5LMKB

Structure of phopsho-cdk2-cyclin a in complex with an atp-competitive inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 2
publication title Explicit treatment of active-site waters enhances quantum mechanical/implicit solvent scoring: Inhibition of CDK2 by new pyrazolo[1,5-a]pyrimidines.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5lmkB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5lmkB02
1OL2B 3MY1B 4EOJB 2BPMB 2PMIB 4CFWB 2C5NB 3DDQB 3TN8B 1PKDB 1E9HB 2WEVB 3POMA 1GUXA 1JOWA 3BHTB 4BCNB 4BCMB 4ROEA 4BCFB 2R7GA 4BCHB 4F6WB 2PK9B 4CFUB 1AISB 1BU2A 3BLRB 4NSTB 4Y72B 2WHBB 3DDPB 1ZP2A 2IW6B 5HQ0B 3MY5B 3QHRB 3G33B 5CEIB 1D3UB 1G3NC 1H26B 2WFYB 4I3ZB 2W9FA 1QMZB 2WMBB 4FX3B 5ACBA 1GUXB 4F6SB 1H27B 1H1PB 2W9ZA 2I40B 1OIYB 4UN0A 1H1RB 2IW9B 3MIAB 4II5B 4BCOB 2BKZB 2UUEB 1VYWB 1XO2A 2UZEB 1KXUA 4KRDB 3QHWB 2JGZB 2CCIB 1UNHD 2W96A 4BCIB 4CXAB 5IF1B 1VINA 4EOLB 4EOPB 1JSUB 3EIDB 5HBJB 3TNHB 1H4LD 4F7NB 4EOOB 1GH6B 1H28B 2X1NB 3BLQB 5HVYB 4EOIB 4F70B 4CFVB 3EJ1B 5HBEB 4ROCA 2QDJA 4OR5B 4BCGB 2WPAB 4BCPB 3BLHB 4EONB 1UNGD 3DOGB 2UZLB 3O0GD 4TTHA 4YOOA 3H4CA 4EORB 2C5VB 3TNIB 2IW8B 1H24B 4BCQD 4ELLA 5FGKB 1N4MA 3F5XB 1H1QB 5LQFB 4KRCB 1FINB 1GY3B 4CFMB 4ELJA 1F5QB 5CYIB 5IDNB 1W98B 1JKWA 1O9KA 4EOKB 1OKWB 2WIHB 4F7JB 2I53A 3RGFB 1OKVB 1URCB 2G9XB 3LQ5B 4IMYB 4BCQB 1OI9B 2C4GB 1FVVB 1OIUB 5L2WB 5IDPB 3BHUB 1C9BA 2IVXA 3EOCB 5I5ZB 2EUFA 5BNJB 3K7AM 2CCHB 2CJMB 5HNBB 2C5OB 4EOSB 4YC3B 4G6LB 2WIPB 3MI9B 1UNLD 4F7SB 2V22B 2B9RA 1O9KB 2WMAB 1TFBA 1OL1B 4CRLB 2PK2A 3TNWB 4EOQB 4YOSA 2PHGA 2UZDB 5LMKB 4F7LB 2W99A 4F6UB 1VOLA 4OGRB 4EC8B 3M03A 1JSTB 4EC9B 2WXVB 1P5EB 2UZBB 4RODA 2F2CA 1H25B 5EFQB 4EOMB 5ICPB 4BCJB 2C6TB 1AD6A 1OGUB 3BHVB 4BCKB 4BCMD 4BCND 4YOZA 2C5XB 4CFXB 4CFUD 5HBHB 2W2HA 4CFNB 1H1SB
chains in the Genus database with same CATH superfamily
1OL2B 3MY1B 2PMIB 2G77A 4ZGEB 5DQVA 2WEVB 3POMA 1JOWA 4BCMB 4OB3B 1UGRB 4ROEA 4QSHA 2PK9B 4CFUB 1BU2A 3BLRB 4BBRM 3DDPB 1ZP2A 1FKMA 5HQ0B 3QHRB 3X28B 3G33B 5CEIB 3A8MB 1D3UB 2W9FA 4FX3B 1OIYB 2ZPFB 2UUEB 2ZZDB 1XO2A 3NDQA 3HBLA 3A8HB 3GTMS 1UNHD 2W96A 2QGSA 2ZPHB 5IF1B 2DPPB 4EOLB 1JSUB 3QXEB 3EIDB 3TNHB 2WJ9A 3X25B 1GH6B 4JX6A 2D0QB 2AHJB 5HBEB 4OR5B 2WPAB 4BCPB 3QWLA 3O0GD 2IW8B 3VKGA 3TW6A 1N4MA 3F5XB 1H1QB 5LQFB 4CFMB 3DTOA 5CYIB 2ZPGB 3A8OB 1O9KA 1OKVB 1OIUB 3DJBA 2CCHB 2C5OB 4LOCA 2B9RA 1O9KB 2WMAB 4EOQB 2PHGA 5LMKB 4F6UB 4BXXX 1JSTB 5ICPB 4BCND 3BHVB 2C5XB 4CFNB 1H1SB 2LW4A 3QYBA 1GUXA 3B57A 1UGSB 4BCNB 4F6WB 2WHBB 4M6VA 2DD5B 4BY1X 1H26B 2WFYB 1GUXB 4F6SB 2W9ZA 4HNTA 2IW9B 3MIAB 2BKZB 2UZEB 4BCIB 4AKIA 1VINA 4F7NB 3X24B 4EOIB 4ROCA 3EJ1B 3A8GB 1UNGD 2KR6A 4TTHA 4EORB 2CZ0B 2ZPEB 3X26B 5DQWA 3A8LB 3BG5A 1F5QB 1QLBA 5IDNB 1JKWA 4EOKB 2I53A 2G9XB 4IMYB 5IDPB 1C9BA 2IVXA 4OB0B 5BNJB 3K7AM 2DXBB 2CJMB 4EOSB 4YC3B 4G6LB 1TFBA 2PK2A 3WVEB 2CZ1B 4ZGJB 2BS2A 4EC8B 2F2CA 3HHTB 4OB1B 4EOMB 4BCJB 1AD6A 4YOZA 3BG3A 2W2HA 2PJQA 3DDQB 1E9HB 3BHTB 4ZGDB 4BCFB 2R7GA 4BCHB 1AISB 3X20B 3TW7A 3HZJA 2IW6B 2ZCFB 3PO3S 3QZ9B 4OB2B 2WMBB 5IHYA 1H1RB 4II5B 4BCOB 1VYWB 4KRDB 1KXUA 3DL1A 2JGZB 2CCIB 2DD4B 2QF7A 5HBJB 2BS3A 2X1NB 3BLQB 4MFEA 5HVYB 4F70B 4AKGA 3BLHB 1ENWA 2ZPBB 3H4CA 2C5VB 4BCQD 4ELLA 5FGKB 4JX4A 4AKHA 1TD6A 1W98B 4BCQB 5I5ZB 2EUFA 2BS4A 3MI9B 1UNLD 4F7SB 4HNVA 2ZPIB 2CZ6B 4CRLB 2UZDB 4F7LB 4MFDA 3M03A 3QYHB 4EC9B 2DXCB 1P5EB 1OGUB 4CFXB 5HBHB 4AI6A 3VKHA 4EOJB 2BPMB 1AHJB 4CFWB 2C5NB 3TN8B 1PKDB 3QYEA 4FM4B 2IN3A 2QQ8A 4NSTB 4Y72B 4NC6A 3MY5B 3QYGB 3KHIA 1G3NC 4I3ZB 2CZ7B 1QMZB 5ACBA 2CYZB 1H27B 1H1PB 2I40B 4UN0A 1UGQB 2QFZA 2DMEA 1IREB 3QHWB 4CXAB 4EOPB 1E7PA 1UGPB 1V29B 1H4LD 4EOOB 1H28B 3WVDB 4CFVB 2QDJA 4BCGB 3VYHB 4Z6YA 4EONB 3DOGB 3HO8A 2UZLB 4YOOA 3TNIB 3VYGB 1H24B 4MIMA 4KRCB 1FINB 4BBSM 1GY3B 4HL4A 4ELJA 2QDYB 1OKWB 2WIHB 4F7JB 3RGFB 1URCB 3LQ5B 1OI9B 2C4GB 1FVVB 5L2WB 3BHUB 3EOCB 3BG9A 5HNBB 2KMGA 4BY7X 3HB9A 2WIPB 2V22B 4HNUA 1OL1B 3TNWB 3QZ5B 4YOSA 2W99A 1VOLA 4JX5A 4OGRB 4RODA 2WXVB 2UZBB 1H25B 5EFQB 4HLQA 2C6TB 5EJCA 4BCKB 4BCMD 4CFUD
chains in the Genus database with same CATH topology
1OL2B 3MY1B 4EOJB 2BPMB 2PMIB 4CFWB 2C5NB 3DDQB 3TN8B 1PKDB 1E9HB 2WEVB 3POMA 1GUXA 1JOWA 3BHTB 4BCNB 4BCMB 4ROEA 4BCFB 2R7GA 4BCHB 4F6WB 2PK9B 4CFUB 1AISB 1BU2A 3BLRB 4NSTB 4Y72B 2WHBB 3DDPB 1ZP2A 2IW6B 5HQ0B 3MY5B 3QHRB 3G33B 5CEIB 1D3UB 1G3NC 1H26B 2WFYB 4I3ZB 2W9FA 1QMZB 2WMBB 4FX3B 5ACBA 1GUXB 4F6SB 1H27B 1H1PB 2W9ZA 2I40B 1OIYB 4UN0A 1H1RB 2IW9B 3MIAB 4II5B 4BCOB 2BKZB 2UUEB 1VYWB 1XO2A 2UZEB 1KXUA 4KRDB 3QHWB 2JGZB 2CCIB 1UNHD 2W96A 4BCIB 4CXAB 5IF1B 1VINA 4EOLB 4EOPB 1JSUB 3EIDB 5HBJB 3TNHB 1H4LD 4F7NB 4EOOB 1GH6B 1H28B 2X1NB 3BLQB 5HVYB 4EOIB 4F70B 4CFVB 3EJ1B 5HBEB 4ROCA 2QDJA 4OR5B 4BCGB 2WPAB 4BCPB 3BLHB 4EONB 1UNGD 3DOGB 2UZLB 3O0GD 4TTHA 4YOOA 3H4CA 4EORB 2C5VB 3TNIB 2IW8B 1H24B 4BCQD 4ELLA 5FGKB 1N4MA 3F5XB 1H1QB 5LQFB 4KRCB 1FINB 1GY3B 4CFMB 4ELJA 1F5QB 5CYIB 5IDNB 1W98B 1JKWA 1O9KA 4EOKB 1OKWB 2WIHB 4F7JB 2I53A 3RGFB 1OKVB 1URCB 2G9XB 3LQ5B 4IMYB 4BCQB 1OI9B 2C4GB 1FVVB 1OIUB 5L2WB 5IDPB 3BHUB 1C9BA 2IVXA 3EOCB 5I5ZB 2EUFA 5BNJB 3K7AM 2CCHB 2CJMB 5HNBB 2C5OB 4EOSB 4YC3B 4G6LB 2WIPB 3MI9B 1UNLD 4F7SB 2V22B 2B9RA 1O9KB 2WMAB 1TFBA 1OL1B 4CRLB 2PK2A 3TNWB 4EOQB 4YOSA 2PHGA 2UZDB 5LMKB 4F7LB 2W99A 4F6UB 1VOLA 4OGRB 4EC8B 3M03A 1JSTB 4EC9B 2WXVB 1P5EB 2UZBB 4RODA 2F2CA 1H25B 5EFQB 4EOMB 5ICPB 4BCJB 2C6TB 1AD6A 1OGUB 3BHVB 4BCKB 4BCMD 4BCND 4YOZA 2C5XB 4CFXB 4CFUD 5HBHB 2W2HA 4CFNB 1H1SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OL2 B;  3MY1 B;  4EOJ B;  2BPM B;  2PMI B;  4CFW B;  2C5N B;  3DDQ B;  3TN8 B;  1PKD B;  1E9H B;  2WEV B;  3POM A;  1GUX A;  1JOW A;  3BHT B;  4BCN B;  4BCM B;  4ROE A;  4BCF B;  2R7G A;  4BCH B;  4F6W B;  2PK9 B;  4CFU B;  1AIS B;  1BU2 A;  3BLR B;  4NST B;  4Y72 B;  2WHB B;  3DDP B;  1ZP2 A;  2IW6 B;  5HQ0 B;  3MY5 B;  3QHR B;  3G33 B;  5CEI B;  1D3U B;  1G3N C;  1H26 B;  2WFY B;  4I3Z B;  2W9F A;  1QMZ B;  2WMB B;  4FX3 B;  5ACB A;  1GUX B;  4F6S B;  1H27 B;  1H1P B;  2W9Z A;  2I40 B;  1OIY B;  4UN0 A;  1H1R B;  2IW9 B;  3MIA B;  4II5 B;  4BCO B;  2BKZ B;  2UUE B;  1VYW B;  1XO2 A;  2UZE B;  1KXU A;  4KRD B;  3QHW B;  2JGZ B;  2CCI B;  1UNH D;  2W96 A;  4BCI B;  4CXA B;  5IF1 B;  1VIN A;  4EOL B;  4EOP B;  1JSU B;  3EID B;  5HBJ B;  3TNH B;  1H4L D;  4F7N B;  4EOO B;  1GH6 B;  1H28 B;  2X1N B;  3BLQ B;  5HVY B;  4EOI B;  4F70 B;  4CFV B;  3EJ1 B;  5HBE B;  4ROC A;  2QDJ A;  4OR5 B;  4BCG B;  2WPA B;  4BCP B;  3BLH B;  4EON B;  1UNG D;  3DOG B;  2UZL B;  3O0G D;  4TTH A;  4YOO A;  3H4C A;  4EOR B;  2C5V B;  3TNI B;  2IW8 B;  1H24 B;  4BCQ D;  4ELL A;  5FGK B;  1N4M A;  3F5X B;  1H1Q B;  5LQF B;  4KRC B;  1FIN B;  1GY3 B;  4CFM B;  4ELJ A;  1F5Q B;  5CYI B;  5IDN B;  1W98 B;  1JKW A;  1O9K A;  4EOK B;  1OKW B;  2WIH B;  4F7J B;  2I53 A;  3RGF B;  1OKV B;  1URC B;  2G9X B;  3LQ5 B;  4IMY B;  4BCQ B;  1OI9 B;  2C4G B;  1FVV B;  1OIU B;  5L2W B;  5IDP B;  3BHU B;  1C9B A;  2IVX A;  3EOC B;  5I5Z B;  2EUF A;  5BNJ B;  3K7A M;  2CCH B;  2CJM B;  5HNB B;  2C5O B;  4EOS B;  4YC3 B;  4G6L B;  2WIP B;  3MI9 B;  1UNL D;  4F7S B;  2V22 B;  2B9R A;  1O9K B;  2WMA B;  1TFB A;  1OL1 B;  4CRL B;  2PK2 A;  3TNW B;  4EOQ B;  4YOS A;  2PHG A;  2UZD B;  5LMK B;  4F7L B;  2W99 A;  4F6U B;  1VOL A;  4OGR B;  4EC8 B;  3M03 A;  1JST B;  4EC9 B;  2WXV B;  1P5E B;  2UZB B;  4ROD A;  2F2C A;  1H25 B;  5EFQ B;  4EOM B;  5ICP B;  4BCJ B;  2C6T B;  1AD6 A;  1OGU B;  3BHV B;  4BCK B;  4BCM D;  4BCN D;  4YOZ A;  2C5X B;  4CFX B;  4CFU D;  5HBH B;  2W2H A;  4CFN B;  1H1S B; 
#chains in the Genus database with same CATH topology
 1OL2 B;  3MY1 B;  2PMI B;  2G77 A;  4ZGE B;  5DQV A;  2WEV B;  3POM A;  1JOW A;  4BCM B;  4OB3 B;  1UGR B;  4ROE A;  4QSH A;  2PK9 B;  4CFU B;  1BU2 A;  3BLR B;  4BBR M;  3DDP B;  1ZP2 A;  1FKM A;  5HQ0 B;  3QHR B;  3X28 B;  3G33 B;  5CEI B;  3A8M B;  1D3U B;  2W9F A;  4FX3 B;  1OIY B;  2ZPF B;  2UUE B;  2ZZD B;  1XO2 A;  3NDQ A;  3HBL A;  3A8H B;  3GTM S;  1UNH D;  2W96 A;  2QGS A;  2ZPH B;  5IF1 B;  2DPP B;  4EOL B;  1JSU B;  3QXE B;  3EID B;  3TNH B;  2WJ9 A;  3X25 B;  1GH6 B;  4JX6 A;  2D0Q B;  2AHJ B;  5HBE B;  4OR5 B;  2WPA B;  4BCP B;  3QWL A;  3O0G D;  2IW8 B;  3VKG A;  3TW6 A;  1N4M A;  3F5X B;  1H1Q B;  5LQF B;  4CFM B;  3DTO A;  5CYI B;  2ZPG B;  3A8O B;  1O9K A;  1OKV B;  1OIU B;  3DJB A;  2CCH B;  2C5O B;  4LOC A;  2B9R A;  1O9K B;  2WMA B;  4EOQ B;  2PHG A;  5LMK B;  4F6U B;  4BXX X;  1JST B;  5ICP B;  4BCN D;  3BHV B;  2C5X B;  4CFN B;  1H1S B;  2LW4 A;  3QYB A;  1GUX A;  3B57 A;  1UGS B;  4BCN B;  4F6W B;  2WHB B;  4M6V A;  2DD5 B;  4BY1 X;  1H26 B;  2WFY B;  1GUX B;  4F6S B;  2W9Z A;  4HNT A;  2IW9 B;  3MIA B;  2BKZ B;  2UZE B;  4BCI B;  4AKI A;  1VIN A;  4F7N B;  3X24 B;  4EOI B;  4ROC A;  3EJ1 B;  3A8G B;  1UNG D;  2KR6 A;  4TTH A;  4EOR B;  2CZ0 B;  2ZPE B;  3X26 B;  5DQW A;  3A8L B;  3BG5 A;  1F5Q B;  1QLB A;  5IDN B;  1JKW A;  4EOK B;  2I53 A;  2G9X B;  4IMY B;  5IDP B;  1C9B A;  2IVX A;  4OB0 B;  5BNJ B;  3K7A M;  2DXB B;  2CJM B;  4EOS B;  4YC3 B;  4G6L B;  1TFB A;  2PK2 A;  3WVE B;  2CZ1 B;  4ZGJ B;  2BS2 A;  4EC8 B;  2F2C A;  3HHT B;  4OB1 B;  4EOM B;  4BCJ B;  1AD6 A;  4YOZ A;  3BG3 A;  2W2H A;  2PJQ A;  3DDQ B;  1E9H B;  3BHT B;  4ZGD B;  4BCF B;  2R7G A;  4BCH B;  1AIS B;  3X20 B;  3TW7 A;  3HZJ A;  2IW6 B;  2ZCF B;  3PO3 S;  3QZ9 B;  4OB2 B;  2WMB B;  5IHY A;  1H1R B;  4II5 B;  4BCO B;  1VYW B;  4KRD B;  1KXU A;  3DL1 A;  2JGZ B;  2CCI B;  2DD4 B;  2QF7 A;  5HBJ B;  2BS3 A;  2X1N B;  3BLQ B;  4MFE A;  5HVY B;  4F70 B;  4AKG A;  3BLH B;  1ENW A;  2ZPB B;  3H4C A;  2C5V B;  4BCQ D;  4ELL A;  5FGK B;  4JX4 A;  4AKH A;  1TD6 A;  1W98 B;  4BCQ B;  5I5Z B;  2EUF A;  2BS4 A;  3MI9 B;  1UNL D;  4F7S B;  4HNV A;  2ZPI B;  2CZ6 B;  4CRL B;  2UZD B;  4F7L B;  4MFD A;  3M03 A;  3QYH B;  4EC9 B;  2DXC B;  1P5E B;  1OGU B;  4CFX B;  5HBH B;  4AI6 A;  3VKH A;  4EOJ B;  2BPM B;  1AHJ B;  4CFW B;  2C5N B;  3TN8 B;  1PKD B;  3QYE A;  4FM4 B;  2IN3 A;  2QQ8 A;  4NST B;  4Y72 B;  4NC6 A;  3MY5 B;  3QYG B;  3KHI A;  1G3N C;  4I3Z B;  2CZ7 B;  1QMZ B;  5ACB A;  2CYZ B;  1H27 B;  1H1P B;  2I40 B;  4UN0 A;  1UGQ B;  2QFZ A;  2DME A;  1IRE B;  3QHW B;  4CXA B;  4EOP B;  1E7P A;  1UGP B;  1V29 B;  1H4L D;  4EOO B;  1H28 B;  3WVD B;  4CFV B;  2QDJ A;  4BCG B;  3VYH B;  4Z6Y A;  4EON B;  3DOG B;  3HO8 A;  2UZL B;  4YOO A;  3TNI B;  3VYG B;  1H24 B;  4MIM A;  4KRC B;  1FIN B;  4BBS M;  1GY3 B;  4HL4 A;  4ELJ A;  2QDY B;  1OKW B;  2WIH B;  4F7J B;  3RGF B;  1URC B;  3LQ5 B;  1OI9 B;  2C4G B;  1FVV B;  5L2W B;  3BHU B;  3EOC B;  3BG9 A;  5HNB B;  2KMG A;  4BY7 X;  3HB9 A;  2WIP B;  2V22 B;  4HNU A;  1OL1 B;  3TNW B;  3QZ5 B;  4YOS A;  2W99 A;  1VOL A;  4JX5 A;  4OGR B;  4ROD A;  2WXV B;  2UZB B;  1H25 B;  5EFQ B;  4HLQ A;  2C6T B;  5EJC A;  4BCK B;  4BCM D;  4CFU D; 
#chains in the Genus database with same CATH homology
 1OL2 B;  3MY1 B;  4EOJ B;  2BPM B;  2PMI B;  4CFW B;  2C5N B;  3DDQ B;  3TN8 B;  1PKD B;  1E9H B;  2WEV B;  3POM A;  1GUX A;  1JOW A;  3BHT B;  4BCN B;  4BCM B;  4ROE A;  4BCF B;  2R7G A;  4BCH B;  4F6W B;  2PK9 B;  4CFU B;  1AIS B;  1BU2 A;  3BLR B;  4NST B;  4Y72 B;  2WHB B;  3DDP B;  1ZP2 A;  2IW6 B;  5HQ0 B;  3MY5 B;  3QHR B;  3G33 B;  5CEI B;  1D3U B;  1G3N C;  1H26 B;  2WFY B;  4I3Z B;  2W9F A;  1QMZ B;  2WMB B;  4FX3 B;  5ACB A;  1GUX B;  4F6S B;  1H27 B;  1H1P B;  2W9Z A;  2I40 B;  1OIY B;  4UN0 A;  1H1R B;  2IW9 B;  3MIA B;  4II5 B;  4BCO B;  2BKZ B;  2UUE B;  1VYW B;  1XO2 A;  2UZE B;  1KXU A;  4KRD B;  3QHW B;  2JGZ B;  2CCI B;  1UNH D;  2W96 A;  4BCI B;  4CXA B;  5IF1 B;  1VIN A;  4EOL B;  4EOP B;  1JSU B;  3EID B;  5HBJ B;  3TNH B;  1H4L D;  4F7N B;  4EOO B;  1GH6 B;  1H28 B;  2X1N B;  3BLQ B;  5HVY B;  4EOI B;  4F70 B;  4CFV B;  3EJ1 B;  5HBE B;  4ROC A;  2QDJ A;  4OR5 B;  4BCG B;  2WPA B;  4BCP B;  3BLH B;  4EON B;  1UNG D;  3DOG B;  2UZL B;  3O0G D;  4TTH A;  4YOO A;  3H4C A;  4EOR B;  2C5V B;  3TNI B;  2IW8 B;  1H24 B;  4BCQ D;  4ELL A;  5FGK B;  1N4M A;  3F5X B;  1H1Q B;  5LQF B;  4KRC B;  1FIN B;  1GY3 B;  4CFM B;  4ELJ A;  1F5Q B;  5CYI B;  5IDN B;  1W98 B;  1JKW A;  1O9K A;  4EOK B;  1OKW B;  2WIH B;  4F7J B;  2I53 A;  3RGF B;  1OKV B;  1URC B;  2G9X B;  3LQ5 B;  4IMY B;  4BCQ B;  1OI9 B;  2C4G B;  1FVV B;  1OIU B;  5L2W B;  5IDP B;  3BHU B;  1C9B A;  2IVX A;  3EOC B;  5I5Z B;  2EUF A;  5BNJ B;  3K7A M;  2CCH B;  2CJM B;  5HNB B;  2C5O B;  4EOS B;  4YC3 B;  4G6L B;  2WIP B;  3MI9 B;  1UNL D;  4F7S B;  2V22 B;  2B9R A;  1O9K B;  2WMA B;  1TFB A;  1OL1 B;  4CRL B;  2PK2 A;  3TNW B;  4EOQ B;  4YOS A;  2PHG A;  2UZD B;  5LMK B;  4F7L B;  2W99 A;  4F6U B;  1VOL A;  4OGR B;  4EC8 B;  3M03 A;  1JST B;  4EC9 B;  2WXV B;  1P5E B;  2UZB B;  4ROD A;  2F2C A;  1H25 B;  5EFQ B;  4EOM B;  5ICP B;  4BCJ B;  2C6T B;  1AD6 A;  1OGU B;  3BHV B;  4BCK B;  4BCM D;  4BCN D;  4YOZ A;  2C5X B;  4CFX B;  4CFU D;  5HBH B;  2W2H A;  4CFN B;  1H1S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...