4BCNB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLLDLHQTYLRAPKHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 257
sequence length 257
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcnB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bcnB02
4YC3B 4EORB 4EOMB 5L2WB 4KRDB 1AISB 1E9HB 2W9FA 1JSTB 3EIDB 5IDNB 2UZEB 1GUXA 5CYIB 4BCMD 4EOJB 3TN8B 3LQ5B 2PK2A 2WPAB 4OR5B 4BCMB 5IF1B 1KXUA 2W99A 5HQ0B 4EOQB 1C9BA 2X1NB 4CFUD 1JKWA 3O0GD 4BCNB 2PHGA 2WHBB 1G3NC 1UNGD 1ZP2A 4CFUB 2C6TB 4ELLA 5HVYB 4IMYB 4EONB 1P5EB 4EC8B 4F6WB 2UZLB 1OIYB 1QMZB 3BLRB 2WMBB 1OGUB 3BLQB 2B9RA 1H25B 4YOSA 2CJMB 4CFXB 2CCHB 1OL2B 2V22B 2R7GA 2I40B 2PMIB 3G33B 2IW6B 1JSUB 1H4LD 4CXAB 2F2CA 3TNWB 3F5XB 2JGZB 1GY3B 2C5VB 2UUEB 5BNJB 4F7JB 4EOPB 3BHVB 2WFYB 2PK9B 3DOGB 5HBJB 4BCGB 5CEIB 1H24B 1PKDB 3EOCB 5HBHB 4BCOB 4BCND 4OGRB 2I53A 4BCQD 2UZBB 1F5QB 2WIHB 5EFQB 1H1PB 4BCJB 5ACBA 4BCQB 2W96A 2IW9B 4F6SB 4NSTB 3DDQB 5HNBB 5LMKB 4EOLB 1VYWB 5ICPB 1URCB 2C4GB 1W98B 2WEVB 3TNIB 1H1QB 4F70B 4CFMB 4FX3B 4UN0A 1OI9B 4KRCB 4TTHA 5IDPB 1AD6A 4EOSB 2EUFA 1O9KB 3BHUB 2IW8B 1FVVB 5HBEB 3MY5B 1JOWA 4YOZA 4EOIB 1H28B 1OKWB 4YOOA 2W9ZA 1OKVB 3K7AM 4BCKB 1OIUB 1TFBA 1H1RB 3M03A 4G6LB 1O9KA 3TNHB 4BCIB 4F7NB 2UZDB 4F7SB 1XO2A 4RODA 1VOLA 4EC9B 4EOOB 2WIPB 3DDPB 4ROEA 1H26B 4F7LB 2C5NB 2W2HA 2WXVB 3MIAB 4I3ZB 3EJ1B 2C5XB 3QHRB 4II5B 4ROCA 4BCPB 2QDJA 3RGFB 3MY1B 4F6UB 5I5ZB 2G9XB 4BCFB 2BPMB 4CFNB 4CFVB 1OL1B 3BHTB 1D3UB 1H27B 1VINA 2BKZB 2IVXA 2CCIB 5LQFB 3MI9B 2C5OB 4ELJA 3QHWB 1N4MA 3POMA 4CFWB 1H1SB 1UNHD 4BCHB 4CRLB 1BU2A 5FGKB 1UNLD 4EOKB 1GUXB 1FINB 1GH6B 3BLHB 4Y72B 2WMAB 3H4CA
chains in the Genus database with same CATH superfamily
4EOMB 1AISB 1E9HB 3EIDB 2UZEB 2CZ0B 3PO3S 2CZ6B 5CYIB 4EOJB 3TN8B 2PK2A 2BS3A 3O0GD 3QYEA 4BCNB 2PHGA 1G3NC 1UNGD 4CFUB 4ELLA 1QMZB 3BLRB 2B9RA 2V22B 4AKHA 2R7GA 2PMIB 3BG3A 4CXAB 4LOCA 2C5VB 2UUEB 4F7JB 3BHVB 2WFYB 4NC6A 1ENWA 5HBJB 4BCGB 2IN3A 3QYBA 1H24B 4QSHA 4MFDA 4BCND 2DPPB 4OB1B 3X20B 3WVEB 5LMKB 1VYWB 4ZGDB 2DXBB 1UGQB 5EJCA 1OI9B 4KRCB 5IDPB 3QWLA 2EUFA 3VYHB 2IW8B 5HBEB 1JOWA 4YOZA 1H28B 1OKVB 4BCKB 2DXCB 3QXEB 4OB2B 4EOOB 2WIPB 4OB3B 4F7LB 2WXVB 3RGFB 4F6UB 2G9XB 4HNVA 1D3UB 3BHTB 1UGSB 1VINA 2BKZB 2QFZA 2IVXA 2CCIB 1H1SB 4BCHB 1UNLD 1FINB 4Y72B 2ZZDB 4YC3B 4EORB 2KR6A 5L2WB 2QGSA 2W9FA 1JSTB 3QYGB 2ZPEB 3LQ5B 4OR5B 2W99A 4EOQB 2X1NB 4OB0B 4ZGJB 2C6TB 5HVYB 1P5EB 4EC8B 2BS2A 1QLBA 2LW4A 2WMBB 3BLQB 3HO8A 2QDYB 3TNWB 4JX5A 1GY3B 3QZ5B 2PK9B 4BXXX 1TD6A 1PKDB 4BCQD 2UZBB 1F5QB 5ACBA 3A8GB 2IW9B 2KMGA 5ICPB 4CFMB 4UN0A 1AD6A 4EOSB 1O9KB 3X28B 3BHUB 2ZPHB 2W9ZA 4Z6YA 1TFBA 4F7NB 1O9KA 4BCIB 4F7SB 1XO2A 1VOLA 4EC9B 3DDPB 4ROEA 3A8OB 3A8HB 3WVDB 3EJ1B 3QHRB 4II5B 3KHIA 2QQ8A 3MY1B 4BY1X 4BY7X 2BPMB 4CFNB 1OL1B 1V29B 2DD5B 3MI9B 1UGPB 4ELJA 4HL4A 1BU2A 5FGKB 1GUXB 3BLHB 5IHYA 3X26B 4AI6A 4AKIA 2PJQA 1GUXA 4BCMD 2WPAB 5IF1B 1KXUA 1C9BA 1JKWA 4M6VA 4EONB 2UZLB 1OIYB 3DL1A 4HLQA 4CFXB 2CCHB 2I40B 2IW6B 3BG5A 2G77A 3HZJA 2F2CA 3B57A 5BNJB 5CEIB 4BCOB 4OGRB 4MIMA 4BCQB 2DD4B 4F6SB 3HHTB 4NSTB 5HNBB 4ZGEB 1URCB 2C4GB 1W98B 4FX3B 4TTHA 2CZ7B 3DTOA 3TW7A 3MY5B 4YOOA 3K7AM 4BBSM 1OIUB 1H1RB 3M03A 1UGRB 3BG9A 1H26B 2C5NB 4HNTA 2W2HA 3MIAB 2C5XB 5I5ZB 2QDJA 4BCFB 3DJBA 1H27B 4HNUA 5LQFB 3QYHB 2C5OB 5DQWA 3HB9A 3QHWB 1N4MA 3POMA 4CFWB 4EOKB 1GH6B 3X25B 3VKGA 3H4CA 2ZPGB 4KRDB 3GTMS 2QF7A 5IDNB 3VKHA 2AHJB 4BCMB 5HQ0B 3X24B 1IREB 4CFUD 2WHBB 1ZP2A 4IMYB 4F6WB 3A8MB 2BS4A 2ZPIB 1OGUB 4YOSA 1H25B 2CJMB 4MFEA 3NDQA 1OL2B 4BBRM 3G33B 1JSUB 1H4LD 1E7PA 2CYZB 3F5XB 2JGZB 3HBLA 4EOPB 3DOGB 3EOCB 5HBHB 2I53A 3QZ9B 2WIHB 5EFQB 1H1PB 4BCJB 2W96A 3DDQB 4EOLB 3VYGB 2WEVB 3TNIB 1H1QB 4F70B 4AKGA 1FVVB 4EOIB 1OKWB 2CZ1B 2ZCFB 2D0QB 4G6LB 3TNHB 2UZDB 4RODA 4JX6A 5DQVA 4I3ZB 3TW6A 4ROCA 4BCPB 1FKMA 4CFVB 2ZPBB 2ZPFB 4FM4B 2WJ9A 2DMEA 4JX4A 1AHJB 1UNHD 4CRLB 3A8LB 2WMAB
chains in the Genus database with same CATH topology
4YC3B 4EORB 4EOMB 5L2WB 4KRDB 1AISB 1E9HB 2W9FA 1JSTB 3EIDB 5IDNB 2UZEB 1GUXA 5CYIB 4BCMD 4EOJB 3TN8B 3LQ5B 2PK2A 2WPAB 4OR5B 4BCMB 5IF1B 1KXUA 2W99A 5HQ0B 4EOQB 1C9BA 2X1NB 4CFUD 1JKWA 3O0GD 4BCNB 2PHGA 2WHBB 1G3NC 1UNGD 1ZP2A 4CFUB 2C6TB 4ELLA 5HVYB 4IMYB 4EONB 1P5EB 4EC8B 4F6WB 2UZLB 1OIYB 1QMZB 3BLRB 2WMBB 1OGUB 3BLQB 2B9RA 1H25B 4YOSA 2CJMB 4CFXB 2CCHB 1OL2B 2V22B 2R7GA 2I40B 2PMIB 3G33B 2IW6B 1JSUB 1H4LD 4CXAB 2F2CA 3TNWB 3F5XB 2JGZB 1GY3B 2C5VB 2UUEB 5BNJB 4F7JB 4EOPB 3BHVB 2WFYB 2PK9B 3DOGB 5HBJB 4BCGB 5CEIB 1H24B 1PKDB 3EOCB 5HBHB 4BCOB 4BCND 4OGRB 2I53A 4BCQD 2UZBB 1F5QB 2WIHB 5EFQB 1H1PB 4BCJB 5ACBA 4BCQB 2W96A 2IW9B 4F6SB 4NSTB 3DDQB 5HNBB 5LMKB 4EOLB 1VYWB 5ICPB 1URCB 2C4GB 1W98B 2WEVB 3TNIB 1H1QB 4F70B 4CFMB 4FX3B 4UN0A 1OI9B 4KRCB 4TTHA 5IDPB 1AD6A 4EOSB 2EUFA 1O9KB 3BHUB 2IW8B 1FVVB 5HBEB 3MY5B 1JOWA 4YOZA 4EOIB 1H28B 1OKWB 4YOOA 2W9ZA 1OKVB 3K7AM 4BCKB 1OIUB 1TFBA 1H1RB 3M03A 4G6LB 1O9KA 3TNHB 4BCIB 4F7NB 2UZDB 4F7SB 1XO2A 4RODA 1VOLA 4EC9B 4EOOB 2WIPB 3DDPB 4ROEA 1H26B 4F7LB 2C5NB 2W2HA 2WXVB 3MIAB 4I3ZB 3EJ1B 2C5XB 3QHRB 4II5B 4ROCA 4BCPB 2QDJA 3RGFB 3MY1B 4F6UB 5I5ZB 2G9XB 4BCFB 2BPMB 4CFNB 4CFVB 1OL1B 3BHTB 1D3UB 1H27B 1VINA 2BKZB 2IVXA 2CCIB 5LQFB 3MI9B 2C5OB 4ELJA 3QHWB 1N4MA 3POMA 4CFWB 1H1SB 1UNHD 4BCHB 4CRLB 1BU2A 5FGKB 1UNLD 4EOKB 1GUXB 1FINB 1GH6B 3BLHB 4Y72B 2WMAB 3H4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YC3 B;  4EOR B;  4EOM B;  5L2W B;  4KRD B;  1AIS B;  1E9H B;  2W9F A;  1JST B;  3EID B;  5IDN B;  2UZE B;  1GUX A;  5CYI B;  4BCM D;  4EOJ B;  3TN8 B;  3LQ5 B;  2PK2 A;  2WPA B;  4OR5 B;  4BCM B;  5IF1 B;  1KXU A;  2W99 A;  5HQ0 B;  4EOQ B;  1C9B A;  2X1N B;  4CFU D;  1JKW A;  3O0G D;  4BCN B;  2PHG A;  2WHB B;  1G3N C;  1UNG D;  1ZP2 A;  4CFU B;  2C6T B;  4ELL A;  5HVY B;  4IMY B;  4EON B;  1P5E B;  4EC8 B;  4F6W B;  2UZL B;  1OIY B;  1QMZ B;  3BLR B;  2WMB B;  1OGU B;  3BLQ B;  2B9R A;  1H25 B;  4YOS A;  2CJM B;  4CFX B;  2CCH B;  1OL2 B;  2V22 B;  2R7G A;  2I40 B;  2PMI B;  3G33 B;  2IW6 B;  1JSU B;  1H4L D;  4CXA B;  2F2C A;  3TNW B;  3F5X B;  2JGZ B;  1GY3 B;  2C5V B;  2UUE B;  5BNJ B;  4F7J B;  4EOP B;  3BHV B;  2WFY B;  2PK9 B;  3DOG B;  5HBJ B;  4BCG B;  5CEI B;  1H24 B;  1PKD B;  3EOC B;  5HBH B;  4BCO B;  4BCN D;  4OGR B;  2I53 A;  4BCQ D;  2UZB B;  1F5Q B;  2WIH B;  5EFQ B;  1H1P B;  4BCJ B;  5ACB A;  4BCQ B;  2W96 A;  2IW9 B;  4F6S B;  4NST B;  3DDQ B;  5HNB B;  5LMK B;  4EOL B;  1VYW B;  5ICP B;  1URC B;  2C4G B;  1W98 B;  2WEV B;  3TNI B;  1H1Q B;  4F70 B;  4CFM B;  4FX3 B;  4UN0 A;  1OI9 B;  4KRC B;  4TTH A;  5IDP B;  1AD6 A;  4EOS B;  2EUF A;  1O9K B;  3BHU B;  2IW8 B;  1FVV B;  5HBE B;  3MY5 B;  1JOW A;  4YOZ A;  4EOI B;  1H28 B;  1OKW B;  4YOO A;  2W9Z A;  1OKV B;  3K7A M;  4BCK B;  1OIU B;  1TFB A;  1H1R B;  3M03 A;  4G6L B;  1O9K A;  3TNH B;  4BCI B;  4F7N B;  2UZD B;  4F7S B;  1XO2 A;  4ROD A;  1VOL A;  4EC9 B;  4EOO B;  2WIP B;  3DDP B;  4ROE A;  1H26 B;  4F7L B;  2C5N B;  2W2H A;  2WXV B;  3MIA B;  4I3Z B;  3EJ1 B;  2C5X B;  3QHR B;  4II5 B;  4ROC A;  4BCP B;  2QDJ A;  3RGF B;  3MY1 B;  4F6U B;  5I5Z B;  2G9X B;  4BCF B;  2BPM B;  4CFN B;  4CFV B;  1OL1 B;  3BHT B;  1D3U B;  1H27 B;  1VIN A;  2BKZ B;  2IVX A;  2CCI B;  5LQF B;  3MI9 B;  2C5O B;  4ELJ A;  3QHW B;  1N4M A;  3POM A;  4CFW B;  1H1S B;  1UNH D;  4BCH B;  4CRL B;  1BU2 A;  5FGK B;  1UNL D;  4EOK B;  1GUX B;  1FIN B;  1GH6 B;  3BLH B;  4Y72 B;  2WMA B;  3H4C A; 
#chains in the Genus database with same CATH topology
 4EOM B;  1AIS B;  1E9H B;  3EID B;  2UZE B;  2CZ0 B;  3PO3 S;  2CZ6 B;  5CYI B;  4EOJ B;  3TN8 B;  2PK2 A;  2BS3 A;  3O0G D;  3QYE A;  4BCN B;  2PHG A;  1G3N C;  1UNG D;  4CFU B;  4ELL A;  1QMZ B;  3BLR B;  2B9R A;  2V22 B;  4AKH A;  2R7G A;  2PMI B;  3BG3 A;  4CXA B;  4LOC A;  2C5V B;  2UUE B;  4F7J B;  3BHV B;  2WFY B;  4NC6 A;  1ENW A;  5HBJ B;  4BCG B;  2IN3 A;  3QYB A;  1H24 B;  4QSH A;  4MFD A;  4BCN D;  2DPP B;  4OB1 B;  3X20 B;  3WVE B;  5LMK B;  1VYW B;  4ZGD B;  2DXB B;  1UGQ B;  5EJC A;  1OI9 B;  4KRC B;  5IDP B;  3QWL A;  2EUF A;  3VYH B;  2IW8 B;  5HBE B;  1JOW A;  4YOZ A;  1H28 B;  1OKV B;  4BCK B;  2DXC B;  3QXE B;  4OB2 B;  4EOO B;  2WIP B;  4OB3 B;  4F7L B;  2WXV B;  3RGF B;  4F6U B;  2G9X B;  4HNV A;  1D3U B;  3BHT B;  1UGS B;  1VIN A;  2BKZ B;  2QFZ A;  2IVX A;  2CCI B;  1H1S B;  4BCH B;  1UNL D;  1FIN B;  4Y72 B;  2ZZD B;  4YC3 B;  4EOR B;  2KR6 A;  5L2W B;  2QGS A;  2W9F A;  1JST B;  3QYG B;  2ZPE B;  3LQ5 B;  4OR5 B;  2W99 A;  4EOQ B;  2X1N B;  4OB0 B;  4ZGJ B;  2C6T B;  5HVY B;  1P5E B;  4EC8 B;  2BS2 A;  1QLB A;  2LW4 A;  2WMB B;  3BLQ B;  3HO8 A;  2QDY B;  3TNW B;  4JX5 A;  1GY3 B;  3QZ5 B;  2PK9 B;  4BXX X;  1TD6 A;  1PKD B;  4BCQ D;  2UZB B;  1F5Q B;  5ACB A;  3A8G B;  2IW9 B;  2KMG A;  5ICP B;  4CFM B;  4UN0 A;  1AD6 A;  4EOS B;  1O9K B;  3X28 B;  3BHU B;  2ZPH B;  2W9Z A;  4Z6Y A;  1TFB A;  4F7N B;  1O9K A;  4BCI B;  4F7S B;  1XO2 A;  1VOL A;  4EC9 B;  3DDP B;  4ROE A;  3A8O B;  3A8H B;  3WVD B;  3EJ1 B;  3QHR B;  4II5 B;  3KHI A;  2QQ8 A;  3MY1 B;  4BY1 X;  4BY7 X;  2BPM B;  4CFN B;  1OL1 B;  1V29 B;  2DD5 B;  3MI9 B;  1UGP B;  4ELJ A;  4HL4 A;  1BU2 A;  5FGK B;  1GUX B;  3BLH B;  5IHY A;  3X26 B;  4AI6 A;  4AKI A;  2PJQ A;  1GUX A;  4BCM D;  2WPA B;  5IF1 B;  1KXU A;  1C9B A;  1JKW A;  4M6V A;  4EON B;  2UZL B;  1OIY B;  3DL1 A;  4HLQ A;  4CFX B;  2CCH B;  2I40 B;  2IW6 B;  3BG5 A;  2G77 A;  3HZJ A;  2F2C A;  3B57 A;  5BNJ B;  5CEI B;  4BCO B;  4OGR B;  4MIM A;  4BCQ B;  2DD4 B;  4F6S B;  3HHT B;  4NST B;  5HNB B;  4ZGE B;  1URC B;  2C4G B;  1W98 B;  4FX3 B;  4TTH A;  2CZ7 B;  3DTO A;  3TW7 A;  3MY5 B;  4YOO A;  3K7A M;  4BBS M;  1OIU B;  1H1R B;  3M03 A;  1UGR B;  3BG9 A;  1H26 B;  2C5N B;  4HNT A;  2W2H A;  3MIA B;  2C5X B;  5I5Z B;  2QDJ A;  4BCF B;  3DJB A;  1H27 B;  4HNU A;  5LQF B;  3QYH B;  2C5O B;  5DQW A;  3HB9 A;  3QHW B;  1N4M A;  3POM A;  4CFW B;  4EOK B;  1GH6 B;  3X25 B;  3VKG A;  3H4C A;  2ZPG B;  4KRD B;  3GTM S;  2QF7 A;  5IDN B;  3VKH A;  2AHJ B;  4BCM B;  5HQ0 B;  3X24 B;  1IRE B;  4CFU D;  2WHB B;  1ZP2 A;  4IMY B;  4F6W B;  3A8M B;  2BS4 A;  2ZPI B;  1OGU B;  4YOS A;  1H25 B;  2CJM B;  4MFE A;  3NDQ A;  1OL2 B;  4BBR M;  3G33 B;  1JSU B;  1H4L D;  1E7P A;  2CYZ B;  3F5X B;  2JGZ B;  3HBL A;  4EOP B;  3DOG B;  3EOC B;  5HBH B;  2I53 A;  3QZ9 B;  2WIH B;  5EFQ B;  1H1P B;  4BCJ B;  2W96 A;  3DDQ B;  4EOL B;  3VYG B;  2WEV B;  3TNI B;  1H1Q B;  4F70 B;  4AKG A;  1FVV B;  4EOI B;  1OKW B;  2CZ1 B;  2ZCF B;  2D0Q B;  4G6L B;  3TNH B;  2UZD B;  4ROD A;  4JX6 A;  5DQV A;  4I3Z B;  3TW6 A;  4ROC A;  4BCP B;  1FKM A;  4CFV B;  2ZPB B;  2ZPF B;  4FM4 B;  2WJ9 A;  2DME A;  4JX4 A;  1AHJ B;  1UNH D;  4CRL B;  3A8L B;  2WMA B; 
#chains in the Genus database with same CATH homology
 4YC3 B;  4EOR B;  4EOM B;  5L2W B;  4KRD B;  1AIS B;  1E9H B;  2W9F A;  1JST B;  3EID B;  5IDN B;  2UZE B;  1GUX A;  5CYI B;  4BCM D;  4EOJ B;  3TN8 B;  3LQ5 B;  2PK2 A;  2WPA B;  4OR5 B;  4BCM B;  5IF1 B;  1KXU A;  2W99 A;  5HQ0 B;  4EOQ B;  1C9B A;  2X1N B;  4CFU D;  1JKW A;  3O0G D;  4BCN B;  2PHG A;  2WHB B;  1G3N C;  1UNG D;  1ZP2 A;  4CFU B;  2C6T B;  4ELL A;  5HVY B;  4IMY B;  4EON B;  1P5E B;  4EC8 B;  4F6W B;  2UZL B;  1OIY B;  1QMZ B;  3BLR B;  2WMB B;  1OGU B;  3BLQ B;  2B9R A;  1H25 B;  4YOS A;  2CJM B;  4CFX B;  2CCH B;  1OL2 B;  2V22 B;  2R7G A;  2I40 B;  2PMI B;  3G33 B;  2IW6 B;  1JSU B;  1H4L D;  4CXA B;  2F2C A;  3TNW B;  3F5X B;  2JGZ B;  1GY3 B;  2C5V B;  2UUE B;  5BNJ B;  4F7J B;  4EOP B;  3BHV B;  2WFY B;  2PK9 B;  3DOG B;  5HBJ B;  4BCG B;  5CEI B;  1H24 B;  1PKD B;  3EOC B;  5HBH B;  4BCO B;  4BCN D;  4OGR B;  2I53 A;  4BCQ D;  2UZB B;  1F5Q B;  2WIH B;  5EFQ B;  1H1P B;  4BCJ B;  5ACB A;  4BCQ B;  2W96 A;  2IW9 B;  4F6S B;  4NST B;  3DDQ B;  5HNB B;  5LMK B;  4EOL B;  1VYW B;  5ICP B;  1URC B;  2C4G B;  1W98 B;  2WEV B;  3TNI B;  1H1Q B;  4F70 B;  4CFM B;  4FX3 B;  4UN0 A;  1OI9 B;  4KRC B;  4TTH A;  5IDP B;  1AD6 A;  4EOS B;  2EUF A;  1O9K B;  3BHU B;  2IW8 B;  1FVV B;  5HBE B;  3MY5 B;  1JOW A;  4YOZ A;  4EOI B;  1H28 B;  1OKW B;  4YOO A;  2W9Z A;  1OKV B;  3K7A M;  4BCK B;  1OIU B;  1TFB A;  1H1R B;  3M03 A;  4G6L B;  1O9K A;  3TNH B;  4BCI B;  4F7N B;  2UZD B;  4F7S B;  1XO2 A;  4ROD A;  1VOL A;  4EC9 B;  4EOO B;  2WIP B;  3DDP B;  4ROE A;  1H26 B;  4F7L B;  2C5N B;  2W2H A;  2WXV B;  3MIA B;  4I3Z B;  3EJ1 B;  2C5X B;  3QHR B;  4II5 B;  4ROC A;  4BCP B;  2QDJ A;  3RGF B;  3MY1 B;  4F6U B;  5I5Z B;  2G9X B;  4BCF B;  2BPM B;  4CFN B;  4CFV B;  1OL1 B;  3BHT B;  1D3U B;  1H27 B;  1VIN A;  2BKZ B;  2IVX A;  2CCI B;  5LQF B;  3MI9 B;  2C5O B;  4ELJ A;  3QHW B;  1N4M A;  3POM A;  4CFW B;  1H1S B;  1UNH D;  4BCH B;  4CRL B;  1BU2 A;  5FGK B;  1UNL D;  4EOK B;  1GUX B;  1FIN B;  1GH6 B;  3BLH B;  4Y72 B;  2WMA B;  3H4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...