BG3A 2UZBB 2ZPEB 3BLQB 3WVDB 1AISB 2W99A 3A8LB 1H24B 3POMA 2IW6B 3TNIB 2W96A 2IN3A 1JSUB 4FX3B 2C5XB 4YOOA 3DL1A 2R7GA 4KRDB 4BCFB 2W9ZA 4CFMB 5LQFB 5HVYB 5IDPB 5IHYA 4CFUD 4BCOB 3BHVB 5I5ZB 1N4MA 4OB0B 2EUFA 1AD6A 4I3ZB 1XO2A 4EOLB 1H1SB 3A8GB 2ZPHB 1OGUB 1AHJB 1BU2A 4EOJB 1H28B 4BCJB 4BCMD 2UUEB 3MY1B 4ROCA 5ACBA 5IF1B 2PJQA 4EOOB 4EOSB 2WXVB 4AKHA 3QZ9B 1GH6B 3NDQA 4YOSA 3TNHB 4YC3B 3VYHB 1P5EB 5CYIB 2X1NB 1UGQB 1W98B 4BBRM 4BCGB 3M03A 4MIMA 5IDNB 4BBSM 3MI9B 5HBJB 2F2CA 2CYZB 3B57A 4FM4B 4BCPB 4OGRB 2CZ0B 3A8MB 4BCQB 1UGPB 4CFXB 2WIPB 5HNBB 2WJ9A 2BKZB 2C5NB 2PMIB 2PK9B 4EOKB 2WFYB 2BS3A 3X24B 5EFQB 4II5B 2C5VB 4F7LB 4M6VA 4HNUA 3PO3S 3A8HB 2C5OB 3TW7A 4ELLA 1H25B 1F5QB 2UZDB 4EC8B 2BS4A 3BHUB 2WPAB 4ROEA 3MIAB 4RODA 1H1PB 1G3NC 2G77A 4EC9B 3X28B 2QFZA 2CZ7B 2ZZDB 1UGRB 2PHGA 2UZEB 3TW6A 2PK2A 3DDQB 2G9XB 4JX6A 1FVVB 1PKDB 4QSHA 1VOLA 1GUXB 1UGSB 4EONB 1GY3B 5FGKB 2BS2A 1TD6A 2C4GB 2ZPGB 4MFEA 4ZGEB 3HB9A 2QDJA 4IMYB 3QYEA 1V29B 5HBHB 2B9RA 3O0GD 4HL4A 2ZCFB 4CFVB 4BCQD 1H27B 4F70B 1JOWA 4EOIB 2KMGA 3QYGB 3EIDB 1OKVB 2CZ6B 4BY7X 3DOGB 1D3UB 1JKWA 1OIYB 2DD4B 1GUXA 2DD5B 2WHBB 3BG5A 3QYHB 3HHTB 4BXXX 3VYGB 5CEIB 4CRLB 3QWLA 2QQ8A 3EJ1B 2CZ1B 1QLBA 1IREB 2WMBB 2W2HA 4MFDA 1UNGD 1E9HB 3WVEB 3DDPB 4ZGDB 1OL2B 2I53A 2CJMB 4G6LB 4JX5A 2QDYB 5ICPB 5BNJB 1H26B 2WMAB 4BCNB 4Z6YA 3GTMS 3TNWB 1TFBA 3QHWB 1QMZB 2DXCB 5HBEB 1ENWA 3X26B 3X20B
chains in the Genus database with same CATH topology
2V22B 5L2WB 1VOLA 1GUXB 4YOZA 4CFWB 2UUEB 3MY1B 4EONB 1GY3B 4ROCA 5ACBA 5LMKB 2IVXA 1UNLD 2IW8B 4UN0A 4NSTB 5IF1B 5FGKB 4EOOB 4F6UB 2C4GB 4EOSB 1OL1B 2WXVB 4KRCB 4EOPB 1GH6B 2QDJA 4IMYB 4BCKB 4BCMB 5HBHB 2C6TB 2IW9B 4YOSA 2B9RA 3TNHB 4YC3B 5CYIB 1P5EB 3O0GD 1OKWB 2X1NB 5HQ0B 4F7SB 3H4CA 1W98B 4CFVB 1VINA 4BCGB 3BLHB 4BCQD 4F6WB 3M03A 1H27B 4F70B 1JOWA 4CXAB 2CCIB 5IDNB 4EOIB 3MI9B 3LQ5B 3MY5B 3QHRB 3BLRB 5HBJB 2F2CA 2BPMB 1O9KB 4EORB 4EOMB 2W9FA 1C9BA 3TN8B 1OI9B 1VYWB 1OIUB 1ZP2A 2JGZB 3EIDB 1OKVB 4BCPB 4OGRB 3DOGB 2UZBB 4BCQB 3BLQB 1D3UB 2CCHB 1JKWA 1OIYB 4CFXB 1GUXA 2WIPB 2WHBB 5HNBB 1AISB 2W99A 2WEVB 1UNHD 2BKZB 1H24B 1FINB 2C5NB 2PMIB 4TTHA 3POMA 4F7JB 2IW6B 3TNIB 2PK9B 2W96A 2WFYB 2I40B 4EOKB 5CEIB 1JSUB 5EFQB 4CRLB 4FX3B 2C5XB 4II5B 4F6SB 2C5VB 4YOOA 4F7LB 2UZLB 2R7GA 4KRDB 4BCFB 3EJ1B 1URCB 2C5OB 4OR5B 2WMBB 4BCND 2W2HA 2W9ZA 1UNGD 1E9HB 4CFMB 4ELLA 4ELJA 1H25B 1H1RB 1KXUA 3DDPB 1F5QB 2UZDB 4EC8B 5LQFB 5HVYB 5IDPB 3BHUB 4EOQB 3F5XB 4CFUD 1O9KA 2WPAB 1OL2B 2I53A 2CJMB 4G6LB 4ROEA 1JSTB 3MIAB 4BCOB 3BHVB 4RODA 5ICPB 1H1PB 3K7AM 1G3NC 4EC9B 5BNJB 5I5ZB 1H26B 2WMAB 1N4MA 4BCNB 2EUFA 1AD6A 3RGFB 4I3ZB 1XO2A 3TNWB 3EOCB 1H4LD 4BCHB 3G33B 4EOLB 1H1SB 1OGUB 4BCIB 4F7NB 1TFBA 1H1QB 2PHGA 4Y72B 4CFUB 2UZEB 2PK2A 3BHTB 3DDQB 3QHWB 1QMZB 1BU2A 5HBEB 4EOJB 1H28B 2G9XB 4BCJB 4CFNB 1FVVB 1PKDB 4BCMD 2WIHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V22 B;  5L2W B;  1VOL A;  1GUX B;  4YOZ A;  4CFW B;  2UUE B;  3MY1 B;  4EON B;  1GY3 B;  4ROC A;  5ACB A;  5LMK B;  2IVX A;  1UNL D;  2IW8 B;  4UN0 A;  4NST B;  5IF1 B;  5FGK B;  4EOO B;  4F6U B;  2C4G B;  4EOS B;  1OL1 B;  2WXV B;  4KRC B;  4EOP B;  1GH6 B;  2QDJ A;  4IMY B;  4BCK B;  4BCM B;  5HBH B;  2C6T B;  2IW9 B;  4YOS A;  2B9R A;  3TNH B;  4YC3 B;  5CYI B;  1P5E B;  3O0G D;  1OKW B;  2X1N B;  5HQ0 B;  4F7S B;  3H4C A;  1W98 B;  4CFV B;  1VIN A;  4BCG B;  3BLH B;  4BCQ D;  4F6W B;  3M03 A;  1H27 B;  4F70 B;  1JOW A;  4CXA B;  2CCI B;  5IDN B;  4EOI B;  3MI9 B;  3LQ5 B;  3MY5 B;  3QHR B;  3BLR B;  5HBJ B;  2F2C A;  2BPM B;  1O9K B;  4EOR B;  4EOM B;  2W9F A;  1C9B A;  3TN8 B;  1OI9 B;  1VYW B;  1OIU B;  1ZP2 A;  2JGZ B;  3EID B;  1OKV B;  4BCP B;  4OGR B;  3DOG B;  2UZB B;  4BCQ B;  3BLQ B;  1D3U B;  2CCH B;  1JKW A;  1OIY B;  4CFX B;  1GUX A;  2WIP B;  2WHB B;  5HNB B;  1AIS B;  2W99 A;  2WEV B;  1UNH D;  2BKZ B;  1H24 B;  1FIN B;  2C5N B;  2PMI B;  4TTH A;  3POM A;  4F7J B;  2IW6 B;  3TNI B;  2PK9 B;  2W96 A;  2WFY B;  2I40 B;  4EOK B;  5CEI B;  1JSU B;  5EFQ B;  4CRL B;  4FX3 B;  2C5X B;  4II5 B;  4F6S B;  2C5V B;  4YOO A;  4F7L B;  2UZL B;  2R7G A;  4KRD B;  4BCF B;  3EJ1 B;  1URC B;  2C5O B;  4OR5 B;  2WMB B;  4BCN D;  2W2H A;  2W9Z A;  1UNG D;  1E9H B;  4CFM B;  4ELL A;  4ELJ A;  1H25 B;  1H1R B;  1KXU A;  3DDP B;  1F5Q B;  2UZD B;  4EC8 B;  5LQF B;  5HVY B;  5IDP B;  3BHU B;  4EOQ B;  3F5X B;  4CFU D;  1O9K A;  2WPA B;  1OL2 B;  2I53 A;  2CJM B;  4G6L B;  4ROE A;  1JST B;  3MIA B;  4BCO B;  3BHV B;  4ROD A;  5ICP B;  1H1P B;  3K7A M;  1G3N C;  4EC9 B;  5BNJ B;  5I5Z B;  1H26 B;  2WMA B;  1N4M A;  4BCN B;  2EUF A;  1AD6 A;  3RGF B;  4I3Z B;  1XO2 A;  3TNW B;  3EOC B;  1H4L D;  4BCH B;  3G33 B;  4EOL B;  1H1S B;  1OGU B;  4BCI B;  4F7N B;  1TFB A;  1H1Q B;  2PHG A;  4Y72 B;  4CFU B;  2UZE B;  2PK2 A;  3BHT B;  3DDQ B;  3QHW B;  1QMZ B;  1BU2 A;  5HBE B;  4EOJ B;  1H28 B;  2G9X B;  4BCJ B;  4CFN B;  1FVV B;  1PKD B;  4BCM D;  2WIH B; 
#chains in the Genus database with same CATH topology
 4YOZ A;  4CFW B;  4UN0 A;  3VKH A;  4HLQ A;  4LOC A;  3HZJ A;  4BCK B;  3VKG A;  1OKW B;  3H4C A;  3A8O B;  4ZGJ B;  4F6W B;  4OB3 B;  2ZPI B;  2CCI B;  4HNV A;  3LQ5 B;  3BLR B;  2BPM B;  1O9K B;  2LW4 A;  1C9B A;  4AKI A;  1OIU B;  1ZP2 A;  2D0Q B;  4AKG A;  2CCH B;  2WEV B;  1UNH D;  1E7P A;  1FIN B;  4OB1 B;  4TTH A;  4F7J B;  2I40 B;  2KR6 A;  3HBL A;  4F6S B;  5DQW A;  5EJC A;  2UZL B;  1URC B;  4OR5 B;  4BCN D;  2DPP B;  4ELJ A;  1H1R B;  4OB2 B;  1KXU A;  1FKM A;  2DXB B;  4EOQ B;  3F5X B;  1O9K A;  3KHI A;  4JX4 A;  1JST B;  3K7A M;  3X25 B;  3HO8 A;  3RGF B;  3EOC B;  1H4L D;  4BCH B;  3G33 B;  2ZPB B;  2DME A;  4NC6 A;  4BCI B;  4F7N B;  1H1Q B;  4CFU B;  4Y72 B;  3BHT B;  5DQV A;  3QXE B;  4AI6 A;  4CFN B;  3QYB A;  2WIH B;  2V22 B;  5L2W B;  5LMK B;  2IVX A;  1UNL D;  2IW8 B;  4NST B;  2QF7 A;  4F6U B;  1OL1 B;  4KRC B;  4EOP B;  3DTO A;  4BCM B;  4BY1 X;  2C6T B;  2IW9 B;  4F7S B;  3DJB A;  5HQ0 B;  2AHJ B;  3BG9 A;  1VIN A;  4HNT A;  3BLH B;  4CXA B;  3MY5 B;  3QHR B;  3QZ5 B;  4EOR B;  4EOM B;  2W9F A;  3TN8 B;  1OI9 B;  2ZPF B;  1VYW B;  2JGZ B;  2QGS A;  3BG3 A;  2UZB B;  2ZPE B;  3BLQ B;  3WVD B;  1AIS B;  2W99 A;  3A8L B;  1H24 B;  3POM A;  2IW6 B;  3TNI B;  2W96 A;  2IN3 A;  1JSU B;  4FX3 B;  2C5X B;  4YOO A;  3DL1 A;  2R7G A;  4KRD B;  4BCF B;  2W9Z A;  4CFM B;  5LQF B;  5HVY B;  5IDP B;  5IHY A;  4CFU D;  4BCO B;  3BHV B;  5I5Z B;  1N4M A;  4OB0 B;  2EUF A;  1AD6 A;  4I3Z B;  1XO2 A;  4EOL B;  1H1S B;  3A8G B;  2ZPH B;  1OGU B;  1AHJ B;  1BU2 A;  4EOJ B;  1H28 B;  4BCJ B;  4BCM D;  2UUE B;  3MY1 B;  4ROC A;  5ACB A;  5IF1 B;  2PJQ A;  4EOO B;  4EOS B;  2WXV B;  4AKH A;  3QZ9 B;  1GH6 B;  3NDQ A;  4YOS A;  3TNH B;  4YC3 B;  3VYH B;  1P5E B;  5CYI B;  2X1N B;  1UGQ B;  1W98 B;  4BBR M;  4BCG B;  3M03 A;  4MIM A;  5IDN B;  4BBS M;  3MI9 B;  5HBJ B;  2F2C A;  2CYZ B;  3B57 A;  4FM4 B;  4BCP B;  4OGR B;  2CZ0 B;  3A8M B;  4BCQ B;  1UGP B;  4CFX B;  2WIP B;  5HNB B;  2WJ9 A;  2BKZ B;  2C5N B;  2PMI B;  2PK9 B;  4EOK B;  2WFY B;  2BS3 A;  3X24 B;  5EFQ B;  4II5 B;  2C5V B;  4F7L B;  4M6V A;  4HNU A;  3PO3 S;  3A8H B;  2C5O B;  3TW7 A;  4ELL A;  1H25 B;  1F5Q B;  2UZD B;  4EC8 B;  2BS4 A;  3BHU B;  2WPA B;  4ROE A;  3MIA B;  4ROD A;  1H1P B;  1G3N C;  2G77 A;  4EC9 B;  3X28 B;  2QFZ A;  2CZ7 B;  2ZZD B;  1UGR B;  2PHG A;  2UZE B;  3TW6 A;  2PK2 A;  3DDQ B;  2G9X B;  4JX6 A;  1FVV B;  1PKD B;  4QSH A;  1VOL A;  1GUX B;  1UGS B;  4EON B;  1GY3 B;  5FGK B;  2BS2 A;  1TD6 A;  2C4G B;  2ZPG B;  4MFE A;  4ZGE B;  3HB9 A;  2QDJ A;  4IMY B;  3QYE A;  1V29 B;  5HBH B;  2B9R A;  3O0G D;  4HL4 A;  2ZCF B;  4CFV B;  4BCQ D;  1H27 B;  4F70 B;  1JOW A;  4EOI B;  2KMG A;  3QYG B;  3EID B;  1OKV B;  2CZ6 B;  4BY7 X;  3DOG B;  1D3U B;  1JKW A;  1OIY B;  2DD4 B;  1GUX A;  2DD5 B;  2WHB B;  3BG5 A;  3QYH B;  3HHT B;  4BXX X;  3VYG B;  5CEI B;  4CRL B;  3QWL A;  2QQ8 A;  3EJ1 B;  2CZ1 B;  1QLB A;  1IRE B;  2WMB B;  2W2H A;  4MFD A;  1UNG D;  1E9H B;  3WVE B;  3DDP B;  4ZGD B;  1OL2 B;  2I53 A;  2CJM B;  4G6L B;  4JX5 A;  2QDY B;  5ICP B;  5BNJ B;  1H26 B;  2WMA B;  4BCN B;  4Z6Y A;  3GTM S;  3TNW B;  1TFB A;  3QHW B;  1QMZ B;  2DXC B;  5HBE B;  1ENW A;  3X26 B;  3X20 B; 
#chains in the Genus database with same CATH homology
 2V22 B;  5L2W B;  1VOL A;  1GUX B;  4YOZ A;  4CFW B;  2UUE B;  3MY1 B;  4EON B;  1GY3 B;  4ROC A;  5ACB A;  5LMK B;  2IVX A;  1UNL D;  2IW8 B;  4UN0 A;  4NST B;  5IF1 B;  5FGK B;  4EOO B;  4F6U B;  2C4G B;  4EOS B;  1OL1 B;  2WXV B;  4KRC B;  4EOP B;  1GH6 B;  2QDJ A;  4IMY B;  4BCK B;  4BCM B;  5HBH B;  2C6T B;  2IW9 B;  4YOS A;  2B9R A;  3TNH B;  4YC3 B;  5CYI B;  1P5E B;  3O0G D;  1OKW B;  2X1N B;  5HQ0 B;  4F7S B;  3H4C A;  1W98 B;  4CFV B;  1VIN A;  4BCG B;  3BLH B;  4BCQ D;  4F6W B;  3M03 A;  1H27 B;  4F70 B;  1JOW A;  4CXA B;  2CCI B;  5IDN B;  4EOI B;  3MI9 B;  3LQ5 B;  3MY5 B;  3QHR B;  3BLR B;  5HBJ B;  2F2C A;  2BPM B;  1O9K B;  4EOR B;  4EOM B;  2W9F A;  1C9B A;  3TN8 B;  1OI9 B;  1VYW B;  1OIU B;  1ZP2 A;  2JGZ B;  3EID B;  1OKV B;  4BCP B;  4OGR B;  3DOG B;  2UZB B;  4BCQ B;  3BLQ B;  1D3U B;  2CCH B;  1JKW A;  1OIY B;  4CFX B;  1GUX A;  2WIP B;  2WHB B;  5HNB B;  1AIS B;  2W99 A;  2WEV B;  1UNH D;  2BKZ B;  1H24 B;  1FIN B;  2C5N B;  2PMI B;  4TTH A;  3POM A;  4F7J B;  2IW6 B;  3TNI B;  2PK9 B;  2W96 A;  2WFY B;  2I40 B;  4EOK B;  5CEI B;  1JSU B;  5EFQ B;  4CRL B;  4FX3 B;  2C5X B;  4II5 B;  4F6S B;  2C5V B;  4YOO A;  4F7L B;  2UZL B;  2R7G A;  4KRD B;  4BCF B;  3EJ1 B;  1URC B;  2C5O B;  4OR5 B;  2WMB B;  4BCN D;  2W2H A;  2W9Z A;  1UNG D;  1E9H B;  4CFM B;  4ELL A;  4ELJ A;  1H25 B;  1H1R B;  1KXU A;  3DDP B;  1F5Q B;  2UZD B;  4EC8 B;  5LQF B;  5HVY B;  5IDP B;  3BHU B;  4EOQ B;  3F5X B;  4CFU D;  1O9K A;  2WPA B;  1OL2 B;  2I53 A;  2CJM B;  4G6L B;  4ROE A;  1JST B;  3MIA B;  4BCO B;  3BHV B;  4ROD A;  5ICP B;  1H1P B;  3K7A M;  1G3N C;  4EC9 B;  5BNJ B;  5I5Z B;  1H26 B;  2WMA B;  1N4M A;  4BCN B;  2EUF A;  1AD6 A;  3RGF B;  4I3Z B;  1XO2 A;  3TNW B;  3EOC B;  1H4L D;  4BCH B;  3G33 B;  4EOL B;  1H1S B;  1OGU B;  4BCI B;  4F7N B;  1TFB A;  1H1Q B;  2PHG A;  4Y72 B;  4CFU B;  2UZE B;  2PK2 A;  3BHT B;  3DDQ B;  3QHW B;  1QMZ B;  1BU2 A;  5HBE B;  4EOJ B;  1H28 B;  2G9X B;  4BCJ B;  4CFN B;  1FVV B;  1PKD B;  4BCM D;  2WIH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...