1UGPB

Crystal structure of co-type nitrile hydratase complexed with n-butyric acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 68
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugpB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugpB02
1QP3A 3QZ9B 1JB0E 3QYGB 3QYHB 1UGPB 2CZ7B 3X26B 3X25B 3A8GB 2DXBB 3QZ5B 2ZZDB 3A8LB 2DD5A 2ZPFB 2CZ6B 4OB3B 1IREB 4KT0E 2ZPBB 2ZCFB 1UGRB 4ZGJB 2DXBA 2PUOB 2O01E 2ZPGB 1QP2A 3A8HB 3HHTB 2AHJB 2PVOB 2ZPEB 2CZ0B 4L6V5 3LW5E 3VYHB 2WSCE 3WVEB 4Y28E 5L8RE 3A8OB 2QDYB 2ZPIB 4ZGDB 4ZGEB 4OB2B 2PVGB 1UGQB 2WSFE 2DD4B 3X20B 4OB0B 1UGSB 3VYGA 2ZPHB 1PSFA 4RKUE 1DJ7B 2DXCA 2CYZB 4XK8E 3A8MB 1V29B 2DD4A 3X28B 2PU9B 2PUKB 2D0QB 3VYGB 2WSEE 1PSEA 2PVDB 4OB1B 2DPPB 2ZZDA 2DXCB 4FM4B 2DD5B 3WVDB 2CZ1B 3X24B 1GXIE 1AHJB 3QXEB
chains in the Genus database with same CATH superfamily
1H26B 3AT1B 1SEMA 1RI0A 2DKGA 1RUWA 2LQ8A 3VRZA 2DJZA 4FT2A 4KRTA 1K73U 3RESA 1VQ5Q 5CIUA 2UZBB 2E70A 4LDUA 1X6OA 2OX7A 4OP0A 5CKEA 1PNJA 2DL8A 2LT4A 2XDPA 4MDXA 2ZPFB 4JS5A 4KT0E 3DLLA 2O31A 1NLPC 3HPWA 5FWCA 2G3RA 4J6WA 3HL8A 2KK4A 3QBYA 3QHSA 1UNGD 2K57A 3EG2A 4XU3A 5IXFA 1WQ7A 3HRUA 1VQOA 3RKWA 2KQWA 3G71A 2JM8A 2XK0A 4A53A 4AFZC 3DJBA 4M4ZA 3H4CA 1NJIR 4HT9A 1GH6B 1ZSZB 4IUPA 3TEEA 2EQKA 2FYKA 2H3EB 3EIDB 3FC3A 1Y0MA 3CC2Q 2MF2A 3CCEQ 1YI2T 3RDVA 4OMPA 4ZGDB 3CC7Q 1VQLA 1FMKA 2PVGB 3OYHA 4BI3A 2KR3A 2K3XA 1YHQT 2YHTA 5I21A 1VQKQ 4OB0B 2A0FB 1NE8A 1GBRA 3OSSC 4Y92A 2CCHB 5CKFA 4OMLA 1OL1B 3LWHA 1YIJT 3CMAA 3OQ5A 1PSFA 4EOQB 2QXFA 2LNHB 2JXBA 1UECA 2EJFA 3DTOA 1ACMB 1SHFA 4GLMA 2RA2A 3JCMd 2BZ8A 1ZBXA 2GTJA 2KGTA 5LJ5j 1T3SA 3LWIA 2C0OA 2PUKB 1XJWB 2B8AA 4PJOF 2L3SA 3RIRA 1ZBJA 1YIJA 2CP3A 1QKWA 2LNVA 3LH0A 3QWYA 4RUGA 1WHLA 3OSVA 2RM4A 3LX7A 2F1LA 1JJ2S 3MO8A 1VQMQ 4FM4B 4G6LB 3THKA 5A0LA 4FYXB 3CCVT 1M5Q1 2K3BA 1YP5A 3MP8A 1UJ0A 2OAUA 4AKGA 4EC9B 2F2CA 1RL2A 2R57A 4PFZA 5GMKm 4QT7A 1C6VX 1IHWA 4LUEA 1KG1A 3HFOA 1IGQA 2KT1A 3VS1A 2EIFA 1W1FA 4EC8B 1ZA2B 2CP0A 4AKIA 2UUEB 1UGRB 3NFCA 2SRCA 4AI6A 4BUGA 1LCKA 3MKDA 2QGFB 4FIBA 1PM3A 4E7JA 3M0PA 5FRNA 3NTHA 4N4GA 1VQ8Q 5ACBA 1M1FA 3QJYA 2DZ9A 4MZTA 4P5NA 2K7AA 4BCMB 2AHJB 5FW9A 2EKOA 1M2VB 4CI0C 1ZUKA 1BCOA 1YITQ 3LLRA 3C4SA 1JJ2A 3NDQA 3HZJA 2XI9A 4ELYC 3QDFA 1WJSA 3TNWB 3SD4A 3I5SA 4AFQC 1SSHA 3QUIA 4ATOA 2O4XB 1S1NA 1KFZA 2PZ1A 5EJCA 3KBGA 4J9CA 2FHDA 4RTWA 5IF1B 1VYVA 3HKSA 1YJ9T 4M78E 4F7NB 1VYWB 1QCNA 3OYDA 5KCHA 1IZ6A 3EHRA 3M03A 4M75A 2KBTA 3VV0A 5CK9A 2OI3A 3OS0A 2VUBA 4CFVB 1X2QA 2CUBA 2WEVB 4C8QD 1QWFA 4M7AE 5D6YA 3FJ5A 4MFEA 3KUFA 3N5BB 3TNHB 3OYNA 1JU5C 2EQMA 2FPFA 1X43A 5ECAA 5CKBA 3KFVA 2RK2A 3FLGA 1JSUB 1UHFA 3BG3A 1I4K1 4ZNXA 1SKUB 4F7UF 2YT6A 1M1KU 1M1KR 3ZL7C 2RQVA 1YJ9A 1WDXA 5HBEB 2QDJA 4HCKA 2V22B 1V76A 3TREA 1G3NC 3VS3A 1M8VA 3QYBA 2FZGB 1GFDA 1H1QB 4J6XA 5KYYB 3FJPA 2PNIA 2MK5A 4C8QC 4R56A 1MHNA 2DXBA 1W70A 3P8HA 2GBQA 3I55T 2BKZB 1MNEA 3UATA 1BU1A 1QLYA 2RJFA 3QIIA 4RCCA 2D9TA 2YLBA 2NWMA 4C8QE 2WSCE 1VQ5T 2L5QA 2GF7A 4M77F 1VYTA 2DM1A 2BKDN 3JB9H 1W98B 1QW1A 3VS7A 5FGKB 5GAOl 3CCRT 3E1SA 1CKBA 4OB2B 1YN8A 1PKTA 1BI3A 2RHYA 5LJ3h 3LH5A 4E6RA 5IHNA 3MCAB 2QA4T 2V8KA 5HQ0B 4C0DC 1RLPC 3CCQT 1TOVA 2IW8B 2KSSA 4M77D 3A1PA 1OX8A 2DF6A 3V8JA 3CCRA 3M0RA 2V1QA 1I5LA 2P4TA 4JX5A 3MPUB 3X28B 4HL4A 2F2WA 3O8VA 4I3ZB 1VINA 4CFWB 1TTHB 1MMDA 2SEMA 2V8IA 3MEWA 1C1AA 2Y90A 2XHCA 3MY1B 1JBMA 1YI2Q 4C92F 1YNZA 2DO3A 4E7LA 3VU3C 4FCYA 3WVDB 2HBPA 3HO8A 4J7IA 3S3MA 1VQLQ 2VV5A 4LD9K 3C95A 2W9ZA 1UGPB 2G6FX 1WNLA 3BHTB 3OYAA 2DZCA 2CDTA 3MJXA 3F5XB 2COZA 1URCB 3HBLA 3OYJA 4M75G 2GFUA 2JVVA 1GFCA 3ZFJA 4HXJA 2QGSA 2QDLA 2JGZB 5CYIB 2K4YA 2A08A 4OB3B 1IREB 1WYXA 5IHYA 1PG5B 4EMKA 4XTVA 2JTFA 4KGVB 2J06A 4M7DA 2I2LA 1I07A 3OMCA 4RTUA 4DBQA 3M0SA 2KY9A 2E6NA 3DLMA 2LRQA 3WXMB 1UTIA 1H8KA 2ZPGB 3HB9A 3RMSA 1VQ9Q 1R77A 2HSEB 4C8QB 1IO6A 2WMBB 4BCHB 2ESWA 2PVOB 2AT1B 2M1HA 2MWPA 4EOOB 2R7GA 4L59A 1B7TA 1RAHB 2DTOA 4NL2A 1RAAB 3FB9A 1VQOT 3JCMV 2X4JA 2DFUA 2Z0WA 2YUOA 4EDUA 4M7AC 5AT1B 2AIRB 1Q81R 1W2BP 1G2BA 3G7ZA 4Y91A 5KYWB 2ZPHB 2KRSA 3I56A 4EONB 3B57A 3S3NA 2EGAA 1QLBA 1E9HB 2RHIA 2QAZA 1G8XA 1VQ7A 4M77A 2C06A 1SHGA 4CFMB 2X9HA 4XTYA 9ATCB 2CS7A 2CKKA 1NBEB 2D0QB 3EH2A 4J9IA 3REBB 3PNWC 1Q81U 3TU4K 1BKBA 2VKNA 3BHUB 2CUDA 1K8AU 2QEXQ 2CGHA 1JO8A 5HNBB 3M0TA 1YITA 1X69A 1K9MR 1VOMA 2DXCB 2LC4A 3I55Q 3CCLQ 4EOKB 3FRNA 2XG8D 1HD3A 1RABB 3BY7A 3M0UA 1WZOA 2IW6B 2BZXA 1VQMT 3TCJA 4A4KA 1H1PB 2KROA 4GY5A 3BLHB 3CCQA 3PVQA 4B9XA 5IHKA 2E12A 1W4SA 5DQWA 4BACA 3G6EQ 2GFAA 2CZ6B 3NHNA 1KC8U 1WGSA 2L3QA 2ZPBB 2JZ2A 1BYMA 4ZGJB 3RKYA 5CQXA 2AK5A 2X4YA 3V8LA 4QVZA 2E5QA 3C12A 4CC3A 1AD5A 1TU0B 5FLXE 5LJ3d 4JJCA 8ATCB 4PLIA 3JAME 1UG1A 1KD1R 4QW2A 3FIFA 1GUXA 2LW4A 3VS4A 2IPOB 2KYBA 3CC7T 2ZAEA 3VYHB 3META 3CCMQ 2M0OA 2LZ6B 4F04B 1D3BA 2JUFA 2QA4Q 3JCMP 3SWNA 2XMFA 3J80E 4ZGEB 2K3YA 3EG3A 5A2QE 1MUZA 5DM7R 5GAN5 3HFNA 4BCKB 2ATCB 1K76A 2WIHB 2P0PA 1GCQC 2ENMA 4YOSA 2RMOA 1D09B 2DMOA 4JRQA 1EFNA 4PJOG 3I35A 5GAOq 1FX7A 5GAMg 1KQSA 1S72T 1UFFA 1WHKA 1V29B 1BIAA 2PU9B 4E7IA 1QQJA 3QWLA 1RACB 1SRLA 3KXTA 1M3AA 3H6ZA 2AKKA 2CH4W 2CT4A 5GANj 4EOIB 3FEOA 3C0CA 4HNVA 2OAWA 3UF4A 2DL7A 1VQ9T 1AHJB 4E7KA 4J9EA 3OBYA 1MMNA 2LTOA 3MP1A 2PK9B 4BCQB 1OV3A 2IIMA 2KMGA 1OGUB 4D6WA 3M58A 4XTWA 4XAXB 2K79A 3CC4Q 4ELJA 1O75A 2HQXA 1UNLD 1AWOA 2NUZA 2RQRA 1OZ2A 2FL7A 3CD6A 3JCMQ 3EGDA 2ZCFB 2G77A 5GANg 1YHQQ 1OOTA 1UB4A 2E65A 4WF2A 1N27A 2PQWA 4JJNK 4EOMB 1WFWA 3MP6A 2YWWA 4MMKA 3POMA 1PKDB 1VUBA 2QI2A 4LDXA 1D3UB 1BB9A 1YJNT 3PE0A 1WXTA 3H8ZA 4F16A 1M2OA 2E64A 2L8DA 3L2VA 1SPKA 2RI5A 1KXUA 2QA4A 1Q95G 2YUNA 1M1KC 4DBFA 2JW4A 2AZSA 2CT3A 3EH1A 4J9HA 4LDWA 3TW6A 3QDRB 4HCBA 4PJMA 1UGQB 4M75B 3LGFA 1Y96A 2HZYA 3CBOA 4A4GA 1ZSZA 1VQ5A 3CCET 3M53A 5GAOn 4EMGA 2B86A 3DDPB 4HVWA 4RKUE 5LJ5e 5J39A 3PTAA 4BE0A 4JRPA 4CC7A 1TS9A 2W2HA 1BI0A 2DXCA 2EUFA 2RI2A 4EMKC 3PFSA 3A8MB 5IH2A 1TH7A 4N0AA 1UHCA 1Y57A 1E6HA 3RERA 4F6SB 5IAYA 1R0BG 3FDRA 4A4EA 4ELZC 1QMCA 4OMNA 3CMEA 1OEBA 3TNIB 4PL6A 1E7OA 4HKEA 3AHUA 3H41A 3ZEHA 1M90C 1UEBA 2CZ7B 4IKFA 3CCEA 1K73R 3EG0A 3A8GB 4FW2A 2DXBB 2BZYA 1BBZA 4BCGB 2YDLA 2JJ9A 3CMET 5HKCA 5FU7C 1YWOA 1N4MA 1KD1C 4WTOB 1VQKA 1YHQA 2VASA 2A37A 4OMFB 3CCSA 1SSFA 4LOCA 3CMAQ 1HK9A 2NUPB 3PGGA 3JCMJ 5LMKB 4NSTB 1H27B 1NZ9A 3SWNB 3QWXX 1KD1U 3UPUA 2CJMB 3CCLA 4F7UA 2L0AA 1S72Q 4BY6C 2BS2A 1NJIU 3GTMS 1QVGP 4M78F 1OPLA 1WXUA 1U06A 1CKAA 3NTIA 5AYFA 1QVGA 3DDQB 1TXQA 5KYUB 2ZGWA 2LJ0A 2DYBA 2K9GA 2MAMA 1BK2A 2YUPA 2LX7A 2BE7D 3X20B 2YRDA 4BXXX 4NL3A 4F7LB 5D6WA 1K9MU 2GTOA 3VKIA 1WHHA 1I1JA 4J9GA 5C6SA 5EFQB 2DL5A 1H3ZA 4C5GA 3U23A 3DL1A 1R0CB 2FVUA 2KXCA 2JMAA 5J3BA 3CCLT 3C94A 2HMAA 4HVVA 3VUBA 3EAEA 3NTKA 1VA7A 2B9RA 4OB1B 1KK7A 4M7AG 1AWJA 5A0DA 2DRMA 1Z9ZA 5CR2A 3JB9I 1XQHA 2X3WD 1UUEA 1GY3B 3M56A 1JXMA 1MMGA 2L2PA 4RG8A 2RK1A 3SHWA 2FZKB 3EGDB 3OYFA 1ZP2A 4XQ3A 1YJWT 4DBHA 2E3IA 2EVRA 2WACA 3RMQA 1LVKA 3QZ5B 2DIQA 3OS2A 1E7PA 3CCSQ 5LJ3j 5KCOA 2RJCA 2DNUA 4XU0A 2XU8A 3IQLA 1G3SA 2HL3A 4VUBA 5CO7A 3NGPA 3ULRB 4LN2A 3OYCA 4PJOE 5KYNA 3G6ET 2MWOA 1YCYA 3CBMA 1NG2A 2L89A 1VQOQ 3GLXA 3BLQB 1QP2A 5I11A 4BY1X 1VQ4A 2XIDA 1G3YA 4RTYA 1SG5A 3OS1A 5CQYA 4BCND 3SB2A 4LDVA 4PJLA 4C5EA 3L2RA 1M90U 2AKLA 2QDYB 3OYLA 2W96A 3JCMc 1QCOA 2UZDB 1PCXA 2BTTA 3CC2A 2DBKA 1P5EB 4C5HA 2YRCA 1ABQA 1M2VA 2X35A 3QPHA 1VOLA 3CC7A 1I81A 5L23A 1Y71A 3QKJA 2A3LA 2KEAA 1Q81C 3PIOA 1M90R 4NS5A 4MIMA 4KUIA 2DTIA 3INZA 4CXAB 4F7UG 2KE9A 4BBRM 2XD0A 2JNGA 2QTVA 1OL2B 4GLKA 3CXCA 4M7DD 2RPNA 1KJWA 1M27C 1QMZB 3EJ1B 3RR6A 2DPPB 4PJOB 2IN3A 1N9RA 1FYNA 3I5RA 4YOZA 4AKHA 1UNHD 2UZEB 2DRKA 3M59A 4CRLB 3I9QA 2I53A 2WMAB 4PJOC 2HNIA 3X25B 4QSHA 3M0QA 3CPFA 1FINB 1OPKA 2DXUA 1YITT 2XDDA 2YUQA 1VQNA 3GPLA 5I22A 3G4SA 2DX1A 1H24B 2RF0A 4X9CA 4F7UB 2LJ1A 4DOWA 4J6YA 3DKMA 1E6GA 4BCOB 2GNCA 1PRMC 2OTJA 2EQJA 2RD1A 1PKSA 3CCVQ 1IHVA 1KQ2A 4Z89A 2P84A 3REAB 5GAN4 1H641 4MFDA 2H3JA 4MMLA 2CZ0B 4JUVA 3M4YA 4EPCA 4XTXA 5GAMd 4D8DA 4HT8A 4EORB 5KYWA 1W2BA 5HCKA 4Y28E 3BE3A 4BCIB 4BCPB 2DIGA 3A8OB 1FKMA 1VQ6Q 4TTHA 3QYEA 2KR6A 2RB6A 1MV3A 3CCJQ 3OA6A 2EAYA 3E19A 3CCMT 4NC6A 4BCFB 2CP7A 3VS6A 5IXBA 2GQIA 1BCMA 3ZBDA 4BCQD 1UGSB 5IDPB 2FRYA 2MMPA 1Q7YR 3F70A 5HK3A 2O9VA 1TUCA 2OTJT 4JRKA 5KE2A 3EGXA 3V7RA 4M78B 1EIFA 1D1BA 4FX3B 3O5ZA 2QK0A 4OVAA 1OU8A 2V1RA 2K5LA 4E2FB 4ZN1A 2X4XA 4OF1A 2C5XB 5LJ5g 2CCIB 2NUTB 3LQ5B 5FU6B 4IUUA 1K8AC 3GIBA 2EPDA 3URGA 2ZZDA 4AG2C 3S6WA 5LJ5h 4BCJB 2JN0A 5L2WB 2JS0A 1T0JA 3BG9A 2K5FA 4PKCC 5CEIB 1OKVB 2COYA 1ZUUA 3E9GA 4M7AD 2DILA 2XKOC 2R58A 2WPAB 3VS2A 4B9WA 1VQNQ 5D7UA 1Q86R 2DEQA 2Y4XA 3G4SQ 4Z6YA 2E6ZA 4RMOA 1AVZC 2ECZA 2CSQA 2MI6A 2XDBA 4KRDB 8AT1B 2DYIA 5GAN2 4OGRB 2RJDA 3CBPA 3CEYA 4PLLA 3V7SA 2EYYA 5EC7A 2VYTA 1PHTA 4M7DE 1WHJA 4WCIA 1G5VA 3JRZA 4M7AF 4M77E 4LD6A 2A36A 2QQBA 2IW9B 2OJ2A 2PUOB 4KGZB 2A7YA 2QFZA 5LQFB 1HYOA 1JOWA 4PFOA 3SEMA 2DVEA 1C0MA 2HBWA 2FG0A 3CCJT 4QVDA 2R5AA 2LDMA 1KC8R 1PC0A 3LW5E 2DEUA 5IT9E 3JCMe 6AT1B 1VQ6A 4J8OA 5L8RE 4OMMA 2LCLA 2ROTA 3I55A 4CFUB 3I56T 1EZZB 4JDSA 1ZUYA 4M77B 2W99A 1VQ7T 3OW2A 2RNAA 2EWNA 4C0DB 4F70B 3V7CA 3PO3S 1H92A 2CH4A 1LJOA 4PK4A 4D8KA 1AWWA 2DE0X 1KQSP 2I0NA 5DLOA 4ZTJA 2JOYA 1F5QB 3VYGA 4BCMD 1B07A 1Q82C 3MEUA 5GJWB 4F7UE 2M16A 2DVJA 1DJ7B 4DA4A 3EFOA 2Y4YA 4Z02A 3P8BB 4FYVB 1G3TA 1YIJQ 1VQ4Q 1D0YA 4A63B 1JQQA 1WX6A 2W9FA 4ANJA 4M7AA 4FYYB 4ROEA 1JEGA 2UZLB 1ABOA 3H0IA 3BDLA 2D6FA 3UT1A 3O0GD 3L2ZA 3SDZA 5GAN6 4NOYA 3QXEB 2ABLA 4OMOA 5GAN8 1YJNQ 3CCMA 2RH2A 2O9SA 3QYHB 1GCPA 3M57A 4RTVA 5GAN7 1SF9A 2O88A 1BIBA 2RHXA 1T3LA 3VRYA 2DETA 1NJIC 5I2MA 3JCMX 1X01A 5DQVA 3M9QA 1KIKA 4FSXA 1HJDA 1OU9A 3OYEA 1OQKA 3HSBA 2OTLT 2EYWA 1KHCA 2CP6A 4N4HA 1AD6A 1RLQC 1WPYA 1C9BA 4C0ZA 4M78D 4YOOA 4C92B 2EQIA 2KMTA 3CQTA 2GCXA 3SFMA 3VUZA 2EGCA 2H8HA 3HTRA 2QQAA 4L6V5 5KH6A 3EG9A 1XOVA 3QHWB 3LGLA 1QVFP 1NPRA 3OW2S 2F5KA 3HRTA 1MNDA 1H4LD 2DA9A 2FEIA 2HKQB 2K2MA 2YLCA 5GAOr 4MZMA 2DLPA 2F2VA 4XU1A 5KYXB 1V1CA 2PK2A 4OGEA 4JZ3A 4RG2A 2MOXA 5IDNB 3CXCS 1Q7YC 3OYIA 5D6XA 5CVIA 4AT1B 1M3BA 4ZTFA 5GMKe 4QQDA 4F6WB 1R8OB 4ESRA 1VQNT 3EOCB 3CPWA 3GBQA 1N8RR 3CD6Q 2BUDA 4RTTA 5I2SA 3HP9A 1Y96B 5GAN3 1NYGA 3G71T 2C5VB 3CCST 2DD4A 4E7HA 4C8QF 2DK3A 1K0XA 3DB4A 4DOVA 4CFXB 5DLQE 1I5OB 3RGFB 2E10A 3L42A 4EOPB 4JJBA 4R55A 4F6UB 3OYMA 3CCUT 1VQ6T 2C6TB 3R6NA 1B34B 3G1JA 2EYXA 1YFNA 4KGXB 2BIVA 3X24B 3PVLA 3R6OA 1TUGB 4XTZA 3OYYA 4E7SA 3JB9J 2HCKA 4JX6A 1H1SB 4LE9A 4ROCA 3QYGB 4F14A 5CKDA 5FU7B 4HVUA 4AMCA 3H0FA 5GANh 2J05A 5HBJB 4DEYA 2NUPA 4EOSB 1ENWA 1WHGA 1U1SA 4M6VA 1N9SA 4BCNB 2BS3A 3A8LB 2KXDA 2DD5A 3QJ6A 4R0KA 2PJQA 4X34A 3PT9A 5GANf 3J81E 1FXXA 2P0KA 1VQPQ 3E9FA 4CC4B 4HLQA 2WJ9A 4Y72B 1K73C 1WJQA 1OULA 1ZQ1A 1K0SA 3EFRA 1D3BB 2QEXT 5LJ3f 4BY6B 2BPMB 3TW7A 4M77G 5DY9A 5HY6A 4FW1A 2W0ZA 3EG1A 1Q82R 3L1AA 2QGGA 2ZPEB 3QHRB 1U8RA 1AT1B 5FROA 4CFNB 2L3PA 2F2XA 2HQEA 4C0GA 1FMVA 4EIKA 4RCBA 4PFPA 2DTHA 2LMJA 3CMEQ 1OIUB 4F17A 4C92A 2KRNA 3J7AF 2LT1A 4MZPA 5GANe 4KULA 4OR5B 1XNIA 4HA8A 4BI4A 2WSFE 4II5B 1K8AR 4II1A 2R5MA 3EG9B 1KC8C 2RJEA 2EFIA 1ZSGA 2C5OB 3JB9G 2D1XA 3CCRQ 2LP5A 2YSQA 1X6BA 1M1GA 2CP2A 1LOJA 2ROLA 3QSUA 1B34A 5KYXA 1H1RB 1FVVB 4EOLB 4M75D 1AOJA 2O4XA 4ME7A 4GBQA 2M0YA 4C92E 4M78C 2DERA 1OYXA 2RO0A 1JKWA 4J9BA 1UJYA 2WSEE 2VWFA 3UDCA 2JTMA 2WHBB 4X1VA 1HXDA 4IUQA 1S72A 2HEQA 4QQ6A 5J26A 4C92C 1F1BB 3A98A 1IXDA 1QP3A 5C0MA 4K11A 5CAIA 1AISB 2WXVB 5LJ3e 3T9NA 2BS4A 4BBSM 3JCMb 4X9DA 4N0AC 2EQUA 1P92A 1QCFA 1KQ1A 2I40B 1H3HA 4IUVA 1NEBA 2J6OA 1WXBA 2P4RA 4BE2A 2VXFA 2C4GB 3OYGA 4IIMA 4CC2A 4OGCA 3MEVA 1W2BS 4C5IA 4JX4A 2DMEA 3BFMA 2X51A 1ZSZC 1X27A 4JS4A 2HSPA 1QVFA 2O01E 1M3CA 2OTLQ 2MIOA 4A54A 2LJ3A 2C0IA 2IVWA 5KE3A 1VQLT 1NEGA 1ZA1B 3CD6T 3M55A 4RODA 4IURA 1K9AA 2P0QA 1GBQA 3ASKA 3BLRB 3ER0A 4CFUD 4LNPA 3EFSA 3V8KA 2VGNA 2GGRA 3NMZC 1PD1A 2YRVA 1TG0A 5GAMe 1YJ9Q 4KBMB 1NM7A 1JJ2P 2JT4A 3UWNA 4IIOA 1G3WA 2QASA 2VB6A 4XU2A 1QVPA 2FB7A 2C0TA 3UA7A 3OW2P 3VS5A 3I56Q 4AG1C 4M75F 2J6FA 1YBYA 4M7AB 1WQWA 1VQ7Q 1WHMA 2VC8A 1Z9QA 2VXEA 5A0GA 2VVKA 1VIFA 2EBPA 1M8MA 3VS0A 2IVXA 4LXCA 2CYZB 4XK8E 1AEYA 4V2SA 2DAQA 1CSKA 2A28A 4J9DA 1RAEB 3G33B 4HCCA 2QEXA 2CSIA 5HVYB 3LYIA 1PWTA 1OZ3A 4C92G 4UN0A 2J6KA 2NYSA 1WIEA 1O9KB 5LJ5f 5BNJB 1U1TA 1YJWQ 1K4US 4JLGA 2KDSA 3L2WA 2C5NB 3JCMh 2CZ1B 2FPEA 2EW3A 3HRSA 1VQKT 3RBBB 3VJPA 5GAOp 7AT1B 4XTUA 1PD0A 1O9SA 1LPLA 1RI9A 1O9KA 3DOGB 3G6EA 3CC2T 2ZZDB 2DL4A 4E7ZA 4MDWA 4O6JA 1TSFA 3VKHA 2M02A 2JM9A 3CPWS 4CRIA 2RHZA 3MY5B 2QQSA 3MI9B 3PMIA 3H0HA 1JRIA 5LL6S 3GOXA 1NPPA 2LVMA 1N6AA 5GMKj 3GP8A 2X4WA 4M7DG 5GAMh 2LQKA 5I5ZB 3TQ7P 1I0CA 2QF7A 4N4IA 3E2UA 5KYUA 2D8HA 1I8FA 2EKHA 1YI2A 1N8RC 4HNTA 3JCMg 3RKXA 3A8HB 2M51A 1Q86C 2D0NA 2X3XD 2QYZA 4EMKB 3OY9A 2J7IA 1D1AA 3JSCA 3M54A 3GNGA 3JB9D 1T0HA 4JJDA 3L2UA 3WVEB 1AWXA 1WI7A 3S3OA 1ZHIA 2HKNA 2RN8A 1KSWA 2ZPIB 3BHVB 2MCNA 1NLOC 2DXTA 2RQWA 2YXYA 4JLIA 1XTDA 5ICPB 4M75E 2E3HA 3H9NA 2FPDA 1QVFS 1GL5A 4HCZA 1Q82U 2V26A 1VQPA 3RUXA 2E4HA 3TN8B 3D7SB 3GNFB 2FZCB 3OBWA 1OI1A 2KAFA 3EHQA 3TSZA 4OMQA 3G4ST 4YC3B 4J83A 4O5VA 2HD0A 1QKXA 1WJRA 2VGMA 1H25B 5GMKi 3BDUA 1VQ9A 5CCAA 3L2QA 1AZGB 4DBRA 1VQPT 1B3QA 1QVGS 2X1NB 4Q5WA 4FT4A 2OTJQ 2QTXA 3CMAT 2K6DA 1TD6A 2KNBB 3Q1JA 4PJJA 1YJWA 4LDYA 1XO2A 3P8DA 1FWZA 3JV3A 2W10A 2PVDB 3JCMf 2L3RA 4J7FA 2AZVA 4FYWB 5GJVB 4A4HA 2DD5B 3CXCP 4DQ2A 1BI2A 2HAXA 1PRLC 3RNJA 2IG0A 4KRCB 2D8JA 2E41A 3CCUA 3X26B 4C0FA 3KHIA 1WA7A 5KYYA 3CC4A 4F7JB 3K7AM 3TVTA 2CREA 2WFYB 1YWPA 1K9MC 4A4FA 4J9FA 5CKHA 2KI7A 4JRIA 4M7DC 1JSTB 1VQ4T 4IMYB 3MIAB 1X2KA 1IRXA 1H28B 3CC4T 3A5ZB 2FO0A 3UA6A 4J5YA 3BG5A 4EOJB 2EYQA 1D1CA 5GAMj 1WLPB 2DJQA 1GCQA 2HDAA 1MV0B 4C8QG 2EGEA 4QVCA 2BE9B 4BE1A 1Q7YU 1U5SA 2EYZA 1M9SA 1VQMA 2JTEA 4UC4A 2KT8A 1RAIB 4HNUA 1W6XA 3JB9F 1TFBA 4PJOD 2ED0A 3TSWA 1ZX6A 5IN1A 4DEXA 3CCQQ 3OYBA 2WIPB 2DL3A 2K5IA 1Q86U 4M77C 4BY7X 1YCSB 5LJ5d 2RHUA 1VQ8T 4PJOA 1K1ZA 1HSQA 2LX9A 4YTLA 1VYUA 2OTLA 5IHIA 1OI9B 3JCMW 5GAMf 4BD3A 1IGUA 1MMAA 1SRMA 3VYGB 3MHXA 2RI3A 2ED1A 1PSEA 4M7DF 2KYMA 1OKWB 1VQ8A 4FSSA 2KVQG 1TWBA 3QO3A 3OB9A 5GMKh 2EJGA 3QG1A 4M78A 4BDZA 1KHIA 3EFOB 1GXIE 2MYSA 1ZLMA 4KH1B 2V8JA 5FWBA 4IUTA 3CCUQ 4RTZA 5GANd 4Z8AA 3OS5A 3QZ9B 1JB0E 3M4GA 4C92D 3GF5A 2NUTA 4KUDK 1AZEA 4M7DB 1A0NB 4PNOA 1G83A 1LNXA 2JS2A 1M4ZA 4RTXA 5EG2A 2O2OA 2XICA 1X75C 3PMTA 3OYKA 1UE9A 4QKUA 3PIPA 1FMWA 1Y7XA 4BI8B 4C8QA 2GQVA 1X6GA 5M9OA 1J3TA 1GUXB 4Z88A 4ORZA 4ELLA 5FU6C 4EMHA 5LJ3g 4M75C 2DBMA 1QWEA 3NPFA 1OX9A 4FU6A 2E1HA 4QQGA 1IB8A 3VKGA 1BI1A 2CP5A 2QG9B 4B6MA 1MGQA 4TVRA 4BB7A 2F69A 1D0XA 2RQTA 3HHTB 2LCSA 2LCCA 3CCVA 3BW1A 3G71Q 5FRMA 2RQUA 1GRIA 4E47A 3SWNC 4LUDA 2F5TX 2HQHA 3M5AA 1UGVA 2G9XB 3EGUA 1BU2A 5HK0A 1KQSS 2QQ9A 3EGXB 1YJNA 1ARKA 1TUDA 2E5KA 2LQWA 3CCJA 4BDYA 2DD4B 3CPWP 2PTKA 1N5ZA 1VIEA 2PMIB 1JXOA 1RAGB 2NLUA 1OIYB 2LQNA 4AFUC 2MPXC 2PHGA 2KRMA 4JPBW 1M30A 1N8RU 3OMGA 4JZ4A 2COWA 4F7SB 2EJ9A 4M78G 2HL5C 2QQRA 2JMCA 1RADB 3MEAA 5GMKl 4FL6A 1D0ZA 4ZN3A 1UDLA 5GAOm 2QQ8A 2M9UA 4L5GA 2FRWA 2K2VA 4KH0B 4PJNA 1NYFA 5HBHB 1U3OA 4AFSC 3ME9A 1EX4A 3DB3A 1RAFB 1Y07A
chains in the Genus database with same CATH topology
1QP3A 3M59A 3BY7A 5C0MA 1RI0A 2DKGA 2LQ8A 5CAIA 2DJZA 4FT2A 3TCJA 1VQMT 1K73U 4PJOC 2HNIA 3RESA 4A4KA 3T9NA 2BS4A 3X25B 4BBSM 5LJ3e 4QSHA 3JCMb 3CPFA 4X9DA 5CIUA 4N0AC 2EQUA 2E70A 2DXUA 4GY5A 1X6OA 1P92A 4LDUA 4OP0A 5CKEA 2XDDA 4B9XA 3CCQA 1KQ1A 2LT4A 2E12A 1W4SA 1VQNA 2XDPA 4IUVA 3GPLA 4BACA 4MDXA 4BE2A 2VXFA 2GFAA 3G4SA 2ZPFB 2CZ6B 1KC8U 1WGSA 3OYGA 4JS5A 4X9CA 4F7UB 4KT0E 3MEVA 4OGCA 3DLLA 4DOWA 1W2BS 4J6YA 3DKMA 2ZPBB 2JZ2A 3HPWA 1BYMA 4ZGJB 2G3RA 4JX4A 4J6WA 3BFMA 5CQXA 3RKYA 3HL8A 2KK4A 3QBYA 4C5IA 2X4YA 3QHSA 4QVZA 3V8LA 2E5QA 2EQJA 2K57A 2OTJA 3C12A 4XU3A 1WQ7A 5FLXE 3HRUA 5LJ3d 4JS4A 1VQOA 1QVFA 2RD1A 2O01E 3RKWA 2KQWA 3G71A 1KQ2A 4PLIA 4A54A 3JAME 2IVWA 2XK0A 5KE3A 1H641 4A53A 4MFDA 5GAN4 4QW2A 2H3JA 3M55A 3H4CA 3FIFA 3CD6T 4MMLA 2CZ0B 4JUVA 3M4YA 4IURA 4EPCA 4XTXA 4HT9A 5GAMd 3CC7T 3VYHB 4IUPA 3TEEA 2EQKA 2FYKA 2P0QA 3META 4HT8A 3ASKA 2M0OA 3ER0A 1W2BA 1D3BA 4Y28E 3FC3A 3EFSA 2JUFA 3V8KA 2VGNA 2MF2A 2DIGA 3A8OB 3JCMP 1FKMA 1YI2T 3SWNA 2YRVA 3QYEA 2KR6A 2RB6A 5GAMe 4ZGDB 4KBMB 3J80E 3OA6A 4ZGEB 1VQLA 2K3YA 2EAYA 3UWNA 2PVGB 3OYHA 3E19A 1G3WA 3CCMT 4BI3A 5A2QE 4XU2A 4NC6A 5DM7R 5GAN5 1QVPA 3HFNA 2K3XA 2FB7A 1YHQT 2YHTA 5I21A 3ZBDA 4OB0B 1NE8A 3OSSC 1UGSB 2P0PA 4M75F 5CKFA 1YBYA 4M7AB 3LWHA 1YIJT 1WQWA 3CMAA 3OQ5A 4JRQA 1PSFA 2MMPA 2QXFA 3F70A 5HK3A 2VC8A 4PJOG 2OTJT 2EJFA 4JRKA 2VXEA 5A0GA 5KE2A 2RA2A 3JCMd 3V7RA 1FX7A 1VIFA 5GAOq 1ZBXA 4M78B 5GAMg 1KQSA 1S72T 2CYZB 1EIFA 4XK8E 1V29B 1BIAA 5LJ5j 3LWIA 2PU9B 4E7IA 4OVAA 3QWLA 2DAQA 2PUKB 1YITT 4V2SA 2K5LA 4ZN1A 3KXTA 2X4XA 2B8AA 4HCCA 4PJOF 4OF1A 3H6ZA 3RIRA 4C8QA 2QEXA 5LJ5g 5GANj 1YIJA 3FEOA 2LNVA 3LH0A 3LYIA 3OSVA 1OZ3A 4HNVA 5FU6B 4C92G 4IUUA 2RM4A 3LX7A 1K8AC 5LJ5f 3GIBA 1JJ2S 3MO8A 1U1TA 3URGA 2ZZDA 4JLGA 4FM4B 2KDSA 3L2WA 3S6WA 5A0LA 5LJ5h 2JN0A 3JCMh 2CZ1B 3CCVT 1VQ9T 1M5Q1 3HRSA 1AHJB 3BG9A 2K5FA 4E7KA 4PKCC 3OBYA 1VQKT 3E9GA 3MP8A 3VJPA 4M7AD 4EMKC 5GAOp 2LTOA 3MP1A 2OAUA 4AKGA 2XKOC 4XTUA 2R58A 2R57A 1RL2A 5GMKm 4B9WA 2KMGA 1O9SA 2DEQA 3M58A 4XTWA 2Y4XA 4D6WA 4XAXB 3G6EA 4Z6YA 2E6ZA 3CC2T 4RMOA 2ZZDB 3HFOA 1KG1A 4ELJA 1O75A 2EIFA 2HQXA 2MI6A 4MDWA 4O6JA 2XDBA 5GAN2 3CEYA 3VKHA 2RJDA 3CBPA 4PLLA 3V7SA 3CPWS 4CRIA 2RHZA 1OZ2A 2FL7A 2QQSA 4AKIA 3CD6A 2VYTA 3JCMQ 3PMIA 4M7DE 3GOXA 1JRIA 5LL6S 2ZCFB 1G5VA 2G77A 1NPPA 1UGRB 2LVMA 1N6AA 3JRZA 3NFCA 1UB4A 5GMKj 5GANg 4M77E 4AI6A 3GP8A 4M7AF 2X4WA 2E65A 4WF2A 4LD6A 4M7DG 5GAMh 2LQKA 1N27A 4BUGA 2QQBA 4FIBA 2PQWA 2QF7A 4N4IA 4JJNK 2PUOB 3MP6A 2A7YA 4E7JA 5FRNA 1I8FA 4MMKA 1YI2A 1N8RC 2QFZA 4HNTA 3NTHA 4N4GA 1M1FA 3JCMg 3QJYA 1VUBA 2QI2A 2DZ9A 4MZTA 4P5NA 3RKXA 4LDXA 1YJNT 3A8HB 2DVEA 2AHJB 1Q86C 2EKOA 3CCJT 4QVDA 4CI0C 2R5AA 3H8ZA 2LDMA 2E64A 3LW5E 2L8DA 3L2VA 4EMKB 3OY9A 5IT9E 2RI5A 3JSCA 3JCMe 3M54A 2QA4A 3GNGA 3JB9D 1VQ6A 3L2UA 3WVEB 4J8OA 3S3OA 1M1KC 1ZHIA 5L8RE 3LLRA 2LCLA 3I55A 3C4SA 1JJ2A 3I56T 2ZPIB 3HZJA 2XI9A 2DXTA 4LDWA 4ELYC 3TW6A 4JDSA 4JLIA 1WJSA 4M77B 1XTDA 3QDRB 3SD4A 1VQ7T 1UGQB 3OW2A 4M75B 3LGFA 1Y96A 3CBOA 4A4GA 2EWNA 4M75E 4C0DB 3V7CA 1QVFS 3QUIA 4ATOA 1LJOA 2O4XB 4HCZA 1Q82U 5DLOA 1VQ5A 5EJCA 1VQPA 3CCET 3KBGA 2JOYA 3M53A 5GAOn 2FHDA 3RUXA 4EMGA 4ZTJA 3VYGA 3HKSA 1YJ9T 3GNFB 4M78E 3OBWA 1OI1A 4RKUE 5LJ5e 1Q82C 3MEUA 2KAFA 4F7UE 5J39A 3OYDA 2M16A 3PTAA 4BE0A 1DJ7B 4JRPA 5KCHA 3G4ST 1BI0A 2DXCA 4DA4A 1IZ6A 4J83A 2RI2A 4M75A 2HD0A 2Y4YA 4O5VA 3VV0A 1WJRA 2VGMA 3A8MB 3P8BB 3PFSA 3BDUA 4Z02A 5GMKi 1TH7A 1G3TA 4N0AA 5CCAA 3OS0A 2VUBA 3L2QA 4QQ6A 1VQPT 1QVGS 4Q5WA 4C8QD 4FT4A 3RERA 2QTXA 5IAYA 4M7AE 3CMAT 4M7AA 1VQ9A 3Q1JA 3FDRA 5D6YA 4LDYA 4A4EA 1YJWA 1FWZA 3P8DA 4MFEA 5CK9A 2PVDB 3KUFA 3JCMf 4ELZC 2L3RA 3N5BB 4J7FA 3BDLA 3OYNA 2D6FA 2EQMA 3UT1A 3L2ZA 3SDZA 4A4HA 2DD5B 3CMEA 5CKBA 2RK2A 5GAN6 4DQ2A 3FLGA 4NOYA 3QXEB 4PL6A 5GAN8 1BI2A 2HAXA 3BG3A 1I4K1 2RH2A 4HKEA 3CCMA 3AHUA 4F7UF 3ZEHA 1M90C 3QYHB 2IG0A 1UEBA 3M57A 2E41A 2CZ7B 1M1KU 4IKFA 5GAN7 3CCUA 3X26B 3CCEA 4C0FA 3KHIA 3CC4A 3A8GB 1YJ9A 2DXBB 1BIBA 2RHXA 1NJIC 1K9MC 4A4FA 3CMET 5CKHA 5I2MA 5HKCA 2QDJA 5FU7C 3JCMX 1X01A 3M9QA 4JRIA 1KD1C 4M7DC 3TREA 1VQKA 4FSXA 1YHQA 1M8VA 3OYEA 1VQ4T 3HSBA 4OMFB 3CCSA 2OTLT 1KHCA 4BDZA 4N4HA 3QYBA 1SSFA 4LOCA 3CC4T 1WPYA 3A5ZB 1HK9A 4J6XA 3FJPA 4J5YA 1VQLT 4C0ZA 3BG5A 3PGGA 4M78D 1MHNA 4C8QC 4R56A 2EYQA 2DXBA 3JCMJ 3P8HA 3I55T 4C92B 2KMTA 1NZ9A 3SWNB 5GAMj 2RJFA 3QIIA 4RCCA 2GCXA 1KD1U 3SFMA 3VUZA 3UPUA 4C8QG 3CCLA 4F7UA 4BY6C 2QQAA 2BS2A 1NJIU 4L6V5 4QVCA 2D9TA 5KH6A 4M78F 4BE1A 1Q7YU 2YLBA 1XOVA 4C8QE 2WSCE 3LGLA 1VQ5T 1M9SA 1NPRA 2L5QA 2GF7A 3NTIA 5AYFA 1QVGA 4M77F 3OW2S 2F5KA 3HRTA 1VQMA 4UC4A 4HCBA 2BKDN 4HNUA 3JB9F 3JB9H 4PJOD 1QW1A 2YLCA 2ZGWA 4MZMA 5GAOr 4XU1A 5GAOl 3CCRT 3E1SA 4OGEA 2MAMA 5IN1A 4OB2B 1BI3A 2RHYA 4RG2A 5LJ3h 3OYBA 3CXCS 1Q7YC 3X20B 3OYIA 5D6XA 5CVIA 3MCAB 2QA4T 2V8KA 2K5IA 4NL3A 1Q86U 4M77C 4C0DC 4ZTFA 5D6WA 1K9MU 5GMKe 4QQDA 3CCQT 5LJ5d 2RHUA 3VKIA 1R8OB 2KSSA 4M77D 1VQNT 5C6SA 3CCRA 3V8JA 1VQ8T 4PJOA 3CPWA 1H3ZA 2LX9A 4C5GA 4YTLA 2BUDA 3DL1A 5I2SA 1I5LA 2P4TA 1Y96B 4JX5A 3HP9A 5GAN3 2FVUA 3G71T 3CCST 2OTLA 2DD4A 4E7HA 4C8QF 3X28B 4HL4A 2DK3A 3DB4A 3JCMW 3O8VA 5GAMf 4DOVA 5J3BA 3CCLT 4BD3A 5DLQE 2E10A 3C94A 3L42A 2V8IA 3MEWA 3VYGB 3MHXA 2Y90A 2RI3A 3VUBA 4R55A 2XHCA 3OYMA 3CCUT 3EAEA 1JBMA 1PSEA 3NTKA 1VQ6T 4M7DF 4C92F 1VQ8A 4OB1B 4M7AG 1B34B 2KVQG 2DO3A 3QO3A 5A0DA 3OB9A 4E7LA 5GMKh 2BIVA 2EJGA 3QG1A 4M78A 3VU3C 5CR2A 3WVDB 3X24B 1KHIA 1XQHA 2HBPA 3R6OA 3HO8A 3JB9I 1GXIE 4J7IA 3M56A 4XTZA 2V8JA 3OYYA 3S3MA 4IUTA 3JB9J 5GANd 4JX6A 2VV5A 4RG8A 3OS5A 3QZ9B 1JB0E 2RK1A 4LD9K 3QYGB 3C95A 3M4GA 5CKDA 3OYFA 5FU7B 1UGPB 4C92D 3GF5A 4XQ3A 1YJWT 4KUDK 4M7DB 1WNLA 5GANh 4PNOA 3OYAA 1LNXA 2DZCA 2WACA 1M4ZA 3RMQA 1U1SA 5EG2A 4M6VA 3QZ5B 1N9SA 2DIQA 2BS3A 3A8LB 3HBLA 3OYJA 2XICA 1X75C 4M75G 3OS2A 1E7PA 2DD5A 2GFUA 2JVVA 3PMTA 3ZFJA 5LJ3j 3QJ6A 5KCOA 3OYKA 3PIPA 2RJCA 1Y7XA 4X34A 2K4YA 4BI8B 4XU0A 4OB3B 2GQVA 1IREB 1FXXA 2P0KA 3PT9A 5M9OA 5GANf 2XU8A 3J81E 3E9FA 1G3SA 5FU6C 4EMHA 5LJ3g 4HLQA 2WJ9A 4M75C 4VUBA 2JTFA 4XTVA 5CO7A 4EMKA 1K73C 4M7DA 3OYCA 1WJQA 1ZQ1A 2I2LA 4PJOE 3EFRA 1D3BB 3OMCA 5LJ3f 2QEXT 3G6ET 4FU6A 4BY6B 2KY9A 2E1HA 4QQGA 3TW7A 2E6NA 3VKGA 2LRQA 2MWOA 1BI1A 3DLMA 4M77G 3WXMB 2ZPGB 3HB9A 5DY9A 1YCYA 3CBMA 1MGQA 5HY6A 4TVRA 3RMSA 4BB7A 2L89A 3L1AA 2F69A 4C8QB 1QP2A 3HHTB 3GLXA 1VQ4A 2PVOB 2XIDA 2LCCA 1G3YA 3CCVA 2ZPEB 2M1HA 3BW1A 5FRMA 2MWPA 4L59A 4E47A 1U8RA 3SWNC 5FROA 2F5TX 2DTOA 2HQEA 3OS1A 4C0GA 5CQYA 3M5AA 3SB2A 4NL2A 4LDVA 4RCBA 4C5EA 2DTHA 3L2RA 3FB9A 1VQOT 3JCMV 2X4JA 1M90U 2QDYB 4C92A 3OYLA 3JCMc 5HK0A 1KQSS 3J7AF 2LT1A 4EDUA 2QQ9A 3CC2A 4MZPA 5GANe 1YJNA 4KULA 4C5HA 4M7AC 1XNIA 4HA8A 4BI4A 2WSFE 3CCJA 4BDYA 2DD4B 2X35A 3QPHA 3CC7A 1I81A 1VIEA 4II1A 2R5MA 1Y71A 3G7ZA 1KC8C 2RJEA 2EFIA 2NLUA 3QKJA 4Y91A 3JB9G 2A3LA 2ZPHB 1Q81C 3PIOA 1M1GA 3I56A 1N8RU 3OMGA 1LOJA 3S3NA 1QLBA 3QSUA 1B34A 2RHIA 2EJ9A 4NS5A 4MIMA 4M78G 4KUIA 2DTIA 1VQ7A 4M77A 3INZA 2QQRA 4F7UG 4BBRM 3MEAA 2C06A 5GMKl 4M75D 4FL6A 2XD0A 2JNGA 2O4XA 4XTYA 4ME7A 4ZN3A 4GLKA 2CS7A 3CXCA 2CKKA 2D0QB 4C92E 5GAOm 4M78C 2QQ8A 4M7DD 3PNWC 1Q81U 2M9UA 1OYXA 2RO0A 3TU4K 4L5GA 1BKBA 2WSEE 2K2VA 3UDCA 2JTMA 1K8AU 2CGHA 2DPPB 4PJOB 1YITA 1HXDA 2DXCB 4IUQA 2LC4A 3ME9A 1S72A 1N9RA 3FRNA 3DB3A 2XG8D 4AKHA 5J26A 4C92C 1Y07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP3 A;  3QZ9 B;  1JB0 E;  3QYG B;  3QYH B;  1UGP B;  2CZ7 B;  3X26 B;  3X25 B;  3A8G B;  2DXB B;  3QZ5 B;  2ZZD B;  3A8L B;  2DD5 A;  2ZPF B;  2CZ6 B;  4OB3 B;  1IRE B;  4KT0 E;  2ZPB B;  2ZCF B;  1UGR B;  4ZGJ B;  2DXB A;  2PUO B;  2O01 E;  2ZPG B;  1QP2 A;  3A8H B;  3HHT B;  2AHJ B;  2PVO B;  2ZPE B;  2CZ0 B;  4L6V 5;  3LW5 E;  3VYH B;  2WSC E;  3WVE B;  4Y28 E;  5L8R E;  3A8O B;  2QDY B;  2ZPI B;  4ZGD B;  4ZGE B;  4OB2 B;  2PVG B;  1UGQ B;  2WSF E;  2DD4 B;  3X20 B;  4OB0 B;  1UGS B;  3VYG A;  2ZPH B;  1PSF A;  4RKU E;  1DJ7 B;  2DXC A;  2CYZ B;  4XK8 E;  3A8M B;  1V29 B;  2DD4 A;  3X28 B;  2PU9 B;  2PUK B;  2D0Q B;  3VYG B;  2WSE E;  1PSE A;  2PVD B;  4OB1 B;  2DPP B;  2ZZD A;  2DXC B;  4FM4 B;  2DD5 B;  3WVD B;  2CZ1 B;  3X24 B;  1GXI E;  1AHJ B;  3QXE B; 
#chains in the Genus database with same CATH topology
 1H26 B;  3AT1 B;  1SEM A;  1RI0 A;  2DKG A;  1RUW A;  2LQ8 A;  3VRZ A;  2DJZ A;  4FT2 A;  4KRT A;  1K73 U;  3RES A;  1VQ5 Q;  5CIU A;  2UZB B;  2E70 A;  4LDU A;  1X6O A;  2OX7 A;  4OP0 A;  5CKE A;  1PNJ A;  2DL8 A;  2LT4 A;  2XDP A;  4MDX A;  2ZPF B;  4JS5 A;  4KT0 E;  3DLL A;  2O31 A;  1NLP C;  3HPW A;  5FWC A;  2G3R A;  4J6W A;  3HL8 A;  2KK4 A;  3QBY A;  3QHS A;  1UNG D;  2K57 A;  3EG2 A;  4XU3 A;  5IXF A;  1WQ7 A;  3HRU A;  1VQO A;  3RKW A;  2KQW A;  3G71 A;  2JM8 A;  2XK0 A;  4A53 A;  4AFZ C;  3DJB A;  4M4Z A;  3H4C A;  1NJI R;  4HT9 A;  1GH6 B;  1ZSZ B;  4IUP A;  3TEE A;  2EQK A;  2FYK A;  2H3E B;  3EID B;  3FC3 A;  1Y0M A;  3CC2 Q;  2MF2 A;  3CCE Q;  1YI2 T;  3RDV A;  4OMP A;  4ZGD B;  3CC7 Q;  1VQL A;  1FMK A;  2PVG B;  3OYH A;  4BI3 A;  2KR3 A;  2K3X A;  1YHQ T;  2YHT A;  5I21 A;  1VQK Q;  4OB0 B;  2A0F B;  1NE8 A;  1GBR A;  3OSS C;  4Y92 A;  2CCH B;  5CKF A;  4OML A;  1OL1 B;  3LWH A;  1YIJ T;  3CMA A;  3OQ5 A;  1PSF A;  4EOQ B;  2QXF A;  2LNH B;  2JXB A;  1UEC A;  2EJF A;  3DTO A;  1ACM B;  1SHF A;  4GLM A;  2RA2 A;  3JCM d;  2BZ8 A;  1ZBX A;  2GTJ A;  2KGT A;  5LJ5 j;  1T3S A;  3LWI A;  2C0O A;  2PUK B;  1XJW B;  2B8A A;  4PJO F;  2L3S A;  3RIR A;  1ZBJ A;  1YIJ A;  2CP3 A;  1QKW A;  2LNV A;  3LH0 A;  3QWY A;  4RUG A;  1WHL A;  3OSV A;  2RM4 A;  3LX7 A;  2F1L A;  1JJ2 S;  3MO8 A;  1VQM Q;  4FM4 B;  4G6L B;  3THK A;  5A0L A;  4FYX B;  3CCV T;  1M5Q 1;  2K3B A;  1YP5 A;  3MP8 A;  1UJ0 A;  2OAU A;  4AKG A;  4EC9 B;  2F2C A;  1RL2 A;  2R57 A;  4PFZ A;  5GMK m;  4QT7 A;  1C6V X;  1IHW A;  4LUE A;  1KG1 A;  3HFO A;  1IGQ A;  2KT1 A;  3VS1 A;  2EIF A;  1W1F A;  4EC8 B;  1ZA2 B;  2CP0 A;  4AKI A;  2UUE B;  1UGR B;  3NFC A;  2SRC A;  4AI6 A;  4BUG A;  1LCK A;  3MKD A;  2QGF B;  4FIB A;  1PM3 A;  4E7J A;  3M0P A;  5FRN A;  3NTH A;  4N4G A;  1VQ8 Q;  5ACB A;  1M1F A;  3QJY A;  2DZ9 A;  4MZT A;  4P5N A;  2K7A A;  4BCM B;  2AHJ B;  5FW9 A;  2EKO A;  1M2V B;  4CI0 C;  1ZUK A;  1BCO A;  1YIT Q;  3LLR A;  3C4S A;  1JJ2 A;  3NDQ A;  3HZJ A;  2XI9 A;  4ELY C;  3QDF A;  1WJS A;  3TNW B;  3SD4 A;  3I5S A;  4AFQ C;  1SSH A;  3QUI A;  4ATO A;  2O4X B;  1S1N A;  1KFZ A;  2PZ1 A;  5EJC A;  3KBG A;  4J9C A;  2FHD A;  4RTW A;  5IF1 B;  1VYV A;  3HKS A;  1YJ9 T;  4M78 E;  4F7N B;  1VYW B;  1QCN A;  3OYD A;  5KCH A;  1IZ6 A;  3EHR A;  3M03 A;  4M75 A;  2KBT A;  3VV0 A;  5CK9 A;  2OI3 A;  3OS0 A;  2VUB A;  4CFV B;  1X2Q A;  2CUB A;  2WEV B;  4C8Q D;  1QWF A;  4M7A E;  5D6Y A;  3FJ5 A;  4MFE A;  3KUF A;  3N5B B;  3TNH B;  3OYN A;  1JU5 C;  2EQM A;  2FPF A;  1X43 A;  5ECA A;  5CKB A;  3KFV A;  2RK2 A;  3FLG A;  1JSU B;  1UHF A;  3BG3 A;  1I4K 1;  4ZNX A;  1SKU B;  4F7U F;  2YT6 A;  1M1K U;  1M1K R;  3ZL7 C;  2RQV A;  1YJ9 A;  1WDX A;  5HBE B;  2QDJ A;  4HCK A;  2V22 B;  1V76 A;  3TRE A;  1G3N C;  3VS3 A;  1M8V A;  3QYB A;  2FZG B;  1GFD A;  1H1Q B;  4J6X A;  5KYY B;  3FJP A;  2PNI A;  2MK5 A;  4C8Q C;  4R56 A;  1MHN A;  2DXB A;  1W70 A;  3P8H A;  2GBQ A;  3I55 T;  2BKZ B;  1MNE A;  3UAT A;  1BU1 A;  1QLY A;  2RJF A;  3QII A;  4RCC A;  2D9T A;  2YLB A;  2NWM A;  4C8Q E;  2WSC E;  1VQ5 T;  2L5Q A;  2GF7 A;  4M77 F;  1VYT A;  2DM1 A;  2BKD N;  3JB9 H;  1W98 B;  1QW1 A;  3VS7 A;  5FGK B;  5GAO l;  3CCR T;  3E1S A;  1CKB A;  4OB2 B;  1YN8 A;  1PKT A;  1BI3 A;  2RHY A;  5LJ3 h;  3LH5 A;  4E6R A;  5IHN A;  3MCA B;  2QA4 T;  2V8K A;  5HQ0 B;  4C0D C;  1RLP C;  3CCQ T;  1TOV A;  2IW8 B;  2KSS A;  4M77 D;  3A1P A;  1OX8 A;  2DF6 A;  3V8J A;  3CCR A;  3M0R A;  2V1Q A;  1I5L A;  2P4T A;  4JX5 A;  3MPU B;  3X28 B;  4HL4 A;  2F2W A;  3O8V A;  4I3Z B;  1VIN A;  4CFW B;  1TTH B;  1MMD A;  2SEM A;  2V8I A;  3MEW A;  1C1A A;  2Y90 A;  2XHC A;  3MY1 B;  1JBM A;  1YI2 Q;  4C92 F;  1YNZ A;  2DO3 A;  4E7L A;  3VU3 C;  4FCY A;  3WVD B;  2HBP A;  3HO8 A;  4J7I A;  3S3M A;  1VQL Q;  2VV5 A;  4LD9 K;  3C95 A;  2W9Z A;  1UGP B;  2G6F X;  1WNL A;  3BHT B;  3OYA A;  2DZC A;  2CDT A;  3MJX A;  3F5X B;  2COZ A;  1URC B;  3HBL A;  3OYJ A;  4M75 G;  2GFU A;  2JVV A;  1GFC A;  3ZFJ A;  4HXJ A;  2QGS A;  2QDL A;  2JGZ B;  5CYI B;  2K4Y A;  2A08 A;  4OB3 B;  1IRE B;  1WYX A;  5IHY A;  1PG5 B;  4EMK A;  4XTV A;  2JTF A;  4KGV B;  2J06 A;  4M7D A;  2I2L A;  1I07 A;  3OMC A;  4RTU A;  4DBQ A;  3M0S A;  2KY9 A;  2E6N A;  3DLM A;  2LRQ A;  3WXM B;  1UTI A;  1H8K A;  2ZPG B;  3HB9 A;  3RMS A;  1VQ9 Q;  1R77 A;  2HSE B;  4C8Q B;  1IO6 A;  2WMB B;  4BCH B;  2ESW A;  2PVO B;  2AT1 B;  2M1H A;  2MWP A;  4EOO B;  2R7G A;  4L59 A;  1B7T A;  1RAH B;  2DTO A;  4NL2 A;  1RAA B;  3FB9 A;  1VQO T;  3JCM V;  2X4J A;  2DFU A;  2Z0W A;  2YUO A;  4EDU A;  4M7A C;  5AT1 B;  2AIR B;  1Q81 R;  1W2B P;  1G2B A;  3G7Z A;  4Y91 A;  5KYW B;  2ZPH B;  2KRS A;  3I56 A;  4EON B;  3B57 A;  3S3N A;  2EGA A;  1QLB A;  1E9H B;  2RHI A;  2QAZ A;  1G8X A;  1VQ7 A;  4M77 A;  2C06 A;  1SHG A;  4CFM B;  2X9H A;  4XTY A;  9ATC B;  2CS7 A;  2CKK A;  1NBE B;  2D0Q B;  3EH2 A;  4J9I A;  3REB B;  3PNW C;  1Q81 U;  3TU4 K;  1BKB A;  2VKN A;  3BHU B;  2CUD A;  1K8A U;  2QEX Q;  2CGH A;  1JO8 A;  5HNB B;  3M0T A;  1YIT A;  1X69 A;  1K9M R;  1VOM A;  2DXC B;  2LC4 A;  3I55 Q;  3CCL Q;  4EOK B;  3FRN A;  2XG8 D;  1HD3 A;  1RAB B;  3BY7 A;  3M0U A;  1WZO A;  2IW6 B;  2BZX A;  1VQM T;  3TCJ A;  4A4K A;  1H1P B;  2KRO A;  4GY5 A;  3BLH B;  3CCQ A;  3PVQ A;  4B9X A;  5IHK A;  2E12 A;  1W4S A;  5DQW A;  4BAC A;  3G6E Q;  2GFA A;  2CZ6 B;  3NHN A;  1KC8 U;  1WGS A;  2L3Q A;  2ZPB B;  2JZ2 A;  1BYM A;  4ZGJ B;  3RKY A;  5CQX A;  2AK5 A;  2X4Y A;  3V8L A;  4QVZ A;  2E5Q A;  3C12 A;  4CC3 A;  1AD5 A;  1TU0 B;  5FLX E;  5LJ3 d;  4JJC A;  8ATC B;  4PLI A;  3JAM E;  1UG1 A;  1KD1 R;  4QW2 A;  3FIF A;  1GUX A;  2LW4 A;  3VS4 A;  2IPO B;  2KYB A;  3CC7 T;  2ZAE A;  3VYH B;  3MET A;  3CCM Q;  2M0O A;  2LZ6 B;  4F04 B;  1D3B A;  2JUF A;  2QA4 Q;  3JCM P;  3SWN A;  2XMF A;  3J80 E;  4ZGE B;  2K3Y A;  3EG3 A;  5A2Q E;  1MUZ A;  5DM7 R;  5GAN 5;  3HFN A;  4BCK B;  2ATC B;  1K76 A;  2WIH B;  2P0P A;  1GCQ C;  2ENM A;  4YOS A;  2RMO A;  1D09 B;  2DMO A;  4JRQ A;  1EFN A;  4PJO G;  3I35 A;  5GAO q;  1FX7 A;  5GAM g;  1KQS A;  1S72 T;  1UFF A;  1WHK A;  1V29 B;  1BIA A;  2PU9 B;  4E7I A;  1QQJ A;  3QWL A;  1RAC B;  1SRL A;  3KXT A;  1M3A A;  3H6Z A;  2AKK A;  2CH4 W;  2CT4 A;  5GAN j;  4EOI B;  3FEO A;  3C0C A;  4HNV A;  2OAW A;  3UF4 A;  2DL7 A;  1VQ9 T;  1AHJ B;  4E7K A;  4J9E A;  3OBY A;  1MMN A;  2LTO A;  3MP1 A;  2PK9 B;  4BCQ B;  1OV3 A;  2IIM A;  2KMG A;  1OGU B;  4D6W A;  3M58 A;  4XTW A;  4XAX B;  2K79 A;  3CC4 Q;  4ELJ A;  1O75 A;  2HQX A;  1UNL D;  1AWO A;  2NUZ A;  2RQR A;  1OZ2 A;  2FL7 A;  3CD6 A;  3JCM Q;  3EGD A;  2ZCF B;  2G77 A;  5GAN g;  1YHQ Q;  1OOT A;  1UB4 A;  2E65 A;  4WF2 A;  1N27 A;  2PQW A;  4JJN K;  4EOM B;  1WFW A;  3MP6 A;  2YWW A;  4MMK A;  3POM A;  1PKD B;  1VUB A;  2QI2 A;  4LDX A;  1D3U B;  1BB9 A;  1YJN T;  3PE0 A;  1WXT A;  3H8Z A;  4F16 A;  1M2O A;  2E64 A;  2L8D A;  3L2V A;  1SPK A;  2RI5 A;  1KXU A;  2QA4 A;  1Q95 G;  2YUN A;  1M1K C;  4DBF A;  2JW4 A;  2AZS A;  2CT3 A;  3EH1 A;  4J9H A;  4LDW A;  3TW6 A;  3QDR B;  4HCB A;  4PJM A;  1UGQ B;  4M75 B;  3LGF A;  1Y96 A;  2HZY A;  3CBO A;  4A4G A;  1ZSZ A;  1VQ5 A;  3CCE T;  3M53 A;  5GAO n;  4EMG A;  2B86 A;  3DDP B;  4HVW A;  4RKU E;  5LJ5 e;  5J39 A;  3PTA A;  4BE0 A;  4JRP A;  4CC7 A;  1TS9 A;  2W2H A;  1BI0 A;  2DXC A;  2EUF A;  2RI2 A;  4EMK C;  3PFS A;  3A8M B;  5IH2 A;  1TH7 A;  4N0A A;  1UHC A;  1Y57 A;  1E6H A;  3RER A;  4F6S B;  5IAY A;  1R0B G;  3FDR A;  4A4E A;  4ELZ C;  1QMC A;  4OMN A;  3CME A;  1OEB A;  3TNI B;  4PL6 A;  1E7O A;  4HKE A;  3AHU A;  3H41 A;  3ZEH A;  1M90 C;  1UEB A;  2CZ7 B;  4IKF A;  3CCE A;  1K73 R;  3EG0 A;  3A8G B;  4FW2 A;  2DXB B;  2BZY A;  1BBZ A;  4BCG B;  2YDL A;  2JJ9 A;  3CME T;  5HKC A;  5FU7 C;  1YWO A;  1N4M A;  1KD1 C;  4WTO B;  1VQK A;  1YHQ A;  2VAS A;  2A37 A;  4OMF B;  3CCS A;  1SSF A;  4LOC A;  3CMA Q;  1HK9 A;  2NUP B;  3PGG A;  3JCM J;  5LMK B;  4NST B;  1H27 B;  1NZ9 A;  3SWN B;  3QWX X;  1KD1 U;  3UPU A;  2CJM B;  3CCL A;  4F7U A;  2L0A A;  1S72 Q;  4BY6 C;  2BS2 A;  1NJI U;  3GTM S;  1QVG P;  4M78 F;  1OPL A;  1WXU A;  1U06 A;  1CKA A;  3NTI A;  5AYF A;  1QVG A;  3DDQ B;  1TXQ A;  5KYU B;  2ZGW A;  2LJ0 A;  2DYB A;  2K9G A;  2MAM A;  1BK2 A;  2YUP A;  2LX7 A;  2BE7 D;  3X20 B;  2YRD A;  4BXX X;  4NL3 A;  4F7L B;  5D6W A;  1K9M U;  2GTO A;  3VKI A;  1WHH A;  1I1J A;  4J9G A;  5C6S A;  5EFQ B;  2DL5 A;  1H3Z A;  4C5G A;  3U23 A;  3DL1 A;  1R0C B;  2FVU A;  2KXC A;  2JMA A;  5J3B A;  3CCL T;  3C94 A;  2HMA A;  4HVV A;  3VUB A;  3EAE A;  3NTK A;  1VA7 A;  2B9R A;  4OB1 B;  1KK7 A;  4M7A G;  1AWJ A;  5A0D A;  2DRM A;  1Z9Z A;  5CR2 A;  3JB9 I;  1XQH A;  2X3W D;  1UUE A;  1GY3 B;  3M56 A;  1JXM A;  1MMG A;  2L2P A;  4RG8 A;  2RK1 A;  3SHW A;  2FZK B;  3EGD B;  3OYF A;  1ZP2 A;  4XQ3 A;  1YJW T;  4DBH A;  2E3I A;  2EVR A;  2WAC A;  3RMQ A;  1LVK A;  3QZ5 B;  2DIQ A;  3OS2 A;  1E7P A;  3CCS Q;  5LJ3 j;  5KCO A;  2RJC A;  2DNU A;  4XU0 A;  2XU8 A;  3IQL A;  1G3S A;  2HL3 A;  4VUB A;  5CO7 A;  3NGP A;  3ULR B;  4LN2 A;  3OYC A;  4PJO E;  5KYN A;  3G6E T;  2MWO A;  1YCY A;  3CBM A;  1NG2 A;  2L89 A;  1VQO Q;  3GLX A;  3BLQ B;  1QP2 A;  5I11 A;  4BY1 X;  1VQ4 A;  2XID A;  1G3Y A;  4RTY A;  1SG5 A;  3OS1 A;  5CQY A;  4BCN D;  3SB2 A;  4LDV A;  4PJL A;  4C5E A;  3L2R A;  1M90 U;  2AKL A;  2QDY B;  3OYL A;  2W96 A;  3JCM c;  1QCO A;  2UZD B;  1PCX A;  2BTT A;  3CC2 A;  2DBK A;  1P5E B;  4C5H A;  2YRC A;  1ABQ A;  1M2V A;  2X35 A;  3QPH A;  1VOL A;  3CC7 A;  1I81 A;  5L23 A;  1Y71 A;  3QKJ A;  2A3L A;  2KEA A;  1Q81 C;  3PIO A;  1M90 R;  4NS5 A;  4MIM A;  4KUI A;  2DTI A;  3INZ A;  4CXA B;  4F7U G;  2KE9 A;  4BBR M;  2XD0 A;  2JNG A;  2QTV A;  1OL2 B;  4GLK A;  3CXC A;  4M7D D;  2RPN A;  1KJW A;  1M27 C;  1QMZ B;  3EJ1 B;  3RR6 A;  2DPP B;  4PJO B;  2IN3 A;  1N9R A;  1FYN A;  3I5R A;  4YOZ A;  4AKH A;  1UNH D;  2UZE B;  2DRK A;  3M59 A;  4CRL B;  3I9Q A;  2I53 A;  2WMA B;  4PJO C;  2HNI A;  3X25 B;  4QSH A;  3M0Q A;  3CPF A;  1FIN B;  1OPK A;  2DXU A;  1YIT T;  2XDD A;  2YUQ A;  1VQN A;  3GPL A;  5I22 A;  3G4S A;  2DX1 A;  1H24 B;  2RF0 A;  4X9C A;  4F7U B;  2LJ1 A;  4DOW A;  4J6Y A;  3DKM A;  1E6G A;  4BCO B;  2GNC A;  1PRM C;  2OTJ A;  2EQJ A;  2RD1 A;  1PKS A;  3CCV Q;  1IHV A;  1KQ2 A;  4Z89 A;  2P84 A;  3REA B;  5GAN 4;  1H64 1;  4MFD A;  2H3J A;  4MML A;  2CZ0 B;  4JUV A;  3M4Y A;  4EPC A;  4XTX A;  5GAM d;  4D8D A;  4HT8 A;  4EOR B;  5KYW A;  1W2B A;  5HCK A;  4Y28 E;  3BE3 A;  4BCI B;  4BCP B;  2DIG A;  3A8O B;  1FKM A;  1VQ6 Q;  4TTH A;  3QYE A;  2KR6 A;  2RB6 A;  1MV3 A;  3CCJ Q;  3OA6 A;  2EAY A;  3E19 A;  3CCM T;  4NC6 A;  4BCF B;  2CP7 A;  3VS6 A;  5IXB A;  2GQI A;  1BCM A;  3ZBD A;  4BCQ D;  1UGS B;  5IDP B;  2FRY A;  2MMP A;  1Q7Y R;  3F70 A;  5HK3 A;  2O9V A;  1TUC A;  2OTJ T;  4JRK A;  5KE2 A;  3EGX A;  3V7R A;  4M78 B;  1EIF A;  1D1B A;  4FX3 B;  3O5Z A;  2QK0 A;  4OVA A;  1OU8 A;  2V1R A;  2K5L A;  4E2F B;  4ZN1 A;  2X4X A;  4OF1 A;  2C5X B;  5LJ5 g;  2CCI B;  2NUT B;  3LQ5 B;  5FU6 B;  4IUU A;  1K8A C;  3GIB A;  2EPD A;  3URG A;  2ZZD A;  4AG2 C;  3S6W A;  5LJ5 h;  4BCJ B;  2JN0 A;  5L2W B;  2JS0 A;  1T0J A;  3BG9 A;  2K5F A;  4PKC C;  5CEI B;  1OKV B;  2COY A;  1ZUU A;  3E9G A;  4M7A D;  2DIL A;  2XKO C;  2R58 A;  2WPA B;  3VS2 A;  4B9W A;  1VQN Q;  5D7U A;  1Q86 R;  2DEQ A;  2Y4X A;  3G4S Q;  4Z6Y A;  2E6Z A;  4RMO A;  1AVZ C;  2ECZ A;  2CSQ A;  2MI6 A;  2XDB A;  4KRD B;  8AT1 B;  2DYI A;  5GAN 2;  4OGR B;  2RJD A;  3CBP A;  3CEY A;  4PLL A;  3V7S A;  2EYY A;  5EC7 A;  2VYT A;  1PHT A;  4M7D E;  1WHJ A;  4WCI A;  1G5V A;  3JRZ A;  4M7A F;  4M77 E;  4LD6 A;  2A36 A;  2QQB A;  2IW9 B;  2OJ2 A;  2PUO B;  4KGZ B;  2A7Y A;  2QFZ A;  5LQF B;  1HYO A;  1JOW A;  4PFO A;  3SEM A;  2DVE A;  1C0M A;  2HBW A;  2FG0 A;  3CCJ T;  4QVD A;  2R5A A;  2LDM A;  1KC8 R;  1PC0 A;  3LW5 E;  2DEU A;  5IT9 E;  3JCM e;  6AT1 B;  1VQ6 A;  4J8O A;  5L8R E;  4OMM A;  2LCL A;  2ROT A;  3I55 A;  4CFU B;  3I56 T;  1EZZ B;  4JDS A;  1ZUY A;  4M77 B;  2W99 A;  1VQ7 T;  3OW2 A;  2RNA A;  2EWN A;  4C0D B;  4F70 B;  3V7C A;  3PO3 S;  1H92 A;  2CH4 A;  1LJO A;  4PK4 A;  4D8K A;  1AWW A;  2DE0 X;  1KQS P;  2I0N A;  5DLO A;  4ZTJ A;  2JOY A;  1F5Q B;  3VYG A;  4BCM D;  1B07 A;  1Q82 C;  3MEU A;  5GJW B;  4F7U E;  2M16 A;  2DVJ A;  1DJ7 B;  4DA4 A;  3EFO A;  2Y4Y A;  4Z02 A;  3P8B B;  4FYV B;  1G3T A;  1YIJ Q;  1VQ4 Q;  1D0Y A;  4A63 B;  1JQQ A;  1WX6 A;  2W9F A;  4ANJ A;  4M7A A;  4FYY B;  4ROE A;  1JEG A;  2UZL B;  1ABO A;  3H0I A;  3BDL A;  2D6F A;  3UT1 A;  3O0G D;  3L2Z A;  3SDZ A;  5GAN 6;  4NOY A;  3QXE B;  2ABL A;  4OMO A;  5GAN 8;  1YJN Q;  3CCM A;  2RH2 A;  2O9S A;  3QYH B;  1GCP A;  3M57 A;  4RTV A;  5GAN 7;  1SF9 A;  2O88 A;  1BIB A;  2RHX A;  1T3L A;  3VRY A;  2DET A;  1NJI C;  5I2M A;  3JCM X;  1X01 A;  5DQV A;  3M9Q A;  1KIK A;  4FSX A;  1HJD A;  1OU9 A;  3OYE A;  1OQK A;  3HSB A;  2OTL T;  2EYW A;  1KHC A;  2CP6 A;  4N4H A;  1AD6 A;  1RLQ C;  1WPY A;  1C9B A;  4C0Z A;  4M78 D;  4YOO A;  4C92 B;  2EQI A;  2KMT A;  3CQT A;  2GCX A;  3SFM A;  3VUZ A;  2EGC A;  2H8H A;  3HTR A;  2QQA A;  4L6V 5;  5KH6 A;  3EG9 A;  1XOV A;  3QHW B;  3LGL A;  1QVF P;  1NPR A;  3OW2 S;  2F5K A;  3HRT A;  1MND A;  1H4L D;  2DA9 A;  2FEI A;  2HKQ B;  2K2M A;  2YLC A;  5GAO r;  4MZM A;  2DLP A;  2F2V A;  4XU1 A;  5KYX B;  1V1C A;  2PK2 A;  4OGE A;  4JZ3 A;  4RG2 A;  2MOX A;  5IDN B;  3CXC S;  1Q7Y C;  3OYI A;  5D6X A;  5CVI A;  4AT1 B;  1M3B A;  4ZTF A;  5GMK e;  4QQD A;  4F6W B;  1R8O B;  4ESR A;  1VQN T;  3EOC B;  3CPW A;  3GBQ A;  1N8R R;  3CD6 Q;  2BUD A;  4RTT A;  5I2S A;  3HP9 A;  1Y96 B;  5GAN 3;  1NYG A;  3G71 T;  2C5V B;  3CCS T;  2DD4 A;  4E7H A;  4C8Q F;  2DK3 A;  1K0X A;  3DB4 A;  4DOV A;  4CFX B;  5DLQ E;  1I5O B;  3RGF B;  2E10 A;  3L42 A;  4EOP B;  4JJB A;  4R55 A;  4F6U B;  3OYM A;  3CCU T;  1VQ6 T;  2C6T B;  3R6N A;  1B34 B;  3G1J A;  2EYX A;  1YFN A;  4KGX B;  2BIV A;  3X24 B;  3PVL A;  3R6O A;  1TUG B;  4XTZ A;  3OYY A;  4E7S A;  3JB9 J;  2HCK A;  4JX6 A;  1H1S B;  4LE9 A;  4ROC A;  3QYG B;  4F14 A;  5CKD A;  5FU7 B;  4HVU A;  4AMC A;  3H0F A;  5GAN h;  2J05 A;  5HBJ B;  4DEY A;  2NUP A;  4EOS B;  1ENW A;  1WHG A;  1U1S A;  4M6V A;  1N9S A;  4BCN B;  2BS3 A;  3A8L B;  2KXD A;  2DD5 A;  3QJ6 A;  4R0K A;  2PJQ A;  4X34 A;  3PT9 A;  5GAN f;  3J81 E;  1FXX A;  2P0K A;  1VQP Q;  3E9F A;  4CC4 B;  4HLQ A;  2WJ9 A;  4Y72 B;  1K73 C;  1WJQ A;  1OUL A;  1ZQ1 A;  1K0S A;  3EFR A;  1D3B B;  2QEX T;  5LJ3 f;  4BY6 B;  2BPM B;  3TW7 A;  4M77 G;  5DY9 A;  5HY6 A;  4FW1 A;  2W0Z A;  3EG1 A;  1Q82 R;  3L1A A;  2QGG A;  2ZPE B;  3QHR B;  1U8R A;  1AT1 B;  5FRO A;  4CFN B;  2L3P A;  2F2X A;  2HQE A;  4C0G A;  1FMV A;  4EIK A;  4RCB A;  4PFP A;  2DTH A;  2LMJ A;  3CME Q;  1OIU B;  4F17 A;  4C92 A;  2KRN A;  3J7A F;  2LT1 A;  4MZP A;  5GAN e;  4KUL A;  4OR5 B;  1XNI A;  4HA8 A;  4BI4 A;  2WSF E;  4II5 B;  1K8A R;  4II1 A;  2R5M A;  3EG9 B;  1KC8 C;  2RJE A;  2EFI A;  1ZSG A;  2C5O B;  3JB9 G;  2D1X A;  3CCR Q;  2LP5 A;  2YSQ A;  1X6B A;  1M1G A;  2CP2 A;  1LOJ A;  2ROL A;  3QSU A;  1B34 A;  5KYX A;  1H1R B;  1FVV B;  4EOL B;  4M75 D;  1AOJ A;  2O4X A;  4ME7 A;  4GBQ A;  2M0Y A;  4C92 E;  4M78 C;  2DER A;  1OYX A;  2RO0 A;  1JKW A;  4J9B A;  1UJY A;  2WSE E;  2VWF A;  3UDC A;  2JTM A;  2WHB B;  4X1V A;  1HXD A;  4IUQ A;  1S72 A;  2HEQ A;  4QQ6 A;  5J26 A;  4C92 C;  1F1B B;  3A98 A;  1IXD A;  1QP3 A;  5C0M A;  4K11 A;  5CAI A;  1AIS B;  2WXV B;  5LJ3 e;  3T9N A;  2BS4 A;  4BBS M;  3JCM b;  4X9D A;  4N0A C;  2EQU A;  1P92 A;  1QCF A;  1KQ1 A;  2I40 B;  1H3H A;  4IUV A;  1NEB A;  2J6O A;  1WXB A;  2P4R A;  4BE2 A;  2VXF A;  2C4G B;  3OYG A;  4IIM A;  4CC2 A;  4OGC A;  3MEV A;  1W2B S;  4C5I A;  4JX4 A;  2DME A;  3BFM A;  2X51 A;  1ZSZ C;  1X27 A;  4JS4 A;  2HSP A;  1QVF A;  2O01 E;  1M3C A;  2OTL Q;  2MIO A;  4A54 A;  2LJ3 A;  2C0I A;  2IVW A;  5KE3 A;  1VQL T;  1NEG A;  1ZA1 B;  3CD6 T;  3M55 A;  4ROD A;  4IUR A;  1K9A A;  2P0Q A;  1GBQ A;  3ASK A;  3BLR B;  3ER0 A;  4CFU D;  4LNP A;  3EFS A;  3V8K A;  2VGN A;  2GGR A;  3NMZ C;  1PD1 A;  2YRV A;  1TG0 A;  5GAM e;  1YJ9 Q;  4KBM B;  1NM7 A;  1JJ2 P;  2JT4 A;  3UWN A;  4IIO A;  1G3W A;  2QAS A;  2VB6 A;  4XU2 A;  1QVP A;  2FB7 A;  2C0T A;  3UA7 A;  3OW2 P;  3VS5 A;  3I56 Q;  4AG1 C;  4M75 F;  2J6F A;  1YBY A;  4M7A B;  1WQW A;  1VQ7 Q;  1WHM A;  2VC8 A;  1Z9Q A;  2VXE A;  5A0G A;  2VVK A;  1VIF A;  2EBP A;  1M8M A;  3VS0 A;  2IVX A;  4LXC A;  2CYZ B;  4XK8 E;  1AEY A;  4V2S A;  2DAQ A;  1CSK A;  2A28 A;  4J9D A;  1RAE B;  3G33 B;  4HCC A;  2QEX A;  2CSI A;  5HVY B;  3LYI A;  1PWT A;  1OZ3 A;  4C92 G;  4UN0 A;  2J6K A;  2NYS A;  1WIE A;  1O9K B;  5LJ5 f;  5BNJ B;  1U1T A;  1YJW Q;  1K4U S;  4JLG A;  2KDS A;  3L2W A;  2C5N B;  3JCM h;  2CZ1 B;  2FPE A;  2EW3 A;  3HRS A;  1VQK T;  3RBB B;  3VJP A;  5GAO p;  7AT1 B;  4XTU A;  1PD0 A;  1O9S A;  1LPL A;  1RI9 A;  1O9K A;  3DOG B;  3G6E A;  3CC2 T;  2ZZD B;  2DL4 A;  4E7Z A;  4MDW A;  4O6J A;  1TSF A;  3VKH A;  2M02 A;  2JM9 A;  3CPW S;  4CRI A;  2RHZ A;  3MY5 B;  2QQS A;  3MI9 B;  3PMI A;  3H0H A;  1JRI A;  5LL6 S;  3GOX A;  1NPP A;  2LVM A;  1N6A A;  5GMK j;  3GP8 A;  2X4W A;  4M7D G;  5GAM h;  2LQK A;  5I5Z B;  3TQ7 P;  1I0C A;  2QF7 A;  4N4I A;  3E2U A;  5KYU A;  2D8H A;  1I8F A;  2EKH A;  1YI2 A;  1N8R C;  4HNT A;  3JCM g;  3RKX A;  3A8H B;  2M51 A;  1Q86 C;  2D0N A;  2X3X D;  2QYZ A;  4EMK B;  3OY9 A;  2J7I A;  1D1A A;  3JSC A;  3M54 A;  3GNG A;  3JB9 D;  1T0H A;  4JJD A;  3L2U A;  3WVE B;  1AWX A;  1WI7 A;  3S3O A;  1ZHI A;  2HKN A;  2RN8 A;  1KSW A;  2ZPI B;  3BHV B;  2MCN A;  1NLO C;  2DXT A;  2RQW A;  2YXY A;  4JLI A;  1XTD A;  5ICP B;  4M75 E;  2E3H A;  3H9N A;  2FPD A;  1QVF S;  1GL5 A;  4HCZ A;  1Q82 U;  2V26 A;  1VQP A;  3RUX A;  2E4H A;  3TN8 B;  3D7S B;  3GNF B;  2FZC B;  3OBW A;  1OI1 A;  2KAF A;  3EHQ A;  3TSZ A;  4OMQ A;  3G4S T;  4YC3 B;  4J83 A;  4O5V A;  2HD0 A;  1QKX A;  1WJR A;  2VGM A;  1H25 B;  5GMK i;  3BDU A;  1VQ9 A;  5CCA A;  3L2Q A;  1AZG B;  4DBR A;  1VQP T;  1B3Q A;  1QVG S;  2X1N B;  4Q5W A;  4FT4 A;  2OTJ Q;  2QTX A;  3CMA T;  2K6D A;  1TD6 A;  2KNB B;  3Q1J A;  4PJJ A;  1YJW A;  4LDY A;  1XO2 A;  3P8D A;  1FWZ A;  3JV3 A;  2W10 A;  2PVD B;  3JCM f;  2L3R A;  4J7F A;  2AZV A;  4FYW B;  5GJV B;  4A4H A;  2DD5 B;  3CXC P;  4DQ2 A;  1BI2 A;  2HAX A;  1PRL C;  3RNJ A;  2IG0 A;  4KRC B;  2D8J A;  2E41 A;  3CCU A;  3X26 B;  4C0F A;  3KHI A;  1WA7 A;  5KYY A;  3CC4 A;  4F7J B;  3K7A M;  3TVT A;  2CRE A;  2WFY B;  1YWP A;  1K9M C;  4A4F A;  4J9F A;  5CKH A;  2KI7 A;  4JRI A;  4M7D C;  1JST B;  1VQ4 T;  4IMY B;  3MIA B;  1X2K A;  1IRX A;  1H28 B;  3CC4 T;  3A5Z B;  2FO0 A;  3UA6 A;  4J5Y A;  3BG5 A;  4EOJ B;  2EYQ A;  1D1C A;  5GAM j;  1WLP B;  2DJQ A;  1GCQ A;  2HDA A;  1MV0 B;  4C8Q G;  2EGE A;  4QVC A;  2BE9 B;  4BE1 A;  1Q7Y U;  1U5S A;  2EYZ A;  1M9S A;  1VQM A;  2JTE A;  4UC4 A;  2KT8 A;  1RAI B;  4HNU A;  1W6X A;  3JB9 F;  1TFB A;  4PJO D;  2ED0 A;  3TSW A;  1ZX6 A;  5IN1 A;  4DEX A;  3CCQ Q;  3OYB A;  2WIP B;  2DL3 A;  2K5I A;  1Q86 U;  4M77 C;  4BY7 X;  1YCS B;  5LJ5 d;  2RHU A;  1VQ8 T;  4PJO A;  1K1Z A;  1HSQ A;  2LX9 A;  4YTL A;  1VYU A;  2OTL A;  5IHI A;  1OI9 B;  3JCM W;  5GAM f;  4BD3 A;  1IGU A;  1MMA A;  1SRM A;  3VYG B;  3MHX A;  2RI3 A;  2ED1 A;  1PSE A;  4M7D F;  2KYM A;  1OKW B;  1VQ8 A;  4FSS A;  2KVQ G;  1TWB A;  3QO3 A;  3OB9 A;  5GMK h;  2EJG A;  3QG1 A;  4M78 A;  4BDZ A;  1KHI A;  3EFO B;  1GXI E;  2MYS A;  1ZLM A;  4KH1 B;  2V8J A;  5FWB A;  4IUT A;  3CCU Q;  4RTZ A;  5GAN d;  4Z8A A;  3OS5 A;  3QZ9 B;  1JB0 E;  3M4G A;  4C92 D;  3GF5 A;  2NUT A;  4KUD K;  1AZE A;  4M7D B;  1A0N B;  4PNO A;  1G83 A;  1LNX A;  2JS2 A;  1M4Z A;  4RTX A;  5EG2 A;  2O2O A;  2XIC A;  1X75 C;  3PMT A;  3OYK A;  1UE9 A;  4QKU A;  3PIP A;  1FMW A;  1Y7X A;  4BI8 B;  4C8Q A;  2GQV A;  1X6G A;  5M9O A;  1J3T A;  1GUX B;  4Z88 A;  4ORZ A;  4ELL A;  5FU6 C;  4EMH A;  5LJ3 g;  4M75 C;  2DBM A;  1QWE A;  3NPF A;  1OX9 A;  4FU6 A;  2E1H A;  4QQG A;  1IB8 A;  3VKG A;  1BI1 A;  2CP5 A;  2QG9 B;  4B6M A;  1MGQ A;  4TVR A;  4BB7 A;  2F69 A;  1D0X A;  2RQT A;  3HHT B;  2LCS A;  2LCC A;  3CCV A;  3BW1 A;  3G71 Q;  5FRM A;  2RQU A;  1GRI A;  4E47 A;  3SWN C;  4LUD A;  2F5T X;  2HQH A;  3M5A A;  1UGV A;  2G9X B;  3EGU A;  1BU2 A;  5HK0 A;  1KQS S;  2QQ9 A;  3EGX B;  1YJN A;  1ARK A;  1TUD A;  2E5K A;  2LQW A;  3CCJ A;  4BDY A;  2DD4 B;  3CPW P;  2PTK A;  1N5Z A;  1VIE A;  2PMI B;  1JXO A;  1RAG B;  2NLU A;  1OIY B;  2LQN A;  4AFU C;  2MPX C;  2PHG A;  2KRM A;  4JPB W;  1M30 A;  1N8R U;  3OMG A;  4JZ4 A;  2COW A;  4F7S B;  2EJ9 A;  4M78 G;  2HL5 C;  2QQR A;  2JMC A;  1RAD B;  3MEA A;  5GMK l;  4FL6 A;  1D0Z A;  4ZN3 A;  1UDL A;  5GAO m;  2QQ8 A;  2M9U A;  4L5G A;  2FRW A;  2K2V A;  4KH0 B;  4PJN A;  1NYF A;  5HBH B;  1U3O A;  4AFS C;  3ME9 A;  1EX4 A;  3DB3 A;  1RAF B;  1Y07 A; 
#chains in the Genus database with same CATH homology
 1QP3 A;  3M59 A;  3BY7 A;  5C0M A;  1RI0 A;  2DKG A;  2LQ8 A;  5CAI A;  2DJZ A;  4FT2 A;  3TCJ A;  1VQM T;  1K73 U;  4PJO C;  2HNI A;  3RES A;  4A4K A;  3T9N A;  2BS4 A;  3X25 B;  4BBS M;  5LJ3 e;  4QSH A;  3JCM b;  3CPF A;  4X9D A;  5CIU A;  4N0A C;  2EQU A;  2E70 A;  2DXU A;  4GY5 A;  1X6O A;  1P92 A;  4LDU A;  4OP0 A;  5CKE A;  2XDD A;  4B9X A;  3CCQ A;  1KQ1 A;  2LT4 A;  2E12 A;  1W4S A;  1VQN A;  2XDP A;  4IUV A;  3GPL A;  4BAC A;  4MDX A;  4BE2 A;  2VXF A;  2GFA A;  3G4S A;  2ZPF B;  2CZ6 B;  1KC8 U;  1WGS A;  3OYG A;  4JS5 A;  4X9C A;  4F7U B;  4KT0 E;  3MEV A;  4OGC A;  3DLL A;  4DOW A;  1W2B S;  4J6Y A;  3DKM A;  2ZPB B;  2JZ2 A;  3HPW A;  1BYM A;  4ZGJ B;  2G3R A;  4JX4 A;  4J6W A;  3BFM A;  5CQX A;  3RKY A;  3HL8 A;  2KK4 A;  3QBY A;  4C5I A;  2X4Y A;  3QHS A;  4QVZ A;  3V8L A;  2E5Q A;  2EQJ A;  2K57 A;  2OTJ A;  3C12 A;  4XU3 A;  1WQ7 A;  5FLX E;  3HRU A;  5LJ3 d;  4JS4 A;  1VQO A;  1QVF A;  2RD1 A;  2O01 E;  3RKW A;  2KQW A;  3G71 A;  1KQ2 A;  4PLI A;  4A54 A;  3JAM E;  2IVW A;  2XK0 A;  5KE3 A;  1H64 1;  4A53 A;  4MFD A;  5GAN 4;  4QW2 A;  2H3J A;  3M55 A;  3H4C A;  3FIF A;  3CD6 T;  4MML A;  2CZ0 B;  4JUV A;  3M4Y A;  4IUR A;  4EPC A;  4XTX A;  4HT9 A;  5GAM d;  3CC7 T;  3VYH B;  4IUP A;  3TEE A;  2EQK A;  2FYK A;  2P0Q A;  3MET A;  4HT8 A;  3ASK A;  2M0O A;  3ER0 A;  1W2B A;  1D3B A;  4Y28 E;  3FC3 A;  3EFS A;  2JUF A;  3V8K A;  2VGN A;  2MF2 A;  2DIG A;  3A8O B;  3JCM P;  1FKM A;  1YI2 T;  3SWN A;  2YRV A;  3QYE A;  2KR6 A;  2RB6 A;  5GAM e;  4ZGD B;  4KBM B;  3J80 E;  3OA6 A;  4ZGE B;  1VQL A;  2K3Y A;  2EAY A;  3UWN A;  2PVG B;  3OYH A;  3E19 A;  1G3W A;  3CCM T;  4BI3 A;  5A2Q E;  4XU2 A;  4NC6 A;  5DM7 R;  5GAN 5;  1QVP A;  3HFN A;  2K3X A;  2FB7 A;  1YHQ T;  2YHT A;  5I21 A;  3ZBD A;  4OB0 B;  1NE8 A;  3OSS C;  1UGS B;  2P0P A;  4M75 F;  5CKF A;  1YBY A;  4M7A B;  3LWH A;  1YIJ T;  1WQW A;  3CMA A;  3OQ5 A;  4JRQ A;  1PSF A;  2MMP A;  2QXF A;  3F70 A;  5HK3 A;  2VC8 A;  4PJO G;  2OTJ T;  2EJF A;  4JRK A;  2VXE A;  5A0G A;  5KE2 A;  2RA2 A;  3JCM d;  3V7R A;  1FX7 A;  1VIF A;  5GAO q;  1ZBX A;  4M78 B;  5GAM g;  1KQS A;  1S72 T;  2CYZ B;  1EIF A;  4XK8 E;  1V29 B;  1BIA A;  5LJ5 j;  3LWI A;  2PU9 B;  4E7I A;  4OVA A;  3QWL A;  2DAQ A;  2PUK B;  1YIT T;  4V2S A;  2K5L A;  4ZN1 A;  3KXT A;  2X4X A;  2B8A A;  4HCC A;  4PJO F;  4OF1 A;  3H6Z A;  3RIR A;  4C8Q A;  2QEX A;  5LJ5 g;  5GAN j;  1YIJ A;  3FEO A;  2LNV A;  3LH0 A;  3LYI A;  3OSV A;  1OZ3 A;  4HNV A;  5FU6 B;  4C92 G;  4IUU A;  2RM4 A;  3LX7 A;  1K8A C;  5LJ5 f;  3GIB A;  1JJ2 S;  3MO8 A;  1U1T A;  3URG A;  2ZZD A;  4JLG A;  4FM4 B;  2KDS A;  3L2W A;  3S6W A;  5A0L A;  5LJ5 h;  2JN0 A;  3JCM h;  2CZ1 B;  3CCV T;  1VQ9 T;  1M5Q 1;  3HRS A;  1AHJ B;  3BG9 A;  2K5F A;  4E7K A;  4PKC C;  3OBY A;  1VQK T;  3E9G A;  3MP8 A;  3VJP A;  4M7A D;  4EMK C;  5GAO p;  2LTO A;  3MP1 A;  2OAU A;  4AKG A;  2XKO C;  4XTU A;  2R58 A;  2R57 A;  1RL2 A;  5GMK m;  4B9W A;  2KMG A;  1O9S A;  2DEQ A;  3M58 A;  4XTW A;  2Y4X A;  4D6W A;  4XAX B;  3G6E A;  4Z6Y A;  2E6Z A;  3CC2 T;  4RMO A;  2ZZD B;  3HFO A;  1KG1 A;  4ELJ A;  1O75 A;  2EIF A;  2HQX A;  2MI6 A;  4MDW A;  4O6J A;  2XDB A;  5GAN 2;  3CEY A;  3VKH A;  2RJD A;  3CBP A;  4PLL A;  3V7S A;  3CPW S;  4CRI A;  2RHZ A;  1OZ2 A;  2FL7 A;  2QQS A;  4AKI A;  3CD6 A;  2VYT A;  3JCM Q;  3PMI A;  4M7D E;  3GOX A;  1JRI A;  5LL6 S;  2ZCF B;  1G5V A;  2G77 A;  1NPP A;  1UGR B;  2LVM A;  1N6A A;  3JRZ A;  3NFC A;  1UB4 A;  5GMK j;  5GAN g;  4M77 E;  4AI6 A;  3GP8 A;  4M7A F;  2X4W A;  2E65 A;  4WF2 A;  4LD6 A;  4M7D G;  5GAM h;  2LQK A;  1N27 A;  4BUG A;  2QQB A;  4FIB A;  2PQW A;  2QF7 A;  4N4I A;  4JJN K;  2PUO B;  3MP6 A;  2A7Y A;  4E7J A;  5FRN A;  1I8F A;  4MMK A;  1YI2 A;  1N8R C;  2QFZ A;  4HNT A;  3NTH A;  4N4G A;  1M1F A;  3JCM g;  3QJY A;  1VUB A;  2QI2 A;  2DZ9 A;  4MZT A;  4P5N A;  3RKX A;  4LDX A;  1YJN T;  3A8H B;  2DVE A;  2AHJ B;  1Q86 C;  2EKO A;  3CCJ T;  4QVD A;  4CI0 C;  2R5A A;  3H8Z A;  2LDM A;  2E64 A;  3LW5 E;  2L8D A;  3L2V A;  4EMK B;  3OY9 A;  5IT9 E;  2RI5 A;  3JSC A;  3JCM e;  3M54 A;  2QA4 A;  3GNG A;  3JB9 D;  1VQ6 A;  3L2U A;  3WVE B;  4J8O A;  3S3O A;  1M1K C;  1ZHI A;  5L8R E;  3LLR A;  2LCL A;  3I55 A;  3C4S A;  1JJ2 A;  3I56 T;  2ZPI B;  3HZJ A;  2XI9 A;  2DXT A;  4LDW A;  4ELY C;  3TW6 A;  4JDS A;  4JLI A;  1WJS A;  4M77 B;  1XTD A;  3QDR B;  3SD4 A;  1VQ7 T;  1UGQ B;  3OW2 A;  4M75 B;  3LGF A;  1Y96 A;  3CBO A;  4A4G A;  2EWN A;  4M75 E;  4C0D B;  3V7C A;  1QVF S;  3QUI A;  4ATO A;  1LJO A;  2O4X B;  4HCZ A;  1Q82 U;  5DLO A;  1VQ5 A;  5EJC A;  1VQP A;  3CCE T;  3KBG A;  2JOY A;  3M53 A;  5GAO n;  2FHD A;  3RUX A;  4EMG A;  4ZTJ A;  3VYG A;  3HKS A;  1YJ9 T;  3GNF B;  4M78 E;  3OBW A;  1OI1 A;  4RKU E;  5LJ5 e;  1Q82 C;  3MEU A;  2KAF A;  4F7U E;  5J39 A;  3OYD A;  2M16 A;  3PTA A;  4BE0 A;  1DJ7 B;  4JRP A;  5KCH A;  3G4S T;  1BI0 A;  2DXC A;  4DA4 A;  1IZ6 A;  4J83 A;  2RI2 A;  4M75 A;  2HD0 A;  2Y4Y A;  4O5V A;  3VV0 A;  1WJR A;  2VGM A;  3A8M B;  3P8B B;  3PFS A;  3BDU A;  4Z02 A;  5GMK i;  1TH7 A;  1G3T A;  4N0A A;  5CCA A;  3OS0 A;  2VUB A;  3L2Q A;  4QQ6 A;  1VQP T;  1QVG S;  4Q5W A;  4C8Q D;  4FT4 A;  3RER A;  2QTX A;  5IAY A;  4M7A E;  3CMA T;  4M7A A;  1VQ9 A;  3Q1J A;  3FDR A;  5D6Y A;  4LDY A;  4A4E A;  1YJW A;  1FWZ A;  3P8D A;  4MFE A;  5CK9 A;  2PVD B;  3KUF A;  3JCM f;  4ELZ C;  2L3R A;  3N5B B;  4J7F A;  3BDL A;  3OYN A;  2D6F A;  2EQM A;  3UT1 A;  3L2Z A;  3SDZ A;  4A4H A;  2DD5 B;  3CME A;  5CKB A;  2RK2 A;  5GAN 6;  4DQ2 A;  3FLG A;  4NOY A;  3QXE B;  4PL6 A;  5GAN 8;  1BI2 A;  2HAX A;  3BG3 A;  1I4K 1;  2RH2 A;  4HKE A;  3CCM A;  3AHU A;  4F7U F;  3ZEH A;  1M90 C;  3QYH B;  2IG0 A;  1UEB A;  3M57 A;  2E41 A;  2CZ7 B;  1M1K U;  4IKF A;  5GAN 7;  3CCU A;  3X26 B;  3CCE A;  4C0F A;  3KHI A;  3CC4 A;  3A8G B;  1YJ9 A;  2DXB B;  1BIB A;  2RHX A;  1NJI C;  1K9M C;  4A4F A;  3CME T;  5CKH A;  5I2M A;  5HKC A;  2QDJ A;  5FU7 C;  3JCM X;  1X01 A;  3M9Q A;  4JRI A;  1KD1 C;  4M7D C;  3TRE A;  1VQK A;  4FSX A;  1YHQ A;  1M8V A;  3OYE A;  1VQ4 T;  3HSB A;  4OMF B;  3CCS A;  2OTL T;  1KHC A;  4BDZ A;  4N4H A;  3QYB A;  1SSF A;  4LOC A;  3CC4 T;  1WPY A;  3A5Z B;  1HK9 A;  4J6X A;  3FJP A;  4J5Y A;  1VQL T;  4C0Z A;  3BG5 A;  3PGG A;  4M78 D;  1MHN A;  4C8Q C;  4R56 A;  2EYQ A;  2DXB A;  3JCM J;  3P8H A;  3I55 T;  4C92 B;  2KMT A;  1NZ9 A;  3SWN B;  5GAM j;  2RJF A;  3QII A;  4RCC A;  2GCX A;  1KD1 U;  3SFM A;  3VUZ A;  3UPU A;  4C8Q G;  3CCL A;  4F7U A;  4BY6 C;  2QQA A;  2BS2 A;  1NJI U;  4L6V 5;  4QVC A;  2D9T A;  5KH6 A;  4M78 F;  4BE1 A;  1Q7Y U;  2YLB A;  1XOV A;  4C8Q E;  2WSC E;  3LGL A;  1VQ5 T;  1M9S A;  1NPR A;  2L5Q A;  2GF7 A;  3NTI A;  5AYF A;  1QVG A;  4M77 F;  3OW2 S;  2F5K A;  3HRT A;  1VQM A;  4UC4 A;  4HCB A;  2BKD N;  4HNU A;  3JB9 F;  3JB9 H;  4PJO D;  1QW1 A;  2YLC A;  2ZGW A;  4MZM A;  5GAO r;  4XU1 A;  5GAO l;  3CCR T;  3E1S A;  4OGE A;  2MAM A;  5IN1 A;  4OB2 B;  1BI3 A;  2RHY A;  4RG2 A;  5LJ3 h;  3OYB A;  3CXC S;  1Q7Y C;  3X20 B;  3OYI A;  5D6X A;  5CVI A;  3MCA B;  2QA4 T;  2V8K A;  2K5I A;  4NL3 A;  1Q86 U;  4M77 C;  4C0D C;  4ZTF A;  5D6W A;  1K9M U;  5GMK e;  4QQD A;  3CCQ T;  5LJ5 d;  2RHU A;  3VKI A;  1R8O B;  2KSS A;  4M77 D;  1VQN T;  5C6S A;  3CCR A;  3V8J A;  1VQ8 T;  4PJO A;  3CPW A;  1H3Z A;  2LX9 A;  4C5G A;  4YTL A;  2BUD A;  3DL1 A;  5I2S A;  1I5L A;  2P4T A;  1Y96 B;  4JX5 A;  3HP9 A;  5GAN 3;  2FVU A;  3G71 T;  3CCS T;  2OTL A;  2DD4 A;  4E7H A;  4C8Q F;  3X28 B;  4HL4 A;  2DK3 A;  3DB4 A;  3JCM W;  3O8V A;  5GAM f;  4DOV A;  5J3B A;  3CCL T;  4BD3 A;  5DLQ E;  2E10 A;  3C94 A;  3L42 A;  2V8I A;  3MEW A;  3VYG B;  3MHX A;  2Y90 A;  2RI3 A;  3VUB A;  4R55 A;  2XHC A;  3OYM A;  3CCU T;  3EAE A;  1JBM A;  1PSE A;  3NTK A;  1VQ6 T;  4M7D F;  4C92 F;  1VQ8 A;  4OB1 B;  4M7A G;  1B34 B;  2KVQ G;  2DO3 A;  3QO3 A;  5A0D A;  3OB9 A;  4E7L A;  5GMK h;  2BIV A;  2EJG A;  3QG1 A;  4M78 A;  3VU3 C;  5CR2 A;  3WVD B;  3X24 B;  1KHI A;  1XQH A;  2HBP A;  3R6O A;  3HO8 A;  3JB9 I;  1GXI E;  4J7I A;  3M56 A;  4XTZ A;  2V8J A;  3OYY A;  3S3M A;  4IUT A;  3JB9 J;  5GAN d;  4JX6 A;  2VV5 A;  4RG8 A;  3OS5 A;  3QZ9 B;  1JB0 E;  2RK1 A;  4LD9 K;  3QYG B;  3C95 A;  3M4G A;  5CKD A;  3OYF A;  5FU7 B;  1UGP B;  4C92 D;  3GF5 A;  4XQ3 A;  1YJW T;  4KUD K;  4M7D B;  1WNL A;  5GAN h;  4PNO A;  3OYA A;  1LNX A;  2DZC A;  2WAC A;  1M4Z A;  3RMQ A;  1U1S A;  5EG2 A;  4M6V A;  3QZ5 B;  1N9S A;  2DIQ A;  2BS3 A;  3A8L B;  3HBL A;  3OYJ A;  2XIC A;  1X75 C;  4M75 G;  3OS2 A;  1E7P A;  2DD5 A;  2GFU A;  2JVV A;  3PMT A;  3ZFJ A;  5LJ3 j;  3QJ6 A;  5KCO A;  3OYK A;  3PIP A;  2RJC A;  1Y7X A;  4X34 A;  2K4Y A;  4BI8 B;  4XU0 A;  4OB3 B;  2GQV A;  1IRE B;  1FXX A;  2P0K A;  3PT9 A;  5M9O A;  5GAN f;  2XU8 A;  3J81 E;  3E9F A;  1G3S A;  5FU6 C;  4EMH A;  5LJ3 g;  4HLQ A;  2WJ9 A;  4M75 C;  4VUB A;  2JTF A;  4XTV A;  5CO7 A;  4EMK A;  1K73 C;  4M7D A;  3OYC A;  1WJQ A;  1ZQ1 A;  2I2L A;  4PJO E;  3EFR A;  1D3B B;  3OMC A;  5LJ3 f;  2QEX T;  3G6E T;  4FU6 A;  4BY6 B;  2KY9 A;  2E1H A;  4QQG A;  3TW7 A;  2E6N A;  3VKG A;  2LRQ A;  2MWO A;  1BI1 A;  3DLM A;  4M77 G;  3WXM B;  2ZPG B;  3HB9 A;  5DY9 A;  1YCY A;  3CBM A;  1MGQ A;  5HY6 A;  4TVR A;  3RMS A;  4BB7 A;  2L89 A;  3L1A A;  2F69 A;  4C8Q B;  1QP2 A;  3HHT B;  3GLX A;  1VQ4 A;  2PVO B;  2XID A;  2LCC A;  1G3Y A;  3CCV A;  2ZPE B;  2M1H A;  3BW1 A;  5FRM A;  2MWP A;  4L59 A;  4E47 A;  1U8R A;  3SWN C;  5FRO A;  2F5T X;  2DTO A;  2HQE A;  3OS1 A;  4C0G A;  5CQY A;  3M5A A;  3SB2 A;  4NL2 A;  4LDV A;  4RCB A;  4C5E A;  2DTH A;  3L2R A;  3FB9 A;  1VQO T;  3JCM V;  2X4J A;  1M90 U;  2QDY B;  4C92 A;  3OYL A;  3JCM c;  5HK0 A;  1KQS S;  3J7A F;  2LT1 A;  4EDU A;  2QQ9 A;  3CC2 A;  4MZP A;  5GAN e;  1YJN A;  4KUL A;  4C5H A;  4M7A C;  1XNI A;  4HA8 A;  4BI4 A;  2WSF E;  3CCJ A;  4BDY A;  2DD4 B;  2X35 A;  3QPH A;  3CC7 A;  1I81 A;  1VIE A;  4II1 A;  2R5M A;  1Y71 A;  3G7Z A;  1KC8 C;  2RJE A;  2EFI A;  2NLU A;  3QKJ A;  4Y91 A;  3JB9 G;  2A3L A;  2ZPH B;  1Q81 C;  3PIO A;  1M1G A;  3I56 A;  1N8R U;  3OMG A;  1LOJ A;  3S3N A;  1QLB A;  3QSU A;  1B34 A;  2RHI A;  2EJ9 A;  4NS5 A;  4MIM A;  4M78 G;  4KUI A;  2DTI A;  1VQ7 A;  4M77 A;  3INZ A;  2QQR A;  4F7U G;  4BBR M;  3MEA A;  2C06 A;  5GMK l;  4M75 D;  4FL6 A;  2XD0 A;  2JNG A;  2O4X A;  4XTY A;  4ME7 A;  4ZN3 A;  4GLK A;  2CS7 A;  3CXC A;  2CKK A;  2D0Q B;  4C92 E;  5GAO m;  4M78 C;  2QQ8 A;  4M7D D;  3PNW C;  1Q81 U;  2M9U A;  1OYX A;  2RO0 A;  3TU4 K;  4L5G A;  1BKB A;  2WSE E;  2K2V A;  3UDC A;  2JTM A;  1K8A U;  2CGH A;  2DPP B;  4PJO B;  1YIT A;  1HXD A;  2DXC B;  4IUQ A;  2LC4 A;  3ME9 A;  1S72 A;  1N9R A;  3FRN A;  3DB3 A;  2XG8 D;  4AKH A;  5J26 A;  4C92 C;  1Y07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...