5LMKB

Structure of phopsho-cdk2-cyclin a in complex with an atp-competitive inhibitor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-dependent kinase 2
publication title Explicit treatment of active-site waters enhances quantum mechanical/implicit solvent scoring: Inhibition of CDK2 by new pyrazolo[1,5-a]pyrimidines.
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5lmkB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5lmkB02
1UNHD 2F2CA 1H27B 1P5EB 2R7GA 4BCQD 2W96A 2PMIB 2IW9B 3BLRB 2X1NB 4EOPB 1GH6B 2WIHB 3K7AM 5FGKB 3BLHB 3DDQB 3EJ1B 1JOWA 3MY5B 2IVXA 2IW8B 1VYWB 2V22B 2C4GB 4F7JB 1GUXA 2BKZB 5HBJB 1FINB 2BPMB 5I5ZB 1GY3B 1OGUB 4F6UB 4CFXB 1H25B 1E9HB 1H28B 4BCJB 5BNJB 5EFQB 4BCMD 1OI9B 4UN0A 1H1QB 5ACBA 4ROCA 1GUXB 1F5QB 4BCND 3BHUB 4BCFB 2CCIB 4RODA 4II5B 1JSUB 1JSTB 1OIYB 4YOSA 1BU2A 2WMAB 3H4CA 3QHWB 4EORB 1VINA 1KXUA 2W99A 2I40B 1QMZB 2C5OB 1JKWA 2G9XB 2UZEB 3TNWB 1O9KA 3MY1B 4BCKB 4BCIB 4CFMB 3LQ5B 1URCB 2W9FA 3RGFB 4I3ZB 3TNHB 2PK9B 4YOZA 3TNIB 3EIDB 4EOKB 2I53A 2JGZB 4EOOB 5L2WB 4F7LB 1H1SB 1OL1B 5HVYB 5ICPB 1ZP2A 3TN8B 2C5NB 4FX3B 5IDNB 1O9KB 1W98B 2WMBB 1H24B 2EUFA 5HBHB 1OIUB 2UUEB 4ROEA 2CCHB 4CFNB 4CFWB 3G33B 3BHVB 3BLQB 4YC3B 4CFUB 4CXAB 4BCGB 1C9BA 4OGRB 1G3NC 4YOOA 2C5XB 4TTHA 2IW6B 1OL2B 3QHRB 4F6SB 2PHGA 1H26B 5IDPB 4BCPB 1VOLA 4F7NB 1FVVB 2WIPB 4ELJA 1UNGD 4F7SB 4NSTB 4KRDB 5HNBB 5LMKB 5CYIB 5IF1B 1AISB 2UZDB 4EC8B 4G6LB 4BCHB 4EOLB 4EONB 4EOQB 1H4LD 1D3UB 1H1RB 2WHBB 2WPAB 2WFYB 3DOGB 2C6TB 4KRCB 4BCQB 4CRLB 4EC9B 3EOCB 1OKWB 2WXVB 4EOIB 5HQ0B 1XO2A 3POMA 1AD6A 1N4MA 3BHTB 3O0GD 2WEVB 4ELLA 4EOMB 3M03A 4EOSB 2UZLB 2UZBB 4F6WB 3F5XB 4CFUD 2B9RA 5CEIB 4OR5B 4EOJB 2QDJA 3MIAB 2W2HA 4CFVB 1TFBA 1OKVB 2C5VB 2W9ZA 4IMYB 1H1PB 4BCOB 5HBEB 4F70B 3DDPB 5LQFB 4BCMB 4Y72B 3MI9B 2PK2A 1UNLD 2CJMB 4BCNB 1PKDB
chains in the Genus database with same CATH superfamily
1UNHD 2D0QB 3QYEA 3K7AM 5FGKB 4OB3B 1JOWA 4AKGA 2C4GB 5HBJB 1GY3B 1OGUB 1H25B 4JX5A 5EFQB 3TW6A 5ACBA 4LOCA 1F5QB 4BCND 3QYGB 3BHUB 4ZGDB 2CCIB 4RODA 4BBSM 3BG5A 4YOSA 3X25B 1BU2A 2WMAB 2CYZB 2LW4A 1KXUA 2ZPBB 2C5OB 2UZEB 3KHIA 2W9FA 2KR6A 3TNHB 4YOZA 2DXBB 3EIDB 4EOKB 5L2WB 4BXXX 3A8MB 2C5NB 5IDNB 3VKGA 4OB0B 1H24B 5HBHB 1OIUB 4ROEA 4CFNB 3G33B 4CXAB 4BCGB 4YOOA 2PHGA 1H26B 2WIPB 3QYBA 2ZCFB 5CYIB 2AHJB 1AHJB 4EOQB 2QQ8A 1D3UB 3DOGB 4BCQB 3EOCB 1OKWB 3QZ5B 3GTMS 3VKHA 4MIMA 2PJQA 3X28B 2G77A 4EOJB 4HLQA 1TFBA 3DTOA 1OKVB 4IMYB 2W9ZA 5HBEB 5LQFB 4BY7X 1ENWA 5DQWA 1TD6A 4JX4A 1UNLD 1PKDB 2F2CA 2ZPHB 2R7GA 2X1NB 3BLHB 1VYWB 3QXEB 2BKZB 2BPMB 5I5ZB 4F6UB 4CFXB 1E9HB 5BNJB 4BY1X 4BCMD 1OI9B 2WJ9A 4AKIA 3BG9A 4HL4A 3X26B 2QF7A 2ZPIB 3QZ9B 1OIYB 4BBRM 5IHYA 2W99A 2BS3A 2G9XB 4BCKB 4BCIB 2PK9B 1UGPB 3TNIB 3VYHB 2ZPGB 4F7LB 4ZGJB 2DXCB 3NDQA 4FX3B 3TN8B 4HNTA 2UUEB 2CCHB 4CFWB 1UGSB 3BLQB 4YC3B 1G3NC 4TTHA 3A8HB 3QHRB 3HZJA 3A8OB 1FVVB 4ELJA 3WVEB 4NSTB 4KRDB 5HNBB 5LMKB 1AISB 2ZPEB 1H1RB 4OB1B 2WPAB 2WFYB 3VYGB 2C6TB 4CRLB 5HQ0B 1N4MA 3BHTB 3M03A 4EOSB 4CFUD 2CZ0B 4OR5B 3BG3A 2QDJA 3MIAB 2BS2A 1QLBA 1UGRB 1H28B 2CJMB 4BCNB 1P5EB 4FM4B 2W96A 2PMIB 1GH6B 2BS4A 4OB2B 3EJ1B 3MY5B 2IVXA 2IW8B 2V22B 1GUXA 1FINB 2DPPB 2ZZDB 4UN0A 3B57A 3HBLA 1H1QB 4ROCA 1GUXB 2ZPFB 4BCFB 4II5B 1JSTB 1VINA 1JKWA 3MY1B 1URCB 4I3ZB 5DQVA 4EOOB 5HVYB 3TW7A 1ZP2A 4HNVA 2EUFA 1C9BA 4HNUA 2C5XB 4NC6A 2IW6B 4JX6A 1OL2B 2DMEA 4F6SB 4BCPB 4F7NB 1UNGD 5IF1B 2UZDB 4EOLB 4BCHB 4EC9B 3WVDB 2WXVB 4EOIB 1XO2A 1AD6A 2WEVB 4ELLA 2CZ6B 3HB9A 4F6WB 3F5XB 2B9RA 2KMGA 3PO3S 3A8LB 4CFVB 2C5VB 1H1PB 5EJCA 4BCMB 4Y72B 3QWLA 2PK2A 4AKHA 3HHTB 3X24B 1H27B 2QDYB 4BCQD 2IW9B 1V29B 2CZ7B 3BLRB 4EOPB 2WIHB 2DD4B 3DDQB 4F7JB 3DL1A 3HO8A 4BCJB 1JSUB 4MFEA 3H4CA 3QHWB 4EORB 2I40B 1QMZB 3TNWB 4CFMB 1O9KA 3LQ5B 3RGFB 1E7PA 2IN3A 2I53A 2JGZB 2CZ1B 1H1SB 1OL1B 5ICPB 1O9KB 1W98B 2WMBB 3A8GB 4QSHA 3BHVB 4CFUB 4AI6A 4OGRB 2QFZA 1IREB 4Z6YA 5IDPB 1FKMA 1VOLA 4F7SB 4ZGEB 4EONB 4EC8B 4G6LB 1UGQB 2WHBB 4KRCB 4M6VA 3POMA 3O0GD 4EOMB 2UZLB 2UZBB 4MFDA 3DJBA 5CEIB 2DD5B 2W2HA 4BCOB 2QGSA 4F70B 3DDPB 3MI9B 3X20B 3QYHB 1H4LD
chains in the Genus database with same CATH topology
1UNHD 2F2CA 1H27B 1P5EB 2R7GA 4BCQD 2W96A 2PMIB 2IW9B 3BLRB 2X1NB 4EOPB 1GH6B 2WIHB 3K7AM 5FGKB 3BLHB 3DDQB 3EJ1B 1JOWA 3MY5B 2IVXA 2IW8B 1VYWB 2V22B 2C4GB 4F7JB 1GUXA 2BKZB 5HBJB 1FINB 2BPMB 5I5ZB 1GY3B 1OGUB 4F6UB 4CFXB 1H25B 1E9HB 1H28B 4BCJB 5BNJB 5EFQB 4BCMD 1OI9B 4UN0A 1H1QB 5ACBA 4ROCA 1GUXB 1F5QB 4BCND 3BHUB 4BCFB 2CCIB 4RODA 4II5B 1JSUB 1JSTB 1OIYB 4YOSA 1BU2A 2WMAB 3H4CA 3QHWB 4EORB 1VINA 1KXUA 2W99A 2I40B 1QMZB 2C5OB 1JKWA 2G9XB 2UZEB 3TNWB 1O9KA 3MY1B 4BCKB 4BCIB 4CFMB 3LQ5B 1URCB 2W9FA 3RGFB 4I3ZB 3TNHB 2PK9B 4YOZA 3TNIB 3EIDB 4EOKB 2I53A 2JGZB 4EOOB 5L2WB 4F7LB 1H1SB 1OL1B 5HVYB 5ICPB 1ZP2A 3TN8B 2C5NB 4FX3B 5IDNB 1O9KB 1W98B 2WMBB 1H24B 2EUFA 5HBHB 1OIUB 2UUEB 4ROEA 2CCHB 4CFNB 4CFWB 3G33B 3BHVB 3BLQB 4YC3B 4CFUB 4CXAB 4BCGB 1C9BA 4OGRB 1G3NC 4YOOA 2C5XB 4TTHA 2IW6B 1OL2B 3QHRB 4F6SB 2PHGA 1H26B 5IDPB 4BCPB 1VOLA 4F7NB 1FVVB 2WIPB 4ELJA 1UNGD 4F7SB 4NSTB 4KRDB 5HNBB 5LMKB 5CYIB 5IF1B 1AISB 2UZDB 4EC8B 4G6LB 4BCHB 4EOLB 4EONB 4EOQB 1H4LD 1D3UB 1H1RB 2WHBB 2WPAB 2WFYB 3DOGB 2C6TB 4KRCB 4BCQB 4CRLB 4EC9B 3EOCB 1OKWB 2WXVB 4EOIB 5HQ0B 1XO2A 3POMA 1AD6A 1N4MA 3BHTB 3O0GD 2WEVB 4ELLA 4EOMB 3M03A 4EOSB 2UZLB 2UZBB 4F6WB 3F5XB 4CFUD 2B9RA 5CEIB 4OR5B 4EOJB 2QDJA 3MIAB 2W2HA 4CFVB 1TFBA 1OKVB 2C5VB 2W9ZA 4IMYB 1H1PB 4BCOB 5HBEB 4F70B 3DDPB 5LQFB 4BCMB 4Y72B 3MI9B 2PK2A 1UNLD 2CJMB 4BCNB 1PKDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNH D;  2F2C A;  1H27 B;  1P5E B;  2R7G A;  4BCQ D;  2W96 A;  2PMI B;  2IW9 B;  3BLR B;  2X1N B;  4EOP B;  1GH6 B;  2WIH B;  3K7A M;  5FGK B;  3BLH B;  3DDQ B;  3EJ1 B;  1JOW A;  3MY5 B;  2IVX A;  2IW8 B;  1VYW B;  2V22 B;  2C4G B;  4F7J B;  1GUX A;  2BKZ B;  5HBJ B;  1FIN B;  2BPM B;  5I5Z B;  1GY3 B;  1OGU B;  4F6U B;  4CFX B;  1H25 B;  1E9H B;  1H28 B;  4BCJ B;  5BNJ B;  5EFQ B;  4BCM D;  1OI9 B;  4UN0 A;  1H1Q B;  5ACB A;  4ROC A;  1GUX B;  1F5Q B;  4BCN D;  3BHU B;  4BCF B;  2CCI B;  4ROD A;  4II5 B;  1JSU B;  1JST B;  1OIY B;  4YOS A;  1BU2 A;  2WMA B;  3H4C A;  3QHW B;  4EOR B;  1VIN A;  1KXU A;  2W99 A;  2I40 B;  1QMZ B;  2C5O B;  1JKW A;  2G9X B;  2UZE B;  3TNW B;  1O9K A;  3MY1 B;  4BCK B;  4BCI B;  4CFM B;  3LQ5 B;  1URC B;  2W9F A;  3RGF B;  4I3Z B;  3TNH B;  2PK9 B;  4YOZ A;  3TNI B;  3EID B;  4EOK B;  2I53 A;  2JGZ B;  4EOO B;  5L2W B;  4F7L B;  1H1S B;  1OL1 B;  5HVY B;  5ICP B;  1ZP2 A;  3TN8 B;  2C5N B;  4FX3 B;  5IDN B;  1O9K B;  1W98 B;  2WMB B;  1H24 B;  2EUF A;  5HBH B;  1OIU B;  2UUE B;  4ROE A;  2CCH B;  4CFN B;  4CFW B;  3G33 B;  3BHV B;  3BLQ B;  4YC3 B;  4CFU B;  4CXA B;  4BCG B;  1C9B A;  4OGR B;  1G3N C;  4YOO A;  2C5X B;  4TTH A;  2IW6 B;  1OL2 B;  3QHR B;  4F6S B;  2PHG A;  1H26 B;  5IDP B;  4BCP B;  1VOL A;  4F7N B;  1FVV B;  2WIP B;  4ELJ A;  1UNG D;  4F7S B;  4NST B;  4KRD B;  5HNB B;  5LMK B;  5CYI B;  5IF1 B;  1AIS B;  2UZD B;  4EC8 B;  4G6L B;  4BCH B;  4EOL B;  4EON B;  4EOQ B;  1H4L D;  1D3U B;  1H1R B;  2WHB B;  2WPA B;  2WFY B;  3DOG B;  2C6T B;  4KRC B;  4BCQ B;  4CRL B;  4EC9 B;  3EOC B;  1OKW B;  2WXV B;  4EOI B;  5HQ0 B;  1XO2 A;  3POM A;  1AD6 A;  1N4M A;  3BHT B;  3O0G D;  2WEV B;  4ELL A;  4EOM B;  3M03 A;  4EOS B;  2UZL B;  2UZB B;  4F6W B;  3F5X B;  4CFU D;  2B9R A;  5CEI B;  4OR5 B;  4EOJ B;  2QDJ A;  3MIA B;  2W2H A;  4CFV B;  1TFB A;  1OKV B;  2C5V B;  2W9Z A;  4IMY B;  1H1P B;  4BCO B;  5HBE B;  4F70 B;  3DDP B;  5LQF B;  4BCM B;  4Y72 B;  3MI9 B;  2PK2 A;  1UNL D;  2CJM B;  4BCN B;  1PKD B; 
#chains in the Genus database with same CATH topology
 1UNH D;  2D0Q B;  3QYE A;  3K7A M;  5FGK B;  4OB3 B;  1JOW A;  4AKG A;  2C4G B;  5HBJ B;  1GY3 B;  1OGU B;  1H25 B;  4JX5 A;  5EFQ B;  3TW6 A;  5ACB A;  4LOC A;  1F5Q B;  4BCN D;  3QYG B;  3BHU B;  4ZGD B;  2CCI B;  4ROD A;  4BBS M;  3BG5 A;  4YOS A;  3X25 B;  1BU2 A;  2WMA B;  2CYZ B;  2LW4 A;  1KXU A;  2ZPB B;  2C5O B;  2UZE B;  3KHI A;  2W9F A;  2KR6 A;  3TNH B;  4YOZ A;  2DXB B;  3EID B;  4EOK B;  5L2W B;  4BXX X;  3A8M B;  2C5N B;  5IDN B;  3VKG A;  4OB0 B;  1H24 B;  5HBH B;  1OIU B;  4ROE A;  4CFN B;  3G33 B;  4CXA B;  4BCG B;  4YOO A;  2PHG A;  1H26 B;  2WIP B;  3QYB A;  2ZCF B;  5CYI B;  2AHJ B;  1AHJ B;  4EOQ B;  2QQ8 A;  1D3U B;  3DOG B;  4BCQ B;  3EOC B;  1OKW B;  3QZ5 B;  3GTM S;  3VKH A;  4MIM A;  2PJQ A;  3X28 B;  2G77 A;  4EOJ B;  4HLQ A;  1TFB A;  3DTO A;  1OKV B;  4IMY B;  2W9Z A;  5HBE B;  5LQF B;  4BY7 X;  1ENW A;  5DQW A;  1TD6 A;  4JX4 A;  1UNL D;  1PKD B;  2F2C A;  2ZPH B;  2R7G A;  2X1N B;  3BLH B;  1VYW B;  3QXE B;  2BKZ B;  2BPM B;  5I5Z B;  4F6U B;  4CFX B;  1E9H B;  5BNJ B;  4BY1 X;  4BCM D;  1OI9 B;  2WJ9 A;  4AKI A;  3BG9 A;  4HL4 A;  3X26 B;  2QF7 A;  2ZPI B;  3QZ9 B;  1OIY B;  4BBR M;  5IHY A;  2W99 A;  2BS3 A;  2G9X B;  4BCK B;  4BCI B;  2PK9 B;  1UGP B;  3TNI B;  3VYH B;  2ZPG B;  4F7L B;  4ZGJ B;  2DXC B;  3NDQ A;  4FX3 B;  3TN8 B;  4HNT A;  2UUE B;  2CCH B;  4CFW B;  1UGS B;  3BLQ B;  4YC3 B;  1G3N C;  4TTH A;  3A8H B;  3QHR B;  3HZJ A;  3A8O B;  1FVV B;  4ELJ A;  3WVE B;  4NST B;  4KRD B;  5HNB B;  5LMK B;  1AIS B;  2ZPE B;  1H1R B;  4OB1 B;  2WPA B;  2WFY B;  3VYG B;  2C6T B;  4CRL B;  5HQ0 B;  1N4M A;  3BHT B;  3M03 A;  4EOS B;  4CFU D;  2CZ0 B;  4OR5 B;  3BG3 A;  2QDJ A;  3MIA B;  2BS2 A;  1QLB A;  1UGR B;  1H28 B;  2CJM B;  4BCN B;  1P5E B;  4FM4 B;  2W96 A;  2PMI B;  1GH6 B;  2BS4 A;  4OB2 B;  3EJ1 B;  3MY5 B;  2IVX A;  2IW8 B;  2V22 B;  1GUX A;  1FIN B;  2DPP B;  2ZZD B;  4UN0 A;  3B57 A;  3HBL A;  1H1Q B;  4ROC A;  1GUX B;  2ZPF B;  4BCF B;  4II5 B;  1JST B;  1VIN A;  1JKW A;  3MY1 B;  1URC B;  4I3Z B;  5DQV A;  4EOO B;  5HVY B;  3TW7 A;  1ZP2 A;  4HNV A;  2EUF A;  1C9B A;  4HNU A;  2C5X B;  4NC6 A;  2IW6 B;  4JX6 A;  1OL2 B;  2DME A;  4F6S B;  4BCP B;  4F7N B;  1UNG D;  5IF1 B;  2UZD B;  4EOL B;  4BCH B;  4EC9 B;  3WVD B;  2WXV B;  4EOI B;  1XO2 A;  1AD6 A;  2WEV B;  4ELL A;  2CZ6 B;  3HB9 A;  4F6W B;  3F5X B;  2B9R A;  2KMG A;  3PO3 S;  3A8L B;  4CFV B;  2C5V B;  1H1P B;  5EJC A;  4BCM B;  4Y72 B;  3QWL A;  2PK2 A;  4AKH A;  3HHT B;  3X24 B;  1H27 B;  2QDY B;  4BCQ D;  2IW9 B;  1V29 B;  2CZ7 B;  3BLR B;  4EOP B;  2WIH B;  2DD4 B;  3DDQ B;  4F7J B;  3DL1 A;  3HO8 A;  4BCJ B;  1JSU B;  4MFE A;  3H4C A;  3QHW B;  4EOR B;  2I40 B;  1QMZ B;  3TNW B;  4CFM B;  1O9K A;  3LQ5 B;  3RGF B;  1E7P A;  2IN3 A;  2I53 A;  2JGZ B;  2CZ1 B;  1H1S B;  1OL1 B;  5ICP B;  1O9K B;  1W98 B;  2WMB B;  3A8G B;  4QSH A;  3BHV B;  4CFU B;  4AI6 A;  4OGR B;  2QFZ A;  1IRE B;  4Z6Y A;  5IDP B;  1FKM A;  1VOL A;  4F7S B;  4ZGE B;  4EON B;  4EC8 B;  4G6L B;  1UGQ B;  2WHB B;  4KRC B;  4M6V A;  3POM A;  3O0G D;  4EOM B;  2UZL B;  2UZB B;  4MFD A;  3DJB A;  5CEI B;  2DD5 B;  2W2H A;  4BCO B;  2QGS A;  4F70 B;  3DDP B;  3MI9 B;  3X20 B;  3QYH B;  1H4L D; 
#chains in the Genus database with same CATH homology
 1UNH D;  2F2C A;  1H27 B;  1P5E B;  2R7G A;  4BCQ D;  2W96 A;  2PMI B;  2IW9 B;  3BLR B;  2X1N B;  4EOP B;  1GH6 B;  2WIH B;  3K7A M;  5FGK B;  3BLH B;  3DDQ B;  3EJ1 B;  1JOW A;  3MY5 B;  2IVX A;  2IW8 B;  1VYW B;  2V22 B;  2C4G B;  4F7J B;  1GUX A;  2BKZ B;  5HBJ B;  1FIN B;  2BPM B;  5I5Z B;  1GY3 B;  1OGU B;  4F6U B;  4CFX B;  1H25 B;  1E9H B;  1H28 B;  4BCJ B;  5BNJ B;  5EFQ B;  4BCM D;  1OI9 B;  4UN0 A;  1H1Q B;  5ACB A;  4ROC A;  1GUX B;  1F5Q B;  4BCN D;  3BHU B;  4BCF B;  2CCI B;  4ROD A;  4II5 B;  1JSU B;  1JST B;  1OIY B;  4YOS A;  1BU2 A;  2WMA B;  3H4C A;  3QHW B;  4EOR B;  1VIN A;  1KXU A;  2W99 A;  2I40 B;  1QMZ B;  2C5O B;  1JKW A;  2G9X B;  2UZE B;  3TNW B;  1O9K A;  3MY1 B;  4BCK B;  4BCI B;  4CFM B;  3LQ5 B;  1URC B;  2W9F A;  3RGF B;  4I3Z B;  3TNH B;  2PK9 B;  4YOZ A;  3TNI B;  3EID B;  4EOK B;  2I53 A;  2JGZ B;  4EOO B;  5L2W B;  4F7L B;  1H1S B;  1OL1 B;  5HVY B;  5ICP B;  1ZP2 A;  3TN8 B;  2C5N B;  4FX3 B;  5IDN B;  1O9K B;  1W98 B;  2WMB B;  1H24 B;  2EUF A;  5HBH B;  1OIU B;  2UUE B;  4ROE A;  2CCH B;  4CFN B;  4CFW B;  3G33 B;  3BHV B;  3BLQ B;  4YC3 B;  4CFU B;  4CXA B;  4BCG B;  1C9B A;  4OGR B;  1G3N C;  4YOO A;  2C5X B;  4TTH A;  2IW6 B;  1OL2 B;  3QHR B;  4F6S B;  2PHG A;  1H26 B;  5IDP B;  4BCP B;  1VOL A;  4F7N B;  1FVV B;  2WIP B;  4ELJ A;  1UNG D;  4F7S B;  4NST B;  4KRD B;  5HNB B;  5LMK B;  5CYI B;  5IF1 B;  1AIS B;  2UZD B;  4EC8 B;  4G6L B;  4BCH B;  4EOL B;  4EON B;  4EOQ B;  1H4L D;  1D3U B;  1H1R B;  2WHB B;  2WPA B;  2WFY B;  3DOG B;  2C6T B;  4KRC B;  4BCQ B;  4CRL B;  4EC9 B;  3EOC B;  1OKW B;  2WXV B;  4EOI B;  5HQ0 B;  1XO2 A;  3POM A;  1AD6 A;  1N4M A;  3BHT B;  3O0G D;  2WEV B;  4ELL A;  4EOM B;  3M03 A;  4EOS B;  2UZL B;  2UZB B;  4F6W B;  3F5X B;  4CFU D;  2B9R A;  5CEI B;  4OR5 B;  4EOJ B;  2QDJ A;  3MIA B;  2W2H A;  4CFV B;  1TFB A;  1OKV B;  2C5V B;  2W9Z A;  4IMY B;  1H1P B;  4BCO B;  5HBE B;  4F70 B;  3DDP B;  5LQF B;  4BCM B;  4Y72 B;  3MI9 B;  2PK2 A;  1UNL D;  2CJM B;  4BCN B;  1PKD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...