2DPPB

Crystal structure of thermostable bacillus sp. rapc8 nitrile hydratase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLAFGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIPRREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratse
rcsb
source organism Bacillus sp. rapc8
molecule tags Lyase
total genus 62
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2dppB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dppB02
2DD4A 4FM4B 2ZPGB 2ZZDA 2ZPBB 3VYGA 2WSFE 3LW5E 4ZGJB 2WSEE 4RKUE 3QZ9B 2PVGB 1GXIE 4OB3B 3A8MB 3QYHB 3A8LB 2D0QB 4OB0B 1PSEA 2DXBB 5L8RE 1QP3A 1IREB 4KT0E 2AHJB 1QP2A 3VYHB 2DD5B 2PU9B 3HHTB 2O01E 4OB2B 3A8HB 2CZ6B 3X26B 4ZGEB 2CZ7B 2DXCA 2PUKB 1AHJB 3X28B 2DD4B 3A8OB 2ZZDB 3WVEB 2ZPIB 2ZPHB 1JB0E 1PSFA 2WSCE 2PVDB 2ZCFB 3A8GB 3X20B 2CYZB 1UGSB 2DXBA 3X25B 1UGRB 4L6V5 2DPPB 4OB1B 2QDYB 2CZ1B 2PVOB 4Y28E 2PUOB 2CZ0B 4ZGDB 2ZPFB 2DD5A 2ZPEB 3QXEB 3QYGB 3QZ5B 3VYGB 1DJ7B 1UGQB 3X24B 4XK8E 3WVDB 1V29B 1UGPB 2DXCB
chains in the Genus database with same CATH superfamily
4MZPA 4CRLB 1TTHB 3ER0A 2GQIA 3J81E 3PT9A 4N4HA 3OYKA 2XK0A 2GCXA 2AKLA 2KNBB 1D0YA 1VQ4Q 4ZGJB 3RMQA 1QVFS 1EFNA 3OS2A 4BE2A 2PJQA 2RQVA 4JLIA 3BG5A 3TQ7P 4J8OA 3M9QA 2DF6A 2JGZB 3QPHA 2DXBB 1UGVA 1W2BA 4OP0A 3CBOA 5KYYA 2C6TB 3RKWA 5GAN6 5CK9A 5GAMj 3VS6A 2FPFA 2DNUA 3VUBA 5KH6A 4PJNA 1QVPA 2WACA 1Q95G 1CSKA 4XTVA 1RAIB 2A7YA 1QCNA 1NYFA 2RF0A 3M0SA 1O9KA 3VS5A 5EG2A 2RN8A 2XU8A 4ZTJA 4F7UE 2LVMA 3X28B 4BCQD 2C5VB 1Q82U 3OMGA 1N4MA 4ESRA 5GAN2 2D9TA 2YXYA 2YRDA 3JCMP 4K11A 4Q5WA 2R5MA 1K9MR 1PHTA 3EGDB 2KR3A 4E7ZA 1WHJA 1UDLA 2ABLA 3EG9A 4RTZA 4JJNK 4JPBW 3G33B 2X4JA 5HCKA 3CMEA 2RQTA 1WYXA 4RMOA 1M90C 3SDZA 4EMKC 4M77C 4KUIA 4DOWA 4FT2A 1YWOA 3G4ST 1WA7A 2V8KA 2V8IA 5I2SA 2A36A 1VQ8T 4FW1A 4JZ3A 1V29B 1M1KU 5CKEA 2CP3A 2HBWA 1WXTA 1VINA 2OTJA 2EYXA 2DO3A 1I0CA 4F7UA 3B57A 4EOJB 1M27C 3JCMc 4JS4A 5HK3A 4HLQA 4PJOB 1KHIA 2BS3A 1ZX6A 3H4CA 3CD6T 1QCOA 1OU9A 4CFWB 1TUCA 4O6JA 1QLYA 1RL2A 2C0TA 1H4LD 3SB2A 2NLUA 2VXEA 2RMOA 4X1VA 5GAMg 2O4XA 5GJWB 5CYIB 2IW8B 4PJOF 3DLMA 2RO0A 2AHJB 1WLPB 2FZCB 4AG2C 3FIFA 1ZHIA 1N6AA 4M77D 1SHFA 2QTXA 1UNLD 2ED1A 1BI0A 1TFBA 2RHUA 4QKUA 1WHHA 4M7DG 1H92A 3QDFA 3CQTA 3G6EA 1SRMA 4BY6C 2C5OB 3JCMg 1GL5A 1WNLA 4HCKA 2KY9A 3DLLA 4JDSA 5GAMf 1NJIR 3EG1A 2DFUA 1YJNQ 2PNIA 2OTJQ 2BUDA 1VQMA 1G3WA 3M56A 2GF7A 2P0KA 1YITT 2E3IA 1SSFA 4PJMA 4XTYA 3NPFA 4CFXB 3JV3A 5CEIB 5KYXB 1BKBA 2BE7D 1MV0B 4Z6YA 5GANg 3V8JA 1H1QB 4KUDK 1MMGA 4HT8A 2RNAA 1OV3A 2YHTA 1XQHA 4GLKA 5A0LA 2QQ8A 2QF7A 1TWBA 2DYIA 1VQLT 3TW6A 3EFRA 3OYBA 2JOYA 1K73R 4LXCA 4ELZC 1IHVA 1TUDA 2W99A 4AKGA 2H8HA 2RH2A 3I56T 4NL2A 4EC8B 4RTUA 3JB9F 1FYNA 4LDYA 1T3LA 3BW1A 1VQ9T 2J05A 4HCCA 4BE0A 4VUBA 5GANf 2ZPBB 5LJ3h 3CPWP 4BACA 4FCYA 5EC7A 1NG2A 3KBGA 4C5HA 1PKTA 4D8KA 3QKJA 1VQMQ 3QZ9B 3VKGA 1PCXA 2K7AA 3URGA 3G71A 4XU2A 2QA4A 1WJRA 4ROCA 2BS4A 2DTIA 3F70A 2LCLA 3A8LB 2KYBA 4M75E 3CC7A 1VA7A 1VIFA 2HQEA 2VC8A 1VUBA 1C9BA 1GY3B 5A2QE 5GAN3 2DL3A 1K8AR 4CFUD 4N0AA 1VOLA 3MEAA 4IMYB 3RESA 4DEYA 1WQ7A 2C0OA 1ZP2A 1R0BG 2CT3A 2QQRA 3BG3A 3TNIB 5GAN7 3K7AM 2FG0A 2LQNA 4HVVA 3QWXX 3V8KA 3GF5A 2O01E 3LGLA 3CXCP 2R7GA 4OR5B 3BG9A 1BCMA 1D0ZA 4J9BA 4BD3A 2DXCA 5M9OA 4BBRM 1OYXA 3JB9H 2XICA 2MWPA 2F2CA 1K76A 2OTLT 1HJDA 2ED0A 4EOIB 2UZBB 2X35A 1GFDA 4BCIB 3OYCA 4J5YA 2CDTA 1I5OB 1U8RA 2ECZA 4DBHA 2UZDB 4ATOA 1GBRA 3JCMb 3VKHA 1KD1U 4ROEA 1WZOA 4OGEA 4M75A 4BCOB 3G71Q 3TVTA 2M02A 2XDDA 2KT1A 3HRSA 3CC7Q 3OYHA 5FRNA 3LGFA 3FB9A 4OMPA 2RHXA 1YWPA 2JTEA 2C5NB 1GCPA 2K5LA 2QGFB 3OYJA 2JXBA 3FJPA 4CC4B 2Y4XA 3EFOA 2E6ZA 2EPDA 4LDUA 3WVDB 1N9RA 2XDPA 5GJVB 3CBMA 1VQOT 2XHCA 1NLPC 3MEWA 5KYXA 1OI9B 1K1ZA 1KQSP 3M5AA 1GCQC 5IDNB 1RADB 3QHWB 1ZSGA 4KULA 2WJ9A 3CXCA 2HKQB 3OW2S 1Q86R 1MV3A 3F5XB 1M1GA 1LPLA 1WXUA 3E19A 2EYYA 2JW4A 2YUOA 1OI1A 4MMKA 1AD5A 4X9DA 2OI3A 4QW2A 4JX5A 2WMBB 1H26B 5J39A 1UHCA 1VQ5T 4JS5A 1H27B 2E1HA 2OX7A 3D7SB 1IREB 3MEVA 1TD6A 4M7AG 4HKEA 4EOOB 4A4KA 1I5LA 3WXMB 5IAYA 1RACB 3KUFA 2MF2A 2VV5A 4MMLA 2DRMA 1XNIA 3CC2Q 2E41A 2DEUA 4B9XA 4FT4A 2JS2A 2J6OA 1UJYA 2E3HA 4WF2A 4E7IA 1YFNA 3OBYA 5LJ5d 4BCND 1XOVA 2JT4A 1HD3A 2NYSA 4PJOG 2A08A 2DETA 4C0ZA 5GMKm 1T0JA 1WIEA 4C5GA 3NDQA 2KRSA 4CI0C 1MUZA 2O2OA 5CQYA 1I07A 3O5ZA 4BY7X 3KHIA 4XTZA 3BHVB 2GGRA 1JSUB 1ZBXA 2WPAB 1CKAA 2QYZA 1N27A 2R5AA 5GANe 2LJ1A 3CPFA 1VQKA 4D8DA 2QAZA 2QDYB 5GAOp 2I40B 2UZEB 2NUZA 2H3JA 2DL7A 4PJLA 1YHQA 2ZPEB 1DJ7B 4BI4A 2CH4W 4O5VA 4BBSM 2YUPA 1OKVB 1X43A 4BDZA 2VASA 2MAMA 2DVJA 1OL1B 2LQWA 5AT1B 4PLIA 5EJCA 3HFOA 4EMHA 1VQPQ 2CSQA 3G1JA 2VGMA 4R56A 1FX7A 2FO0A 3O8VA 2B86A 2EJFA 1M3AA 2EKHA 2E12A 2K3XA 5LQFB 2QQAA 2QEXT 4PJOC 3OA6A 1NE8A 5IT9E 4YOSA 5KYUA 3SHWA 2K79A 4Z89A 1CKBA 1VQ6Q 3E9GA 9ATCB 1YIJA 2DM1A 2B8AA 5GAMd 3JB9G 4KBMB 3VYHB 3C4SA 2EVRA 3FRNA 1AWWA 2PU9B 4G6LB 3OYMA 1OEBA 3X26B 4F14A 3CCUA 5GAN8 1Q81C 5FU6B 4QT7A 2EGAA 3VKIA 1NZ9A 1Q82C 2DD4B 4JX6A 1M8VA 2QI2A 1B3QA 1UB4A 1Q7YU 3JCMd 4AT1B 2LP5A 2BKZB 4JRIA 1MHNA 3PGGA 5KYWB 3CCLA 2KSSA 2L0AA 3M4YA 3V7RA 4PJOD 5KE2A 4B6MA 3QYEA 2YRCA 1UGSB 2DMOA 4R55A 1UGRB 4M78F 4BUGA 3CCQT 2RHIA 4OB1B 2NUPA 3CMAA 1VQ4A 4F6SB 4MZTA 1M90R 4E47A 3EGXB 1YIJQ 4MZMA 1X27A 2KQWA 2W96A 3QXEB 2X3WD 1M3BA 3M0TA 3NMZC 2EW3A 4JRQA 2NUTB 1O9SA 3PIOA 1JO8A 5HKCA 2BPMB 5A0GA 4M7DE 1NLOC 5FWBA 1BI1A 5CO7A 4E6RA 2KBTA 3U23A 2CCHB 5D7UA 3FDRA 1D1BA 2FPEA 3CMET 1K9AA 1YBYA 1SEMA 1M8MA 2IIMA 4J6WA 4F6WB 3CCVA 4QQGA 3HP9A 3QYHB 2M51A 2EUFA 4CC2A 2HQHA 3RUXA 2LMJA 2RJFA 2RHYA 5GMKj 5L8RE 1Z9QA 1YI2A 3JAME 1QP3A 2IW6B 2HMAA 2GTOA 4KT0E 3QYBA 1B34B 2XIDA 1JKWA 3HKSA 3CCMA 5LJ3j 2IW9B 3UWNA 4Z88A 4JJDA 1H1PB 3CMAQ 4II5B 1XTDA 4OB2B 3SWNB 5CR2A 2CZ7B 3HRTA 5I5ZB 5GAOm 1PRMC 1Y57A 1HYOA 4PFPA 1D09B 2PUKB 1PC0A 4M7DA 1SSHA 2O88A 4QVZA 2DBKA 2QGSA 1TH7A 1X6GA 3N5BB 4E7KA 4J9IA 5IHKA 2VYTA 4E7LA 3M03A 2WFYB 4EOPB 2E64A 1R77A 1JB0E 3A8GB 1H8KA 2GNCA 5GAOn 1Y7XA 5LJ5g 3CCVQ 1M4ZA 3AHUA 1M1FA 2L3PA 1Q81U 4PNOA 3P8BB 3G6ET 3OYAA 4C92B 3NHNA 2DXTA 3ME9A 1YI2Q 2DD5A 3NTIA 3OS5A 3QHSA 3TN8B 3QZ5B 2CH4A 3CCMQ 2QG9B 3VS7A 1M2VA 4C92F 2OJ2A 4XK8E 3EGUA 4EOLB 2O31A 1UG1A 1SPKA 3PIPA 1WQWA 3CC4Q 4V2SA 5DLQE 4X9CA 2QGGA 3CCJA 2PK2A 4BCMB 2RD1A 3LQ5B 2BKDN 5LJ5f 1M2OA 2MCNA 1GRIA 3OS0A 2DYBA 3QO3A 1YNZA 2CGHA 2ZZDA 4N4IA 4IIOA 4F7NB 3A5ZB 2DZ9A 4M7AB 3UF4A 1SG5A 1Y07A 3OYNA 1RAFB 4A53A 1H25B 3TNHB 2ATCB 3FJ5A 2KMTA 4M7AF 2CP2A 2E5QA 3H0IA 1YJNA 5LJ3g 1S1NA 4QVDA 3VS0A 2COZA 5CQXA 3RIRA 3CCRA 4RTXA 1KJWA 2DL4A 3RBBB 2K5IA 3EG3A 1Y96A 3OYYA 3RGFB 4OVAA 1NEBA 1GCQA 4YOOA 3LWIA 1M30A 1ABOA 2L8DA 1N5ZA 2XMFA 2LJ3A 2QDLA 2QA4T 3POMA 1B34A 3OYFA 4KH0B 2IPOB 4C8QF 4BCPB 4IURA 1PRLC 1D3BB 1C6VX 4FX3B 3JCMX 1OPLA 3CCJQ 3MHXA 3ULRB 4BI3A 4M6VA 3PO3S 4E7SA 1VYWB 2R57A 1PM3A 4DOVA 1JXMA 1KD1C 1JEGA 2CYZB 1MMNA 4BCKB 4JLGA 3SFMA 2HZYA 3J80E 1P5EB 4UC4A 3E9FA 2DXBA 4NOYA 1IRXA 1F1BB 2CUDA 2C0IA 2KGTA 3TEEA 3HO8A 3L2VA 1X01A 3KXTA 4LD6A 3TSZA 2DIQA 5GAOl 3S3OA 1KXUA 1QVFP 1K4US 4LOCA 4J6YA 3QHRB 3CCRQ 5HQ0B 2ESWA 4GY5A 2CS7A 1LNXA 1YJ9Q 2L3SA 2Y90A 3M57A 5DY9A 1BK2A 1WHLA 1SKUB 4PKCC 2RHZA 4M78G 1FMVA 2D6FA 2M1HA 3EH1A 3JCMf 4PJOE 3IQLA 1UTIA 4DEXA 3OQ5A 4YOZA 1OZ2A 2GBQA 1RI0A 3EGDA 5FLXE 1BIBA 5D6WA 4J9FA 1N8RU 4EOKB 3RKXA 3HB9A 1PKDB 1G3SA 3CCST 1VIEA 2D0NA 1AD6A 1YN8A 2HL5C 3TU4K 1XO2A 2LTOA 4J7IA 1JSTB 3EG0A 1YP5A 3HRUA 4M7DC 2NWMA 5ECAA 2DBMA 4L5GA 4Z02A 1RLPC 2I0NA 1BYMA 1D0XA 2QASA 5IXFA 1HK9A 1S72T 2P0PA 3PMTA 3OSSC 1QKXA 1BBZA 2QXFA 1QVFA 1E6GA 4P5NA 8ATCB 2LW4A 3LLRA 2HBPA 3G7ZA 3M0QA 3QJYA 4PJOA 2DJQA 1KC8R 1KQ2A 3RKYA 2E6NA 4LDVA 1GUXB 2BS2A 5CCAA 5HBEB 3M53A 4LUEA 3VS2A 4BCQB 4IUUA 1RLQC 4F7UG 2HDAA 1LJOA 4JRPA 2K2MA 2EKOA 3JCMJ 2F1LA 3GTMS 5GAMh 4E7HA 1QWFA 1QCFA 2PMIB 2I53A 2RQUA 2YLBA 4KRCB 1UNHD 4M7DD 4EOMB 2V1QA 1FINB 3G4SQ 1TS9A 3QYGB 1UGQB 1OX9A 3GOXA 2K3YA 1W4SA 3M55A 4WCIA 2BIVA 4RTVA 2F2WA 3QJ6A 1G83A 2BZYA 2DX1A 2H3EB 3CEYA 3CPWA 5J3BA 4BE1A 4C0GA 2AKKA 2RJEA 3MO8A 1IB8A 5HNBB 3HL8A 1VQKT 3JSCA 3CC2A 3I35A 3CCET 3UA6A 3EAEA 3LW5E 2VXFA 1G3YA 2LQ8A 3Q1JA 2V1RA 3I9QA 3CD6Q 3QWYA 1YHQT 2E4HA 2A0FB 1H28B 4AI6A 4C92G 3MKDA 4LDWA 4NL3A 2K9GA 3BLQB 1ZLMA 2HNIA 4RG8A 1T3SA 1U5SA 1JJ2S 1VQLA 1QP2A 5GANh 4HVWA 1VYUA 4DBRA 1K0XA 2P84A 5IDPB 2OAWA 4HVUA 1RI9A 3HHTB 2GQVA 3I56A 4CFVB 4CXAB 1AOJA 5GAMe 4J9HA 1MNEA 3QIIA 3P8DA 2WXVB 4OMMA 3SWNC 2QQ9A 3OB9A 1VQ9A 2EYWA 2J06A 2L89A 4DBFA 1Q7YC 4FIBA 3BFMA 3VRYA 1Q82R 3TW7A 3DDQB 5IH2A 1YIJT 2FZGB 3A8OB 4HCBA 3L2UA 2J6KA 4FSSA 4XU1A 2CJMB 4J9GA 5AYFA 2X9HA 4WTOB 4M77F 1UNGD 1OU8A 4NC6A 2FHDA 1YITQ 1TSFA 1K9MU 3HFNA 2DRKA 2CP6A 4R0KA 1YJWA 1VQNT 3JCMe 5L23A 2DTOA 4ANJA 2PHGA 2JVVA 2LX7A 3S6WA 4BCGB 2LC4A 3CCUT 5FRMA 1VQPA 1BU2A 1FMWA 4NS5A 2B9RA 4Y92A 3GPLA 2BZXA 4C8QG 4ZGDB 2MMPA 1AISB 2EAYA 4C92C 4AKIA 3VRZA 5EFQB 2JM9A 1Z9ZA 1JU5C 5CKFA 3VJPA 1VQLQ 1W2BS 2WEVB 2AZVA 1NPRA 4IUQA 4OMLA 2P4RA 2KRNA 2A28A 2CP5A 1KQSA 1VQ6A 1MGQA 3H9NA 1BCOA 2OTLA 3CCLT 3PMIA 3I56Q 5IHNA 1M1KR 2F2VA 2XDBA 1UUEA 3REBB 4MFDA 2XG8D 3MCAB 1U1SA 2JTMA 4EORB 1ABQA 3VS4A 2LX9A 1I4K1 2J7IA 4KRTA 4E7JA 3H41A 1VQ9Q 4Y72B 4I3ZB 3DOGB 3GIBA 3CMAT 3P8HA 1QMZB 1VQ4T 4FYXB 3NTHA 3VU3C 4A4FA 4M7AC 1AWJA 5GMKi 1RAEB 2X51A 3RR6A 3LX7A 5I22A 2UZLB 3RNJA 1WHGA 1YJWQ 5CAIA 4QQDA 1IXDA 4X34A 4KGZB 4EONB 3T9NA 1A0NB 5LJ3d 4L59A 4C92D 1YCSB 4BCJB 4A4HA 1FWZA 1QMCA 4CC7A 2JMCA 2W9FA 2XKOC 4J7FA 4OMNA 4CFUB 3M0PA 4IUPA 1D1CA 4B9WA 2YRVA 4F04B 3QDRB 2MYSA 2M0OA 4J83A 3SD4A 2OTLQ 2DMEA 4M4ZA 1SHGA 4D6WA 1YI2T 1NJIU 1OPKA 4BCMD 3ZFJA 3INZA 2EGEA 2L3RA 1VOMA 5IN1A 1QVGP 4EOSB 4NSTB 2ZCFB 1IGUA 2EGCA 1VQ5A 2EQIA 2KT8A 4TVRA 1M5Q1 4M7AD 4YTLA 2GTJA 2I2LA 2KXCA 3OYGA 3MPUB 2M16A 3OW2P 3OS1A 1M3CA 1F5QB 3HBLA 2CZ1B 2FRWA 2PVOB 4F16A 3SEMA 4FYVB 4J9DA 1BU1A 2DK3A 4M78B 2C4GB 2YLCA 4FW2A 2RJCA 1K73U 1MNDA 2DTHA 4UN0A 2E10A 2DVEA 2CSIA 1VQOQ 5FW9A 2EYZA 5J26A 2O9VA 1O9KB 4FYWB 3L42A 2EJGA 4QVCA 1U1TA 5GAOq 3EOCB 1LCKA 4DQ2A 2ENMA 2LDMA 1RUWA 4ELLA 1R0CB 4ELJA 1R8OB 3PTAA 3LYIA 2G77A 3ZEHA 2RI2A 4ME7A 2JTFA 2J6FA 3TCJA 1JOWA 1VQ5Q 2CP7A 3M59A 2D0QB 1PSEA 3EH2A 3EG9B 1WI7A 3C94A 1K8AU 1AVZC 1QVGA 4LD9K 3CCJT 5KE3A 2KMGA 2AIRB 2FPDA 2KAFA 1RAGB 1OKWB 2DKGA 1H3ZA 2JUFA 1X69A 1TG0A 3OW2A 4LNPA 2X1NB 5KYNA 3MY1B 1IO6A 1WJSA 2M9UA 2ROLA 1K0SA 1RAAB 3JRZA 4RODA 3QBYA 1AHJB 2F5TX 2KK4A 4F7UB 4PK4A 2X4WA 1LVKA 3UT1A 1YJNT 2OTJT 1G3NC 4M78E 1BB9A 8AT1B 1G5VA 3CCRT 2ZPIB 3PE0A 2X4YA 4HT9A 1PSFA 3PNWC 2PVDB 4XQ3A 5CVIA 3CC4A 1ZUKA 1KD1R 1QWEA 4F7UF 5A0DA 3JB9D 2AT1B 1N9SA 3X25B 4F7SB 2E70A 2LT4A 3QG1A 1QKWA 2HKNA 1G2BA 1NM7A 4XU0A 3LH5A 2RJDA 3QSUA 1JQQA 2RK2A 2EYQA 4EDUA 1OIYB 4F70B 1JXOA 2V26A 4AFZC 3EJ1B 2VVKA 3OYLA 4M77G 2LZ6B 1VQ7A 1WX6A 1ZA1B 2A37A 1XJWB 2ZAEA 3PFSA 2BTTA 1Y0MA 5D6XA 2DD4A 2LT1A 2OAUA 3I55A 5CKDA 2QK0A 3I5SA 3V8LA 2GFUA 1Q86U 2MI6A 2EQKA 1TUGB 2BE9B 4ZTFA 3GNGA 4M78A 2FVUA 2Z0WA 5KYWA 1EX4A 2VKNA 5D6YA 1ZA2B 3UPUA 4AFQC 2W10A 1BI2A 5C0MA 1VQMT 5HK0A 2QEXQ 4HNTA 1N8RC 1GXIE 1OL2B 2YDLA 3V7CA 3CCQA 1H1SB 2DEQA 2KEAA 4RCCA 2COWA 2CP0A 2BZ8A 1H1RB 1UEBA 1KHCA 1NPPA 5GAOr 3EGXA 4A63B 3OY9A 2LJ0A 1D1AA 2EFIA 4BCHB 2KI7A 2NUTA 4OMOA 3MIAB 2K4YA 4XAXB 3CPWS 1PWTA 2W9ZA 4AG1C 1QLBA 1WDXA 4LUDA 5I21A 1NBEB 1I8FA 1V76A 1GBQA 4RG2A 1HXDA 3HZJA 1WHKA 4EMGA 3JB9I 1VQ7Q 4C0DB 1AWOA 3KFVA 5GANj 2O9SA 2G3RA 2YUNA 3I55Q 2K2VA 1YJ9A 2FZKB 1FKMA 4C8QB 3X20B 2F69A 2CKKA 2KYMA 4J6XA 2DAQA 3CXCS 4XTUA 3BDLA 3M0RA 4LE9A 2EBPA 3G71T 4HNUA 1KQ1A 1MMAA 3ASKA 4C92E 4DBQA 3L2QA 6AT1B 4IUTA 3CC7T 2RM4A 4OGRB 5BNJB 4HNVA 3CCQQ 3GP8A 3LWHA 1OQKA 5DQWA 1OGUB 5ICPB 2AK5A 2RQWA 4XTXA 5FU7B 1E7OA 3EHRA 3J7AF 2LCSA 5LJ3f 5I2MA 4A54A 1TU0B 3VYGB 3R6NA 2VGNA 3SWNA 3FC3A 4N4GA 2KE9A 2CCIB 1UGPB 2DXCB 1ZQ1A 5FGKB 2KR6A 1I1JA 4OGCA 4JX4A 2DIGA 1BIAA 4HL4A 3DB3A 2ZPGB 1X6BA 4Y91A 2VWFA 4M7AE 2QDJA 3M0UA 3CMEQ 4RTYA 4JUVA 3M4GA 2IVXA 4AMCA 1Y71A 1LOJA 4ELYC 2X3XD 2F5KA 3A8MB 3HTRA 4Z8AA 3HSBA 3C95A 4OB0B 4M75B 2D8JA 5LJ5h 4RTWA 1TOVA 1PD0A 4C92A 2DERA 1YCYA 1KQSS 2V22B 2HD0A 2E65A 3REAB 2LCCA 4GLMA 4EC9B 4C8QE 2HSEB 4M75F 3EIDB 3CC2T 4RUGA 3UATA 4F7LB 3NTKA 3EFOB 1H24B 4J9EA 3VUZA 4XU3A 1OULA 4AFSC 1EIFA 3ZL7C 1ZSZB 1Q7YR 4EOQB 1E6HA 2CREA 3G4SA 4ZN3A 4M7AA 1WGSA 3TNWB 2ZPHB 3JCMQ 2DJZA 2KROA 2DILA 1VQ8A 2DA9A 3BHTB 2MPXC 2GFAA 2MOXA 1K9MC 1GFCA 5KCHA 5I11A 5GMKh 2QQSA 3NFCA 4JZ4A 1ZUUA 4F17A 3G6EQ 2DPPB 1E7PA 1X75C 5FU6C 3MEUA 1M90U 3CD6A 1FMKA 4PLLA 5LL6S 3O0GD 5LMKB 2JMAA 4C8QA 5HBHB 4BB7A 2R58A 5LJ5e 4M78C 2ZGWA 5CIUA 5C6SA 3BDUA 1B07A 1YJWT 2FEIA 1V1CA 4IIMA 2K5FA 2LNHB 4MFEA 1W98B 1D3BA 1OX8A 2L5QA 3OMCA 2KRMA 2YSQA 1VQPT 3META 1IHWA 3VYGA 4KGVB 2WSFE 3AT1B 2G9XB 2YT6A 2RQRA 2MK5A 4PJJA 3FEOA 3DTOA 3S3MA 2PVGB 1JBMA 2WHBB 5DQVA 3MJXA 1VQ8Q 3BLHB 3V7SA 1VQ6T 3PVQA 1ZBJA 3DB4A 2L3QA 2RI3A 4FL6A 7AT1B 3JCMh 3QUIA 4AKHA 3OYEA 2G6FX 1YITA 4AFUC 1MMDA 4C0FA 1ARKA 4KH1B 5GMKe 1KFZA 3A8HB 2HQXA 2CZ6B 2K3BA 1P92A 3L1AA 4M78D 2HSPA 2RA2A 2RB6A 5LJ3e 2JJ9A 2QA4Q 1O75A 1G3TA 2KDSA 1W1FA 4E2FB 1AEYA 2P0QA 2DLPA 1X6OA 1NJIC 2JN0A 2HEQA 3EHQA 2SEMA 3DKMA 1KIKA 1IGQA 2WSCE 2QFZA 3THKA 4CRIA 4MIMA 3CCSA 1QVGS 3RERA 1C0MA 1KSWA 4PL6A 3UDCA 5KYUB 1T0HA 2X4XA 2RK1A 1ZSZA 1Q81R 3HPWA 4M77B 4EMKB 2CUBA 2FB7A 4Y28E 4TTHA 4OF1A 3M54A 2RI5A 2ZPFB 2D1XA 1PKSA 1RABB 1K73C 3OSVA 1M9SA 1S72A 2KVQG 5HBJB 2PK9B 4A4GA 1AT1B 1PNJA 4YC3B 4HXJA 4BXXX 2QTVA 1ACMB 1ZUYA 3S3NA 3OYIA 4LN2A 3E1SA 1EZZB 3R6OA 3VS3A 1QQJA 3L2WA 4LDXA 4HA8A 4QSHA 2XI9A 3LH0A 2C5XB 1GUXA 3BY7A 1X2KA 1J3TA 2JNGA 3JCMV 2HCKA 2WSEE 4RKUE 1NEGA 2EQUA 2UUEB 3PVLA 4MDXA 3UA7A 4OB3B 1QW1A 3BE3A 2L2PA 3CCSQ 1K8AC 1AZEA 4FYYB 5L2WB 4F6UB 5CKBA 1UECA 3EFSA 4BY1X 2NUPB 3OYDA 4CFNB 1KC8C 4BI8B 3H6ZA 3A98A 2XD0A 1UFFA 1U06A 2SRCA 3EG2A 3QWLA 2VUBA 2M0YA 1C1AA 2LRQA 1JRIA 4BY6B 1WHMA 4ZNXA 4II1A 2JZ2A 2MWOA 5HY6A 1W70A 4PFOA 3FLGA 4M77E 3DDPB 1OIUB 1S72Q 1PD1A 3BHUB 2AZSA 3CCEA 2COYA 4EPCA 1H641 2DE0X 3MP8A 1UHFA 2FRYA 4RCBA 4C0DC 1FXXA 1RAHB 1AWXA 5GAN4 1VQOA 2C06A 2K6DA 4M75G 1SF9A 3H0HA 3CCVT 4CFMB 4C8QC 2KXDA 2VB6A 4L6V5 3H0FA 2IN3A 3NGPA 3I5RA 1WPYA 2PQWA 3JB9J 3DL1A 2RPNA 4GBQA 3GLXA 2PZ1A 3VV0A 3A1PA 4EIKA 1UE9A 4N0AC 2WMAB 5HVYB 4PFZA 3E2UA 3C12A 1AZGB 4J9CA 3CCMT 5FU7C 2CT4A 4A4EA 4IUVA 2PTKA 3TSWA 3MY5B 1W6XA 1IZ6A 2EJ9A 4KRDB 3TREA 2LQKA 3VS1A 3MI9B 3CC4T 1JJ2P 4FU6A 4EMKA 4M77A 4DA4A 4BDYA 3L2RA 2F2XA 4M7DB 3L2ZA 4C5EA 4FM4B 2DXUA 5KYYB 2JM8A 4XTWA 1U3OA 1Q86C 4ORZA 1VQKQ 4IKFA 3CCEQ 1URCB 1VQNA 4M7DF 1SRLA 5KCOA 2EWNA 1YHQQ 3M58A 1N8RR 3DJBA 1TXQA 1VYVA 2QQBA 4F7JB 1KG1A 5CKHA 3OBWA 4C5IA 5ACBA 4C8QD 2K57A 1KK7A 1VQ7T 4OMQA 5FROA 2A3LA 1HSQA 2MIOA 4M75C 2EIFA 1G8XA 3I55T 3JCMW 2YWWA 3MP1A 2DL8A 2DD5B 3RMSA 1WJQA 5DM7R 1FVVB 5DLOA 2DL5A 4RTTA 1I81A 4KGXB 3RDVA 3BLRB 1M2VB 4ZGEB 5FWCA 1X2QA 4JJCA 2V8JA 1BI3A 2EQMA 4JJBA 3H8ZA 3ZBDA 2LNVA 5LJ5j 3GNFB 1NYGA 4HCZA 2IG0A 1OOTA 2D8HA 2HL3A 2W2HA 4JRKA 2WIHB 2E5KA 5GANd 1W2BP 3CBPA 1ZSZC 2ZZDB 1UJ0A 3WVEB 1KC8U 4FSXA 1JJ2A 1GH6B 5GMKl 5IHYA 1M1KC 1WFWA 1VQNQ 2IVWA 3GBQA 1D3UB 3CCUQ 4MDWA 2JS0A 1VYTA 4OMFB 2WIPB 1ENWA 1OZ3A 3MP6A 2PUOB 4M75D 4CC3A 2CZ0B 1WXBA 4ZN1A 1B7TA 5IXBA 4QQ6A 2YUQA 2QEXA 1H3HA 1Y96B 2P4TA 2HAXA 2FL7A 3C0CA 3X24B 4BCFB 1PG5B 1YJ9T 5IHIA 5IF1B 4BCNB 2EQJA 2ROTA 3CCLQ 2DZCA 2FYKA 2W0ZA 1E9HB 5GAN5 2Y4YA 2O4XB
chains in the Genus database with same CATH topology
2KR6A 4MZPA 4C0GA 4OGCA 4JX4A 2DIGA 2RJEA 3MO8A 4PLIA 5EJCA 1BIAA 4HL4A 3ER0A 3HFOA 3DB3A 2ZPGB 4EMHA 3HL8A 3PT9A 4N4HA 4Y91A 3J81E 2XK0A 2GCXA 2QDJA 3OYKA 3JSCA 1VQKT 4M7AE 3CC2A 1VQ5T 3CCET 2VGMA 4R56A 1FX7A 3O8VA 4JUVA 3EAEA 3M4GA 3LW5E 2VXFA 1G3YA 2EJFA 2LQ8A 3Q1JA 4ZGJB 3RMQA 2K3XA 2E12A 1QVFS 1Y71A 1LOJA 2QQAA 2QEXT 4ELYC 3OS2A 1YHQT 2F5KA 3A8MB 4PJOC 3OA6A 1NE8A 4BE2A 4JLIA 3BG5A 5IT9E 4AI6A 4J8OA 3M9QA 4C92G 4LDWA 3HSBA 3C95A 3QPHA 4OB0B 4NL3A 2DXBB 4M75B 1W2BA 3E9GA 1M8VA 4OP0A 3CBOA 5LJ5h 2HNIA 4C92A 1YIJA 4RG8A 3RKWA 5GAN6 5CK9A 1YCYA 5GAMj 1JJ2S 2B8AA 5GAMd 3JB9G 1KQSS 1VQLA 3VUBA 5KH6A 1QP2A 5GANh 2HD0A 2E65A 4KBMB 2LCCA 3VYHB 3C4SA 4C8QE 1QVPA 2WACA 4M75F 3FRNA 2PU9B 3HHTB 2GQVA 3OYMA 3CC2T 3I56A 4XTVA 3X26B 2A7YA 3NTKA 3CCUA 5GAMe 3QIIA 5GAN8 3VUZA 3P8DA 1Q81C 5FU6B 4XU3A 3SWNC 2QQ9A 3OB9A 5EG2A 2XU8A 1VQ9A 1EIFA 4ZTJA 2L89A 4F7UE 2LVMA 3X28B 3VKIA 1NZ9A 4FIBA 2DD4B 4JX6A 3BFMA 1Q7YC 3TW7A 1UB4A 2QI2A 3OMGA 3JCMd 1Q7YU 1Q82U 1YIJT 3A8OB 3G4SA 5GAN2 4ZN3A 4JRIA 1WGSA 4M7AA 1MHNA 4HCBA 3L2UA 2ZPHB 4XU1A 2D9TA 2DJZA 3JCMQ 3PGGA 5AYFA 1VQ8A 4M77F 3JCMP 2GFAA 1K9MC 4Q5WA 4NC6A 2FHDA 2R5MA 3CCLA 1K9MU 3HFNA 2KSSA 5KCHA 3M4YA 3V7RA 4PJOD 1YJWA 5KE2A 3QYEA 3JCMe 1VQNT 1UGSB 2DTOA 5GMKh 4JJNK 2JVVA 4R55A 3S6WA 1UGRB 2LC4A 2QQSA 3NFCA 3CPWA 3CCUT 4M78F 1Q82C 5FRMA 4BUGA 5J3BA 1VQPA 2X4JA 3CCQT 3CMEA 2DPPB 2RHIA 4OB1B 4NS5A 1E7PA 4RMOA 3CMAA 1X75C 5FU6C 1VQ4A 4MZTA 3SDZA 3GPLA 1M90C 3MEUA 4C8QG 4ZGDB 2MMPA 1M90U 4E47A 4M77C 4EMKC 2EAYA 4KUIA 3CD6A 4C92C 4AKIA 4PLLA 4FT2A 4MZMA 5LL6S 4DOWA 4BE0A 2KQWA 3VJPA 5CKFA 4C8QA 3QXEB 3G4ST 4JRQA 1W2BS 4BB7A 1NPRA 4IUQA 2V8KA 2R58A 2V8IA 1O9SA 5I2SA 5LJ5e 3PIOA 1KQSA 1VQ6A 1VQ8T 1MGQA 5HKCA 4M78C 2OTLA 5A0GA 2ZGWA 5CIUA 3PMIA 3BDUA 1V29B 5C6SA 3CCLT 5CKEA 1M1KU 4M7DE 1YJWT 2XDBA 4MFDA 1BI1A 2XG8D 5CO7A 2OTJA 2DO3A 2K5FA 3MCAB 1U1SA 4MFEA 1D3BA 2JTMA 4F7UA 4E7JA 2LX9A 1I4K1 2L5QA 3OMCA 1VQPT 3FDRA 3JCMc 3CMET 4JS4A 3META 3GIBA 5HK3A 4HLQA 3CMAT 3P8HA 3VYGA 1YBYA 2WSFE 1VQ4T 4PJOB 1KHIA 2BS3A 4J6WA 3H4CA 3NTHA 3VU3C 3CD6T 3CCVA 3FEOA 4QQGA 4A4FA 3HP9A 3S3MA 2PVGB 4O6JA 4M7AC 1JBMA 1RL2A 5GMKi 3QYHB 3RUXA 3LX7A 3SB2A 2NLUA 3V7SA 2VXEA 2RJFA 2RHYA 5GMKj 5GAMg 5L8RE 2O4XA 1VQ6T 4PJOF 3DLMA 1YI2A 3DB4A 3JAME 1QP3A 4KT0E 2RI3A 4FL6A 3QYBA 4QQDA 5CAIA 1B34B 2RO0A 4X34A 2XIDA 2AHJB 3JCMh 3HKSA 3QUIA 4AKHA 3T9NA 3FIFA 1ZHIA 3OYEA 3CCMA 5LJ3j 1N6AA 4M77D 5LJ3d 4L59A 3UWNA 4C92D 1YITA 2QTXA 4A4HA 4C0FA 1BI0A 1FWZA 5GMKe 1XTDA 4OB2B 3A8HB 2HQXA 2CZ6B 1P92A 2RHUA 2XKOC 4J7FA 3SWNB 4M7DG 5CR2A 2CZ7B 3HRTA 3L1AA 4IUPA 4B9WA 4M78D 2RA2A 2RB6A 2YRVA 5GAOm 3G6EA 3QDRB 2PUKB 2M0OA 4BY6C 5LJ3e 4M7DA 4J83A 3JCMg 3SD4A 1O75A 4QVZA 1G3TA 1WNLA 2KDSA 1TH7A 2KY9A 2P0QA 3N5BB 4JDSA 1X6OA 4D6WA 5GAMf 3DLLA 4E7KA 1YI2T 2JN0A 1NJIU 1NJIC 3ZFJA 4E7LA 2VYTA 2BUDA 3INZA 1VQMA 1G3WA 2L3RA 2E64A 2GF7A 3M56A 5IN1A 3DKMA 1JB0E 2WSCE 2ZCFB 2QFZA 3A8GB 2P0KA 4CRIA 4MIMA 1VQ5A 4TVRA 1YITT 3CCSA 1QVGS 1M5Q1 5GAOn 4M7AD 3RERA 1Y7XA 4YTLA 1SSFA 4PL6A 5LJ5g 3UDCA 1M4ZA 2I2LA 2X4XA 2RK1A 4XTYA 3OYGA 2M16A 3AHUA 1BKBA 1M1FA 1Q81U 3OS1A 4Z6YA 4PNOA 5GANg 3HPWA 3P8BB 4M77B 4EMKB 3V8JA 3OYAA 4C92B 3G6ET 4KUDK 4HT8A 3HBLA 2FB7A 2CZ1B 2DXTA 3ME9A 2PVOB 4Y28E 2YHTA 1XQHA 4OF1A 4GLKA 3M54A 2RI5A 5A0LA 2QQ8A 2ZPFB 2DD5A 2QF7A 3NTIA 3OS5A 3QHSA 1VQLT 3TW6A 3EFRA 2DK3A 2JOYA 3OYBA 4M78B 3QZ5B 2YLCA 1K73C 3OSVA 2RJCA 1K73U 4C92F 2DTHA 1M9SA 4XK8E 4ELZC 2KVQG 2E10A 1S72A 2DVEA 4AKGA 4A4GA 3PIPA 2RH2A 3I56T 4NL2A 1WQWA 5J26A 4V2SA 5DLQE 4X9CA 3CCJA 3JB9F 4LDYA 3S3NA 3L42A 2RD1A 2EJGA 2BKDN 1U1TA 4QVCA 5GAOq 3OYIA 3E1SA 3R6OA 5LJ5f 4DQ2A 3L2WA 3OS0A 2LDMA 4LDXA 4HA8A 3BW1A 1VQ9T 3QO3A 4QSHA 2CGHA 2ZZDA 4N4IA 4VUBA 2ZPBB 4ELJA 1R8OB 2XI9A 5LJ3h 5GANf 3PTAA 4BACA 3LYIA 2G77A 3A5ZB 2DZ9A 3LH0A 4M7AB 3BY7A 1Y07A 3OYNA 3ZEHA 3KBGA 2JNGA 3JCMV 4C5HA 2WSEE 4RKUE 4A53A 2EQUA 2RI2A 4MDXA 3QKJA 4ME7A 2JTFA 3QZ9B 3VKGA 3TCJA 3G71A 4OB3B 1QW1A 4XU2A 3URGA 2QA4A 1WJRA 2DTIA 2BS4A 3F70A 2LCLA 3A8LB 3CC7A 4M75E 1VIFA 2HQEA 2VC8A 2KMTA 3M59A 2D0QB 1PSEA 1VUBA 4M7AF 4BE1A 1K8AC 5A2QE 3C94A 5GAN3 1K8AU 2E5QA 1YJNA 4N0AA 5LJ3g 4QVDA 1QVGA 3MEAA 5CKBA 3RESA 3CCJT 3EFSA 5CQXA 3RIRA 5KE3A 3CCRA 1WQ7A 4LD9K 2KMGA 3OYDA 2QQRA 2KAFA 1KC8C 4BI8B 3BG3A 2K5IA 1Y96A 3H6ZA 3OYYA 5GAN7 2XD0A 2DKGA 1H3ZA 2JUFA 3V8KA 3GF5A 2O01E 3QWLA 3LGLA 4OVAA 2VUBA 2LRQA 1JRIA 4BY6B 3BG9A 3OW2A 4II1A 4BD3A 3LWIA 2JZ2A 2L8DA 2MWOA 5HY6A 2DXCA 3FLGA 4M77E 4BBRM 5M9OA 1OYXA 1WJSA 2M9UA 2QA4T 2XICA 2MWPA 3JB9H 1B34A 3OYFA 2OTLT 3JRZA 3QBYA 4C8QF 1AHJB 2F5TX 2KK4A 3CCEA 2X35A 4IURA 4EPCA 1D3BB 4F7UB 1H641 2X4WA 3MP8A 3JCMX 3UT1A 3OYCA 4J5YA 1YJNT 2OTJT 3MHXA 4M78E 4RCBA 1G5VA 4C0DC 1U8RA 4BI3A 1FXXA 2ZPIB 4M6VA 3CCRT 2X4YA 4HT9A 1PSFA 5GAN4 3PNWC 2PVDB 4XQ3A 1VQOA 2R57A 2C06A 4ATOA 4DOVA 5CVIA 3CC4A 3JCMb 4M75G 1KD1C 3VKHA 2CYZB 4F7UF 1KD1U 3SFMA 4JLGA 5A0DA 4OGEA 3JB9D 3J80E 4UC4A 3E9FA 1N9SA 3X25B 2DXBA 4NOYA 4M75A 4C8QC 3CCVT 2E70A 4L6V5 3TEEA 2LT4A 2XDDA 3HO8A 3HRSA 3L2VA 3OYHA 1WPYA 3LGFA 2PQWA 3FB9A 1X01A 3QG1A 3DL1A 3KXTA 3JB9J 5FRNA 2RHXA 4LD6A 4XU0A 2DIQA 2RJDA 3GLXA 3VV0A 5GAOl 3S3OA 3QSUA 2RK2A 2EYQA 4N0AC 4LOCA 2K5LA 4J6YA 4EDUA 3OYJA 3FJPA 3C12A 3CCMT 5FU7C 2Y4XA 4GY5A 2E6ZA 4LDUA 2CS7A 4IUVA 3WVDB 4A4EA 3OYLA 1N9RA 1LNXA 2XDPA 4M77G 3CBMA 1IZ6A 2Y90A 2EJ9A 2XHCA 3M57A 5DY9A 1VQOT 1VQ7A 3MEWA 3TREA 2LQKA 3CC4T 4FU6A 4EMKA 4M77A 4DA4A 4BDYA 3M5AA 3L2RA 4M7DB 3L2ZA 3PFSA 4PKCC 5D6XA 2DD4A 2RHZA 4FM4B 2DXUA 2LT1A 2OAUA 4C5EA 5CKDA 3I55A 4M78G 3V8LA 4XTWA 3CXCA 4KULA 2WJ9A 3OW2S 1Q86C 2D6FA 2GFUA 2M1HA 2MI6A 3JCMf 1Q86U 4PJOE 2EQKA 4ZTFA 4IKFA 1M1GA 3GNGA 2FVUA 3OQ5A 4M78A 3E19A 5D6YA 1OZ2A 1VQNA 4M7DF 1OI1A 1RI0A 4MMKA 3UPUA 5KCOA 5FLXE 5C0MA 1BI2A 2EWNA 4X9DA 1VQMT 1BIBA 4QW2A 4HNTA 3M58A 5HK0A 1N8RC 5D6WA 1N8RU 1GXIE 4JX5A 2QQBA 3RKXA 3V7CA 3HB9A 3CCQA 1KG1A 5CKHA 3OBWA 5J39A 4C5IA 1G3SA 3CCST 1VIEA 2DEQA 2K57A 4C8QD 4JS5A 4RCCA 1VQ7T 2E1HA 3MEVA 3TU4K 1IREB 5FROA 4M7AG 2LTOA 4HKEA 2A3LA 4A4KA 4J7IA 1UEBA 1KHCA 1NPPA 4M75C 5GAOr 2EIFA 3WXMB 1I5LA 5IAYA 3KUFA 3OY9A 2MF2A 3HRUA 4M7DC 3I55T 2VV5A 4HCCA 3JCMW 3MP1A 2DD5B 3RMSA 1WJQA 2EFIA 4MMLA 5DM7R 5DLOA 2K4YA 4L5GA 1XNIA 4XAXB 3CPWS 2E41A 1I81A 4Z02A 1QLBA 4B9XA 4FT4A 4ZGEB 5I21A 1BYMA 1I8FA 2V8JA 1HK9A 1BI3A 4RG2A 1HXDA 1S72T 3HZJA 2EQMA 2P0PA 3H8ZA 3OSSC 3PMTA 4WF2A 3ZBDA 4E7IA 2LNVA 4EMGA 5LJ5j 2QXFA 3GNFB 3OBYA 5LJ5d 3JB9I 1XOVA 1QVFA 4HCZA 2IG0A 4C0DB 4JRKA 4PJOG 4P5NA 5GANj 5GANd 4C0ZA 5GMKm 3CBPA 3LLRA 2HBPA 3G7ZA 2ZZDB 4C5GA 2G3RA 3QJYA 4PJOA 3WVEB 1KC8U 2K2VA 3RKYA 4CI0C 2E6NA 4FSXA 4LDVA 1YJ9A 1KQ2A 1FKMA 2BS2A 1JJ2A 5CQYA 4C8QB 5CCAA 3X20B 2F69A 3M53A 2CKKA 4XTZA 3KHIA 5GMKl 4J6XA 1ZBXA 2DAQA 1M1KC 3CXCS 1N27A 2R5AA 4IUUA 4XTUA 2IVWA 3BDLA 3CPFA 5GANe 4F7UG 1LJOA 4JRPA 3G71T 4HNUA 1KQ1A 3ASKA 4MDWA 4C92E 2EKOA 3JCMJ 3L2QA 4IUTA 1VQKA 2RM4A 5GAMh 4E7HA 3CC7T 4HNVA 3GP8A 2QDYB 4OMFB 3LWHA 5GAOp 1OZ3A 3MP6A 2PUOB 4M75D 2CZ0B 2H3JA 2YLBA 4ZN1A 5FU7B 4XTXA 4M7DD 4QQ6A 3J7AF 5LJ3f 1YHQA 5I2MA 2QEXA 2ZPEB 1Y96B 2P4TA 2HAXA 2FL7A 4A54A 3QYGB 3VYGB 1DJ7B 1UGQB 3X24B 2VGNA 3SWNA 3FC3A 4N4GA 2K3YA 3GOXA 1W4SA 4BI4A 1YJ9T 3M55A 2EQJA 4O5VA 4BBSM 2BIVA 1UGPB 2DXCB 4BDZA 3QJ6A 2DZCA 2FYKA 2MAMA 1ZQ1A 5GAN5 3CEYA 2Y4YA 2O4XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD4 A;  4FM4 B;  2ZPG B;  2ZZD A;  2ZPB B;  3VYG A;  2WSF E;  3LW5 E;  4ZGJ B;  2WSE E;  4RKU E;  3QZ9 B;  2PVG B;  1GXI E;  4OB3 B;  3A8M B;  3QYH B;  3A8L B;  2D0Q B;  4OB0 B;  1PSE A;  2DXB B;  5L8R E;  1QP3 A;  1IRE B;  4KT0 E;  2AHJ B;  1QP2 A;  3VYH B;  2DD5 B;  2PU9 B;  3HHT B;  2O01 E;  4OB2 B;  3A8H B;  2CZ6 B;  3X26 B;  4ZGE B;  2CZ7 B;  2DXC A;  2PUK B;  1AHJ B;  3X28 B;  2DD4 B;  3A8O B;  2ZZD B;  3WVE B;  2ZPI B;  2ZPH B;  1JB0 E;  1PSF A;  2WSC E;  2PVD B;  2ZCF B;  3A8G B;  3X20 B;  2CYZ B;  1UGS B;  2DXB A;  3X25 B;  1UGR B;  4L6V 5;  2DPP B;  4OB1 B;  2QDY B;  2CZ1 B;  2PVO B;  4Y28 E;  2PUO B;  2CZ0 B;  4ZGD B;  2ZPF B;  2DD5 A;  2ZPE B;  3QXE B;  3QYG B;  3QZ5 B;  3VYG B;  1DJ7 B;  1UGQ B;  3X24 B;  4XK8 E;  3WVD B;  1V29 B;  1UGP B;  2DXC B; 
#chains in the Genus database with same CATH topology
 4MZP A;  4CRL B;  1TTH B;  3ER0 A;  2GQI A;  3J81 E;  3PT9 A;  4N4H A;  3OYK A;  2XK0 A;  2GCX A;  2AKL A;  2KNB B;  1D0Y A;  1VQ4 Q;  4ZGJ B;  3RMQ A;  1QVF S;  1EFN A;  3OS2 A;  4BE2 A;  2PJQ A;  2RQV A;  4JLI A;  3BG5 A;  3TQ7 P;  4J8O A;  3M9Q A;  2DF6 A;  2JGZ B;  3QPH A;  2DXB B;  1UGV A;  1W2B A;  4OP0 A;  3CBO A;  5KYY A;  2C6T B;  3RKW A;  5GAN 6;  5CK9 A;  5GAM j;  3VS6 A;  2FPF A;  2DNU A;  3VUB A;  5KH6 A;  4PJN A;  1QVP A;  2WAC A;  1Q95 G;  1CSK A;  4XTV A;  1RAI B;  2A7Y A;  1QCN A;  1NYF A;  2RF0 A;  3M0S A;  1O9K A;  3VS5 A;  5EG2 A;  2RN8 A;  2XU8 A;  4ZTJ A;  4F7U E;  2LVM A;  3X28 B;  4BCQ D;  2C5V B;  1Q82 U;  3OMG A;  1N4M A;  4ESR A;  5GAN 2;  2D9T A;  2YXY A;  2YRD A;  3JCM P;  4K11 A;  4Q5W A;  2R5M A;  1K9M R;  1PHT A;  3EGD B;  2KR3 A;  4E7Z A;  1WHJ A;  1UDL A;  2ABL A;  3EG9 A;  4RTZ A;  4JJN K;  4JPB W;  3G33 B;  2X4J A;  5HCK A;  3CME A;  2RQT A;  1WYX A;  4RMO A;  1M90 C;  3SDZ A;  4EMK C;  4M77 C;  4KUI A;  4DOW A;  4FT2 A;  1YWO A;  3G4S T;  1WA7 A;  2V8K A;  2V8I A;  5I2S A;  2A36 A;  1VQ8 T;  4FW1 A;  4JZ3 A;  1V29 B;  1M1K U;  5CKE A;  2CP3 A;  2HBW A;  1WXT A;  1VIN A;  2OTJ A;  2EYX A;  2DO3 A;  1I0C A;  4F7U A;  3B57 A;  4EOJ B;  1M27 C;  3JCM c;  4JS4 A;  5HK3 A;  4HLQ A;  4PJO B;  1KHI A;  2BS3 A;  1ZX6 A;  3H4C A;  3CD6 T;  1QCO A;  1OU9 A;  4CFW B;  1TUC A;  4O6J A;  1QLY A;  1RL2 A;  2C0T A;  1H4L D;  3SB2 A;  2NLU A;  2VXE A;  2RMO A;  4X1V A;  5GAM g;  2O4X A;  5GJW B;  5CYI B;  2IW8 B;  4PJO F;  3DLM A;  2RO0 A;  2AHJ B;  1WLP B;  2FZC B;  4AG2 C;  3FIF A;  1ZHI A;  1N6A A;  4M77 D;  1SHF A;  2QTX A;  1UNL D;  2ED1 A;  1BI0 A;  1TFB A;  2RHU A;  4QKU A;  1WHH A;  4M7D G;  1H92 A;  3QDF A;  3CQT A;  3G6E A;  1SRM A;  4BY6 C;  2C5O B;  3JCM g;  1GL5 A;  1WNL A;  4HCK A;  2KY9 A;  3DLL A;  4JDS A;  5GAM f;  1NJI R;  3EG1 A;  2DFU A;  1YJN Q;  2PNI A;  2OTJ Q;  2BUD A;  1VQM A;  1G3W A;  3M56 A;  2GF7 A;  2P0K A;  1YIT T;  2E3I A;  1SSF A;  4PJM A;  4XTY A;  3NPF A;  4CFX B;  3JV3 A;  5CEI B;  5KYX B;  1BKB A;  2BE7 D;  1MV0 B;  4Z6Y A;  5GAN g;  3V8J A;  1H1Q B;  4KUD K;  1MMG A;  4HT8 A;  2RNA A;  1OV3 A;  2YHT A;  1XQH A;  4GLK A;  5A0L A;  2QQ8 A;  2QF7 A;  1TWB A;  2DYI A;  1VQL T;  3TW6 A;  3EFR A;  3OYB A;  2JOY A;  1K73 R;  4LXC A;  4ELZ C;  1IHV A;  1TUD A;  2W99 A;  4AKG A;  2H8H A;  2RH2 A;  3I56 T;  4NL2 A;  4EC8 B;  4RTU A;  3JB9 F;  1FYN A;  4LDY A;  1T3L A;  3BW1 A;  1VQ9 T;  2J05 A;  4HCC A;  4BE0 A;  4VUB A;  5GAN f;  2ZPB B;  5LJ3 h;  3CPW P;  4BAC A;  4FCY A;  5EC7 A;  1NG2 A;  3KBG A;  4C5H A;  1PKT A;  4D8K A;  3QKJ A;  1VQM Q;  3QZ9 B;  3VKG A;  1PCX A;  2K7A A;  3URG A;  3G71 A;  4XU2 A;  2QA4 A;  1WJR A;  4ROC A;  2BS4 A;  2DTI A;  3F70 A;  2LCL A;  3A8L B;  2KYB A;  4M75 E;  3CC7 A;  1VA7 A;  1VIF A;  2HQE A;  2VC8 A;  1VUB A;  1C9B A;  1GY3 B;  5A2Q E;  5GAN 3;  2DL3 A;  1K8A R;  4CFU D;  4N0A A;  1VOL A;  3MEA A;  4IMY B;  3RES A;  4DEY A;  1WQ7 A;  2C0O A;  1ZP2 A;  1R0B G;  2CT3 A;  2QQR A;  3BG3 A;  3TNI B;  5GAN 7;  3K7A M;  2FG0 A;  2LQN A;  4HVV A;  3QWX X;  3V8K A;  3GF5 A;  2O01 E;  3LGL A;  3CXC P;  2R7G A;  4OR5 B;  3BG9 A;  1BCM A;  1D0Z A;  4J9B A;  4BD3 A;  2DXC A;  5M9O A;  4BBR M;  1OYX A;  3JB9 H;  2XIC A;  2MWP A;  2F2C A;  1K76 A;  2OTL T;  1HJD A;  2ED0 A;  4EOI B;  2UZB B;  2X35 A;  1GFD A;  4BCI B;  3OYC A;  4J5Y A;  2CDT A;  1I5O B;  1U8R A;  2ECZ A;  4DBH A;  2UZD B;  4ATO A;  1GBR A;  3JCM b;  3VKH A;  1KD1 U;  4ROE A;  1WZO A;  4OGE A;  4M75 A;  4BCO B;  3G71 Q;  3TVT A;  2M02 A;  2XDD A;  2KT1 A;  3HRS A;  3CC7 Q;  3OYH A;  5FRN A;  3LGF A;  3FB9 A;  4OMP A;  2RHX A;  1YWP A;  2JTE A;  2C5N B;  1GCP A;  2K5L A;  2QGF B;  3OYJ A;  2JXB A;  3FJP A;  4CC4 B;  2Y4X A;  3EFO A;  2E6Z A;  2EPD A;  4LDU A;  3WVD B;  1N9R A;  2XDP A;  5GJV B;  3CBM A;  1VQO T;  2XHC A;  1NLP C;  3MEW A;  5KYX A;  1OI9 B;  1K1Z A;  1KQS P;  3M5A A;  1GCQ C;  5IDN B;  1RAD B;  3QHW B;  1ZSG A;  4KUL A;  2WJ9 A;  3CXC A;  2HKQ B;  3OW2 S;  1Q86 R;  1MV3 A;  3F5X B;  1M1G A;  1LPL A;  1WXU A;  3E19 A;  2EYY A;  2JW4 A;  2YUO A;  1OI1 A;  4MMK A;  1AD5 A;  4X9D A;  2OI3 A;  4QW2 A;  4JX5 A;  2WMB B;  1H26 B;  5J39 A;  1UHC A;  1VQ5 T;  4JS5 A;  1H27 B;  2E1H A;  2OX7 A;  3D7S B;  1IRE B;  3MEV A;  1TD6 A;  4M7A G;  4HKE A;  4EOO B;  4A4K A;  1I5L A;  3WXM B;  5IAY A;  1RAC B;  3KUF A;  2MF2 A;  2VV5 A;  4MML A;  2DRM A;  1XNI A;  3CC2 Q;  2E41 A;  2DEU A;  4B9X A;  4FT4 A;  2JS2 A;  2J6O A;  1UJY A;  2E3H A;  4WF2 A;  4E7I A;  1YFN A;  3OBY A;  5LJ5 d;  4BCN D;  1XOV A;  2JT4 A;  1HD3 A;  2NYS A;  4PJO G;  2A08 A;  2DET A;  4C0Z A;  5GMK m;  1T0J A;  1WIE A;  4C5G A;  3NDQ A;  2KRS A;  4CI0 C;  1MUZ A;  2O2O A;  5CQY A;  1I07 A;  3O5Z A;  4BY7 X;  3KHI A;  4XTZ A;  3BHV B;  2GGR A;  1JSU B;  1ZBX A;  2WPA B;  1CKA A;  2QYZ A;  1N27 A;  2R5A A;  5GAN e;  2LJ1 A;  3CPF A;  1VQK A;  4D8D A;  2QAZ A;  2QDY B;  5GAO p;  2I40 B;  2UZE B;  2NUZ A;  2H3J A;  2DL7 A;  4PJL A;  1YHQ A;  2ZPE B;  1DJ7 B;  4BI4 A;  2CH4 W;  4O5V A;  4BBS M;  2YUP A;  1OKV B;  1X43 A;  4BDZ A;  2VAS A;  2MAM A;  2DVJ A;  1OL1 B;  2LQW A;  5AT1 B;  4PLI A;  5EJC A;  3HFO A;  4EMH A;  1VQP Q;  2CSQ A;  3G1J A;  2VGM A;  4R56 A;  1FX7 A;  2FO0 A;  3O8V A;  2B86 A;  2EJF A;  1M3A A;  2EKH A;  2E12 A;  2K3X A;  5LQF B;  2QQA A;  2QEX T;  4PJO C;  3OA6 A;  1NE8 A;  5IT9 E;  4YOS A;  5KYU A;  3SHW A;  2K79 A;  4Z89 A;  1CKB A;  1VQ6 Q;  3E9G A;  9ATC B;  1YIJ A;  2DM1 A;  2B8A A;  5GAM d;  3JB9 G;  4KBM B;  3VYH B;  3C4S A;  2EVR A;  3FRN A;  1AWW A;  2PU9 B;  4G6L B;  3OYM A;  1OEB A;  3X26 B;  4F14 A;  3CCU A;  5GAN 8;  1Q81 C;  5FU6 B;  4QT7 A;  2EGA A;  3VKI A;  1NZ9 A;  1Q82 C;  2DD4 B;  4JX6 A;  1M8V A;  2QI2 A;  1B3Q A;  1UB4 A;  1Q7Y U;  3JCM d;  4AT1 B;  2LP5 A;  2BKZ B;  4JRI A;  1MHN A;  3PGG A;  5KYW B;  3CCL A;  2KSS A;  2L0A A;  3M4Y A;  3V7R A;  4PJO D;  5KE2 A;  4B6M A;  3QYE A;  2YRC A;  1UGS B;  2DMO A;  4R55 A;  1UGR B;  4M78 F;  4BUG A;  3CCQ T;  2RHI A;  4OB1 B;  2NUP A;  3CMA A;  1VQ4 A;  4F6S B;  4MZT A;  1M90 R;  4E47 A;  3EGX B;  1YIJ Q;  4MZM A;  1X27 A;  2KQW A;  2W96 A;  3QXE B;  2X3W D;  1M3B A;  3M0T A;  3NMZ C;  2EW3 A;  4JRQ A;  2NUT B;  1O9S A;  3PIO A;  1JO8 A;  5HKC A;  2BPM B;  5A0G A;  4M7D E;  1NLO C;  5FWB A;  1BI1 A;  5CO7 A;  4E6R A;  2KBT A;  3U23 A;  2CCH B;  5D7U A;  3FDR A;  1D1B A;  2FPE A;  3CME T;  1K9A A;  1YBY A;  1SEM A;  1M8M A;  2IIM A;  4J6W A;  4F6W B;  3CCV A;  4QQG A;  3HP9 A;  3QYH B;  2M51 A;  2EUF A;  4CC2 A;  2HQH A;  3RUX A;  2LMJ A;  2RJF A;  2RHY A;  5GMK j;  5L8R E;  1Z9Q A;  1YI2 A;  3JAM E;  1QP3 A;  2IW6 B;  2HMA A;  2GTO A;  4KT0 E;  3QYB A;  1B34 B;  2XID A;  1JKW A;  3HKS A;  3CCM A;  5LJ3 j;  2IW9 B;  3UWN A;  4Z88 A;  4JJD A;  1H1P B;  3CMA Q;  4II5 B;  1XTD A;  4OB2 B;  3SWN B;  5CR2 A;  2CZ7 B;  3HRT A;  5I5Z B;  5GAO m;  1PRM C;  1Y57 A;  1HYO A;  4PFP A;  1D09 B;  2PUK B;  1PC0 A;  4M7D A;  1SSH A;  2O88 A;  4QVZ A;  2DBK A;  2QGS A;  1TH7 A;  1X6G A;  3N5B B;  4E7K A;  4J9I A;  5IHK A;  2VYT A;  4E7L A;  3M03 A;  2WFY B;  4EOP B;  2E64 A;  1R77 A;  1JB0 E;  3A8G B;  1H8K A;  2GNC A;  5GAO n;  1Y7X A;  5LJ5 g;  3CCV Q;  1M4Z A;  3AHU A;  1M1F A;  2L3P A;  1Q81 U;  4PNO A;  3P8B B;  3G6E T;  3OYA A;  4C92 B;  3NHN A;  2DXT A;  3ME9 A;  1YI2 Q;  2DD5 A;  3NTI A;  3OS5 A;  3QHS A;  3TN8 B;  3QZ5 B;  2CH4 A;  3CCM Q;  2QG9 B;  3VS7 A;  1M2V A;  4C92 F;  2OJ2 A;  4XK8 E;  3EGU A;  4EOL B;  2O31 A;  1UG1 A;  1SPK A;  3PIP A;  1WQW A;  3CC4 Q;  4V2S A;  5DLQ E;  4X9C A;  2QGG A;  3CCJ A;  2PK2 A;  4BCM B;  2RD1 A;  3LQ5 B;  2BKD N;  5LJ5 f;  1M2O A;  2MCN A;  1GRI A;  3OS0 A;  2DYB A;  3QO3 A;  1YNZ A;  2CGH A;  2ZZD A;  4N4I A;  4IIO A;  4F7N B;  3A5Z B;  2DZ9 A;  4M7A B;  3UF4 A;  1SG5 A;  1Y07 A;  3OYN A;  1RAF B;  4A53 A;  1H25 B;  3TNH B;  2ATC B;  3FJ5 A;  2KMT A;  4M7A F;  2CP2 A;  2E5Q A;  3H0I A;  1YJN A;  5LJ3 g;  1S1N A;  4QVD A;  3VS0 A;  2COZ A;  5CQX A;  3RIR A;  3CCR A;  4RTX A;  1KJW A;  2DL4 A;  3RBB B;  2K5I A;  3EG3 A;  1Y96 A;  3OYY A;  3RGF B;  4OVA A;  1NEB A;  1GCQ A;  4YOO A;  3LWI A;  1M30 A;  1ABO A;  2L8D A;  1N5Z A;  2XMF A;  2LJ3 A;  2QDL A;  2QA4 T;  3POM A;  1B34 A;  3OYF A;  4KH0 B;  2IPO B;  4C8Q F;  4BCP B;  4IUR A;  1PRL C;  1D3B B;  1C6V X;  4FX3 B;  3JCM X;  1OPL A;  3CCJ Q;  3MHX A;  3ULR B;  4BI3 A;  4M6V A;  3PO3 S;  4E7S A;  1VYW B;  2R57 A;  1PM3 A;  4DOV A;  1JXM A;  1KD1 C;  1JEG A;  2CYZ B;  1MMN A;  4BCK B;  4JLG A;  3SFM A;  2HZY A;  3J80 E;  1P5E B;  4UC4 A;  3E9F A;  2DXB A;  4NOY A;  1IRX A;  1F1B B;  2CUD A;  2C0I A;  2KGT A;  3TEE A;  3HO8 A;  3L2V A;  1X01 A;  3KXT A;  4LD6 A;  3TSZ A;  2DIQ A;  5GAO l;  3S3O A;  1KXU A;  1QVF P;  1K4U S;  4LOC A;  4J6Y A;  3QHR B;  3CCR Q;  5HQ0 B;  2ESW A;  4GY5 A;  2CS7 A;  1LNX A;  1YJ9 Q;  2L3S A;  2Y90 A;  3M57 A;  5DY9 A;  1BK2 A;  1WHL A;  1SKU B;  4PKC C;  2RHZ A;  4M78 G;  1FMV A;  2D6F A;  2M1H A;  3EH1 A;  3JCM f;  4PJO E;  3IQL A;  1UTI A;  4DEX A;  3OQ5 A;  4YOZ A;  1OZ2 A;  2GBQ A;  1RI0 A;  3EGD A;  5FLX E;  1BIB A;  5D6W A;  4J9F A;  1N8R U;  4EOK B;  3RKX A;  3HB9 A;  1PKD B;  1G3S A;  3CCS T;  1VIE A;  2D0N A;  1AD6 A;  1YN8 A;  2HL5 C;  3TU4 K;  1XO2 A;  2LTO A;  4J7I A;  1JST B;  3EG0 A;  1YP5 A;  3HRU A;  4M7D C;  2NWM A;  5ECA A;  2DBM A;  4L5G A;  4Z02 A;  1RLP C;  2I0N A;  1BYM A;  1D0X A;  2QAS A;  5IXF A;  1HK9 A;  1S72 T;  2P0P A;  3PMT A;  3OSS C;  1QKX A;  1BBZ A;  2QXF A;  1QVF A;  1E6G A;  4P5N A;  8ATC B;  2LW4 A;  3LLR A;  2HBP A;  3G7Z A;  3M0Q A;  3QJY A;  4PJO A;  2DJQ A;  1KC8 R;  1KQ2 A;  3RKY A;  2E6N A;  4LDV A;  1GUX B;  2BS2 A;  5CCA A;  5HBE B;  3M53 A;  4LUE A;  3VS2 A;  4BCQ B;  4IUU A;  1RLQ C;  4F7U G;  2HDA A;  1LJO A;  4JRP A;  2K2M A;  2EKO A;  3JCM J;  2F1L A;  3GTM S;  5GAM h;  4E7H A;  1QWF A;  1QCF A;  2PMI B;  2I53 A;  2RQU A;  2YLB A;  4KRC B;  1UNH D;  4M7D D;  4EOM B;  2V1Q A;  1FIN B;  3G4S Q;  1TS9 A;  3QYG B;  1UGQ B;  1OX9 A;  3GOX A;  2K3Y A;  1W4S A;  3M55 A;  4WCI A;  2BIV A;  4RTV A;  2F2W A;  3QJ6 A;  1G83 A;  2BZY A;  2DX1 A;  2H3E B;  3CEY A;  3CPW A;  5J3B A;  4BE1 A;  4C0G A;  2AKK A;  2RJE A;  3MO8 A;  1IB8 A;  5HNB B;  3HL8 A;  1VQK T;  3JSC A;  3CC2 A;  3I35 A;  3CCE T;  3UA6 A;  3EAE A;  3LW5 E;  2VXF A;  1G3Y A;  2LQ8 A;  3Q1J A;  2V1R A;  3I9Q A;  3CD6 Q;  3QWY A;  1YHQ T;  2E4H A;  2A0F B;  1H28 B;  4AI6 A;  4C92 G;  3MKD A;  4LDW A;  4NL3 A;  2K9G A;  3BLQ B;  1ZLM A;  2HNI A;  4RG8 A;  1T3S A;  1U5S A;  1JJ2 S;  1VQL A;  1QP2 A;  5GAN h;  4HVW A;  1VYU A;  4DBR A;  1K0X A;  2P84 A;  5IDP B;  2OAW A;  4HVU A;  1RI9 A;  3HHT B;  2GQV A;  3I56 A;  4CFV B;  4CXA B;  1AOJ A;  5GAM e;  4J9H A;  1MNE A;  3QII A;  3P8D A;  2WXV B;  4OMM A;  3SWN C;  2QQ9 A;  3OB9 A;  1VQ9 A;  2EYW A;  2J06 A;  2L89 A;  4DBF A;  1Q7Y C;  4FIB A;  3BFM A;  3VRY A;  1Q82 R;  3TW7 A;  3DDQ B;  5IH2 A;  1YIJ T;  2FZG B;  3A8O B;  4HCB A;  3L2U A;  2J6K A;  4FSS A;  4XU1 A;  2CJM B;  4J9G A;  5AYF A;  2X9H A;  4WTO B;  4M77 F;  1UNG D;  1OU8 A;  4NC6 A;  2FHD A;  1YIT Q;  1TSF A;  1K9M U;  3HFN A;  2DRK A;  2CP6 A;  4R0K A;  1YJW A;  1VQN T;  3JCM e;  5L23 A;  2DTO A;  4ANJ A;  2PHG A;  2JVV A;  2LX7 A;  3S6W A;  4BCG B;  2LC4 A;  3CCU T;  5FRM A;  1VQP A;  1BU2 A;  1FMW A;  4NS5 A;  2B9R A;  4Y92 A;  3GPL A;  2BZX A;  4C8Q G;  4ZGD B;  2MMP A;  1AIS B;  2EAY A;  4C92 C;  4AKI A;  3VRZ A;  5EFQ B;  2JM9 A;  1Z9Z A;  1JU5 C;  5CKF A;  3VJP A;  1VQL Q;  1W2B S;  2WEV B;  2AZV A;  1NPR A;  4IUQ A;  4OML A;  2P4R A;  2KRN A;  2A28 A;  2CP5 A;  1KQS A;  1VQ6 A;  1MGQ A;  3H9N A;  1BCO A;  2OTL A;  3CCL T;  3PMI A;  3I56 Q;  5IHN A;  1M1K R;  2F2V A;  2XDB A;  1UUE A;  3REB B;  4MFD A;  2XG8 D;  3MCA B;  1U1S A;  2JTM A;  4EOR B;  1ABQ A;  3VS4 A;  2LX9 A;  1I4K 1;  2J7I A;  4KRT A;  4E7J A;  3H41 A;  1VQ9 Q;  4Y72 B;  4I3Z B;  3DOG B;  3GIB A;  3CMA T;  3P8H A;  1QMZ B;  1VQ4 T;  4FYX B;  3NTH A;  3VU3 C;  4A4F A;  4M7A C;  1AWJ A;  5GMK i;  1RAE B;  2X51 A;  3RR6 A;  3LX7 A;  5I22 A;  2UZL B;  3RNJ A;  1WHG A;  1YJW Q;  5CAI A;  4QQD A;  1IXD A;  4X34 A;  4KGZ B;  4EON B;  3T9N A;  1A0N B;  5LJ3 d;  4L59 A;  4C92 D;  1YCS B;  4BCJ B;  4A4H A;  1FWZ A;  1QMC A;  4CC7 A;  2JMC A;  2W9F A;  2XKO C;  4J7F A;  4OMN A;  4CFU B;  3M0P A;  4IUP A;  1D1C A;  4B9W A;  2YRV A;  4F04 B;  3QDR B;  2MYS A;  2M0O A;  4J83 A;  3SD4 A;  2OTL Q;  2DME A;  4M4Z A;  1SHG A;  4D6W A;  1YI2 T;  1NJI U;  1OPK A;  4BCM D;  3ZFJ A;  3INZ A;  2EGE A;  2L3R A;  1VOM A;  5IN1 A;  1QVG P;  4EOS B;  4NST B;  2ZCF B;  1IGU A;  2EGC A;  1VQ5 A;  2EQI A;  2KT8 A;  4TVR A;  1M5Q 1;  4M7A D;  4YTL A;  2GTJ A;  2I2L A;  2KXC A;  3OYG A;  3MPU B;  2M16 A;  3OW2 P;  3OS1 A;  1M3C A;  1F5Q B;  3HBL A;  2CZ1 B;  2FRW A;  2PVO B;  4F16 A;  3SEM A;  4FYV B;  4J9D A;  1BU1 A;  2DK3 A;  4M78 B;  2C4G B;  2YLC A;  4FW2 A;  2RJC A;  1K73 U;  1MND A;  2DTH A;  4UN0 A;  2E10 A;  2DVE A;  2CSI A;  1VQO Q;  5FW9 A;  2EYZ A;  5J26 A;  2O9V A;  1O9K B;  4FYW B;  3L42 A;  2EJG A;  4QVC A;  1U1T A;  5GAO q;  3EOC B;  1LCK A;  4DQ2 A;  2ENM A;  2LDM A;  1RUW A;  4ELL A;  1R0C B;  4ELJ A;  1R8O B;  3PTA A;  3LYI A;  2G77 A;  3ZEH A;  2RI2 A;  4ME7 A;  2JTF A;  2J6F A;  3TCJ A;  1JOW A;  1VQ5 Q;  2CP7 A;  3M59 A;  2D0Q B;  1PSE A;  3EH2 A;  3EG9 B;  1WI7 A;  3C94 A;  1K8A U;  1AVZ C;  1QVG A;  4LD9 K;  3CCJ T;  5KE3 A;  2KMG A;  2AIR B;  2FPD A;  2KAF A;  1RAG B;  1OKW B;  2DKG A;  1H3Z A;  2JUF A;  1X69 A;  1TG0 A;  3OW2 A;  4LNP A;  2X1N B;  5KYN A;  3MY1 B;  1IO6 A;  1WJS A;  2M9U A;  2ROL A;  1K0S A;  1RAA B;  3JRZ A;  4ROD A;  3QBY A;  1AHJ B;  2F5T X;  2KK4 A;  4F7U B;  4PK4 A;  2X4W A;  1LVK A;  3UT1 A;  1YJN T;  2OTJ T;  1G3N C;  4M78 E;  1BB9 A;  8AT1 B;  1G5V A;  3CCR T;  2ZPI B;  3PE0 A;  2X4Y A;  4HT9 A;  1PSF A;  3PNW C;  2PVD B;  4XQ3 A;  5CVI A;  3CC4 A;  1ZUK A;  1KD1 R;  1QWE A;  4F7U F;  5A0D A;  3JB9 D;  2AT1 B;  1N9S A;  3X25 B;  4F7S B;  2E70 A;  2LT4 A;  3QG1 A;  1QKW A;  2HKN A;  1G2B A;  1NM7 A;  4XU0 A;  3LH5 A;  2RJD A;  3QSU A;  1JQQ A;  2RK2 A;  2EYQ A;  4EDU A;  1OIY B;  4F70 B;  1JXO A;  2V26 A;  4AFZ C;  3EJ1 B;  2VVK A;  3OYL A;  4M77 G;  2LZ6 B;  1VQ7 A;  1WX6 A;  1ZA1 B;  2A37 A;  1XJW B;  2ZAE A;  3PFS A;  2BTT A;  1Y0M A;  5D6X A;  2DD4 A;  2LT1 A;  2OAU A;  3I55 A;  5CKD A;  2QK0 A;  3I5S A;  3V8L A;  2GFU A;  1Q86 U;  2MI6 A;  2EQK A;  1TUG B;  2BE9 B;  4ZTF A;  3GNG A;  4M78 A;  2FVU A;  2Z0W A;  5KYW A;  1EX4 A;  2VKN A;  5D6Y A;  1ZA2 B;  3UPU A;  4AFQ C;  2W10 A;  1BI2 A;  5C0M A;  1VQM T;  5HK0 A;  2QEX Q;  4HNT A;  1N8R C;  1GXI E;  1OL2 B;  2YDL A;  3V7C A;  3CCQ A;  1H1S B;  2DEQ A;  2KEA A;  4RCC A;  2COW A;  2CP0 A;  2BZ8 A;  1H1R B;  1UEB A;  1KHC A;  1NPP A;  5GAO r;  3EGX A;  4A63 B;  3OY9 A;  2LJ0 A;  1D1A A;  2EFI A;  4BCH B;  2KI7 A;  2NUT A;  4OMO A;  3MIA B;  2K4Y A;  4XAX B;  3CPW S;  1PWT A;  2W9Z A;  4AG1 C;  1QLB A;  1WDX A;  4LUD A;  5I21 A;  1NBE B;  1I8F A;  1V76 A;  1GBQ A;  4RG2 A;  1HXD A;  3HZJ A;  1WHK A;  4EMG A;  3JB9 I;  1VQ7 Q;  4C0D B;  1AWO A;  3KFV A;  5GAN j;  2O9S A;  2G3R A;  2YUN A;  3I55 Q;  2K2V A;  1YJ9 A;  2FZK B;  1FKM A;  4C8Q B;  3X20 B;  2F69 A;  2CKK A;  2KYM A;  4J6X A;  2DAQ A;  3CXC S;  4XTU A;  3BDL A;  3M0R A;  4LE9 A;  2EBP A;  3G71 T;  4HNU A;  1KQ1 A;  1MMA A;  3ASK A;  4C92 E;  4DBQ A;  3L2Q A;  6AT1 B;  4IUT A;  3CC7 T;  2RM4 A;  4OGR B;  5BNJ B;  4HNV A;  3CCQ Q;  3GP8 A;  3LWH A;  1OQK A;  5DQW A;  1OGU B;  5ICP B;  2AK5 A;  2RQW A;  4XTX A;  5FU7 B;  1E7O A;  3EHR A;  3J7A F;  2LCS A;  5LJ3 f;  5I2M A;  4A54 A;  1TU0 B;  3VYG B;  3R6N A;  2VGN A;  3SWN A;  3FC3 A;  4N4G A;  2KE9 A;  2CCI B;  1UGP B;  2DXC B;  1ZQ1 A;  5FGK B;  2KR6 A;  1I1J A;  4OGC A;  4JX4 A;  2DIG A;  1BIA A;  4HL4 A;  3DB3 A;  2ZPG B;  1X6B A;  4Y91 A;  2VWF A;  4M7A E;  2QDJ A;  3M0U A;  3CME Q;  4RTY A;  4JUV A;  3M4G A;  2IVX A;  4AMC A;  1Y71 A;  1LOJ A;  4ELY C;  2X3X D;  2F5K A;  3A8M B;  3HTR A;  4Z8A A;  3HSB A;  3C95 A;  4OB0 B;  4M75 B;  2D8J A;  5LJ5 h;  4RTW A;  1TOV A;  1PD0 A;  4C92 A;  2DER A;  1YCY A;  1KQS S;  2V22 B;  2HD0 A;  2E65 A;  3REA B;  2LCC A;  4GLM A;  4EC9 B;  4C8Q E;  2HSE B;  4M75 F;  3EID B;  3CC2 T;  4RUG A;  3UAT A;  4F7L B;  3NTK A;  3EFO B;  1H24 B;  4J9E A;  3VUZ A;  4XU3 A;  1OUL A;  4AFS C;  1EIF A;  3ZL7 C;  1ZSZ B;  1Q7Y R;  4EOQ B;  1E6H A;  2CRE A;  3G4S A;  4ZN3 A;  4M7A A;  1WGS A;  3TNW B;  2ZPH B;  3JCM Q;  2DJZ A;  2KRO A;  2DIL A;  1VQ8 A;  2DA9 A;  3BHT B;  2MPX C;  2GFA A;  2MOX A;  1K9M C;  1GFC A;  5KCH A;  5I11 A;  5GMK h;  2QQS A;  3NFC A;  4JZ4 A;  1ZUU A;  4F17 A;  3G6E Q;  2DPP B;  1E7P A;  1X75 C;  5FU6 C;  3MEU A;  1M90 U;  3CD6 A;  1FMK A;  4PLL A;  5LL6 S;  3O0G D;  5LMK B;  2JMA A;  4C8Q A;  5HBH B;  4BB7 A;  2R58 A;  5LJ5 e;  4M78 C;  2ZGW A;  5CIU A;  5C6S A;  3BDU A;  1B07 A;  1YJW T;  2FEI A;  1V1C A;  4IIM A;  2K5F A;  2LNH B;  4MFE A;  1W98 B;  1D3B A;  1OX8 A;  2L5Q A;  3OMC A;  2KRM A;  2YSQ A;  1VQP T;  3MET A;  1IHW A;  3VYG A;  4KGV B;  2WSF E;  3AT1 B;  2G9X B;  2YT6 A;  2RQR A;  2MK5 A;  4PJJ A;  3FEO A;  3DTO A;  3S3M A;  2PVG B;  1JBM A;  2WHB B;  5DQV A;  3MJX A;  1VQ8 Q;  3BLH B;  3V7S A;  1VQ6 T;  3PVQ A;  1ZBJ A;  3DB4 A;  2L3Q A;  2RI3 A;  4FL6 A;  7AT1 B;  3JCM h;  3QUI A;  4AKH A;  3OYE A;  2G6F X;  1YIT A;  4AFU C;  1MMD A;  4C0F A;  1ARK A;  4KH1 B;  5GMK e;  1KFZ A;  3A8H B;  2HQX A;  2CZ6 B;  2K3B A;  1P92 A;  3L1A A;  4M78 D;  2HSP A;  2RA2 A;  2RB6 A;  5LJ3 e;  2JJ9 A;  2QA4 Q;  1O75 A;  1G3T A;  2KDS A;  1W1F A;  4E2F B;  1AEY A;  2P0Q A;  2DLP A;  1X6O A;  1NJI C;  2JN0 A;  2HEQ A;  3EHQ A;  2SEM A;  3DKM A;  1KIK A;  1IGQ A;  2WSC E;  2QFZ A;  3THK A;  4CRI A;  4MIM A;  3CCS A;  1QVG S;  3RER A;  1C0M A;  1KSW A;  4PL6 A;  3UDC A;  5KYU B;  1T0H A;  2X4X A;  2RK1 A;  1ZSZ A;  1Q81 R;  3HPW A;  4M77 B;  4EMK B;  2CUB A;  2FB7 A;  4Y28 E;  4TTH A;  4OF1 A;  3M54 A;  2RI5 A;  2ZPF B;  2D1X A;  1PKS A;  1RAB B;  1K73 C;  3OSV A;  1M9S A;  1S72 A;  2KVQ G;  5HBJ B;  2PK9 B;  4A4G A;  1AT1 B;  1PNJ A;  4YC3 B;  4HXJ A;  4BXX X;  2QTV A;  1ACM B;  1ZUY A;  3S3N A;  3OYI A;  4LN2 A;  3E1S A;  1EZZ B;  3R6O A;  3VS3 A;  1QQJ A;  3L2W A;  4LDX A;  4HA8 A;  4QSH A;  2XI9 A;  3LH0 A;  2C5X B;  1GUX A;  3BY7 A;  1X2K A;  1J3T A;  2JNG A;  3JCM V;  2HCK A;  2WSE E;  4RKU E;  1NEG A;  2EQU A;  2UUE B;  3PVL A;  4MDX A;  3UA7 A;  4OB3 B;  1QW1 A;  3BE3 A;  2L2P A;  3CCS Q;  1K8A C;  1AZE A;  4FYY B;  5L2W B;  4F6U B;  5CKB A;  1UEC A;  3EFS A;  4BY1 X;  2NUP B;  3OYD A;  4CFN B;  1KC8 C;  4BI8 B;  3H6Z A;  3A98 A;  2XD0 A;  1UFF A;  1U06 A;  2SRC A;  3EG2 A;  3QWL A;  2VUB A;  2M0Y A;  1C1A A;  2LRQ A;  1JRI A;  4BY6 B;  1WHM A;  4ZNX A;  4II1 A;  2JZ2 A;  2MWO A;  5HY6 A;  1W70 A;  4PFO A;  3FLG A;  4M77 E;  3DDP B;  1OIU B;  1S72 Q;  1PD1 A;  3BHU B;  2AZS A;  3CCE A;  2COY A;  4EPC A;  1H64 1;  2DE0 X;  3MP8 A;  1UHF A;  2FRY A;  4RCB A;  4C0D C;  1FXX A;  1RAH B;  1AWX A;  5GAN 4;  1VQO A;  2C06 A;  2K6D A;  4M75 G;  1SF9 A;  3H0H A;  3CCV T;  4CFM B;  4C8Q C;  2KXD A;  2VB6 A;  4L6V 5;  3H0F A;  2IN3 A;  3NGP A;  3I5R A;  1WPY A;  2PQW A;  3JB9 J;  3DL1 A;  2RPN A;  4GBQ A;  3GLX A;  2PZ1 A;  3VV0 A;  3A1P A;  4EIK A;  1UE9 A;  4N0A C;  2WMA B;  5HVY B;  4PFZ A;  3E2U A;  3C12 A;  1AZG B;  4J9C A;  3CCM T;  5FU7 C;  2CT4 A;  4A4E A;  4IUV A;  2PTK A;  3TSW A;  3MY5 B;  1W6X A;  1IZ6 A;  2EJ9 A;  4KRD B;  3TRE A;  2LQK A;  3VS1 A;  3MI9 B;  3CC4 T;  1JJ2 P;  4FU6 A;  4EMK A;  4M77 A;  4DA4 A;  4BDY A;  3L2R A;  2F2X A;  4M7D B;  3L2Z A;  4C5E A;  4FM4 B;  2DXU A;  5KYY B;  2JM8 A;  4XTW A;  1U3O A;  1Q86 C;  4ORZ A;  1VQK Q;  4IKF A;  3CCE Q;  1URC B;  1VQN A;  4M7D F;  1SRL A;  5KCO A;  2EWN A;  1YHQ Q;  3M58 A;  1N8R R;  3DJB A;  1TXQ A;  1VYV A;  2QQB A;  4F7J B;  1KG1 A;  5CKH A;  3OBW A;  4C5I A;  5ACB A;  4C8Q D;  2K57 A;  1KK7 A;  1VQ7 T;  4OMQ A;  5FRO A;  2A3L A;  1HSQ A;  2MIO A;  4M75 C;  2EIF A;  1G8X A;  3I55 T;  3JCM W;  2YWW A;  3MP1 A;  2DL8 A;  2DD5 B;  3RMS A;  1WJQ A;  5DM7 R;  1FVV B;  5DLO A;  2DL5 A;  4RTT A;  1I81 A;  4KGX B;  3RDV A;  3BLR B;  1M2V B;  4ZGE B;  5FWC A;  1X2Q A;  4JJC A;  2V8J A;  1BI3 A;  2EQM A;  4JJB A;  3H8Z A;  3ZBD A;  2LNV A;  5LJ5 j;  3GNF B;  1NYG A;  4HCZ A;  2IG0 A;  1OOT A;  2D8H A;  2HL3 A;  2W2H A;  4JRK A;  2WIH B;  2E5K A;  5GAN d;  1W2B P;  3CBP A;  1ZSZ C;  2ZZD B;  1UJ0 A;  3WVE B;  1KC8 U;  4FSX A;  1JJ2 A;  1GH6 B;  5GMK l;  5IHY A;  1M1K C;  1WFW A;  1VQN Q;  2IVW A;  3GBQ A;  1D3U B;  3CCU Q;  4MDW A;  2JS0 A;  1VYT A;  4OMF B;  2WIP B;  1ENW A;  1OZ3 A;  3MP6 A;  2PUO B;  4M75 D;  4CC3 A;  2CZ0 B;  1WXB A;  4ZN1 A;  1B7T A;  5IXB A;  4QQ6 A;  2YUQ A;  2QEX A;  1H3H A;  1Y96 B;  2P4T A;  2HAX A;  2FL7 A;  3C0C A;  3X24 B;  4BCF B;  1PG5 B;  1YJ9 T;  5IHI A;  5IF1 B;  4BCN B;  2EQJ A;  2ROT A;  3CCL Q;  2DZC A;  2FYK A;  2W0Z A;  1E9H B;  5GAN 5;  2Y4Y A;  2O4X B; 
#chains in the Genus database with same CATH homology
 2KR6 A;  4MZP A;  4C0G A;  4OGC A;  4JX4 A;  2DIG A;  2RJE A;  3MO8 A;  4PLI A;  5EJC A;  1BIA A;  4HL4 A;  3ER0 A;  3HFO A;  3DB3 A;  2ZPG B;  4EMH A;  3HL8 A;  3PT9 A;  4N4H A;  4Y91 A;  3J81 E;  2XK0 A;  2GCX A;  2QDJ A;  3OYK A;  3JSC A;  1VQK T;  4M7A E;  3CC2 A;  1VQ5 T;  3CCE T;  2VGM A;  4R56 A;  1FX7 A;  3O8V A;  4JUV A;  3EAE A;  3M4G A;  3LW5 E;  2VXF A;  1G3Y A;  2EJF A;  2LQ8 A;  3Q1J A;  4ZGJ B;  3RMQ A;  2K3X A;  2E12 A;  1QVF S;  1Y71 A;  1LOJ A;  2QQA A;  2QEX T;  4ELY C;  3OS2 A;  1YHQ T;  2F5K A;  3A8M B;  4PJO C;  3OA6 A;  1NE8 A;  4BE2 A;  4JLI A;  3BG5 A;  5IT9 E;  4AI6 A;  4J8O A;  3M9Q A;  4C92 G;  4LDW A;  3HSB A;  3C95 A;  3QPH A;  4OB0 B;  4NL3 A;  2DXB B;  4M75 B;  1W2B A;  3E9G A;  1M8V A;  4OP0 A;  3CBO A;  5LJ5 h;  2HNI A;  4C92 A;  1YIJ A;  4RG8 A;  3RKW A;  5GAN 6;  5CK9 A;  1YCY A;  5GAM j;  1JJ2 S;  2B8A A;  5GAM d;  3JB9 G;  1KQS S;  1VQL A;  3VUB A;  5KH6 A;  1QP2 A;  5GAN h;  2HD0 A;  2E65 A;  4KBM B;  2LCC A;  3VYH B;  3C4S A;  4C8Q E;  1QVP A;  2WAC A;  4M75 F;  3FRN A;  2PU9 B;  3HHT B;  2GQV A;  3OYM A;  3CC2 T;  3I56 A;  4XTV A;  3X26 B;  2A7Y A;  3NTK A;  3CCU A;  5GAM e;  3QII A;  5GAN 8;  3VUZ A;  3P8D A;  1Q81 C;  5FU6 B;  4XU3 A;  3SWN C;  2QQ9 A;  3OB9 A;  5EG2 A;  2XU8 A;  1VQ9 A;  1EIF A;  4ZTJ A;  2L89 A;  4F7U E;  2LVM A;  3X28 B;  3VKI A;  1NZ9 A;  4FIB A;  2DD4 B;  4JX6 A;  3BFM A;  1Q7Y C;  3TW7 A;  1UB4 A;  2QI2 A;  3OMG A;  3JCM d;  1Q7Y U;  1Q82 U;  1YIJ T;  3A8O B;  3G4S A;  5GAN 2;  4ZN3 A;  4JRI A;  1WGS A;  4M7A A;  1MHN A;  4HCB A;  3L2U A;  2ZPH B;  4XU1 A;  2D9T A;  2DJZ A;  3JCM Q;  3PGG A;  5AYF A;  1VQ8 A;  4M77 F;  3JCM P;  2GFA A;  1K9M C;  4Q5W A;  4NC6 A;  2FHD A;  2R5M A;  3CCL A;  1K9M U;  3HFN A;  2KSS A;  5KCH A;  3M4Y A;  3V7R A;  4PJO D;  1YJW A;  5KE2 A;  3QYE A;  3JCM e;  1VQN T;  1UGS B;  2DTO A;  5GMK h;  4JJN K;  2JVV A;  4R55 A;  3S6W A;  1UGR B;  2LC4 A;  2QQS A;  3NFC A;  3CPW A;  3CCU T;  4M78 F;  1Q82 C;  5FRM A;  4BUG A;  5J3B A;  1VQP A;  2X4J A;  3CCQ T;  3CME A;  2DPP B;  2RHI A;  4OB1 B;  4NS5 A;  1E7P A;  4RMO A;  3CMA A;  1X75 C;  5FU6 C;  1VQ4 A;  4MZT A;  3SDZ A;  3GPL A;  1M90 C;  3MEU A;  4C8Q G;  4ZGD B;  2MMP A;  1M90 U;  4E47 A;  4M77 C;  4EMK C;  2EAY A;  4KUI A;  3CD6 A;  4C92 C;  4AKI A;  4PLL A;  4FT2 A;  4MZM A;  5LL6 S;  4DOW A;  4BE0 A;  2KQW A;  3VJP A;  5CKF A;  4C8Q A;  3QXE B;  3G4S T;  4JRQ A;  1W2B S;  4BB7 A;  1NPR A;  4IUQ A;  2V8K A;  2R58 A;  2V8I A;  1O9S A;  5I2S A;  5LJ5 e;  3PIO A;  1KQS A;  1VQ6 A;  1VQ8 T;  1MGQ A;  5HKC A;  4M78 C;  2OTL A;  5A0G A;  2ZGW A;  5CIU A;  3PMI A;  3BDU A;  1V29 B;  5C6S A;  3CCL T;  5CKE A;  1M1K U;  4M7D E;  1YJW T;  2XDB A;  4MFD A;  1BI1 A;  2XG8 D;  5CO7 A;  2OTJ A;  2DO3 A;  2K5F A;  3MCA B;  1U1S A;  4MFE A;  1D3B A;  2JTM A;  4F7U A;  4E7J A;  2LX9 A;  1I4K 1;  2L5Q A;  3OMC A;  1VQP T;  3FDR A;  3JCM c;  3CME T;  4JS4 A;  3MET A;  3GIB A;  5HK3 A;  4HLQ A;  3CMA T;  3P8H A;  3VYG A;  1YBY A;  2WSF E;  1VQ4 T;  4PJO B;  1KHI A;  2BS3 A;  4J6W A;  3H4C A;  3NTH A;  3VU3 C;  3CD6 T;  3CCV A;  3FEO A;  4QQG A;  4A4F A;  3HP9 A;  3S3M A;  2PVG B;  4O6J A;  4M7A C;  1JBM A;  1RL2 A;  5GMK i;  3QYH B;  3RUX A;  3LX7 A;  3SB2 A;  2NLU A;  3V7S A;  2VXE A;  2RJF A;  2RHY A;  5GMK j;  5GAM g;  5L8R E;  2O4X A;  1VQ6 T;  4PJO F;  3DLM A;  1YI2 A;  3DB4 A;  3JAM E;  1QP3 A;  4KT0 E;  2RI3 A;  4FL6 A;  3QYB A;  4QQD A;  5CAI A;  1B34 B;  2RO0 A;  4X34 A;  2XID A;  2AHJ B;  3JCM h;  3HKS A;  3QUI A;  4AKH A;  3T9N A;  3FIF A;  1ZHI A;  3OYE A;  3CCM A;  5LJ3 j;  1N6A A;  4M77 D;  5LJ3 d;  4L59 A;  3UWN A;  4C92 D;  1YIT A;  2QTX A;  4A4H A;  4C0F A;  1BI0 A;  1FWZ A;  5GMK e;  1XTD A;  4OB2 B;  3A8H B;  2HQX A;  2CZ6 B;  1P92 A;  2RHU A;  2XKO C;  4J7F A;  3SWN B;  4M7D G;  5CR2 A;  2CZ7 B;  3HRT A;  3L1A A;  4IUP A;  4B9W A;  4M78 D;  2RA2 A;  2RB6 A;  2YRV A;  5GAO m;  3G6E A;  3QDR B;  2PUK B;  2M0O A;  4BY6 C;  5LJ3 e;  4M7D A;  4J83 A;  3JCM g;  3SD4 A;  1O75 A;  4QVZ A;  1G3T A;  1WNL A;  2KDS A;  1TH7 A;  2KY9 A;  2P0Q A;  3N5B B;  4JDS A;  1X6O A;  4D6W A;  5GAM f;  3DLL A;  4E7K A;  1YI2 T;  2JN0 A;  1NJI U;  1NJI C;  3ZFJ A;  4E7L A;  2VYT A;  2BUD A;  3INZ A;  1VQM A;  1G3W A;  2L3R A;  2E64 A;  2GF7 A;  3M56 A;  5IN1 A;  3DKM A;  1JB0 E;  2WSC E;  2ZCF B;  2QFZ A;  3A8G B;  2P0K A;  4CRI A;  4MIM A;  1VQ5 A;  4TVR A;  1YIT T;  3CCS A;  1QVG S;  1M5Q 1;  5GAO n;  4M7A D;  3RER A;  1Y7X A;  4YTL A;  1SSF A;  4PL6 A;  5LJ5 g;  3UDC A;  1M4Z A;  2I2L A;  2X4X A;  2RK1 A;  4XTY A;  3OYG A;  2M16 A;  3AHU A;  1BKB A;  1M1F A;  1Q81 U;  3OS1 A;  4Z6Y A;  4PNO A;  5GAN g;  3HPW A;  3P8B B;  4M77 B;  4EMK B;  3V8J A;  3OYA A;  4C92 B;  3G6E T;  4KUD K;  4HT8 A;  3HBL A;  2FB7 A;  2CZ1 B;  2DXT A;  3ME9 A;  2PVO B;  4Y28 E;  2YHT A;  1XQH A;  4OF1 A;  4GLK A;  3M54 A;  2RI5 A;  5A0L A;  2QQ8 A;  2ZPF B;  2DD5 A;  2QF7 A;  3NTI A;  3OS5 A;  3QHS A;  1VQL T;  3TW6 A;  3EFR A;  2DK3 A;  2JOY A;  3OYB A;  4M78 B;  3QZ5 B;  2YLC A;  1K73 C;  3OSV A;  2RJC A;  1K73 U;  4C92 F;  2DTH A;  1M9S A;  4XK8 E;  4ELZ C;  2KVQ G;  2E10 A;  1S72 A;  2DVE A;  4AKG A;  4A4G A;  3PIP A;  2RH2 A;  3I56 T;  4NL2 A;  1WQW A;  5J26 A;  4V2S A;  5DLQ E;  4X9C A;  3CCJ A;  3JB9 F;  4LDY A;  3S3N A;  3L42 A;  2RD1 A;  2EJG A;  2BKD N;  1U1T A;  4QVC A;  5GAO q;  3OYI A;  3E1S A;  3R6O A;  5LJ5 f;  4DQ2 A;  3L2W A;  3OS0 A;  2LDM A;  4LDX A;  4HA8 A;  3BW1 A;  1VQ9 T;  3QO3 A;  4QSH A;  2CGH A;  2ZZD A;  4N4I A;  4VUB A;  2ZPB B;  4ELJ A;  1R8O B;  2XI9 A;  5LJ3 h;  5GAN f;  3PTA A;  4BAC A;  3LYI A;  2G77 A;  3A5Z B;  2DZ9 A;  3LH0 A;  4M7A B;  3BY7 A;  1Y07 A;  3OYN A;  3ZEH A;  3KBG A;  2JNG A;  3JCM V;  4C5H A;  2WSE E;  4RKU E;  4A53 A;  2EQU A;  2RI2 A;  4MDX A;  3QKJ A;  4ME7 A;  2JTF A;  3QZ9 B;  3VKG A;  3TCJ A;  3G71 A;  4OB3 B;  1QW1 A;  4XU2 A;  3URG A;  2QA4 A;  1WJR A;  2DTI A;  2BS4 A;  3F70 A;  2LCL A;  3A8L B;  3CC7 A;  4M75 E;  1VIF A;  2HQE A;  2VC8 A;  2KMT A;  3M59 A;  2D0Q B;  1PSE A;  1VUB A;  4M7A F;  4BE1 A;  1K8A C;  5A2Q E;  3C94 A;  5GAN 3;  1K8A U;  2E5Q A;  1YJN A;  4N0A A;  5LJ3 g;  4QVD A;  1QVG A;  3MEA A;  5CKB A;  3RES A;  3CCJ T;  3EFS A;  5CQX A;  3RIR A;  5KE3 A;  3CCR A;  1WQ7 A;  4LD9 K;  2KMG A;  3OYD A;  2QQR A;  2KAF A;  1KC8 C;  4BI8 B;  3BG3 A;  2K5I A;  1Y96 A;  3H6Z A;  3OYY A;  5GAN 7;  2XD0 A;  2DKG A;  1H3Z A;  2JUF A;  3V8K A;  3GF5 A;  2O01 E;  3QWL A;  3LGL A;  4OVA A;  2VUB A;  2LRQ A;  1JRI A;  4BY6 B;  3BG9 A;  3OW2 A;  4II1 A;  4BD3 A;  3LWI A;  2JZ2 A;  2L8D A;  2MWO A;  5HY6 A;  2DXC A;  3FLG A;  4M77 E;  4BBR M;  5M9O A;  1OYX A;  1WJS A;  2M9U A;  2QA4 T;  2XIC A;  2MWP A;  3JB9 H;  1B34 A;  3OYF A;  2OTL T;  3JRZ A;  3QBY A;  4C8Q F;  1AHJ B;  2F5T X;  2KK4 A;  3CCE A;  2X35 A;  4IUR A;  4EPC A;  1D3B B;  4F7U B;  1H64 1;  2X4W A;  3MP8 A;  3JCM X;  3UT1 A;  3OYC A;  4J5Y A;  1YJN T;  2OTJ T;  3MHX A;  4M78 E;  4RCB A;  1G5V A;  4C0D C;  1U8R A;  4BI3 A;  1FXX A;  2ZPI B;  4M6V A;  3CCR T;  2X4Y A;  4HT9 A;  1PSF A;  5GAN 4;  3PNW C;  2PVD B;  4XQ3 A;  1VQO A;  2R57 A;  2C06 A;  4ATO A;  4DOV A;  5CVI A;  3CC4 A;  3JCM b;  4M75 G;  1KD1 C;  3VKH A;  2CYZ B;  4F7U F;  1KD1 U;  3SFM A;  4JLG A;  5A0D A;  4OGE A;  3JB9 D;  3J80 E;  4UC4 A;  3E9F A;  1N9S A;  3X25 B;  2DXB A;  4NOY A;  4M75 A;  4C8Q C;  3CCV T;  2E70 A;  4L6V 5;  3TEE A;  2LT4 A;  2XDD A;  3HO8 A;  3HRS A;  3L2V A;  3OYH A;  1WPY A;  3LGF A;  2PQW A;  3FB9 A;  1X01 A;  3QG1 A;  3DL1 A;  3KXT A;  3JB9 J;  5FRN A;  2RHX A;  4LD6 A;  4XU0 A;  2DIQ A;  2RJD A;  3GLX A;  3VV0 A;  5GAO l;  3S3O A;  3QSU A;  2RK2 A;  2EYQ A;  4N0A C;  4LOC A;  2K5L A;  4J6Y A;  4EDU A;  3OYJ A;  3FJP A;  3C12 A;  3CCM T;  5FU7 C;  2Y4X A;  4GY5 A;  2E6Z A;  4LDU A;  2CS7 A;  4IUV A;  3WVD B;  4A4E A;  3OYL A;  1N9R A;  1LNX A;  2XDP A;  4M77 G;  3CBM A;  1IZ6 A;  2Y90 A;  2EJ9 A;  2XHC A;  3M57 A;  5DY9 A;  1VQO T;  1VQ7 A;  3MEW A;  3TRE A;  2LQK A;  3CC4 T;  4FU6 A;  4EMK A;  4M77 A;  4DA4 A;  4BDY A;  3M5A A;  3L2R A;  4M7D B;  3L2Z A;  3PFS A;  4PKC C;  5D6X A;  2DD4 A;  2RHZ A;  4FM4 B;  2DXU A;  2LT1 A;  2OAU A;  4C5E A;  5CKD A;  3I55 A;  4M78 G;  3V8L A;  4XTW A;  3CXC A;  4KUL A;  2WJ9 A;  3OW2 S;  1Q86 C;  2D6F A;  2GFU A;  2M1H A;  2MI6 A;  3JCM f;  1Q86 U;  4PJO E;  2EQK A;  4ZTF A;  4IKF A;  1M1G A;  3GNG A;  2FVU A;  3OQ5 A;  4M78 A;  3E19 A;  5D6Y A;  1OZ2 A;  1VQN A;  4M7D F;  1OI1 A;  1RI0 A;  4MMK A;  3UPU A;  5KCO A;  5FLX E;  5C0M A;  1BI2 A;  2EWN A;  4X9D A;  1VQM T;  1BIB A;  4QW2 A;  4HNT A;  3M58 A;  5HK0 A;  1N8R C;  5D6W A;  1N8R U;  1GXI E;  4JX5 A;  2QQB A;  3RKX A;  3V7C A;  3HB9 A;  3CCQ A;  1KG1 A;  5CKH A;  3OBW A;  5J39 A;  4C5I A;  1G3S A;  3CCS T;  1VIE A;  2DEQ A;  2K57 A;  4C8Q D;  4JS5 A;  4RCC A;  1VQ7 T;  2E1H A;  3MEV A;  3TU4 K;  1IRE B;  5FRO A;  4M7A G;  2LTO A;  4HKE A;  2A3L A;  4A4K A;  4J7I A;  1UEB A;  1KHC A;  1NPP A;  4M75 C;  5GAO r;  2EIF A;  3WXM B;  1I5L A;  5IAY A;  3KUF A;  3OY9 A;  2MF2 A;  3HRU A;  4M7D C;  3I55 T;  2VV5 A;  4HCC A;  3JCM W;  3MP1 A;  2DD5 B;  3RMS A;  1WJQ A;  2EFI A;  4MML A;  5DM7 R;  5DLO A;  2K4Y A;  4L5G A;  1XNI A;  4XAX B;  3CPW S;  2E41 A;  1I81 A;  4Z02 A;  1QLB A;  4B9X A;  4FT4 A;  4ZGE B;  5I21 A;  1BYM A;  1I8F A;  2V8J A;  1HK9 A;  1BI3 A;  4RG2 A;  1HXD A;  1S72 T;  3HZJ A;  2EQM A;  2P0P A;  3H8Z A;  3OSS C;  3PMT A;  4WF2 A;  3ZBD A;  4E7I A;  2LNV A;  4EMG A;  5LJ5 j;  2QXF A;  3GNF B;  3OBY A;  5LJ5 d;  3JB9 I;  1XOV A;  1QVF A;  4HCZ A;  2IG0 A;  4C0D B;  4JRK A;  4PJO G;  4P5N A;  5GAN j;  5GAN d;  4C0Z A;  5GMK m;  3CBP A;  3LLR A;  2HBP A;  3G7Z A;  2ZZD B;  4C5G A;  2G3R A;  3QJY A;  4PJO A;  3WVE B;  1KC8 U;  2K2V A;  3RKY A;  4CI0 C;  2E6N A;  4FSX A;  4LDV A;  1YJ9 A;  1KQ2 A;  1FKM A;  2BS2 A;  1JJ2 A;  5CQY A;  4C8Q B;  5CCA A;  3X20 B;  2F69 A;  3M53 A;  2CKK A;  4XTZ A;  3KHI A;  5GMK l;  4J6X A;  1ZBX A;  2DAQ A;  1M1K C;  3CXC S;  1N27 A;  2R5A A;  4IUU A;  4XTU A;  2IVW A;  3BDL A;  3CPF A;  5GAN e;  4F7U G;  1LJO A;  4JRP A;  3G71 T;  4HNU A;  1KQ1 A;  3ASK A;  4MDW A;  4C92 E;  2EKO A;  3JCM J;  3L2Q A;  4IUT A;  1VQK A;  2RM4 A;  5GAM h;  4E7H A;  3CC7 T;  4HNV A;  3GP8 A;  2QDY B;  4OMF B;  3LWH A;  5GAO p;  1OZ3 A;  3MP6 A;  2PUO B;  4M75 D;  2CZ0 B;  2H3J A;  2YLB A;  4ZN1 A;  5FU7 B;  4XTX A;  4M7D D;  4QQ6 A;  3J7A F;  5LJ3 f;  1YHQ A;  5I2M A;  2QEX A;  2ZPE B;  1Y96 B;  2P4T A;  2HAX A;  2FL7 A;  4A54 A;  3QYG B;  3VYG B;  1DJ7 B;  1UGQ B;  3X24 B;  2VGN A;  3SWN A;  3FC3 A;  4N4G A;  2K3Y A;  3GOX A;  1W4S A;  4BI4 A;  1YJ9 T;  3M55 A;  2EQJ A;  4O5V A;  4BBS M;  2BIV A;  1UGP B;  2DXC B;  4BDZ A;  3QJ6 A;  2DZC A;  2FYK A;  2MAM A;  1ZQ1 A;  5GAN 5;  3CEY A;  2Y4Y A;  2O4X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...