2DPPB

Crystal structure of thermostable bacillus sp. rapc8 nitrile hydratase
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
227
structure length
227
Chain Sequence
MNGIHDVGGMDGFGKVMYVKEEEDIYFTHDWERLAFGLVAGCMAQGLGMKAFDEFRIGIELMRPVDYLTSSYYGHWIATVAYNLVDTGVLDEKELDERTEVFLKKPDTKIPRREDPALVKLVEKALYDGLSPLREISASPRFKVGERIKTKNIHPTGHTRFPRYARDKYGVIDEVYGAHVFPDDAAHRKGENPQYLYRVRFEAEELWGYKQKDSVYIDLWESYMEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratse
rcsb
source organism Bacillus sp. rapc8
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 62
structure length 227
sequence length 227
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2006-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2dppB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dppB02
2DD5A 2PUOB 1PSFA 2ZZDB 5L8RE 4ZGDB 2ZPEB 2ZPHB 1UGPB 2QDYB 3QZ9B 4L6V5 3X20B 4Y28E 3QZ5B 1JB0E 4OB1B 1IREB 2DD4B 4ZGEB 3WVDB 2CZ1B 1QP2A 2PVDB 1AHJB 2PVOB 1V29B 1UGSB 3QXEB 2CZ6B 4XK8E 3A8OB 4KT0E 4OB2B 4OB0B 1PSEA 2CZ0B 2PU9B 2CYZB 2ZCFB 1GXIE 3QYHB 3A8HB 2DXCB 2CZ7B 2DD5B 1UGQB 3A8MB 2WSFE 2DXCA 3HHTB 2DXBA 3WVEB 2DD4A 2ZPFB 2WSCE 4OB3B 2ZZDA 2DPPB 2O01E 3VYGA 2ZPIB 2PVGB 2DXBB 3VYHB 2AHJB 3A8LB 3X28B 1QP3A 3A8GB 3X26B 2ZPBB 2ZPGB 3VYGB 3X24B 3LW5E 1UGRB 2WSEE 3QYGB 4ZGJB 2D0QB 4RKUE 1DJ7B 3X25B 4FM4B 2PUKB
chains in the Genus database with same CATH superfamily
3GIBA 4OGEA 2KAFA 5IN1A 1W2BA 4JDSA 5L8RE 1Q82U 4HNUA 2DIQA 4KGXB 2J6FA 2DK3A 3I56T 2KR3A 1QMCA 4GLMA 1YWOA 2Y4XA 4ZN3A 3HFNA 2LDMA 4P5NA 4D8KA 1SF9A 4A63B 1QKXA 4BCPB 4Z6YA 5LJ5d 4ZTFA 3JAME 2RI3A 4MMLA 4MMKA 2LNVA 2K57A 2C06A 3AHUA 2HQHA 2FL7A 5CEIB 3BG3A 4M7AG 1Z9QA 1Q81R 1K0XA 4PLLA 1RUWA 4ANJA 4M78F 2HQEA 2F5KA 2MPXC 3VV0A 3EFOB 3EG9B 3CMET 2RHIA 2RH2A 4DOVA 1HYOA 3CMEA 2J6OA 2QAZA 2DX1A 1Y07A 5GAN3 2WJ9A 4PFOA 3CC7T 4KRCB 4RTVA 2OTLA 2OI3A 1AEYA 1UHFA 2ZPIB 1JXOA 2VV5A 1J3TA 2RHUA 2K2VA 4ATOA 1ZSGA 5KE3A 2AZSA 1SRLA 2IG0A 2J05A 5FRMA 4MZPA 2RQTA 2HSEB 2C6TB 3C4SA 1AWOA 1LPLA 4MZMA 4FSXA 2PTKA 1OZ3A 3BG9A 5GAOm 5LJ5f 1M2VB 2DERA 3MEAA 2P4RA 4FW2A 2ECZA 3JCMf 4JUVA 2W9ZA 2F69A 3QHRB 1E6HA 1QWEA 3DB3A 4C92E 2X35A 5LJ5e 1I5OB 1KFZA 4OMOA 2OAUA 3H8ZA 2EJGA 4BY7X 5A0GA 4PJMA 2XU8A 1R0BG 2DJQA 2UUEB 2C0TA 3QZ9B 3JB9I 4LUEA 4LDUA 3U23A 3OYNA 3A5ZB 2RHZA 2LQNA 4OB1B 3M0QA 4BY1X 2COZA 4UC4A 2NUZA 5KYYA 1FX7A 1UHCA 2C0IA 1PCXA 3CCQT 2PVDB 2HD0A 2KGTA 2O4XA 1WNLA 4EC9B 3CCRA 1RL2A 4M78G 1PM3A 3L2WA 1W4SA 4IUQA 4M7AE 1MMGA 3CD6A 4F7SB 1M4ZA 3SWNB 1KD1R 3MJXA 2R7GA 1JU5C 5LMKB 1ABOA 4XU1A 4KH1B 4MZTA 1AWXA 4XTYA 3I55T 1TH7A 3N5BB 3NFCA 2G9XB 2DXCB 2LQ8A 2QQ9A 3HP9A 4EMGA 1OOTA 1SSFA 2EGCA 2DL7A 2KYBA 2DVJA 1YJWQ 2GFUA 4AT1B 2R5MA 3CD6Q 1XO2A 1VQPA 2WSCE 2Y90A 4CFXB 3FJPA 3R6OA 3O8VA 1QVFS 2ZZDA 4WF2A 3HBLA 5GAMh 2K79A 1YI2A 3G71Q 2LJ3A 1WGSA 4KH0B 1WDXA 1MUZA 1OZ2A 2YRVA 4M75G 4J6XA 2A3LA 1AD5A 1E6GA 3VUBA 2XKOC 4N4IA 5GJWB 3CCST 2DIGA 1OIYB 3CCSA 5KYNA 1BI0A 2K3YA 3CC4A 1RLQC 2B8AA 4N0AC 3QYBA 3SFMA 2V1QA 5GMKi 2W9FA 2L3RA 3B57A 2CCIB 3J81E 2LCCA 1OYXA 4PL6A 3CMAT 2E6NA 1VQ8Q 3MO8A 3PMIA 2VB6A 3QJYA 1XTDA 3RKWA 2LQKA 3VS0A 3L1AA 2RM4A 1AT1B 4MIMA 1WHGA 2E4HA 1JB0E 4EOMB 4AI6A 1BI1A 1WJSA 4PFZA 1I1JA 4ZNXA 2RB6A 2CZ1B 4II1A 1QP2A 1H28B 4FSSA 3UF4A 4DA4A 1PG5B 4IIMA 4OGCA 2X4YA 1U1SA 2QQ8A 4UN0A 1ZSZA 2RHXA 3G7ZA 3GOXA 2VGNA 4LD9K 2WFYB 2DL5A 3MCAB 2UZLB 1ZA2B 4C0GA 3ZFJA 3OYMA 3TNWB 3MEVA 5IXBA 1ZUKA 2DL3A 4CC7A 4M75E 2LZ6B 4BCHB 1OIUB 2CZ7B 4HVVA 3FJ5A 3MY5B 1UE9A 2ED0A 2K5FA 4M7DG 3JB9D 3WVEB 2FPEA 3CCQQ 1VQ4Q 1WHKA 1ZX6A 1OI1A 2KYMA 1RAGB 1NM7A 1T0HA 4HCKA 4AFUC 4AMCA 4DBRA 1YIJQ 4AG2C 1YJWT 2V8JA 4BCND 1VQMT 1AZGB 3I56A 2V22B 2EIFA 4BY6C 1RAEB 1YJNQ 1M1FA 2X4JA 3CXCP 3CC2A 3SHWA 2A08A 4A4GA 3CPWA 2DTOA 2G6FX 2GTOA 1YNZA 1G3WA 3C95A 1VQ7Q 2XHCA 5KYXA 5DLQE 1TTHB 4WTOB 1R8OB 4ZGJB 1MNEA 3FDRA 3DL1A 1NYFA 4R55A 5ECAA 1BIBA 4CI0C 3GPLA 1JO8A 4J6WA 2PUKB 1NJIU 4C92F 1O9SA 2HBPA 2XK0A 4EC8B 3MI9B 2QASA 2RD1A 3M0RA 2C5XB 3PT9A 4AFSC 3I5SA 1H1SB 1SKUB 1KQSS 2MMPA 5CR2A 4HCCA 1KC8C 1QCNA 2PHGA 2EYQA 4HCBA 2LCLA 3RESA 1TUDA 1LNXA 2JZ2A 3OYYA 1UDLA 1UGVA 2DF6A 2X9HA 1VQ5T 2E70A 2DLPA 1WHHA 2QEXQ 4QT7A 3UA6A 4BE0A 2FVUA 2ZCFB 3BW1A 4M75B 5HK3A 2FB7A 1W2BS 1K8AC 3GTMS 2X3XD 3MEWA 2RK2A 2GFAA 1D1CA 1T3SA 1MMNA 2MIOA 4RG2A 4YTLA 1UGQB 1JRIA 2BUDA 1OX9A 1Y71A 2QGGA 1RLPC 2RN8A 1M3AA 1GBQA 1SPKA 2KRMA 3NDQA 2JUFA 4C8QG 4Q5WA 4BI8B 3L2UA 1QMZB 3DLLA 5HBHB 1IB8A 5HY6A 4FW1A 1N8RR 2RMOA 2E64A 3VYGA 4JX4A 1N27A 4RTZA 3FEOA 3PE0A 4E6RA 3VYHB 4XTUA 4M7DF 1WQWA 4OP0A 2LT1A 2NUPB 4CC3A 1H25B 3TNIB 1D09B 2RO0A 4L5GA 3RDVA 3JB9G 3OYEA 4Y72B 4M78C 2NUPA 1M3CA 4M77E 3MPUB 4JLIA 1K9MC 3LW5E 1IHVA 1YITA 3JCMJ 4E7HA 4C92C 4M75C 5CK9A 4X1VA 1RI0A 3TN8B 3JCMd 2E3HA 2JM8A 2XDPA 4RKUE 4RUGA 4C5HA 5KYWB 1T3LA 2DL8A 1MMAA 2AKLA 2WEVB 2DJZA 4GBQA 1MV0B 3G6EA 1M3BA 3CCET 4F04B 1KQ2A 2QQAA 2ZZDB 1JQQA 5HBJB 5AYFA 2J6KA 2QTXA 1Y0MA 2M51A 4PKCC 4EMKA 2LX9A 2HL5C 1UGPB 3CEYA 5IH2A 2VXFA 5EFQB 1FMKA 2IIMA 5GAOl 1VIFA 2B9RA 3KBGA 1VQ7T 4GY5A 3G71T 5CYIB 4ZGEB 3PO3S 2JM9A 3CMEQ 3M59A 3CXCA 1D1BA 1JXMA 3VS2A 2LCSA 2ROTA 3CCUT 3OS0A 1VQPQ 4Z89A 3QXEB 1WIEA 2OJ2A 2G77A 4KULA 1Q7YR 1PSEA 1HSQA 3VS3A 4EORB 2CJMB 2WMBB 1VYUA 3CBMA 3VRZA 4HL4A 3T9NA 4AKGA 5GJVB 1ZLMA 1D0XA 4LUDA 3L2QA 2LVMA 4BDYA 2JXBA 3DDQB 3CC7A 1W70A 3QWXX 3OB9A 3E1SA 2DYBA 3CC4T 1KXUA 1K9MR 1TG0A 4CRLB 4J9DA 2NUTB 5CKFA 2DXBA 2KXDA 3NTIA 3TEEA 3S3OA 1K4US 2NWMA 3QWLA 4HA8A 5FRNA 1D3BA 2HZYA 4PJOA 4X34A 3G6EQ 2WIHB 1ABQA 1NPRA 4CFUD 2MWPA 2EYXA 2X51A 1QLBA 2HAXA 3EFOA 2LW4A 2JT4A 2JNGA 4RMOA 2E12A 1QKWA 4JX6A 4PLIA 5I22A 5GAMg 1ACMB 4A4FA 4XU3A 3JCMV 5HBEB 2OTLQ 4EOIB 4HT8A 1SHGA 2FPFA 6AT1B 3C0CA 5GMKl 5LL6S 1AWJA 2OTLT 2EFIA 2JTMA 4BUGA 4PJNA 2QG9B 2EBPA 2M9UA 3IQLA 1QVGA 4J8OA 3FB9A 1KHIA 2CH4W 3G4ST 5IDPB 3OA6A 1E7OA 2VKNA 1VQNA 5GAMe 5GAN8 4F7UG 4BCIB 3K7AM 1PC0A 3SB2A 4C8QB 4XU0A 3SDZA 1VQOQ 2M0OA 3TW6A 4FYWB 3FIFA 1TS9A 5GAMd 3V8LA 1VINA 2ABLA 4D8DA 4KBMB 2LT4A 2HNIA 2ZGWA 3CD6T 1UECA 2KT1A 4F16A 1FVVB 2KEAA 3OBWA 2QK0A 4RCBA 1KHCA 2W2HA 2DILA 1K9MU 2EJFA 2C5NB 3EGXB 4IUVA 1X27A 1ARKA 4YC3B 3CCVT 4E7SA 1BB9A 3E9GA 1V1CA 2F1LA 1FMWA 5HVYB 1JEGA 3M55A 2BZ8A 5GANh 1UB4A 2AZVA 2HKQB 3VKHA 4DBHA 2QA4A 2VASA 4C92B 2C5VB 2YRCA 4HLQA 5CQYA 5IDNB 1U1TA 1FMVA 1X2KA 5J26A 2FPDA 3HHTB 2HKNA 2M1HA 1VYWB 3CBPA 2KNBB 3H6ZA 4XQ3A 2W99A 4FCYA 2VGMA 3THKA 1Y96A 1ZHIA 2A7YA 2F2VA 2EQJA 4DOWA 5GMKh 3HRSA 2SRCA 2KROA 1OKWB 4E7ZA 2YRDA 4LXCA 2JMAA 1XNIA 5GAOn 3JCMW 1GY3B 4J9FA 1H3HA 1YP5A 1H3ZA 1NEGA 4E7LA 2P0QA 1VQNT 1QCOA 2DBKA 2HDAA 1K8AU 2QDJA 2K9GA 4JPBW 2QQSA 2P0KA 2J06A 5ACBA 1VQ8A 3L2VA 1RAFB 3D7SB 4E7IA 2EYYA 2WXVB 4OVAA 2D8JA 5FWCA 4NL2A 5GAN4 4LDWA 3EH2A 4NL3A 4PJJA 2H3EB 2CP3A 3BHUB 4J9EA 1TD6A 1UG1A 4NS5A 1TUCA 1H1QB 3X25B 4FM4B 3OYGA 4M7AC 5GAN7 4MFEA 2CGHA 3UA7A 5KCOA 1WXUA 3AT1B 1PSFA 5DQWA 1EZZB 1BIAA 5GMKe 1M1GA 4AKHA 3S6WA 1GUXB 5KYUB 1FKMA 1RAHB 4F6UB 3G4SQ 1WHLA 1GCQA 4QVDA 1XQHA 3JCMe 3OW2P 4C8QD 5D6YA 1MHNA 2AKKA 2XICA 4BI3A 3OYKA 3CCLT 2KMGA 2KY9A 2I40B 4EOJB 2EQKA 2DRMA 1Y7XA 5J3BA 3R6NA 3JCMX 4XAXB 2E3IA 4FIBA 1YJNT 5HNBB 3MHXA 3TSZA 1VQKA 5I21A 3A8OB 4IUTA 3SD4A 4AKIA 3TQ7P 1X6BA 1ZUUA 4CXAB 3EIDB 4BCOB 2AK5A 1TWBA 2O31A 2GGRA 4JX5A 2RQRA 3F5XB 1D3UB 3CBOA 1BK2A 5LJ5h 2KR6A 1BU1A 3M54A 1GRIA 1QVFP 3EGUA 1WPYA 3INZA 1VOLA 5FW9A 4LDYA 2DD4A 4J7IA 4G6LB 2E10A 2PQWA 3BLHB 4J7FA 1N9SA 4ZTJA 2QYZA 1Q95G 1UTIA 2JTFA 3CCRT 1C0MA 3M0UA 1OX8A 1ZQ1A 5IHNA 4MDXA 2X3WD 3CCSQ 1PKTA 2YDLA 1NJIR 3JB9F 2CP2A 3LX7A 1KC8U 5KH6A 4BCJB 2WIPB 1JKWA 1YJWA 2XMFA 1P92A 4L59A 1FINB 1IZ6A 3JCMh 1W1FA 3TCJA 2K7AA 1KQ1A 2AIRB 1FWZA 1W98B 1OPKA 2E6ZA 2JJ9A 2YHTA 3TSWA 1YHQA 1WJRA 2MCNA 2KVQG 4OMFB 3G4SA 2QI2A 1Q86U 1PRMC 4E2FB 3BHTB 1NE8A 1F1BB 1WZOA 4YOSA 3QDRB 2KE9A 3HRUA 2QF7A 2P4TA 1VQ5Q 1B07A 3UWNA 1SEMA 2F2WA 1C6VX 1PHTA 3VRYA 5HKCA 2GF7A 4FL6A 1YJNA 2IVXA 1KJWA 4ELLA 1BI2A 1IRXA 1BKBA 4L6V5 4EMHA 3PMTA 2E5KA 2CSQA 4M7AD 3OYIA 4ME7A 5EC7A 1GFCA 1YJ9Q 1LOJA 2FZCB 5GAOp 1IO6A 2PZ1A 2ESWA 2BKZB 4PJOF 4IUUA 2BZYA 2XDDA 2DYIA 3L42A 1LJOA 1UJ0A 3UPUA 2DAQA 5HK0A 2W0ZA 3TNHB 1NZ9A 1NJIC 5IHKA 5I5ZB 1B3QA 2QQBA 4CFVB 2EQUA 3CCLQ 1E7PA 3OBYA 3EG3A 2NUTA 2EJ9A 1R77A 1LCKA 3CQTA 1VOMA 1O9KB 4M78B 1WHMA 8AT1B 1K1ZA 3TW7A 2JOYA 5FWBA 3CXCS 5LJ3e 1M8VA 1K73R 2PMIB 1JJ2P 3ASKA 1YHQQ 2GNCA 3L2RA 1OGUB 4JLGA 2FO0A 3EHQA 4LN2A 2AHJB 3DB4A 3A8LB 5DQVA 2D0NA 1Q86C 1MNDA 2YT6A 4RTYA 4PFPA 5DY9A 4N4HA 3BDUA 1X6GA 3VKGA 5KYUA 5IF1B 3LYIA 3RIRA 1BCMA 2WSEE 3NTHA 1WFWA 4LD6A 4J9BA 4JRQA 2K6DA 1WXBA 5GAOq 5C0MA 3CC2T 1MGQA 2A0FB 5LJ3f 2HCKA 2XIDA 3H0FA 4RG8A 1VQ7A 4BCMB 3CMAQ 2PUOB 2D6FA 3OYDA 4M77D 4M7DD 4N4GA 1URCB 1QVFA 3M4GA 3VS6A 3V7CA 4C5GA 2ZPEB 2WHBB 5GAN5 2MAMA 1VQNQ 2E1HA 3ME9A 2F2CA 1MV3A 3HKSA 4M7AB 3CC4Q 4LOCA 3GNFB 1QVGP 4M7DA 1H24B 2YUOA 3NTKA 3EG1A 1VQLT 1RACB 4QVZA 3REAB 3VUZA 2K4YA 4V2SA 1M8MA 3QUIA 3QYEA 5D7UA 1QW1A 3QO3A 1GUXA 1TXQA 4OB2B 1QCFA 2DL4A 4E47A 1SG5A 2V26A 1AD6A 5DLOA 3DTOA 4C0FA 1GXIE 4M75D 3TU4K 1CSKA 2HMAA 1NG2A 3I35A 3M57A 2K5IA 2DXCA 3LGLA 2HL3A 3M0PA 2YUQA 4J9GA 2EWNA 1X69A 3C12A 3CPWP 5IXFA 4KGZB 3OW2S 3FLGA 2LC4A 1ZA1B 4BI4A 2WACA 4M6VA 2KRSA 2ROLA 4EIKA 1Q82C 2O2OA 5A0DA 2O01E 4M77G 5L23A 1YIJT 2SEMA 2DTHA 1VQ9A 2PK9B 3MY1B 3CPFA 1EFNA 3V7SA 2CSIA 2CH4A 2FRWA 1NLOC 3A1PA 1K8AR 4EOSB 1YHQT 1IGQA 1KQSP 2F5TX 3M9QA 3JCMP 2KBTA 3I9QA 2FZGB 1U8RA 3LLRA 4ELJA 2L3QA 4F7UA 4X9DA 5CKHA 1M1KU 1AWWA 2DO3A 1IXDA 3DJBA 4F7UB 1Q7YC 5IHIA 3VS1A 4BCKB 2VUBA 4RTWA 4QQ6A 1W2BP 3JB9J 4J9HA 4EOLB 2D8HA 2J7IA 4JJBA 2CP0A 3RBBB 3LWIA 4JZ4A 7AT1B 4BCNB 1PRLC 2PNIA 4M7DB 4LE9A 2L2PA 2CUBA 3MP6A 4LNPA 1P5EB 4KGVB 4IIOA 3L2ZA 2I2LA 3X20B 3OYCA 4Z02A 3PGGA 2RI5A 3LH5A 1RABB 2OAWA 1TFBA 2DD4B 2O88A 2C5OB 3M5AA 4RTTA 2V8KA 1NEBA 3BHVB 1M30A 1I4K1 2L0AA 2UZEB 2BZXA 3CC2Q 2JVVA 3E19A 4C92G 5GANd 1VQLQ 2E65A 3I55A 4KT0E 2IPOB 1WQ7A 3OY9A 2DMEA 4HVUA 1NBEB 1M1KC 3LQ5B 5KE2A 3KFVA 1YIJA 4JRKA 3OMCA 2QGFB 1YFNA 4I3ZB 2RJCA 1VQ9Q 1ENWA 1RAIB 3JCMg 1WHJA 2KT8A 4RODA 2ZPFB 5FU7C 1H92A 2VVKA 4N0AA 2D9TA 2VC8A 2COWA 9ATCB 3RMQA 2FZKB 3CCLA 4PK4A 3PIOA 2A37A 2GQIA 3HRTA 1D3BB 2CP6A 3LWHA 3J7AF 3X28B 4BDZA 4A4EA 5CKBA 2QA4Q 4QW2A 3X26B 1G3TA 4JJNK 4KRTA 3S3NA 4FYXB 3TREA 3X24B 1NYGA 2MWOA 2NLUA 1OQKA 1K76A 1UGRB 1A0NB 5I11A 3UATA 2CUDA 2KXCA 4GLKA 2D0QB 1GCPA 5LJ5g 3OYBA 2EKHA 1N5ZA 1M90U 5KYWA 1VYTA 3P8HA 1M90R 4ROEA 1VQMQ 4VUBA 3PVQA 4M78E 3CCVQ 2FHDA 5BNJB 4Y28E 2EQIA 4F7JB 4XTWA 3PNWC 4F14A 3GBQA 2YUNA 2R57A 3CCJQ 3MIAB 2JTEA 1AHJB 2JW4A 3CCEQ 3EJ1B 4ELYC 1S72T 2DE0X 4JS4A 2CKKA 2RQUA 3OSVA 1VQ4A 3P8DA 2CZ6B 4R56A 3DOGB 3QWYA 3BG5A 2D1XA 2OX7A 4O6JA 5FLXE 4FX3B 3VS4A 3BY7A 4BCQB 2I53A 3M56A 3CCUQ 2ZAEA 4M75F 2DKGA 3EG9A 4EPCA 3MP1A 4DEXA 3PTAA 3QYHB 1W6XA 1YWPA 1WXTA 2QTVA 1OI9B 4FU6A 1KD1C 2MK5A 4PJLA 3A8MB 2GTJA 3JB9H 5FGKB 2EYZA 4OMMA 3MEUA 4BACA 1C9BA 1KSWA 2JN0A 4KUIA 1K73U 3QKJA 1WJQA 2IN3A 3META 4EOQB 5CCAA 4IKFA 4PJOC 1GL5A 3WXMB 1TOVA 1OKVB 2KK4A 1U3OA 4II5B 2UZDB 1B7TA 1QWFA 1SHFA 1BCOA 1UNLD 2PVGB 4LDXA 2QEXA 3CCVA 3QJ6A 1VQ9T 1JSTB 4HT9A 1M90C 1RI9A 1I81A 4OF1A 3LGFA 3CPWS 2QFZA 2IW8B 3GP8A 3VYGB 3ER0A 1T0JA 4Y91A 2X1NB 2B86A 4JJDA 1PKDB 1VUBA 4X9CA 3HSBA 1M9SA 4ROCA 3RR6A 4YOOA 2GCXA 5ICPB 2X4XA 5GANf 5IHYA 4M78D 2R5AA 2XG8D 2L3SA 1M5Q1 3EHRA 1EX4A 4XTZA 3URGA 1WI7A 4EMKC 1WX6A 3H0HA 4PJOG 3GF5A 5GANg 1OL1B 4F6WB 1KK7A 3GNGA 1H27B 2COYA 2KSSA 4E7JA 1ZP2A 4AG1C 2RJFA 1OU8A 3BFMA 4A54A 3JRZA 5AT1B 3BDLA 3WVDB 4BBRM 4Z8AA 1BBZA 1BI3A 2KMTA 3OYLA 4A53A 1V29B 1VQ6A 4B9WA 4CFWB 4C92A 5KCHA 2BIVA 2LNHB 5A2QE 3CCMQ 2OTJA 3CCJT 1D0ZA 3TVTA 1QVGS 2LX7A 4JJCA 2CZ0B 2CYZB 2M0YA 2P84A 3G71A 3QHWB 3O5ZA 5L2WB 4JRPA 3Q1JA 3H4CA 3OQ5A 3V7RA 1OPLA 4IMYB 4PJOD 1YI2T 1PWTA 5IT9E 3QSUA 1VQ6Q 5KYXB 2L3PA 1Y57A 4J9IA 1TU0B 1JJ2A 4RTXA 1VQPT 4ESRA 1VQOA 3I5RA 2DRKA 2H8HA 2X4WA 3VKIA 1H8KA 4YOZA 2DPPB 2HEQA 3CC7Q 1G83A 4BXXX 2EW3A 2IVWA 1Z9ZA 5LJ3j 4PJOE 2EGAA 2O9VA 2K3BA 1QP3A 4CFNB 1O9KA 1QVPA 4M4ZA 4J6YA 4K11A 4ORZA 4CFUB 1XJWB 4C92D 5CVIA 1X43A 3PFSA 3JCMQ 5GANj 3CMAA 1QQJA 1OL2B 1YN8A 1VA7A 4BE2A 2RK1A 1M27C 4J5YA 4TVRA 3OW2A 1OU9A 3DDPB 4HNVA 2DZCA 2HSPA 3E2UA 3G6ET 3V8KA 3CCQA 4FYVB 1Q86R 1VQ8T 2UZBB 2AT1B 3EGDB 1VQLA 2NYSA 2CS7A 1YJ9A 3OSSC 2G3RA 2WPAB 4ZGDB 4EONB 2JS0A 5GAMf 2ZPHB 4R0KA 3OYJA 1H4LD 3NGPA 1AVZC 4KRDB 3JCMb 1H641 2L5QA 1Q81C 1H1PB 4F70B 3RMSA 5GAN2 1G3SA 1AOJA 2CP7A 5GMKm 2PVOB 4C8QC 1B34B 5LJ3d 1UGSB 2DM1A 4Z88A 3RUXA 1VQ4T 3G1JA 1X01A 5CKEA 4F7UE 1ZBXA 5FU6C 3OS2A 1HJDA 2BS2A 1X6OA 4BCGB 3S3MA 4C8QE 1U5SA 3MKDA 3I56Q 1F5QB 3SEMA 3KHIA 1NLPC 3EOCB 4A4KA 1V76A 4ELZC 3OMGA 3I55Q 1JSUB 4OR5B 3EG0A 2RNAA 4M7AF 5I2SA 3JV3A 1JBMA 3FRNA 4OB3B 2YUPA 1GFDA 3OYFA 3SWNA 2MYSA 1FXXA 5FROA 4PJOB 2CT4A 2R58A 1H1RB 4C0ZA 4NOYA 2CDTA 2DZ9A 2EGEA 4OMQA 2K5LA 2C0OA 1S72Q 5CQXA 2E41A 2BE9B 4CC4B 1HXDA 1TSFA 1XOVA 4OMLA 2BPMB 3M0SA 1ZSZC 4M77C 3KXTA 1YI2Q 3ZL7C 1E9HB 3PVLA 2Z0WA 2JS2A 3CCRQ 3HB9A 3QYGB 1IGUA 3ZEHA 4BB7A 3POMA 1UNGD 2QGSA 2V1RA 4KUDK 1UNHD 3BE3A 2KRNA 2RJEA 1NPPA 4AFQC 1UUEA 1KD1U 5EJCA 2DD5A 4CFMB 3VS7A 1S72A 2DBMA 1Q7YU 3M0TA 2DEQA 4C0DB 4M77A 1PD0A 5D6WA 2QDYB 4NSTB 3QIIA 4M7DC 1Y96B 2JGZB 1Q82R 2C4GB 4EMKB 2DTIA 2OTJT 4RCCA 1SRMA 1IREB 4DQ2A 3V8JA 2EUFA 2F2XA 3H0IA 2JMCA 2IW6B 2PK2A 3EFRA 3DKMA 2QEXT 1VQMA 1YITQ 3REBB 1OULA 4XK8E 1YCSB 2RF0A 3G33B 2DEUA 4OB0B 1PNJA 2VYTA 3RERA 2DETA 5GAOr 2BTTA 2LJ1A 2QA4T 4WCIA 1EIFA 2DD5B 2QQRA 1ZUYA 2RA2A 5CKDA 2RJDA 4JS5A 4DBQA 1VIEA 4JRIA 2LP5A 3J80E 1AZEA 1MMDA 2EYWA 2DMOA 4RTUA 1GBRA 3M4YA 1VQOT 2DVEA 4O5VA 4M77F 2P0PA 4DBFA 4C8QA 1K9AA 3OYHA 5LQFB 1HK9A 2K2MA 4B9XA 4F7NB 3CCMT 4BCFB 3HZJA 3VJPA 3NPFA 1I8FA 4Y92A 2ZPBB 2RHYA 1ZBJA 1RAAB 2ZPGB 5LJ5j 3LH0A 2GBQA 4HNTA 3A98A 3EH1A 4BCQD 4D6WA 4M75A 2IW9B 3C94A 1UFFA 1N9RA 4IUPA 1I07A 2VWFA 2PJQA 4A4HA 3EFSA 8ATCB 4J83A 2FYKA 1M1KR 1FYNA 4JZ3A 3PIPA 1OEBA 4HKEA 1JOWA 4BE1A 2MF2A 2DXTA 4C8QF 1O75A 1KIKA 4QKUA 1IHWA 1K0SA 2FG0A 4QSHA 2I0NA 3CCJA 4OGRB 2FEIA 4B6MA 1D1AA 4LDVA 1K73C 1R0CB 1BYMA 1M2OA 4C0DC 2QXFA 2EQMA 3EAEA 4EOPB 5IAYA 3BLRB 3O0GD 1AISB 2BS4A 2A28A 2LJ0A 4F7UF 1G5VA 2RQVA 4C5EA 1WYXA 2LMJA 1RADB 4XTVA 2V8IA 1QLYA 2RPNA 4HXJA 3QPHA 2EVRA 4M77B 1ZSZB 5LJ3h 3A8HB 1KG1A 2YXYA 2YLBA 4FT4A 5C6SA 2O9SA 3CCMA 2OTJQ 2DXUA 5KYYB 3KUFA 1N8RU 4QQDA 1S1NA 3H9NA 1HD3A 4MDWA 3JSCA 3H41A 5J39A 2MOXA 5D6XA 3CCEA 4NC6A 1YITT 2Y4YA 1YJ9T 1BU2A 2EKOA 2A36A 3E9FA 1KC8R 1B34A 2CP5A 2QDLA 3P8BB 1UEBA 2KQWA 4OMPA 1I0CA 3A8GB 5A0LA 4CRIA 5CAIA 4EDUA 1VYVA 1VQ5A 2FRYA 3JCMc 3UT1A 4QVCA 3MP8A 3HPWA 4CC2A 2M02A 4EOKB 3RGFB 3FC3A 3OS5A 5I2MA 4FYYB 1G3NC 3SWNC 2MI6A 2XD0A 1OV3A 5FU6B 1GH6B 5LJ3g 4AFZC 1JJ2S 1YBYA 2YSQA 4C5IA 2DFUA 4MFDA 1DJ7B 4HVWA 2LTOA 3EGXA 4OMNA 2XI9A 3HTRA 3NHNA 2K3XA 2KDSA 2YLCA 3F70A 3QG1A 1VQKQ 5DM7R 4ZN1A 4F7LB 3BLQB 1LVKA 1VQKT 3HL8A 2ENMA 1I5LA 2GQVA 1VQ6T 3GLXA 2HBWA 1D0YA 4M7DE 4PNOA 2ED1A 2CREA 3QZ5B 2RQWA 4J9CA 1GCQC 3M58A 1WLPB 4IURA 5GMKj 3RKXA 1CKBA 4BCMD 2HQXA 2BS3A 4FT2A 2YWWA 4M7AA 3NMZC 3M03A 5HCKA 2EPDA 2H3JA 2WMAB 3M53A 3ZBDA 4EOOB 2PU9B 3EGDA 3ULRB 3OYAA 1N8RC 4F6SB 2W10A 5GANe 3DLMA 1N4MA 4BY6B 2BKDN 2O4XB 2WSFE 4E7KA 2ATCB 3HFOA 5GAN6 2CCHB 1X2QA 2KI7A 5CO7A 3UDCA 2L89A 1TUGB 2DNUA 3RKYA 3OS1A 1C1AA 2LRQA 1PKSA 3VS5A 4XTXA 2E5QA 1UJYA 1H26B 2BE7D 4QQGA 2VXEA 1SSHA 2DXBB 1N6AA 3CCUA 3HO8A 5CIUA 1CKAA 5M9OA 5FU7B 1Q81U 3VU3C 4BBSM 2CT3A 1PD1A 4F17A 4DEYA 2EAYA 5GAMj 1WA7A 1KQSA 1G3YA 2RI2A 1G2BA 2L8DA 2M16A 1M2VA 1U06A 5EG2A 5HQ0B 3RNJA 1YCYA 1X75C 3QHSA 3QDFA 3EG2A 4TTHA 2LQWA 1G8XA 4XU2A 4HCZA 3QBYA 2XDBA 2DA9A 4M78A 2W96A 4BD3A
chains in the Genus database with same CATH topology
4RG8A 3GIBA 4OGEA 1VQ7A 2KAFA 5IN1A 2PUOB 2D6FA 3OYDA 4M77D 2QQAA 2ZZDB 1VQLA 1W2BA 2CS7A 5AYFA 3OSSC 1YJ9A 4JDSA 4M7DD 5L8RE 4N4GA 2G3RA 1Q82U 4ZGDB 2QTXA 1QVFA 4HNUA 2DIQA 3M4GA 3V7CA 2DK3A 4PKCC 4C5GA 2ZPEB 2LX9A 4EMKA 2ZPHB 1UGPB 3CEYA 5GAMf 3OYJA 3I56T 3CCET 5GAN5 2MAMA 2VXFA 2E1HA 3ME9A 3JCMb 2Y4XA 1VIFA 3HKSA 4M7AB 4ZN3A 1H641 3KBGA 5GAOl 4LOCA 2L5QA 3HFNA 3GNFB 4GY5A 2LDMA 3G71T 1Q81C 1VQ7T 4P5NA 3RMSA 4M7DA 4ZGEB 3NTKA 5GAN2 1G3SA 1VQLT 3M59A 3CXCA 5GMKm 2PVOB 4QVZA 4C8QC 1B34B 5LJ3d 2K4YA 3VUZA 3CCUT 3OS0A 4V2SA 1UGSB 3QXEB 4Z6YA 5LJ5d 3QUIA 3QYEA 4ZTFA 2G77A 3RUXA 1VQ4T 1QW1A 3QO3A 1X01A 3JAME 5CKEA 4F7UE 1VQ8T 2RI3A 4MMLA 4OB2B 2LNVA 2K57A 4MMKA 1ZBXA 2C06A 3AHUA 4E47A 2FL7A 4KULA 5FU6C 1PSEA 3OS2A 3CBMA 3BG3A 4M7AG 4HL4A 2BS2A 1X6OA 3T9NA 4AKGA 5DLOA 3S3MA 4C0FA 1GXIE 4C8QE 4M75D 3L2QA 3TU4K 2LVMA 4BDYA 3M57A 3KHIA 3CC7A 4PLLA 4A4KA 2K5IA 4ELZC 3OB9A 3E1SA 2DXCA 3CC4T 3LGLA 4M78F 2HQEA 5CKFA 2DXBA 2F5KA 3OMGA 3NTIA 3TEEA 3S3OA 3VV0A 3QWLA 2EWNA 4HA8A 3C12A 3CMET 2RHIA 1D3BA 5FRNA 2RH2A 4M7AF 4X34A 4PJOA 4DOVA 5I2SA 3CMEA 3OW2S 1NPRA 3FLGA 1JBMA 2LC4A 1Y07A 5GAN3 3FRNA 4BI4A 2MWPA 2WJ9A 2WACA 4M6VA 4OB3B 3CC7T 3OYFA 1Q82C 5A0DA 2OTLA 2O01E 4M77G 3SWNA 1YIJT 1QLBA 2ZPIB 2HAXA 2DTHA 2VV5A 1VQ9A 3CPFA 2JNGA 1FXXA 2E12A 2K2VA 2RHUA 3V7SA 5FROA 4RMOA 4ATOA 5KE3A 2R58A 4PJOB 4JX6A 4PLIA 2IG0A 4C0ZA 4NOYA 5GAMg 4A4FA 4MZPA 5FRMA 4XU3A 3JCMV 2DZ9A 1YHQT 2K5LA 4HT8A 3C4SA 5GMKl 2F5TX 3M9QA 5LL6S 4MZMA 5CQXA 3JCMP 2OTLT 2E41A 4FSXA 1OZ3A 1U8RA 1HXDA 1XOVA 2EFIA 3LLRA 4ELJA 2JTMA 3BG9A 4BUGA 4F7UA 5GAOm 4M77C 3KXTA 4X9DA 5CKHA 1M1KU 2M9UA 2DO3A 5LJ5f 4F7UB 1QVGA 1Q7YC 3MEAA 4J8OA 3FB9A 1KHIA 3HB9A 3QYGB 2VUBA 4QQ6A 3G4ST 3ZEHA 3JCMf 3OA6A 4JUVA 4BB7A 2F69A 3JB9J 4KUDK 3DB3A 4C92E 1VQNA 5GAMe 2X35A 5GAN8 4F7UG 5LJ5e 2RJEA 1NPPA 3SB2A 1KD1U 4C8QB 3LWIA 2OAUA 4XU0A 3H8ZA 5EJCA 2EJGA 2DD5A 3SDZA 2M0OA 3TW6A 1S72A 5A0GA 4M7DB 1Q7YU 3FIFA 2XU8A 5GAMd 3MP6A 3V8LA 2DEQA 4C0DB 4M77A 4KBMB 2LT4A 2HNIA 2ZGWA 3CD6T 5D6WA 2QDYB 3QZ9B 3L2ZA 3QIIA 1Y96B 3JB9I 2I2LA 4LDUA 4M7DC 3X20B 4EMKB 3OYNA 2DTIA 2RHZA 3A5ZB 3PGGA 2RI5A 4Z02A 3OYCA 3OBWA 4RCBA 2OTJT 4RCCA 4OB1B 1KHCA 1IREB 4DQ2A 1K9MU 2EJFA 3V8JA 4UC4A 2DD4B 1FX7A 3CCQT 1VQ4A 3M5AA 2PVDB 2HD0A 2O4XA 4IUVA 1WNLA 3CCRA 1RL2A 4M78G 3EFRA 3L2WA 1W4SA 3DKMA 4IUQA 4M7AE 2QEXT 3CCVT 1VQMA 2V8KA 3E9GA 3CD6A 1I4K1 1M4ZA 4XK8E 3SWNB 2JVVA 3E19A 4C92G 5GANd 2E65A 3I55A 4KT0E 4XU1A 3M55A 1WQ7A 4MZTA 3OY9A 5GANh 1UB4A 4XTYA 3I55T 4OB0B 1TH7A 3VKHA 3N5BB 2QA4A 1M1KC 2VYTA 3NFCA 3RERA 5GAOr 5KE2A 4C92B 2QA4T 1YIJA 4JRKA 3OMCA 2DXCB 4HLQA 1EIFA 2LQ8A 2DD5B 2QQ9A 5CQYA 2RJCA 1U1TA 2QQRA 2RA2A 3HP9A 5J26A 4EMGA 5CKDA 2RJDA 3H6ZA 3HHTB 2M1HA 1SSFA 3CBPA 4XQ3A 4JS5A 2GFUA 2R5MA 1VIEA 3JCMg 2VGMA 4JRIA 3J80E 2ZPFB 1Y96A 1ZHIA 2A7YA 2EQJA 5FU7C 4DOWA 5GMKh 1VQPA 3HRSA 4N0AA 2WSCE 2D9TA 2VC8A 2Y90A 3FJPA 3M4YA 3O8VA 3R6OA 3RMQA 1XNIA 2DVEA 2ZZDA 1VQOT 3CCLA 1QVFS 4O5VA 4M77F 4WF2A 2P0PA 5GAOn 3PIOA 3JCMW 3HBLA 5GAMh 4C8QA 3OYHA 1YI2A 3HRTA 1D3BB 3LWHA 4E7LA 1H3ZA 1HK9A 3J7AF 1WGSA 2P0QA 3X28B 4B9XA 3CCMT 4BDZA 3HZJA 3VJPA 4A4EA 5CKBA 4QW2A 1VQNT 3X26B 1I8FA 1G3TA 1OZ2A 2YRVA 1K8AU 2ZPBB 2RHYA 4M75G 4J6XA 2QDJA 2ZPGB 2A3LA 5LJ5j 4JJNK 3LH0A 4C5EA 4HNTA 3S3NA 2QQSA 2P0KA 3TREA 3VUBA 3X24B 2XKOC 4D6WA 4M75A 4N4IA 2MWOA 3C94A 4IUPA 1N9RA 2NLUA 2DIGA 1UGRB 3CCST 1VQ8A 3L2VA 4E7IA 3CCSA 4OVAA 4A4HA 4GLKA 3EFSA 4NL2A 5GAN4 1BI0A 2K3YA 4LDWA 3CC4A 4J83A 2B8AA 2FYKA 4NL3A 2D0QB 3QYBA 4N0AC 3SFMA 3PIPA 4NS5A 5LJ5g 5GMKi 3OYBA 2L3RA 4HKEA 4BE1A 3X25B 2MF2A 1M90U 3J81E 4FM4B 3OYGA 4M7AC 2DXTA 2LCCA 1OYXA 4PL6A 1O75A 2E6NA 3P8HA 4C8QF 5GAN7 4MFEA 3CMAT 2CGHA 5KCOA 3MO8A 3PMIA 1PSFA 4QSHA 3QJYA 1XTDA 1BIAA 3RKWA 5GMKe 1M1GA 4AKHA 2LQKA 3S6WA 4VUBA 3CCJA 1FKMA 4M78E 2FHDA 3L1AA 2RM4A 4Y28E 4MIMA 4QVDA 1XQHA 3JCMe 1JB0E 4LDVA 4AI6A 1K73C 4XTWA 1BYMA 3PNWC 4C0DC 1BI1A 1MHNA 1WJSA 2QXFA 2EQMA 2XICA 5D6YA 4BI3A 3OYKA 3EAEA 2R57A 5IAYA 2RB6A 2CZ1B 2KMGA 4II1A 1QP2A 3CCLT 1AHJB 4DA4A 2KY9A 4OGCA 2BS4A 2X4YA 4ELYC 1S72T 4F7UF 1U1SA 2QQ8A 1G5VA 4JS4A 2EQKA 2RHXA 1Y7XA 2CKKA 3G7ZA 3OSVA 5J3BA 3P8DA 2CZ6B 2VGNA 4XAXB 4FIBA 3JCMX 4R56A 3GOXA 1YJNT 3BG5A 2V8IA 3MHXA 4XTVA 4LD9K 5FLXE 4O6JA 1VQKA 3MCAB 5I21A 3A8OB 4IUTA 3SD4A 4AKIA 4C0GA 3ZFJA 3OYMA 3MEVA 3BY7A 3M56A 4M75F 4EPCA 2DKGA 3QPHA 4M75E 4JX5A 3MP1A 4M77B 3PTAA 3QYHB 3CBOA 3A8HB 5LJ3h 5LJ5h 2KR6A 1KG1A 2CZ7B 4FU6A 1KD1C 3M54A 2YLBA 3A8MB 3JB9H 4FT4A 5C6SA 3CCMA 3MEUA 4BACA 4M7DG 2K5FA 1WPYA 2JN0A 3JB9D 3INZA 3WVEB 4KUIA 1K73U 2DXUA 4LDYA 2DD4A 3KUFA 1WJQA 3QKJA 4J7IA 1N8RU 4QQDA 2E10A 2PQWA 3META 4MDWA 3JSCA 5CCAA 4IKFA 1OI1A 4J7FA 5J39A 1N9SA 4PJOC 3WXMB 5D6XA 4ZTJA 2KK4A 3CCEA 4NC6A 1YITT 2Y4YA 1YJWT 2JTFA 1YJ9T 2V8JA 3CCRT 2PVGB 2EKOA 4LDXA 3E9FA 2QEXA 1ZQ1A 3CCVA 1VQMT 4MDXA 3QJ6A 1B34A 1VQ9T 3P8BB 3I56A 1UEBA 4HT9A 2KQWA 2EIFA 4BY6C 1M90C 3JB9F 3A8GB 3LX7A 1M1FA 1I81A 2X4JA 5A0LA 1KC8U 4OF1A 3LGFA 3CC2A 4CRIA 5CAIA 4EDUA 5KH6A 3CPWS 1VQ5A 3JCMc 2QFZA 3GP8A 3VYGB 3UT1A 3ER0A 4A4GA 3CPWA 1YJWA 4QVCA 3MP8A 4Y91A 1P92A 2DTOA 3HPWA 4L59A 3FC3A 1IZ6A 1G3WA 3C95A 3OS5A 5I2MA 3SWNC 3JCMh 2XHCA 3TCJA 1KQ1A 1VUBA 2MI6A 4X9CA 1M9SA 2XD0A 3HSBA 1FWZA 5DLQE 5FU6B 2YHTA 2E6ZA 2GCXA 5LJ3g 1R8OB 4ZGJB 1YHQA 1WJRA 2X4XA 5GANf 1JJ2S 2KVQG 1YBYA 3FDRA 2QI2A 4M78D 2R5AA 4OMFB 4C5IA 3G4SA 3DL1A 2XG8D 4MFDA 1DJ7B 2LTOA 4R55A 1M5Q1 1BIBA 4CI0C 2XI9A 4XTZA 3URGA 3GPLA 4J6WA 1NE8A 2PUKB 2K3XA 3QDRB 2KDSA 3HRUA 4EMKC 2QF7A 2P4TA 2YLCA 3F70A 4C92F 3UWNA 1NJIU 1O9SA 3QG1A 4PJOG 2HBPA 2XK0A 5HKCA 3GF5A 2GF7A 5GANg 4FL6A 5DM7R 1YJNA 4ZN1A 3GNGA 2RD1A 1VQKT 3HL8A 2KSSA 1I5LA 2GQVA 3PT9A 1BI2A 4E7JA 3GLXA 1VQ6T 1BKBA 4L6V5 4EMHA 3PMTA 2RJFA 4M7DE 4PNOA 3QZ5B 3BFMA 1KQSS 2MMPA 4M7AD 3M58A 4IURA 4A54A 3JRZA 5GMKj 3RKXA 5CR2A 4HCCA 3OYIA 1KC8C 3BDLA 3WVDB 4BBRM 2HQXA 4ME7A 2BS3A 1BI3A 2EYQA 2KMTA 1LOJA 4HCBA 3OYLA 4A53A 5GAOp 2LCLA 4FT2A 3RESA 1V29B 1LNXA 1VQ6A 4B9WA 4C92A 5KCHA 2JZ2A 2BIVA 4PJOF 4M7AA 3OYYA 5A2QE 4IUUA 2OTJA 2XDDA 3CCJT 3L42A 1LJOA 3UPUA 1QVGS 2H3JA 1VQ5T 2DAQA 5HK0A 3M53A 2CZ0B 2E70A 2PU9B 2CYZB 3ZBDA 3OYAA 1N8RC 1NZ9A 1NJIC 4BE0A 2FVUA 2ZCFB 3BW1A 4M75B 5HK3A 2FB7A 1W2BS 1K8AC 3G71A 3MEWA 5GANe 2RK2A 2GFAA 2QQBA 2EQUA 4JRPA 3DLMA 1E7PA 4BY6B 3OBYA 3Q1JA 4RG2A 2BKDN 4YTLA 1UGQB 1JRIA 2BUDA 3H4CA 2EJ9A 2O4XB 2WSFE 4E7KA 1Y71A 3OQ5A 4M78B 3V7RA 3HFOA 5GAN6 4PJOD 1YI2T 5CO7A 5IT9E 3QSUA 2JUFA 3UDCA 4Q5WA 2L89A 4C8QG 3TW7A 2JOYA 3RKYA 3OS1A 4BI8B 1JJ2A 2LRQA 3L2UA 3CXCS 5LJ3e 1M8VA 3DLLA 1VQOA 5HY6A 1VQPT 4XTXA 2X4WA 2E5QA 2E64A 3VKIA 2DPPB 3ASKA 3VYGA 4JX4A 1N27A 4QQGA 3L2RA 3FEOA 2VXEA 2DXBB 3VYHB 4JLGA 1N6AA 4XTUA 4M7DF 1WQWA 2IVWA 3HO8A 4OP0A 3CCUA 5LJ3j 2LT1A 5CIUA 4PJOE 5M9OA 2AHJB 3DB4A 5FU7B 3A8LB 2RO0A 1QP3A 3JB9G 4L5GA 1Q81U 1QVPA 3VU3C 3OYEA 4BBSM 4J6YA 4M78C 1Q86C 4M77E 4C92D 2EAYA 5CVIA 5GAMj 1KQSA 1Q86U 1G3YA 4JLIA 1K9MC 2RI2A 3PFSA 5DY9A 2L8DA 2M16A 3LW5E 4N4HA 3BDUA 3JCMQ 3JCMJ 4E7HA 4C92C 5GANj 1YITA 3CMAA 4M75C 3VKGA 5EG2A 5CK9A 1YCYA 1RI0A 1X75C 3QHSA 3LYIA 4BE2A 3JCMd 3RIRA 2WSEE 3NTHA 4LD6A 2RK1A 4J5YA 4TVRA 4JRQA 2XDPA 3OW2A 4RKUE 4HNVA 5GAOq 4C5HA 5C0MA 2DZCA 4XU2A 4HCZA 3QBYA 3CC2T 1MGQA 2XDBA 2DJZA 4M78A 3G6ET 3V8KA 5LJ3f 3CCQA 2XIDA 3G6EA 4BD3A 4C8QD 1KQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DD5 A;  2PUO B;  1PSF A;  2ZZD B;  5L8R E;  4ZGD B;  2ZPE B;  2ZPH B;  1UGP B;  2QDY B;  3QZ9 B;  4L6V 5;  3X20 B;  4Y28 E;  3QZ5 B;  1JB0 E;  4OB1 B;  1IRE B;  2DD4 B;  4ZGE B;  3WVD B;  2CZ1 B;  1QP2 A;  2PVD B;  1AHJ B;  2PVO B;  1V29 B;  1UGS B;  3QXE B;  2CZ6 B;  4XK8 E;  3A8O B;  4KT0 E;  4OB2 B;  4OB0 B;  1PSE A;  2CZ0 B;  2PU9 B;  2CYZ B;  2ZCF B;  1GXI E;  3QYH B;  3A8H B;  2DXC B;  2CZ7 B;  2DD5 B;  1UGQ B;  3A8M B;  2WSF E;  2DXC A;  3HHT B;  2DXB A;  3WVE B;  2DD4 A;  2ZPF B;  2WSC E;  4OB3 B;  2ZZD A;  2DPP B;  2O01 E;  3VYG A;  2ZPI B;  2PVG B;  2DXB B;  3VYH B;  2AHJ B;  3A8L B;  3X28 B;  1QP3 A;  3A8G B;  3X26 B;  2ZPB B;  2ZPG B;  3VYG B;  3X24 B;  3LW5 E;  1UGR B;  2WSE E;  3QYG B;  4ZGJ B;  2D0Q B;  4RKU E;  1DJ7 B;  3X25 B;  4FM4 B;  2PUK B; 
#chains in the Genus database with same CATH topology
 3GIB A;  4OGE A;  2KAF A;  5IN1 A;  1W2B A;  4JDS A;  5L8R E;  1Q82 U;  4HNU A;  2DIQ A;  4KGX B;  2J6F A;  2DK3 A;  3I56 T;  2KR3 A;  1QMC A;  4GLM A;  1YWO A;  2Y4X A;  4ZN3 A;  3HFN A;  2LDM A;  4P5N A;  4D8K A;  1SF9 A;  4A63 B;  1QKX A;  4BCP B;  4Z6Y A;  5LJ5 d;  4ZTF A;  3JAM E;  2RI3 A;  4MML A;  4MMK A;  2LNV A;  2K57 A;  2C06 A;  3AHU A;  2HQH A;  2FL7 A;  5CEI B;  3BG3 A;  4M7A G;  1Z9Q A;  1Q81 R;  1K0X A;  4PLL A;  1RUW A;  4ANJ A;  4M78 F;  2HQE A;  2F5K A;  2MPX C;  3VV0 A;  3EFO B;  3EG9 B;  3CME T;  2RHI A;  2RH2 A;  4DOV A;  1HYO A;  3CME A;  2J6O A;  2QAZ A;  2DX1 A;  1Y07 A;  5GAN 3;  2WJ9 A;  4PFO A;  3CC7 T;  4KRC B;  4RTV A;  2OTL A;  2OI3 A;  1AEY A;  1UHF A;  2ZPI B;  1JXO A;  2VV5 A;  1J3T A;  2RHU A;  2K2V A;  4ATO A;  1ZSG A;  5KE3 A;  2AZS A;  1SRL A;  2IG0 A;  2J05 A;  5FRM A;  4MZP A;  2RQT A;  2HSE B;  2C6T B;  3C4S A;  1AWO A;  1LPL A;  4MZM A;  4FSX A;  2PTK A;  1OZ3 A;  3BG9 A;  5GAO m;  5LJ5 f;  1M2V B;  2DER A;  3MEA A;  2P4R A;  4FW2 A;  2ECZ A;  3JCM f;  4JUV A;  2W9Z A;  2F69 A;  3QHR B;  1E6H A;  1QWE A;  3DB3 A;  4C92 E;  2X35 A;  5LJ5 e;  1I5O B;  1KFZ A;  4OMO A;  2OAU A;  3H8Z A;  2EJG A;  4BY7 X;  5A0G A;  4PJM A;  2XU8 A;  1R0B G;  2DJQ A;  2UUE B;  2C0T A;  3QZ9 B;  3JB9 I;  4LUE A;  4LDU A;  3U23 A;  3OYN A;  3A5Z B;  2RHZ A;  2LQN A;  4OB1 B;  3M0Q A;  4BY1 X;  2COZ A;  4UC4 A;  2NUZ A;  5KYY A;  1FX7 A;  1UHC A;  2C0I A;  1PCX A;  3CCQ T;  2PVD B;  2HD0 A;  2KGT A;  2O4X A;  1WNL A;  4EC9 B;  3CCR A;  1RL2 A;  4M78 G;  1PM3 A;  3L2W A;  1W4S A;  4IUQ A;  4M7A E;  1MMG A;  3CD6 A;  4F7S B;  1M4Z A;  3SWN B;  1KD1 R;  3MJX A;  2R7G A;  1JU5 C;  5LMK B;  1ABO A;  4XU1 A;  4KH1 B;  4MZT A;  1AWX A;  4XTY A;  3I55 T;  1TH7 A;  3N5B B;  3NFC A;  2G9X B;  2DXC B;  2LQ8 A;  2QQ9 A;  3HP9 A;  4EMG A;  1OOT A;  1SSF A;  2EGC A;  2DL7 A;  2KYB A;  2DVJ A;  1YJW Q;  2GFU A;  4AT1 B;  2R5M A;  3CD6 Q;  1XO2 A;  1VQP A;  2WSC E;  2Y90 A;  4CFX B;  3FJP A;  3R6O A;  3O8V A;  1QVF S;  2ZZD A;  4WF2 A;  3HBL A;  5GAM h;  2K79 A;  1YI2 A;  3G71 Q;  2LJ3 A;  1WGS A;  4KH0 B;  1WDX A;  1MUZ A;  1OZ2 A;  2YRV A;  4M75 G;  4J6X A;  2A3L A;  1AD5 A;  1E6G A;  3VUB A;  2XKO C;  4N4I A;  5GJW B;  3CCS T;  2DIG A;  1OIY B;  3CCS A;  5KYN A;  1BI0 A;  2K3Y A;  3CC4 A;  1RLQ C;  2B8A A;  4N0A C;  3QYB A;  3SFM A;  2V1Q A;  5GMK i;  2W9F A;  2L3R A;  3B57 A;  2CCI B;  3J81 E;  2LCC A;  1OYX A;  4PL6 A;  3CMA T;  2E6N A;  1VQ8 Q;  3MO8 A;  3PMI A;  2VB6 A;  3QJY A;  1XTD A;  3RKW A;  2LQK A;  3VS0 A;  3L1A A;  2RM4 A;  1AT1 B;  4MIM A;  1WHG A;  2E4H A;  1JB0 E;  4EOM B;  4AI6 A;  1BI1 A;  1WJS A;  4PFZ A;  1I1J A;  4ZNX A;  2RB6 A;  2CZ1 B;  4II1 A;  1QP2 A;  1H28 B;  4FSS A;  3UF4 A;  4DA4 A;  1PG5 B;  4IIM A;  4OGC A;  2X4Y A;  1U1S A;  2QQ8 A;  4UN0 A;  1ZSZ A;  2RHX A;  3G7Z A;  3GOX A;  2VGN A;  4LD9 K;  2WFY B;  2DL5 A;  3MCA B;  2UZL B;  1ZA2 B;  4C0G A;  3ZFJ A;  3OYM A;  3TNW B;  3MEV A;  5IXB A;  1ZUK A;  2DL3 A;  4CC7 A;  4M75 E;  2LZ6 B;  4BCH B;  1OIU B;  2CZ7 B;  4HVV A;  3FJ5 A;  3MY5 B;  1UE9 A;  2ED0 A;  2K5F A;  4M7D G;  3JB9 D;  3WVE B;  2FPE A;  3CCQ Q;  1VQ4 Q;  1WHK A;  1ZX6 A;  1OI1 A;  2KYM A;  1RAG B;  1NM7 A;  1T0H A;  4HCK A;  4AFU C;  4AMC A;  4DBR A;  1YIJ Q;  4AG2 C;  1YJW T;  2V8J A;  4BCN D;  1VQM T;  1AZG B;  3I56 A;  2V22 B;  2EIF A;  4BY6 C;  1RAE B;  1YJN Q;  1M1F A;  2X4J A;  3CXC P;  3CC2 A;  3SHW A;  2A08 A;  4A4G A;  3CPW A;  2DTO A;  2G6F X;  2GTO A;  1YNZ A;  1G3W A;  3C95 A;  1VQ7 Q;  2XHC A;  5KYX A;  5DLQ E;  1TTH B;  4WTO B;  1R8O B;  4ZGJ B;  1MNE A;  3FDR A;  3DL1 A;  1NYF A;  4R55 A;  5ECA A;  1BIB A;  4CI0 C;  3GPL A;  1JO8 A;  4J6W A;  2PUK B;  1NJI U;  4C92 F;  1O9S A;  2HBP A;  2XK0 A;  4EC8 B;  3MI9 B;  2QAS A;  2RD1 A;  3M0R A;  2C5X B;  3PT9 A;  4AFS C;  3I5S A;  1H1S B;  1SKU B;  1KQS S;  2MMP A;  5CR2 A;  4HCC A;  1KC8 C;  1QCN A;  2PHG A;  2EYQ A;  4HCB A;  2LCL A;  3RES A;  1TUD A;  1LNX A;  2JZ2 A;  3OYY A;  1UDL A;  1UGV A;  2DF6 A;  2X9H A;  1VQ5 T;  2E70 A;  2DLP A;  1WHH A;  2QEX Q;  4QT7 A;  3UA6 A;  4BE0 A;  2FVU A;  2ZCF B;  3BW1 A;  4M75 B;  5HK3 A;  2FB7 A;  1W2B S;  1K8A C;  3GTM S;  2X3X D;  3MEW A;  2RK2 A;  2GFA A;  1D1C A;  1T3S A;  1MMN A;  2MIO A;  4RG2 A;  4YTL A;  1UGQ B;  1JRI A;  2BUD A;  1OX9 A;  1Y71 A;  2QGG A;  1RLP C;  2RN8 A;  1M3A A;  1GBQ A;  1SPK A;  2KRM A;  3NDQ A;  2JUF A;  4C8Q G;  4Q5W A;  4BI8 B;  3L2U A;  1QMZ B;  3DLL A;  5HBH B;  1IB8 A;  5HY6 A;  4FW1 A;  1N8R R;  2RMO A;  2E64 A;  3VYG A;  4JX4 A;  1N27 A;  4RTZ A;  3FEO A;  3PE0 A;  4E6R A;  3VYH B;  4XTU A;  4M7D F;  1WQW A;  4OP0 A;  2LT1 A;  2NUP B;  4CC3 A;  1H25 B;  3TNI B;  1D09 B;  2RO0 A;  4L5G A;  3RDV A;  3JB9 G;  3OYE A;  4Y72 B;  4M78 C;  2NUP A;  1M3C A;  4M77 E;  3MPU B;  4JLI A;  1K9M C;  3LW5 E;  1IHV A;  1YIT A;  3JCM J;  4E7H A;  4C92 C;  4M75 C;  5CK9 A;  4X1V A;  1RI0 A;  3TN8 B;  3JCM d;  2E3H A;  2JM8 A;  2XDP A;  4RKU E;  4RUG A;  4C5H A;  5KYW B;  1T3L A;  2DL8 A;  1MMA A;  2AKL A;  2WEV B;  2DJZ A;  4GBQ A;  1MV0 B;  3G6E A;  1M3B A;  3CCE T;  4F04 B;  1KQ2 A;  2QQA A;  2ZZD B;  1JQQ A;  5HBJ B;  5AYF A;  2J6K A;  2QTX A;  1Y0M A;  2M51 A;  4PKC C;  4EMK A;  2LX9 A;  2HL5 C;  1UGP B;  3CEY A;  5IH2 A;  2VXF A;  5EFQ B;  1FMK A;  2IIM A;  5GAO l;  1VIF A;  2B9R A;  3KBG A;  1VQ7 T;  4GY5 A;  3G71 T;  5CYI B;  4ZGE B;  3PO3 S;  2JM9 A;  3CME Q;  3M59 A;  3CXC A;  1D1B A;  1JXM A;  3VS2 A;  2LCS A;  2ROT A;  3CCU T;  3OS0 A;  1VQP Q;  4Z89 A;  3QXE B;  1WIE A;  2OJ2 A;  2G77 A;  4KUL A;  1Q7Y R;  1PSE A;  1HSQ A;  3VS3 A;  4EOR B;  2CJM B;  2WMB B;  1VYU A;  3CBM A;  3VRZ A;  4HL4 A;  3T9N A;  4AKG A;  5GJV B;  1ZLM A;  1D0X A;  4LUD A;  3L2Q A;  2LVM A;  4BDY A;  2JXB A;  3DDQ B;  3CC7 A;  1W70 A;  3QWX X;  3OB9 A;  3E1S A;  2DYB A;  3CC4 T;  1KXU A;  1K9M R;  1TG0 A;  4CRL B;  4J9D A;  2NUT B;  5CKF A;  2DXB A;  2KXD A;  3NTI A;  3TEE A;  3S3O A;  1K4U S;  2NWM A;  3QWL A;  4HA8 A;  5FRN A;  1D3B A;  2HZY A;  4PJO A;  4X34 A;  3G6E Q;  2WIH B;  1ABQ A;  1NPR A;  4CFU D;  2MWP A;  2EYX A;  2X51 A;  1QLB A;  2HAX A;  3EFO A;  2LW4 A;  2JT4 A;  2JNG A;  4RMO A;  2E12 A;  1QKW A;  4JX6 A;  4PLI A;  5I22 A;  5GAM g;  1ACM B;  4A4F A;  4XU3 A;  3JCM V;  5HBE B;  2OTL Q;  4EOI B;  4HT8 A;  1SHG A;  2FPF A;  6AT1 B;  3C0C A;  5GMK l;  5LL6 S;  1AWJ A;  2OTL T;  2EFI A;  2JTM A;  4BUG A;  4PJN A;  2QG9 B;  2EBP A;  2M9U A;  3IQL A;  1QVG A;  4J8O A;  3FB9 A;  1KHI A;  2CH4 W;  3G4S T;  5IDP B;  3OA6 A;  1E7O A;  2VKN A;  1VQN A;  5GAM e;  5GAN 8;  4F7U G;  4BCI B;  3K7A M;  1PC0 A;  3SB2 A;  4C8Q B;  4XU0 A;  3SDZ A;  1VQO Q;  2M0O A;  3TW6 A;  4FYW B;  3FIF A;  1TS9 A;  5GAM d;  3V8L A;  1VIN A;  2ABL A;  4D8D A;  4KBM B;  2LT4 A;  2HNI A;  2ZGW A;  3CD6 T;  1UEC A;  2KT1 A;  4F16 A;  1FVV B;  2KEA A;  3OBW A;  2QK0 A;  4RCB A;  1KHC A;  2W2H A;  2DIL A;  1K9M U;  2EJF A;  2C5N B;  3EGX B;  4IUV A;  1X27 A;  1ARK A;  4YC3 B;  3CCV T;  4E7S A;  1BB9 A;  3E9G A;  1V1C A;  2F1L A;  1FMW A;  5HVY B;  1JEG A;  3M55 A;  2BZ8 A;  5GAN h;  1UB4 A;  2AZV A;  2HKQ B;  3VKH A;  4DBH A;  2QA4 A;  2VAS A;  4C92 B;  2C5V B;  2YRC A;  4HLQ A;  5CQY A;  5IDN B;  1U1T A;  1FMV A;  1X2K A;  5J26 A;  2FPD A;  3HHT B;  2HKN A;  2M1H A;  1VYW B;  3CBP A;  2KNB B;  3H6Z A;  4XQ3 A;  2W99 A;  4FCY A;  2VGM A;  3THK A;  1Y96 A;  1ZHI A;  2A7Y A;  2F2V A;  2EQJ A;  4DOW A;  5GMK h;  3HRS A;  2SRC A;  2KRO A;  1OKW B;  4E7Z A;  2YRD A;  4LXC A;  2JMA A;  1XNI A;  5GAO n;  3JCM W;  1GY3 B;  4J9F A;  1H3H A;  1YP5 A;  1H3Z A;  1NEG A;  4E7L A;  2P0Q A;  1VQN T;  1QCO A;  2DBK A;  2HDA A;  1K8A U;  2QDJ A;  2K9G A;  4JPB W;  2QQS A;  2P0K A;  2J06 A;  5ACB A;  1VQ8 A;  3L2V A;  1RAF B;  3D7S B;  4E7I A;  2EYY A;  2WXV B;  4OVA A;  2D8J A;  5FWC A;  4NL2 A;  5GAN 4;  4LDW A;  3EH2 A;  4NL3 A;  4PJJ A;  2H3E B;  2CP3 A;  3BHU B;  4J9E A;  1TD6 A;  1UG1 A;  4NS5 A;  1TUC A;  1H1Q B;  3X25 B;  4FM4 B;  3OYG A;  4M7A C;  5GAN 7;  4MFE A;  2CGH A;  3UA7 A;  5KCO A;  1WXU A;  3AT1 B;  1PSF A;  5DQW A;  1EZZ B;  1BIA A;  5GMK e;  1M1G A;  4AKH A;  3S6W A;  1GUX B;  5KYU B;  1FKM A;  1RAH B;  4F6U B;  3G4S Q;  1WHL A;  1GCQ A;  4QVD A;  1XQH A;  3JCM e;  3OW2 P;  4C8Q D;  5D6Y A;  1MHN A;  2AKK A;  2XIC A;  4BI3 A;  3OYK A;  3CCL T;  2KMG A;  2KY9 A;  2I40 B;  4EOJ B;  2EQK A;  2DRM A;  1Y7X A;  5J3B A;  3R6N A;  3JCM X;  4XAX B;  2E3I A;  4FIB A;  1YJN T;  5HNB B;  3MHX A;  3TSZ A;  1VQK A;  5I21 A;  3A8O B;  4IUT A;  3SD4 A;  4AKI A;  3TQ7 P;  1X6B A;  1ZUU A;  4CXA B;  3EID B;  4BCO B;  2AK5 A;  1TWB A;  2O31 A;  2GGR A;  4JX5 A;  2RQR A;  3F5X B;  1D3U B;  3CBO A;  1BK2 A;  5LJ5 h;  2KR6 A;  1BU1 A;  3M54 A;  1GRI A;  1QVF P;  3EGU A;  1WPY A;  3INZ A;  1VOL A;  5FW9 A;  4LDY A;  2DD4 A;  4J7I A;  4G6L B;  2E10 A;  2PQW A;  3BLH B;  4J7F A;  1N9S A;  4ZTJ A;  2QYZ A;  1Q95 G;  1UTI A;  2JTF A;  3CCR T;  1C0M A;  3M0U A;  1OX8 A;  1ZQ1 A;  5IHN A;  4MDX A;  2X3W D;  3CCS Q;  1PKT A;  2YDL A;  1NJI R;  3JB9 F;  2CP2 A;  3LX7 A;  1KC8 U;  5KH6 A;  4BCJ B;  2WIP B;  1JKW A;  1YJW A;  2XMF A;  1P92 A;  4L59 A;  1FIN B;  1IZ6 A;  3JCM h;  1W1F A;  3TCJ A;  2K7A A;  1KQ1 A;  2AIR B;  1FWZ A;  1W98 B;  1OPK A;  2E6Z A;  2JJ9 A;  2YHT A;  3TSW A;  1YHQ A;  1WJR A;  2MCN A;  2KVQ G;  4OMF B;  3G4S A;  2QI2 A;  1Q86 U;  1PRM C;  4E2F B;  3BHT B;  1NE8 A;  1F1B B;  1WZO A;  4YOS A;  3QDR B;  2KE9 A;  3HRU A;  2QF7 A;  2P4T A;  1VQ5 Q;  1B07 A;  3UWN A;  1SEM A;  2F2W A;  1C6V X;  1PHT A;  3VRY A;  5HKC A;  2GF7 A;  4FL6 A;  1YJN A;  2IVX A;  1KJW A;  4ELL A;  1BI2 A;  1IRX A;  1BKB A;  4L6V 5;  4EMH A;  3PMT A;  2E5K A;  2CSQ A;  4M7A D;  3OYI A;  4ME7 A;  5EC7 A;  1GFC A;  1YJ9 Q;  1LOJ A;  2FZC B;  5GAO p;  1IO6 A;  2PZ1 A;  2ESW A;  2BKZ B;  4PJO F;  4IUU A;  2BZY A;  2XDD A;  2DYI A;  3L42 A;  1LJO A;  1UJ0 A;  3UPU A;  2DAQ A;  5HK0 A;  2W0Z A;  3TNH B;  1NZ9 A;  1NJI C;  5IHK A;  5I5Z B;  1B3Q A;  2QQB A;  4CFV B;  2EQU A;  3CCL Q;  1E7P A;  3OBY A;  3EG3 A;  2NUT A;  2EJ9 A;  1R77 A;  1LCK A;  3CQT A;  1VOM A;  1O9K B;  4M78 B;  1WHM A;  8AT1 B;  1K1Z A;  3TW7 A;  2JOY A;  5FWB A;  3CXC S;  5LJ3 e;  1M8V A;  1K73 R;  2PMI B;  1JJ2 P;  3ASK A;  1YHQ Q;  2GNC A;  3L2R A;  1OGU B;  4JLG A;  2FO0 A;  3EHQ A;  4LN2 A;  2AHJ B;  3DB4 A;  3A8L B;  5DQV A;  2D0N A;  1Q86 C;  1MND A;  2YT6 A;  4RTY A;  4PFP A;  5DY9 A;  4N4H A;  3BDU A;  1X6G A;  3VKG A;  5KYU A;  5IF1 B;  3LYI A;  3RIR A;  1BCM A;  2WSE E;  3NTH A;  1WFW A;  4LD6 A;  4J9B A;  4JRQ A;  2K6D A;  1WXB A;  5GAO q;  5C0M A;  3CC2 T;  1MGQ A;  2A0F B;  5LJ3 f;  2HCK A;  2XID A;  3H0F A;  4RG8 A;  1VQ7 A;  4BCM B;  3CMA Q;  2PUO B;  2D6F A;  3OYD A;  4M77 D;  4M7D D;  4N4G A;  1URC B;  1QVF A;  3M4G A;  3VS6 A;  3V7C A;  4C5G A;  2ZPE B;  2WHB B;  5GAN 5;  2MAM A;  1VQN Q;  2E1H A;  3ME9 A;  2F2C A;  1MV3 A;  3HKS A;  4M7A B;  3CC4 Q;  4LOC A;  3GNF B;  1QVG P;  4M7D A;  1H24 B;  2YUO A;  3NTK A;  3EG1 A;  1VQL T;  1RAC B;  4QVZ A;  3REA B;  3VUZ A;  2K4Y A;  4V2S A;  1M8M A;  3QUI A;  3QYE A;  5D7U A;  1QW1 A;  3QO3 A;  1GUX A;  1TXQ A;  4OB2 B;  1QCF A;  2DL4 A;  4E47 A;  1SG5 A;  2V26 A;  1AD6 A;  5DLO A;  3DTO A;  4C0F A;  1GXI E;  4M75 D;  3TU4 K;  1CSK A;  2HMA A;  1NG2 A;  3I35 A;  3M57 A;  2K5I A;  2DXC A;  3LGL A;  2HL3 A;  3M0P A;  2YUQ A;  4J9G A;  2EWN A;  1X69 A;  3C12 A;  3CPW P;  5IXF A;  4KGZ B;  3OW2 S;  3FLG A;  2LC4 A;  1ZA1 B;  4BI4 A;  2WAC A;  4M6V A;  2KRS A;  2ROL A;  4EIK A;  1Q82 C;  2O2O A;  5A0D A;  2O01 E;  4M77 G;  5L23 A;  1YIJ T;  2SEM A;  2DTH A;  1VQ9 A;  2PK9 B;  3MY1 B;  3CPF A;  1EFN A;  3V7S A;  2CSI A;  2CH4 A;  2FRW A;  1NLO C;  3A1P A;  1K8A R;  4EOS B;  1YHQ T;  1IGQ A;  1KQS P;  2F5T X;  3M9Q A;  3JCM P;  2KBT A;  3I9Q A;  2FZG B;  1U8R A;  3LLR A;  4ELJ A;  2L3Q A;  4F7U A;  4X9D A;  5CKH A;  1M1K U;  1AWW A;  2DO3 A;  1IXD A;  3DJB A;  4F7U B;  1Q7Y C;  5IHI A;  3VS1 A;  4BCK B;  2VUB A;  4RTW A;  4QQ6 A;  1W2B P;  3JB9 J;  4J9H A;  4EOL B;  2D8H A;  2J7I A;  4JJB A;  2CP0 A;  3RBB B;  3LWI A;  4JZ4 A;  7AT1 B;  4BCN B;  1PRL C;  2PNI A;  4M7D B;  4LE9 A;  2L2P A;  2CUB A;  3MP6 A;  4LNP A;  1P5E B;  4KGV B;  4IIO A;  3L2Z A;  2I2L A;  3X20 B;  3OYC A;  4Z02 A;  3PGG A;  2RI5 A;  3LH5 A;  1RAB B;  2OAW A;  1TFB A;  2DD4 B;  2O88 A;  2C5O B;  3M5A A;  4RTT A;  2V8K A;  1NEB A;  3BHV B;  1M30 A;  1I4K 1;  2L0A A;  2UZE B;  2BZX A;  3CC2 Q;  2JVV A;  3E19 A;  4C92 G;  5GAN d;  1VQL Q;  2E65 A;  3I55 A;  4KT0 E;  2IPO B;  1WQ7 A;  3OY9 A;  2DME A;  4HVU A;  1NBE B;  1M1K C;  3LQ5 B;  5KE2 A;  3KFV A;  1YIJ A;  4JRK A;  3OMC A;  2QGF B;  1YFN A;  4I3Z B;  2RJC A;  1VQ9 Q;  1ENW A;  1RAI B;  3JCM g;  1WHJ A;  2KT8 A;  4ROD A;  2ZPF B;  5FU7 C;  1H92 A;  2VVK A;  4N0A A;  2D9T A;  2VC8 A;  2COW A;  9ATC B;  3RMQ A;  2FZK B;  3CCL A;  4PK4 A;  3PIO A;  2A37 A;  2GQI A;  3HRT A;  1D3B B;  2CP6 A;  3LWH A;  3J7A F;  3X28 B;  4BDZ A;  4A4E A;  5CKB A;  2QA4 Q;  4QW2 A;  3X26 B;  1G3T A;  4JJN K;  4KRT A;  3S3N A;  4FYX B;  3TRE A;  3X24 B;  1NYG A;  2MWO A;  2NLU A;  1OQK A;  1K76 A;  1UGR B;  1A0N B;  5I11 A;  3UAT A;  2CUD A;  2KXC A;  4GLK A;  2D0Q B;  1GCP A;  5LJ5 g;  3OYB A;  2EKH A;  1N5Z A;  1M90 U;  5KYW A;  1VYT A;  3P8H A;  1M90 R;  4ROE A;  1VQM Q;  4VUB A;  3PVQ A;  4M78 E;  3CCV Q;  2FHD A;  5BNJ B;  4Y28 E;  2EQI A;  4F7J B;  4XTW A;  3PNW C;  4F14 A;  3GBQ A;  2YUN A;  2R57 A;  3CCJ Q;  3MIA B;  2JTE A;  1AHJ B;  2JW4 A;  3CCE Q;  3EJ1 B;  4ELY C;  1S72 T;  2DE0 X;  4JS4 A;  2CKK A;  2RQU A;  3OSV A;  1VQ4 A;  3P8D A;  2CZ6 B;  4R56 A;  3DOG B;  3QWY A;  3BG5 A;  2D1X A;  2OX7 A;  4O6J A;  5FLX E;  4FX3 B;  3VS4 A;  3BY7 A;  4BCQ B;  2I53 A;  3M56 A;  3CCU Q;  2ZAE A;  4M75 F;  2DKG A;  3EG9 A;  4EPC A;  3MP1 A;  4DEX A;  3PTA A;  3QYH B;  1W6X A;  1YWP A;  1WXT A;  2QTV A;  1OI9 B;  4FU6 A;  1KD1 C;  2MK5 A;  4PJL A;  3A8M B;  2GTJ A;  3JB9 H;  5FGK B;  2EYZ A;  4OMM A;  3MEU A;  4BAC A;  1C9B A;  1KSW A;  2JN0 A;  4KUI A;  1K73 U;  3QKJ A;  1WJQ A;  2IN3 A;  3MET A;  4EOQ B;  5CCA A;  4IKF A;  4PJO C;  1GL5 A;  3WXM B;  1TOV A;  1OKV B;  2KK4 A;  1U3O A;  4II5 B;  2UZD B;  1B7T A;  1QWF A;  1SHF A;  1BCO A;  1UNL D;  2PVG B;  4LDX A;  2QEX A;  3CCV A;  3QJ6 A;  1VQ9 T;  1JST B;  4HT9 A;  1M90 C;  1RI9 A;  1I81 A;  4OF1 A;  3LGF A;  3CPW S;  2QFZ A;  2IW8 B;  3GP8 A;  3VYG B;  3ER0 A;  1T0J A;  4Y91 A;  2X1N B;  2B86 A;  4JJD A;  1PKD B;  1VUB A;  4X9C A;  3HSB A;  1M9S A;  4ROC A;  3RR6 A;  4YOO A;  2GCX A;  5ICP B;  2X4X A;  5GAN f;  5IHY A;  4M78 D;  2R5A A;  2XG8 D;  2L3S A;  1M5Q 1;  3EHR A;  1EX4 A;  4XTZ A;  3URG A;  1WI7 A;  4EMK C;  1WX6 A;  3H0H A;  4PJO G;  3GF5 A;  5GAN g;  1OL1 B;  4F6W B;  1KK7 A;  3GNG A;  1H27 B;  2COY A;  2KSS A;  4E7J A;  1ZP2 A;  4AG1 C;  2RJF A;  1OU8 A;  3BFM A;  4A54 A;  3JRZ A;  5AT1 B;  3BDL A;  3WVD B;  4BBR M;  4Z8A A;  1BBZ A;  1BI3 A;  2KMT A;  3OYL A;  4A53 A;  1V29 B;  1VQ6 A;  4B9W A;  4CFW B;  4C92 A;  5KCH A;  2BIV A;  2LNH B;  5A2Q E;  3CCM Q;  2OTJ A;  3CCJ T;  1D0Z A;  3TVT A;  1QVG S;  2LX7 A;  4JJC A;  2CZ0 B;  2CYZ B;  2M0Y A;  2P84 A;  3G71 A;  3QHW B;  3O5Z A;  5L2W B;  4JRP A;  3Q1J A;  3H4C A;  3OQ5 A;  3V7R A;  1OPL A;  4IMY B;  4PJO D;  1YI2 T;  1PWT A;  5IT9 E;  3QSU A;  1VQ6 Q;  5KYX B;  2L3P A;  1Y57 A;  4J9I A;  1TU0 B;  1JJ2 A;  4RTX A;  1VQP T;  4ESR A;  1VQO A;  3I5R A;  2DRK A;  2H8H A;  2X4W A;  3VKI A;  1H8K A;  4YOZ A;  2DPP B;  2HEQ A;  3CC7 Q;  1G83 A;  4BXX X;  2EW3 A;  2IVW A;  1Z9Z A;  5LJ3 j;  4PJO E;  2EGA A;  2O9V A;  2K3B A;  1QP3 A;  4CFN B;  1O9K A;  1QVP A;  4M4Z A;  4J6Y A;  4K11 A;  4ORZ A;  4CFU B;  1XJW B;  4C92 D;  5CVI A;  1X43 A;  3PFS A;  3JCM Q;  5GAN j;  3CMA A;  1QQJ A;  1OL2 B;  1YN8 A;  1VA7 A;  4BE2 A;  2RK1 A;  1M27 C;  4J5Y A;  4TVR A;  3OW2 A;  1OU9 A;  3DDP B;  4HNV A;  2DZC A;  2HSP A;  3E2U A;  3G6E T;  3V8K A;  3CCQ A;  4FYV B;  1Q86 R;  1VQ8 T;  2UZB B;  2AT1 B;  3EGD B;  1VQL A;  2NYS A;  2CS7 A;  1YJ9 A;  3OSS C;  2G3R A;  2WPA B;  4ZGD B;  4EON B;  2JS0 A;  5GAM f;  2ZPH B;  4R0K A;  3OYJ A;  1H4L D;  3NGP A;  1AVZ C;  4KRD B;  3JCM b;  1H64 1;  2L5Q A;  1Q81 C;  1H1P B;  4F70 B;  3RMS A;  5GAN 2;  1G3S A;  1AOJ A;  2CP7 A;  5GMK m;  2PVO B;  4C8Q C;  1B34 B;  5LJ3 d;  1UGS B;  2DM1 A;  4Z88 A;  3RUX A;  1VQ4 T;  3G1J A;  1X01 A;  5CKE A;  4F7U E;  1ZBX A;  5FU6 C;  3OS2 A;  1HJD A;  2BS2 A;  1X6O A;  4BCG B;  3S3M A;  4C8Q E;  1U5S A;  3MKD A;  3I56 Q;  1F5Q B;  3SEM A;  3KHI A;  1NLP C;  3EOC B;  4A4K A;  1V76 A;  4ELZ C;  3OMG A;  3I55 Q;  1JSU B;  4OR5 B;  3EG0 A;  2RNA A;  4M7A F;  5I2S A;  3JV3 A;  1JBM A;  3FRN A;  4OB3 B;  2YUP A;  1GFD A;  3OYF A;  3SWN A;  2MYS A;  1FXX A;  5FRO A;  4PJO B;  2CT4 A;  2R58 A;  1H1R B;  4C0Z A;  4NOY A;  2CDT A;  2DZ9 A;  2EGE A;  4OMQ A;  2K5L A;  2C0O A;  1S72 Q;  5CQX A;  2E41 A;  2BE9 B;  4CC4 B;  1HXD A;  1TSF A;  1XOV A;  4OML A;  2BPM B;  3M0S A;  1ZSZ C;  4M77 C;  3KXT A;  1YI2 Q;  3ZL7 C;  1E9H B;  3PVL A;  2Z0W A;  2JS2 A;  3CCR Q;  3HB9 A;  3QYG B;  1IGU A;  3ZEH A;  4BB7 A;  3POM A;  1UNG D;  2QGS A;  2V1R A;  4KUD K;  1UNH D;  3BE3 A;  2KRN A;  2RJE A;  1NPP A;  4AFQ C;  1UUE A;  1KD1 U;  5EJC A;  2DD5 A;  4CFM B;  3VS7 A;  1S72 A;  2DBM A;  1Q7Y U;  3M0T A;  2DEQ A;  4C0D B;  4M77 A;  1PD0 A;  5D6W A;  2QDY B;  4NST B;  3QII A;  4M7D C;  1Y96 B;  2JGZ B;  1Q82 R;  2C4G B;  4EMK B;  2DTI A;  2OTJ T;  4RCC A;  1SRM A;  1IRE B;  4DQ2 A;  3V8J A;  2EUF A;  2F2X A;  3H0I A;  2JMC A;  2IW6 B;  2PK2 A;  3EFR A;  3DKM A;  2QEX T;  1VQM A;  1YIT Q;  3REB B;  1OUL A;  4XK8 E;  1YCS B;  2RF0 A;  3G33 B;  2DEU A;  4OB0 B;  1PNJ A;  2VYT A;  3RER A;  2DET A;  5GAO r;  2BTT A;  2LJ1 A;  2QA4 T;  4WCI A;  1EIF A;  2DD5 B;  2QQR A;  1ZUY A;  2RA2 A;  5CKD A;  2RJD A;  4JS5 A;  4DBQ A;  1VIE A;  4JRI A;  2LP5 A;  3J80 E;  1AZE A;  1MMD A;  2EYW A;  2DMO A;  4RTU A;  1GBR A;  3M4Y A;  1VQO T;  2DVE A;  4O5V A;  4M77 F;  2P0P A;  4DBF A;  4C8Q A;  1K9A A;  3OYH A;  5LQF B;  1HK9 A;  2K2M A;  4B9X A;  4F7N B;  3CCM T;  4BCF B;  3HZJ A;  3VJP A;  3NPF A;  1I8F A;  4Y92 A;  2ZPB B;  2RHY A;  1ZBJ A;  1RAA B;  2ZPG B;  5LJ5 j;  3LH0 A;  2GBQ A;  4HNT A;  3A98 A;  3EH1 A;  4BCQ D;  4D6W A;  4M75 A;  2IW9 B;  3C94 A;  1UFF A;  1N9R A;  4IUP A;  1I07 A;  2VWF A;  2PJQ A;  4A4H A;  3EFS A;  8ATC B;  4J83 A;  2FYK A;  1M1K R;  1FYN A;  4JZ3 A;  3PIP A;  1OEB A;  4HKE A;  1JOW A;  4BE1 A;  2MF2 A;  2DXT A;  4C8Q F;  1O75 A;  1KIK A;  4QKU A;  1IHW A;  1K0S A;  2FG0 A;  4QSH A;  2I0N A;  3CCJ A;  4OGR B;  2FEI A;  4B6M A;  1D1A A;  4LDV A;  1K73 C;  1R0C B;  1BYM A;  1M2O A;  4C0D C;  2QXF A;  2EQM A;  3EAE A;  4EOP B;  5IAY A;  3BLR B;  3O0G D;  1AIS B;  2BS4 A;  2A28 A;  2LJ0 A;  4F7U F;  1G5V A;  2RQV A;  4C5E A;  1WYX A;  2LMJ A;  1RAD B;  4XTV A;  2V8I A;  1QLY A;  2RPN A;  4HXJ A;  3QPH A;  2EVR A;  4M77 B;  1ZSZ B;  5LJ3 h;  3A8H B;  1KG1 A;  2YXY A;  2YLB A;  4FT4 A;  5C6S A;  2O9S A;  3CCM A;  2OTJ Q;  2DXU A;  5KYY B;  3KUF A;  1N8R U;  4QQD A;  1S1N A;  3H9N A;  1HD3 A;  4MDW A;  3JSC A;  3H41 A;  5J39 A;  2MOX A;  5D6X A;  3CCE A;  4NC6 A;  1YIT T;  2Y4Y A;  1YJ9 T;  1BU2 A;  2EKO A;  2A36 A;  3E9F A;  1KC8 R;  1B34 A;  2CP5 A;  2QDL A;  3P8B B;  1UEB A;  2KQW A;  4OMP A;  1I0C A;  3A8G B;  5A0L A;  4CRI A;  5CAI A;  4EDU A;  1VYV A;  1VQ5 A;  2FRY A;  3JCM c;  3UT1 A;  4QVC A;  3MP8 A;  3HPW A;  4CC2 A;  2M02 A;  4EOK B;  3RGF B;  3FC3 A;  3OS5 A;  5I2M A;  4FYY B;  1G3N C;  3SWN C;  2MI6 A;  2XD0 A;  1OV3 A;  5FU6 B;  1GH6 B;  5LJ3 g;  4AFZ C;  1JJ2 S;  1YBY A;  2YSQ A;  4C5I A;  2DFU A;  4MFD A;  1DJ7 B;  4HVW A;  2LTO A;  3EGX A;  4OMN A;  2XI9 A;  3HTR A;  3NHN A;  2K3X A;  2KDS A;  2YLC A;  3F70 A;  3QG1 A;  1VQK Q;  5DM7 R;  4ZN1 A;  4F7L B;  3BLQ B;  1LVK A;  1VQK T;  3HL8 A;  2ENM A;  1I5L A;  2GQV A;  1VQ6 T;  3GLX A;  2HBW A;  1D0Y A;  4M7D E;  4PNO A;  2ED1 A;  2CRE A;  3QZ5 B;  2RQW A;  4J9C A;  1GCQ C;  3M58 A;  1WLP B;  4IUR A;  5GMK j;  3RKX A;  1CKB A;  4BCM D;  2HQX A;  2BS3 A;  4FT2 A;  2YWW A;  4M7A A;  3NMZ C;  3M03 A;  5HCK A;  2EPD A;  2H3J A;  2WMA B;  3M53 A;  3ZBD A;  4EOO B;  2PU9 B;  3EGD A;  3ULR B;  3OYA A;  1N8R C;  4F6S B;  2W10 A;  5GAN e;  3DLM A;  1N4M A;  4BY6 B;  2BKD N;  2O4X B;  2WSF E;  4E7K A;  2ATC B;  3HFO A;  5GAN 6;  2CCH B;  1X2Q A;  2KI7 A;  5CO7 A;  3UDC A;  2L89 A;  1TUG B;  2DNU A;  3RKY A;  3OS1 A;  1C1A A;  2LRQ A;  1PKS A;  3VS5 A;  4XTX A;  2E5Q A;  1UJY A;  1H26 B;  2BE7 D;  4QQG A;  2VXE A;  1SSH A;  2DXB B;  1N6A A;  3CCU A;  3HO8 A;  5CIU A;  1CKA A;  5M9O A;  5FU7 B;  1Q81 U;  3VU3 C;  4BBS M;  2CT3 A;  1PD1 A;  4F17 A;  4DEY A;  2EAY A;  5GAM j;  1WA7 A;  1KQS A;  1G3Y A;  2RI2 A;  1G2B A;  2L8D A;  2M16 A;  1M2V A;  1U06 A;  5EG2 A;  5HQ0 B;  3RNJ A;  1YCY A;  1X75 C;  3QHS A;  3QDF A;  3EG2 A;  4TTH A;  2LQW A;  1G8X A;  4XU2 A;  4HCZ A;  3QBY A;  2XDB A;  2DA9 A;  4M78 A;  2W96 A;  4BD3 A; 
#chains in the Genus database with same CATH homology
 4RG8 A;  3GIB A;  4OGE A;  1VQ7 A;  2KAF A;  5IN1 A;  2PUO B;  2D6F A;  3OYD A;  4M77 D;  2QQA A;  2ZZD B;  1VQL A;  1W2B A;  2CS7 A;  5AYF A;  3OSS C;  1YJ9 A;  4JDS A;  4M7D D;  5L8R E;  4N4G A;  2G3R A;  1Q82 U;  4ZGD B;  2QTX A;  1QVF A;  4HNU A;  2DIQ A;  3M4G A;  3V7C A;  2DK3 A;  4PKC C;  4C5G A;  2ZPE B;  2LX9 A;  4EMK A;  2ZPH B;  1UGP B;  3CEY A;  5GAM f;  3OYJ A;  3I56 T;  3CCE T;  5GAN 5;  2MAM A;  2VXF A;  2E1H A;  3ME9 A;  3JCM b;  2Y4X A;  1VIF A;  3HKS A;  4M7A B;  4ZN3 A;  1H64 1;  3KBG A;  5GAO l;  4LOC A;  2L5Q A;  3HFN A;  3GNF B;  4GY5 A;  2LDM A;  3G71 T;  1Q81 C;  1VQ7 T;  4P5N A;  3RMS A;  4M7D A;  4ZGE B;  3NTK A;  5GAN 2;  1G3S A;  1VQL T;  3M59 A;  3CXC A;  5GMK m;  2PVO B;  4QVZ A;  4C8Q C;  1B34 B;  5LJ3 d;  2K4Y A;  3VUZ A;  3CCU T;  3OS0 A;  4V2S A;  1UGS B;  3QXE B;  4Z6Y A;  5LJ5 d;  3QUI A;  3QYE A;  4ZTF A;  2G77 A;  3RUX A;  1VQ4 T;  1QW1 A;  3QO3 A;  1X01 A;  3JAM E;  5CKE A;  4F7U E;  1VQ8 T;  2RI3 A;  4MML A;  4OB2 B;  2LNV A;  2K57 A;  4MMK A;  1ZBX A;  2C06 A;  3AHU A;  4E47 A;  2FL7 A;  4KUL A;  5FU6 C;  1PSE A;  3OS2 A;  3CBM A;  3BG3 A;  4M7A G;  4HL4 A;  2BS2 A;  1X6O A;  3T9N A;  4AKG A;  5DLO A;  3S3M A;  4C0F A;  1GXI E;  4C8Q E;  4M75 D;  3L2Q A;  3TU4 K;  2LVM A;  4BDY A;  3M57 A;  3KHI A;  3CC7 A;  4PLL A;  4A4K A;  2K5I A;  4ELZ C;  3OB9 A;  3E1S A;  2DXC A;  3CC4 T;  3LGL A;  4M78 F;  2HQE A;  5CKF A;  2DXB A;  2F5K A;  3OMG A;  3NTI A;  3TEE A;  3S3O A;  3VV0 A;  3QWL A;  2EWN A;  4HA8 A;  3C12 A;  3CME T;  2RHI A;  1D3B A;  5FRN A;  2RH2 A;  4M7A F;  4X34 A;  4PJO A;  4DOV A;  5I2S A;  3CME A;  3OW2 S;  1NPR A;  3FLG A;  1JBM A;  2LC4 A;  1Y07 A;  5GAN 3;  3FRN A;  4BI4 A;  2MWP A;  2WJ9 A;  2WAC A;  4M6V A;  4OB3 B;  3CC7 T;  3OYF A;  1Q82 C;  5A0D A;  2OTL A;  2O01 E;  4M77 G;  3SWN A;  1YIJ T;  1QLB A;  2ZPI B;  2HAX A;  2DTH A;  2VV5 A;  1VQ9 A;  3CPF A;  2JNG A;  1FXX A;  2E12 A;  2K2V A;  2RHU A;  3V7S A;  5FRO A;  4RMO A;  4ATO A;  5KE3 A;  2R58 A;  4PJO B;  4JX6 A;  4PLI A;  2IG0 A;  4C0Z A;  4NOY A;  5GAM g;  4A4F A;  4MZP A;  5FRM A;  4XU3 A;  3JCM V;  2DZ9 A;  1YHQ T;  2K5L A;  4HT8 A;  3C4S A;  5GMK l;  2F5T X;  3M9Q A;  5LL6 S;  4MZM A;  5CQX A;  3JCM P;  2OTL T;  2E41 A;  4FSX A;  1OZ3 A;  1U8R A;  1HXD A;  1XOV A;  2EFI A;  3LLR A;  4ELJ A;  2JTM A;  3BG9 A;  4BUG A;  4F7U A;  5GAO m;  4M77 C;  3KXT A;  4X9D A;  5CKH A;  1M1K U;  2M9U A;  2DO3 A;  5LJ5 f;  4F7U B;  1QVG A;  1Q7Y C;  3MEA A;  4J8O A;  3FB9 A;  1KHI A;  3HB9 A;  3QYG B;  2VUB A;  4QQ6 A;  3G4S T;  3ZEH A;  3JCM f;  3OA6 A;  4JUV A;  4BB7 A;  2F69 A;  3JB9 J;  4KUD K;  3DB3 A;  4C92 E;  1VQN A;  5GAM e;  2X35 A;  5GAN 8;  4F7U G;  5LJ5 e;  2RJE A;  1NPP A;  3SB2 A;  1KD1 U;  4C8Q B;  3LWI A;  2OAU A;  4XU0 A;  3H8Z A;  5EJC A;  2EJG A;  2DD5 A;  3SDZ A;  2M0O A;  3TW6 A;  1S72 A;  5A0G A;  4M7D B;  1Q7Y U;  3FIF A;  2XU8 A;  5GAM d;  3MP6 A;  3V8L A;  2DEQ A;  4C0D B;  4M77 A;  4KBM B;  2LT4 A;  2HNI A;  2ZGW A;  3CD6 T;  5D6W A;  2QDY B;  3QZ9 B;  3L2Z A;  3QII A;  1Y96 B;  3JB9 I;  2I2L A;  4LDU A;  4M7D C;  3X20 B;  4EMK B;  3OYN A;  2DTI A;  2RHZ A;  3A5Z B;  3PGG A;  2RI5 A;  4Z02 A;  3OYC A;  3OBW A;  4RCB A;  2OTJ T;  4RCC A;  4OB1 B;  1KHC A;  1IRE B;  4DQ2 A;  1K9M U;  2EJF A;  3V8J A;  4UC4 A;  2DD4 B;  1FX7 A;  3CCQ T;  1VQ4 A;  3M5A A;  2PVD B;  2HD0 A;  2O4X A;  4IUV A;  1WNL A;  3CCR A;  1RL2 A;  4M78 G;  3EFR A;  3L2W A;  1W4S A;  3DKM A;  4IUQ A;  4M7A E;  2QEX T;  3CCV T;  1VQM A;  2V8K A;  3E9G A;  3CD6 A;  1I4K 1;  1M4Z A;  4XK8 E;  3SWN B;  2JVV A;  3E19 A;  4C92 G;  5GAN d;  2E65 A;  3I55 A;  4KT0 E;  4XU1 A;  3M55 A;  1WQ7 A;  4MZT A;  3OY9 A;  5GAN h;  1UB4 A;  4XTY A;  3I55 T;  4OB0 B;  1TH7 A;  3VKH A;  3N5B B;  2QA4 A;  1M1K C;  2VYT A;  3NFC A;  3RER A;  5GAO r;  5KE2 A;  4C92 B;  2QA4 T;  1YIJ A;  4JRK A;  3OMC A;  2DXC B;  4HLQ A;  1EIF A;  2LQ8 A;  2DD5 B;  2QQ9 A;  5CQY A;  2RJC A;  1U1T A;  2QQR A;  2RA2 A;  3HP9 A;  5J26 A;  4EMG A;  5CKD A;  2RJD A;  3H6Z A;  3HHT B;  2M1H A;  1SSF A;  3CBP A;  4XQ3 A;  4JS5 A;  2GFU A;  2R5M A;  1VIE A;  3JCM g;  2VGM A;  4JRI A;  3J80 E;  2ZPF B;  1Y96 A;  1ZHI A;  2A7Y A;  2EQJ A;  5FU7 C;  4DOW A;  5GMK h;  1VQP A;  3HRS A;  4N0A A;  2WSC E;  2D9T A;  2VC8 A;  2Y90 A;  3FJP A;  3M4Y A;  3O8V A;  3R6O A;  3RMQ A;  1XNI A;  2DVE A;  2ZZD A;  1VQO T;  3CCL A;  1QVF S;  4O5V A;  4M77 F;  4WF2 A;  2P0P A;  5GAO n;  3PIO A;  3JCM W;  3HBL A;  5GAM h;  4C8Q A;  3OYH A;  1YI2 A;  3HRT A;  1D3B B;  3LWH A;  4E7L A;  1H3Z A;  1HK9 A;  3J7A F;  1WGS A;  2P0Q A;  3X28 B;  4B9X A;  3CCM T;  4BDZ A;  3HZJ A;  3VJP A;  4A4E A;  5CKB A;  4QW2 A;  1VQN T;  3X26 B;  1I8F A;  1G3T A;  1OZ2 A;  2YRV A;  1K8A U;  2ZPB B;  2RHY A;  4M75 G;  4J6X A;  2QDJ A;  2ZPG B;  2A3L A;  5LJ5 j;  4JJN K;  3LH0 A;  4C5E A;  4HNT A;  3S3N A;  2QQS A;  2P0K A;  3TRE A;  3VUB A;  3X24 B;  2XKO C;  4D6W A;  4M75 A;  4N4I A;  2MWO A;  3C94 A;  4IUP A;  1N9R A;  2NLU A;  2DIG A;  1UGR B;  3CCS T;  1VQ8 A;  3L2V A;  4E7I A;  3CCS A;  4OVA A;  4A4H A;  4GLK A;  3EFS A;  4NL2 A;  5GAN 4;  1BI0 A;  2K3Y A;  4LDW A;  3CC4 A;  4J83 A;  2B8A A;  2FYK A;  4NL3 A;  2D0Q B;  3QYB A;  4N0A C;  3SFM A;  3PIP A;  4NS5 A;  5LJ5 g;  5GMK i;  3OYB A;  2L3R A;  4HKE A;  4BE1 A;  3X25 B;  2MF2 A;  1M90 U;  3J81 E;  4FM4 B;  3OYG A;  4M7A C;  2DXT A;  2LCC A;  1OYX A;  4PL6 A;  1O75 A;  2E6N A;  3P8H A;  4C8Q F;  5GAN 7;  4MFE A;  3CMA T;  2CGH A;  5KCO A;  3MO8 A;  3PMI A;  1PSF A;  4QSH A;  3QJY A;  1XTD A;  1BIA A;  3RKW A;  5GMK e;  1M1G A;  4AKH A;  2LQK A;  3S6W A;  4VUB A;  3CCJ A;  1FKM A;  4M78 E;  2FHD A;  3L1A A;  2RM4 A;  4Y28 E;  4MIM A;  4QVD A;  1XQH A;  3JCM e;  1JB0 E;  4LDV A;  4AI6 A;  1K73 C;  4XTW A;  1BYM A;  3PNW C;  4C0D C;  1BI1 A;  1MHN A;  1WJS A;  2QXF A;  2EQM A;  2XIC A;  5D6Y A;  4BI3 A;  3OYK A;  3EAE A;  2R57 A;  5IAY A;  2RB6 A;  2CZ1 B;  2KMG A;  4II1 A;  1QP2 A;  3CCL T;  1AHJ B;  4DA4 A;  2KY9 A;  4OGC A;  2BS4 A;  2X4Y A;  4ELY C;  1S72 T;  4F7U F;  1U1S A;  2QQ8 A;  1G5V A;  4JS4 A;  2EQK A;  2RHX A;  1Y7X A;  2CKK A;  3G7Z A;  3OSV A;  5J3B A;  3P8D A;  2CZ6 B;  2VGN A;  4XAX B;  4FIB A;  3JCM X;  4R56 A;  3GOX A;  1YJN T;  3BG5 A;  2V8I A;  3MHX A;  4XTV A;  4LD9 K;  5FLX E;  4O6J A;  1VQK A;  3MCA B;  5I21 A;  3A8O B;  4IUT A;  3SD4 A;  4AKI A;  4C0G A;  3ZFJ A;  3OYM A;  3MEV A;  3BY7 A;  3M56 A;  4M75 F;  4EPC A;  2DKG A;  3QPH A;  4M75 E;  4JX5 A;  3MP1 A;  4M77 B;  3PTA A;  3QYH B;  3CBO A;  3A8H B;  5LJ3 h;  5LJ5 h;  2KR6 A;  1KG1 A;  2CZ7 B;  4FU6 A;  1KD1 C;  3M54 A;  2YLB A;  3A8M B;  3JB9 H;  4FT4 A;  5C6S A;  3CCM A;  3MEU A;  4BAC A;  4M7D G;  2K5F A;  1WPY A;  2JN0 A;  3JB9 D;  3INZ A;  3WVE B;  4KUI A;  1K73 U;  2DXU A;  4LDY A;  2DD4 A;  3KUF A;  1WJQ A;  3QKJ A;  4J7I A;  1N8R U;  4QQD A;  2E10 A;  2PQW A;  3MET A;  4MDW A;  3JSC A;  5CCA A;  4IKF A;  1OI1 A;  4J7F A;  5J39 A;  1N9S A;  4PJO C;  3WXM B;  5D6X A;  4ZTJ A;  2KK4 A;  3CCE A;  4NC6 A;  1YIT T;  2Y4Y A;  1YJW T;  2JTF A;  1YJ9 T;  2V8J A;  3CCR T;  2PVG B;  2EKO A;  4LDX A;  3E9F A;  2QEX A;  1ZQ1 A;  3CCV A;  1VQM T;  4MDX A;  3QJ6 A;  1B34 A;  1VQ9 T;  3P8B B;  3I56 A;  1UEB A;  4HT9 A;  2KQW A;  2EIF A;  4BY6 C;  1M90 C;  3JB9 F;  3A8G B;  3LX7 A;  1M1F A;  1I81 A;  2X4J A;  5A0L A;  1KC8 U;  4OF1 A;  3LGF A;  3CC2 A;  4CRI A;  5CAI A;  4EDU A;  5KH6 A;  3CPW S;  1VQ5 A;  3JCM c;  2QFZ A;  3GP8 A;  3VYG B;  3UT1 A;  3ER0 A;  4A4G A;  3CPW A;  1YJW A;  4QVC A;  3MP8 A;  4Y91 A;  1P92 A;  2DTO A;  3HPW A;  4L59 A;  3FC3 A;  1IZ6 A;  1G3W A;  3C95 A;  3OS5 A;  5I2M A;  3SWN C;  3JCM h;  2XHC A;  3TCJ A;  1KQ1 A;  1VUB A;  2MI6 A;  4X9C A;  1M9S A;  2XD0 A;  3HSB A;  1FWZ A;  5DLQ E;  5FU6 B;  2YHT A;  2E6Z A;  2GCX A;  5LJ3 g;  1R8O B;  4ZGJ B;  1YHQ A;  1WJR A;  2X4X A;  5GAN f;  1JJ2 S;  2KVQ G;  1YBY A;  3FDR A;  2QI2 A;  4M78 D;  2R5A A;  4OMF B;  4C5I A;  3G4S A;  3DL1 A;  2XG8 D;  4MFD A;  1DJ7 B;  2LTO A;  4R55 A;  1M5Q 1;  1BIB A;  4CI0 C;  2XI9 A;  4XTZ A;  3URG A;  3GPL A;  4J6W A;  1NE8 A;  2PUK B;  2K3X A;  3QDR B;  2KDS A;  3HRU A;  4EMK C;  2QF7 A;  2P4T A;  2YLC A;  3F70 A;  4C92 F;  3UWN A;  1NJI U;  1O9S A;  3QG1 A;  4PJO G;  2HBP A;  2XK0 A;  5HKC A;  3GF5 A;  2GF7 A;  5GAN g;  4FL6 A;  5DM7 R;  1YJN A;  4ZN1 A;  3GNG A;  2RD1 A;  1VQK T;  3HL8 A;  2KSS A;  1I5L A;  2GQV A;  3PT9 A;  1BI2 A;  4E7J A;  3GLX A;  1VQ6 T;  1BKB A;  4L6V 5;  4EMH A;  3PMT A;  2RJF A;  4M7D E;  4PNO A;  3QZ5 B;  3BFM A;  1KQS S;  2MMP A;  4M7A D;  3M58 A;  4IUR A;  4A54 A;  3JRZ A;  5GMK j;  3RKX A;  5CR2 A;  4HCC A;  3OYI A;  1KC8 C;  3BDL A;  3WVD B;  4BBR M;  2HQX A;  4ME7 A;  2BS3 A;  1BI3 A;  2EYQ A;  2KMT A;  1LOJ A;  4HCB A;  3OYL A;  4A53 A;  5GAO p;  2LCL A;  4FT2 A;  3RES A;  1V29 B;  1LNX A;  1VQ6 A;  4B9W A;  4C92 A;  5KCH A;  2JZ2 A;  2BIV A;  4PJO F;  4M7A A;  3OYY A;  5A2Q E;  4IUU A;  2OTJ A;  2XDD A;  3CCJ T;  3L42 A;  1LJO A;  3UPU A;  1QVG S;  2H3J A;  1VQ5 T;  2DAQ A;  5HK0 A;  3M53 A;  2CZ0 B;  2E70 A;  2PU9 B;  2CYZ B;  3ZBD A;  3OYA A;  1N8R C;  1NZ9 A;  1NJI C;  4BE0 A;  2FVU A;  2ZCF B;  3BW1 A;  4M75 B;  5HK3 A;  2FB7 A;  1W2B S;  1K8A C;  3G71 A;  3MEW A;  5GAN e;  2RK2 A;  2GFA A;  2QQB A;  2EQU A;  4JRP A;  3DLM A;  1E7P A;  4BY6 B;  3OBY A;  3Q1J A;  4RG2 A;  2BKD N;  4YTL A;  1UGQ B;  1JRI A;  2BUD A;  3H4C A;  2EJ9 A;  2O4X B;  2WSF E;  4E7K A;  1Y71 A;  3OQ5 A;  4M78 B;  3V7R A;  3HFO A;  5GAN 6;  4PJO D;  1YI2 T;  5CO7 A;  5IT9 E;  3QSU A;  2JUF A;  3UDC A;  4Q5W A;  2L89 A;  4C8Q G;  3TW7 A;  2JOY A;  3RKY A;  3OS1 A;  4BI8 B;  1JJ2 A;  2LRQ A;  3L2U A;  3CXC S;  5LJ3 e;  1M8V A;  3DLL A;  1VQO A;  5HY6 A;  1VQP T;  4XTX A;  2X4W A;  2E5Q A;  2E64 A;  3VKI A;  2DPP B;  3ASK A;  3VYG A;  4JX4 A;  1N27 A;  4QQG A;  3L2R A;  3FEO A;  2VXE A;  2DXB B;  3VYH B;  4JLG A;  1N6A A;  4XTU A;  4M7D F;  1WQW A;  2IVW A;  3HO8 A;  4OP0 A;  3CCU A;  5LJ3 j;  2LT1 A;  5CIU A;  4PJO E;  5M9O A;  2AHJ B;  3DB4 A;  5FU7 B;  3A8L B;  2RO0 A;  1QP3 A;  3JB9 G;  4L5G A;  1Q81 U;  1QVP A;  3VU3 C;  3OYE A;  4BBS M;  4J6Y A;  4M78 C;  1Q86 C;  4M77 E;  4C92 D;  2EAY A;  5CVI A;  5GAM j;  1KQS A;  1Q86 U;  1G3Y A;  4JLI A;  1K9M C;  2RI2 A;  3PFS A;  5DY9 A;  2L8D A;  2M16 A;  3LW5 E;  4N4H A;  3BDU A;  3JCM Q;  3JCM J;  4E7H A;  4C92 C;  5GAN j;  1YIT A;  3CMA A;  4M75 C;  3VKG A;  5EG2 A;  5CK9 A;  1YCY A;  1RI0 A;  1X75 C;  3QHS A;  3LYI A;  4BE2 A;  3JCM d;  3RIR A;  2WSE E;  3NTH A;  4LD6 A;  2RK1 A;  4J5Y A;  4TVR A;  4JRQ A;  2XDP A;  3OW2 A;  4RKU E;  4HNV A;  5GAO q;  4C5H A;  5C0M A;  2DZC A;  4XU2 A;  4HCZ A;  3QBY A;  3CC2 T;  1MGQ A;  2XDB A;  2DJZ A;  4M78 A;  3G6E T;  3V8K A;  5LJ3 f;  3CCQ A;  2XID A;  3G6E A;  4BD3 A;  4C8Q D;  1KQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...