2DPPB

Crystal structure of thermostable bacillus sp. rapc8 nitrile hydratase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLAFGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIPRREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratse
rcsb
source organism Bacillus sp. rapc8
total genus 62
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2dppB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dppB02
3X24B 4L6V5 2DD4A 2DPPB 2ZZDB 2QDYB 1IREB 2PVGB 3X28B 2ZPBB 2PU9B 1UGRB 2ZPFB 2PVDB 2DXCA 1AHJB 1PSEA 2WSFE 2ZZDA 5L8RE 3HHTB 4OB1B 3QYGB 3QYHB 1PSFA 3A8OB 3X26B 1QP2A 2CZ0B 1DJ7B 1V29B 3QZ9B 2ZPEB 3VYHB 2DD5B 4OB2B 4ZGJB 1GXIE 3A8GB 1UGPB 3WVDB 2O01E 4ZGEB 3A8LB 3QXEB 2ZPIB 2PUKB 2DXBB 1UGQB 3A8MB 2CZ6B 3X20B 4RKUE 1JB0E 2WSEE 2PVOB 2DXBA 2DD5A 2CYZB 4FM4B 4Y28E 4XK8E 3X25B 1UGSB 2ZPGB 2AHJB 2ZCFB 3VYGB 4KT0E 3QZ5B 4OB0B 2ZPHB 4OB3B 2DD4B 3WVEB 2PUOB 3A8HB 4ZGDB 2WSCE 2CZ7B 3VYGA 2D0QB 2CZ1B 3LW5E 1QP3A 2DXCB
chains in the Genus database with same CATH superfamily
3A1PA 3JCMf 3H6ZA 3GOXA 5CIUA 2DNUA 1Z9QA 4J6WA 4LN2A 4FCYA 1OI1A 1YHQA 4D8KA 5GMKi 3JB9G 4M75G 3KHIA 2GNCA 3JCMQ 4G6LB 1QVGA 4QQ6A 3UA6A 2DK3A 3NDQA 1UGVA 2X3XD 5EJCA 4C0FA 1RAGB 2QGGA 4BCND 1ZQ1A 3EGDB 4RTWA 2LMJA 4M77E 4RTUA 1UNLD 2RB6A 4M78C 4J8OA 3L2VA 1GCPA 4J6YA 1D3UB 1VIFA 5HK0A 2WXVB 2LT4A 1GXIE 3A5ZB 1VOLA 2QQAA 4O6JA 2QGSA 5HY6A 3G4SA 1H1QB 2F5TX 3PMIA 5I11A 1B7TA 5GJWB 2G9XB 1JXMA 1N9SA 3FLGA 3ULRB 3S3MA 2HQEA 1JO8A 1LPLA 2IG0A 2PNIA 3CQTA 3CCMT 4KUDK 3CD6T 2WJ9A 3M59A 5HVYB 1M1FA 5CAIA 2DBKA 3OYFA 4JJNK 4FYWB 2W0ZA 4EMKB 4M7AE 2WFYB 3EJ1B 3VKHA 4NL2A 2O4XA 1F1BB 4NSTB 3MEWA 3RKXA 3TSZA 3EG3A 4RODA 1WHJA 2ROTA 3RUXA 4F17A 1VQNA 2WIPB 2HQHA 1TFBA 2PMIB 3BHUB 3ER0A 1W2BA 3OYMA 3BLQB 1UHFA 2AHJB 3H4CA 3CXCA 1FMVA 1SPKA 3BW1A 3TW7A 3CMAA 4BBSM 2CCHB 3ZBDA 4OVAA 1B07A 1UNGD 3OYJA 5CQXA 5IN1A 2KDSA 4CI0C 3O0GD 3G6EA 2ZPBB 3E19A 5AYFA 3FJPA 4PJNA 5L23A 3QUIA 3I55A 1OPKA 2JM8A 2KROA 5LJ5e 1PG5B 3M5AA 2CP5A 3OMGA 2W99A 2QASA 3FDRA 4OB1B 3CBMA 4KGZB 2OTLA 4XTUA 4TTHA 1VQ9A 1BIBA 4EOSB 4OMOA 4WTOB 2DAQA 4LDWA 3JCMg 5I21A 1N5ZA 1DJ7B 2HZYA 2V8IA 2DD5B 2C6TB 2G3RA 2C06A 2MYSA 2C0TA 1YJWA 2X35A 2XI9A 4ORZA 4PJOA 2PZ1A 1IZ6A 2EQMA 1MMAA 5KYNA 3CCET 2JW4A 4M7AB 2DETA 4QSHA 1BYMA 2A37A 1WNLA 2KVQG 2YDLA 4QQDA 5LJ3h 1WQ7A 3P8DA 5LJ5j 4M6VA 4D8DA 1O9KA 4BI8B 1D1AA 4JRIA 4RTXA 3CCMQ 3CD6Q 4JRQA 1W6XA 1H3ZA 1Q86C 2MWPA 2DE0X 2FZKB 2EQUA 3EAEA 1YITA 4M78F 4XU0A 2O88A 4EC9B 1NG2A 1ENWA 1IRXA 4C92A 2DMOA 2K5LA 2KYMA 1M1GA 1H25B 2DVJA 2YRCA 3P8BB 4C8QG 2L3QA 3QBYA 3M57A 3NGPA 5FLXE 3EG1A 3CCVA 2CH4A 3FJ5A 1XO2A 4Z02A 2QTVA 1VYTA 1KQ1A 4OB3B 2RD1A 1Y07A 1QKXA 1N8RR 2O9VA 4GLKA 5GAOp 1A0NB 4HCZA 5FROA 3JB9J 4M75A 5GMKm 3OA6A 2EQJA 1S72Q 5ICPB 4BCGB 2UZEB 3DLMA 2DXCB 2HSEB 1MMDA 2EVRA 3JCMW 2XDDA 1X2KA 2KRSA 2M0OA 2A08A 1OULA 4DEYA 1AWJA 4LDXA 2QEXQ 3EFOA 1C0MA 3RERA 4YTLA 2Y4XA 1WXTA 2H3JA 5KH6A 4FT4A 1WHKA 4F7NB 1BB9A 2OAUA 2YSQA 3TREA 3HL8A 1VYVA 4HCKA 2C0OA 2FPEA 2DJZA 4BDYA 1WQWA 3QHWB 2K3BA 1PKTA 2BE7D 2OTJT 3MI9B 5DQWA 1HXDA 3A8GB 4YOSA 2BKZB 1UGPB 1N8RU 5CEIB 1UG1A 4BCFB 1M2VB 4HCBA 2KT8A 1JU5C 4J9DA 4F7UG 2AKLA 4M7AD 3ASKA 1M5Q1 5CKEA 1M8MA 3OYKA 2GFAA 3CCEQ 2CKKA 4CFMB 4RTYA 2KAFA 3I5RA 4FL6A 4ZNXA 3OBYA 2EGAA 3LWIA 1MNDA 1ABQA 5IXBA 1M1KR 1GH6B 4CFUB 4EC8B 2KI7A 4XU2A 4HT9A 3MEVA 1NLPC 2WSEE 1M4ZA 1MMGA 1ZUKA 2VYTA 3EFRA 1EIFA 2JM9A 5IXFA 4KRCB 1Y96A 2EAYA 3QIIA 2HAXA 3QWLA 2DEQA 5KCHA 1YNZA 1WXBA 5GAMd 2X3WD 4LXCA 2CDTA 2YUNA 2NUPA 1YIJA 2JT4A 2LJ1A 2V8JA 1T3LA 3QZ5B 1FINB 3H0HA 1VQNT 2COYA 4BDZA 1LCKA 3RMQA 3SDZA 3CMEQ 5GAN3 5GMKe 1D1BA 1P5EB 5DLOA 1E6GA 4K11A 2HCKA 4BCMB 4HT8A 4XTZA 3QHRB 2NUZA 3I56T 4EOQB 1Q81C 2DPPB 2X1NB 2DKGA 2K3YA 3FRNA 1M1KU 4J6XA 5D6YA 2PVDB 1H3HA 1IGQA 1ZSZA 2BS3A 5FW9A 2K5IA 2D8HA 4QVZA 5L8RE 3G1JA 1JQQA 5LJ5g 2YHTA 4LDUA 2DIQA 3JAME 4CC2A 1MGQA 1PSFA 3PFSA 3PVLA 1N6AA 3VS5A 1KQ2A 1AVZC 2BKDN 2I0NA 2COZA 2FRYA 1BCOA 2K2VA 3TQ7P 3DJBA 3DB4A 3CPWS 1SRMA 2CS7A 3VYHB 1PC0A 2HSPA 1D1CA 2VUBA 1GUXA 3JCMP 2QXFA 3G71A 4KULA 1GFDA 1XJWB 2HBWA 1R77A 3INZA 4JS5A 2L8DA 1M1KC 4BCHB 1UNHD 2CSQA 1FYNA 2DA9A 4TVRA 3MJXA 5KYWA 1IO6A 2CP7A 5IHKA 2QA4A 1QLYA 4F7JB 1KXUA 2RQVA 2DLPA 1AWWA 3DOGB 3UDCA 1Y71A 2LJ0A 4C5HA 5FWCA 5LL6S 2LTOA 2XICA 4PLIA 4C8QA 1XOVA 1HJDA 2DXBA 3SWNA 4AG2C 1G3WA 2JS0A 5KYXB 3VV0A 4OMQA 3MPUB 2F2VA 2EBPA 3MO8A 1C6VX 1VQMA 4WF2A 2KE9A 5IHYA 2EQIA 1SEMA 1Q7YR 2C5XB 1JJ2A 1UHCA 1O75A 4AI6A 3GNGA 5ACBA 1UECA 2XDPA 3CC2T 5CQYA 5EG2A 1KHIA 1QKWA 5BNJB 1ZSGA 1X2QA 1OKVB 1VQNQ 2DRMA 4PK4A 1YWPA 5AT1B 3VYGA 4C92C 2RO0A 9ATCB 4EOOB 4CFWB 3CCUA 4Q5WA 2ZZDB 2QDYB 1VQ5T 3QPHA 3I56Q 2O2OA 3OYIA 3GIBA 3AHUA 2DM1A 3CC4T 3U23A 1AD6A 5GAOn 4JJCA 1KQSS 3BDLA 2WSFE 3OYYA 3VRYA 1K1ZA 2V8KA 2JMCA 2UZBB 1SHFA 3JSCA 2BZYA 2YLBA 3G6EQ 4M75C 3F5XB 5KYYA 4F6WB 3OS2A 1Q86R 1TOVA 4FW1A 2FZCB 4N0AA 4OMMA 1Q7YU 3MCAB 4F7UA 2VXEA 5EFQB 4ROCA 2L3SA 2B8AA 2O9SA 4HNTA 1VQ9Q 3CCJT 1MV3A 5IAYA 2CREA 2RM4A 1HYOA 1MHNA 3CC7A 4BE0A 1K9MC 5LJ3e 1ZA2B 2B86A 3L1AA 1AT1B 2DVEA 3I9QA 3OYAA 2XDBA 3PMTA 3TSWA 3HRTA 1URCB 2BE9B 3VKGA 2IVXA 4Z8AA 3CCQT 5IDPB 3QWYA 1Y0MA 2WMBB 1U5SA 4XU1A 2RI2A 5GANj 1Q86U 3DDPB 2RN8A 2RA2A 3QDFA 2DRKA 3EG9B 1Q82C 1Y57A 2QQ9A 1D0XA 1VQPT 1K73C 2FPFA 3BFMA 5KYUA 3M54A 1YITQ 1QLBA 2AZSA 4PJOG 1QVGS 2ZCFB 2EW3A 1WPYA 4BCQB 5GMKl 1SSFA 1YJ9A 2ZPHB 2DMEA 1YI2A 1UFFA 1AZGB 2CP0A 4M7DA 1G8XA 2QDLA 5CKHA 3HFOA 1VQKT 2OX7A 3CPWP 3M03A 4L6V5 2E41A 4KH1B 3K7AM 2GTOA 1FMWA 1FXXA 4C5GA 2WMAB 1OIUB 4EOIB 2GF7A 1VQ5Q 2LDMA 3TU4K 2JXBA 2GQIA 4C92G 3EG2A 4MZMA 3CC4Q 4BBRM 2L89A 2DBMA 3PO3S 4PKCC 1UEBA 1ZBJA 2P0KA 1MNEA 2A7YA 1NEGA 3DKMA 3NHNA 4E7LA 5FU6C 5LJ3f 1NLOC 1KD1C 1NJIC 1BU2A 1V29B 3E9GA 4J9IA 1ZX6A 5CKFA 4PNOA 5KE3A 2YRDA 2ZGWA 1OZ3A 4PL6A 1ZSZC 5GAN8 2JJ9A 2LJ3A 3CCJQ 1FKMA 3M4YA 3BDUA 3FB9A 2XKOC 1RACB 2E1HA 2R5AA 2QYZA 3G71T 1W2BS 1BI1A 5HBHB 1KJWA 3M58A 1TSFA 4QVDA 1B3QA 3CXCS 4NS5A 3OSSC 1I81A 3PVQA 3JB9F 4M75F 4EOMB 1Q81R 2LQWA 3CCQQ 1VQ4A 4PJJA 2EGEA 3VUZA 3EFOB 4FSXA 1VQLT 3CBOA 4KH0B 4F14A 4A4HA 3M0RA 3RGFB 1VQPQ 4JJDA 4BCQD 5GAMh 1H28B 3TNIB 4C0DB 1M8VA 4OB0B 2R57A 3UPUA 5FU7C 1G3TA 3WVEB 4C8QC 4KRDB 1I1JA 3I35A 3SWNC 1WHHA 1M9SA 2NUTB 1YIJQ 5CVIA 1H27B 2FB7A 1RI9A 4FT2A 1VQKQ 4J5YA 2HMAA 2DD4A 1XTDA 2EFIA 1O9SA 1T3SA 1WHGA 3H41A 4OF1A 4X34A 5J39A 2VASA 2CJMB 2A0FB 2FPDA 2JUFA 4M78E 2GCXA 1Q81U 3JCMc 3VS7A 2KK4A 3OQ5A 5M9OA 3HBLA 3HHTB 2KRNA 3QYGB 3QYHB 4MMKA 1S72T 4ROEA 4OGEA 4BY6B 5HBJB 3GNFB 3QYBA 2QTXA 1PWTA 2V1RA 4M77G 4PJLA 2QI2A 3LLRA 2QEXT 3QZ9B 1K0SA 1AZEA 2MCNA 5GANg 3LWHA 1ZUUA 4RTTA 1VQ6T 1BCMA 2XU8A 4MDWA 2E65A 2B9RA 1OL1B 1AD5A 2J6OA 2EJFA 2RQWA 2M1HA 3L2UA 3EGXB 2D1XA 4J9BA 2GFUA 1Q7YC 1LOJA 1QQJA 2ED1A 5LJ3g 1ZP2A 2ABLA 3G71Q 4JRPA 4A63B 4N0AC 1P92A 4IUQA 3JB9D 1VIEA 4A4EA 1SF9A 3TCJA 4HCCA 1XQHA 2CP3A 2KQWA 8ATCB 2AKKA 3CCRA 3VKIA 4M7AG 4FM4B 2OAWA 3OYNA 3D7SB 4PJMA 3VS4A 3V7SA 2NLUA 1ZBXA 1TWBA 2CUBA 1N9RA 1VYUA 2J7IA 1R0CB 2VC8A 4C0ZA 1VQLQ 3CCSA 4FYXB 4A4GA 1BI0A 3S3NA 3DB3A 1QVFA 5GAOq 2HKQB 1PRMC 5D6WA 1YJNA 1I07A 3M0TA 2X4JA 4I3ZB 4OGRB 4YOOA 3HKSA 4M78B 4QQGA 1X6BA 4CFVB 2J6FA 1X6OA 3PIOA 2YXYA 2KNBB 1Z9ZA 4ZGDB 1VQMQ 3HSBA 2KRMA 3LW5E 3M0PA 2BS4A 1GUXB 3MP6A 1LNXA 3V8LA 3Q1JA 1B34B 2RPNA 3HB9A 2RHUA 2AK5A 4LUDA 1YN8A 1K9MR 2MF2A 5KE2A 5C0MA 3CCLA 1AHJB 3J7AF 1AOJA 1PSEA 3CMET 3CCUQ 4M7DC 1E7OA 3VS0A 4B6MA 4E7HA 4JLIA 2H3EB 2XIDA 1QWEA 5I2SA 2DFUA 4HA8A 2E6ZA 4Z88A 3S6WA 2EYZA 5GJVB 1E9HB 1QP2A 4RCBA 3HRUA 3SHWA 4D6WA 1H1RB 4C8QF 3EGDA 3OYDA 1I8FA 3MP8A 2MI6A 1Q82R 3GTMS 4AKIA 3CEYA 4J9CA 5CK9A 2XHCA 3PNWC 5J3BA 4HKEA 2XD0A 1K73R 2HL3A 3MY5B 2DL3A 2FVUA 1VQ6Q 4PFZA 1YHQT 4QT7A 2JGZB 2KXCA 1N4MA 3RMSA 2DL4A 3RBBB 5CO7A 2IPOB 3V8JA 1H92A 1XNIA 2QG9B 1K9MU 1VQOA 1GCQA 4N4HA 4KRTA 2IVWA 2LNVA 2KR6A 2KSSA 4FYYB 4BUGA 2YWWA 1KK7A 3BHVB 1QCFA 2F2XA 4F6SB 3QG1A 2JTMA 2JOYA 4EMKA 3G4ST 4MIMA 4E7KA 2MPXC 1UGSB 2HQXA 1SSHA 3LX7A 3M4GA 1Q82U 1WHLA 4MZPA 4CRLB 3JV3A 5CYIB 1K73U 4M78D 1KD1R 3OSVA 1NJIR 1GL5A 4QVCA 2JVVA 4EDUA 1IXDA 4JPBW 1K76A 4F7UF 2W2HA 2BZXA 1I5OB 3C0CA 4N4GA 1PKSA 4LDYA 3EH1A 3TN8B 2PTKA 5GAOl 3J81E 1KSWA 2E5KA 2QAZA 1SRLA 3EIDB 2J06A 1X27A 5GAN5 2DTIA 2QQRA 4IUVA 4M77A 4AT1B 2BPMB 5ECAA 3VUBA 4BCKB 2RHZA 4ME7A 3CMAT 4ANJA 2COWA 4M7DG 1M3AA 1VQ7A 3H8ZA 3JRZA 1Y7XA 2W9ZA 2RJDA 1KD1U 1NJIU 3HZJA 4PLLA 4NC6A 2CSIA 2YUOA 3M55A 3G6ET 2J05A 3OYGA 4VUBA 2MIOA 4EOJB 2IIMA 3L42A 3I55T 2W96A 1AWOA 1FVVB 3MEUA 2AIRB 1YHQQ 3TNWB 3OB9A 4QKUA 2KYBA 1WJSA 1WLPB 1JJ2S 2X4YA 4AMCA 2G6FX 4RMOA 2OTLT 1VQ9T 1K8AR 4M7AA 4DBQA 5GMKj 1FWZA 2QQ8A 3DTOA 1NZ9A 1RAEB 1TD6A 2PVOB 2E64A 1UJ0A 2E5QA 1KC8C 2XK0A 4J9GA 1D3BB 4BCPB 2CGHA 1VUBA 1YJWT 4IIMA 4E6RA 2DJQA 1QW1A 3UWNA 5GAMe 1RAHB 3G4SQ 4LD9K 7AT1B 4GBQA 2EGCA 3H9NA 8AT1B 4II5B 2HD0A 2RJCA 4XAXB 5LJ5h 2W9FA 1YCYA 2EKHA 4II1A 3DLLA 3OS5A 4A54A 2L5QA 4PJOC 4BCJB 4OP0A 2JNGA 1GFCA 2E12A 1VA7A 3O5ZA 1AWXA 1RI0A 1CKAA 3X24B 1YITT 4ATOA 1MV0B 2E3HA 1K8AU 2PVGB 1NM7A 1WJRA 1ZA1B 4B9XA 4ZTJA 5FWBA 2CUDA 4IURA 2DXCA 3OW2A 3NTKA 2F2WA 3JCMV 4RTZA 3JCMd 3CD6A 1GRIA 2RHYA 3CCVT 1ZUYA 4P5NA 4J83A 2MMPA 2JZ2A 3CCLT 4OMFB 4EORB 3R6OA 4X9CA 1NEBA 4UC4A 3SD4A 4DOWA 2HEQA 4IUPA 1IGUA 2LX7A 2PQWA 3LH0A 2YRVA 3N5BB 3VU3C 2VVKA 3CMAQ 2DXTA 4DOVA 2GGRA 3EHQA 4RG2A 4BI3A 3KUFA 2P0PA 5I22A 3THKA 3NTHA 1TUGB 3OS0A 2FEIA 2O01E 4PJOE 1RAIB 3I55Q 2KR3A 3A8LB 1M2VA 1PCXA 4EMHA 2O4XB 1LJOA 1J3TA 1JRIA 1V1CA 3NFCA 5GAMf 2OTLQ 2WIHB 2C4GB 2DZCA 1U3OA 4JLGA 2QQBA 3M9QA 1WZOA 4FYVB 4JRKA 1BI3A 3QDRB 3FC3A 1HSQA 3MY1B 4HNUA 2JTEA 1X43A 3HRSA 1HK9A 4F7LB 2P0QA 4C92E 5CR2A 1GCQC 1YJWQ 5HK3A 2F69A 4PFOA 1C9BA 4F7SB 3F70A 3BG5A 4MFEA 2JS2A 3A8HB 2LP5A 2BIVA 3KXTA 5HKCA 2JN0A 4E7JA 5DLQE 4ESRA 2C5NB 4EMKC 1VQ8A 4JX5A 2LRQA 4XTVA 4M75E 3EG0A 4NL3A 3E2UA 1H641 1MUZA 3QKJA 4KUIA 2FRWA 1PKDB 2ZPFB 3SEMA 1H26B 3PGGA 3CCEA 1PD0A 1BKBA 1X01A 1W1FA 2RH2A 1OKWB 4RG8A 3B57A 5LJ3j 1OOTA 1N27A 3QSUA 1OX8A 4KBMB 4A53A 1YIJT 5IDNB 2FZGB 2KGTA 1SHGA 4UN0A 3OY9A 1C1AA 1RUWA 3E9FA 4DA4A 2VV5A 1KHCA 3HPWA 1JSTB 3CCVQ 3CCLQ 1PNJA 2CZ0B 1NPPA 1LVKA 5GAN4 4PJOB 1M90C 1H1PB 4PFPA 4FX3B 4PJOF 2DYBA 4ZGJB 3QHSA 1S1NA 1NYGA 3ZFJA 4BE2A 4J7IA 4M77C 5GAOm 1ACMB 1NE8A 1VQ7T 1O9KB 3MP1A 4F04B 2YUPA 2EYQA 3OMCA 2WACA 3OS1A 2JMAA 3HFNA 2F1LA 2I2LA 1PRLC 2D6FA 4A4KA 4FU6A 3QXEB 4ELYC 3P8HA 3O8VA 3A8MB 3NMZC 4OGCA 4C92B 2LCLA 2EYWA 4CXAB 4C92F 4AFSC 5D7UA 4F16A 3QJYA 1EZZB 2CT3A 4E2FB 4BCIB 2H8HA 2LCCA 4JDSA 3FEOA 2WHBB 1TH7A 2D8JA 3OYCA 2DEUA 1G3YA 3I5SA 5GAOr 2LVMA 4IUUA 3BLRB 4LNPA 4DBRA 2QDJA 1G2BA 5KYXA 1WJQA 2YLCA 1OU9A 4M7AC 4M75B 4V2SA 5GAMg 4KT0E 4JS4A 2DTHA 4MDXA 2Y4YA 1YFNA 2RI3A 3UATA 2QA4T 1CKBA 3QO3A 4EOPB 1OI9B 4ELLA 2KMTA 2E70A 2OTJA 2MAMA 2VGNA 1KG1A 3TW6A 1QCNA 2DL8A 3TVTA 4C5EA 2LQNA 2A3LA 2DILA 4HVWA 4A4FA 2M51A 2X51A 3X28B 5LJ5d 2EQKA 3JB9I 1KQSP 1D0YA 1RL2A 2DXUA 4LDVA 2MK5A 3RESA 2ZZDA 1TU0B 1VQMT 4DEXA 1BI2A 4J9FA 5HQ0B 4CFNB 2QQSA 1K8AC 1NYFA 1WIEA 2EKOA 3REBB 3BE3A 4IMYB 3M56A 4EOKB 3C95A 1OGUB 3EOCB 4CFXB 2IN3A 4PJOD 1KC8R 2EUFA 2OJ2A 3CCUT 2K3XA 2ENMA 2JTFA 2DTOA 5C6SA 2PK9B 1G5VA 5GAN6 4FIBA 4BY7X 2RJFA 3TNHB 2L2PA 3EHRA 1VQ7Q 2EYYA 1SG5A 1H1SB 1QVFS 1QVPA 2L3PA 2PHGA 2DO3A 3URGA 1QWFA 3BY7A 4C92D 1RADB 2UZLB 1Y96B 4M4ZA 1H8KA 2K57A 3I56A 3KBGA 2NUPB 1K9AA 4DBHA 4AFZC 4CC7A 4FSSA 1OPLA 3WXMB 4C8QE 4O5VA 3TEEA 4MFDA 4XK8E 2UUEB 4M77B 1KC8U 4M77F 1QVGP 3CC7T 2RQTA 2R5MA 4M75D 4YC3B 3MEAA 1R8OB 1ZLMA 3EG9A 4AKGA 3PIPA 4AFUC 3OYHA 4EPCA 1TUCA 5FU6B 1YBYA 4DQ2A 1UDLA 1BU1A 2ESWA 2LQKA 5IHNA 2QA4Q 2CZ1B 3BG9A 1M3CA 2F2CA 1T0HA 3L2QA 4BE1A 1MMNA 1ZSZB 3GBQA 1UUEA 5GANh 2PU9B 2EPDA 4BXXX 2P4RA 1UE9A 1VQ8T 5IF1B 4FW2A 1U8RA 4M78G 2CH4W 1QMCA 3EGUA 1TG0A 2IW9B 5KCOA 4M7AF 1YJ9T 3X26B 2RJEA 2EYXA 3JCMh 1YI2T 2P84A 2PK2A 3UA7A 3QYEA 2ZPEB 2F5KA 3HP9A 3BHTB 2KBTA 1KIKA 5KYWB 1CSKA 4OMLA 2C5VB 2ED0A 1W70A 4F7UE 4BD3A 1I4K1 1UJYA 5IT9E 2K7AA 4CC3A 2FG0A 1W2BP 1OQKA 1WGSA 2RK1A 1UTIA 4LE9A 2DL5A 1OIYB 3PTAA 2V22B 5FU7B 3REAB 3CXCP 3CC2A 4C8QB 1WX6A 1GY3B 2DXBB 1F5QB 3SWNB 2K2MA 1JSUB 4JJBA 2M02A 2E4HA 2CZ6B 2ECZA 5LJ5f 1RLPC 2NYSA 3GF5A 1VQ5A 2LX9A 4GLMA 4B9WA 3VS2A 2OI3A 3CC4A 3QWXX 3M53A 2BZ8A 2YUQA 4JUVA 3T9NA 4M77D 4XU3A 3X25B 2EWNA 3C4SA 3H0IA 1T0JA 2RI5A 1OU8A 1I5LA 3VYGB 3SFMA 3CC7Q 3PT9A 3KFVA 5IHIA 4HVVA 2DL7A 3LYIA 3LQ5B 1R0BG 5A0GA 1M90R 2E6NA 4JZ4A 4Z6YA 3RR6A 1X75C 3JCMJ 4M7DE 5J26A 3CCJA 4C0GA 1W98B 3V7RA 1BK2A 3OBWA 4XQ3A 5I2MA 1VQ4T 4N4IA 3G7ZA 3JCMb 2QFZA 2K79A 5LMKB 2NUTA 1GBQA 2K4YA 1UB4A 3BLHB 5KYYB 2LZ6B 1M2OA 2DZ9A 2E3IA 2G77A 3MKDA 4ZTFA 4F6UB 4L5GA 3AT1B 5A0LA 5CKBA 1VQ8Q 3DDQB 2V1QA 1H24B 4F7UB 1QVFP 1NPRA 1PM3A 3CCQA 4LD6A 1NBEB 2AT1B 1D09B 2A36A 4RUGA 1WDXA 1YJ9Q 2RMOA 1YI2Q 2GBQA 3E1SA 5A2QE 3L2WA 3L2ZA 5CKDA 5DM7R 1FMKA 1JEGA 4Y72B 1M90U 4OR5B 1VQPA 2E10A 3OYBA 1VOMA 1TUDA 2HL5C 2Y90A 2CT4A 3ZEHA 2X4WA 1D0ZA 2RQUA 5HCKA 2M9UA 4C8QD 2ATCB 2RQRA 3EGXA 1GBRA 2KXDA 3OYLA 1VQKA 3HO8A 4AG1C 4EONB 2L3RA 3VJPA 1JB0E 4J7FA 4KGVB 4XTYA 5KYUB 2DD5A 3POMA 5EC7A 3G33B 2CP2A 2CP6A 5FGKB 4BY1X 1WHMA 4E7IA 1G83A 2K6DA 5I5ZB 1ZHIA 4C5IA 4M7DB 3OW2S 2RF0A 1U1SA 4M7DF 4IIOA 4JX6A 1AISB 2ZAEA 3J80E 2IW6B 2WPAB 1IHWA 2DERA 1M27C 2A28A 1IHVA 1V76A 2BUDA 2C0IA 2WSCE 3M0UA 4CRIA 3NTIA 1QP3A 1RLQC 1VINA 4M78A 4RCCA 3RKWA 1ARKA 1OL2B 3BG3A 1WYXA 2V26A 2PJQA 2QGFB 1E6HA 2BTTA 3CCRT 1YWOA 1VQ4Q 3VS6A 2OTJQ 1I0CA 2LT1A 1SKUB 1M3BA 1B34A 6AT1B 4HL4A 1YP5A 4EMGA 3JB9H 2EJGA 3DL1A 4R56A 3CPFA 4BI4A 1AEYA 2VB6A 3CCST 2L0AA 4DBFA 1YJNT 1U1TA 4ZN1A 3A98A 5GANd 1TTHB 1BBZA 1BIAA 2QK0A 1X6GA 4CFUD 1K4US 2K9GA 4X9DA 1WI7A 4J9EA 2VXFA 4E7ZA 2VWFA 1VQLA 4QW2A 4LOCA 2FHDA 3R6NA 3UF4A 1PHTA 5LJ3d 3CCMA 2IW8B 3M0QA 3M0SA 4YOZA 5GAMj 2HNIA 1WFWA 2D0NA 1QCOA 2KMGA 3C94A 3LH5A 3VS1A 2ZPIB 1EX4A 1OYXA 2AZVA 3RKYA 3OYEA 3CPWA 2SEMA 4E7SA 4E47A 2I40B 4ZN3A 5GAN7 5A0DA 3X20B 2DX1A 3VRZA 5DY9A 1K0XA 4J9HA 1RABB 2P4TA 2DF6A 2HDAA 3LGFA 1JKWA 4XTXA 4BCMD 2CYZB 5HNBB 3MHXA 3GLXA 2FL7A 2FO0A 4AFQC 3LGLA 4M7DD 2ROLA 2C5OB 4GY5A 4EOLB 2ZPGB 1S72A 2HBPA 1G3SA 3L2RA 4OMPA 3NPFA 1QMZB 2DD4B 1VQOT 2PUOB 1JBMA 2X9HA 5CCAA 2QEXA 3RIRA 2CZ7B 1EFNA 2D0QB 5L2WB 2LQ8A 2YT6A 2DIGA 4MMLA 2X4XA 1VQ6A 4BCOB 1H4LD 5GANe 3SB2A 1IREB 1PD1A 1JXOA 1UGRB 3META 3UT1A 1YCSB 2FYKA 5FRMA 2RK2A 1E7PA 4AKHA 2M0YA 3CCRQ 3EFSA 2LC4A 3QJ6A 2KY9A 1G3NC 2J6KA 3V8KA 4CC4B 4BACA 2LCSA 4JX4A 4MZTA 3JCMe 4BCNB 4Y92A 4C0DC 3MIAB 2EJ9A 3GPLA 2KT1A 3A8OB 4LUEA 4NOYA 3CCSQ 5DQVA 2RHXA 1YJNQ 2MWOA 2BS2A 3HTRA 2XMFA 3PE0A 3S3OA 1N8RC 1M30A 4R0KA 5IH2A 2KEAA 1W4SA 4OB2B 4KGXB 4OMNA 1JOWA 3RDVA 1OV3A 2EIFA 2NWMA 2VGMA 1WXUA 3GP8A 4R55A 1TXQA 1IB8A 1RAAB 1KQSA 1TS9A 2CCIB 2GQVA 4Z89A 3WVDB 5LQFB 2LW4A 3VS3A 4IUTA 1OZ2A 1JJ2P 4ZGEB 3OW2P 4HNVA 2GTJA 3ZL7C 4HXJA 2PUKB 1Q95G 2XG8D 3RNJA 2WEVB 1UGQB 4BY6C 2R58A 2W10A 4JZ3A 5GAN2 3C12A 2R7GA 2Z0WA 1X69A 4RKUE 4ELZC 4HVUA 1KFZA 2M16A 3CC2Q 4BB7A 1VYWB 2O31A 2LNHB 1WA7A 4Y28E 1HD3A 2I53A 2UZDB 1U06A 3JCMX 1OX9A 1RAFB 2K5FA 2DYIA 3FIFA 3CMEA 4ELJA 5GANf 2RHIA 2VKNA 4L59A 4HLQA 1D3BA 5D6XA 2RNAA 5FRNA 3H0FA 4F70B 4RTVA 4Y91A 2HKNA 3ME9A 2SRCA 4XTWA 4WCIA 5HBEB 4X1VA 1FX7A 3EH2A 1ABOA 3V7CA 3CBPA 4EIKA 1VQOQ 1OEBA 2QF7A 4IKFA 5GMKh 2MOXA 3IQLA 2D9TA
chains in the Genus database with same CATH topology
4BE1A 3CCUA 3JCMf 3H6ZA 4N4GA 4LDYA 4Q5WA 2ZZDB 3GOXA 2QDYB 5GAOl 5CIUA 3QPHA 3J81E 1VQ5T 4J6WA 5GANh 2PU9B 3OYIA 3GIBA 1OI1A 1YHQA 3CC4T 5GMKi 3JB9G 4M75G 3AHUA 5GAOn 3KHIA 1KQSS 5GAN5 1VQ8T 2DTIA 3JCMQ 2QQRA 3BDLA 2WSFE 3OYYA 4M78G 4IUVA 4M77A 1U8RA 1QVGA 4QQ6A 2V8KA 2DK3A 3JSCA 5EJCA 3VUBA 4C0FA 2YLBA 4M75C 1ZQ1A 5KCOA 2RHZA 4ME7A 3OS2A 4M77E 4M7AF 1YJ9T 3X26B 2RJEA 3JCMh 1YI2T 2RB6A 4M78C 4J8OA 3QYEA 4J6YA 4N0AA 3L2VA 2ZPEB 3CMAT 1VIFA 1Q7YU 4M7DG 3MCAB 4F7UA 5HK0A 2VXEA 1VQ7A 2F5KA 3HP9A 2LT4A 2B8AA 3H8ZA 1GXIE 3JRZA 4HNTA 1Y7XA 2QQAA 2RJDA 3A5ZB 4O6JA 5IAYA 3CCJT 1NJIU 1KD1U 2RM4A 5HY6A 3HZJA 4F7UE 3G4SA 2F5TX 4BD3A 3PMIA 4NC6A 3M55A 4PLLA 3G6ET 1I4K1 5IT9E 3OYGA 4VUBA 1MHNA 3CC7A 4BE0A 1K9MC 3L42A 1N9SA 3I55T 3FLGA 5LJ3e 3L1AA 1WGSA 3S3MA 2RK1A 3MEUA 2HQEA 2DVEA 2IG0A 3OB9A 3PTAA 1WJSA 3OYAA 5FU7B 3CC2A 1JJ2S 2X4YA 2XDBA 4KUDK 3CCMT 3CD6T 2WJ9A 3M59A 3PMTA 3HRTA 4C8QB 4RMOA 2OTLT 3VKGA 1M1FA 2DXBB 3SWNB 1VQ9T 4M7AA 3CCQT 5CAIA 5GMKj 1FWZA 2CZ6B 2QQ8A 3OYFA 4JJNK 1NZ9A 4EMKB 5LJ5f 4M7AE 3GF5A 4XU1A 2PVOB 3VKHA 2LX9A 2E64A 2RI2A 1VQ5A 4NL2A 2O4XA 2E5QA 4B9WA 5GANj 1Q86U 1KC8C 2XK0A 3CC4A 3M53A 4JUVA 2RA2A 3MEWA 3T9NA 1D3BB 1Q82C 3RKXA 2CGHA 4M77D 1VUBA 1YJWT 2QQ9A 4XU3A 3RUXA 3X25B 1VQPT 1K73C 1VQNA 3BFMA 2EWNA 1QW1A 3M54A 3C4SA 3ER0A 1QLBA 3UWNA 2RI5A 5GAMe 3OYMA 1W2BA 4PJOG 4LD9K 2AHJB 1QVGS 2ZCFB 1I5LA 3VYGB 3SFMA 1WPYA 3H4CA 5GMKl 3PT9A 1SSFA 1YJ9A 2ZPHB 3CXCA 2HD0A 2RJCA 4XAXB 5LJ5h 1YI2A 1YCYA 3BW1A 4II1A 3DLLA 1VQ8A 3TW7A 3LYIA 4M7DA 5A0GA 3OS5A 4A54A 2L5QA 5CKHA 3HFOA 3CMAA 1VQKT 4PJOC 2E6NA 4BBSM 4OP0A 3ZBDA 2JNGA 2E12A 4OVAA 4Z6YA 3JCMJ 1X75C 1RI0A 3OYJA 5J26A 3CCJA 3X24B 5CQXA 4L6V5 2E41A 4C0GA 1YITT 5IN1A 3V7RA 4ATOA 2KDSA 3OBWA 4XQ3A 1FXXA 5I2MA 4CI0C 2PVGB 4N4IA 3G7ZA 3JCMb 3G6EA 1WJRA 2QFZA 1K8AU 4B9XA 2ZPBB 4C5GA 4ZTJA 3E19A 2K4YA 5AYFA 3FJPA 1UB4A 2GF7A 3QUIA 3I55A 1VQ4T 2LDMA 3TU4K 4IURA 2DXCA 5LJ5e 4C92G 2DZ9A 3M5AA 3OW2A 3NTKA 2G77A 3OMGA 4MZMA 4ZTFA 4BBRM 4L5GA 3JCMV 2L89A 3FDRA 3JCMd 5A0LA 4OB1B 5CKBA 3CD6A 3CBMA 4PKCC 2RHYA 3CCVT 4XTUA 4P5NA 4J83A 2MMPA 4F7UB 1VQ9A 1BIBA 2OTLA 1UEBA 2JZ2A 2P0KA 4OMFB 3CCLT 3R6OA 1NPRA 3CCQA 4LD6A 2A7YA 4X9CA 2DAQA 3DKMA 4LDWA 4UC4A 3JCMg 5I21A 4E7LA 5FU6C 5LJ3f 3SD4A 4DOWA 1KD1C 1DJ7B 1NJIC 1V29B 4IUPA 2V8IA 2DD5B 3E9GA 2G3RA 5CKFA 4PNOA 5KE3A 2PQWA 1OZ3A 2ZGWA 3LH0A 2YRVA 4PL6A 3N5BB 3VU3C 3E1SA 5A2QE 3L2WA 3L2ZA 2C06A 2DXTA 4M7DE 5CKDA 5DM7R 4DOVA 5GAN8 1M90U 1YJWA 2X35A 2XI9A 4RG2A 4BI3A 1VQPA 1FKMA 3M4YA 2E10A 3KUFA 4PJOA 1IZ6A 2EQMA 3OYBA 2P0PA 3BDUA 3FB9A 3NTHA 2XKOC 3CCET 2E1HA 3OS0A 4M7AB 1BYMA 4QSHA 2R5AA 3G71T 1W2BS 1BI1A 1WNLA 2Y90A 3M58A 2KVQG 2O01E 4QQDA 4PJOE 3ZEHA 2X4WA 5LJ3h 1WQ7A 3P8DA 5LJ5j 2M9UA 4M6VA 4C8QD 4QVDA 3A8LB 4BI8B 4EMHA 3CXCS 4NS5A 3OYLA 2O4XB 1VQKA 3OSSC 3HO8A 4JRIA 1I81A 1LJOA 3JB9F 4M75F 1JRIA 5GAMf 3NFCA 4JRQA 1Q86C 2MWPA 1H3ZA 2EQUA 2L3RA 3EAEA 3VJPA 1JB0E 1YITA 4M78F 2DZCA 4XU0A 4J7FA 4JLGA 1VQ4A 4XTYA 2DD5A 2QQBA 3VUZA 4C92A 3M9QA 4JRKA 1BI3A 3QDRB 4FSXA 2K5LA 3FC3A 4HNUA 1VQLT 1M1GA 4E7IA 3HRSA 3CBOA 1ZHIA 3P8BB 4C8QG 1HK9A 4C5IA 2P0QA 4C92E 4M7DB 4A4HA 3OW2S 3QBYA 5CR2A 1U1SA 3M57A 5FLXE 4M7DF 3CCVA 5HK3A 2F69A 4Z02A 5GAMh 4JX6A 4C0DB 1M8VA 4OB0B 2R57A 3F70A 3UPUA 3J80E 1KQ1A 1G3TA 5FU7C 4OB3B 3BG5A 4MFEA 3WVEB 2RD1A 4C8QC 1Y07A 2BUDA 4GLKA 5GAOp 4HCZA 3A8HB 3SWNC 2BIVA 5FROA 3JB9J 2WSCE 1M9SA 4M75A 3KXTA 5GMKm 3OA6A 5HKCA 1M1KU 4CRIA 2JN0A 2EQJA 3NTIA 1QP3A 4FT2A 2FB7A 5CVIA 5DLQE 4E7JA 4J5YA 3DLMA 2DXCB 2DD4A 4M78A 4EMKC 1XTDA 2EFIA 4JX5A 1O9SA 2LRQA 4RCCA 4XTVA 4M75E 3RKWA 2XDDA 3JCMW 2M0OA 5J39A 3BG3A 4OF1A 4X34A 4NL3A 1H641 3QKJA 4KUIA 3CCRT 4LDXA 2JUFA 2ZPFB 4M78E 2GCXA 1Q81U 3PGGA 3CCEA 1BKBA 2LT1A 3JCMc 3RERA 4YTLA 2Y4XA 1X01A 2KK4A 2H3JA 3OQ5A 5M9OA 1B34A 2RH2A 4RG8A 4HL4A 5LJ3j 3HBLA 1N27A 4EMGA 3JB9H 3HHTB 2EJGA 3DL1A 4A53A 4KBMB 3QSUA 4R56A 3CPFA 4BI4A 1YIJT 5KH6A 3CCST 3QYGB 3QYHB 4FT4A 4MMKA 1S72T 4OGEA 2OAUA 3OY9A 3TREA 3E9FA 4DA4A 3HL8A 1YJNT 1U1TA 2VV5A 1KHCA 4BY6B 2DJZA 4ZN1A 3HPWA 5GANd 4BDYA 3GNFB 3QYBA 1WQWA 2QTXA 2CZ0B 4M77G 1NPPA 2QI2A 3LLRA 2QEXT 3QZ9B 1BIAA 5GAN4 4PJOB 1M90C 2OTJT 5GANg 4PJOF 3LWHA 4ZGJB 3QHSA 4X9DA 1HXDA 1VQ6T 3A8GB 2XU8A 2VXFA 3ZFJA 1UGPB 4MDWA 1N8RU 1VQLA 4QW2A 4LOCA 4BE2A 4J7IA 2FHDA 4M77C 5GAOm 2E65A 1NE8A 5LJ3d 1VQ7T 4HCBA 2EJFA 3MP1A 3CCMA 2M1HA 4F7UG 2EYQA 3L2UA 4M7AD 3OMCA 3ASKA 2WACA 1M5Q1 2GFUA 5CKEA 2HNIA 5GAMj 3OS1A 1Q7YC 3HFNA 3OYKA 1LOJA 5LJ3g 2GFAA 2I2LA 2CKKA 2D6FA 2KMGA 2KAFA 4A4KA 3C94A 4FL6A 4N0AC 4JRPA 3OBYA 3QXEB 4FU6A 2ZPIB 1P92A 3LWIA 4IUQA 1OYXA 4ELYC 3JB9D 3P8HA 3O8VA 3RKYA 3A8MB 1VIEA 4A4EA 3OYEA 3CPWA 4OGCA 4C92B 4E47A 2LCLA 4ZN3A 5GAN7 5A0DA 3X20B 3TCJA 4C92F 4HCCA 5DY9A 4XU2A 1XQHA 4HT9A 2P4TA 3LGFA 3MEVA 3QJYA 2WSEE 2KQWA 1M4ZA 4XTXA 2VYTA 2LCCA 3EFRA 1EIFA 2CYZB 3FEOA 4JDSA 3CCRA 3VKIA 4M7AG 4FM4B 1TH7A 1Y96A 2EAYA 3QIIA 3MHXA 3GLXA 2FL7A 3QWLA 3OYNA 3OYCA 2DEQA 1G3YA 5KCHA 2HAXA 5GAOr 2LVMA 4IUUA 5GAMd 3V7SA 2NLUA 1ZBXA 3LGLA 1N9RA 4M7DD 4GY5A 1YIJA 2VC8A 4C0ZA 2QDJA 3CCSA 4A4GA 2ZPGB 1BI0A 1S72A 3S3NA 3DB3A 1QVFA 1WJQA 2YLCA 5GAOq 4M7AC 4M75B 2HBPA 4V2SA 1G3SA 5D6WA 5GAMg 3L2RA 1YJNA 2V8JA 4KT0E 3QZ5B 4JS4A 2DTHA 2X4JA 3HKSA 1VQNT 2DD4B 4M78B 4MDXA 2Y4YA 2RI3A 1VQOT 2PUOB 1JBMA 4QQGA 3RMQA 1X6OA 5CCAA 3PIOA 2QA4T 3QO3A 3SDZA 2QEXA 5GAN3 5GMKe 2KMTA 2E70A 4ZGDB 5DLOA 3HSBA 2MAMA 2OTJA 2VGNA 3RIRA 2CZ7B 1KG1A 2D0QB 3TW6A 3LW5E 2LQ8A 4HT8A 4XTZA 2DIGA 4MMLA 2BS4A 2X4XA 3MP6A 1LNXA 4C5EA 1VQ6A 3I56T 1Q81C 3V8LA 2DPPB 5GANe 2A3LA 3Q1JA 1B34B 4A4FA 3HB9A 3SB2A 1IREB 2RHUA 3X28B 2DKGA 2K3YA 2MF2A 1UGRB 3FRNA 3META 3UT1A 2EQKA 4J6XA 2FYKA 5D6YA 5KE2A 2PVDB 5LJ5d 3JB9I 5C0MA 2RK2A 5FRMA 3CCLA 1RL2A 1AHJB 3J7AF 1PSEA 1E7PA 4AKHA 2BS3A 2DXUA 3EFSA 4LDVA 3RESA 2K5IA 2ZZDA 2LC4A 3QJ6A 4QVZA 5L8RE 3CMET 2KY9A 4BDZA 1VQMT 5LJ5g 2YHTA 4LDUA 4M7DC 1BI2A 2DIQA 4JLIA 3V8KA 3JAME 4E7HA 1MGQA 1PSFA 2XIDA 3PFSA 4JX4A 4MZTA 5I2SA 3JCMe 4HA8A 4BACA 1N6AA 2QQSA 1K8AC 2E6ZA 1KQ2A 4C0DC 2BKDN 2EJ9A 2EKOA 3A8OB 4NOYA 3S6WA 3GPLA 3M56A 2RHXA 2K2VA 1QP2A 4RCBA 3C95A 3HRUA 2MWOA 2BS2A 3DB4A 4D6WA 3CPWS 2CS7A 4PJOD 4C8QF 3S3OA 3VYHB 1N8RC 1W4SA 4OB2B 3OYDA 1I8FA 2EIFA 2MI6A 2VGMA 3MP8A 2VUBA 3CCUT 3JCMP 2K3XA 4AKIA 2QXFA 3CEYA 4KULA 5CK9A 3GP8A 3G71A 2JTFA 2XHCA 3PNWC 4HKEA 5J3BA 4R55A 2XD0A 2DTOA 2FVUA 3INZA 5C6SA 2L8DA 4JS5A 1M1KC 1KQSA 1YHQT 2GQVA 1G5VA 5GAN6 4FIBA 2RJFA 4TVRA 3WVDB 3RMSA 5CO7A 4IUTA 1OZ2A 3V8JA 4ZGEB 1QVFS 1QVPA 4HNVA 1XNIA 1K9MU 1VQOA 2QA4A 4N4HA 2PUKB 2XG8D 1UGQB 2DO3A 3UDCA 3URGA 3BY7A 4C92D 1Y71A 4BY6C 4C5HA 2IVWA 2R58A 2LNVA 1Y96B 2KR6A 5LL6S 2LTOA 2KSSA 4BUGA 5GAN2 3C12A 2K57A 3I56A 2XICA 4PLIA 4RKUE 4ELZC 4C8QA 1XOVA 2M16A 3KBGA 2DXBA 3SWNA 4BB7A 3QG1A 1G3WA 3VV0A 4Y28E 3WXMB 4C8QE 3JCMX 4O5VA 3TEEA 2JTMA 4MFDA 2JOYA 2K5FA 4XK8E 4EMKA 3G4ST 3FIFA 3CMEA 4M77B 3MO8A 4MIMA 1KC8U 4M77F 1VQMA 4WF2A 4E7KA 1UGSB 3CC7T 2HQXA 4ELJA 5GANf 2RHIA 2R5MA 3LX7A 3M4GA 4L59A 4M75D 4HLQA 3MEAA 1R8OB 1Q82U 4MZPA 1JJ2A 4AKGA 1D3BA 1O75A 4AI6A 5D6XA 3PIPA 4Y91A 1K73U 5FRNA 3GNGA 3OYHA 4M78D 2XDPA 3OSVA 4EPCA 5CQYA 5EG2A 3CC2T 5FU6B 1KHIA 3ME9A 1YBYA 4DQ2A 4QVCA 2JVVA 4EDUA 4XTWA 2LQKA 1FX7A 3V7CA 3CBPA 4F7UF 3VYGA 2CZ1B 3BG9A 2QF7A 4C92C 2RO0A 4IKFA 5GMKh 3L2QA 2D9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X24 B;  4L6V 5;  2DD4 A;  2DPP B;  2ZZD B;  2QDY B;  1IRE B;  2PVG B;  3X28 B;  2ZPB B;  2PU9 B;  1UGR B;  2ZPF B;  2PVD B;  2DXC A;  1AHJ B;  1PSE A;  2WSF E;  2ZZD A;  5L8R E;  3HHT B;  4OB1 B;  3QYG B;  3QYH B;  1PSF A;  3A8O B;  3X26 B;  1QP2 A;  2CZ0 B;  1DJ7 B;  1V29 B;  3QZ9 B;  2ZPE B;  3VYH B;  2DD5 B;  4OB2 B;  4ZGJ B;  1GXI E;  3A8G B;  1UGP B;  3WVD B;  2O01 E;  4ZGE B;  3A8L B;  3QXE B;  2ZPI B;  2PUK B;  2DXB B;  1UGQ B;  3A8M B;  2CZ6 B;  3X20 B;  4RKU E;  1JB0 E;  2WSE E;  2PVO B;  2DXB A;  2DD5 A;  2CYZ B;  4FM4 B;  4Y28 E;  4XK8 E;  3X25 B;  1UGS B;  2ZPG B;  2AHJ B;  2ZCF B;  3VYG B;  4KT0 E;  3QZ5 B;  4OB0 B;  2ZPH B;  4OB3 B;  2DD4 B;  3WVE B;  2PUO B;  3A8H B;  4ZGD B;  2WSC E;  2CZ7 B;  3VYG A;  2D0Q B;  2CZ1 B;  3LW5 E;  1QP3 A;  2DXC B; 
#chains in the Genus database with same CATH topology
 3A1P A;  3JCM f;  3H6Z A;  3GOX A;  5CIU A;  2DNU A;  1Z9Q A;  4J6W A;  4LN2 A;  4FCY A;  1OI1 A;  1YHQ A;  4D8K A;  5GMK i;  3JB9 G;  4M75 G;  3KHI A;  2GNC A;  3JCM Q;  4G6L B;  1QVG A;  4QQ6 A;  3UA6 A;  2DK3 A;  3NDQ A;  1UGV A;  2X3X D;  5EJC A;  4C0F A;  1RAG B;  2QGG A;  4BCN D;  1ZQ1 A;  3EGD B;  4RTW A;  2LMJ A;  4M77 E;  4RTU A;  1UNL D;  2RB6 A;  4M78 C;  4J8O A;  3L2V A;  1GCP A;  4J6Y A;  1D3U B;  1VIF A;  5HK0 A;  2WXV B;  2LT4 A;  1GXI E;  3A5Z B;  1VOL A;  2QQA A;  4O6J A;  2QGS A;  5HY6 A;  3G4S A;  1H1Q B;  2F5T X;  3PMI A;  5I11 A;  1B7T A;  5GJW B;  2G9X B;  1JXM A;  1N9S A;  3FLG A;  3ULR B;  3S3M A;  2HQE A;  1JO8 A;  1LPL A;  2IG0 A;  2PNI A;  3CQT A;  3CCM T;  4KUD K;  3CD6 T;  2WJ9 A;  3M59 A;  5HVY B;  1M1F A;  5CAI A;  2DBK A;  3OYF A;  4JJN K;  4FYW B;  2W0Z A;  4EMK B;  4M7A E;  2WFY B;  3EJ1 B;  3VKH A;  4NL2 A;  2O4X A;  1F1B B;  4NST B;  3MEW A;  3RKX A;  3TSZ A;  3EG3 A;  4ROD A;  1WHJ A;  2ROT A;  3RUX A;  4F17 A;  1VQN A;  2WIP B;  2HQH A;  1TFB A;  2PMI B;  3BHU B;  3ER0 A;  1W2B A;  3OYM A;  3BLQ B;  1UHF A;  2AHJ B;  3H4C A;  3CXC A;  1FMV A;  1SPK A;  3BW1 A;  3TW7 A;  3CMA A;  4BBS M;  2CCH B;  3ZBD A;  4OVA A;  1B07 A;  1UNG D;  3OYJ A;  5CQX A;  5IN1 A;  2KDS A;  4CI0 C;  3O0G D;  3G6E A;  2ZPB B;  3E19 A;  5AYF A;  3FJP A;  4PJN A;  5L23 A;  3QUI A;  3I55 A;  1OPK A;  2JM8 A;  2KRO A;  5LJ5 e;  1PG5 B;  3M5A A;  2CP5 A;  3OMG A;  2W99 A;  2QAS A;  3FDR A;  4OB1 B;  3CBM A;  4KGZ B;  2OTL A;  4XTU A;  4TTH A;  1VQ9 A;  1BIB A;  4EOS B;  4OMO A;  4WTO B;  2DAQ A;  4LDW A;  3JCM g;  5I21 A;  1N5Z A;  1DJ7 B;  2HZY A;  2V8I A;  2DD5 B;  2C6T B;  2G3R A;  2C06 A;  2MYS A;  2C0T A;  1YJW A;  2X35 A;  2XI9 A;  4ORZ A;  4PJO A;  2PZ1 A;  1IZ6 A;  2EQM A;  1MMA A;  5KYN A;  3CCE T;  2JW4 A;  4M7A B;  2DET A;  4QSH A;  1BYM A;  2A37 A;  1WNL A;  2KVQ G;  2YDL A;  4QQD A;  5LJ3 h;  1WQ7 A;  3P8D A;  5LJ5 j;  4M6V A;  4D8D A;  1O9K A;  4BI8 B;  1D1A A;  4JRI A;  4RTX A;  3CCM Q;  3CD6 Q;  4JRQ A;  1W6X A;  1H3Z A;  1Q86 C;  2MWP A;  2DE0 X;  2FZK B;  2EQU A;  3EAE A;  1YIT A;  4M78 F;  4XU0 A;  2O88 A;  4EC9 B;  1NG2 A;  1ENW A;  1IRX A;  4C92 A;  2DMO A;  2K5L A;  2KYM A;  1M1G A;  1H25 B;  2DVJ A;  2YRC A;  3P8B B;  4C8Q G;  2L3Q A;  3QBY A;  3M57 A;  3NGP A;  5FLX E;  3EG1 A;  3CCV A;  2CH4 A;  3FJ5 A;  1XO2 A;  4Z02 A;  2QTV A;  1VYT A;  1KQ1 A;  4OB3 B;  2RD1 A;  1Y07 A;  1QKX A;  1N8R R;  2O9V A;  4GLK A;  5GAO p;  1A0N B;  4HCZ A;  5FRO A;  3JB9 J;  4M75 A;  5GMK m;  3OA6 A;  2EQJ A;  1S72 Q;  5ICP B;  4BCG B;  2UZE B;  3DLM A;  2DXC B;  2HSE B;  1MMD A;  2EVR A;  3JCM W;  2XDD A;  1X2K A;  2KRS A;  2M0O A;  2A08 A;  1OUL A;  4DEY A;  1AWJ A;  4LDX A;  2QEX Q;  3EFO A;  1C0M A;  3RER A;  4YTL A;  2Y4X A;  1WXT A;  2H3J A;  5KH6 A;  4FT4 A;  1WHK A;  4F7N B;  1BB9 A;  2OAU A;  2YSQ A;  3TRE A;  3HL8 A;  1VYV A;  4HCK A;  2C0O A;  2FPE A;  2DJZ A;  4BDY A;  1WQW A;  3QHW B;  2K3B A;  1PKT A;  2BE7 D;  2OTJ T;  3MI9 B;  5DQW A;  1HXD A;  3A8G B;  4YOS A;  2BKZ B;  1UGP B;  1N8R U;  5CEI B;  1UG1 A;  4BCF B;  1M2V B;  4HCB A;  2KT8 A;  1JU5 C;  4J9D A;  4F7U G;  2AKL A;  4M7A D;  3ASK A;  1M5Q 1;  5CKE A;  1M8M A;  3OYK A;  2GFA A;  3CCE Q;  2CKK A;  4CFM B;  4RTY A;  2KAF A;  3I5R A;  4FL6 A;  4ZNX A;  3OBY A;  2EGA A;  3LWI A;  1MND A;  1ABQ A;  5IXB A;  1M1K R;  1GH6 B;  4CFU B;  4EC8 B;  2KI7 A;  4XU2 A;  4HT9 A;  3MEV A;  1NLP C;  2WSE E;  1M4Z A;  1MMG A;  1ZUK A;  2VYT A;  3EFR A;  1EIF A;  2JM9 A;  5IXF A;  4KRC B;  1Y96 A;  2EAY A;  3QII A;  2HAX A;  3QWL A;  2DEQ A;  5KCH A;  1YNZ A;  1WXB A;  5GAM d;  2X3W D;  4LXC A;  2CDT A;  2YUN A;  2NUP A;  1YIJ A;  2JT4 A;  2LJ1 A;  2V8J A;  1T3L A;  3QZ5 B;  1FIN B;  3H0H A;  1VQN T;  2COY A;  4BDZ A;  1LCK A;  3RMQ A;  3SDZ A;  3CME Q;  5GAN 3;  5GMK e;  1D1B A;  1P5E B;  5DLO A;  1E6G A;  4K11 A;  2HCK A;  4BCM B;  4HT8 A;  4XTZ A;  3QHR B;  2NUZ A;  3I56 T;  4EOQ B;  1Q81 C;  2DPP B;  2X1N B;  2DKG A;  2K3Y A;  3FRN A;  1M1K U;  4J6X A;  5D6Y A;  2PVD B;  1H3H A;  1IGQ A;  1ZSZ A;  2BS3 A;  5FW9 A;  2K5I A;  2D8H A;  4QVZ A;  5L8R E;  3G1J A;  1JQQ A;  5LJ5 g;  2YHT A;  4LDU A;  2DIQ A;  3JAM E;  4CC2 A;  1MGQ A;  1PSF A;  3PFS A;  3PVL A;  1N6A A;  3VS5 A;  1KQ2 A;  1AVZ C;  2BKD N;  2I0N A;  2COZ A;  2FRY A;  1BCO A;  2K2V A;  3TQ7 P;  3DJB A;  3DB4 A;  3CPW S;  1SRM A;  2CS7 A;  3VYH B;  1PC0 A;  2HSP A;  1D1C A;  2VUB A;  1GUX A;  3JCM P;  2QXF A;  3G71 A;  4KUL A;  1GFD A;  1XJW B;  2HBW A;  1R77 A;  3INZ A;  4JS5 A;  2L8D A;  1M1K C;  4BCH B;  1UNH D;  2CSQ A;  1FYN A;  2DA9 A;  4TVR A;  3MJX A;  5KYW A;  1IO6 A;  2CP7 A;  5IHK A;  2QA4 A;  1QLY A;  4F7J B;  1KXU A;  2RQV A;  2DLP A;  1AWW A;  3DOG B;  3UDC A;  1Y71 A;  2LJ0 A;  4C5H A;  5FWC A;  5LL6 S;  2LTO A;  2XIC A;  4PLI A;  4C8Q A;  1XOV A;  1HJD A;  2DXB A;  3SWN A;  4AG2 C;  1G3W A;  2JS0 A;  5KYX B;  3VV0 A;  4OMQ A;  3MPU B;  2F2V A;  2EBP A;  3MO8 A;  1C6V X;  1VQM A;  4WF2 A;  2KE9 A;  5IHY A;  2EQI A;  1SEM A;  1Q7Y R;  2C5X B;  1JJ2 A;  1UHC A;  1O75 A;  4AI6 A;  3GNG A;  5ACB A;  1UEC A;  2XDP A;  3CC2 T;  5CQY A;  5EG2 A;  1KHI A;  1QKW A;  5BNJ B;  1ZSG A;  1X2Q A;  1OKV B;  1VQN Q;  2DRM A;  4PK4 A;  1YWP A;  5AT1 B;  3VYG A;  4C92 C;  2RO0 A;  9ATC B;  4EOO B;  4CFW B;  3CCU A;  4Q5W A;  2ZZD B;  2QDY B;  1VQ5 T;  3QPH A;  3I56 Q;  2O2O A;  3OYI A;  3GIB A;  3AHU A;  2DM1 A;  3CC4 T;  3U23 A;  1AD6 A;  5GAO n;  4JJC A;  1KQS S;  3BDL A;  2WSF E;  3OYY A;  3VRY A;  1K1Z A;  2V8K A;  2JMC A;  2UZB B;  1SHF A;  3JSC A;  2BZY A;  2YLB A;  3G6E Q;  4M75 C;  3F5X B;  5KYY A;  4F6W B;  3OS2 A;  1Q86 R;  1TOV A;  4FW1 A;  2FZC B;  4N0A A;  4OMM A;  1Q7Y U;  3MCA B;  4F7U A;  2VXE A;  5EFQ B;  4ROC A;  2L3S A;  2B8A A;  2O9S A;  4HNT A;  1VQ9 Q;  3CCJ T;  1MV3 A;  5IAY A;  2CRE A;  2RM4 A;  1HYO A;  1MHN A;  3CC7 A;  4BE0 A;  1K9M C;  5LJ3 e;  1ZA2 B;  2B86 A;  3L1A A;  1AT1 B;  2DVE A;  3I9Q A;  3OYA A;  2XDB A;  3PMT A;  3TSW A;  3HRT A;  1URC B;  2BE9 B;  3VKG A;  2IVX A;  4Z8A A;  3CCQ T;  5IDP B;  3QWY A;  1Y0M A;  2WMB B;  1U5S A;  4XU1 A;  2RI2 A;  5GAN j;  1Q86 U;  3DDP B;  2RN8 A;  2RA2 A;  3QDF A;  2DRK A;  3EG9 B;  1Q82 C;  1Y57 A;  2QQ9 A;  1D0X A;  1VQP T;  1K73 C;  2FPF A;  3BFM A;  5KYU A;  3M54 A;  1YIT Q;  1QLB A;  2AZS A;  4PJO G;  1QVG S;  2ZCF B;  2EW3 A;  1WPY A;  4BCQ B;  5GMK l;  1SSF A;  1YJ9 A;  2ZPH B;  2DME A;  1YI2 A;  1UFF A;  1AZG B;  2CP0 A;  4M7D A;  1G8X A;  2QDL A;  5CKH A;  3HFO A;  1VQK T;  2OX7 A;  3CPW P;  3M03 A;  4L6V 5;  2E41 A;  4KH1 B;  3K7A M;  2GTO A;  1FMW A;  1FXX A;  4C5G A;  2WMA B;  1OIU B;  4EOI B;  2GF7 A;  1VQ5 Q;  2LDM A;  3TU4 K;  2JXB A;  2GQI A;  4C92 G;  3EG2 A;  4MZM A;  3CC4 Q;  4BBR M;  2L89 A;  2DBM A;  3PO3 S;  4PKC C;  1UEB A;  1ZBJ A;  2P0K A;  1MNE A;  2A7Y A;  1NEG A;  3DKM A;  3NHN A;  4E7L A;  5FU6 C;  5LJ3 f;  1NLO C;  1KD1 C;  1NJI C;  1BU2 A;  1V29 B;  3E9G A;  4J9I A;  1ZX6 A;  5CKF A;  4PNO A;  5KE3 A;  2YRD A;  2ZGW A;  1OZ3 A;  4PL6 A;  1ZSZ C;  5GAN 8;  2JJ9 A;  2LJ3 A;  3CCJ Q;  1FKM A;  3M4Y A;  3BDU A;  3FB9 A;  2XKO C;  1RAC B;  2E1H A;  2R5A A;  2QYZ A;  3G71 T;  1W2B S;  1BI1 A;  5HBH B;  1KJW A;  3M58 A;  1TSF A;  4QVD A;  1B3Q A;  3CXC S;  4NS5 A;  3OSS C;  1I81 A;  3PVQ A;  3JB9 F;  4M75 F;  4EOM B;  1Q81 R;  2LQW A;  3CCQ Q;  1VQ4 A;  4PJJ A;  2EGE A;  3VUZ A;  3EFO B;  4FSX A;  1VQL T;  3CBO A;  4KH0 B;  4F14 A;  4A4H A;  3M0R A;  3RGF B;  1VQP Q;  4JJD A;  4BCQ D;  5GAM h;  1H28 B;  3TNI B;  4C0D B;  1M8V A;  4OB0 B;  2R57 A;  3UPU A;  5FU7 C;  1G3T A;  3WVE B;  4C8Q C;  4KRD B;  1I1J A;  3I35 A;  3SWN C;  1WHH A;  1M9S A;  2NUT B;  1YIJ Q;  5CVI A;  1H27 B;  2FB7 A;  1RI9 A;  4FT2 A;  1VQK Q;  4J5Y A;  2HMA A;  2DD4 A;  1XTD A;  2EFI A;  1O9S A;  1T3S A;  1WHG A;  3H41 A;  4OF1 A;  4X34 A;  5J39 A;  2VAS A;  2CJM B;  2A0F B;  2FPD A;  2JUF A;  4M78 E;  2GCX A;  1Q81 U;  3JCM c;  3VS7 A;  2KK4 A;  3OQ5 A;  5M9O A;  3HBL A;  3HHT B;  2KRN A;  3QYG B;  3QYH B;  4MMK A;  1S72 T;  4ROE A;  4OGE A;  4BY6 B;  5HBJ B;  3GNF B;  3QYB A;  2QTX A;  1PWT A;  2V1R A;  4M77 G;  4PJL A;  2QI2 A;  3LLR A;  2QEX T;  3QZ9 B;  1K0S A;  1AZE A;  2MCN A;  5GAN g;  3LWH A;  1ZUU A;  4RTT A;  1VQ6 T;  1BCM A;  2XU8 A;  4MDW A;  2E65 A;  2B9R A;  1OL1 B;  1AD5 A;  2J6O A;  2EJF A;  2RQW A;  2M1H A;  3L2U A;  3EGX B;  2D1X A;  4J9B A;  2GFU A;  1Q7Y C;  1LOJ A;  1QQJ A;  2ED1 A;  5LJ3 g;  1ZP2 A;  2ABL A;  3G71 Q;  4JRP A;  4A63 B;  4N0A C;  1P92 A;  4IUQ A;  3JB9 D;  1VIE A;  4A4E A;  1SF9 A;  3TCJ A;  4HCC A;  1XQH A;  2CP3 A;  2KQW A;  8ATC B;  2AKK A;  3CCR A;  3VKI A;  4M7A G;  4FM4 B;  2OAW A;  3OYN A;  3D7S B;  4PJM A;  3VS4 A;  3V7S A;  2NLU A;  1ZBX A;  1TWB A;  2CUB A;  1N9R A;  1VYU A;  2J7I A;  1R0C B;  2VC8 A;  4C0Z A;  1VQL Q;  3CCS A;  4FYX B;  4A4G A;  1BI0 A;  3S3N A;  3DB3 A;  1QVF A;  5GAO q;  2HKQ B;  1PRM C;  5D6W A;  1YJN A;  1I07 A;  3M0T A;  2X4J A;  4I3Z B;  4OGR B;  4YOO A;  3HKS A;  4M78 B;  4QQG A;  1X6B A;  4CFV B;  2J6F A;  1X6O A;  3PIO A;  2YXY A;  2KNB B;  1Z9Z A;  4ZGD B;  1VQM Q;  3HSB A;  2KRM A;  3LW5 E;  3M0P A;  2BS4 A;  1GUX B;  3MP6 A;  1LNX A;  3V8L A;  3Q1J A;  1B34 B;  2RPN A;  3HB9 A;  2RHU A;  2AK5 A;  4LUD A;  1YN8 A;  1K9M R;  2MF2 A;  5KE2 A;  5C0M A;  3CCL A;  1AHJ B;  3J7A F;  1AOJ A;  1PSE A;  3CME T;  3CCU Q;  4M7D C;  1E7O A;  3VS0 A;  4B6M A;  4E7H A;  4JLI A;  2H3E B;  2XID A;  1QWE A;  5I2S A;  2DFU A;  4HA8 A;  2E6Z A;  4Z88 A;  3S6W A;  2EYZ A;  5GJV B;  1E9H B;  1QP2 A;  4RCB A;  3HRU A;  3SHW A;  4D6W A;  1H1R B;  4C8Q F;  3EGD A;  3OYD A;  1I8F A;  3MP8 A;  2MI6 A;  1Q82 R;  3GTM S;  4AKI A;  3CEY A;  4J9C A;  5CK9 A;  2XHC A;  3PNW C;  5J3B A;  4HKE A;  2XD0 A;  1K73 R;  2HL3 A;  3MY5 B;  2DL3 A;  2FVU A;  1VQ6 Q;  4PFZ A;  1YHQ T;  4QT7 A;  2JGZ B;  2KXC A;  1N4M A;  3RMS A;  2DL4 A;  3RBB B;  5CO7 A;  2IPO B;  3V8J A;  1H92 A;  1XNI A;  2QG9 B;  1K9M U;  1VQO A;  1GCQ A;  4N4H A;  4KRT A;  2IVW A;  2LNV A;  2KR6 A;  2KSS A;  4FYY B;  4BUG A;  2YWW A;  1KK7 A;  3BHV B;  1QCF A;  2F2X A;  4F6S B;  3QG1 A;  2JTM A;  2JOY A;  4EMK A;  3G4S T;  4MIM A;  4E7K A;  2MPX C;  1UGS B;  2HQX A;  1SSH A;  3LX7 A;  3M4G A;  1Q82 U;  1WHL A;  4MZP A;  4CRL B;  3JV3 A;  5CYI B;  1K73 U;  4M78 D;  1KD1 R;  3OSV A;  1NJI R;  1GL5 A;  4QVC A;  2JVV A;  4EDU A;  1IXD A;  4JPB W;  1K76 A;  4F7U F;  2W2H A;  2BZX A;  1I5O B;  3C0C A;  4N4G A;  1PKS A;  4LDY A;  3EH1 A;  3TN8 B;  2PTK A;  5GAO l;  3J81 E;  1KSW A;  2E5K A;  2QAZ A;  1SRL A;  3EID B;  2J06 A;  1X27 A;  5GAN 5;  2DTI A;  2QQR A;  4IUV A;  4M77 A;  4AT1 B;  2BPM B;  5ECA A;  3VUB A;  4BCK B;  2RHZ A;  4ME7 A;  3CMA T;  4ANJ A;  2COW A;  4M7D G;  1M3A A;  1VQ7 A;  3H8Z A;  3JRZ A;  1Y7X A;  2W9Z A;  2RJD A;  1KD1 U;  1NJI U;  3HZJ A;  4PLL A;  4NC6 A;  2CSI A;  2YUO A;  3M55 A;  3G6E T;  2J05 A;  3OYG A;  4VUB A;  2MIO A;  4EOJ B;  2IIM A;  3L42 A;  3I55 T;  2W96 A;  1AWO A;  1FVV B;  3MEU A;  2AIR B;  1YHQ Q;  3TNW B;  3OB9 A;  4QKU A;  2KYB A;  1WJS A;  1WLP B;  1JJ2 S;  2X4Y A;  4AMC A;  2G6F X;  4RMO A;  2OTL T;  1VQ9 T;  1K8A R;  4M7A A;  4DBQ A;  5GMK j;  1FWZ A;  2QQ8 A;  3DTO A;  1NZ9 A;  1RAE B;  1TD6 A;  2PVO B;  2E64 A;  1UJ0 A;  2E5Q A;  1KC8 C;  2XK0 A;  4J9G A;  1D3B B;  4BCP B;  2CGH A;  1VUB A;  1YJW T;  4IIM A;  4E6R A;  2DJQ A;  1QW1 A;  3UWN A;  5GAM e;  1RAH B;  3G4S Q;  4LD9 K;  7AT1 B;  4GBQ A;  2EGC A;  3H9N A;  8AT1 B;  4II5 B;  2HD0 A;  2RJC A;  4XAX B;  5LJ5 h;  2W9F A;  1YCY A;  2EKH A;  4II1 A;  3DLL A;  3OS5 A;  4A54 A;  2L5Q A;  4PJO C;  4BCJ B;  4OP0 A;  2JNG A;  1GFC A;  2E12 A;  1VA7 A;  3O5Z A;  1AWX A;  1RI0 A;  1CKA A;  3X24 B;  1YIT T;  4ATO A;  1MV0 B;  2E3H A;  1K8A U;  2PVG B;  1NM7 A;  1WJR A;  1ZA1 B;  4B9X A;  4ZTJ A;  5FWB A;  2CUD A;  4IUR A;  2DXC A;  3OW2 A;  3NTK A;  2F2W A;  3JCM V;  4RTZ A;  3JCM d;  3CD6 A;  1GRI A;  2RHY A;  3CCV T;  1ZUY A;  4P5N A;  4J83 A;  2MMP A;  2JZ2 A;  3CCL T;  4OMF B;  4EOR B;  3R6O A;  4X9C A;  1NEB A;  4UC4 A;  3SD4 A;  4DOW A;  2HEQ A;  4IUP A;  1IGU A;  2LX7 A;  2PQW A;  3LH0 A;  2YRV A;  3N5B B;  3VU3 C;  2VVK A;  3CMA Q;  2DXT A;  4DOV A;  2GGR A;  3EHQ A;  4RG2 A;  4BI3 A;  3KUF A;  2P0P A;  5I22 A;  3THK A;  3NTH A;  1TUG B;  3OS0 A;  2FEI A;  2O01 E;  4PJO E;  1RAI B;  3I55 Q;  2KR3 A;  3A8L B;  1M2V A;  1PCX A;  4EMH A;  2O4X B;  1LJO A;  1J3T A;  1JRI A;  1V1C A;  3NFC A;  5GAM f;  2OTL Q;  2WIH B;  2C4G B;  2DZC A;  1U3O A;  4JLG A;  2QQB A;  3M9Q A;  1WZO A;  4FYV B;  4JRK A;  1BI3 A;  3QDR B;  3FC3 A;  1HSQ A;  3MY1 B;  4HNU A;  2JTE A;  1X43 A;  3HRS A;  1HK9 A;  4F7L B;  2P0Q A;  4C92 E;  5CR2 A;  1GCQ C;  1YJW Q;  5HK3 A;  2F69 A;  4PFO A;  1C9B A;  4F7S B;  3F70 A;  3BG5 A;  4MFE A;  2JS2 A;  3A8H B;  2LP5 A;  2BIV A;  3KXT A;  5HKC A;  2JN0 A;  4E7J A;  5DLQ E;  4ESR A;  2C5N B;  4EMK C;  1VQ8 A;  4JX5 A;  2LRQ A;  4XTV A;  4M75 E;  3EG0 A;  4NL3 A;  3E2U A;  1H64 1;  1MUZ A;  3QKJ A;  4KUI A;  2FRW A;  1PKD B;  2ZPF B;  3SEM A;  1H26 B;  3PGG A;  3CCE A;  1PD0 A;  1BKB A;  1X01 A;  1W1F A;  2RH2 A;  1OKW B;  4RG8 A;  3B57 A;  5LJ3 j;  1OOT A;  1N27 A;  3QSU A;  1OX8 A;  4KBM B;  4A53 A;  1YIJ T;  5IDN B;  2FZG B;  2KGT A;  1SHG A;  4UN0 A;  3OY9 A;  1C1A A;  1RUW A;  3E9F A;  4DA4 A;  2VV5 A;  1KHC A;  3HPW A;  1JST B;  3CCV Q;  3CCL Q;  1PNJ A;  2CZ0 B;  1NPP A;  1LVK A;  5GAN 4;  4PJO B;  1M90 C;  1H1P B;  4PFP A;  4FX3 B;  4PJO F;  2DYB A;  4ZGJ B;  3QHS A;  1S1N A;  1NYG A;  3ZFJ A;  4BE2 A;  4J7I A;  4M77 C;  5GAO m;  1ACM B;  1NE8 A;  1VQ7 T;  1O9K B;  3MP1 A;  4F04 B;  2YUP A;  2EYQ A;  3OMC A;  2WAC A;  3OS1 A;  2JMA A;  3HFN A;  2F1L A;  2I2L A;  1PRL C;  2D6F A;  4A4K A;  4FU6 A;  3QXE B;  4ELY C;  3P8H A;  3O8V A;  3A8M B;  3NMZ C;  4OGC A;  4C92 B;  2LCL A;  2EYW A;  4CXA B;  4C92 F;  4AFS C;  5D7U A;  4F16 A;  3QJY A;  1EZZ B;  2CT3 A;  4E2F B;  4BCI B;  2H8H A;  2LCC A;  4JDS A;  3FEO A;  2WHB B;  1TH7 A;  2D8J A;  3OYC A;  2DEU A;  1G3Y A;  3I5S A;  5GAO r;  2LVM A;  4IUU A;  3BLR B;  4LNP A;  4DBR A;  2QDJ A;  1G2B A;  5KYX A;  1WJQ A;  2YLC A;  1OU9 A;  4M7A C;  4M75 B;  4V2S A;  5GAM g;  4KT0 E;  4JS4 A;  2DTH A;  4MDX A;  2Y4Y A;  1YFN A;  2RI3 A;  3UAT A;  2QA4 T;  1CKB A;  3QO3 A;  4EOP B;  1OI9 B;  4ELL A;  2KMT A;  2E70 A;  2OTJ A;  2MAM A;  2VGN A;  1KG1 A;  3TW6 A;  1QCN A;  2DL8 A;  3TVT A;  4C5E A;  2LQN A;  2A3L A;  2DIL A;  4HVW A;  4A4F A;  2M51 A;  2X51 A;  3X28 B;  5LJ5 d;  2EQK A;  3JB9 I;  1KQS P;  1D0Y A;  1RL2 A;  2DXU A;  4LDV A;  2MK5 A;  3RES A;  2ZZD A;  1TU0 B;  1VQM T;  4DEX A;  1BI2 A;  4J9F A;  5HQ0 B;  4CFN B;  2QQS A;  1K8A C;  1NYF A;  1WIE A;  2EKO A;  3REB B;  3BE3 A;  4IMY B;  3M56 A;  4EOK B;  3C95 A;  1OGU B;  3EOC B;  4CFX B;  2IN3 A;  4PJO D;  1KC8 R;  2EUF A;  2OJ2 A;  3CCU T;  2K3X A;  2ENM A;  2JTF A;  2DTO A;  5C6S A;  2PK9 B;  1G5V A;  5GAN 6;  4FIB A;  4BY7 X;  2RJF A;  3TNH B;  2L2P A;  3EHR A;  1VQ7 Q;  2EYY A;  1SG5 A;  1H1S B;  1QVF S;  1QVP A;  2L3P A;  2PHG A;  2DO3 A;  3URG A;  1QWF A;  3BY7 A;  4C92 D;  1RAD B;  2UZL B;  1Y96 B;  4M4Z A;  1H8K A;  2K57 A;  3I56 A;  3KBG A;  2NUP B;  1K9A A;  4DBH A;  4AFZ C;  4CC7 A;  4FSS A;  1OPL A;  3WXM B;  4C8Q E;  4O5V A;  3TEE A;  4MFD A;  4XK8 E;  2UUE B;  4M77 B;  1KC8 U;  4M77 F;  1QVG P;  3CC7 T;  2RQT A;  2R5M A;  4M75 D;  4YC3 B;  3MEA A;  1R8O B;  1ZLM A;  3EG9 A;  4AKG A;  3PIP A;  4AFU C;  3OYH A;  4EPC A;  1TUC A;  5FU6 B;  1YBY A;  4DQ2 A;  1UDL A;  1BU1 A;  2ESW A;  2LQK A;  5IHN A;  2QA4 Q;  2CZ1 B;  3BG9 A;  1M3C A;  2F2C A;  1T0H A;  3L2Q A;  4BE1 A;  1MMN A;  1ZSZ B;  3GBQ A;  1UUE A;  5GAN h;  2PU9 B;  2EPD A;  4BXX X;  2P4R A;  1UE9 A;  1VQ8 T;  5IF1 B;  4FW2 A;  1U8R A;  4M78 G;  2CH4 W;  1QMC A;  3EGU A;  1TG0 A;  2IW9 B;  5KCO A;  4M7A F;  1YJ9 T;  3X26 B;  2RJE A;  2EYX A;  3JCM h;  1YI2 T;  2P84 A;  2PK2 A;  3UA7 A;  3QYE A;  2ZPE B;  2F5K A;  3HP9 A;  3BHT B;  2KBT A;  1KIK A;  5KYW B;  1CSK A;  4OML A;  2C5V B;  2ED0 A;  1W70 A;  4F7U E;  4BD3 A;  1I4K 1;  1UJY A;  5IT9 E;  2K7A A;  4CC3 A;  2FG0 A;  1W2B P;  1OQK A;  1WGS A;  2RK1 A;  1UTI A;  4LE9 A;  2DL5 A;  1OIY B;  3PTA A;  2V22 B;  5FU7 B;  3REA B;  3CXC P;  3CC2 A;  4C8Q B;  1WX6 A;  1GY3 B;  2DXB B;  1F5Q B;  3SWN B;  2K2M A;  1JSU B;  4JJB A;  2M02 A;  2E4H A;  2CZ6 B;  2ECZ A;  5LJ5 f;  1RLP C;  2NYS A;  3GF5 A;  1VQ5 A;  2LX9 A;  4GLM A;  4B9W A;  3VS2 A;  2OI3 A;  3CC4 A;  3QWX X;  3M53 A;  2BZ8 A;  2YUQ A;  4JUV A;  3T9N A;  4M77 D;  4XU3 A;  3X25 B;  2EWN A;  3C4S A;  3H0I A;  1T0J A;  2RI5 A;  1OU8 A;  1I5L A;  3VYG B;  3SFM A;  3CC7 Q;  3PT9 A;  3KFV A;  5IHI A;  4HVV A;  2DL7 A;  3LYI A;  3LQ5 B;  1R0B G;  5A0G A;  1M90 R;  2E6N A;  4JZ4 A;  4Z6Y A;  3RR6 A;  1X75 C;  3JCM J;  4M7D E;  5J26 A;  3CCJ A;  4C0G A;  1W98 B;  3V7R A;  1BK2 A;  3OBW A;  4XQ3 A;  5I2M A;  1VQ4 T;  4N4I A;  3G7Z A;  3JCM b;  2QFZ A;  2K79 A;  5LMK B;  2NUT A;  1GBQ A;  2K4Y A;  1UB4 A;  3BLH B;  5KYY B;  2LZ6 B;  1M2O A;  2DZ9 A;  2E3I A;  2G77 A;  3MKD A;  4ZTF A;  4F6U B;  4L5G A;  3AT1 B;  5A0L A;  5CKB A;  1VQ8 Q;  3DDQ B;  2V1Q A;  1H24 B;  4F7U B;  1QVF P;  1NPR A;  1PM3 A;  3CCQ A;  4LD6 A;  1NBE B;  2AT1 B;  1D09 B;  2A36 A;  4RUG A;  1WDX A;  1YJ9 Q;  2RMO A;  1YI2 Q;  2GBQ A;  3E1S A;  5A2Q E;  3L2W A;  3L2Z A;  5CKD A;  5DM7 R;  1FMK A;  1JEG A;  4Y72 B;  1M90 U;  4OR5 B;  1VQP A;  2E10 A;  3OYB A;  1VOM A;  1TUD A;  2HL5 C;  2Y90 A;  2CT4 A;  3ZEH A;  2X4W A;  1D0Z A;  2RQU A;  5HCK A;  2M9U A;  4C8Q D;  2ATC B;  2RQR A;  3EGX A;  1GBR A;  2KXD A;  3OYL A;  1VQK A;  3HO8 A;  4AG1 C;  4EON B;  2L3R A;  3VJP A;  1JB0 E;  4J7F A;  4KGV B;  4XTY A;  5KYU B;  2DD5 A;  3POM A;  5EC7 A;  3G33 B;  2CP2 A;  2CP6 A;  5FGK B;  4BY1 X;  1WHM A;  4E7I A;  1G83 A;  2K6D A;  5I5Z B;  1ZHI A;  4C5I A;  4M7D B;  3OW2 S;  2RF0 A;  1U1S A;  4M7D F;  4IIO A;  4JX6 A;  1AIS B;  2ZAE A;  3J80 E;  2IW6 B;  2WPA B;  1IHW A;  2DER A;  1M27 C;  2A28 A;  1IHV A;  1V76 A;  2BUD A;  2C0I A;  2WSC E;  3M0U A;  4CRI A;  3NTI A;  1QP3 A;  1RLQ C;  1VIN A;  4M78 A;  4RCC A;  3RKW A;  1ARK A;  1OL2 B;  3BG3 A;  1WYX A;  2V26 A;  2PJQ A;  2QGF B;  1E6H A;  2BTT A;  3CCR T;  1YWO A;  1VQ4 Q;  3VS6 A;  2OTJ Q;  1I0C A;  2LT1 A;  1SKU B;  1M3B A;  1B34 A;  6AT1 B;  4HL4 A;  1YP5 A;  4EMG A;  3JB9 H;  2EJG A;  3DL1 A;  4R56 A;  3CPF A;  4BI4 A;  1AEY A;  2VB6 A;  3CCS T;  2L0A A;  4DBF A;  1YJN T;  1U1T A;  4ZN1 A;  3A98 A;  5GAN d;  1TTH B;  1BBZ A;  1BIA A;  2QK0 A;  1X6G A;  4CFU D;  1K4U S;  2K9G A;  4X9D A;  1WI7 A;  4J9E A;  2VXF A;  4E7Z A;  2VWF A;  1VQL A;  4QW2 A;  4LOC A;  2FHD A;  3R6N A;  3UF4 A;  1PHT A;  5LJ3 d;  3CCM A;  2IW8 B;  3M0Q A;  3M0S A;  4YOZ A;  5GAM j;  2HNI A;  1WFW A;  2D0N A;  1QCO A;  2KMG A;  3C94 A;  3LH5 A;  3VS1 A;  2ZPI B;  1EX4 A;  1OYX A;  2AZV A;  3RKY A;  3OYE A;  3CPW A;  2SEM A;  4E7S A;  4E47 A;  2I40 B;  4ZN3 A;  5GAN 7;  5A0D A;  3X20 B;  2DX1 A;  3VRZ A;  5DY9 A;  1K0X A;  4J9H A;  1RAB B;  2P4T A;  2DF6 A;  2HDA A;  3LGF A;  1JKW A;  4XTX A;  4BCM D;  2CYZ B;  5HNB B;  3MHX A;  3GLX A;  2FL7 A;  2FO0 A;  4AFQ C;  3LGL A;  4M7D D;  2ROL A;  2C5O B;  4GY5 A;  4EOL B;  2ZPG B;  1S72 A;  2HBP A;  1G3S A;  3L2R A;  4OMP A;  3NPF A;  1QMZ B;  2DD4 B;  1VQO T;  2PUO B;  1JBM A;  2X9H A;  5CCA A;  2QEX A;  3RIR A;  2CZ7 B;  1EFN A;  2D0Q B;  5L2W B;  2LQ8 A;  2YT6 A;  2DIG A;  4MML A;  2X4X A;  1VQ6 A;  4BCO B;  1H4L D;  5GAN e;  3SB2 A;  1IRE B;  1PD1 A;  1JXO A;  1UGR B;  3MET A;  3UT1 A;  1YCS B;  2FYK A;  5FRM A;  2RK2 A;  1E7P A;  4AKH A;  2M0Y A;  3CCR Q;  3EFS A;  2LC4 A;  3QJ6 A;  2KY9 A;  1G3N C;  2J6K A;  3V8K A;  4CC4 B;  4BAC A;  2LCS A;  4JX4 A;  4MZT A;  3JCM e;  4BCN B;  4Y92 A;  4C0D C;  3MIA B;  2EJ9 A;  3GPL A;  2KT1 A;  3A8O B;  4LUE A;  4NOY A;  3CCS Q;  5DQV A;  2RHX A;  1YJN Q;  2MWO A;  2BS2 A;  3HTR A;  2XMF A;  3PE0 A;  3S3O A;  1N8R C;  1M30 A;  4R0K A;  5IH2 A;  2KEA A;  1W4S A;  4OB2 B;  4KGX B;  4OMN A;  1JOW A;  3RDV A;  1OV3 A;  2EIF A;  2NWM A;  2VGM A;  1WXU A;  3GP8 A;  4R55 A;  1TXQ A;  1IB8 A;  1RAA B;  1KQS A;  1TS9 A;  2CCI B;  2GQV A;  4Z89 A;  3WVD B;  5LQF B;  2LW4 A;  3VS3 A;  4IUT A;  1OZ2 A;  1JJ2 P;  4ZGE B;  3OW2 P;  4HNV A;  2GTJ A;  3ZL7 C;  4HXJ A;  2PUK B;  1Q95 G;  2XG8 D;  3RNJ A;  2WEV B;  1UGQ B;  4BY6 C;  2R58 A;  2W10 A;  4JZ3 A;  5GAN 2;  3C12 A;  2R7G A;  2Z0W A;  1X69 A;  4RKU E;  4ELZ C;  4HVU A;  1KFZ A;  2M16 A;  3CC2 Q;  4BB7 A;  1VYW B;  2O31 A;  2LNH B;  1WA7 A;  4Y28 E;  1HD3 A;  2I53 A;  2UZD B;  1U06 A;  3JCM X;  1OX9 A;  1RAF B;  2K5F A;  2DYI A;  3FIF A;  3CME A;  4ELJ A;  5GAN f;  2RHI A;  2VKN A;  4L59 A;  4HLQ A;  1D3B A;  5D6X A;  2RNA A;  5FRN A;  3H0F A;  4F70 B;  4RTV A;  4Y91 A;  2HKN A;  3ME9 A;  2SRC A;  4XTW A;  4WCI A;  5HBE B;  4X1V A;  1FX7 A;  3EH2 A;  1ABO A;  3V7C A;  3CBP A;  4EIK A;  1VQO Q;  1OEB A;  2QF7 A;  4IKF A;  5GMK h;  2MOX A;  3IQL A;  2D9T A; 
#chains in the Genus database with same CATH homology
 4BE1 A;  3CCU A;  3JCM f;  3H6Z A;  4N4G A;  4LDY A;  4Q5W A;  2ZZD B;  3GOX A;  2QDY B;  5GAO l;  5CIU A;  3QPH A;  3J81 E;  1VQ5 T;  4J6W A;  5GAN h;  2PU9 B;  3OYI A;  3GIB A;  1OI1 A;  1YHQ A;  3CC4 T;  5GMK i;  3JB9 G;  4M75 G;  3AHU A;  5GAO n;  3KHI A;  1KQS S;  5GAN 5;  1VQ8 T;  2DTI A;  3JCM Q;  2QQR A;  3BDL A;  2WSF E;  3OYY A;  4M78 G;  4IUV A;  4M77 A;  1U8R A;  1QVG A;  4QQ6 A;  2V8K A;  2DK3 A;  3JSC A;  5EJC A;  3VUB A;  4C0F A;  2YLB A;  4M75 C;  1ZQ1 A;  5KCO A;  2RHZ A;  4ME7 A;  3OS2 A;  4M77 E;  4M7A F;  1YJ9 T;  3X26 B;  2RJE A;  3JCM h;  1YI2 T;  2RB6 A;  4M78 C;  4J8O A;  3QYE A;  4J6Y A;  4N0A A;  3L2V A;  2ZPE B;  3CMA T;  1VIF A;  1Q7Y U;  4M7D G;  3MCA B;  4F7U A;  5HK0 A;  2VXE A;  1VQ7 A;  2F5K A;  3HP9 A;  2LT4 A;  2B8A A;  3H8Z A;  1GXI E;  3JRZ A;  4HNT A;  1Y7X A;  2QQA A;  2RJD A;  3A5Z B;  4O6J A;  5IAY A;  3CCJ T;  1NJI U;  1KD1 U;  2RM4 A;  5HY6 A;  3HZJ A;  4F7U E;  3G4S A;  2F5T X;  4BD3 A;  3PMI A;  4NC6 A;  3M55 A;  4PLL A;  3G6E T;  1I4K 1;  5IT9 E;  3OYG A;  4VUB A;  1MHN A;  3CC7 A;  4BE0 A;  1K9M C;  3L42 A;  1N9S A;  3I55 T;  3FLG A;  5LJ3 e;  3L1A A;  1WGS A;  3S3M A;  2RK1 A;  3MEU A;  2HQE A;  2DVE A;  2IG0 A;  3OB9 A;  3PTA A;  1WJS A;  3OYA A;  5FU7 B;  3CC2 A;  1JJ2 S;  2X4Y A;  2XDB A;  4KUD K;  3CCM T;  3CD6 T;  2WJ9 A;  3M59 A;  3PMT A;  3HRT A;  4C8Q B;  4RMO A;  2OTL T;  3VKG A;  1M1F A;  2DXB B;  3SWN B;  1VQ9 T;  4M7A A;  3CCQ T;  5CAI A;  5GMK j;  1FWZ A;  2CZ6 B;  2QQ8 A;  3OYF A;  4JJN K;  1NZ9 A;  4EMK B;  5LJ5 f;  4M7A E;  3GF5 A;  4XU1 A;  2PVO B;  3VKH A;  2LX9 A;  2E64 A;  2RI2 A;  1VQ5 A;  4NL2 A;  2O4X A;  2E5Q A;  4B9W A;  5GAN j;  1Q86 U;  1KC8 C;  2XK0 A;  3CC4 A;  3M53 A;  4JUV A;  2RA2 A;  3MEW A;  3T9N A;  1D3B B;  1Q82 C;  3RKX A;  2CGH A;  4M77 D;  1VUB A;  1YJW T;  2QQ9 A;  4XU3 A;  3RUX A;  3X25 B;  1VQP T;  1K73 C;  1VQN A;  3BFM A;  2EWN A;  1QW1 A;  3M54 A;  3C4S A;  3ER0 A;  1QLB A;  3UWN A;  2RI5 A;  5GAM e;  3OYM A;  1W2B A;  4PJO G;  4LD9 K;  2AHJ B;  1QVG S;  2ZCF B;  1I5L A;  3VYG B;  3SFM A;  1WPY A;  3H4C A;  5GMK l;  3PT9 A;  1SSF A;  1YJ9 A;  2ZPH B;  3CXC A;  2HD0 A;  2RJC A;  4XAX B;  5LJ5 h;  1YI2 A;  1YCY A;  3BW1 A;  4II1 A;  3DLL A;  1VQ8 A;  3TW7 A;  3LYI A;  4M7D A;  5A0G A;  3OS5 A;  4A54 A;  2L5Q A;  5CKH A;  3HFO A;  3CMA A;  1VQK T;  4PJO C;  2E6N A;  4BBS M;  4OP0 A;  3ZBD A;  2JNG A;  2E12 A;  4OVA A;  4Z6Y A;  3JCM J;  1X75 C;  1RI0 A;  3OYJ A;  5J26 A;  3CCJ A;  3X24 B;  5CQX A;  4L6V 5;  2E41 A;  4C0G A;  1YIT T;  5IN1 A;  3V7R A;  4ATO A;  2KDS A;  3OBW A;  4XQ3 A;  1FXX A;  5I2M A;  4CI0 C;  2PVG B;  4N4I A;  3G7Z A;  3JCM b;  3G6E A;  1WJR A;  2QFZ A;  1K8A U;  4B9X A;  2ZPB B;  4C5G A;  4ZTJ A;  3E19 A;  2K4Y A;  5AYF A;  3FJP A;  1UB4 A;  2GF7 A;  3QUI A;  3I55 A;  1VQ4 T;  2LDM A;  3TU4 K;  4IUR A;  2DXC A;  5LJ5 e;  4C92 G;  2DZ9 A;  3M5A A;  3OW2 A;  3NTK A;  2G77 A;  3OMG A;  4MZM A;  4ZTF A;  4BBR M;  4L5G A;  3JCM V;  2L89 A;  3FDR A;  3JCM d;  5A0L A;  4OB1 B;  5CKB A;  3CD6 A;  3CBM A;  4PKC C;  2RHY A;  3CCV T;  4XTU A;  4P5N A;  4J83 A;  2MMP A;  4F7U B;  1VQ9 A;  1BIB A;  2OTL A;  1UEB A;  2JZ2 A;  2P0K A;  4OMF B;  3CCL T;  3R6O A;  1NPR A;  3CCQ A;  4LD6 A;  2A7Y A;  4X9C A;  2DAQ A;  3DKM A;  4LDW A;  4UC4 A;  3JCM g;  5I21 A;  4E7L A;  5FU6 C;  5LJ3 f;  3SD4 A;  4DOW A;  1KD1 C;  1DJ7 B;  1NJI C;  1V29 B;  4IUP A;  2V8I A;  2DD5 B;  3E9G A;  2G3R A;  5CKF A;  4PNO A;  5KE3 A;  2PQW A;  1OZ3 A;  2ZGW A;  3LH0 A;  2YRV A;  4PL6 A;  3N5B B;  3VU3 C;  3E1S A;  5A2Q E;  3L2W A;  3L2Z A;  2C06 A;  2DXT A;  4M7D E;  5CKD A;  5DM7 R;  4DOV A;  5GAN 8;  1M90 U;  1YJW A;  2X35 A;  2XI9 A;  4RG2 A;  4BI3 A;  1VQP A;  1FKM A;  3M4Y A;  2E10 A;  3KUF A;  4PJO A;  1IZ6 A;  2EQM A;  3OYB A;  2P0P A;  3BDU A;  3FB9 A;  3NTH A;  2XKO C;  3CCE T;  2E1H A;  3OS0 A;  4M7A B;  1BYM A;  4QSH A;  2R5A A;  3G71 T;  1W2B S;  1BI1 A;  1WNL A;  2Y90 A;  3M58 A;  2KVQ G;  2O01 E;  4QQD A;  4PJO E;  3ZEH A;  2X4W A;  5LJ3 h;  1WQ7 A;  3P8D A;  5LJ5 j;  2M9U A;  4M6V A;  4C8Q D;  4QVD A;  3A8L B;  4BI8 B;  4EMH A;  3CXC S;  4NS5 A;  3OYL A;  2O4X B;  1VQK A;  3OSS C;  3HO8 A;  4JRI A;  1I81 A;  1LJO A;  3JB9 F;  4M75 F;  1JRI A;  5GAM f;  3NFC A;  4JRQ A;  1Q86 C;  2MWP A;  1H3Z A;  2EQU A;  2L3R A;  3EAE A;  3VJP A;  1JB0 E;  1YIT A;  4M78 F;  2DZC A;  4XU0 A;  4J7F A;  4JLG A;  1VQ4 A;  4XTY A;  2DD5 A;  2QQB A;  3VUZ A;  4C92 A;  3M9Q A;  4JRK A;  1BI3 A;  3QDR B;  4FSX A;  2K5L A;  3FC3 A;  4HNU A;  1VQL T;  1M1G A;  4E7I A;  3HRS A;  3CBO A;  1ZHI A;  3P8B B;  4C8Q G;  1HK9 A;  4C5I A;  2P0Q A;  4C92 E;  4M7D B;  4A4H A;  3OW2 S;  3QBY A;  5CR2 A;  1U1S A;  3M57 A;  5FLX E;  4M7D F;  3CCV A;  5HK3 A;  2F69 A;  4Z02 A;  5GAM h;  4JX6 A;  4C0D B;  1M8V A;  4OB0 B;  2R57 A;  3F70 A;  3UPU A;  3J80 E;  1KQ1 A;  1G3T A;  5FU7 C;  4OB3 B;  3BG5 A;  4MFE A;  3WVE B;  2RD1 A;  4C8Q C;  1Y07 A;  2BUD A;  4GLK A;  5GAO p;  4HCZ A;  3A8H B;  3SWN C;  2BIV A;  5FRO A;  3JB9 J;  2WSC E;  1M9S A;  4M75 A;  3KXT A;  5GMK m;  3OA6 A;  5HKC A;  1M1K U;  4CRI A;  2JN0 A;  2EQJ A;  3NTI A;  1QP3 A;  4FT2 A;  2FB7 A;  5CVI A;  5DLQ E;  4E7J A;  4J5Y A;  3DLM A;  2DXC B;  2DD4 A;  4M78 A;  4EMK C;  1XTD A;  2EFI A;  4JX5 A;  1O9S A;  2LRQ A;  4RCC A;  4XTV A;  4M75 E;  3RKW A;  2XDD A;  3JCM W;  2M0O A;  5J39 A;  3BG3 A;  4OF1 A;  4X34 A;  4NL3 A;  1H64 1;  3QKJ A;  4KUI A;  3CCR T;  4LDX A;  2JUF A;  2ZPF B;  4M78 E;  2GCX A;  1Q81 U;  3PGG A;  3CCE A;  1BKB A;  2LT1 A;  3JCM c;  3RER A;  4YTL A;  2Y4X A;  1X01 A;  2KK4 A;  2H3J A;  3OQ5 A;  5M9O A;  1B34 A;  2RH2 A;  4RG8 A;  4HL4 A;  5LJ3 j;  3HBL A;  1N27 A;  4EMG A;  3JB9 H;  3HHT B;  2EJG A;  3DL1 A;  4A53 A;  4KBM B;  3QSU A;  4R56 A;  3CPF A;  4BI4 A;  1YIJ T;  5KH6 A;  3CCS T;  3QYG B;  3QYH B;  4FT4 A;  4MMK A;  1S72 T;  4OGE A;  2OAU A;  3OY9 A;  3TRE A;  3E9F A;  4DA4 A;  3HL8 A;  1YJN T;  1U1T A;  2VV5 A;  1KHC A;  4BY6 B;  2DJZ A;  4ZN1 A;  3HPW A;  5GAN d;  4BDY A;  3GNF B;  3QYB A;  1WQW A;  2QTX A;  2CZ0 B;  4M77 G;  1NPP A;  2QI2 A;  3LLR A;  2QEX T;  3QZ9 B;  1BIA A;  5GAN 4;  4PJO B;  1M90 C;  2OTJ T;  5GAN g;  4PJO F;  3LWH A;  4ZGJ B;  3QHS A;  4X9D A;  1HXD A;  1VQ6 T;  3A8G B;  2XU8 A;  2VXF A;  3ZFJ A;  1UGP B;  4MDW A;  1N8R U;  1VQL A;  4QW2 A;  4LOC A;  4BE2 A;  4J7I A;  2FHD A;  4M77 C;  5GAO m;  2E65 A;  1NE8 A;  5LJ3 d;  1VQ7 T;  4HCB A;  2EJF A;  3MP1 A;  3CCM A;  2M1H A;  4F7U G;  2EYQ A;  3L2U A;  4M7A D;  3OMC A;  3ASK A;  2WAC A;  1M5Q 1;  2GFU A;  5CKE A;  2HNI A;  5GAM j;  3OS1 A;  1Q7Y C;  3HFN A;  3OYK A;  1LOJ A;  5LJ3 g;  2GFA A;  2I2L A;  2CKK A;  2D6F A;  2KMG A;  2KAF A;  4A4K A;  3C94 A;  4FL6 A;  4N0A C;  4JRP A;  3OBY A;  3QXE B;  4FU6 A;  2ZPI B;  1P92 A;  3LWI A;  4IUQ A;  1OYX A;  4ELY C;  3JB9 D;  3P8H A;  3O8V A;  3RKY A;  3A8M B;  1VIE A;  4A4E A;  3OYE A;  3CPW A;  4OGC A;  4C92 B;  4E47 A;  2LCL A;  4ZN3 A;  5GAN 7;  5A0D A;  3X20 B;  3TCJ A;  4C92 F;  4HCC A;  5DY9 A;  4XU2 A;  1XQH A;  4HT9 A;  2P4T A;  3LGF A;  3MEV A;  3QJY A;  2WSE E;  2KQW A;  1M4Z A;  4XTX A;  2VYT A;  2LCC A;  3EFR A;  1EIF A;  2CYZ B;  3FEO A;  4JDS A;  3CCR A;  3VKI A;  4M7A G;  4FM4 B;  1TH7 A;  1Y96 A;  2EAY A;  3QII A;  3MHX A;  3GLX A;  2FL7 A;  3QWL A;  3OYN A;  3OYC A;  2DEQ A;  1G3Y A;  5KCH A;  2HAX A;  5GAO r;  2LVM A;  4IUU A;  5GAM d;  3V7S A;  2NLU A;  1ZBX A;  3LGL A;  1N9R A;  4M7D D;  4GY5 A;  1YIJ A;  2VC8 A;  4C0Z A;  2QDJ A;  3CCS A;  4A4G A;  2ZPG B;  1BI0 A;  1S72 A;  3S3N A;  3DB3 A;  1QVF A;  1WJQ A;  2YLC A;  5GAO q;  4M7A C;  4M75 B;  2HBP A;  4V2S A;  1G3S A;  5D6W A;  5GAM g;  3L2R A;  1YJN A;  2V8J A;  4KT0 E;  3QZ5 B;  4JS4 A;  2DTH A;  2X4J A;  3HKS A;  1VQN T;  2DD4 B;  4M78 B;  4MDX A;  2Y4Y A;  2RI3 A;  1VQO T;  2PUO B;  1JBM A;  4QQG A;  3RMQ A;  1X6O A;  5CCA A;  3PIO A;  2QA4 T;  3QO3 A;  3SDZ A;  2QEX A;  5GAN 3;  5GMK e;  2KMT A;  2E70 A;  4ZGD B;  5DLO A;  3HSB A;  2MAM A;  2OTJ A;  2VGN A;  3RIR A;  2CZ7 B;  1KG1 A;  2D0Q B;  3TW6 A;  3LW5 E;  2LQ8 A;  4HT8 A;  4XTZ A;  2DIG A;  4MML A;  2BS4 A;  2X4X A;  3MP6 A;  1LNX A;  4C5E A;  1VQ6 A;  3I56 T;  1Q81 C;  3V8L A;  2DPP B;  5GAN e;  2A3L A;  3Q1J A;  1B34 B;  4A4F A;  3HB9 A;  3SB2 A;  1IRE B;  2RHU A;  3X28 B;  2DKG A;  2K3Y A;  2MF2 A;  1UGR B;  3FRN A;  3MET A;  3UT1 A;  2EQK A;  4J6X A;  2FYK A;  5D6Y A;  5KE2 A;  2PVD B;  5LJ5 d;  3JB9 I;  5C0M A;  2RK2 A;  5FRM A;  3CCL A;  1RL2 A;  1AHJ B;  3J7A F;  1PSE A;  1E7P A;  4AKH A;  2BS3 A;  2DXU A;  3EFS A;  4LDV A;  3RES A;  2K5I A;  2ZZD A;  2LC4 A;  3QJ6 A;  4QVZ A;  5L8R E;  3CME T;  2KY9 A;  4BDZ A;  1VQM T;  5LJ5 g;  2YHT A;  4LDU A;  4M7D C;  1BI2 A;  2DIQ A;  4JLI A;  3V8K A;  3JAM E;  4E7H A;  1MGQ A;  1PSF A;  2XID A;  3PFS A;  4JX4 A;  4MZT A;  5I2S A;  3JCM e;  4HA8 A;  4BAC A;  1N6A A;  2QQS A;  1K8A C;  2E6Z A;  1KQ2 A;  4C0D C;  2BKD N;  2EJ9 A;  2EKO A;  3A8O B;  4NOY A;  3S6W A;  3GPL A;  3M56 A;  2RHX A;  2K2V A;  1QP2 A;  4RCB A;  3C95 A;  3HRU A;  2MWO A;  2BS2 A;  3DB4 A;  4D6W A;  3CPW S;  2CS7 A;  4PJO D;  4C8Q F;  3S3O A;  3VYH B;  1N8R C;  1W4S A;  4OB2 B;  3OYD A;  1I8F A;  2EIF A;  2MI6 A;  2VGM A;  3MP8 A;  2VUB A;  3CCU T;  3JCM P;  2K3X A;  4AKI A;  2QXF A;  3CEY A;  4KUL A;  5CK9 A;  3GP8 A;  3G71 A;  2JTF A;  2XHC A;  3PNW C;  4HKE A;  5J3B A;  4R55 A;  2XD0 A;  2DTO A;  2FVU A;  3INZ A;  5C6S A;  2L8D A;  4JS5 A;  1M1K C;  1KQS A;  1YHQ T;  2GQV A;  1G5V A;  5GAN 6;  4FIB A;  2RJF A;  4TVR A;  3WVD B;  3RMS A;  5CO7 A;  4IUT A;  1OZ2 A;  3V8J A;  4ZGE B;  1QVF S;  1QVP A;  4HNV A;  1XNI A;  1K9M U;  1VQO A;  2QA4 A;  4N4H A;  2PUK B;  2XG8 D;  1UGQ B;  2DO3 A;  3UDC A;  3URG A;  3BY7 A;  4C92 D;  1Y71 A;  4BY6 C;  4C5H A;  2IVW A;  2R58 A;  2LNV A;  1Y96 B;  2KR6 A;  5LL6 S;  2LTO A;  2KSS A;  4BUG A;  5GAN 2;  3C12 A;  2K57 A;  3I56 A;  2XIC A;  4PLI A;  4RKU E;  4ELZ C;  4C8Q A;  1XOV A;  2M16 A;  3KBG A;  2DXB A;  3SWN A;  4BB7 A;  3QG1 A;  1G3W A;  3VV0 A;  4Y28 E;  3WXM B;  4C8Q E;  3JCM X;  4O5V A;  3TEE A;  2JTM A;  4MFD A;  2JOY A;  2K5F A;  4XK8 E;  4EMK A;  3G4S T;  3FIF A;  3CME A;  4M77 B;  3MO8 A;  4MIM A;  1KC8 U;  4M77 F;  1VQM A;  4WF2 A;  4E7K A;  1UGS B;  3CC7 T;  2HQX A;  4ELJ A;  5GAN f;  2RHI A;  2R5M A;  3LX7 A;  3M4G A;  4L59 A;  4M75 D;  4HLQ A;  3MEA A;  1R8O B;  1Q82 U;  4MZP A;  1JJ2 A;  4AKG A;  1D3B A;  1O75 A;  4AI6 A;  5D6X A;  3PIP A;  4Y91 A;  1K73 U;  5FRN A;  3GNG A;  3OYH A;  4M78 D;  2XDP A;  3OSV A;  4EPC A;  5CQY A;  5EG2 A;  3CC2 T;  5FU6 B;  1KHI A;  3ME9 A;  1YBY A;  4DQ2 A;  4QVC A;  2JVV A;  4EDU A;  4XTW A;  2LQK A;  1FX7 A;  3V7C A;  3CBP A;  4F7U F;  3VYG A;  2CZ1 B;  3BG9 A;  2QF7 A;  4C92 C;  2RO0 A;  4IKF A;  5GMK h;  3L2Q A;  2D9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...