2DPPB

Crystal structure of thermostable bacillus sp. rapc8 nitrile hydratase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLAFGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIPRREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratse
rcsb
source organism Bacillus sp. rapc8
molecule tags Lyase
total genus 62
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2dppB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dppB02
3WVEB 2DXCB 2DD4A 2ZCFB 1UGPB 2DPPB 2ZPIB 2DD4B 4OB2B 3QZ5B 2CZ0B 4FM4B 2CZ6B 2PU9B 2WSEE 1PSFA 2PVGB 3QYHB 2AHJB 1IREB 2QDYB 3X25B 1UGSB 4OB1B 1PSEA 2ZPEB 3HHTB 2O01E 3VYHB 2WSCE 2PUKB 1DJ7B 2CZ1B 3WVDB 3A8MB 2WSFE 1UGQB 3QYGB 3LW5E 4ZGJB 2DD5B 2DXBA 1AHJB 3VYGA 2ZPBB 2DXBB 3VYGB 4L6V5 2CZ7B 2ZZDA 3A8HB 3X20B 3A8LB 3A8OB 2ZZDB 1QP2A 2PVOB 2D0QB 4RKUE 2DD5A 3X24B 4ZGDB 4KT0E 3X28B 3X26B 1JB0E 4Y28E 2PVDB 2ZPGB 1UGRB 4ZGEB 1GXIE 5L8RE 2ZPHB 2CYZB 4OB0B 2ZPFB 2PUOB 3A8GB 4OB3B 4XK8E 1QP3A 2DXCA 3QXEB 3QZ9B 1V29B
chains in the Genus database with same CATH superfamily
2KNBB 1W98B 2DD4A 1X2KA 1VQ6T 1PHTA 4M7AB 3KUFA 5GAN4 4JJNK 2YT6A 1MNEA 5GAOl 1NPRA 4LN2A 3UWNA 1E7OA 1UDLA 3OYAA 1E6HA 3ZEHA 5IHIA 1GFCA 1WXTA 4M75D 1PKDB 2EW3A 3CEYA 3BHUB 4WCIA 3RMQA 1TSFA 3G4ST 1SPKA 2EWNA 3UT1A 3HL8A 2ROTA 1VIEA 1BCMA 4EOPB 3MEAA 5GJVB 3BDLA 1SEMA 1I5OB 2EFIA 2A3LA 3QWLA 2KRNA 3OSSC 4XTUA 3GNGA 1K9AA 1E6GA 2YXYA 2ZPEB 4DBRA 2O01E 5IXFA 1Q86U 3CCSQ 3VYHB 1D0YA 1VQLT 3O5ZA 5I11A 2DEUA 2VASA 4JRIA 2LCLA 3JCMh 4M7DF 1ZUKA 1BI1A 4MMKA 2KYMA 4JJDA 4EMKC 2EQIA 1N9RA 4PL6A 5LJ5d 5FU7C 4PJOB 5M9OA 2E10A 1EZZB 3EFSA 2DA9A 3S3MA 2RA2A 3M57A 3CCEA 4O5VA 1I1JA 1KXUA 3SEMA 5GAMe 1JQQA 1QKWA 2DKGA 1M3BA 4PJLA 4A4HA 4KRTA 3MY1B 2G6FX 2B8AA 4XU1A 2CGHA 2EAYA 3JCMc 8ATCB 1UHCA 3GLXA 3RMSA 3QYBA 3TW7A 2X4XA 3RDVA 2DZCA 4C92C 3CD6A 2IVXA 4FT2A 4MZMA 2RJEA 3PIPA 4J7IA 5HBHB 2O9VA 2HQHA 3HSBA 1M9SA 2I40B 4PK4A 4ZGEB 1LNXA 4XTXA 5CQXA 1K73C 2GTJA 3KBGA 4N4GA 4BCND 3EIDB 4PKCC 1FMVA 2AKKA 1XQHA 1T3SA 3GBQA 2QQ8A 2COWA 3CXCS 4AFUC 4BACA 3AHUA 3BG5A 3H9NA 4M77G 1M3AA 3QZ9B 5D7UA 3MY5B 4F7UE 4B9WA 2RB6A 4Y72B 4X9CA 3CCQA 3E1SA 1JKWA 2C6TB 2JGZB 3CPWA 2FYKA 3FC3A 2EIFA 4F16A 3OW2P 2CZ0B 1M5Q1 5GMKm 2L3SA 2SRCA 1YJ9Q 1UUEA 2XK0A 1G2BA 5CKFA 4M7AC 2CUBA 4DOVA 1VQOA 3ER0A 2KYBA 2QGSA 1PNJA 1WNLA 4BI8B 3MEWA 2GCXA 3I56T 4KRDB 1MUZA 2K2VA 2P4RA 1VQ4A 3CBMA 1SKUB 4PJMA 3OS5A 2IW8B 3C94A 4AKGA 1GFDA 2OJ2A 2UUEB 4M78G 3DJBA 5EFQB 1R77A 2J7IA 4E6RA 4B9XA 5GAOp 3POMA 4CFUD 3V8JA 3TQ7P 3DKMA 4BY6B 4IMYB 2P4TA 2QQRA 1T3LA 2BS3A 2KBTA 1VQMT 2KR6A 3HFNA 3JSCA 2BS4A 3A8HB 2HAXA 2VVKA 4WTOB 2JOYA 1X69A 5CIUA 3G6EQ 2O4XA 4BCHB 3HB9A 3CC4Q 4C8QA 4D6WA 4QW2A 4RKUE 4MFDA 5GMKe 4F6UB 3QHWB 2CKKA 1YJNQ 2A08A 2LJ3A 1U3OA 1VIFA 3M4GA 5KH6A 4IURA 3HRUA 1RAHB 5GAOq 2EKOA 1URCB 3V7RA 1PRMC 3EGXB 4YOZA 1KQ1A 3QSUA 1NLOC 3L2UA 3M4YA 4HNTA 3VKHA 3CC4T 3SDZA 3QDRB 2F1LA 4QVDA 3QHSA 1F5QB 5GAN3 2EGEA 3QJYA 2RQVA 1Q7YR 4R55A 1WHGA 2H8HA 2ZGWA 2RQUA 3EG9B 4RODA 2E6NA 4MMLA 2BZXA 3PVQA 1VQ7Q 4BBSM 2QEXA 3KFVA 3PFSA 1JJ2P 3OYFA 1PCXA 2D9TA 3GP8A 4M7DE 5GAMg 1U8RA 4M77F 2OTJA 1VQPA 2E5QA 1PSFA 2PVGB 3G1JA 2LNHB 5KYYB 4YC3B 1YHQQ 3UF4A 2K2MA 1AISB 2MWOA 5EG2A 2KRSA 4R0KA 3ULRB 2RI3A 1YWOA 3MCAB 2WSCE 4LOCA 1YP5A 3WVDB 2OTLT 1BIAA 1TU0B 2M0OA 1PD1A 4LD9K 2JTEA 5CKEA 3LGLA 2DJQA 1YITT 2DXBA 4QKUA 4M7DC 3CCVT 3G7ZA 1IXDA 3I35A 3OYEA 2QDJA 2FL7A 4M78F 1YFNA 5LJ5h 3L42A 1WHKA 1VQ8T 1IO6A 3F5XB 1OIYB 4OMFB 1Y07A 2ZZDB 2MAMA 5IHNA 1VUBA 1PM3A 1JU5C 2FRWA 4ELYC 5CAIA 3JRZA 1E9HB 4M75A 1JRIA 2F5KA 3CCJT 4BDZA 4MFEA 1AVZC 1G5VA 1WJRA 3PGGA 4RCCA 4M7DD 3OYIA 4FYXB 3RBBB 3X28B 2DL5A 2E65A 1Q86R 3G71T 4C92G 2HSEB 3JB9J 4A54A 2QYZA 3OYKA 4CXAB 1OYXA 1ZHIA 2ZPFB 5FWCA 2PUOB 2QA4A 1YWPA 1RAIB 2CT3A 3QWXX 3GTMS 3K7AM 2LDMA 2V26A 3SWNC 4ZN1A 1TUDA 1WGSA 4JX5A 2F5TX 4OMPA 3CC7T 2CSIA 1O9SA 4Y91A 3VUZA 1IHVA 4J9CA 1V29B 1FYNA 3L1AA 1YI2A 4BDYA 4A53A 3M5AA 3PE0A 3TW6A 6AT1B 3BE3A 3EHRA 4HL4A 5GANe 4BCGB 2ESWA 3OBWA 4UC4A 3QPHA 1RABB 2W2HA 2WIHB 1WQWA 4EMKA 4C0ZA 4XU2A 4M7AG 3H0IA 2WFYB 1QCOA 2QGFB 1I5LA 4AT1B 2XD0A 5L2WB 1M1GA 1NJIU 4NL3A 3TU4K 5C6SA 5J39A 1QLYA 2LC4A 2RO0A 2CZ1B 1KD1C 1X27A 2DK3A 2EBPA 2DVJA 3OQ5A 2HQXA 1M90U 4M78B 4IIMA 3QYGB 2I53A 5GMKj 2Y4YA 4DA4A 1D0ZA 2ZPBB 2EYWA 2RQWA 4C92A 2DEQA 4J9HA 1P5EB 5LJ3e 5I5ZB 5FU6B 2KK4A 4QT7A 1RI9A 1NYGA 4PJNA 2E70A 5GAN8 4BE1A 2VYTA 1QP2A 2PVOB 2VKNA 5LQFB 1H27B 2PMIB 2BS2A 4HVVA 2JZ2A 2DD5A 4PJOG 3X24B 1D1BA 3TSZA 4V2SA 5I22A 3EFOA 2A0FB 5GAN2 4M77E 3CD6Q 3CCET 1ZSGA 3OYHA 2DZ9A 5L8RE 3RUXA 3NHNA 1UJYA 4RG2A 1EIFA 1M2VB 1OI1A 1ZP2A 1R0CB 4C92F 4BY1X 4KUIA 4RTXA 1OPLA 5C0MA 5ECAA 1VQKQ 3JCMX 2HQEA 4M7AA 3NDQA 2GTOA 2XMFA 1OX8A 2RPNA 1W2BS 1Q82R 3META 2W0ZA 5A2QE 4BCQD 2M0YA 1K8AU 1X01A 1NM7A 2GBQA 1Y96B 1SHFA 2QGGA 4OVAA 5L23A 3OYYA 2CUDA 1GUXB 1VQ5Q 4OMOA 2HL3A 2WSEE 2JJ9A 4M77C 2GQVA 4DQ2A 2LQWA 5KYWB 2KROA 4F7UA 4LD6A 2ABLA 2V22B 2NUTB 1KIKA 2CP0A 2V1QA 1VYTA 1Q81U 1OGUB 1VYUA 4PNOA 2X4WA 3CCQT 2CP7A 4HXJA 3DB3A 5D6WA 4PLLA 2YUQA 4OGCA 4C8QD 3I55T 3M55A 2FPDA 4M77D 2L8DA 4HA8A 1AHJB 1H28B 1OV3A 1QWFA 1ABOA 4KULA 1QQJA 1YIJA 1VQOT 1H3ZA 1OKVB 3CXCP 4EOQB 3X20B 1VQ4T 4M78C 4M4ZA 2V8JA 1M1KR 4KH0B 3EGUA 2PNIA 3R6OA 4LNPA 2WXVB 1QVFP 1M3CA 4J5YA 2VGNA 2QQAA 4RG8A 5GANg 5HBJB 2RJFA 3E9GA 3JCMQ 3E19A 2M16A 5FU6C 5HVYB 2O88A 1M8VA 4FT4A 2D0NA 4LE9A 2G9XB 2CCHB 2BE7D 1M1KC 5D6YA 2AZVA 4OF1A 4OGRB 4PJOF 2X35A 4R56A 1NEBA 5CKBA 5GANj 2QFZA 3A8GB 4BCNB 2JS2A 2M1HA 3H0FA 5IHYA 1QKXA 2XDPA 4JX6A 4A4GA 1UG1A 2C5XB 1ZBJA 3M58A 4KGXB 2KMTA 1IB8A 2NUPB 1K9MU 1UNGD 2HZYA 3QWYA 4X34A 2K57A 4E7JA 2WIPB 2LT1A 4G6LB 5LJ3g 3QZ5B 1VQNT 2QEXQ 3CCLA 1OKWB 1MHNA 2X1NB 2FVUA 2OTJQ 1VQPQ 4JUVA 2QI2A 3MI9B 1BK2A 1WA7A 4M7DA 2K5LA 3EGDB 3OYDA 5LJ3j 3JB9G 2R58A 2ATCB 4ANJA 3VKGA 3RIRA 4LDYA 4C0DC 4E7KA 4EOOB 1NBEB 1UE9A 2JTMA 4J8OA 2DO3A 1VQPT 3C4SA 1UEBA 3ZBDA 2UZBB 1QMCA 1YCYA 2V1RA 1WI7A 5KCHA 2FPFA 2DTIA 1GH6B 1U06A 4J9GA 1Y57A 3NGPA 2Y90A 5FRMA 2BIVA 3A8LB 4C92E 3OMCA 2AK5A 1TH7A 2JVVA 4JJCA 1M27C 1OPKA 2LVMA 2A28A 2LJ1A 3SHWA 3SWNA 3OW2A 2YRDA 2MF2A 5FWBA 1NJIR 3EGXA 2MPXC 4RTYA 3C0CA 3M53A 2IN3A 3ME9A 3CCST 1A0NB 2ZPHB 5LMKB 4JDSA 4DOWA 1R8OB 1M90R 3CBOA 1RACB 2K5FA 3FIFA 1QVGA 2BE9B 4E7SA 1KQSS 2E1HA 2WJ9A 4F7LB 4RTZA 2X4YA 1UJ0A 3PMIA 1G8XA 1X6BA 2QA4Q 5GAMf 3BG3A 1N5ZA 3DOGB 4IIOA 4HCCA 1WLPB 3SFMA 5DQVA 4AKIA 1RUWA 3CCUA 4BCIB 4XAXB 2IG0A 4F6SB 4M7AE 2BPMB 3GPLA 1YI2Q 3DDPB 2ECZA 3VS6A 2LZ6B 4F7JB 3M0UA 4FM4B 2CZ6B 2IVWA 1NLPC 5KYYA 2QA4T 1SSHA 1WJSA 1VQKA 4EOIB 1RAGB 4N0AA 4EOKB 5GAOn 4DBFA 4NC6A 1NPPA 1B34A 1Y0MA 4II5B 4C92D 4EOMB 3X25B 4E7HA 4M6VA 1YI2T 3RESA 4Y92A 1QVFS 4J9EA 1VQ5A 1WIEA 2L5QA 3MEUA 1ZBXA 1N6AA 1QVPA 2DIGA 3EG1A 4BI4A 3JB9F 1X2QA 2RQRA 1TXQA 2R5MA 4PJOE 1K8AR 2E3HA 2HBPA 3MP8A 1S72A 4O6JA 2A7YA 3TNWB 2ZZDA 2DNUA 5GAMd 4KBMB 4BCFB 1YJ9T 4J9IA 3BDUA 1V76A 2C5NB 2EJ9A 3IQLA 2O31A 5GMKl 3M0TA 5EJCA 1Q81R 3PT9A 3EAEA 4M7AD 5HQ0B 1Y71A 3LLRA 3CCMA 2HMAA 1KJWA 2G77A 2ZPGB 1VOLA 3F70A 3CCRA 4CFMB 1YJWQ 2RHXA 2K5IA 4DBHA 3TNIB 1B7TA 4OB3B 4PJOC 2K79A 4FCYA 5LJ5j 1QW1A 3EJ1B 4JS5A 4M77A 4HT9A 3V8KA 4KRCB 4F7NB 2RJDA 4BCMB 1FXXA 4PFPA 2GF7A 5CO7A 1HK9A 1GCPA 2QQSA 2I2LA 4XTWA 3G6ET 2YUOA 4JX4A 1JBMA 1PG5B 1SF9A 1QCFA 2JW4A 5KE2A 3RKWA 2MYSA 1N8RU 4DEYA 1H1PB 2KAFA 4CC3A 1YJNT 2CP3A 3DLMA 2M9UA 5IXBA 4F14A 4Z88A 4RMOA 2DL8A 1KFZA 2DTHA 3HHTB 3CMEA 1OZ3A 1BKBA 1Q7YC 3H0HA 2X3XD 1IZ6A 5I21A 1DJ7B 2B9RA 4M78A 3VU3C 2FO0A 4HCBA 1QWEA 1ZSZB 4J83A 2LX9A 3PMTA 1B3QA 4WF2A 1K9MR 4C5EA 2EQJA 1VQ6A 4CRIA 4A4KA 1VQ7T 1C9BA 3ASKA 4JZ4A 4I3ZB 2IW6B 5HK3A 1UFFA 1YIJQ 2KXDA 4CRLB 2F69A 1TOVA 3G4SA 3HBLA 1VYVA 1W2BP 2D8HA 2QTXA 1KC8U 1H26B 4ELJA 3TVTA 4EC9B 2NLUA 1YHQT 1VINA 3H4CA 2WMAB 2F2XA 2RHIA 2O2OA 1D1AA 1RL2A 3JCMW 3Q1JA 3JCMP 1YIJT 5CVIA 5GMKi 1QCNA 5D6XA 4Y28E 3HRTA 2KRMA 2M02A 3O8VA 3UPUA 2CH4A 3L2RA 4JRPA 1VQLA 4OMNA 1ZUYA 1P92A 2AT1B 2PK9B 2NWMA 2YWWA 4B6MA 1FMKA 3JAME 1WXUA 3VS3A 5KYUB 4BY6C 3BHVB 3VS1A 4E7ZA 3QXEB 1K1ZA 2VXEA 2RF0A 2FG0A 3OYGA 4RTTA 2DRMA 1NEGA 3P8HA 2X51A 1UGPB 1MV3A 2EJGA 2DE0X 1I07A 4ELLA 5CYIB 2LRQA 1XTDA 2V8KA 4BCJB 4LDWA 1HYOA 5KYWA 2OX7A 2PU9B 2ROLA 3B57A 4NOYA 2JMAA 2QK0A 1Q86C 2X3WD 3EG2A 3CCLQ 3J7AF 1ZA1B 1D3BB 4CC2A 1MMNA 1KK7A 3BHTB 5GAOr 1BYMA 1FVVB 2P0QA 2DETA 3JCMe 3OYJA 3CQTA 1IRXA 3VS0A 1H3HA 1TUGB 3UATA 2QAZA 2CSQA 4BBRM 4EOJB 4GY5A 2YRVA 2E4HA 1QVGS 1BIBA 5FRNA 4NS5A 4N4HA 3M54A 1N27A 1NYFA 4C8QB 3S6WA 1O75A 2RHYA 3VS7A 1OEBA 1ABQA 3QG1A 1PC0A 3J80E 4XTYA 1WZOA 2HKNA 3HFOA 1IHWA 1AWJA 3ZFJA 2L3PA 1R0BG 4AG1C 4NL2A 1AD6A 2LW4A 3DDQB 4HNVA 1WPYA 1ZSZC 3QKJA 4AFZC 1RAEB 2UZEB 3LYIA 1RLPC 2B86A 5CKHA 1MMGA 3L2ZA 1VA7A 4N0AC 2RK2A 1PRLC 7AT1B 5GAMh 1D0XA 3CC2Q 2J6KA 4OMQA 2IW9B 3KHIA 4EOLB 1ZX6A 1N9SA 3EFRA 4F6WB 4OMLA 3JB9D 5IHKA 5I2MA 2RMOA 4HT8A 1CKAA 2DJZA 3E9FA 4D8DA 2OAWA 3MHXA 4UN0A 3LH5A 4OB0B 3REBB 3CMAQ 1HJDA 3HKSA 3CPWS 2ZAEA 5LJ3f 4Z6YA 1K73U 3C12A 2C0OA 1WXBA 2JMCA 1U1SA 1VQMA 2QXFA 4K11A 1YJWA 1G3NC 1GBRA 4XQ3A 1Z9QA 3RERA 4HCZA 3CCUQ 5A0GA 5CQYA 4AKHA 3JCMJ 3FEOA 4RTUA 4D8KA 5KYXA 5IH2A 2C06A 4CFVB 2EYZA 1MNDA 3C95A 2DIQA 1IREB 1S1NA 4YOSA 5J3BA 3EGDA 2XG8D 3CD6T 1MV0B 2X9HA 3A5ZB 1C1AA 3URGA 2LNVA 3CCUT 1PSEA 2E3IA 1K76A 5IN1A 1MGQA 3RKXA 1I81A 3H41A 2PZ1A 4J6YA 3PO3S 2OI3A 2H3JA 4M75B 1VQKT 2UZLB 2DMOA 4P5NA 4M78E 4GLMA 2JUFA 3PTAA 1KQSP 3TREA 2W9FA 1Q82C 4IKFA 4J9DA 4QQGA 2COZA 3L2WA 1O9KB 4ORZA 5LJ3d 4MIMA 1W6XA 3QYEA 1SHGA 3OA6A 1N8RR 2PJQA 1H1QB 1GCQC 1YCSB 1EFNA 1S72Q 2RD1A 3REAB 1VQ5T 2J06A 4J9FA 1X6OA 3OB9A 5FW9A 1H4LD 1NZ9A 1YNZA 2JT4A 5ACBA 4PJOA 4OR5B 4BCPB 3MKDA 1H1SB 3LWIA 1I8FA 1WHLA 2PVDB 3LWHA 2XKOC 2RHUA 5AYFA 1UGRB 5GMKh 2DF6A 2MK5A 3CCMQ 1KHCA 3BY7A 1T0HA 3JCMg 2OTLA 4BUGA 3CCRQ 3MEVA 4A4FA 2C5VB 1RAFB 1YITA 4AMCA 1QP3A 3CCVA 1K0XA 2RI5A 3VS5A 1AZEA 1H641 4ROCA 4EMKB 1VQ8A 2EYXA 2YHTA 2DPPB 1N4MA 1FX7A 2RQTA 5FU7B 5IAYA 1FMWA 4OB2B 4KH1B 4EONB 2FZKB 2K3XA 1M30A 1G3WA 4M78D 3ZL7C 1U5SA 3EH1A 2DBKA 3QDFA 4ESRA 1OULA 1X6GA 4J6XA 2BUDA 1LVKA 4ELZC 1AWOA 3BG9A 2LP5A 2KEAA 1NG2A 1WYXA 2YUNA 2YLBA 3G71A 5LL6S 2BKDN 2K3YA 4FSXA 4LUDA 1LJOA 4Q5WA 3JCMV 2EKHA 2DLPA 3MP6A 2KGTA 4ZNXA 2D8JA 5GJWB 3CMEQ 3RR6A 2D1XA 5LJ5e 3CC7A 3SD4A 4FX3B 2FRYA 1SG5A 2RHZA 3EH2A 2DD5B 4F7SB 2MI6A 3FDRA 2WPAB 4J6WA 1H1RB 4CFXB 4EIKA 3EFOB 1GRIA 4DBQA 5GAOm 4EORB 1TD6A 1VQ6Q 4HCKA 4JRKA 5FGKB 2F2VA 4CC4B 1B07A 2HL5C 1XOVA 2KY9A 2QEXT 1AWWA 2OAUA 2VUBA 3BW1A 1I0CA 1IGQA 2KT8A 4C5IA 1BU2A 2HNIA 3VKIA 3OSVA 2OTJT 1AT1B 2FHDA 2RN8A 3G4SQ 3KXTA 2YRCA 2GNCA 4CI0C 1JOWA 4CFUB 3QIIA 3X26B 2C0TA 2LJ0A 4JS4A 5AT1B 2FEIA 1FINB 2E12A 4FYYB 1LPLA 1KHIA 2JM8A 1VQLQ 3CC2A 5CEIB 4ZTJA 3L2VA 3PIOA 3O0GD 1LCKA 2XIDA 4RCBA 1HSQA 4KUDK 1C0MA 5GAN7 4F7UB 5HNBB 1OU8A 2VV5A 2LT4A 2ZPIB 3CMAA 5CKDA 2C4GB 2K9GA 3NTHA 1PD0A 4JRQA 4BXXX 1PKTA 4XTZA 3P8DA 3BLHB 1D1CA 1ENWA 3VRYA 1NJIC 1UHFA 4EC8B 3EG9A 2XI9A 3QYHB 2E5KA 5GANh 2RH2A 2DVEA 3LX7A 1M90C 2EYYA 2G3RA 4OP0A 4QVCA 1Q95G 2LCSA 4LDVA 1ZSZA 3DL1A 3VJPA 3U23A 1K73R 4VUBA 2NYSA 2A36A 4RUGA 2ED1A 2DXUA 2HDAA 4EOSB 2BZYA 3LW5E 3E2UA 2MOXA 2F2CA 3R6NA 2YDLA 3EG0A 2CP2A 1H8KA 1VQ9A 1TTHB 3VYGB 1KD1U 1QMZB 1G83A 1TG0A 1G3YA 2KE9A 1V1CA 2DTOA 2XDDA 3T9NA 2Z0WA 3S3OA 4X1VA 5LJ3h 4C8QG 1TUCA 1ZQ1A 3VRZA 3N5BB 5HKCA 1Y7XA 4KT0E 4KGVB 4FW1A 4N4IA 2R5AA 4TTHA 3S3NA 4AFQC 3I56Q 4C5HA 2XICA 2VGMA 3THKA 1G3SA 1PWTA 5KYUA 3I55A 4FL6A 1K0SA 2J05A 1CKBA 2QG9B 4KGZB 3M0PA 3PVLA 2X4JA 4C0GA 2BKZB 4BB7A 3MIAB 1JJ2A 5HBEB 2R7GA 1K8AC 4GLKA 2K4YA 3VUBA 3M03A 5LJ5g 1QVGP 3INZA 2DXCB 2F2WA 5BNJB 2E6ZA 2CP5A 2PQWA 1CSKA 1RI0A 3FLGA 3OYCA 2LQKA 4L5GA 1GL5A 2DD4B 4M7DB 2DAQA 2XU8A 2SEMA 2FZCB 2IPOB 2GFAA 1VQMQ 2L89A 4YOOA 2KR3A 1Q81C 2HKQB 2CCIB 5DLQE 2BZ8A 2PHGA 1D3BA 2L0AA 3WXMB 1WX6A 3HRSA 4J9BA 4XU0A 3UA6A 1M2OA 2LX7A 4FYVB 3DLLA 4F70B 1W2BA 1YBYA 5HY6A 1AWXA 1OI9B 1YJWT 3V7CA 1UNLD 3H8ZA 2KT1A 5I2SA 4FYWB 1J3TA 2PUKB 1Q82U 1KQ2A 4II1A 3P8BB 1GCQA 1FWZA 2CDTA 3UA7A 2JS0A 2DYIA 1M4ZA 4PJOD 2MMPA 5IF1B 1MMDA 2EQUA 2FB7A 3H6ZA 2GGRA 3CPWP 4ROEA 4BCOB 4QSHA 3SWNB 4RTWA 4BE2A 1WJQA 4ME7A 9ATCB 2AKLA 5KYNA 1VQNA 4JZ3A 4BI3A 2E41A 4HLQA 2KDSA 4HVUA 1D3UB 3JB9I 2QQ9A 3EG3A 2C0IA 3M56A 1VYWB 4M75G 5IT9E 3M0RA 1D09B 3A98A 2LTOA 4E7IA 4ZGDB 2BTTA 2K3BA 1Z9ZA 5GAN5 2HCKA 2EUFA 3D7SB 1LOJA 2DL4A 1HXDA 2YUPA 4OMMA 5FLXE 3BLQB 4C8QF 3QUIA 1GXIE 5KCOA 1BBZA 1WQ7A 2J6OA 5CCAA 2DERA 2Y4XA 4AG2C 1ZA2B 1QLBA 2E64A 4J7FA 1K9MC 2XHCA 1RADB 3QHRB 4JLIA 2OTLQ 4IUUA 3LH0A 1M1KU 2EGAA 2RM4A 3NTIA 2KXCA 2RI2A 3AT1B 1NE8A 2JNGA 2KSSA 1PKSA 3WVEB 2CT4A 5HCKA 2A37A 1YITQ 3NMZC 3CCVQ 4A63B 2ZCFB 1B34B 2YSQA 2IIMA 1K4US 1OL2B 5GAMj 2DRKA 1OX9A 1JSTB 4PFOA 1X43A 1BI2A 1VQ8Q 3I9QA 4HNUA 2COYA 1M2VA 2PK2A 2L3RA 3JCMb 5DLOA 2CJMB 4A4EA 3CCJQ 1UNHD 1WHMA 1WFWA 3UDCA 5CK9A 1JO8A 1OL1B 1RAAB 3CCSA 3G71Q 2KMGA 4OB1B 3GIBA 3OMGA 1Y96A 3TEEA 5IDNB 3HO8A 2DL3A 4FW2A 1GUXA 4BCQB 1RLQC 2JXBA 2VXFA 1UTIA 4QQ6A 3TNHB 2FZGB 2JTFA 4CC7A 3G33B 3A8MB 2WSFE 4OGEA 3M9QA 4C0FA 4LDUA 3LQ5B 2VWFA 1BI3A 3CC7Q 2NUTA 4YTLA 1O9KA 3HZJA 3RGFB 3OW2S 4L6V5 1WDXA 3QBYA 3OS0A 2CZ7B 2UZDB 2LQNA 3FB9A 3DTOA 3EHQA 1ARKA 2CS7A 2GFUA 5ICPB 2EQMA 2W10A 3OYLA 2O4XB 2WEVB 3CCLT 4MZTA 4Z8AA 2QDLA 3JCMf 4BCMD 4EMGA 1OIUB 4M77B 1U1TA 1OU9A 4PLIA 4LDXA 5GANf 1SSFA 4RTVA 5HK0A 1E7PA 2ENMA 2EYQA 4M75F 2HSPA 2I0NA 5A0LA 4L59A 2EQKA 5CR2A 3OS1A 1JXMA 3OY9A 2CH4W 1BB9A 1XJWB 3CBPA 3GF5A 1KD1R 4F04B 3I5SA 1T0JA 3M0SA 1XNIA 1WHJA 1W70A 2FPEA 1H92A 3I56A 1OQKA 4FSSA 1WHHA 2KVQG 5DY9A 1YJ9A 1TWBA 2KI7A 4JLGA 1KQSA 1OOTA 3NTKA 1JXOA 1JSUB 4LUEA 4HKEA 4QVZA 3CC2T 2AZSA 2QTVA 1ACMB 2ED0A 3HPWA 4IUPA 4F7UG 2AHJB 2NUZA 3FRNA 3GOXA 1FKMA 2DM1A 2V8IA 1UGVA 2QDYB 2NUPA 3TSWA 2P0KA 4EDUA 5EC7A 2DYBA 4F17A 2CREA 2LMJA 4ATOA 1SRMA 1VOMA 1UGSB 4Z02A 4GBQA 4FIBA 3CMAT 3CCEQ 3JCMd 4CFNB 3I5RA 3JV3A 1GY3B 2DXTA 1W1FA 3CXCA 5GANd 4ZGJB 2W9ZA 1BI0A 1UECA 1JJ2S 2MWPA 4C8QE 5J26A 4JJBA 2HBWA 3DB4A 1H24B 2DXBB 3MO8A 1QVFA 2WACA 1MMAA 1VQ9Q 2J6FA 2WHBB 3G6EA 5GAN6 4BCKB 2MCNA 3CC4A 2O9SA 5KE3A 1KSWA 1AD5A 4Z89A 2P84A 1KG1A 4E2FB 1YJNA 1G3TA 1UB4A 2D0QB 2HD0A 4XTVA 2XDBA 1AEYA 4HVWA 2DMEA 4X9DA 3TN8B 2P0PA 1VQ9T 3V7SA 2K6DA 4MZPA 1XO2A 4BD3A 3NFCA 1TS9A 4DEXA 2RNAA 2WMBB 4PJJA 2CYZB 2YLCA 4C5GA 4BE0A 4C8QC 1I4K1 4PFZA 2KQWA 2GQIA 3CCQQ 4C0DB 2H3EB 3I55Q 2EGCA 4ZTFA 1VQ7A 1GBQA 4NSTB 3MPUB 1SRLA 1W4SA 4IUTA 4QQDA 5DM7R 1N8RC 3JB9H 1VQOQ 2JN0A 1HD3A 4E47A 2RK1A 1S72T 3VS2A 1BCOA 2DILA 1VQ4Q 3HP9A 1YN8A 3FJ5A 4M7AF 1YHQA 1BU1A 4AFSC 3M59A 4TVRA 3VV0A 2VB6A 2M51A 3OS2A 2DX1A 4MDXA 2EPDA 2DL7A 2QF7A 3OBYA 2W96A 1EX4A 4LXCA 3BFMA 4M7DG 3CCMT 1F1BB 2DFUA 3OYMA 4IUQA 3CPFA 3V8LA 3CCRT 2MIOA 1H25B 3TCJA 2RJCA 4F7UF 5DQWA 2W99A 2PTKA 3MP1A 1TFBA 1KC8R 1C6VX 1AOJA 3BLRB 4E7LA 3CCJA 2L3QA 1M8MA 1UGQB 3QJ6A 2LCCA 1Q7YU 3VYGA 1X75C 4M75E 2K7AA 3HTRA 2EJFA 3SB2A 3MJXA 4AI6A 4ZN3A 1ZUUA 1KC8C 3EOCB 4C92B 4EPCA 4CFWB 2C5OB 3FJPA 3L2QA 2QASA 3OYNA 1OZ2A 3A8OB 3M0QA 4BY7X 1VQNQ 1IGUA 3GNFB 3NPFA 5A0DA 2JM9A 3PNWC 3OYBA 1JEGA 2HEQA 3VS4A 2LQ8A 4JPBW 3J81E 2DBMA 1AZGB 2VC8A 2AIRB 3RKYA 1JB0E 2CP6A 3QO3A 4MDWA 3RNJA 5IDPB 1M1FA 5LJ5f 3LGFA 2QQBA 3A1PA 4FU6A 3CMET 4M75C 2L2PA 1ZLMA 8AT1B 4XK8E 4IUVA 4EMHA 5KYXB 2DXCA 2EVRA 4XU3A 2D6FA 5FROA 2R57A
chains in the Genus database with same CATH topology
2HQEA 4M7AA 3OYGA 3INZA 2DXCB 2DD4A 2E6ZA 2PQWA 3P8HA 1UGPB 1RI0A 3FLGA 1VQ6T 4M7AB 3KUFA 2LQKA 4L5GA 3OYCA 2EJGA 2DD4B 5GAN4 4JJNK 1W2BS 4M7DB 2DAQA 2XU8A 3META 5A2QE 5GAOl 1NPRA 3UWNA 2LRQA 2GFAA 1X01A 1K8AU 2L89A 1XTDA 1Y96B 3OYAA 4OVAA 2V8KA 3OYYA 3ZEHA 4LDWA 4M75D 2PU9B 1Q81C 2WSEE 3CEYA 5DLQE 4NOYA 4M77C 3RMQA 3G4ST 2GQVA 2EWNA 1D3BA 3UT1A 4DQ2A 3WXMB 3HL8A 1Q86C 3HRSA 1VIEA 4F7UA 3MEAA 4XU0A 3J7AF 3BDLA 1D3BB 4LD6A 3DLLA 1W2BA 1YBYA 5HY6A 5GAOr 1BYMA 2EFIA 2P0QA 2A3LA 3QWLA 1Q81U 3OSSC 4XTUA 3GNGA 3JCMe 3OYJA 1YJWT 3V7CA 3H8ZA 4PNOA 2ZPEB 2O01E 1Q86U 2X4WA 5I2SA 3CCQT 3VYHB 3DB3A 5D6WA 4BBRM 4PLLA 1VQLT 2PUKB 1Q82U 1KQ2A 4GY5A 4II1A 2YRVA 3P8BB 4JRIA 4OGCA 1FWZA 1BIBA 2LCLA 4NS5A 4C8QD 4N4HA 3I55T 1QVGS 5FRNA 3M55A 3M54A 3JCMh 4M7DF 1M4ZA 1N27A 1BI1A 4MMKA 4EMKC 4PJOD 4M77D 4C8QB 3S6WA 2MMPA 1N9RA 2L8DA 1O75A 2RHYA 4PL6A 5LJ5d 2EQUA 4HA8A 1AHJB 2FB7A 3H6ZA 4KULA 5FU7C 3QG1A 5M9OA 2E10A 1YIJA 1VQOT 3J80E 4XTYA 4QSHA 3SWNB 1H3ZA 3EFSA 3HFOA 3S3MA 4BE2A 2RA2A 3M57A 3ZFJA 3CCEA 4O5VA 4NL2A 1WJQA 4ME7A 5GAMe 4HNVA 1WPYA 2DKGA 1VQNA 3QKJA 4A4HA 3X20B 1VQ4T 4M78C 4BI3A 2V8JA 2B8AA 2E41A 4HLQA 3LYIA 4XU1A 2CGHA 5CKHA 2KDSA 3L2ZA 3JB9I 3R6OA 2EAYA 2QQ9A 3JCMc 4N0AC 3GLXA 3RMSA 4J5YA 2RK2A 3QYBA 2VGNA 2QQAA 3M56A 3TW7A 4M75G 2X4XA 4RG8A 5GAMh 5GANg 2RJFA 3E9GA 5IT9E 3JCMQ 2DZCA 3E19A 3KHIA 2LTOA 4C92C 2M16A 4E7IA 3CD6A 4ZGDB 5FU6C 1M8VA 4FT2A 1N9SA 4FT4A 3EFRA 4MZMA 2RJEA 5GAN5 3PIPA 3JB9D 5I2MA 4J7IA 1LOJA 4HT8A 1HXDA 2DJZA 1M1KC 3E9FA 3HSBA 5FLXE 1M9SA 5D6YA 4ZGEB 4C8QF 1LNXA 3QUIA 4XTXA 5KCOA 5CQXA 1K73C 1GXIE 3MHXA 1WQ7A 4OF1A 3KBGA 4OB0B 4N4GA 4PJOF 2X35A 4R56A 5CCAA 3HKSA 5CKBA 4PKCC 2Y4XA 5GANj 2QFZA 3A8GB 3CPWS 1QLBA 1XQHA 2E64A 4J7FA 2M1HA 1K9MC 2XDPA 2XHCA 4JLIA 2QQ8A 4JX6A 3LH0A 4IUUA 4A4GA 1M1KU 5LJ3f 3CXCS 4Z6YA 4BACA 3AHUA 2RM4A 3M58A 3BG5A 2RI2A 3NTIA 4M77G 1K73U 3QZ9B 1NE8A 2KMTA 3C12A 2JNGA 2KSSA 3WVEB 2ZCFB 1B34B 1U1SA 1VQMA 2QXFA 4F7UE 1YJWA 1K9MU 5GAMj 4X34A 4B9WA 2RB6A 2K57A 4XQ3A 1BI2A 4X9CA 3CCQA 4E7JA 3RERA 2LT1A 3E1SA 3CPWA 5LJ3g 2FYKA 4HCZA 4HNUA 3FC3A 3QZ5B 2EIFA 1VQNT 5A0GA 2L3RA 2CZ0B 1M5Q1 5GMKm 5CQYA 4AKHA 3JCMb 3JCMJ 3FEOA 3CCLA 5DLOA 1MHNA 2C06A 2XK0A 2FVUA 4A4EA 5CKFA 4M7AC 3C95A 2QI2A 4JUVA 4DOVA 1VQOA 2DIQA 3UDCA 1IREB 5J3BA 3ER0A 2XG8D 5CK9A 3CD6T 4M7DA 3A5ZB 2K5LA 3CCSA 3URGA 1WNLA 2LNVA 3MEWA 2GCXA 4BI8B 2R58A 5LJ3j 3OYDA 3I56T 2KMGA 3CCUT 4OB1B 3VKGA 1PSEA 2K2VA 1VQ4A 3RIRA 3GIBA 3CBMA 3OMGA 4LDYA 1Y96A 3TEEA 4C0DC 4E7KA 5IN1A 3OS5A 3HO8A 1MGQA 3RKXA 3C94A 4AKGA 1I81A 4M78G 2JTMA 2VXFA 2DO3A 4J8OA 3C4SA 1UEBA 2JTFA 4QQ6A 3ZBDA 4B9XA 5GAOp 4J6YA 1YCYA 3A8MB 2WSFE 4OGEA 3M9QA 2H3JA 4C0FA 4M75B 1VQKT 4LDUA 4P5NA 4M78E 3V8JA 1BI3A 2JUFA 3DKMA 3PTAA 4BY6B 3TREA 2P4TA 4YTLA 5KCHA 1Q82C 4IKFA 4M7DC 3HZJA 4QQGA 3OW2S 4L6V5 2QQRA 2DTIA 3QBYA 3OS0A 3L2WA 2CZ7B 2BS3A 2Y90A 1VQMT 2KR6A 4MIMA 3FB9A 3QYEA 2BIVA 3HFNA 2BS4A 3A8HB 3JSCA 5LJ3d 3OA6A 2HAXA 5FRMA 3A8LB 2CS7A 4C92E 2JOYA 2GFUA 3OMCA 2RD1A 5CIUA 1VQ5T 1TH7A 2EQMA 2JVVA 2O4XA 3OYLA 3HB9A 1X6OA 3OB9A 1NZ9A 4C8QA 4D6WA 2LVMA 2O4XB 4QW2A 4RKUE 4MFDA 4MZTA 3CCLT 5GMKe 4PJOA 2CKKA 3JCMf 4EMGA 3SWNA 3OW2A 1VIFA 3M4GA 5KH6A 2MF2A 4IURA 3HRUA 4M77B 5GAOq 2EKOA 1U1TA 3VUBA 4PLIA 1I8FA 3LWIA 3V7RA 2PVDB 3M53A 5GANf 4LDXA 3LWHA 3ME9A 1SSFA 2XKOC 2RHUA 5AYFA 5HK0A 1UGRB 1E7PA 5GMKh 2EYQA 1KQ1A 3CCST 4M75F 3QSUA 1KHCA 2ZPHB 3BY7A 4JDSA 3L2UA 4DOWA 5A0LA 3M4YA 1R8OB 3JCMg 4HNTA 2EQKA 2K5FA 3CBOA 3FIFA 4L59A 4BUGA 3VKHA 3MEVA 5CR2A 3SDZA 3QDRB 4A4FA 3OS1A 3CC4T 1KQSS 4QVDA 3QHSA 2E1HA 5GAN3 2WJ9A 3QJYA 3OY9A 4R55A 1YITA 2X4YA 3CBPA 3PMIA 1QP3A 3CCVA 2ZGWA 3GF5A 5GAMf 2RI5A 3BG3A 1H641 1VQPT 4HCCA 1XNIA 2E6NA 3SFMA 4MMLA 4EMKB 1VQ8A 2YHTA 4AKIA 3I56A 3CCUA 2DPPB 4XAXB 1FX7A 4BBSM 2QEXA 5FU7B 2IG0A 5IAYA 2KVQG 3PFSA 4M7AE 3OYFA 4OB2B 5DY9A 2D9TA 3GPLA 4JLGA 1YJ9A 3GP8A 1KQSA 4M7DE 2K3XA 5GAMg 1U8RA 4M77F 1G3WA 1VQPA 4M78D 2OTJA 2E5QA 3NTKA 4FM4B 2CZ6B 2IVWA 3QXEB 4HKEA 2QA4T 4QVZA 3CC2T 1WJSA 1PSFA 1VQKA 4J6XA 2PVGB 4N0AA 2BUDA 3HPWA 4IUPA 4ELZC 3BG9A 2AHJB 3FRNA 4F7UG 5GAOn 1FKMA 3GOXA 4NC6A 1NPPA 2MWOA 2YLBA 2V8IA 5EG2A 3G71A 2RI3A 1B34A 5LL6S 4C92D 2QDYB 2BKDN 3X25B 2P0KA 4EDUA 2K3YA 4E7HA 4FSXA 4M6VA 1YI2T 4ATOA 1LJOA 1UGSB 4Q5WA 4Z02A 3RESA 3JCMV 4FIBA 3CMAT 1QVFS 3MP6A 3JCMd 1VQ5A 3MCAB 2WSCE 4LOCA 2DXTA 2L5QA 3MEUA 3WVDB 1ZBXA 2OTLT 1BIAA 3CXCA 1N6AA 2M0OA 5GANd 3CC7A 1QVPA 5LJ5e 4LD9K 5CKEA 2DIGA 3LGLA 3SD4A 4BI4A 3JB9F 2RHZA 4ZGJB 1YITT 1BI0A 4PJOB 2DD5B 2DXBA 2MI6A 1JJ2S 3CCVT 2MWPA 3FDRA 3G7ZA 4C8QE 4J6WA 5J26A 3DB4A 2DXBB 2R5MA 3MO8A 3OYEA 2HBPA 5GAOm 2WACA 3MP8A 2QDJA 2FL7A 1QVFA 4M78F 1S72A 4O6JA 5LJ5h 2A7YA 3L42A 3G6EA 5GAN6 1QVGA 1VQ8T 4JRKA 2ZZDA 5GAMd 2QEXT 1XOVA 2KY9A 3CC4A 4OMFB 4KBMB 1Y07A 5KE3A 2OAUA 2ZZDB 2MAMA 2VUBA 1YJ9T 3BW1A 1KG1A 4C5IA 3BDUA 1VUBA 1YJNA 4ELYC 2HNIA 5CAIA 3VKIA 3OSVA 2OTJT 1G3TA 1UB4A 2D0QB 2EJ9A 2FHDA 3JRZA 4M75A 1JRIA 2F5KA 5GMKl 2HD0A 4XTVA 4MFEA 3CCJT 4BDZA 2XDBA 3KXTA 5EJCA 2VXEA 3PT9A 4X9DA 4CI0C 3EAEA 4M7AD 1G5VA 1WJRA 1Y71A 3PGGA 4RCCA 4M7DD 2P0PA 3LLRA 3OYIA 3X28B 2E65A 3QIIA 3X26B 3V7SA 4MZPA 3CCMA 3G71T 4C92G 4BD3A 2G77A 2ZPGB 3F70A 3NFCA 3CCRA 1VQ9T 3JB9J 4A54A 4JS4A 3OYKA 1OYXA 1ZHIA 2RHXA 2CYZB 2YLCA 2E12A 2K5IA 4PJOE 2ZPFB 4C5GA 4BE0A 4C8QC 1I4K1 2KQWA 2PUOB 2QA4A 3CC2A 1KHIA 4OB3B 4PJOC 2LDMA 4C0DB 4ZTJA 5LJ5j 3L2VA 4ZN1A 3SWNC 1QW1A 3PIOA 1WGSA 2XIDA 4JX5A 2F5TX 3CC7T 4ZTFA 1O9SA 4Y91A 3VUZA 4M77A 4RCBA 4JS5A 1VQ7A 4HT9A 1V29B 3L1AA 4KUDK 5GAN7 3V8KA 4F7UB 1W4SA 2RJDA 4IUTA 4QQDA 5DM7R 1YI2A 4BDYA 1N8RC 4A53A 3JB9H 1FXXA 2VV5A 2JN0A 2LT4A 3M5AA 2ZPIB 2GF7A 4E47A 5CO7A 3CMAA 1HK9A 3TW6A 5CKDA 2RK1A 1S72T 2QQSA 3NTHA 2I2LA 4HL4A 4XTWA 3G6ET 4JX4A 1JBMA 4JRQA 5GANe 3HP9A 5KE2A 3RKWA 3OBWA 4XTZA 4M7AF 4UC4A 1N8RU 1YHQA 3M59A 4TVRA 3P8DA 3VV0A 2KAFA 3QPHA 3OS2A 3JB9G 1YJNT 1NJIC 3DLMA 4MDXA 2QF7A 2XI9A 3QYHB 3OBYA 1WQWA 4EMKA 5GANh 4C0ZA 2M9UA 4XU2A 4M7AG 2RH2A 3BFMA 2DVEA 4M7DG 1I5LA 3LX7A 4RMOA 1M90C 2XD0A 1M1GA 3CCMT 2G3RA 4OP0A 4QVCA 3OYMA 4IUQA 1NJIU 2DTHA 3CPFA 3HHTB 3CMEA 3V8LA 1OZ3A 4NL3A 3CCRT 1BKBA 3TCJA 3TU4K 5C6SA 4LDVA 1Q7YC 5J39A 2RJCA 4F7UF 3MP1A 1IZ6A 3DL1A 3VJPA 1DJ7B 2LC4A 5I21A 2RO0A 2CZ1B 4M78A 3VU3C 1KD1C 2DK3A 4VUBA 4E7LA 3CCJA 4HCBA 3OQ5A 4J83A 2HQXA 1M90U 4M78B 2DXUA 2LX9A 1UGQB 3QYGB 3PMTA 4WF2A 5GMKj 2Y4YA 3LW5E 3QJ6A 4DA4A 2LCCA 4C5EA 1Q7YU 3VYGA 2EQJA 1X75C 1VQ9A 2ZPBB 4M75E 4CRIA 1VQ6A 4A4KA 1VQ7T 3ASKA 4C92A 2DEQA 2EJFA 3VYGB 5HK3A 3SB2A 1KD1U 4AI6A 4ZN3A 5LJ3e 1KC8C 1G3YA 4C92B 4EPCA 5FU6B 2KK4A 2F69A 3FJPA 2DTOA 2XDDA 3L2QA 3OYNA 1OZ2A 3A8OB 2E70A 5GAN8 4BE1A 3T9NA 2VYTA 3G4SA 3S3OA 3HBLA 1QP2A 2PVOB 3GNFB 5LJ3h 4C8QG 2BS2A 2QTXA 5A0DA 1KC8U 2OTLA 4ELJA 3PNWC 2JZ2A 1ZQ1A 2DD5A 2NLUA 3OYBA 2LQ8A 4PJOG 1YHQT 3H4CA 3X24B 3J81E 3N5BB 4V2SA 2RHIA 5HKCA 1RL2A 2VC8A 1Y7XA 3JCMW 4KT0E 3Q1JA 3RKYA 3JCMP 1YIJT 5CVIA 5GMKi 5D6XA 1JB0E 4Y28E 5GAN2 3HRTA 4M77E 3QO3A 4MDWA 3UPUA 3O8VA 1M1FA 4N4IA 3CCET 2R5AA 3L2RA 3OYHA 4JRPA 2DZ9A 3S3NA 1VQLA 5L8RE 5LJ5f 4C5HA 2XICA 2VGMA 3RUXA 1G3SA 3LGFA 2QQBA 1P92A 3I55A 4FU6A 3CMET 4M75C 4RG2A 4FL6A 3JAME 1EIFA 1OI1A 4XK8E 4IUVA 4BY6C 2X4JA 4C0GA 4EMHA 4C92F 4KUIA 4BB7A 1JJ2A 1K8AC 2DXCA 2D6FA 4GLKA 4XU3A 2K4YA 5C0MA 5LJ5g 5FROA 3JCMX 2R57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WVE B;  2DXC B;  2DD4 A;  2ZCF B;  1UGP B;  2DPP B;  2ZPI B;  2DD4 B;  4OB2 B;  3QZ5 B;  2CZ0 B;  4FM4 B;  2CZ6 B;  2PU9 B;  2WSE E;  1PSF A;  2PVG B;  3QYH B;  2AHJ B;  1IRE B;  2QDY B;  3X25 B;  1UGS B;  4OB1 B;  1PSE A;  2ZPE B;  3HHT B;  2O01 E;  3VYH B;  2WSC E;  2PUK B;  1DJ7 B;  2CZ1 B;  3WVD B;  3A8M B;  2WSF E;  1UGQ B;  3QYG B;  3LW5 E;  4ZGJ B;  2DD5 B;  2DXB A;  1AHJ B;  3VYG A;  2ZPB B;  2DXB B;  3VYG B;  4L6V 5;  2CZ7 B;  2ZZD A;  3A8H B;  3X20 B;  3A8L B;  3A8O B;  2ZZD B;  1QP2 A;  2PVO B;  2D0Q B;  4RKU E;  2DD5 A;  3X24 B;  4ZGD B;  4KT0 E;  3X28 B;  3X26 B;  1JB0 E;  4Y28 E;  2PVD B;  2ZPG B;  1UGR B;  4ZGE B;  1GXI E;  5L8R E;  2ZPH B;  2CYZ B;  4OB0 B;  2ZPF B;  2PUO B;  3A8G B;  4OB3 B;  4XK8 E;  1QP3 A;  2DXC A;  3QXE B;  3QZ9 B;  1V29 B; 
#chains in the Genus database with same CATH topology
 2KNB B;  1W98 B;  2DD4 A;  1X2K A;  1VQ6 T;  1PHT A;  4M7A B;  3KUF A;  5GAN 4;  4JJN K;  2YT6 A;  1MNE A;  5GAO l;  1NPR A;  4LN2 A;  3UWN A;  1E7O A;  1UDL A;  3OYA A;  1E6H A;  3ZEH A;  5IHI A;  1GFC A;  1WXT A;  4M75 D;  1PKD B;  2EW3 A;  3CEY A;  3BHU B;  4WCI A;  3RMQ A;  1TSF A;  3G4S T;  1SPK A;  2EWN A;  3UT1 A;  3HL8 A;  2ROT A;  1VIE A;  1BCM A;  4EOP B;  3MEA A;  5GJV B;  3BDL A;  1SEM A;  1I5O B;  2EFI A;  2A3L A;  3QWL A;  2KRN A;  3OSS C;  4XTU A;  3GNG A;  1K9A A;  1E6G A;  2YXY A;  2ZPE B;  4DBR A;  2O01 E;  5IXF A;  1Q86 U;  3CCS Q;  3VYH B;  1D0Y A;  1VQL T;  3O5Z A;  5I11 A;  2DEU A;  2VAS A;  4JRI A;  2LCL A;  3JCM h;  4M7D F;  1ZUK A;  1BI1 A;  4MMK A;  2KYM A;  4JJD A;  4EMK C;  2EQI A;  1N9R A;  4PL6 A;  5LJ5 d;  5FU7 C;  4PJO B;  5M9O A;  2E10 A;  1EZZ B;  3EFS A;  2DA9 A;  3S3M A;  2RA2 A;  3M57 A;  3CCE A;  4O5V A;  1I1J A;  1KXU A;  3SEM A;  5GAM e;  1JQQ A;  1QKW A;  2DKG A;  1M3B A;  4PJL A;  4A4H A;  4KRT A;  3MY1 B;  2G6F X;  2B8A A;  4XU1 A;  2CGH A;  2EAY A;  3JCM c;  8ATC B;  1UHC A;  3GLX A;  3RMS A;  3QYB A;  3TW7 A;  2X4X A;  3RDV A;  2DZC A;  4C92 C;  3CD6 A;  2IVX A;  4FT2 A;  4MZM A;  2RJE A;  3PIP A;  4J7I A;  5HBH B;  2O9V A;  2HQH A;  3HSB A;  1M9S A;  2I40 B;  4PK4 A;  4ZGE B;  1LNX A;  4XTX A;  5CQX A;  1K73 C;  2GTJ A;  3KBG A;  4N4G A;  4BCN D;  3EID B;  4PKC C;  1FMV A;  2AKK A;  1XQH A;  1T3S A;  3GBQ A;  2QQ8 A;  2COW A;  3CXC S;  4AFU C;  4BAC A;  3AHU A;  3BG5 A;  3H9N A;  4M77 G;  1M3A A;  3QZ9 B;  5D7U A;  3MY5 B;  4F7U E;  4B9W A;  2RB6 A;  4Y72 B;  4X9C A;  3CCQ A;  3E1S A;  1JKW A;  2C6T B;  2JGZ B;  3CPW A;  2FYK A;  3FC3 A;  2EIF A;  4F16 A;  3OW2 P;  2CZ0 B;  1M5Q 1;  5GMK m;  2L3S A;  2SRC A;  1YJ9 Q;  1UUE A;  2XK0 A;  1G2B A;  5CKF A;  4M7A C;  2CUB A;  4DOV A;  1VQO A;  3ER0 A;  2KYB A;  2QGS A;  1PNJ A;  1WNL A;  4BI8 B;  3MEW A;  2GCX A;  3I56 T;  4KRD B;  1MUZ A;  2K2V A;  2P4R A;  1VQ4 A;  3CBM A;  1SKU B;  4PJM A;  3OS5 A;  2IW8 B;  3C94 A;  4AKG A;  1GFD A;  2OJ2 A;  2UUE B;  4M78 G;  3DJB A;  5EFQ B;  1R77 A;  2J7I A;  4E6R A;  4B9X A;  5GAO p;  3POM A;  4CFU D;  3V8J A;  3TQ7 P;  3DKM A;  4BY6 B;  4IMY B;  2P4T A;  2QQR A;  1T3L A;  2BS3 A;  2KBT A;  1VQM T;  2KR6 A;  3HFN A;  3JSC A;  2BS4 A;  3A8H B;  2HAX A;  2VVK A;  4WTO B;  2JOY A;  1X69 A;  5CIU A;  3G6E Q;  2O4X A;  4BCH B;  3HB9 A;  3CC4 Q;  4C8Q A;  4D6W A;  4QW2 A;  4RKU E;  4MFD A;  5GMK e;  4F6U B;  3QHW B;  2CKK A;  1YJN Q;  2A08 A;  2LJ3 A;  1U3O A;  1VIF A;  3M4G A;  5KH6 A;  4IUR A;  3HRU A;  1RAH B;  5GAO q;  2EKO A;  1URC B;  3V7R A;  1PRM C;  3EGX B;  4YOZ A;  1KQ1 A;  3QSU A;  1NLO C;  3L2U A;  3M4Y A;  4HNT A;  3VKH A;  3CC4 T;  3SDZ A;  3QDR B;  2F1L A;  4QVD A;  3QHS A;  1F5Q B;  5GAN 3;  2EGE A;  3QJY A;  2RQV A;  1Q7Y R;  4R55 A;  1WHG A;  2H8H A;  2ZGW A;  2RQU A;  3EG9 B;  4ROD A;  2E6N A;  4MML A;  2BZX A;  3PVQ A;  1VQ7 Q;  4BBS M;  2QEX A;  3KFV A;  3PFS A;  1JJ2 P;  3OYF A;  1PCX A;  2D9T A;  3GP8 A;  4M7D E;  5GAM g;  1U8R A;  4M77 F;  2OTJ A;  1VQP A;  2E5Q A;  1PSF A;  2PVG B;  3G1J A;  2LNH B;  5KYY B;  4YC3 B;  1YHQ Q;  3UF4 A;  2K2M A;  1AIS B;  2MWO A;  5EG2 A;  2KRS A;  4R0K A;  3ULR B;  2RI3 A;  1YWO A;  3MCA B;  2WSC E;  4LOC A;  1YP5 A;  3WVD B;  2OTL T;  1BIA A;  1TU0 B;  2M0O A;  1PD1 A;  4LD9 K;  2JTE A;  5CKE A;  3LGL A;  2DJQ A;  1YIT T;  2DXB A;  4QKU A;  4M7D C;  3CCV T;  3G7Z A;  1IXD A;  3I35 A;  3OYE A;  2QDJ A;  2FL7 A;  4M78 F;  1YFN A;  5LJ5 h;  3L42 A;  1WHK A;  1VQ8 T;  1IO6 A;  3F5X B;  1OIY B;  4OMF B;  1Y07 A;  2ZZD B;  2MAM A;  5IHN A;  1VUB A;  1PM3 A;  1JU5 C;  2FRW A;  4ELY C;  5CAI A;  3JRZ A;  1E9H B;  4M75 A;  1JRI A;  2F5K A;  3CCJ T;  4BDZ A;  4MFE A;  1AVZ C;  1G5V A;  1WJR A;  3PGG A;  4RCC A;  4M7D D;  3OYI A;  4FYX B;  3RBB B;  3X28 B;  2DL5 A;  2E65 A;  1Q86 R;  3G71 T;  4C92 G;  2HSE B;  3JB9 J;  4A54 A;  2QYZ A;  3OYK A;  4CXA B;  1OYX A;  1ZHI A;  2ZPF B;  5FWC A;  2PUO B;  2QA4 A;  1YWP A;  1RAI B;  2CT3 A;  3QWX X;  3GTM S;  3K7A M;  2LDM A;  2V26 A;  3SWN C;  4ZN1 A;  1TUD A;  1WGS A;  4JX5 A;  2F5T X;  4OMP A;  3CC7 T;  2CSI A;  1O9S A;  4Y91 A;  3VUZ A;  1IHV A;  4J9C A;  1V29 B;  1FYN A;  3L1A A;  1YI2 A;  4BDY A;  4A53 A;  3M5A A;  3PE0 A;  3TW6 A;  6AT1 B;  3BE3 A;  3EHR A;  4HL4 A;  5GAN e;  4BCG B;  2ESW A;  3OBW A;  4UC4 A;  3QPH A;  1RAB B;  2W2H A;  2WIH B;  1WQW A;  4EMK A;  4C0Z A;  4XU2 A;  4M7A G;  3H0I A;  2WFY B;  1QCO A;  2QGF B;  1I5L A;  4AT1 B;  2XD0 A;  5L2W B;  1M1G A;  1NJI U;  4NL3 A;  3TU4 K;  5C6S A;  5J39 A;  1QLY A;  2LC4 A;  2RO0 A;  2CZ1 B;  1KD1 C;  1X27 A;  2DK3 A;  2EBP A;  2DVJ A;  3OQ5 A;  2HQX A;  1M90 U;  4M78 B;  4IIM A;  3QYG B;  2I53 A;  5GMK j;  2Y4Y A;  4DA4 A;  1D0Z A;  2ZPB B;  2EYW A;  2RQW A;  4C92 A;  2DEQ A;  4J9H A;  1P5E B;  5LJ3 e;  5I5Z B;  5FU6 B;  2KK4 A;  4QT7 A;  1RI9 A;  1NYG A;  4PJN A;  2E70 A;  5GAN 8;  4BE1 A;  2VYT A;  1QP2 A;  2PVO B;  2VKN A;  5LQF B;  1H27 B;  2PMI B;  2BS2 A;  4HVV A;  2JZ2 A;  2DD5 A;  4PJO G;  3X24 B;  1D1B A;  3TSZ A;  4V2S A;  5I22 A;  3EFO A;  2A0F B;  5GAN 2;  4M77 E;  3CD6 Q;  3CCE T;  1ZSG A;  3OYH A;  2DZ9 A;  5L8R E;  3RUX A;  3NHN A;  1UJY A;  4RG2 A;  1EIF A;  1M2V B;  1OI1 A;  1ZP2 A;  1R0C B;  4C92 F;  4BY1 X;  4KUI A;  4RTX A;  1OPL A;  5C0M A;  5ECA A;  1VQK Q;  3JCM X;  2HQE A;  4M7A A;  3NDQ A;  2GTO A;  2XMF A;  1OX8 A;  2RPN A;  1W2B S;  1Q82 R;  3MET A;  2W0Z A;  5A2Q E;  4BCQ D;  2M0Y A;  1K8A U;  1X01 A;  1NM7 A;  2GBQ A;  1Y96 B;  1SHF A;  2QGG A;  4OVA A;  5L23 A;  3OYY A;  2CUD A;  1GUX B;  1VQ5 Q;  4OMO A;  2HL3 A;  2WSE E;  2JJ9 A;  4M77 C;  2GQV A;  4DQ2 A;  2LQW A;  5KYW B;  2KRO A;  4F7U A;  4LD6 A;  2ABL A;  2V22 B;  2NUT B;  1KIK A;  2CP0 A;  2V1Q A;  1VYT A;  1Q81 U;  1OGU B;  1VYU A;  4PNO A;  2X4W A;  3CCQ T;  2CP7 A;  4HXJ A;  3DB3 A;  5D6W A;  4PLL A;  2YUQ A;  4OGC A;  4C8Q D;  3I55 T;  3M55 A;  2FPD A;  4M77 D;  2L8D A;  4HA8 A;  1AHJ B;  1H28 B;  1OV3 A;  1QWF A;  1ABO A;  4KUL A;  1QQJ A;  1YIJ A;  1VQO T;  1H3Z A;  1OKV B;  3CXC P;  4EOQ B;  3X20 B;  1VQ4 T;  4M78 C;  4M4Z A;  2V8J A;  1M1K R;  4KH0 B;  3EGU A;  2PNI A;  3R6O A;  4LNP A;  2WXV B;  1QVF P;  1M3C A;  4J5Y A;  2VGN A;  2QQA A;  4RG8 A;  5GAN g;  5HBJ B;  2RJF A;  3E9G A;  3JCM Q;  3E19 A;  2M16 A;  5FU6 C;  5HVY B;  2O88 A;  1M8V A;  4FT4 A;  2D0N A;  4LE9 A;  2G9X B;  2CCH B;  2BE7 D;  1M1K C;  5D6Y A;  2AZV A;  4OF1 A;  4OGR B;  4PJO F;  2X35 A;  4R56 A;  1NEB A;  5CKB A;  5GAN j;  2QFZ A;  3A8G B;  4BCN B;  2JS2 A;  2M1H A;  3H0F A;  5IHY A;  1QKX A;  2XDP A;  4JX6 A;  4A4G A;  1UG1 A;  2C5X B;  1ZBJ A;  3M58 A;  4KGX B;  2KMT A;  1IB8 A;  2NUP B;  1K9M U;  1UNG D;  2HZY A;  3QWY A;  4X34 A;  2K57 A;  4E7J A;  2WIP B;  2LT1 A;  4G6L B;  5LJ3 g;  3QZ5 B;  1VQN T;  2QEX Q;  3CCL A;  1OKW B;  1MHN A;  2X1N B;  2FVU A;  2OTJ Q;  1VQP Q;  4JUV A;  2QI2 A;  3MI9 B;  1BK2 A;  1WA7 A;  4M7D A;  2K5L A;  3EGD B;  3OYD A;  5LJ3 j;  3JB9 G;  2R58 A;  2ATC B;  4ANJ A;  3VKG A;  3RIR A;  4LDY A;  4C0D C;  4E7K A;  4EOO B;  1NBE B;  1UE9 A;  2JTM A;  4J8O A;  2DO3 A;  1VQP T;  3C4S A;  1UEB A;  3ZBD A;  2UZB B;  1QMC A;  1YCY A;  2V1R A;  1WI7 A;  5KCH A;  2FPF A;  2DTI A;  1GH6 B;  1U06 A;  4J9G A;  1Y57 A;  3NGP A;  2Y90 A;  5FRM A;  2BIV A;  3A8L B;  4C92 E;  3OMC A;  2AK5 A;  1TH7 A;  2JVV A;  4JJC A;  1M27 C;  1OPK A;  2LVM A;  2A28 A;  2LJ1 A;  3SHW A;  3SWN A;  3OW2 A;  2YRD A;  2MF2 A;  5FWB A;  1NJI R;  3EGX A;  2MPX C;  4RTY A;  3C0C A;  3M53 A;  2IN3 A;  3ME9 A;  3CCS T;  1A0N B;  2ZPH B;  5LMK B;  4JDS A;  4DOW A;  1R8O B;  1M90 R;  3CBO A;  1RAC B;  2K5F A;  3FIF A;  1QVG A;  2BE9 B;  4E7S A;  1KQS S;  2E1H A;  2WJ9 A;  4F7L B;  4RTZ A;  2X4Y A;  1UJ0 A;  3PMI A;  1G8X A;  1X6B A;  2QA4 Q;  5GAM f;  3BG3 A;  1N5Z A;  3DOG B;  4IIO A;  4HCC A;  1WLP B;  3SFM A;  5DQV A;  4AKI A;  1RUW A;  3CCU A;  4BCI B;  4XAX B;  2IG0 A;  4F6S B;  4M7A E;  2BPM B;  3GPL A;  1YI2 Q;  3DDP B;  2ECZ A;  3VS6 A;  2LZ6 B;  4F7J B;  3M0U A;  4FM4 B;  2CZ6 B;  2IVW A;  1NLP C;  5KYY A;  2QA4 T;  1SSH A;  1WJS A;  1VQK A;  4EOI B;  1RAG B;  4N0A A;  4EOK B;  5GAO n;  4DBF A;  4NC6 A;  1NPP A;  1B34 A;  1Y0M A;  4II5 B;  4C92 D;  4EOM B;  3X25 B;  4E7H A;  4M6V A;  1YI2 T;  3RES A;  4Y92 A;  1QVF S;  4J9E A;  1VQ5 A;  1WIE A;  2L5Q A;  3MEU A;  1ZBX A;  1N6A A;  1QVP A;  2DIG A;  3EG1 A;  4BI4 A;  3JB9 F;  1X2Q A;  2RQR A;  1TXQ A;  2R5M A;  4PJO E;  1K8A R;  2E3H A;  2HBP A;  3MP8 A;  1S72 A;  4O6J A;  2A7Y A;  3TNW B;  2ZZD A;  2DNU A;  5GAM d;  4KBM B;  4BCF B;  1YJ9 T;  4J9I A;  3BDU A;  1V76 A;  2C5N B;  2EJ9 A;  3IQL A;  2O31 A;  5GMK l;  3M0T A;  5EJC A;  1Q81 R;  3PT9 A;  3EAE A;  4M7A D;  5HQ0 B;  1Y71 A;  3LLR A;  3CCM A;  2HMA A;  1KJW A;  2G77 A;  2ZPG B;  1VOL A;  3F70 A;  3CCR A;  4CFM B;  1YJW Q;  2RHX A;  2K5I A;  4DBH A;  3TNI B;  1B7T A;  4OB3 B;  4PJO C;  2K79 A;  4FCY A;  5LJ5 j;  1QW1 A;  3EJ1 B;  4JS5 A;  4M77 A;  4HT9 A;  3V8K A;  4KRC B;  4F7N B;  2RJD A;  4BCM B;  1FXX A;  4PFP A;  2GF7 A;  5CO7 A;  1HK9 A;  1GCP A;  2QQS A;  2I2L A;  4XTW A;  3G6E T;  2YUO A;  4JX4 A;  1JBM A;  1PG5 B;  1SF9 A;  1QCF A;  2JW4 A;  5KE2 A;  3RKW A;  2MYS A;  1N8R U;  4DEY A;  1H1P B;  2KAF A;  4CC3 A;  1YJN T;  2CP3 A;  3DLM A;  2M9U A;  5IXB A;  4F14 A;  4Z88 A;  4RMO A;  2DL8 A;  1KFZ A;  2DTH A;  3HHT B;  3CME A;  1OZ3 A;  1BKB A;  1Q7Y C;  3H0H A;  2X3X D;  1IZ6 A;  5I21 A;  1DJ7 B;  2B9R A;  4M78 A;  3VU3 C;  2FO0 A;  4HCB A;  1QWE A;  1ZSZ B;  4J83 A;  2LX9 A;  3PMT A;  1B3Q A;  4WF2 A;  1K9M R;  4C5E A;  2EQJ A;  1VQ6 A;  4CRI A;  4A4K A;  1VQ7 T;  1C9B A;  3ASK A;  4JZ4 A;  4I3Z B;  2IW6 B;  5HK3 A;  1UFF A;  1YIJ Q;  2KXD A;  4CRL B;  2F69 A;  1TOV A;  3G4S A;  3HBL A;  1VYV A;  1W2B P;  2D8H A;  2QTX A;  1KC8 U;  1H26 B;  4ELJ A;  3TVT A;  4EC9 B;  2NLU A;  1YHQ T;  1VIN A;  3H4C A;  2WMA B;  2F2X A;  2RHI A;  2O2O A;  1D1A A;  1RL2 A;  3JCM W;  3Q1J A;  3JCM P;  1YIJ T;  5CVI A;  5GMK i;  1QCN A;  5D6X A;  4Y28 E;  3HRT A;  2KRM A;  2M02 A;  3O8V A;  3UPU A;  2CH4 A;  3L2R A;  4JRP A;  1VQL A;  4OMN A;  1ZUY A;  1P92 A;  2AT1 B;  2PK9 B;  2NWM A;  2YWW A;  4B6M A;  1FMK A;  3JAM E;  1WXU A;  3VS3 A;  5KYU B;  4BY6 C;  3BHV B;  3VS1 A;  4E7Z A;  3QXE B;  1K1Z A;  2VXE A;  2RF0 A;  2FG0 A;  3OYG A;  4RTT A;  2DRM A;  1NEG A;  3P8H A;  2X51 A;  1UGP B;  1MV3 A;  2EJG A;  2DE0 X;  1I07 A;  4ELL A;  5CYI B;  2LRQ A;  1XTD A;  2V8K A;  4BCJ B;  4LDW A;  1HYO A;  5KYW A;  2OX7 A;  2PU9 B;  2ROL A;  3B57 A;  4NOY A;  2JMA A;  2QK0 A;  1Q86 C;  2X3W D;  3EG2 A;  3CCL Q;  3J7A F;  1ZA1 B;  1D3B B;  4CC2 A;  1MMN A;  1KK7 A;  3BHT B;  5GAO r;  1BYM A;  1FVV B;  2P0Q A;  2DET A;  3JCM e;  3OYJ A;  3CQT A;  1IRX A;  3VS0 A;  1H3H A;  1TUG B;  3UAT A;  2QAZ A;  2CSQ A;  4BBR M;  4EOJ B;  4GY5 A;  2YRV A;  2E4H A;  1QVG S;  1BIB A;  5FRN A;  4NS5 A;  4N4H A;  3M54 A;  1N27 A;  1NYF A;  4C8Q B;  3S6W A;  1O75 A;  2RHY A;  3VS7 A;  1OEB A;  1ABQ A;  3QG1 A;  1PC0 A;  3J80 E;  4XTY A;  1WZO A;  2HKN A;  3HFO A;  1IHW A;  1AWJ A;  3ZFJ A;  2L3P A;  1R0B G;  4AG1 C;  4NL2 A;  1AD6 A;  2LW4 A;  3DDQ B;  4HNV A;  1WPY A;  1ZSZ C;  3QKJ A;  4AFZ C;  1RAE B;  2UZE B;  3LYI A;  1RLP C;  2B86 A;  5CKH A;  1MMG A;  3L2Z A;  1VA7 A;  4N0A C;  2RK2 A;  1PRL C;  7AT1 B;  5GAM h;  1D0X A;  3CC2 Q;  2J6K A;  4OMQ A;  2IW9 B;  3KHI A;  4EOL B;  1ZX6 A;  1N9S A;  3EFR A;  4F6W B;  4OML A;  3JB9 D;  5IHK A;  5I2M A;  2RMO A;  4HT8 A;  1CKA A;  2DJZ A;  3E9F A;  4D8D A;  2OAW A;  3MHX A;  4UN0 A;  3LH5 A;  4OB0 B;  3REB B;  3CMA Q;  1HJD A;  3HKS A;  3CPW S;  2ZAE A;  5LJ3 f;  4Z6Y A;  1K73 U;  3C12 A;  2C0O A;  1WXB A;  2JMC A;  1U1S A;  1VQM A;  2QXF A;  4K11 A;  1YJW A;  1G3N C;  1GBR A;  4XQ3 A;  1Z9Q A;  3RER A;  4HCZ A;  3CCU Q;  5A0G A;  5CQY A;  4AKH A;  3JCM J;  3FEO A;  4RTU A;  4D8K A;  5KYX A;  5IH2 A;  2C06 A;  4CFV B;  2EYZ A;  1MND A;  3C95 A;  2DIQ A;  1IRE B;  1S1N A;  4YOS A;  5J3B A;  3EGD A;  2XG8 D;  3CD6 T;  1MV0 B;  2X9H A;  3A5Z B;  1C1A A;  3URG A;  2LNV A;  3CCU T;  1PSE A;  2E3I A;  1K76 A;  5IN1 A;  1MGQ A;  3RKX A;  1I81 A;  3H41 A;  2PZ1 A;  4J6Y A;  3PO3 S;  2OI3 A;  2H3J A;  4M75 B;  1VQK T;  2UZL B;  2DMO A;  4P5N A;  4M78 E;  4GLM A;  2JUF A;  3PTA A;  1KQS P;  3TRE A;  2W9F A;  1Q82 C;  4IKF A;  4J9D A;  4QQG A;  2COZ A;  3L2W A;  1O9K B;  4ORZ A;  5LJ3 d;  4MIM A;  1W6X A;  3QYE A;  1SHG A;  3OA6 A;  1N8R R;  2PJQ A;  1H1Q B;  1GCQ C;  1YCS B;  1EFN A;  1S72 Q;  2RD1 A;  3REA B;  1VQ5 T;  2J06 A;  4J9F A;  1X6O A;  3OB9 A;  5FW9 A;  1H4L D;  1NZ9 A;  1YNZ A;  2JT4 A;  5ACB A;  4PJO A;  4OR5 B;  4BCP B;  3MKD A;  1H1S B;  3LWI A;  1I8F A;  1WHL A;  2PVD B;  3LWH A;  2XKO C;  2RHU A;  5AYF A;  1UGR B;  5GMK h;  2DF6 A;  2MK5 A;  3CCM Q;  1KHC A;  3BY7 A;  1T0H A;  3JCM g;  2OTL A;  4BUG A;  3CCR Q;  3MEV A;  4A4F A;  2C5V B;  1RAF B;  1YIT A;  4AMC A;  1QP3 A;  3CCV A;  1K0X A;  2RI5 A;  3VS5 A;  1AZE A;  1H64 1;  4ROC A;  4EMK B;  1VQ8 A;  2EYX A;  2YHT A;  2DPP B;  1N4M A;  1FX7 A;  2RQT A;  5FU7 B;  5IAY A;  1FMW A;  4OB2 B;  4KH1 B;  4EON B;  2FZK B;  2K3X A;  1M30 A;  1G3W A;  4M78 D;  3ZL7 C;  1U5S A;  3EH1 A;  2DBK A;  3QDF A;  4ESR A;  1OUL A;  1X6G A;  4J6X A;  2BUD A;  1LVK A;  4ELZ C;  1AWO A;  3BG9 A;  2LP5 A;  2KEA A;  1NG2 A;  1WYX A;  2YUN A;  2YLB A;  3G71 A;  5LL6 S;  2BKD N;  2K3Y A;  4FSX A;  4LUD A;  1LJO A;  4Q5W A;  3JCM V;  2EKH A;  2DLP A;  3MP6 A;  2KGT A;  4ZNX A;  2D8J A;  5GJW B;  3CME Q;  3RR6 A;  2D1X A;  5LJ5 e;  3CC7 A;  3SD4 A;  4FX3 B;  2FRY A;  1SG5 A;  2RHZ A;  3EH2 A;  2DD5 B;  4F7S B;  2MI6 A;  3FDR A;  2WPA B;  4J6W A;  1H1R B;  4CFX B;  4EIK A;  3EFO B;  1GRI A;  4DBQ A;  5GAO m;  4EOR B;  1TD6 A;  1VQ6 Q;  4HCK A;  4JRK A;  5FGK B;  2F2V A;  4CC4 B;  1B07 A;  2HL5 C;  1XOV A;  2KY9 A;  2QEX T;  1AWW A;  2OAU A;  2VUB A;  3BW1 A;  1I0C A;  1IGQ A;  2KT8 A;  4C5I A;  1BU2 A;  2HNI A;  3VKI A;  3OSV A;  2OTJ T;  1AT1 B;  2FHD A;  2RN8 A;  3G4S Q;  3KXT A;  2YRC A;  2GNC A;  4CI0 C;  1JOW A;  4CFU B;  3QII A;  3X26 B;  2C0T A;  2LJ0 A;  4JS4 A;  5AT1 B;  2FEI A;  1FIN B;  2E12 A;  4FYY B;  1LPL A;  1KHI A;  2JM8 A;  1VQL Q;  3CC2 A;  5CEI B;  4ZTJ A;  3L2V A;  3PIO A;  3O0G D;  1LCK A;  2XID A;  4RCB A;  1HSQ A;  4KUD K;  1C0M A;  5GAN 7;  4F7U B;  5HNB B;  1OU8 A;  2VV5 A;  2LT4 A;  2ZPI B;  3CMA A;  5CKD A;  2C4G B;  2K9G A;  3NTH A;  1PD0 A;  4JRQ A;  4BXX X;  1PKT A;  4XTZ A;  3P8D A;  3BLH B;  1D1C A;  1ENW A;  3VRY A;  1NJI C;  1UHF A;  4EC8 B;  3EG9 A;  2XI9 A;  3QYH B;  2E5K A;  5GAN h;  2RH2 A;  2DVE A;  3LX7 A;  1M90 C;  2EYY A;  2G3R A;  4OP0 A;  4QVC A;  1Q95 G;  2LCS A;  4LDV A;  1ZSZ A;  3DL1 A;  3VJP A;  3U23 A;  1K73 R;  4VUB A;  2NYS A;  2A36 A;  4RUG A;  2ED1 A;  2DXU A;  2HDA A;  4EOS B;  2BZY A;  3LW5 E;  3E2U A;  2MOX A;  2F2C A;  3R6N A;  2YDL A;  3EG0 A;  2CP2 A;  1H8K A;  1VQ9 A;  1TTH B;  3VYG B;  1KD1 U;  1QMZ B;  1G83 A;  1TG0 A;  1G3Y A;  2KE9 A;  1V1C A;  2DTO A;  2XDD A;  3T9N A;  2Z0W A;  3S3O A;  4X1V A;  5LJ3 h;  4C8Q G;  1TUC A;  1ZQ1 A;  3VRZ A;  3N5B B;  5HKC A;  1Y7X A;  4KT0 E;  4KGV B;  4FW1 A;  4N4I A;  2R5A A;  4TTH A;  3S3N A;  4AFQ C;  3I56 Q;  4C5H A;  2XIC A;  2VGM A;  3THK A;  1G3S A;  1PWT A;  5KYU A;  3I55 A;  4FL6 A;  1K0S A;  2J05 A;  1CKB A;  2QG9 B;  4KGZ B;  3M0P A;  3PVL A;  2X4J A;  4C0G A;  2BKZ B;  4BB7 A;  3MIA B;  1JJ2 A;  5HBE B;  2R7G A;  1K8A C;  4GLK A;  2K4Y A;  3VUB A;  3M03 A;  5LJ5 g;  1QVG P;  3INZ A;  2DXC B;  2F2W A;  5BNJ B;  2E6Z A;  2CP5 A;  2PQW A;  1CSK A;  1RI0 A;  3FLG A;  3OYC A;  2LQK A;  4L5G A;  1GL5 A;  2DD4 B;  4M7D B;  2DAQ A;  2XU8 A;  2SEM A;  2FZC B;  2IPO B;  2GFA A;  1VQM Q;  2L89 A;  4YOO A;  2KR3 A;  1Q81 C;  2HKQ B;  2CCI B;  5DLQ E;  2BZ8 A;  2PHG A;  1D3B A;  2L0A A;  3WXM B;  1WX6 A;  3HRS A;  4J9B A;  4XU0 A;  3UA6 A;  1M2O A;  2LX7 A;  4FYV B;  3DLL A;  4F70 B;  1W2B A;  1YBY A;  5HY6 A;  1AWX A;  1OI9 B;  1YJW T;  3V7C A;  1UNL D;  3H8Z A;  2KT1 A;  5I2S A;  4FYW B;  1J3T A;  2PUK B;  1Q82 U;  1KQ2 A;  4II1 A;  3P8B B;  1GCQ A;  1FWZ A;  2CDT A;  3UA7 A;  2JS0 A;  2DYI A;  1M4Z A;  4PJO D;  2MMP A;  5IF1 B;  1MMD A;  2EQU A;  2FB7 A;  3H6Z A;  2GGR A;  3CPW P;  4ROE A;  4BCO B;  4QSH A;  3SWN B;  4RTW A;  4BE2 A;  1WJQ A;  4ME7 A;  9ATC B;  2AKL A;  5KYN A;  1VQN A;  4JZ3 A;  4BI3 A;  2E41 A;  4HLQ A;  2KDS A;  4HVU A;  1D3U B;  3JB9 I;  2QQ9 A;  3EG3 A;  2C0I A;  3M56 A;  1VYW B;  4M75 G;  5IT9 E;  3M0R A;  1D09 B;  3A98 A;  2LTO A;  4E7I A;  4ZGD B;  2BTT A;  2K3B A;  1Z9Z A;  5GAN 5;  2HCK A;  2EUF A;  3D7S B;  1LOJ A;  2DL4 A;  1HXD A;  2YUP A;  4OMM A;  5FLX E;  3BLQ B;  4C8Q F;  3QUI A;  1GXI E;  5KCO A;  1BBZ A;  1WQ7 A;  2J6O A;  5CCA A;  2DER A;  2Y4X A;  4AG2 C;  1ZA2 B;  1QLB A;  2E64 A;  4J7F A;  1K9M C;  2XHC A;  1RAD B;  3QHR B;  4JLI A;  2OTL Q;  4IUU A;  3LH0 A;  1M1K U;  2EGA A;  2RM4 A;  3NTI A;  2KXC A;  2RI2 A;  3AT1 B;  1NE8 A;  2JNG A;  2KSS A;  1PKS A;  3WVE B;  2CT4 A;  5HCK A;  2A37 A;  1YIT Q;  3NMZ C;  3CCV Q;  4A63 B;  2ZCF B;  1B34 B;  2YSQ A;  2IIM A;  1K4U S;  1OL2 B;  5GAM j;  2DRK A;  1OX9 A;  1JST B;  4PFO A;  1X43 A;  1BI2 A;  1VQ8 Q;  3I9Q A;  4HNU A;  2COY A;  1M2V A;  2PK2 A;  2L3R A;  3JCM b;  5DLO A;  2CJM B;  4A4E A;  3CCJ Q;  1UNH D;  1WHM A;  1WFW A;  3UDC A;  5CK9 A;  1JO8 A;  1OL1 B;  1RAA B;  3CCS A;  3G71 Q;  2KMG A;  4OB1 B;  3GIB A;  3OMG A;  1Y96 A;  3TEE A;  5IDN B;  3HO8 A;  2DL3 A;  4FW2 A;  1GUX A;  4BCQ B;  1RLQ C;  2JXB A;  2VXF A;  1UTI A;  4QQ6 A;  3TNH B;  2FZG B;  2JTF A;  4CC7 A;  3G33 B;  3A8M B;  2WSF E;  4OGE A;  3M9Q A;  4C0F A;  4LDU A;  3LQ5 B;  2VWF A;  1BI3 A;  3CC7 Q;  2NUT A;  4YTL A;  1O9K A;  3HZJ A;  3RGF B;  3OW2 S;  4L6V 5;  1WDX A;  3QBY A;  3OS0 A;  2CZ7 B;  2UZD B;  2LQN A;  3FB9 A;  3DTO A;  3EHQ A;  1ARK A;  2CS7 A;  2GFU A;  5ICP B;  2EQM A;  2W10 A;  3OYL A;  2O4X B;  2WEV B;  3CCL T;  4MZT A;  4Z8A A;  2QDL A;  3JCM f;  4BCM D;  4EMG A;  1OIU B;  4M77 B;  1U1T A;  1OU9 A;  4PLI A;  4LDX A;  5GAN f;  1SSF A;  4RTV A;  5HK0 A;  1E7P A;  2ENM A;  2EYQ A;  4M75 F;  2HSP A;  2I0N A;  5A0L A;  4L59 A;  2EQK A;  5CR2 A;  3OS1 A;  1JXM A;  3OY9 A;  2CH4 W;  1BB9 A;  1XJW B;  3CBP A;  3GF5 A;  1KD1 R;  4F04 B;  3I5S A;  1T0J A;  3M0S A;  1XNI A;  1WHJ A;  1W70 A;  2FPE A;  1H92 A;  3I56 A;  1OQK A;  4FSS A;  1WHH A;  2KVQ G;  5DY9 A;  1YJ9 A;  1TWB A;  2KI7 A;  4JLG A;  1KQS A;  1OOT A;  3NTK A;  1JXO A;  1JSU B;  4LUE A;  4HKE A;  4QVZ A;  3CC2 T;  2AZS A;  2QTV A;  1ACM B;  2ED0 A;  3HPW A;  4IUP A;  4F7U G;  2AHJ B;  2NUZ A;  3FRN A;  3GOX A;  1FKM A;  2DM1 A;  2V8I A;  1UGV A;  2QDY B;  2NUP A;  3TSW A;  2P0K A;  4EDU A;  5EC7 A;  2DYB A;  4F17 A;  2CRE A;  2LMJ A;  4ATO A;  1SRM A;  1VOM A;  1UGS B;  4Z02 A;  4GBQ A;  4FIB A;  3CMA T;  3CCE Q;  3JCM d;  4CFN B;  3I5R A;  3JV3 A;  1GY3 B;  2DXT A;  1W1F A;  3CXC A;  5GAN d;  4ZGJ B;  2W9Z A;  1BI0 A;  1UEC A;  1JJ2 S;  2MWP A;  4C8Q E;  5J26 A;  4JJB A;  2HBW A;  3DB4 A;  1H24 B;  2DXB B;  3MO8 A;  1QVF A;  2WAC A;  1MMA A;  1VQ9 Q;  2J6F A;  2WHB B;  3G6E A;  5GAN 6;  4BCK B;  2MCN A;  3CC4 A;  2O9S A;  5KE3 A;  1KSW A;  1AD5 A;  4Z89 A;  2P84 A;  1KG1 A;  4E2F B;  1YJN A;  1G3T A;  1UB4 A;  2D0Q B;  2HD0 A;  4XTV A;  2XDB A;  1AEY A;  4HVW A;  2DME A;  4X9D A;  3TN8 B;  2P0P A;  1VQ9 T;  3V7S A;  2K6D A;  4MZP A;  1XO2 A;  4BD3 A;  3NFC A;  1TS9 A;  4DEX A;  2RNA A;  2WMB B;  4PJJ A;  2CYZ B;  2YLC A;  4C5G A;  4BE0 A;  4C8Q C;  1I4K 1;  4PFZ A;  2KQW A;  2GQI A;  3CCQ Q;  4C0D B;  2H3E B;  3I55 Q;  2EGC A;  4ZTF A;  1VQ7 A;  1GBQ A;  4NST B;  3MPU B;  1SRL A;  1W4S A;  4IUT A;  4QQD A;  5DM7 R;  1N8R C;  3JB9 H;  1VQO Q;  2JN0 A;  1HD3 A;  4E47 A;  2RK1 A;  1S72 T;  3VS2 A;  1BCO A;  2DIL A;  1VQ4 Q;  3HP9 A;  1YN8 A;  3FJ5 A;  4M7A F;  1YHQ A;  1BU1 A;  4AFS C;  3M59 A;  4TVR A;  3VV0 A;  2VB6 A;  2M51 A;  3OS2 A;  2DX1 A;  4MDX A;  2EPD A;  2DL7 A;  2QF7 A;  3OBY A;  2W96 A;  1EX4 A;  4LXC A;  3BFM A;  4M7D G;  3CCM T;  1F1B B;  2DFU A;  3OYM A;  4IUQ A;  3CPF A;  3V8L A;  3CCR T;  2MIO A;  1H25 B;  3TCJ A;  2RJC A;  4F7U F;  5DQW A;  2W99 A;  2PTK A;  3MP1 A;  1TFB A;  1KC8 R;  1C6V X;  1AOJ A;  3BLR B;  4E7L A;  3CCJ A;  2L3Q A;  1M8M A;  1UGQ B;  3QJ6 A;  2LCC A;  1Q7Y U;  3VYG A;  1X75 C;  4M75 E;  2K7A A;  3HTR A;  2EJF A;  3SB2 A;  3MJX A;  4AI6 A;  4ZN3 A;  1ZUU A;  1KC8 C;  3EOC B;  4C92 B;  4EPC A;  4CFW B;  2C5O B;  3FJP A;  3L2Q A;  2QAS A;  3OYN A;  1OZ2 A;  3A8O B;  3M0Q A;  4BY7 X;  1VQN Q;  1IGU A;  3GNF B;  3NPF A;  5A0D A;  2JM9 A;  3PNW C;  3OYB A;  1JEG A;  2HEQ A;  3VS4 A;  2LQ8 A;  4JPB W;  3J81 E;  2DBM A;  1AZG B;  2VC8 A;  2AIR B;  3RKY A;  1JB0 E;  2CP6 A;  3QO3 A;  4MDW A;  3RNJ A;  5IDP B;  1M1F A;  5LJ5 f;  3LGF A;  2QQB A;  3A1P A;  4FU6 A;  3CME T;  4M75 C;  2L2P A;  1ZLM A;  8AT1 B;  4XK8 E;  4IUV A;  4EMH A;  5KYX B;  2DXC A;  2EVR A;  4XU3 A;  2D6F A;  5FRO A;  2R57 A; 
#chains in the Genus database with same CATH homology
 2HQE A;  4M7A A;  3OYG A;  3INZ A;  2DXC B;  2DD4 A;  2E6Z A;  2PQW A;  3P8H A;  1UGP B;  1RI0 A;  3FLG A;  1VQ6 T;  4M7A B;  3KUF A;  2LQK A;  4L5G A;  3OYC A;  2EJG A;  2DD4 B;  5GAN 4;  4JJN K;  1W2B S;  4M7D B;  2DAQ A;  2XU8 A;  3MET A;  5A2Q E;  5GAO l;  1NPR A;  3UWN A;  2LRQ A;  2GFA A;  1X01 A;  1K8A U;  2L89 A;  1XTD A;  1Y96 B;  3OYA A;  4OVA A;  2V8K A;  3OYY A;  3ZEH A;  4LDW A;  4M75 D;  2PU9 B;  1Q81 C;  2WSE E;  3CEY A;  5DLQ E;  4NOY A;  4M77 C;  3RMQ A;  3G4S T;  2GQV A;  2EWN A;  1D3B A;  3UT1 A;  4DQ2 A;  3WXM B;  3HL8 A;  1Q86 C;  3HRS A;  1VIE A;  4F7U A;  3MEA A;  4XU0 A;  3J7A F;  3BDL A;  1D3B B;  4LD6 A;  3DLL A;  1W2B A;  1YBY A;  5HY6 A;  5GAO r;  1BYM A;  2EFI A;  2P0Q A;  2A3L A;  3QWL A;  1Q81 U;  3OSS C;  4XTU A;  3GNG A;  3JCM e;  3OYJ A;  1YJW T;  3V7C A;  3H8Z A;  4PNO A;  2ZPE B;  2O01 E;  1Q86 U;  2X4W A;  5I2S A;  3CCQ T;  3VYH B;  3DB3 A;  5D6W A;  4BBR M;  4PLL A;  1VQL T;  2PUK B;  1Q82 U;  1KQ2 A;  4GY5 A;  4II1 A;  2YRV A;  3P8B B;  4JRI A;  4OGC A;  1FWZ A;  1BIB A;  2LCL A;  4NS5 A;  4C8Q D;  4N4H A;  3I55 T;  1QVG S;  5FRN A;  3M55 A;  3M54 A;  3JCM h;  4M7D F;  1M4Z A;  1N27 A;  1BI1 A;  4MMK A;  4EMK C;  4PJO D;  4M77 D;  4C8Q B;  3S6W A;  2MMP A;  1N9R A;  2L8D A;  1O75 A;  2RHY A;  4PL6 A;  5LJ5 d;  2EQU A;  4HA8 A;  1AHJ B;  2FB7 A;  3H6Z A;  4KUL A;  5FU7 C;  3QG1 A;  5M9O A;  2E10 A;  1YIJ A;  1VQO T;  3J80 E;  4XTY A;  4QSH A;  3SWN B;  1H3Z A;  3EFS A;  3HFO A;  3S3M A;  4BE2 A;  2RA2 A;  3M57 A;  3ZFJ A;  3CCE A;  4O5V A;  4NL2 A;  1WJQ A;  4ME7 A;  5GAM e;  4HNV A;  1WPY A;  2DKG A;  1VQN A;  3QKJ A;  4A4H A;  3X20 B;  1VQ4 T;  4M78 C;  4BI3 A;  2V8J A;  2B8A A;  2E41 A;  4HLQ A;  3LYI A;  4XU1 A;  2CGH A;  5CKH A;  2KDS A;  3L2Z A;  3JB9 I;  3R6O A;  2EAY A;  2QQ9 A;  3JCM c;  4N0A C;  3GLX A;  3RMS A;  4J5Y A;  2RK2 A;  3QYB A;  2VGN A;  2QQA A;  3M56 A;  3TW7 A;  4M75 G;  2X4X A;  4RG8 A;  5GAM h;  5GAN g;  2RJF A;  3E9G A;  5IT9 E;  3JCM Q;  2DZC A;  3E19 A;  3KHI A;  2LTO A;  4C92 C;  2M16 A;  4E7I A;  3CD6 A;  4ZGD B;  5FU6 C;  1M8V A;  4FT2 A;  1N9S A;  4FT4 A;  3EFR A;  4MZM A;  2RJE A;  5GAN 5;  3PIP A;  3JB9 D;  5I2M A;  4J7I A;  1LOJ A;  4HT8 A;  1HXD A;  2DJZ A;  1M1K C;  3E9F A;  3HSB A;  5FLX E;  1M9S A;  5D6Y A;  4ZGE B;  4C8Q F;  1LNX A;  3QUI A;  4XTX A;  5KCO A;  5CQX A;  1K73 C;  1GXI E;  3MHX A;  1WQ7 A;  4OF1 A;  3KBG A;  4OB0 B;  4N4G A;  4PJO F;  2X35 A;  4R56 A;  5CCA A;  3HKS A;  5CKB A;  4PKC C;  2Y4X A;  5GAN j;  2QFZ A;  3A8G B;  3CPW S;  1QLB A;  1XQH A;  2E64 A;  4J7F A;  2M1H A;  1K9M C;  2XDP A;  2XHC A;  4JLI A;  2QQ8 A;  4JX6 A;  3LH0 A;  4IUU A;  4A4G A;  1M1K U;  5LJ3 f;  3CXC S;  4Z6Y A;  4BAC A;  3AHU A;  2RM4 A;  3M58 A;  3BG5 A;  2RI2 A;  3NTI A;  4M77 G;  1K73 U;  3QZ9 B;  1NE8 A;  2KMT A;  3C12 A;  2JNG A;  2KSS A;  3WVE B;  2ZCF B;  1B34 B;  1U1S A;  1VQM A;  2QXF A;  4F7U E;  1YJW A;  1K9M U;  5GAM j;  4X34 A;  4B9W A;  2RB6 A;  2K57 A;  4XQ3 A;  1BI2 A;  4X9C A;  3CCQ A;  4E7J A;  3RER A;  2LT1 A;  3E1S A;  3CPW A;  5LJ3 g;  2FYK A;  4HCZ A;  4HNU A;  3FC3 A;  3QZ5 B;  2EIF A;  1VQN T;  5A0G A;  2L3R A;  2CZ0 B;  1M5Q 1;  5GMK m;  5CQY A;  4AKH A;  3JCM b;  3JCM J;  3FEO A;  3CCL A;  5DLO A;  1MHN A;  2C06 A;  2XK0 A;  2FVU A;  4A4E A;  5CKF A;  4M7A C;  3C95 A;  2QI2 A;  4JUV A;  4DOV A;  1VQO A;  2DIQ A;  3UDC A;  1IRE B;  5J3B A;  3ER0 A;  2XG8 D;  5CK9 A;  3CD6 T;  4M7D A;  3A5Z B;  2K5L A;  3CCS A;  3URG A;  1WNL A;  2LNV A;  3MEW A;  2GCX A;  4BI8 B;  2R58 A;  5LJ3 j;  3OYD A;  3I56 T;  2KMG A;  3CCU T;  4OB1 B;  3VKG A;  1PSE A;  2K2V A;  1VQ4 A;  3RIR A;  3GIB A;  3CBM A;  3OMG A;  4LDY A;  1Y96 A;  3TEE A;  4C0D C;  4E7K A;  5IN1 A;  3OS5 A;  3HO8 A;  1MGQ A;  3RKX A;  3C94 A;  4AKG A;  1I81 A;  4M78 G;  2JTM A;  2VXF A;  2DO3 A;  4J8O A;  3C4S A;  1UEB A;  2JTF A;  4QQ6 A;  3ZBD A;  4B9X A;  5GAO p;  4J6Y A;  1YCY A;  3A8M B;  2WSF E;  4OGE A;  3M9Q A;  2H3J A;  4C0F A;  4M75 B;  1VQK T;  4LDU A;  4P5N A;  4M78 E;  3V8J A;  1BI3 A;  2JUF A;  3DKM A;  3PTA A;  4BY6 B;  3TRE A;  2P4T A;  4YTL A;  5KCH A;  1Q82 C;  4IKF A;  4M7D C;  3HZJ A;  4QQG A;  3OW2 S;  4L6V 5;  2QQR A;  2DTI A;  3QBY A;  3OS0 A;  3L2W A;  2CZ7 B;  2BS3 A;  2Y90 A;  1VQM T;  2KR6 A;  4MIM A;  3FB9 A;  3QYE A;  2BIV A;  3HFN A;  2BS4 A;  3A8H B;  3JSC A;  5LJ3 d;  3OA6 A;  2HAX A;  5FRM A;  3A8L B;  2CS7 A;  4C92 E;  2JOY A;  2GFU A;  3OMC A;  2RD1 A;  5CIU A;  1VQ5 T;  1TH7 A;  2EQM A;  2JVV A;  2O4X A;  3OYL A;  3HB9 A;  1X6O A;  3OB9 A;  1NZ9 A;  4C8Q A;  4D6W A;  2LVM A;  2O4X B;  4QW2 A;  4RKU E;  4MFD A;  4MZT A;  3CCL T;  5GMK e;  4PJO A;  2CKK A;  3JCM f;  4EMG A;  3SWN A;  3OW2 A;  1VIF A;  3M4G A;  5KH6 A;  2MF2 A;  4IUR A;  3HRU A;  4M77 B;  5GAO q;  2EKO A;  1U1T A;  3VUB A;  4PLI A;  1I8F A;  3LWI A;  3V7R A;  2PVD B;  3M53 A;  5GAN f;  4LDX A;  3LWH A;  3ME9 A;  1SSF A;  2XKO C;  2RHU A;  5AYF A;  5HK0 A;  1UGR B;  1E7P A;  5GMK h;  2EYQ A;  1KQ1 A;  3CCS T;  4M75 F;  3QSU A;  1KHC A;  2ZPH B;  3BY7 A;  4JDS A;  3L2U A;  4DOW A;  5A0L A;  3M4Y A;  1R8O B;  3JCM g;  4HNT A;  2EQK A;  2K5F A;  3CBO A;  3FIF A;  4L59 A;  4BUG A;  3VKH A;  3MEV A;  5CR2 A;  3SDZ A;  3QDR B;  4A4F A;  3OS1 A;  3CC4 T;  1KQS S;  4QVD A;  3QHS A;  2E1H A;  5GAN 3;  2WJ9 A;  3QJY A;  3OY9 A;  4R55 A;  1YIT A;  2X4Y A;  3CBP A;  3PMI A;  1QP3 A;  3CCV A;  2ZGW A;  3GF5 A;  5GAM f;  2RI5 A;  3BG3 A;  1H64 1;  1VQP T;  4HCC A;  1XNI A;  2E6N A;  3SFM A;  4MML A;  4EMK B;  1VQ8 A;  2YHT A;  4AKI A;  3I56 A;  3CCU A;  2DPP B;  4XAX B;  1FX7 A;  4BBS M;  2QEX A;  5FU7 B;  2IG0 A;  5IAY A;  2KVQ G;  3PFS A;  4M7A E;  3OYF A;  4OB2 B;  5DY9 A;  2D9T A;  3GPL A;  4JLG A;  1YJ9 A;  3GP8 A;  1KQS A;  4M7D E;  2K3X A;  5GAM g;  1U8R A;  4M77 F;  1G3W A;  1VQP A;  4M78 D;  2OTJ A;  2E5Q A;  3NTK A;  4FM4 B;  2CZ6 B;  2IVW A;  3QXE B;  4HKE A;  2QA4 T;  4QVZ A;  3CC2 T;  1WJS A;  1PSF A;  1VQK A;  4J6X A;  2PVG B;  4N0A A;  2BUD A;  3HPW A;  4IUP A;  4ELZ C;  3BG9 A;  2AHJ B;  3FRN A;  4F7U G;  5GAO n;  1FKM A;  3GOX A;  4NC6 A;  1NPP A;  2MWO A;  2YLB A;  2V8I A;  5EG2 A;  3G71 A;  2RI3 A;  1B34 A;  5LL6 S;  4C92 D;  2QDY B;  2BKD N;  3X25 B;  2P0K A;  4EDU A;  2K3Y A;  4E7H A;  4FSX A;  4M6V A;  1YI2 T;  4ATO A;  1LJO A;  1UGS B;  4Q5W A;  4Z02 A;  3RES A;  3JCM V;  4FIB A;  3CMA T;  1QVF S;  3MP6 A;  3JCM d;  1VQ5 A;  3MCA B;  2WSC E;  4LOC A;  2DXT A;  2L5Q A;  3MEU A;  3WVD B;  1ZBX A;  2OTL T;  1BIA A;  3CXC A;  1N6A A;  2M0O A;  5GAN d;  3CC7 A;  1QVP A;  5LJ5 e;  4LD9 K;  5CKE A;  2DIG A;  3LGL A;  3SD4 A;  4BI4 A;  3JB9 F;  2RHZ A;  4ZGJ B;  1YIT T;  1BI0 A;  4PJO B;  2DD5 B;  2DXB A;  2MI6 A;  1JJ2 S;  3CCV T;  2MWP A;  3FDR A;  3G7Z A;  4C8Q E;  4J6W A;  5J26 A;  3DB4 A;  2DXB B;  2R5M A;  3MO8 A;  3OYE A;  2HBP A;  5GAO m;  2WAC A;  3MP8 A;  2QDJ A;  2FL7 A;  1QVF A;  4M78 F;  1S72 A;  4O6J A;  5LJ5 h;  2A7Y A;  3L42 A;  3G6E A;  5GAN 6;  1QVG A;  1VQ8 T;  4JRK A;  2ZZD A;  5GAM d;  2QEX T;  1XOV A;  2KY9 A;  3CC4 A;  4OMF B;  4KBM B;  1Y07 A;  5KE3 A;  2OAU A;  2ZZD B;  2MAM A;  2VUB A;  1YJ9 T;  3BW1 A;  1KG1 A;  4C5I A;  3BDU A;  1VUB A;  1YJN A;  4ELY C;  2HNI A;  5CAI A;  3VKI A;  3OSV A;  2OTJ T;  1G3T A;  1UB4 A;  2D0Q B;  2EJ9 A;  2FHD A;  3JRZ A;  4M75 A;  1JRI A;  2F5K A;  5GMK l;  2HD0 A;  4XTV A;  4MFE A;  3CCJ T;  4BDZ A;  2XDB A;  3KXT A;  5EJC A;  2VXE A;  3PT9 A;  4X9D A;  4CI0 C;  3EAE A;  4M7A D;  1G5V A;  1WJR A;  1Y71 A;  3PGG A;  4RCC A;  4M7D D;  2P0P A;  3LLR A;  3OYI A;  3X28 B;  2E65 A;  3QII A;  3X26 B;  3V7S A;  4MZP A;  3CCM A;  3G71 T;  4C92 G;  4BD3 A;  2G77 A;  2ZPG B;  3F70 A;  3NFC A;  3CCR A;  1VQ9 T;  3JB9 J;  4A54 A;  4JS4 A;  3OYK A;  1OYX A;  1ZHI A;  2RHX A;  2CYZ B;  2YLC A;  2E12 A;  2K5I A;  4PJO E;  2ZPF B;  4C5G A;  4BE0 A;  4C8Q C;  1I4K 1;  2KQW A;  2PUO B;  2QA4 A;  3CC2 A;  1KHI A;  4OB3 B;  4PJO C;  2LDM A;  4C0D B;  4ZTJ A;  5LJ5 j;  3L2V A;  4ZN1 A;  3SWN C;  1QW1 A;  3PIO A;  1WGS A;  2XID A;  4JX5 A;  2F5T X;  3CC7 T;  4ZTF A;  1O9S A;  4Y91 A;  3VUZ A;  4M77 A;  4RCB A;  4JS5 A;  1VQ7 A;  4HT9 A;  1V29 B;  3L1A A;  4KUD K;  5GAN 7;  3V8K A;  4F7U B;  1W4S A;  2RJD A;  4IUT A;  4QQD A;  5DM7 R;  1YI2 A;  4BDY A;  1N8R C;  4A53 A;  3JB9 H;  1FXX A;  2VV5 A;  2JN0 A;  2LT4 A;  3M5A A;  2ZPI B;  2GF7 A;  4E47 A;  5CO7 A;  3CMA A;  1HK9 A;  3TW6 A;  5CKD A;  2RK1 A;  1S72 T;  2QQS A;  3NTH A;  2I2L A;  4HL4 A;  4XTW A;  3G6E T;  4JX4 A;  1JBM A;  4JRQ A;  5GAN e;  3HP9 A;  5KE2 A;  3RKW A;  3OBW A;  4XTZ A;  4M7A F;  4UC4 A;  1N8R U;  1YHQ A;  3M59 A;  4TVR A;  3P8D A;  3VV0 A;  2KAF A;  3QPH A;  3OS2 A;  3JB9 G;  1YJN T;  1NJI C;  3DLM A;  4MDX A;  2QF7 A;  2XI9 A;  3QYH B;  3OBY A;  1WQW A;  4EMK A;  5GAN h;  4C0Z A;  2M9U A;  4XU2 A;  4M7A G;  2RH2 A;  3BFM A;  2DVE A;  4M7D G;  1I5L A;  3LX7 A;  4RMO A;  1M90 C;  2XD0 A;  1M1G A;  3CCM T;  2G3R A;  4OP0 A;  4QVC A;  3OYM A;  4IUQ A;  1NJI U;  2DTH A;  3CPF A;  3HHT B;  3CME A;  3V8L A;  1OZ3 A;  4NL3 A;  3CCR T;  1BKB A;  3TCJ A;  3TU4 K;  5C6S A;  4LDV A;  1Q7Y C;  5J39 A;  2RJC A;  4F7U F;  3MP1 A;  1IZ6 A;  3DL1 A;  3VJP A;  1DJ7 B;  2LC4 A;  5I21 A;  2RO0 A;  2CZ1 B;  4M78 A;  3VU3 C;  1KD1 C;  2DK3 A;  4VUB A;  4E7L A;  3CCJ A;  4HCB A;  3OQ5 A;  4J83 A;  2HQX A;  1M90 U;  4M78 B;  2DXU A;  2LX9 A;  1UGQ B;  3QYG B;  3PMT A;  4WF2 A;  5GMK j;  2Y4Y A;  3LW5 E;  3QJ6 A;  4DA4 A;  2LCC A;  4C5E A;  1Q7Y U;  3VYG A;  2EQJ A;  1X75 C;  1VQ9 A;  2ZPB B;  4M75 E;  4CRI A;  1VQ6 A;  4A4K A;  1VQ7 T;  3ASK A;  4C92 A;  2DEQ A;  2EJF A;  3VYG B;  5HK3 A;  3SB2 A;  1KD1 U;  4AI6 A;  4ZN3 A;  5LJ3 e;  1KC8 C;  1G3Y A;  4C92 B;  4EPC A;  5FU6 B;  2KK4 A;  2F69 A;  3FJP A;  2DTO A;  2XDD A;  3L2Q A;  3OYN A;  1OZ2 A;  3A8O B;  2E70 A;  5GAN 8;  4BE1 A;  3T9N A;  2VYT A;  3G4S A;  3S3O A;  3HBL A;  1QP2 A;  2PVO B;  3GNF B;  5LJ3 h;  4C8Q G;  2BS2 A;  2QTX A;  5A0D A;  1KC8 U;  2OTL A;  4ELJ A;  3PNW C;  2JZ2 A;  1ZQ1 A;  2DD5 A;  2NLU A;  3OYB A;  2LQ8 A;  4PJO G;  1YHQ T;  3H4C A;  3X24 B;  3J81 E;  3N5B B;  4V2S A;  2RHI A;  5HKC A;  1RL2 A;  2VC8 A;  1Y7X A;  3JCM W;  4KT0 E;  3Q1J A;  3RKY A;  3JCM P;  1YIJ T;  5CVI A;  5GMK i;  5D6X A;  1JB0 E;  4Y28 E;  5GAN 2;  3HRT A;  4M77 E;  3QO3 A;  4MDW A;  3UPU A;  3O8V A;  1M1F A;  4N4I A;  3CCE T;  2R5A A;  3L2R A;  3OYH A;  4JRP A;  2DZ9 A;  3S3N A;  1VQL A;  5L8R E;  5LJ5 f;  4C5H A;  2XIC A;  2VGM A;  3RUX A;  1G3S A;  3LGF A;  2QQB A;  1P92 A;  3I55 A;  4FU6 A;  3CME T;  4M75 C;  4RG2 A;  4FL6 A;  3JAM E;  1EIF A;  1OI1 A;  4XK8 E;  4IUV A;  4BY6 C;  2X4J A;  4C0G A;  4EMH A;  4C92 F;  4KUI A;  4BB7 A;  1JJ2 A;  1K8A C;  2DXC A;  2D6F A;  4GLK A;  4XU3 A;  2K4Y A;  5C0M A;  5LJ5 g;  5FRO A;  3JCM X;  2R57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...