2DPPB

Crystal structure of thermostable bacillus sp. rapc8 nitrile hydratase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
227
Chain Sequence
b'MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLAFGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIPRREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
molecule tags Lyase
source organism Bacillus sp. rapc8
publication title Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratse
rcsb
total genus 62
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2dppB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dppB02
1UGRB 3X24B 1IREB 2PVOB 3QZ9B 2D0QB 2DD4A 1UGPB 1AHJB 3WVDB 3VYGA 2DD5A 4KT0E 2WSEE 3QYHB 3LW5E 2ZZDB 2PUKB 3A8GB 4Y28E 1UGQB 2PU9B 4OB0B 3X28B 2O01E 3A8LB 2ZCFB 2ZPIB 2ZZDA 2ZPEB 4FM4B 4OB3B 3X20B 1PSFA 2WSCE 3VYGB 2CYZB 1PSEA 2DD5B 4OB2B 5L8RE 1DJ7B 2QDYB 2DXCB 2CZ7B 1V29B 2ZPHB 3VYHB 4RKUE 2AHJB 3A8HB 2PUOB 4XK8E 3HHTB 1GXIE 1JB0E 2DXBB 1QP2A 1QP3A 1UGSB 3QYGB 2CZ0B 4ZGJB 2DPPB 4L6V5 4ZGEB 2PVGB 2DXCA 2WSFE 3X25B 2ZPGB 2CZ1B 3QXEB 3A8MB 3WVEB 2DXBA 2ZPFB 2CZ6B 4ZGDB 3QZ5B 2DD4B 4OB1B 2ZPBB 2PVDB 3A8OB 3X26B
chains in the Genus database with same CATH superfamily
4M77A 1D09B 3CC4A 4GLMA 2ROTA 2RHYA 4P5NA 4M75G 1WGSA 4EONB 1H641 4YC3B 3D7SB 3LWHA 4LDWA 4QQ6A 2K2VA 2K3XA 1M1KR 2VYTA 1RLQC 3I55A 2ESWA 4QQGA 4F04B 5DQWA 3PT9A 2M9UA 3S3MA 1K0SA 4JZ3A 3CBMA 4A4GA 1U1TA 2L2PA 1RL2A 5CK9A 1RAAB 1TUGB 3VU3C 3V8KA 2AKKA 2YUQA 1M90C 4OGCA 1O9KB 1FKMA 4ROEA 2IW9B 5FROA 1G8XA 3EG9B 4J5YA 2LMJA 4EORB 2F69A 2X4WA 4B6MA 2WHBB 1SF9A 2JMAA 1WA7A 2E10A 1VQ5T 2EYWA 2NUPB 5GAN2 2L3QA 3PIPA 4BY6C 5KE2A 1QVFP 1PKSA 4C92F 4HVWA 2RHZA 4DEXA 1YJNQ 1KD1U 1VQ4T 2EKHA 3CCUA 4OP0A 1HJDA 4JX6A 4Z88A 4HA8A 5D6YA 1KHIA 3ZL7C 2DA9A 4RTVA 2KXDA 3FRNA 3CCJA 4XTYA 1IGUA 2DBMA 1KQSS 2CZ0B 2EPDA 2L0AA 1VQPQ 1WFWA 2ECZA 4FU6A 3PE0A 5LJ3g 4MZTA 1MNDA 4Z8AA 2OTJT 1X2QA 2CP7A 4PFPA 4C0GA 2ZPGB 1E9HB 2LT4A 4LXCA 3G1JA 4PL6A 1NE8A 1SSFA 3O5ZA 2UZBB 3PMTA 2O88A 3J80E 4C5EA 1TWBA 3QKJA 1H3HA 3JV3A 2DM1A 3VUZA 2M16A 2WFYB 5CKFA 1ZP2A 1H1QB 1KIKA 5LJ3f 2K5LA 1S72T 2AIRB 2KMTA 3OBWA 3A8OB 1VQPT 2L3RA 1VQ7A 1BIBA 5GAMe 1M4ZA 3BE3A 2BE7D 4JRPA 1C0MA 5FWCA 4OMMA 2JNGA 1M90U 3NTIA 1PD0A 2CP6A 2EGEA 2QQRA 5CVIA 1K1ZA 4BCFB 2L5QA 3BG5A 1VIFA 2JM9A 2P0KA 4FW1A 1SSHA 3V7SA 2VGNA 4MFEA 1F1BB 2ZAEA 1M27C 3CBPA 3QYBA 3SD4A 4MZPA 2J6KA 3CCRQ 1B07A 1D1CA 4M78B 4EOLB 1OX8A 1E7OA 1UJYA 3GLXA 3UA6A 1Q82C 1YP5A 3C12A 1VQLA 5CQXA 2ZCFB 1WHHA 1F5QB 2GCXA 3JCMW 2PZ1A 1QMCA 1YJ9A 1BK2A 1XQHA 4FM4B 1VQ4A 2NLUA 1G3TA 1PSEA 2DRMA 4KRTA 2I0NA 5A0LA 1W2BS 1VQ5A 2A7YA 3EGXA 1SRMA 4KGXB 4ME7A 2EVRA 4BDZA 4WTOB 1U5SA 3CCRA 3EH2A 1GCQC 1WHJA 3CC2T 2BZYA 1KQ2A 4LUDA 1YJWQ 4NL2A 3UWNA 1Y0MA 2K9GA 4CFNB 4IUUA 3CC7T 2G77A 4J6YA 2IN3A 1MNEA 5A0GA 2KVQG 4M6VA 4EC9B 3JCMe 2WSFE 4M7AE 2Y90A 2QQAA 1VYVA 1Q81C 3G33B 3EFRA 4CFXB 3I55Q 1MMGA 3A8MB 2MK5A 2J7IA 3J7AF 4EOMB 3LGFA 1I07A 1UHCA 4YOOA 1VQOT 2W10A 1QMZB 5HCKA 2FL7A 3L2QA 3CC4T 4JLGA 1K9MC 2FB7A 4OMQA 3OYAA 4ZN3A 2A3LA 1C9BA 1VYTA 4D6WA 2C5NB 1GRIA 2LX9A 4A4KA 4C5GA 1VQLT 5C0MA 4OVAA 5GAOm 3UA7A 1H1PB 3MHXA 4J9BA 1RI9A 1ZQ1A 3EGDA 4ZN1A 1TU0B 1K9AA 1Y7XA 3FB9A 2MWOA 2E70A 2C0OA 2X4XA 2L8DA 3CCLQ 2YWWA 2VC8A 2WJ9A 1WJSA 2HDAA 5IXBA 1YWPA 1VQMA 1QVGP 3QHRB 1SRLA 2C5OB 3LW5E 3PGGA 1FXXA 1HXDA 3CMAA 1AWJA 2KRSA 4XQ3A 8AT1B 5KYWA 3BHTB 3H4CA 3L2ZA 3CXCP 4J83A 2YSQA 2YHTA 1GH6B 1H26B 4BE0A 2FVUA 4BDYA 1HK9A 2V26A 4C0FA 4RMOA 1WXUA 2X35A 1KC8C 1VQ8T 3SWNB 1CSKA 1M8MA 1QVGS 1S72A 2NUZA 4C8QF 2W99A 5GANg 3QYEA 4HXJA 4F70B 2XHCA 1UECA 3G6EQ 2BE9B 1JJ2A 4OMNA 4EMKA 2WMBB 3REBB 1HD3A 1UNHD 2DXCB 3HKSA 1KD1R 2B9RA 4XTWA 1W70A 1NM7A 2E65A 3JCMh 5L2WB 3CCSA 2LJ1A 2KQWA 3M0UA 3I5SA 2G9XB 3K7AM 1PD1A 2M02A 2VXEA 4QSHA 1KSWA 1FMVA 3REAB 1ZBJA 2QEXQ 2EYZA 1ZUKA 4HT9A 3FJ5A 2NUPA 4BE1A 1JBMA 3EG0A 1XNIA 3CC4Q 3GTMS 5GANh 1AWOA 4AFUC 5IHKA 5IHYA 4CFVB 1U8RA 2LTOA 3QWLA 2UZDB 2A08A 1YI2T 3F70A 2B86A 2RQTA 3M58A 4DA4A 1NLPC 5KYXB 1Y07A 4XU1A 2GQIA 4KUIA 1Y57A 1PRLC 2RNAA 3RKXA 1N27A 4IUQA 4RTZA 1N4MA 2KRNA 4M75B 3THKA 1VOMA 1X69A 2PJQA 5DQVA 3EAEA 3QWYA 5KYWB 2M0OA 1IREB 4JX5A 2PVOB 3LH5A 2YLCA 4EIKA 4RTTA 3OYEA 4K11A 4D8KA 1R77A 3MO8A 1K8AR 2YUOA 3WVDB 2EYYA 2M1HA 2QGFB 1VQ5Q 2FYKA 1NJIU 3MI9B 5BNJB 2QDJA 2PUKB 3PNWC 2JTMA 2IVXA 4N4IA 3UDCA 3CC7Q 4EOJB 4V2SA 2PU9B 1D0XA 4UC4A 1UDLA 2XDPA 4AKIA 1NEGA 2COWA 4M78G 1BB9A 4LE9A 3CCQQ 1LPLA 3EHQA 4OMOA 2QTXA 2BTTA 3CCSQ 3RNJA 3OYYA 2EJGA 5CIUA 2QQ9A 4X34A 2JOYA 2ZZDA 1R8OB 2DL5A 4M7DA 1V76A 4KGZB 2AZSA 4F7UE 2LJ3A 1H1RB 1MUZA 2F5TX 4B9XA 3V8JA 4JJDA 4YOZA 4OB2B 5EC7A 2JZ2A 1N8RU 4FYXB 2A36A 2CP3A 3ZBDA 2ZPHB 3TREA 2O2OA 4BCGB 2K3BA 1OIUB 2NWMA 4LD9K 1QP2A 2DL3A 3CD6T 2FRWA 2JMCA 3CMEQ 2EUFA 2VV5A 1NZ9A 4ZGEB 3PVQA 4PFOA 1KQ1A 2QAZA 1TD6A 3BW1A 3VJPA 1VQNA 1PG5B 3JCMb 1RABB 2F2VA 2JM8A 3EFOA 2C5VB 2RQRA 1AT1B 3TQ7P 2W0ZA 2EGCA 2HL3A 5DM7R 1YHQQ 5HBJB 3CMAQ 2CKKA 1UE9A 4VUBA 5LJ5j 3M0TA 1I5LA 1B34A 2DK3A 1ENWA 1NYGA 3PO3S 5KCHA 1QVFA 1RACB 4F7UG 4E7SA 3CCUQ 1BCOA 5LMKB 1UEBA 2LT1A 4PK4A 1O75A 2A37A 2OTJQ 1Q86C 3A1PA 4R0KA 5LJ5f 2A0FB 3EH1A 1U06A 1LNXA 3E2UA 3G4SA 3TEEA 5D6XA 2HQEA 3MY1B 1SPKA 2VWFA 2SEMA 3LQ5B 2O31A 3JCMf 1T0HA 3OYLA 2BS4A 4PJMA 5LJ5e 1YJWA 3HZJA 1QWFA 5A0DA 2XIDA 4BB7A 4IUVA 4XAXB 3M5AA 1K73R 4EOPB 4OF1A 1TUDA 5LJ3e 1OL1B 3X20B 3QG1A 2JXBA 3CD6A 3TCJA 2BPMB 2OAUA 2LCCA 1H92A 2P0QA 1YITA 1DJ7B 1G3SA 5I22A 4IURA 2AHJB 1C6VX 1OPLA 1ZA2B 3M0SA 4A4HA 4F16A 4F6WB 2P0PA 3KFVA 2CSIA 1GBRA 4BCJB 3QWXX 1D0ZA 1K76A 3OMCA 3SB2A 4PJOA 1S1NA 5FW9A 1QKXA 2RB6A 4AT1B 2CUDA 2RD1A 4HCKA 3QDRB 4RTUA 3ZEHA 4DOWA 3HRTA 2HBWA 2KY9A 3MPUB 4LDYA 2DL4A 4EPCA 3TNHB 2K3YA 1D0YA 2ABLA 4PKCC 4Y92A 7AT1B 2DEQA 3TSWA 2RI5A 4A54A 1YJNT 2DTHA 2BZXA 1H25B 3VS0A 3CCQA 4GBQA 2LQWA 5D7UA 2JJ9A 3L42A 5FU6C 3WXMB 1JJ2P 4XTXA 1RUWA 2D0QB 2G3RA 4MDWA 5GAOq 1UNGD 4E6RA 2GQVA 3URGA 1FVVB 1X43A 4C92G 2RA2A 2RJEA 2C4GB 3JCMV 2EQKA 5ICPB 1RAGB 1KJWA 3G6EA 2XI9A 4N4GA 2QI2A 2D6FA 2OJ2A 4ELJA 5GAMg 3MIAB 1MHNA 3KUFA 2MYSA 1AOJA 2E1HA 3GNGA 1XOVA 2CS7A 2J6OA 3SWNC 5IDPB 3B57A 4HT8A 1G2BA 2GTJA 4C8QD 3S3NA 4M77C 3CCMT 3M0RA 3PMIA 2XDBA 4M7DD 2HKNA 3CCVA 2O9SA 2KE9A 3A5ZB 1VQ6Q 1GUXB 5IXFA 5HKCA 1QVPA 2YUNA 5GMKj 3C94A 5GANf 1CKAA 1S72Q 1TOVA 2CH4A 2W9FA 1I81A 3BFMA 1K8AC 3QYGB 1D3UB 3LGLA 4CRLB 3EG2A 2W9ZA 2D8JA 5GJVB 4RODA 3G71Q 1NPPA 2WPAB 4Y72B 3BG3A 1OI9B 4M75E 3TU4K 4LOCA 2V8IA 3GOXA 1T3LA 1OOTA 2DXUA 3SEMA 1V1CA 3T9NA 2MF2A 2VUBA 4XU3A 1PNJA 2DAQA 5GAN8 2DEUA 2XKOC 5GAN3 5GMKh 1AWXA 1UHFA 3NPFA 3CMAT 4IKFA 3NHNA 1Q81U 3NMZC 2UZLB 1VA7A 3OYDA 3TNIB 1ZUYA 4IMYB 3HTRA 4M78F 2YT6A 2DO3A 5HVYB 2IW6B 1VQ9A 4BCHB 2QGSA 2WXVB 1CKBA 4DBQA 2Y4XA 1QKWA 1M1FA 1JSTB 5GANe 2UUEB 3JB9G 3AT1B 4C92C 3QPHA 1YITT 2DE0X 4HCCA 2X1NB 4PLLA 1OULA 2H3JA 2DTOA 4HKEA 2QEXA 1GUXA 3HFNA 3P8BB 1GY3B 3JAME 3CBOA 2UZEB 4FCYA 1M1KC 4M4ZA 3JCMP 1VQ6A 3HSBA 3OYCA 3OS2A 1OZ2A 2O9VA 1X27A 4J6WA 3OS0A 4RCCA 4ELLA 1IB8A 1XJWB 5LJ3j 1VQKQ 3OYJA 1U3OA 2Y4YA 4JZ4A 3I56A 4J7FA 1H28B 1BI2A 1H4LD 3LX7A 3OS5A 2RJCA 2QDYB 2I2LA 1ABQA 4CC4B 4PNOA 3G7ZA 1BKBA 2IPOB 4A53A 3HHTB 5J26A 4M7DE 2AT1B 1BU2A 2LCLA 1YBYA 3I5RA 2AK5A 4ZGJB 2HQHA 2DIGA 2DPPB 2AKLA 4FYVB 4L6V5 1YJ9T 4M78C 3VRYA 2KT1A 3H9NA 2DXCA 1XTDA 5GAMh 1AZGB 1G3NC 2DVJA 2RQUA 4X9CA 4F7SB 4M7DG 2EIFA 2GTOA 2PQWA 1ZSZB 3DLLA 1N9RA 2WIPB 4OMFB 5LJ3d 2HMAA 1ZSZC 2L3SA 4CFUD 3EHRA 2GGRA 2DD4B 3HO8A 2LW4A 1YIJQ 1IXDA 2K2MA 4BXXX 4M75D 3HL8A 1A0NB 1T0JA 3TVTA 1K73C 2D1XA 1OV3A 1ZX6A 4JPBW 3X24B 1X01A 2C0IA 3GF5A 3FIFA 3F5XB 1PRMC 1EFNA 5KH6A 2RHUA 5C6SA 5DLQE 4M7DF 1KHCA 2ENMA 4WCIA 3QZ9B 2LDMA 2RK1A 1SG5A 2VB6A 4NOYA 1Y96B 3CEYA 2HQXA 3H6ZA 4J9DA 1G3WA 4FT4A 2KYMA 2JUFA 1OKVB 2K57A 1M8VA 1G83A 4BCPB 2DNUA 4RTXA 3QYHB 3UATA 3M4GA 2ZZDB 3L2UA 4MIMA 3MCAB 3O0GD 2YDLA 3P8DA 2HKQB 4RTWA 2EBPA 4KRDB 4ELYC 2MI6A 4EMKC 3VKHA 3QJ6A 1KXUA 1GCPA 1NJIC 1M1KU 2LVMA 4AI6A 4J9EA 5KYUA 3JCMQ 3DB4A 1H27B 3TN8B 2RK2A 1OYXA 4JJBA 1WHKA 2LZ6B 1WI7A 3DB3A 1Q82R 4N4HA 2COYA 2CCHB 2HD0A 4CXAB 4X1VA 1KQSA 3JCMJ 2EQJA 4ANJA 1UG1A 1MMAA 2BS2A 1FINB 1OI1A 4C0DC 3HRSA 1I5OB 3CCUT 4PJJA 1MV3A 1GXIE 2BKDN 3L2WA 1NPRA 4EOKB 4FT2A 1K4US 5DLOA 1ARKA 1AVZC 3NGPA 2HAXA 1N8RC 2FZGB 2D8HA 4QVCA 3OYIA 1BI3A 3CCJQ 2W96A 2PVGB 3DLMA 1B34B 4F6UB 3OYKA 1MV0B 2OTLQ 1M2OA 4L5GA 2LCSA 3CMET 3C95A 2E6NA 3TNWB 4HNVA 1E6GA 6AT1B 4F6SB 1Q7YC 1AZEA 1E6HA 2QQSA 5J3BA 5HBHB 1OQKA 1JQQA 2EW3A 3G6ET 5KYYA 1WYXA 2CP0A 3I55T 3BLQB 1M90R 2FRYA 2KI7A 3I56Q 4DQ2A 5GANj 4CFUB 2DL7A 1BIAA 2HBPA 5CO7A 3HP9A 2I40B 1SEMA 3MP6A 2GBQA 4IUPA 3TW6A 3CPWP 2LQNA 2YRVA 2I53A 2XG8D 3CCQT 4C0DB 1YJNA 4FSXA 5KYUB 2K5FA 1HYOA 5FU6B 1OX9A 4C5HA 3UF4A 1AWWA 5HNBB 4OGRB 1H3ZA 2JN0A 2HZYA 2EQUA 5HK0A 2L89A 3PTAA 3HFOA 2FG0A 3NDQA 2E64A 3VRZA 4J9IA 4BBRM 2XK0A 1WQ7A 2DYBA 5GJWB 2CSQA 2F1LA 4CC7A 4KUDK 2WEVB 1QVFS 4DBHA 2C0TA 3PVLA 3EG3A 2BIVA 1PSFA 2M0YA 2KGTA 4PLIA 1YIJA 1N9SA 1UGVA 3FC3A 2YUPA 5FGKB 1VQMT 4BCQD 2E4HA 4DEYA 1VQOQ 2MCNA 3E1SA 2F2XA 4ZTJA 4FL6A 5IT9E 1D1AA 2GFUA 4AFZC 3VYHB 4BCQB 1YWOA 4Z89A 1PM3A 3S6WA 1YI2Q 1ZBXA 4ZNXA 2WACA 2X4JA 3BDLA 3S3OA 5LJ5g 3M54A 1VYWB 3NTHA 3OYFA 1GFDA 2JS2A 3INZA 2Z0WA 2EAYA 2OAWA 2E6ZA 4C8QE 3CQTA 2PHGA 2RO0A 2CZ1B 2OTLT 3EGXB 1UJ0A 3VKGA 3DDPB 4M7AB 3N5BB 4B9WA 3KHIA 2CZ6B 3EG1A 4O6JA 4JJNK 3L2VA 1ABOA 2KNBB 2QA4Q 2RF0A 4YOSA 3PIOA 1WDXA 1J3TA 4ZTFA 3DJBA 1OU8A 1C1AA 1W1FA 1TG0A 3VS6A 3MKDA 4M78D 3JSCA 3LYIA 4BCOB 1JRIA 2C6TB 2CJMB 4XTVA 4NSTB 2DL8A 3JCMX 2LJ0A 4PJNA 4J9HA 4BD3A 2JGZB 1OZ3A 2MAMA 3EG9A 2M51A 1H8KA 3CCRT 3OA6A 2LQKA 4FIBA 5LJ5h 3VYGA 1BCMA 2FZKB 4KBMB 2WSEE 1W2BP 3OYHA 3H8ZA 3VKIA 2EQMA 3QJYA 4LNPA 1UGQB 1TS9A 1LCKA 3EOCB 4KRCB 2K5IA 2K79A 5IN1A 4BI4A 3U23A 1K73U 1VQNT 4FYWB 3QDFA 4LDXA 4JX4A 3JB9D 1M3CA 4M7DC 2HCKA 1GBQA 2V8JA 1M2VB 2CREA 4HNTA 2EJ9A 3GP8A 3MEVA 4PJLA 1YIJT 2DZ9A 2FPDA 1PWTA 2MPXC 2RI2A 2COZA 1U1SA 2QK0A 3OMGA 2KDSA 4J6XA 5DY9A 2RH2A 1Q86U 5FRMA 4RCBA 4F7LB 1JB0E 3VS2A 3NTKA 3QO3A 4F7UB 5GMKe 2DMOA 3CXCA 4OMPA 4C8QB 1TUCA 2KAFA 2X3XD 1SHFA 1RAHB 4LD6A 4M7AD 3H0HA 1M5Q1 4EDUA 3P8HA 4JS4A 2HSPA 4IUTA 4OR5B 4EOIB 2OTJA 1GL5A 2DXTA 1UUEA 1VQ4Q 4AKHA 3RKWA 1H24B 4CC2A 3QZ5B 1YNZA 4OB1B 4LDUA 1YFNA 3CCJT 4QW2A 5KE3A 4E7IA 5IHNA 2VASA 3NFCA 1M1GA 1Q82U 2BUDA 2JTEA 1B7TA 3V7RA 1Q81R 1I0CA 3ER0A 4OGEA 4KGVB 1UGPB 3QHWB 1AHJB 3QHSA 4XTZA 1WHGA 1YN8A 1JSUB 4JDSA 4C8QG 1EZZB 2ZGWA 1VQKT 2A28A 4C5IA 4BCND 1AD5A 1N8RR 3VUBA 2LC4A 4EOOB 4II1A 3C0CA 3E19A 5KYYB 4QVDA 4M75F 4OB0B 2PK2A 3X28B 4M77B 2OI3A 3BHVB 2X51A 3RGFB 4BE2A 4RTYA 3M57A 4AFSC 2CT4A 8ATCB 3M4YA 1E7PA 1WZOA 3H0IA 2CYZB 2DD5B 3KBGA 3R6OA 1M30A 4E7HA 2RHXA 1TH7A 1AEYA 4TTHA 1URCB 3QIIA 2D0NA 1QVGA 1JXMA 2VXFA 2EKOA 2PUOB 1K9MR 3MP8A 2RJFA 3OW2P 1FMKA 3DDQB 1QP3A 4BBSM 1PC0A 3EFSA 2IVWA 4R55A 1G5VA 4HLQA 1T3SA 2NUTB 3VS3A 4KULA 3IQLA 2K4YA 4HCZA 3EGDB 3Q1JA 5GMKl 1TSFA 3UT1A 4CRIA 3RMSA 1KD1C 4OMLA 2DXBA 2QQ8A 1AISB 4C0ZA 3MEAA 1UFFA 1WQWA 1VUBA 2JTFA 2J06A 1Y96A 1JEGA 3CCMQ 1WHLA 2DBKA 3CCET 1YCSB 2H8HA 1YJ9Q 4F14A 5GANd 4WF2A 1UGRB 1P92A 2AZVA 1M3AA 5J39A 4M75C 5LQFB 3EFOB 4YTLA 2MWPA 1JO8A 1YCYA 3EJ1B 3BDUA 2FPFA 1R0CB 1H1SB 2DD4A 2LNVA 5CKBA 4C8QC 2G6FX 1OKWB 2CDTA 4AMCA 3FDRA 3L2RA 2F2CA 2DD5A 4G6LB 3VS7A 4E47A 3MEWA 4KH1B 4ELZC 4XU2A 2RN8A 4AG2C 1ZUUA 2V22B 3A8GB 4JRQA 1VQOA 2KR3A 1D1BA 2ROLA 2CT3A 2F2WA 5GMKi 2CCIB 5CKHA 1WX6A 1KC8U 4HVVA 3RMQA 3RIRA 4BACA 3DOGB 2ZPEB 4GY5A 3JB9F 5ACBA 3VYGB 4J9CA 4E7KA 1D3BA 1FMWA 5L8RE 3VV0A 2EWNA 2DTIA 2XICA 4E7ZA 1QCOA 2KROA 4AKGA 3CC2A 4M78A 1X6GA 2OX7A 1Q7YR 5GAN5 3M56A 1OPKA 3EGUA 2V8KA 1JXOA 2DX1A 2EFIA 3JB9I 1SHGA 1JJ2S 1K9MU 2DXBB 4PJOE 1OEBA 3SFMA 3GNFB 1TXQA 2KYBA 5IF1B 4L59A 5AYFA 1OL2B 4RG8A 3I9QA 2EYQA 2QQBA 4M7AF 4CFWB 5LL6S 4MZMA 4EOSB 1FX7A 3CPWS 1QWEA 2EGAA 3M0PA 4FSSA 2E3HA 3HRUA 9ATCB 1M3BA 4JRKA 2X4YA 2LNHB 2ZPFB 3OQ5A 4F7JB 2IIMA 5FU7B 3L1AA 1Z9QA 2XU8A 3SHWA 4C8QA 4RUGA 4PJOB 4BCNB 4MFDA 3OSVA 4PFZA 1XO2A 4M7AG 5KCOA 4RG2A 1KQSP 2JT4A 2NYSA 3MJXA 5HK3A 1WLPB 1PKTA 3HB9A 1TFBA 1ZHIA 4C92D 2P84A 5A2QE 5CCAA 2FHDA 2DVEA 1KFZA 2B8AA 1VQNQ 1WNLA 1KC8R 3CD6Q 3JB9H 4M7DB 1VQ7T 2MOXA 2MMPA 2HEQA 2W2HA 5GMKm 2DIQA 3BLRB 2EYXA 3RESA 3H0FA 2FO0A 2FPEA 2LX7A 2P4RA 4Q5WA 1RAEB 2DYIA 4QVZA 3RBBB 5GAMf 1PHTA 4CFMB 3OY9A 5IHIA 1B3QA 4O5VA 4M78E 4M77D 3M03A 4EMHA 2QGGA 2KR6A 2K6DA 5GAOr 2DERA 3E9GA 5GAMd 4MDXA 1JU5C 2XDDA 2WIHB 1Q86R 3CXCS 3CCVT 5EG2A 2WSCE 5CR2A 5IAYA 1JKWA 2RPNA 1IHWA 2KBTA 3CCMA 2KXCA 1O9KA 3MP1A 1GCQA 4PJOC 4HCBA 2F5KA 2LP5A 3CCLT 3A8HB 1BI0A 3FJPA 2RQVA 3CMEA 5CQYA 5I11A 3OYGA 1IRXA 2O4XB 1UGSB 3G4SQ 3M53A 1Z9ZA 2XMFA 3HBLA 5GAN7 5HY6A 5I5ZB 3X25B 1RLPC 2FZCB 4JRIA 3MEUA 3HPWA 2BKZB 2QDLA 5HBEB 3QXEB 4PJOD 3LLRA 4E7LA 2DMEA 1TTHB 5CEIB 3I56T 1WIEA 1QQJA 4AFQC 5I2MA 4CI0C 3FLGA 5AT1B 3DTOA 5IH2A 3V8LA 2QA4A 2ZPBB 2RI3A 3ME9A 3X26B 5EFQB 1VQMQ 5KYNA 2PK9B 3JCMc 2PTKA 3QSUA 1WHMA 2EQIA 2RMOA 1RADB 2PMIB 1X6OA 2J6FA 5CYIB 1VINA 1WXBA 2QEXT 2D9TA 1I8FA 4MMLA 5I2SA 2YRDA 3JRZA 1EIFA 4II5B 3TW7A 2HSEB 2YRCA 3JCMd 3CC2Q 2X3WD 1MMDA 2DZCA 2DJZA 3RDVA 1MGQA 5FRNA 1WXTA 5KYXA 1M2VA 2EJFA 2P4TA 3M9QA 2IG0A 3RKYA 4HVUA 4J9FA 2DRKA 1QLBA 2YLBA 1VQ9T 3EIDB 4BCMD 5GAOp 2XD0A 4JUVA 2O4XA 3C4SA 4J7IA 1YHQA 3PFSA 1Y71A 4F7UA 4AG1C 1VQ8Q 4J8OA 1P5EB 2DJQA 2ED1A 1X6BA 3MY5B 5CKEA 1OGUB 4BI8B 1NJIR 2CZ7B 1V29B 2DF6A 1FWZA 1RI0A 2KK4A 2QYZA 2KT8A 2VKNA 2ED0A 5CKDA 3CPWA 1I4K1 3FEOA 2QG9B 1O9SA 2DLPA 3GPLA 2R58A 2QA4T 2GNCA 4A4FA 3DKMA 2IW8B 3G4ST 1NEBA 2QXFA 5FLXE 1VOLA 1W98B 3A98A 1ACMB 4ROCA 1KG1A 1LVKA 1D3BB 2GFAA 2BZ8A 2R5MA 1IO6A 4TVRA 5IDNB 1MMNA 1WJQA 1HSQA 2RHIA 1LOJA 3OW2A 1IHVA 2VVKA 3CCVQ 2DKGA 1FYNA 4IIMA 1VQKA 4ATOA 1ZLMA 1W4SA 1R0BG 1UTIA 4BCMB 4BY7X 3OYMA 4BI3A 3OYBA 4BY6B 3RUXA 3ULRB 5GAN4 1VQ6T 4F7NB 3R6NA 4LUEA 1NBEB 5FU7C 2HNIA 1X2KA 3CPFA 1QLYA 1GFCA 2KSSA 1UNLD 2LQ8A 5I21A 4ESRA 3CCLA 3SWNA 3LWIA 2PNIA 4FX3B 4FYYB 5GAOl 3G71A 4R56A 2E5QA 1PCXA 2H3EB 4EC8B 3SDZA 3CCST 3TSZA 2O01E 2JVVA 4JS5A 4J9GA 3QBYA 3M55A 1BBZA 1VQ9Q 3A8LB 4JLIA 1BI1A 2DILA 3BG9A 2DETA 1WJRA 5M9OA 1ZA1B 2RJDA 4NL3A 2L3PA 1UB4A 1K8AU 1NLOC 2RQWA 3VS1A 1VIEA 3META 4N0AC 2KMGA 5ECAA 4EMGA 2K7AA 2NUTA 1VQ8A 4JJCA 3LH0A 4X9DA 3POMA 2RM4A 4M7AA 1W6XA 2X9HA 3AHUA 3I35A 2R57A 4EOQB 4XK8E 2CP5A 4C92A 1I1JA 2R7GA 2J05A 1N5ZA 4Y91A 1OIYB 3VS4A 2SRCA 1W2BA 4EMKB 5LJ3h 4QKUA 5FWBA 1M9SA 3OW2S 2GF7A 4F7UF 2HL5C 1NG2A 1QCNA 4FW2A 4BCIB 5LJ5d 4M75A 1N6AA 3M59A 5D6WA 4KH0B 3WVEB 3ASKA 2CH4W 3CCEQ 3GIBA 1Q95G 2WMAB 1AD6A 3BLHB 4BCKB 4PJOF 4GLKA 4LN2A 1K0XA 3V7CA 1QW1A 4I3ZB 3VS5A 2C5XB 1YJWT 4DBRA 3G71T 1PKDB 2PVDB 1G3YA 2ATCB 2E12A 4UN0A 2CP2A 4D8DA 2QF7A 4BY1X 3OBYA 2E5KA 2LRQA 1LJOA 1YI2A 3OSSC 5GAMj 4A63B 4PJOG 2KRMA 1X75C 1SKUB 1JOWA 4F17A 4IIOA 3O8VA 5HQ0B 4KT0E 3OYNA 4HL4A 3CC7A 1BYMA 4XU0A 4A4EA 3JCMg 3QUIA 2VGMA 4Y28E 1WPYA 1YITQ 2R5AA 2JS0A 1VQ7Q 5EJCA 2OTLA 4NC6A 2DFUA 3OS1A 2ZPIB 4C92E 1KK7A 4C92B 1OU9A 4M77F 3M0QA 3J81E 2C06A 5L23A 4Z6YA 3E9FA 2V1RA 4OB3B 2E3IA 4E7JA 1QCFA 5GAN6 2QTVA 3DL1A 1EX4A 3ZFJA 1RAIB 4RKUE 4XTUA 2CGHA 4ORZA 5GAOn 3BHUB 4M77G 4E2FB 4M7AC 3CCEA 3UPUA 1ZSZA 1VQLQ 2QASA 3RR6A 2V1QA 2QFZA 3GBQA 4LDVA 1Q7YU 5CAIA 1ZSGA 3H41A 4Z02A 1YHQT 4DBFA 3KXTA 3RERA 1NYFA 2YXYA 4CC3A 2JW4A 4M77E 2MIOA 3OB9A 4QQDA 3BY7A 4QT7A 4BUGA 1VYUA 4MMKA 1IZ6A 1RAFB 4DOVA 2BS3A 4ZGDB 1IGQA 2FEIA 1VQPA 2KEAA 3JB9J 4NS5A 4N0AA 2CUBA 4HNUA 2E41A 1BU1A
chains in the Genus database with same CATH topology
4M7AG 5KCOA 4M77A 4RG2A 3CC4A 5HK3A 4DQ2A 2RHYA 5KCHA 5GANj 1QVFA 3HB9A 1ZHIA 4P5NA 4F7UG 4M75G 4C92D 1BIAA 1WGSA 2HBPA 5CCAA 5A2QE 2FHDA 5CO7A 2DVEA 3HP9A 1H641 2B8AA 3LWHA 3MP6A 4LDWA 4QQ6A 1UEBA 2LT1A 3TW6A 2K2VA 1WNLA 2K3XA 1O75A 2VYTA 2YRVA 4IUPA 3JB9H 1Q86C 4M7DB 5LJ5f 2XG8D 3I55A 3CCQT 1VQ7T 4C0DB 2MMPA 4QQGA 1YJNA 5GMKm 4FSXA 2DIQA 3PT9A 2K5FA 2M9UA 3S3MA 3CBMA 1LNXA 5FU6B 4A4GA 1U1TA 3RESA 3G4SA 4C5HA 1RL2A 3TEEA 5CK9A 3VU3C 5D6XA 2HQEA 4Q5WA 3V8KA 1M90C 2JN0A 5HK0A 2EQUA 4QVZA 4OGCA 1H3ZA 1FKMA 5GAMf 5FROA 2L89A 3OY9A 3PTAA 3HFOA 3JCMf 4J5YA 3OYLA 4O5VA 2E64A 4M78E 4M77D 2BS4A 4BBRM 2F69A 2XK0A 5LJ5e 2X4WA 1YJWA 4EMHA 3CC7T 2KR6A 1WQ7A 3HZJA 5GAOr 3E9GA 5GAMd 5A0DA 2XIDA 4KUDK 1QVFS 4MDXA 2XDDA 4BB7A 4IUVA 4XAXB 2E10A 3M5AA 1VQ5T 5GAN2 4OF1A 5LJ3e 3CXCS 2BIVA 3X20B 1PSFA 2WSCE 3QG1A 5EG2A 4BY6C 3TCJA 5IAYA 5KE2A 2OAUA 2LCCA 5CR2A 3CD6A 4PLIA 2P0QA 1N9SA 4C92F 3CCMA 3FC3A 1VQMT 1YIJA 1YITA 2RHZA 1KD1U 3MP1A 1VQ4T 1DJ7B 1G3SA 4PJOC 3E1SA 4HCBA 3CCUA 2F5KA 4FL6A 5IT9E 2GFUA 4ZTJA 3VYHB 4IURA 2AHJB 4OP0A 3CCLT 3A8HB 4JX6A 1BI0A 3FJPA 4HA8A 5D6YA 3S6WA 4A4HA 3CMEA 2P0PA 1ZBXA 1KHIA 2WACA 5CQYA 2X4JA 3OYGA 3FRNA 3BDLA 3CCJA 4XTYA 3S3OA 2O4XB 5LJ5g 4PJOA 3OMCA 3M54A 1UGSB 3SB2A 3NTHA 1KQSS 2CZ0B 3M53A 3OYFA 3INZA 4FU6A 2RB6A 2EAYA 2E6ZA 3HBLA 5GAN7 5HY6A 4MZTA 5LJ3g 3X25B 2RD1A 4C8QE 2OTJT 4C0GA 2RO0A 2ZPGB 2LT4A 3QDRB 4JRIA 3MEUA 3HPWA 3ZEHA 2CZ1B 4DOWA 2OTLT 3HRTA 3QXEB 4PJOD 3VKGA 1NE8A 2KY9A 4PL6A 1SSFA 4LDYA 3LLRA 4E7LA 4M7AB 4EPCA 3N5BB 3PMTA 2K3YA 4B9WA 3KHIA 4C5EA 3J80E 3QKJA 2CZ6B 3I56T 4PKCC 4O6JA 4JJNK 3VUZA 2M16A 3L2VA 5CKFA 5I2MA 4CI0C 3FLGA 3V8LA 3PIOA 2QA4A 2DEQA 2ZPBB 2RI3A 5LJ3f 4ZTFA 2K5LA 1S72T 2RI5A 3ME9A 2KMTA 3OBWA 3A8OB 2DTHA 3X26B 2L3RA 4A54A 3CCQA 1YJNT 1VQPT 1VQ7A 3JCMc 3QSUA 1BIBA 5GAMe 4M78D 1M4ZA 3JSCA 4JRPA 1X6OA 3LYIA 1JRIA 2JNGA 1M90U 3L42A 5FU6C 3NTIA 3WXMB 2QEXT 2D9TA 1I8FA 2QQRA 4MMLA 4XTVA 4XTXA 5I2SA 5CVIA 2D0QB 2G3RA 4MDWA 3JCMX 2L5QA 5GAOq 3JRZA 1EIFA 3BG5A 3TW7A 1VIFA 3JCMd 4BD3A 2P0KA 2GQVA 1OZ3A 2MAMA 3URGA 3CCRT 2DZCA 3OA6A 3V7SA 2LQKA 4FIBA 2DJZA 5LJ5h 3VYGA 4C92G 2RA2A 2RJEA 2VGNA 1MGQA 5FRNA 3JCMV 4MFEA 2EQKA 4KBMB 2WSEE 3CBPA 3OYHA 3H8ZA 3VKIA 3G6EA 3QYBA 2XI9A 4MZPA 3SD4A 2EJFA 2EQMA 4N4GA 2P4TA 2QI2A 3M9QA 4M78B 3QJYA 2IG0A 3RKYA 2D6FA 1UGQB 4ELJA 2K5IA 3GLXA 1Q82C 5IN1A 3C12A 5GAMg 1MHNA 3KUFA 1QLBA 2YLBA 1VQ9T 4BI4A 5GAOp 1VQLA 2XD0A 4JUVA 1K73U 5CQXA 2E1HA 2ZCFB 1VQNT 3GNGA 2O4XA 1XOVA 4LDXA 4JX4A 3PIPA 2CS7A 2GCXA 3SWNC 3C4SA 3JCMW 3JB9D 4J7IA 4M7DC 1YHQA 2V8JA 1YJ9A 1XQHA 4HT8A 4C8QD 3S3NA 4FM4B 1VQ4A 4M77C 4HNTA 2EJ9A 2NLUA 3PFSA 1Y71A 3MEVA 1G3TA 4F7UA 3GP8A 3CCMT 1YIJT 1PSEA 3PMIA 2DZ9A 4J8OA 2XDBA 4M7DD 5A0LA 3CCVA 1W2BS 1VQ5A 2A7YA 2RI2A 4ME7A 5CKEA 1U1SA 4BI8B 4BDZA 3OMGA 2KDSA 2CZ7B 1V29B 3A5ZB 4J6XA 5DY9A 3CCRA 1FWZA 1RI0A 2RH2A 1Q86U 5FRMA 2KK4A 5HKCA 1QVPA 5GMKj 3CC2T 3C94A 4RCBA 5GANf 1KQ2A 5CKDA 3CPWA 1JB0E 1I4K1 4NL2A 3UWNA 3FEOA 3NTKA 3QO3A 4IUUA 1O9SA 4F7UB 2G77A 1I81A 2R58A 3BFMA 4J6YA 4A4FA 5GMKe 4C8QB 5A0GA 3CXCA 3DKMA 2KVQG 2KAFA 3QYGB 3LGLA 4LD6A 3G4ST 4M6VA 4M7AD 2QXFA 5FLXE 1M5Q1 3GPLA 3JCMe 2WSFE 4EDUA 1NPPA 1KG1A 4M7AE 2Y90A 2QQAA 3BG3A 3P8HA 4M75E 1D3BB 3EFRA 4JS4A 3TU4K 1Q81C 4IUTA 4LOCA 2V8IA 3GOXA 2DXUA 3A8MB 3T9NA 2GFAA 2R5MA 2OTJA 2MF2A 3J7AF 2VUBA 3LGFA 4XU3A 4TVRA 2DXTA 2DAQA 1WJQA 1VQOT 4AKHA 1LOJA 2RHIA 5GAN8 3OW2A 3RKWA 2XKOC 5GAN3 5GMKh 3QZ5B 2FL7A 3L2QA 3CMAT 4OB1B 4IKFA 3CC4T 4JLGA 1Q81U 2FB7A 2DKGA 1K9MC 3OYAA 4LDUA 3CCJT 4QW2A 4ZN3A 2A3LA 5KE3A 3OYDA 1VQKA 4ATOA 1W4SA 4E7IA 4M78F 4D6WA 2LX9A 3NFCA 2DO3A 4A4KA 4C5GA 4BI3A 5C0MA 3OYMA 3OYBA 4OVAA 5GAOm 1VQ9A 4BY6B 1VQLT 3RUXA 1M1GA 1Q82U 2BUDA 3MHXA 5GAN4 1VQ6T 1ZQ1A 3V7RA 5FU7C 2Y4XA 2HNIA 4ZN1A 3CPFA 1Y7XA 3ER0A 3FB9A 1M1FA 5GANe 2MWOA 4OGEA 2E70A 1UGPB 2KSSA 3JB9G 1AHJB 2LQ8A 2X4XA 3QHSA 4XTZA 5I21A 4C92C 2L8DA 3CCLA 3SWNA 4JDSA 4C8QG 2VC8A 3LWIA 2ZGWA 1VQKT 2WJ9A 1WJSA 5GAOl 3G71A 4R56A 3QPHA 2E5QA 4C5IA 1YITT 1VQMA 3I55T 4HCCA 3LW5E 3PGGA 1FXXA 1HXDA 3CMAA 4XQ3A 3VUBA 2QA4T 2LC4A 4II1A 3H4CA 2H3JA 4PLLA 2DTOA 3L2ZA 3CCVT 3E19A 4HKEA 2QEXA 4J83A 4QVDA 2YHTA 3SDZA 3HFNA 4BE0A 2FVUA 3CCST 4BDYA 4M75F 3P8BB 1HK9A 4OB0B 3JAME 3X28B 2O01E 2JVVA 3CBOA 4M77B 4C0FA 4RMOA 4JS5A 2X35A 3QBYA 1KC8C 1M1KC 3JCMP 3M55A 1VQ8T 1VQ6A 3A8LB 3SWNB 4JLIA 4BE2A 3OYCA 3OS2A 1BI1A 3M57A 1QVGS 3HSBA 1OZ2A 4J6WA 3OS0A 1S72A 3BG9A 4RCCA 4C8QF 5LJ3j 5GANg 3QYEA 3M4YA 1WJRA 5M9OA 1E7PA 2RJDA 4NL3A 1UB4A 1K8AU 3OYJA 2XHCA 2Y4YA 3I56A 1JJ2A 2CYZB 4J7FA 2DD5B 1BI2A 3KBGA 3R6OA 1VIEA 3META 3LX7A 3OS5A 4N0AC 4EMKA 2KMGA 2RJCA 4E7HA 2RHXA 4EMGA 1TH7A 3QIIA 2QDYB 2DXCB 1VQ8A 3HKSA 4XTWA 2I2LA 3LH0A 4X9DA 2RM4A 1QVGA 4M7AA 2E65A 3JCMh 2VXFA 4PNOA 3AHUA 2R57A 2EKOA 2PUOB 4XK8E 3MP8A 3G7ZA 3CCSA 4C92A 1BKBA 2RJFA 4A53A 3HHTB 2KQWA 5J26A 4Y91A 4M7DE 2LCLA 1QP3A 1YBYA 2VXEA 4BBSM 4QSHA 4ZGJB 2IVWA 3EFSA 4EMKB 4R55A 1W2BA 1G5VA 2DIGA 2DPPB 4HLQA 1M9SA 4L6V5 5LJ3h 3OW2S 4M78C 1YJ9T 2GF7A 4HT9A 2DXCA 4F7UF 4KULA 4BE1A 2K4YA 1XTDA 4HCZA 5GAMh 1JBMA 1XNIA 3Q1JA 5GMKl 5LJ5d 4M75A 4X9CA 1N6AA 5GANh 3M59A 3UT1A 4CRIA 4M7DG 5D6WA 3RMSA 1KD1C 3WVEB 2EIFA 2PQWA 3ASKA 2LTOA 3QWLA 1U8RA 2DXBA 3DLLA 3GIBA 2QQ8A 1N9RA 4C0ZA 4OMFB 1YI2T 4PJOF 3F70A 3MEAA 5LJ3d 4GLKA 3M58A 1WQWA 1VUBA 2JTFA 3V7CA 1QW1A 4DA4A 2DD4B 1Y96A 3HO8A 1Y07A 4XU1A 3CCET 4M75D 3HL8A 4KUIA 1YJWT 3G71T 2PVDB 1K73C 1G3YA 5GANd 3RKXA 4WF2A 1N27A 4IUQA 1UGRB 3X24B 1P92A 2E12A 1X01A 4M75B 3FIFA 3EAEA 2QF7A 3GF5A 4M75C 5J39A 5KH6A 2M0OA 2RHUA 3OBYA 1IREB 4YTLA 5DLQE 4JX5A 5C6SA 4M7DF 1KHCA 2LRQA 1LJOA 2PVOB 2MWPA 3QZ9B 2LDMA 3OSSC 1YCYA 5GAMj 2YLCA 2RK1A 3BDUA 1YI2A 3OYEA 4PJOG 1X75C 3MO8A 4NOYA 1Y96B 2DD4A 2LNVA 3CEYA 2HQXA 5CKBA 4C8QC 3H6ZA 1G3WA 3FDRA 4FT4A 3L2RA 3WVDB 2JUFA 2M1HA 2K57A 2DD5A 3O8VA 1M8VA 4E47A 2FYKA 4KT0E 3MEWA 1NJIU 3QYHB 4ELZC 3M4GA 4XU2A 2ZZDB 4HL4A 2QDJA 3OYNA 2PUKB 3PNWC 3L2UA 4MIMA 3MCAB 2JTMA 4XU0A 4N4IA 3UDCA 3CC7A 4V2SA 1BYMA 4A4EA 3JCMg 3QUIA 3A8GB 4JRQA 2VGMA 4Y28E 1VQOA 1WPYA 2PU9B 3P8DA 2XDPA 4UC4A 4AKIA 2R5AA 4M78G 5EJCA 2OTLA 4ELYC 2MI6A 4EMKC 3VKHA 5GMKi 3QJ6A 4NC6A 2QTXA 5CKHA 1NJIC 1KC8U 1M1KU 3RMQA 2LVMA 4AI6A 3RIRA 3OS1A 3OYYA 2ZPIB 2EJGA 3JCMQ 4C92E 3J81E 5CIUA 4M77F 2QQ9A 3DB4A 4C92B 2C06A 4X34A 4BACA 2JOYA 2RK2A 1OYXA 2ZZDA 4Z6YA 1R8OB 2ZPEB 3E9FA 4M7DA 4GY5A 3JB9F 4OB3B 3DB3A 4E7JA 4F7UE 3VYGB 4N4HA 5GAN6 2F5TX 4B9XA 3V8JA 4E7KA 1D3BA 2HD0A 4OB2B 2JZ2A 5L8RE 3VV0A 1N8RU 1K8AC 2EWNA 1KQSA 2DTIA 3JCMJ 2EQJA 3DL1A 2XICA 3ZBDA 3ZFJA 2ZPHB 4RKUE 3TREA 2BS2A 4AKGA 3CC2A 1OI1A 4M78A 5GAN5 4XTUA 4C0DC 2CGHA 3M56A 2V8KA 3HRSA 3CCUT 5GAOn 2EFIA 3JB9I 1GXIE 2BKDN 4M77G 3L2WA 1NPRA 4M7AC 4FT2A 3CCEA 3UPUA 5DLOA 1K9MU 1JJ2S 4LD9K 2DXBB 4PJOE 1QP2A 3SFMA 2HAXA 3CD6T 3GNFB 1N8RC 4QVCA 2VV5A 3OYIA 2QFZA 4LDVA 1NZ9A 5CAIA 4L59A 1BI3A 4ZGEB 1Q7YU 4Z02A 2PVGB 5AYFA 1KQ1A 1YHQT 4RG8A 3DLMA 1B34B 3OYKA 2EYQA 2QQBA 4M7AF 3KXTA 3RERA 3BW1A 3VJPA 5LL6S 4L5GA 4MZMA 3CMET 1VQNA 4M77E 1FX7A 3CPWS 3OB9A 2E6NA 3C95A 4QQDA 3BY7A 4BUGA 3JCMb 4HNVA 3HRUA 1Q7YC 4MMKA 1IZ6A 4JRKA 4DOVA 2X4YA 2BS3A 5DM7R 2ZPFB 2CKKA 2QQSA 4ZGDB 3OQ5A 5J3BA 4VUBA 1VQPA 5FU7B 3L1AA 3G6ET 5LJ5j 4NS5A 3JB9J 2XU8A 1I5LA 4N0AA 4HNUA 1B34A 2E41A 4C8QA 4PJOB 2DK3A 4MFDA 3OSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGR B;  3X24 B;  1IRE B;  2PVO B;  3QZ9 B;  2D0Q B;  2DD4 A;  1UGP B;  1AHJ B;  3WVD B;  3VYG A;  2DD5 A;  4KT0 E;  2WSE E;  3QYH B;  3LW5 E;  2ZZD B;  2PUK B;  3A8G B;  4Y28 E;  1UGQ B;  2PU9 B;  4OB0 B;  3X28 B;  2O01 E;  3A8L B;  2ZCF B;  2ZPI B;  2ZZD A;  2ZPE B;  4FM4 B;  4OB3 B;  3X20 B;  1PSF A;  2WSC E;  3VYG B;  2CYZ B;  1PSE A;  2DD5 B;  4OB2 B;  5L8R E;  1DJ7 B;  2QDY B;  2DXC B;  2CZ7 B;  1V29 B;  2ZPH B;  3VYH B;  4RKU E;  2AHJ B;  3A8H B;  2PUO B;  4XK8 E;  3HHT B;  1GXI E;  1JB0 E;  2DXB B;  1QP2 A;  1QP3 A;  1UGS B;  3QYG B;  2CZ0 B;  4ZGJ B;  2DPP B;  4L6V 5;  4ZGE B;  2PVG B;  2DXC A;  2WSF E;  3X25 B;  2ZPG B;  2CZ1 B;  3QXE B;  3A8M B;  3WVE B;  2DXB A;  2ZPF B;  2CZ6 B;  4ZGD B;  3QZ5 B;  2DD4 B;  4OB1 B;  2ZPB B;  2PVD B;  3A8O B;  3X26 B; 
#chains in the Genus database with same CATH topology
 4M77 A;  1D09 B;  3CC4 A;  4GLM A;  2ROT A;  2RHY A;  4P5N A;  4M75 G;  1WGS A;  4EON B;  1H64 1;  4YC3 B;  3D7S B;  3LWH A;  4LDW A;  4QQ6 A;  2K2V A;  2K3X A;  1M1K R;  2VYT A;  1RLQ C;  3I55 A;  2ESW A;  4QQG A;  4F04 B;  5DQW A;  3PT9 A;  2M9U A;  3S3M A;  1K0S A;  4JZ3 A;  3CBM A;  4A4G A;  1U1T A;  2L2P A;  1RL2 A;  5CK9 A;  1RAA B;  1TUG B;  3VU3 C;  3V8K A;  2AKK A;  2YUQ A;  1M90 C;  4OGC A;  1O9K B;  1FKM A;  4ROE A;  2IW9 B;  5FRO A;  1G8X A;  3EG9 B;  4J5Y A;  2LMJ A;  4EOR B;  2F69 A;  2X4W A;  4B6M A;  2WHB B;  1SF9 A;  2JMA A;  1WA7 A;  2E10 A;  1VQ5 T;  2EYW A;  2NUP B;  5GAN 2;  2L3Q A;  3PIP A;  4BY6 C;  5KE2 A;  1QVF P;  1PKS A;  4C92 F;  4HVW A;  2RHZ A;  4DEX A;  1YJN Q;  1KD1 U;  1VQ4 T;  2EKH A;  3CCU A;  4OP0 A;  1HJD A;  4JX6 A;  4Z88 A;  4HA8 A;  5D6Y A;  1KHI A;  3ZL7 C;  2DA9 A;  4RTV A;  2KXD A;  3FRN A;  3CCJ A;  4XTY A;  1IGU A;  2DBM A;  1KQS S;  2CZ0 B;  2EPD A;  2L0A A;  1VQP Q;  1WFW A;  2ECZ A;  4FU6 A;  3PE0 A;  5LJ3 g;  4MZT A;  1MND A;  4Z8A A;  2OTJ T;  1X2Q A;  2CP7 A;  4PFP A;  4C0G A;  2ZPG B;  1E9H B;  2LT4 A;  4LXC A;  3G1J A;  4PL6 A;  1NE8 A;  1SSF A;  3O5Z A;  2UZB B;  3PMT A;  2O88 A;  3J80 E;  4C5E A;  1TWB A;  3QKJ A;  1H3H A;  3JV3 A;  2DM1 A;  3VUZ A;  2M16 A;  2WFY B;  5CKF A;  1ZP2 A;  1H1Q B;  1KIK A;  5LJ3 f;  2K5L A;  1S72 T;  2AIR B;  2KMT A;  3OBW A;  3A8O B;  1VQP T;  2L3R A;  1VQ7 A;  1BIB A;  5GAM e;  1M4Z A;  3BE3 A;  2BE7 D;  4JRP A;  1C0M A;  5FWC A;  4OMM A;  2JNG A;  1M90 U;  3NTI A;  1PD0 A;  2CP6 A;  2EGE A;  2QQR A;  5CVI A;  1K1Z A;  4BCF B;  2L5Q A;  3BG5 A;  1VIF A;  2JM9 A;  2P0K A;  4FW1 A;  1SSH A;  3V7S A;  2VGN A;  4MFE A;  1F1B B;  2ZAE A;  1M27 C;  3CBP A;  3QYB A;  3SD4 A;  4MZP A;  2J6K A;  3CCR Q;  1B07 A;  1D1C A;  4M78 B;  4EOL B;  1OX8 A;  1E7O A;  1UJY A;  3GLX A;  3UA6 A;  1Q82 C;  1YP5 A;  3C12 A;  1VQL A;  5CQX A;  2ZCF B;  1WHH A;  1F5Q B;  2GCX A;  3JCM W;  2PZ1 A;  1QMC A;  1YJ9 A;  1BK2 A;  1XQH A;  4FM4 B;  1VQ4 A;  2NLU A;  1G3T A;  1PSE A;  2DRM A;  4KRT A;  2I0N A;  5A0L A;  1W2B S;  1VQ5 A;  2A7Y A;  3EGX A;  1SRM A;  4KGX B;  4ME7 A;  2EVR A;  4BDZ A;  4WTO B;  1U5S A;  3CCR A;  3EH2 A;  1GCQ C;  1WHJ A;  3CC2 T;  2BZY A;  1KQ2 A;  4LUD A;  1YJW Q;  4NL2 A;  3UWN A;  1Y0M A;  2K9G A;  4CFN B;  4IUU A;  3CC7 T;  2G77 A;  4J6Y A;  2IN3 A;  1MNE A;  5A0G A;  2KVQ G;  4M6V A;  4EC9 B;  3JCM e;  2WSF E;  4M7A E;  2Y90 A;  2QQA A;  1VYV A;  1Q81 C;  3G33 B;  3EFR A;  4CFX B;  3I55 Q;  1MMG A;  3A8M B;  2MK5 A;  2J7I A;  3J7A F;  4EOM B;  3LGF A;  1I07 A;  1UHC A;  4YOO A;  1VQO T;  2W10 A;  1QMZ B;  5HCK A;  2FL7 A;  3L2Q A;  3CC4 T;  4JLG A;  1K9M C;  2FB7 A;  4OMQ A;  3OYA A;  4ZN3 A;  2A3L A;  1C9B A;  1VYT A;  4D6W A;  2C5N B;  1GRI A;  2LX9 A;  4A4K A;  4C5G A;  1VQL T;  5C0M A;  4OVA A;  5GAO m;  3UA7 A;  1H1P B;  3MHX A;  4J9B A;  1RI9 A;  1ZQ1 A;  3EGD A;  4ZN1 A;  1TU0 B;  1K9A A;  1Y7X A;  3FB9 A;  2MWO A;  2E70 A;  2C0O A;  2X4X A;  2L8D A;  3CCL Q;  2YWW A;  2VC8 A;  2WJ9 A;  1WJS A;  2HDA A;  5IXB A;  1YWP A;  1VQM A;  1QVG P;  3QHR B;  1SRL A;  2C5O B;  3LW5 E;  3PGG A;  1FXX A;  1HXD A;  3CMA A;  1AWJ A;  2KRS A;  4XQ3 A;  8AT1 B;  5KYW A;  3BHT B;  3H4C A;  3L2Z A;  3CXC P;  4J83 A;  2YSQ A;  2YHT A;  1GH6 B;  1H26 B;  4BE0 A;  2FVU A;  4BDY A;  1HK9 A;  2V26 A;  4C0F A;  4RMO A;  1WXU A;  2X35 A;  1KC8 C;  1VQ8 T;  3SWN B;  1CSK A;  1M8M A;  1QVG S;  1S72 A;  2NUZ A;  4C8Q F;  2W99 A;  5GAN g;  3QYE A;  4HXJ A;  4F70 B;  2XHC A;  1UEC A;  3G6E Q;  2BE9 B;  1JJ2 A;  4OMN A;  4EMK A;  2WMB B;  3REB B;  1HD3 A;  1UNH D;  2DXC B;  3HKS A;  1KD1 R;  2B9R A;  4XTW A;  1W70 A;  1NM7 A;  2E65 A;  3JCM h;  5L2W B;  3CCS A;  2LJ1 A;  2KQW A;  3M0U A;  3I5S A;  2G9X B;  3K7A M;  1PD1 A;  2M02 A;  2VXE A;  4QSH A;  1KSW A;  1FMV A;  3REA B;  1ZBJ A;  2QEX Q;  2EYZ A;  1ZUK A;  4HT9 A;  3FJ5 A;  2NUP A;  4BE1 A;  1JBM A;  3EG0 A;  1XNI A;  3CC4 Q;  3GTM S;  5GAN h;  1AWO A;  4AFU C;  5IHK A;  5IHY A;  4CFV B;  1U8R A;  2LTO A;  3QWL A;  2UZD B;  2A08 A;  1YI2 T;  3F70 A;  2B86 A;  2RQT A;  3M58 A;  4DA4 A;  1NLP C;  5KYX B;  1Y07 A;  4XU1 A;  2GQI A;  4KUI A;  1Y57 A;  1PRL C;  2RNA A;  3RKX A;  1N27 A;  4IUQ A;  4RTZ A;  1N4M A;  2KRN A;  4M75 B;  3THK A;  1VOM A;  1X69 A;  2PJQ A;  5DQV A;  3EAE A;  3QWY A;  5KYW B;  2M0O A;  1IRE B;  4JX5 A;  2PVO B;  3LH5 A;  2YLC A;  4EIK A;  4RTT A;  3OYE A;  4K11 A;  4D8K A;  1R77 A;  3MO8 A;  1K8A R;  2YUO A;  3WVD B;  2EYY A;  2M1H A;  2QGF B;  1VQ5 Q;  2FYK A;  1NJI U;  3MI9 B;  5BNJ B;  2QDJ A;  2PUK B;  3PNW C;  2JTM A;  2IVX A;  4N4I A;  3UDC A;  3CC7 Q;  4EOJ B;  4V2S A;  2PU9 B;  1D0X A;  4UC4 A;  1UDL A;  2XDP A;  4AKI A;  1NEG A;  2COW A;  4M78 G;  1BB9 A;  4LE9 A;  3CCQ Q;  1LPL A;  3EHQ A;  4OMO A;  2QTX A;  2BTT A;  3CCS Q;  3RNJ A;  3OYY A;  2EJG A;  5CIU A;  2QQ9 A;  4X34 A;  2JOY A;  2ZZD A;  1R8O B;  2DL5 A;  4M7D A;  1V76 A;  4KGZ B;  2AZS A;  4F7U E;  2LJ3 A;  1H1R B;  1MUZ A;  2F5T X;  4B9X A;  3V8J A;  4JJD A;  4YOZ A;  4OB2 B;  5EC7 A;  2JZ2 A;  1N8R U;  4FYX B;  2A36 A;  2CP3 A;  3ZBD A;  2ZPH B;  3TRE A;  2O2O A;  4BCG B;  2K3B A;  1OIU B;  2NWM A;  4LD9 K;  1QP2 A;  2DL3 A;  3CD6 T;  2FRW A;  2JMC A;  3CME Q;  2EUF A;  2VV5 A;  1NZ9 A;  4ZGE B;  3PVQ A;  4PFO A;  1KQ1 A;  2QAZ A;  1TD6 A;  3BW1 A;  3VJP A;  1VQN A;  1PG5 B;  3JCM b;  1RAB B;  2F2V A;  2JM8 A;  3EFO A;  2C5V B;  2RQR A;  1AT1 B;  3TQ7 P;  2W0Z A;  2EGC A;  2HL3 A;  5DM7 R;  1YHQ Q;  5HBJ B;  3CMA Q;  2CKK A;  1UE9 A;  4VUB A;  5LJ5 j;  3M0T A;  1I5L A;  1B34 A;  2DK3 A;  1ENW A;  1NYG A;  3PO3 S;  5KCH A;  1QVF A;  1RAC B;  4F7U G;  4E7S A;  3CCU Q;  1BCO A;  5LMK B;  1UEB A;  2LT1 A;  4PK4 A;  1O75 A;  2A37 A;  2OTJ Q;  1Q86 C;  3A1P A;  4R0K A;  5LJ5 f;  2A0F B;  3EH1 A;  1U06 A;  1LNX A;  3E2U A;  3G4S A;  3TEE A;  5D6X A;  2HQE A;  3MY1 B;  1SPK A;  2VWF A;  2SEM A;  3LQ5 B;  2O31 A;  3JCM f;  1T0H A;  3OYL A;  2BS4 A;  4PJM A;  5LJ5 e;  1YJW A;  3HZJ A;  1QWF A;  5A0D A;  2XID A;  4BB7 A;  4IUV A;  4XAX B;  3M5A A;  1K73 R;  4EOP B;  4OF1 A;  1TUD A;  5LJ3 e;  1OL1 B;  3X20 B;  3QG1 A;  2JXB A;  3CD6 A;  3TCJ A;  2BPM B;  2OAU A;  2LCC A;  1H92 A;  2P0Q A;  1YIT A;  1DJ7 B;  1G3S A;  5I22 A;  4IUR A;  2AHJ B;  1C6V X;  1OPL A;  1ZA2 B;  3M0S A;  4A4H A;  4F16 A;  4F6W B;  2P0P A;  3KFV A;  2CSI A;  1GBR A;  4BCJ B;  3QWX X;  1D0Z A;  1K76 A;  3OMC A;  3SB2 A;  4PJO A;  1S1N A;  5FW9 A;  1QKX A;  2RB6 A;  4AT1 B;  2CUD A;  2RD1 A;  4HCK A;  3QDR B;  4RTU A;  3ZEH A;  4DOW A;  3HRT A;  2HBW A;  2KY9 A;  3MPU B;  4LDY A;  2DL4 A;  4EPC A;  3TNH B;  2K3Y A;  1D0Y A;  2ABL A;  4PKC C;  4Y92 A;  7AT1 B;  2DEQ A;  3TSW A;  2RI5 A;  4A54 A;  1YJN T;  2DTH A;  2BZX A;  1H25 B;  3VS0 A;  3CCQ A;  4GBQ A;  2LQW A;  5D7U A;  2JJ9 A;  3L42 A;  5FU6 C;  3WXM B;  1JJ2 P;  4XTX A;  1RUW A;  2D0Q B;  2G3R A;  4MDW A;  5GAO q;  1UNG D;  4E6R A;  2GQV A;  3URG A;  1FVV B;  1X43 A;  4C92 G;  2RA2 A;  2RJE A;  2C4G B;  3JCM V;  2EQK A;  5ICP B;  1RAG B;  1KJW A;  3G6E A;  2XI9 A;  4N4G A;  2QI2 A;  2D6F A;  2OJ2 A;  4ELJ A;  5GAM g;  3MIA B;  1MHN A;  3KUF A;  2MYS A;  1AOJ A;  2E1H A;  3GNG A;  1XOV A;  2CS7 A;  2J6O A;  3SWN C;  5IDP B;  3B57 A;  4HT8 A;  1G2B A;  2GTJ A;  4C8Q D;  3S3N A;  4M77 C;  3CCM T;  3M0R A;  3PMI A;  2XDB A;  4M7D D;  2HKN A;  3CCV A;  2O9S A;  2KE9 A;  3A5Z B;  1VQ6 Q;  1GUX B;  5IXF A;  5HKC A;  1QVP A;  2YUN A;  5GMK j;  3C94 A;  5GAN f;  1CKA A;  1S72 Q;  1TOV A;  2CH4 A;  2W9F A;  1I81 A;  3BFM A;  1K8A C;  3QYG B;  1D3U B;  3LGL A;  4CRL B;  3EG2 A;  2W9Z A;  2D8J A;  5GJV B;  4ROD A;  3G71 Q;  1NPP A;  2WPA B;  4Y72 B;  3BG3 A;  1OI9 B;  4M75 E;  3TU4 K;  4LOC A;  2V8I A;  3GOX A;  1T3L A;  1OOT A;  2DXU A;  3SEM A;  1V1C A;  3T9N A;  2MF2 A;  2VUB A;  4XU3 A;  1PNJ A;  2DAQ A;  5GAN 8;  2DEU A;  2XKO C;  5GAN 3;  5GMK h;  1AWX A;  1UHF A;  3NPF A;  3CMA T;  4IKF A;  3NHN A;  1Q81 U;  3NMZ C;  2UZL B;  1VA7 A;  3OYD A;  3TNI B;  1ZUY A;  4IMY B;  3HTR A;  4M78 F;  2YT6 A;  2DO3 A;  5HVY B;  2IW6 B;  1VQ9 A;  4BCH B;  2QGS A;  2WXV B;  1CKB A;  4DBQ A;  2Y4X A;  1QKW A;  1M1F A;  1JST B;  5GAN e;  2UUE B;  3JB9 G;  3AT1 B;  4C92 C;  3QPH A;  1YIT T;  2DE0 X;  4HCC A;  2X1N B;  4PLL A;  1OUL A;  2H3J A;  2DTO A;  4HKE A;  2QEX A;  1GUX A;  3HFN A;  3P8B B;  1GY3 B;  3JAM E;  3CBO A;  2UZE B;  4FCY A;  1M1K C;  4M4Z A;  3JCM P;  1VQ6 A;  3HSB A;  3OYC A;  3OS2 A;  1OZ2 A;  2O9V A;  1X27 A;  4J6W A;  3OS0 A;  4RCC A;  4ELL A;  1IB8 A;  1XJW B;  5LJ3 j;  1VQK Q;  3OYJ A;  1U3O A;  2Y4Y A;  4JZ4 A;  3I56 A;  4J7F A;  1H28 B;  1BI2 A;  1H4L D;  3LX7 A;  3OS5 A;  2RJC A;  2QDY B;  2I2L A;  1ABQ A;  4CC4 B;  4PNO A;  3G7Z A;  1BKB A;  2IPO B;  4A53 A;  3HHT B;  5J26 A;  4M7D E;  2AT1 B;  1BU2 A;  2LCL A;  1YBY A;  3I5R A;  2AK5 A;  4ZGJ B;  2HQH A;  2DIG A;  2DPP B;  2AKL A;  4FYV B;  4L6V 5;  1YJ9 T;  4M78 C;  3VRY A;  2KT1 A;  3H9N A;  2DXC A;  1XTD A;  5GAM h;  1AZG B;  1G3N C;  2DVJ A;  2RQU A;  4X9C A;  4F7S B;  4M7D G;  2EIF A;  2GTO A;  2PQW A;  1ZSZ B;  3DLL A;  1N9R A;  2WIP B;  4OMF B;  5LJ3 d;  2HMA A;  1ZSZ C;  2L3S A;  4CFU D;  3EHR A;  2GGR A;  2DD4 B;  3HO8 A;  2LW4 A;  1YIJ Q;  1IXD A;  2K2M A;  4BXX X;  4M75 D;  3HL8 A;  1A0N B;  1T0J A;  3TVT A;  1K73 C;  2D1X A;  1OV3 A;  1ZX6 A;  4JPB W;  3X24 B;  1X01 A;  2C0I A;  3GF5 A;  3FIF A;  3F5X B;  1PRM C;  1EFN A;  5KH6 A;  2RHU A;  5C6S A;  5DLQ E;  4M7D F;  1KHC A;  2ENM A;  4WCI A;  3QZ9 B;  2LDM A;  2RK1 A;  1SG5 A;  2VB6 A;  4NOY A;  1Y96 B;  3CEY A;  2HQX A;  3H6Z A;  4J9D A;  1G3W A;  4FT4 A;  2KYM A;  2JUF A;  1OKV B;  2K57 A;  1M8V A;  1G83 A;  4BCP B;  2DNU A;  4RTX A;  3QYH B;  3UAT A;  3M4G A;  2ZZD B;  3L2U A;  4MIM A;  3MCA B;  3O0G D;  2YDL A;  3P8D A;  2HKQ B;  4RTW A;  2EBP A;  4KRD B;  4ELY C;  2MI6 A;  4EMK C;  3VKH A;  3QJ6 A;  1KXU A;  1GCP A;  1NJI C;  1M1K U;  2LVM A;  4AI6 A;  4J9E A;  5KYU A;  3JCM Q;  3DB4 A;  1H27 B;  3TN8 B;  2RK2 A;  1OYX A;  4JJB A;  1WHK A;  2LZ6 B;  1WI7 A;  3DB3 A;  1Q82 R;  4N4H A;  2COY A;  2CCH B;  2HD0 A;  4CXA B;  4X1V A;  1KQS A;  3JCM J;  2EQJ A;  4ANJ A;  1UG1 A;  1MMA A;  2BS2 A;  1FIN B;  1OI1 A;  4C0D C;  3HRS A;  1I5O B;  3CCU T;  4PJJ A;  1MV3 A;  1GXI E;  2BKD N;  3L2W A;  1NPR A;  4EOK B;  4FT2 A;  1K4U S;  5DLO A;  1ARK A;  1AVZ C;  3NGP A;  2HAX A;  1N8R C;  2FZG B;  2D8H A;  4QVC A;  3OYI A;  1BI3 A;  3CCJ Q;  2W96 A;  2PVG B;  3DLM A;  1B34 B;  4F6U B;  3OYK A;  1MV0 B;  2OTL Q;  1M2O A;  4L5G A;  2LCS A;  3CME T;  3C95 A;  2E6N A;  3TNW B;  4HNV A;  1E6G A;  6AT1 B;  4F6S B;  1Q7Y C;  1AZE A;  1E6H A;  2QQS A;  5J3B A;  5HBH B;  1OQK A;  1JQQ A;  2EW3 A;  3G6E T;  5KYY A;  1WYX A;  2CP0 A;  3I55 T;  3BLQ B;  1M90 R;  2FRY A;  2KI7 A;  3I56 Q;  4DQ2 A;  5GAN j;  4CFU B;  2DL7 A;  1BIA A;  2HBP A;  5CO7 A;  3HP9 A;  2I40 B;  1SEM A;  3MP6 A;  2GBQ A;  4IUP A;  3TW6 A;  3CPW P;  2LQN A;  2YRV A;  2I53 A;  2XG8 D;  3CCQ T;  4C0D B;  1YJN A;  4FSX A;  5KYU B;  2K5F A;  1HYO A;  5FU6 B;  1OX9 A;  4C5H A;  3UF4 A;  1AWW A;  5HNB B;  4OGR B;  1H3Z A;  2JN0 A;  2HZY A;  2EQU A;  5HK0 A;  2L89 A;  3PTA A;  3HFO A;  2FG0 A;  3NDQ A;  2E64 A;  3VRZ A;  4J9I A;  4BBR M;  2XK0 A;  1WQ7 A;  2DYB A;  5GJW B;  2CSQ A;  2F1L A;  4CC7 A;  4KUD K;  2WEV B;  1QVF S;  4DBH A;  2C0T A;  3PVL A;  3EG3 A;  2BIV A;  1PSF A;  2M0Y A;  2KGT A;  4PLI A;  1YIJ A;  1N9S A;  1UGV A;  3FC3 A;  2YUP A;  5FGK B;  1VQM T;  4BCQ D;  2E4H A;  4DEY A;  1VQO Q;  2MCN A;  3E1S A;  2F2X A;  4ZTJ A;  4FL6 A;  5IT9 E;  1D1A A;  2GFU A;  4AFZ C;  3VYH B;  4BCQ B;  1YWO A;  4Z89 A;  1PM3 A;  3S6W A;  1YI2 Q;  1ZBX A;  4ZNX A;  2WAC A;  2X4J A;  3BDL A;  3S3O A;  5LJ5 g;  3M54 A;  1VYW B;  3NTH A;  3OYF A;  1GFD A;  2JS2 A;  3INZ A;  2Z0W A;  2EAY A;  2OAW A;  2E6Z A;  4C8Q E;  3CQT A;  2PHG A;  2RO0 A;  2CZ1 B;  2OTL T;  3EGX B;  1UJ0 A;  3VKG A;  3DDP B;  4M7A B;  3N5B B;  4B9W A;  3KHI A;  2CZ6 B;  3EG1 A;  4O6J A;  4JJN K;  3L2V A;  1ABO A;  2KNB B;  2QA4 Q;  2RF0 A;  4YOS A;  3PIO A;  1WDX A;  1J3T A;  4ZTF A;  3DJB A;  1OU8 A;  1C1A A;  1W1F A;  1TG0 A;  3VS6 A;  3MKD A;  4M78 D;  3JSC A;  3LYI A;  4BCO B;  1JRI A;  2C6T B;  2CJM B;  4XTV A;  4NST B;  2DL8 A;  3JCM X;  2LJ0 A;  4PJN A;  4J9H A;  4BD3 A;  2JGZ B;  1OZ3 A;  2MAM A;  3EG9 A;  2M51 A;  1H8K A;  3CCR T;  3OA6 A;  2LQK A;  4FIB A;  5LJ5 h;  3VYG A;  1BCM A;  2FZK B;  4KBM B;  2WSE E;  1W2B P;  3OYH A;  3H8Z A;  3VKI A;  2EQM A;  3QJY A;  4LNP A;  1UGQ B;  1TS9 A;  1LCK A;  3EOC B;  4KRC B;  2K5I A;  2K79 A;  5IN1 A;  4BI4 A;  3U23 A;  1K73 U;  1VQN T;  4FYW B;  3QDF A;  4LDX A;  4JX4 A;  3JB9 D;  1M3C A;  4M7D C;  2HCK A;  1GBQ A;  2V8J A;  1M2V B;  2CRE A;  4HNT A;  2EJ9 A;  3GP8 A;  3MEV A;  4PJL A;  1YIJ T;  2DZ9 A;  2FPD A;  1PWT A;  2MPX C;  2RI2 A;  2COZ A;  1U1S A;  2QK0 A;  3OMG A;  2KDS A;  4J6X A;  5DY9 A;  2RH2 A;  1Q86 U;  5FRM A;  4RCB A;  4F7L B;  1JB0 E;  3VS2 A;  3NTK A;  3QO3 A;  4F7U B;  5GMK e;  2DMO A;  3CXC A;  4OMP A;  4C8Q B;  1TUC A;  2KAF A;  2X3X D;  1SHF A;  1RAH B;  4LD6 A;  4M7A D;  3H0H A;  1M5Q 1;  4EDU A;  3P8H A;  4JS4 A;  2HSP A;  4IUT A;  4OR5 B;  4EOI B;  2OTJ A;  1GL5 A;  2DXT A;  1UUE A;  1VQ4 Q;  4AKH A;  3RKW A;  1H24 B;  4CC2 A;  3QZ5 B;  1YNZ A;  4OB1 B;  4LDU A;  1YFN A;  3CCJ T;  4QW2 A;  5KE3 A;  4E7I A;  5IHN A;  2VAS A;  3NFC A;  1M1G A;  1Q82 U;  2BUD A;  2JTE A;  1B7T A;  3V7R A;  1Q81 R;  1I0C A;  3ER0 A;  4OGE A;  4KGV B;  1UGP B;  3QHW B;  1AHJ B;  3QHS A;  4XTZ A;  1WHG A;  1YN8 A;  1JSU B;  4JDS A;  4C8Q G;  1EZZ B;  2ZGW A;  1VQK T;  2A28 A;  4C5I A;  4BCN D;  1AD5 A;  1N8R R;  3VUB A;  2LC4 A;  4EOO B;  4II1 A;  3C0C A;  3E19 A;  5KYY B;  4QVD A;  4M75 F;  4OB0 B;  2PK2 A;  3X28 B;  4M77 B;  2OI3 A;  3BHV B;  2X51 A;  3RGF B;  4BE2 A;  4RTY A;  3M57 A;  4AFS C;  2CT4 A;  8ATC B;  3M4Y A;  1E7P A;  1WZO A;  3H0I A;  2CYZ B;  2DD5 B;  3KBG A;  3R6O A;  1M30 A;  4E7H A;  2RHX A;  1TH7 A;  1AEY A;  4TTH A;  1URC B;  3QII A;  2D0N A;  1QVG A;  1JXM A;  2VXF A;  2EKO A;  2PUO B;  1K9M R;  3MP8 A;  2RJF A;  3OW2 P;  1FMK A;  3DDQ B;  1QP3 A;  4BBS M;  1PC0 A;  3EFS A;  2IVW A;  4R55 A;  1G5V A;  4HLQ A;  1T3S A;  2NUT B;  3VS3 A;  4KUL A;  3IQL A;  2K4Y A;  4HCZ A;  3EGD B;  3Q1J A;  5GMK l;  1TSF A;  3UT1 A;  4CRI A;  3RMS A;  1KD1 C;  4OML A;  2DXB A;  2QQ8 A;  1AIS B;  4C0Z A;  3MEA A;  1UFF A;  1WQW A;  1VUB A;  2JTF A;  2J06 A;  1Y96 A;  1JEG A;  3CCM Q;  1WHL A;  2DBK A;  3CCE T;  1YCS B;  2H8H A;  1YJ9 Q;  4F14 A;  5GAN d;  4WF2 A;  1UGR B;  1P92 A;  2AZV A;  1M3A A;  5J39 A;  4M75 C;  5LQF B;  3EFO B;  4YTL A;  2MWP A;  1JO8 A;  1YCY A;  3EJ1 B;  3BDU A;  2FPF A;  1R0C B;  1H1S B;  2DD4 A;  2LNV A;  5CKB A;  4C8Q C;  2G6F X;  1OKW B;  2CDT A;  4AMC A;  3FDR A;  3L2R A;  2F2C A;  2DD5 A;  4G6L B;  3VS7 A;  4E47 A;  3MEW A;  4KH1 B;  4ELZ C;  4XU2 A;  2RN8 A;  4AG2 C;  1ZUU A;  2V22 B;  3A8G B;  4JRQ A;  1VQO A;  2KR3 A;  1D1B A;  2ROL A;  2CT3 A;  2F2W A;  5GMK i;  2CCI B;  5CKH A;  1WX6 A;  1KC8 U;  4HVV A;  3RMQ A;  3RIR A;  4BAC A;  3DOG B;  2ZPE B;  4GY5 A;  3JB9 F;  5ACB A;  3VYG B;  4J9C A;  4E7K A;  1D3B A;  1FMW A;  5L8R E;  3VV0 A;  2EWN A;  2DTI A;  2XIC A;  4E7Z A;  1QCO A;  2KRO A;  4AKG A;  3CC2 A;  4M78 A;  1X6G A;  2OX7 A;  1Q7Y R;  5GAN 5;  3M56 A;  1OPK A;  3EGU A;  2V8K A;  1JXO A;  2DX1 A;  2EFI A;  3JB9 I;  1SHG A;  1JJ2 S;  1K9M U;  2DXB B;  4PJO E;  1OEB A;  3SFM A;  3GNF B;  1TXQ A;  2KYB A;  5IF1 B;  4L59 A;  5AYF A;  1OL2 B;  4RG8 A;  3I9Q A;  2EYQ A;  2QQB A;  4M7A F;  4CFW B;  5LL6 S;  4MZM A;  4EOS B;  1FX7 A;  3CPW S;  1QWE A;  2EGA A;  3M0P A;  4FSS A;  2E3H A;  3HRU A;  9ATC B;  1M3B A;  4JRK A;  2X4Y A;  2LNH B;  2ZPF B;  3OQ5 A;  4F7J B;  2IIM A;  5FU7 B;  3L1A A;  1Z9Q A;  2XU8 A;  3SHW A;  4C8Q A;  4RUG A;  4PJO B;  4BCN B;  4MFD A;  3OSV A;  4PFZ A;  1XO2 A;  4M7A G;  5KCO A;  4RG2 A;  1KQS P;  2JT4 A;  2NYS A;  3MJX A;  5HK3 A;  1WLP B;  1PKT A;  3HB9 A;  1TFB A;  1ZHI A;  4C92 D;  2P84 A;  5A2Q E;  5CCA A;  2FHD A;  2DVE A;  1KFZ A;  2B8A A;  1VQN Q;  1WNL A;  1KC8 R;  3CD6 Q;  3JB9 H;  4M7D B;  1VQ7 T;  2MOX A;  2MMP A;  2HEQ A;  2W2H A;  5GMK m;  2DIQ A;  3BLR B;  2EYX A;  3RES A;  3H0F A;  2FO0 A;  2FPE A;  2LX7 A;  2P4R A;  4Q5W A;  1RAE B;  2DYI A;  4QVZ A;  3RBB B;  5GAM f;  1PHT A;  4CFM B;  3OY9 A;  5IHI A;  1B3Q A;  4O5V A;  4M78 E;  4M77 D;  3M03 A;  4EMH A;  2QGG A;  2KR6 A;  2K6D A;  5GAO r;  2DER A;  3E9G A;  5GAM d;  4MDX A;  1JU5 C;  2XDD A;  2WIH B;  1Q86 R;  3CXC S;  3CCV T;  5EG2 A;  2WSC E;  5CR2 A;  5IAY A;  1JKW A;  2RPN A;  1IHW A;  2KBT A;  3CCM A;  2KXC A;  1O9K A;  3MP1 A;  1GCQ A;  4PJO C;  4HCB A;  2F5K A;  2LP5 A;  3CCL T;  3A8H B;  1BI0 A;  3FJP A;  2RQV A;  3CME A;  5CQY A;  5I11 A;  3OYG A;  1IRX A;  2O4X B;  1UGS B;  3G4S Q;  3M53 A;  1Z9Z A;  2XMF A;  3HBL A;  5GAN 7;  5HY6 A;  5I5Z B;  3X25 B;  1RLP C;  2FZC B;  4JRI A;  3MEU A;  3HPW A;  2BKZ B;  2QDL A;  5HBE B;  3QXE B;  4PJO D;  3LLR A;  4E7L A;  2DME A;  1TTH B;  5CEI B;  3I56 T;  1WIE A;  1QQJ A;  4AFQ C;  5I2M A;  4CI0 C;  3FLG A;  5AT1 B;  3DTO A;  5IH2 A;  3V8L A;  2QA4 A;  2ZPB B;  2RI3 A;  3ME9 A;  3X26 B;  5EFQ B;  1VQM Q;  5KYN A;  2PK9 B;  3JCM c;  2PTK A;  3QSU A;  1WHM A;  2EQI A;  2RMO A;  1RAD B;  2PMI B;  1X6O A;  2J6F A;  5CYI B;  1VIN A;  1WXB A;  2QEX T;  2D9T A;  1I8F A;  4MML A;  5I2S A;  2YRD A;  3JRZ A;  1EIF A;  4II5 B;  3TW7 A;  2HSE B;  2YRC A;  3JCM d;  3CC2 Q;  2X3W D;  1MMD A;  2DZC A;  2DJZ A;  3RDV A;  1MGQ A;  5FRN A;  1WXT A;  5KYX A;  1M2V A;  2EJF A;  2P4T A;  3M9Q A;  2IG0 A;  3RKY A;  4HVU A;  4J9F A;  2DRK A;  1QLB A;  2YLB A;  1VQ9 T;  3EID B;  4BCM D;  5GAO p;  2XD0 A;  4JUV A;  2O4X A;  3C4S A;  4J7I A;  1YHQ A;  3PFS A;  1Y71 A;  4F7U A;  4AG1 C;  1VQ8 Q;  4J8O A;  1P5E B;  2DJQ A;  2ED1 A;  1X6B A;  3MY5 B;  5CKE A;  1OGU B;  4BI8 B;  1NJI R;  2CZ7 B;  1V29 B;  2DF6 A;  1FWZ A;  1RI0 A;  2KK4 A;  2QYZ A;  2KT8 A;  2VKN A;  2ED0 A;  5CKD A;  3CPW A;  1I4K 1;  3FEO A;  2QG9 B;  1O9S A;  2DLP A;  3GPL A;  2R58 A;  2QA4 T;  2GNC A;  4A4F A;  3DKM A;  2IW8 B;  3G4S T;  1NEB A;  2QXF A;  5FLX E;  1VOL A;  1W98 B;  3A98 A;  1ACM B;  4ROC A;  1KG1 A;  1LVK A;  1D3B B;  2GFA A;  2BZ8 A;  2R5M A;  1IO6 A;  4TVR A;  5IDN B;  1MMN A;  1WJQ A;  1HSQ A;  2RHI A;  1LOJ A;  3OW2 A;  1IHV A;  2VVK A;  3CCV Q;  2DKG A;  1FYN A;  4IIM A;  1VQK A;  4ATO A;  1ZLM A;  1W4S A;  1R0B G;  1UTI A;  4BCM B;  4BY7 X;  3OYM A;  4BI3 A;  3OYB A;  4BY6 B;  3RUX A;  3ULR B;  5GAN 4;  1VQ6 T;  4F7N B;  3R6N A;  4LUE A;  1NBE B;  5FU7 C;  2HNI A;  1X2K A;  3CPF A;  1QLY A;  1GFC A;  2KSS A;  1UNL D;  2LQ8 A;  5I21 A;  4ESR A;  3CCL A;  3SWN A;  3LWI A;  2PNI A;  4FX3 B;  4FYY B;  5GAO l;  3G71 A;  4R56 A;  2E5Q A;  1PCX A;  2H3E B;  4EC8 B;  3SDZ A;  3CCS T;  3TSZ A;  2O01 E;  2JVV A;  4JS5 A;  4J9G A;  3QBY A;  3M55 A;  1BBZ A;  1VQ9 Q;  3A8L B;  4JLI A;  1BI1 A;  2DIL A;  3BG9 A;  2DET A;  1WJR A;  5M9O A;  1ZA1 B;  2RJD A;  4NL3 A;  2L3P A;  1UB4 A;  1K8A U;  1NLO C;  2RQW A;  3VS1 A;  1VIE A;  3MET A;  4N0A C;  2KMG A;  5ECA A;  4EMG A;  2K7A A;  2NUT A;  1VQ8 A;  4JJC A;  3LH0 A;  4X9D A;  3POM A;  2RM4 A;  4M7A A;  1W6X A;  2X9H A;  3AHU A;  3I35 A;  2R57 A;  4EOQ B;  4XK8 E;  2CP5 A;  4C92 A;  1I1J A;  2R7G A;  2J05 A;  1N5Z A;  4Y91 A;  1OIY B;  3VS4 A;  2SRC A;  1W2B A;  4EMK B;  5LJ3 h;  4QKU A;  5FWB A;  1M9S A;  3OW2 S;  2GF7 A;  4F7U F;  2HL5 C;  1NG2 A;  1QCN A;  4FW2 A;  4BCI B;  5LJ5 d;  4M75 A;  1N6A A;  3M59 A;  5D6W A;  4KH0 B;  3WVE B;  3ASK A;  2CH4 W;  3CCE Q;  3GIB A;  1Q95 G;  2WMA B;  1AD6 A;  3BLH B;  4BCK B;  4PJO F;  4GLK A;  4LN2 A;  1K0X A;  3V7C A;  1QW1 A;  4I3Z B;  3VS5 A;  2C5X B;  1YJW T;  4DBR A;  3G71 T;  1PKD B;  2PVD B;  1G3Y A;  2ATC B;  2E12 A;  4UN0 A;  2CP2 A;  4D8D A;  2QF7 A;  4BY1 X;  3OBY A;  2E5K A;  2LRQ A;  1LJO A;  1YI2 A;  3OSS C;  5GAM j;  4A63 B;  4PJO G;  2KRM A;  1X75 C;  1SKU B;  1JOW A;  4F17 A;  4IIO A;  3O8V A;  5HQ0 B;  4KT0 E;  3OYN A;  4HL4 A;  3CC7 A;  1BYM A;  4XU0 A;  4A4E A;  3JCM g;  3QUI A;  2VGM A;  4Y28 E;  1WPY A;  1YIT Q;  2R5A A;  2JS0 A;  1VQ7 Q;  5EJC A;  2OTL A;  4NC6 A;  2DFU A;  3OS1 A;  2ZPI B;  4C92 E;  1KK7 A;  4C92 B;  1OU9 A;  4M77 F;  3M0Q A;  3J81 E;  2C06 A;  5L23 A;  4Z6Y A;  3E9F A;  2V1R A;  4OB3 B;  2E3I A;  4E7J A;  1QCF A;  5GAN 6;  2QTV A;  3DL1 A;  1EX4 A;  3ZFJ A;  1RAI B;  4RKU E;  4XTU A;  2CGH A;  4ORZ A;  5GAO n;  3BHU B;  4M77 G;  4E2F B;  4M7A C;  3CCE A;  3UPU A;  1ZSZ A;  1VQL Q;  2QAS A;  3RR6 A;  2V1Q A;  2QFZ A;  3GBQ A;  4LDV A;  1Q7Y U;  5CAI A;  1ZSG A;  3H41 A;  4Z02 A;  1YHQ T;  4DBF A;  3KXT A;  3RER A;  1NYF A;  2YXY A;  4CC3 A;  2JW4 A;  4M77 E;  2MIO A;  3OB9 A;  4QQD A;  3BY7 A;  4QT7 A;  4BUG A;  1VYU A;  4MMK A;  1IZ6 A;  1RAF B;  4DOV A;  2BS3 A;  4ZGD B;  1IGQ A;  2FEI A;  1VQP A;  2KEA A;  3JB9 J;  4NS5 A;  4N0A A;  2CUB A;  4HNU A;  2E41 A;  1BU1 A; 
#chains in the Genus database with same CATH homology
 4M7A G;  5KCO A;  4M77 A;  4RG2 A;  3CC4 A;  5HK3 A;  4DQ2 A;  2RHY A;  5KCH A;  5GAN j;  1QVF A;  3HB9 A;  1ZHI A;  4P5N A;  4F7U G;  4M75 G;  4C92 D;  1BIA A;  1WGS A;  2HBP A;  5CCA A;  5A2Q E;  2FHD A;  5CO7 A;  2DVE A;  3HP9 A;  1H64 1;  2B8A A;  3LWH A;  3MP6 A;  4LDW A;  4QQ6 A;  1UEB A;  2LT1 A;  3TW6 A;  2K2V A;  1WNL A;  2K3X A;  1O75 A;  2VYT A;  2YRV A;  4IUP A;  3JB9 H;  1Q86 C;  4M7D B;  5LJ5 f;  2XG8 D;  3I55 A;  3CCQ T;  1VQ7 T;  4C0D B;  2MMP A;  4QQG A;  1YJN A;  5GMK m;  4FSX A;  2DIQ A;  3PT9 A;  2K5F A;  2M9U A;  3S3M A;  3CBM A;  1LNX A;  5FU6 B;  4A4G A;  1U1T A;  3RES A;  3G4S A;  4C5H A;  1RL2 A;  3TEE A;  5CK9 A;  3VU3 C;  5D6X A;  2HQE A;  4Q5W A;  3V8K A;  1M90 C;  2JN0 A;  5HK0 A;  2EQU A;  4QVZ A;  4OGC A;  1H3Z A;  1FKM A;  5GAM f;  5FRO A;  2L89 A;  3OY9 A;  3PTA A;  3HFO A;  3JCM f;  4J5Y A;  3OYL A;  4O5V A;  2E64 A;  4M78 E;  4M77 D;  2BS4 A;  4BBR M;  2F69 A;  2XK0 A;  5LJ5 e;  2X4W A;  1YJW A;  4EMH A;  3CC7 T;  2KR6 A;  1WQ7 A;  3HZJ A;  5GAO r;  3E9G A;  5GAM d;  5A0D A;  2XID A;  4KUD K;  1QVF S;  4MDX A;  2XDD A;  4BB7 A;  4IUV A;  4XAX B;  2E10 A;  3M5A A;  1VQ5 T;  5GAN 2;  4OF1 A;  5LJ3 e;  3CXC S;  2BIV A;  3X20 B;  1PSF A;  2WSC E;  3QG1 A;  5EG2 A;  4BY6 C;  3TCJ A;  5IAY A;  5KE2 A;  2OAU A;  2LCC A;  5CR2 A;  3CD6 A;  4PLI A;  2P0Q A;  1N9S A;  4C92 F;  3CCM A;  3FC3 A;  1VQM T;  1YIJ A;  1YIT A;  2RHZ A;  1KD1 U;  3MP1 A;  1VQ4 T;  1DJ7 B;  1G3S A;  4PJO C;  3E1S A;  4HCB A;  3CCU A;  2F5K A;  4FL6 A;  5IT9 E;  2GFU A;  4ZTJ A;  3VYH B;  4IUR A;  2AHJ B;  4OP0 A;  3CCL T;  3A8H B;  4JX6 A;  1BI0 A;  3FJP A;  4HA8 A;  5D6Y A;  3S6W A;  4A4H A;  3CME A;  2P0P A;  1ZBX A;  1KHI A;  2WAC A;  5CQY A;  2X4J A;  3OYG A;  3FRN A;  3BDL A;  3CCJ A;  4XTY A;  3S3O A;  2O4X B;  5LJ5 g;  4PJO A;  3OMC A;  3M54 A;  1UGS B;  3SB2 A;  3NTH A;  1KQS S;  2CZ0 B;  3M53 A;  3OYF A;  3INZ A;  4FU6 A;  2RB6 A;  2EAY A;  2E6Z A;  3HBL A;  5GAN 7;  5HY6 A;  4MZT A;  5LJ3 g;  3X25 B;  2RD1 A;  4C8Q E;  2OTJ T;  4C0G A;  2RO0 A;  2ZPG B;  2LT4 A;  3QDR B;  4JRI A;  3MEU A;  3HPW A;  3ZEH A;  2CZ1 B;  4DOW A;  2OTL T;  3HRT A;  3QXE B;  4PJO D;  3VKG A;  1NE8 A;  2KY9 A;  4PL6 A;  1SSF A;  4LDY A;  3LLR A;  4E7L A;  4M7A B;  4EPC A;  3N5B B;  3PMT A;  2K3Y A;  4B9W A;  3KHI A;  4C5E A;  3J80 E;  3QKJ A;  2CZ6 B;  3I56 T;  4PKC C;  4O6J A;  4JJN K;  3VUZ A;  2M16 A;  3L2V A;  5CKF A;  5I2M A;  4CI0 C;  3FLG A;  3V8L A;  3PIO A;  2QA4 A;  2DEQ A;  2ZPB B;  2RI3 A;  5LJ3 f;  4ZTF A;  2K5L A;  1S72 T;  2RI5 A;  3ME9 A;  2KMT A;  3OBW A;  3A8O B;  2DTH A;  3X26 B;  2L3R A;  4A54 A;  3CCQ A;  1YJN T;  1VQP T;  1VQ7 A;  3JCM c;  3QSU A;  1BIB A;  5GAM e;  4M78 D;  1M4Z A;  3JSC A;  4JRP A;  1X6O A;  3LYI A;  1JRI A;  2JNG A;  1M90 U;  3L42 A;  5FU6 C;  3NTI A;  3WXM B;  2QEX T;  2D9T A;  1I8F A;  2QQR A;  4MML A;  4XTV A;  4XTX A;  5I2S A;  5CVI A;  2D0Q B;  2G3R A;  4MDW A;  3JCM X;  2L5Q A;  5GAO q;  3JRZ A;  1EIF A;  3BG5 A;  3TW7 A;  1VIF A;  3JCM d;  4BD3 A;  2P0K A;  2GQV A;  1OZ3 A;  2MAM A;  3URG A;  3CCR T;  2DZC A;  3OA6 A;  3V7S A;  2LQK A;  4FIB A;  2DJZ A;  5LJ5 h;  3VYG A;  4C92 G;  2RA2 A;  2RJE A;  2VGN A;  1MGQ A;  5FRN A;  3JCM V;  4MFE A;  2EQK A;  4KBM B;  2WSE E;  3CBP A;  3OYH A;  3H8Z A;  3VKI A;  3G6E A;  3QYB A;  2XI9 A;  4MZP A;  3SD4 A;  2EJF A;  2EQM A;  4N4G A;  2P4T A;  2QI2 A;  3M9Q A;  4M78 B;  3QJY A;  2IG0 A;  3RKY A;  2D6F A;  1UGQ B;  4ELJ A;  2K5I A;  3GLX A;  1Q82 C;  5IN1 A;  3C12 A;  5GAM g;  1MHN A;  3KUF A;  1QLB A;  2YLB A;  1VQ9 T;  4BI4 A;  5GAO p;  1VQL A;  2XD0 A;  4JUV A;  1K73 U;  5CQX A;  2E1H A;  2ZCF B;  1VQN T;  3GNG A;  2O4X A;  1XOV A;  4LDX A;  4JX4 A;  3PIP A;  2CS7 A;  2GCX A;  3SWN C;  3C4S A;  3JCM W;  3JB9 D;  4J7I A;  4M7D C;  1YHQ A;  2V8J A;  1YJ9 A;  1XQH A;  4HT8 A;  4C8Q D;  3S3N A;  4FM4 B;  1VQ4 A;  4M77 C;  4HNT A;  2EJ9 A;  2NLU A;  3PFS A;  1Y71 A;  3MEV A;  1G3T A;  4F7U A;  3GP8 A;  3CCM T;  1YIJ T;  1PSE A;  3PMI A;  2DZ9 A;  4J8O A;  2XDB A;  4M7D D;  5A0L A;  3CCV A;  1W2B S;  1VQ5 A;  2A7Y A;  2RI2 A;  4ME7 A;  5CKE A;  1U1S A;  4BI8 B;  4BDZ A;  3OMG A;  2KDS A;  2CZ7 B;  1V29 B;  3A5Z B;  4J6X A;  5DY9 A;  3CCR A;  1FWZ A;  1RI0 A;  2RH2 A;  1Q86 U;  5FRM A;  2KK4 A;  5HKC A;  1QVP A;  5GMK j;  3CC2 T;  3C94 A;  4RCB A;  5GAN f;  1KQ2 A;  5CKD A;  3CPW A;  1JB0 E;  1I4K 1;  4NL2 A;  3UWN A;  3FEO A;  3NTK A;  3QO3 A;  4IUU A;  1O9S A;  4F7U B;  2G77 A;  1I81 A;  2R58 A;  3BFM A;  4J6Y A;  4A4F A;  5GMK e;  4C8Q B;  5A0G A;  3CXC A;  3DKM A;  2KVQ G;  2KAF A;  3QYG B;  3LGL A;  4LD6 A;  3G4S T;  4M6V A;  4M7A D;  2QXF A;  5FLX E;  1M5Q 1;  3GPL A;  3JCM e;  2WSF E;  4EDU A;  1NPP A;  1KG1 A;  4M7A E;  2Y90 A;  2QQA A;  3BG3 A;  3P8H A;  4M75 E;  1D3B B;  3EFR A;  4JS4 A;  3TU4 K;  1Q81 C;  4IUT A;  4LOC A;  2V8I A;  3GOX A;  2DXU A;  3A8M B;  3T9N A;  2GFA A;  2R5M A;  2OTJ A;  2MF2 A;  3J7A F;  2VUB A;  3LGF A;  4XU3 A;  4TVR A;  2DXT A;  2DAQ A;  1WJQ A;  1VQO T;  4AKH A;  1LOJ A;  2RHI A;  5GAN 8;  3OW2 A;  3RKW A;  2XKO C;  5GAN 3;  5GMK h;  3QZ5 B;  2FL7 A;  3L2Q A;  3CMA T;  4OB1 B;  4IKF A;  3CC4 T;  4JLG A;  1Q81 U;  2FB7 A;  2DKG A;  1K9M C;  3OYA A;  4LDU A;  3CCJ T;  4QW2 A;  4ZN3 A;  2A3L A;  5KE3 A;  3OYD A;  1VQK A;  4ATO A;  1W4S A;  4E7I A;  4M78 F;  4D6W A;  2LX9 A;  3NFC A;  2DO3 A;  4A4K A;  4C5G A;  4BI3 A;  5C0M A;  3OYM A;  3OYB A;  4OVA A;  5GAO m;  1VQ9 A;  4BY6 B;  1VQL T;  3RUX A;  1M1G A;  1Q82 U;  2BUD A;  3MHX A;  5GAN 4;  1VQ6 T;  1ZQ1 A;  3V7R A;  5FU7 C;  2Y4X A;  2HNI A;  4ZN1 A;  3CPF A;  1Y7X A;  3ER0 A;  3FB9 A;  1M1F A;  5GAN e;  2MWO A;  4OGE A;  2E70 A;  1UGP B;  2KSS A;  3JB9 G;  1AHJ B;  2LQ8 A;  2X4X A;  3QHS A;  4XTZ A;  5I21 A;  4C92 C;  2L8D A;  3CCL A;  3SWN A;  4JDS A;  4C8Q G;  2VC8 A;  3LWI A;  2ZGW A;  1VQK T;  2WJ9 A;  1WJS A;  5GAO l;  3G71 A;  4R56 A;  3QPH A;  2E5Q A;  4C5I A;  1YIT T;  1VQM A;  3I55 T;  4HCC A;  3LW5 E;  3PGG A;  1FXX A;  1HXD A;  3CMA A;  4XQ3 A;  3VUB A;  2QA4 T;  2LC4 A;  4II1 A;  3H4C A;  2H3J A;  4PLL A;  2DTO A;  3L2Z A;  3CCV T;  3E19 A;  4HKE A;  2QEX A;  4J83 A;  4QVD A;  2YHT A;  3SDZ A;  3HFN A;  4BE0 A;  2FVU A;  3CCS T;  4BDY A;  4M75 F;  3P8B B;  1HK9 A;  4OB0 B;  3JAM E;  3X28 B;  2O01 E;  2JVV A;  3CBO A;  4M77 B;  4C0F A;  4RMO A;  4JS5 A;  2X35 A;  3QBY A;  1KC8 C;  1M1K C;  3JCM P;  3M55 A;  1VQ8 T;  1VQ6 A;  3A8L B;  3SWN B;  4JLI A;  4BE2 A;  3OYC A;  3OS2 A;  1BI1 A;  3M57 A;  1QVG S;  3HSB A;  1OZ2 A;  4J6W A;  3OS0 A;  1S72 A;  3BG9 A;  4RCC A;  4C8Q F;  5LJ3 j;  5GAN g;  3QYE A;  3M4Y A;  1WJR A;  5M9O A;  1E7P A;  2RJD A;  4NL3 A;  1UB4 A;  1K8A U;  3OYJ A;  2XHC A;  2Y4Y A;  3I56 A;  1JJ2 A;  2CYZ B;  4J7F A;  2DD5 B;  1BI2 A;  3KBG A;  3R6O A;  1VIE A;  3MET A;  3LX7 A;  3OS5 A;  4N0A C;  4EMK A;  2KMG A;  2RJC A;  4E7H A;  2RHX A;  4EMG A;  1TH7 A;  3QII A;  2QDY B;  2DXC B;  1VQ8 A;  3HKS A;  4XTW A;  2I2L A;  3LH0 A;  4X9D A;  2RM4 A;  1QVG A;  4M7A A;  2E65 A;  3JCM h;  2VXF A;  4PNO A;  3AHU A;  2R57 A;  2EKO A;  2PUO B;  4XK8 E;  3MP8 A;  3G7Z A;  3CCS A;  4C92 A;  1BKB A;  2RJF A;  4A53 A;  3HHT B;  2KQW A;  5J26 A;  4Y91 A;  4M7D E;  2LCL A;  1QP3 A;  1YBY A;  2VXE A;  4BBS M;  4QSH A;  4ZGJ B;  2IVW A;  3EFS A;  4EMK B;  4R55 A;  1W2B A;  1G5V A;  2DIG A;  2DPP B;  4HLQ A;  1M9S A;  4L6V 5;  5LJ3 h;  3OW2 S;  4M78 C;  1YJ9 T;  2GF7 A;  4HT9 A;  2DXC A;  4F7U F;  4KUL A;  4BE1 A;  2K4Y A;  1XTD A;  4HCZ A;  5GAM h;  1JBM A;  1XNI A;  3Q1J A;  5GMK l;  5LJ5 d;  4M75 A;  4X9C A;  1N6A A;  5GAN h;  3M59 A;  3UT1 A;  4CRI A;  4M7D G;  5D6W A;  3RMS A;  1KD1 C;  3WVE B;  2EIF A;  2PQW A;  3ASK A;  2LTO A;  3QWL A;  1U8R A;  2DXB A;  3DLL A;  3GIB A;  2QQ8 A;  1N9R A;  4C0Z A;  4OMF B;  1YI2 T;  4PJO F;  3F70 A;  3MEA A;  5LJ3 d;  4GLK A;  3M58 A;  1WQW A;  1VUB A;  2JTF A;  3V7C A;  1QW1 A;  4DA4 A;  2DD4 B;  1Y96 A;  3HO8 A;  1Y07 A;  4XU1 A;  3CCE T;  4M75 D;  3HL8 A;  4KUI A;  1YJW T;  3G71 T;  2PVD B;  1K73 C;  1G3Y A;  5GAN d;  3RKX A;  4WF2 A;  1N27 A;  4IUQ A;  1UGR B;  3X24 B;  1P92 A;  2E12 A;  1X01 A;  4M75 B;  3FIF A;  3EAE A;  2QF7 A;  3GF5 A;  4M75 C;  5J39 A;  5KH6 A;  2M0O A;  2RHU A;  3OBY A;  1IRE B;  4YTL A;  5DLQ E;  4JX5 A;  5C6S A;  4M7D F;  1KHC A;  2LRQ A;  1LJO A;  2PVO B;  2MWP A;  3QZ9 B;  2LDM A;  3OSS C;  1YCY A;  5GAM j;  2YLC A;  2RK1 A;  3BDU A;  1YI2 A;  3OYE A;  4PJO G;  1X75 C;  3MO8 A;  4NOY A;  1Y96 B;  2DD4 A;  2LNV A;  3CEY A;  2HQX A;  5CKB A;  4C8Q C;  3H6Z A;  1G3W A;  3FDR A;  4FT4 A;  3L2R A;  3WVD B;  2JUF A;  2M1H A;  2K57 A;  2DD5 A;  3O8V A;  1M8V A;  4E47 A;  2FYK A;  4KT0 E;  3MEW A;  1NJI U;  3QYH B;  4ELZ C;  3M4G A;  4XU2 A;  2ZZD B;  4HL4 A;  2QDJ A;  3OYN A;  2PUK B;  3PNW C;  3L2U A;  4MIM A;  3MCA B;  2JTM A;  4XU0 A;  4N4I A;  3UDC A;  3CC7 A;  4V2S A;  1BYM A;  4A4E A;  3JCM g;  3QUI A;  3A8G B;  4JRQ A;  2VGM A;  4Y28 E;  1VQO A;  1WPY A;  2PU9 B;  3P8D A;  2XDP A;  4UC4 A;  4AKI A;  2R5A A;  4M78 G;  5EJC A;  2OTL A;  4ELY C;  2MI6 A;  4EMK C;  3VKH A;  5GMK i;  3QJ6 A;  4NC6 A;  2QTX A;  5CKH A;  1NJI C;  1KC8 U;  1M1K U;  3RMQ A;  2LVM A;  4AI6 A;  3RIR A;  3OS1 A;  3OYY A;  2ZPI B;  2EJG A;  3JCM Q;  4C92 E;  3J81 E;  5CIU A;  4M77 F;  2QQ9 A;  3DB4 A;  4C92 B;  2C06 A;  4X34 A;  4BAC A;  2JOY A;  2RK2 A;  1OYX A;  2ZZD A;  4Z6Y A;  1R8O B;  2ZPE B;  3E9F A;  4M7D A;  4GY5 A;  3JB9 F;  4OB3 B;  3DB3 A;  4E7J A;  4F7U E;  3VYG B;  4N4H A;  5GAN 6;  2F5T X;  4B9X A;  3V8J A;  4E7K A;  1D3B A;  2HD0 A;  4OB2 B;  2JZ2 A;  5L8R E;  3VV0 A;  1N8R U;  1K8A C;  2EWN A;  1KQS A;  2DTI A;  3JCM J;  2EQJ A;  3DL1 A;  2XIC A;  3ZBD A;  3ZFJ A;  2ZPH B;  4RKU E;  3TRE A;  2BS2 A;  4AKG A;  3CC2 A;  1OI1 A;  4M78 A;  5GAN 5;  4XTU A;  4C0D C;  2CGH A;  3M56 A;  2V8K A;  3HRS A;  3CCU T;  5GAO n;  2EFI A;  3JB9 I;  1GXI E;  2BKD N;  4M77 G;  3L2W A;  1NPR A;  4M7A C;  4FT2 A;  3CCE A;  3UPU A;  5DLO A;  1K9M U;  1JJ2 S;  4LD9 K;  2DXB B;  4PJO E;  1QP2 A;  3SFM A;  2HAX A;  3CD6 T;  3GNF B;  1N8R C;  4QVC A;  2VV5 A;  3OYI A;  2QFZ A;  4LDV A;  1NZ9 A;  5CAI A;  4L59 A;  1BI3 A;  4ZGE B;  1Q7Y U;  4Z02 A;  2PVG B;  5AYF A;  1KQ1 A;  1YHQ T;  4RG8 A;  3DLM A;  1B34 B;  3OYK A;  2EYQ A;  2QQB A;  4M7A F;  3KXT A;  3RER A;  3BW1 A;  3VJP A;  5LL6 S;  4L5G A;  4MZM A;  3CME T;  1VQN A;  4M77 E;  1FX7 A;  3CPW S;  3OB9 A;  2E6N A;  3C95 A;  4QQD A;  3BY7 A;  4BUG A;  3JCM b;  4HNV A;  3HRU A;  1Q7Y C;  4MMK A;  1IZ6 A;  4JRK A;  4DOV A;  2X4Y A;  2BS3 A;  5DM7 R;  2ZPF B;  2CKK A;  2QQS A;  4ZGD B;  3OQ5 A;  5J3B A;  4VUB A;  1VQP A;  5FU7 B;  3L1A A;  3G6E T;  5LJ5 j;  4NS5 A;  3JB9 J;  2XU8 A;  1I5L A;  4N0A A;  4HNU A;  1B34 A;  2E41 A;  4C8Q A;  4PJO B;  2DK3 A;  4MFD A;  3OSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...