1UGPB

Crystal structure of co-type nitrile hydratase complexed with n-butyric acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugpB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugpB02
3LW5E 2ZPEB 5L8RE 1QP3A 2ZCFB 1JB0E 2CZ1B 3HHTB 4OB1B 2ZPFB 1UGSB 1UGQB 4OB3B 3X28B 3QZ9B 2PU9B 2CYZB 2PVOB 2ZPGB 3WVEB 3A8HB 1AHJB 2DD4B 2WSFE 2AHJB 4ZGDB 2DPPB 2DD4A 4Y28E 4OB0B 2ZPIB 2QDYB 1V29B 4OB2B 2CZ0B 3A8GB 3A8OB 2WSEE 3X26B 3A8MB 2PVGB 4RKUE 2DXCB 1GXIE 2O01E 1PSFA 3QXEB 4XK8E 3VYGA 3WVDB 1PSEA 4ZGJB 2PVDB 3QZ5B 3QYGB 2DXCA 3X20B 1DJ7B 3VYHB 3A8LB 1IREB 3X24B 2CZ7B 3QYHB 4L6V5 4FM4B 2DXBB 2PUKB 2CZ6B 3X25B 2D0QB 4ZGEB 2ZPBB 3VYGB 2DXBA 2ZZDB 2WSCE 1QP2A 4KT0E 2ZZDA 2DD5B 1UGRB 2DD5A 2PUOB 2ZPHB 1UGPB
chains in the Genus database with same CATH superfamily
2QQ9A 1PKTA 2DMOA 2KYMA 5DM7R 4BE0A 4PJOF 4Z02A 1BCMA 5CR2A 2DNUA 3VUZA 2FB7A 2BZYA 3HHTB 1D3BA 4C0GA 2ZPFB 3DL1A 2MYSA 2RJDA 3H41A 4LD9K 2CYZB 4OGEA 1KG1A 4C0DB 4BDZA 1KXUA 2O2OA 4PJJA 2LJ1A 2JNGA 3ER0A 2KXDA 1WXUA 2K3BA 4ZGDB 4EOPB 2QXFA 1TH7A 4OGRB 5GANj 4AFQC 2ZPIB 2FZGB 4JRIA 1YHQQ 1WHJA 2J6FA 3CEYA 2LP5A 3JCMQ 3TREA 4HT9A 1YJWQ 1YI2T 5IXFA 3QJYA 5CEIB 2FYKA 1KQSS 1QVFS 4C5IA 1IHVA 4JLIA 2C4GB 1JSTB 1SHFA 1M3AA 1RI9A 3I55T 4M77D 4PL6A 2GGRA 3E2UA 1LVKA 4F17A 2PTKA 3BLRB 3QYBA 1C6VX 3CCJA 1QMCA 4J9DA 4FW1A 3OYHA 3A1PA 3M0QA 1PSEA 3CCVT 3NHNA 2PK2A 2DA9A 1VQ7Q 4X1VA 4HNUA 1IZ6A 1H27B 1BIAA 2D0NA 1M2VA 3M58A 3V7CA 4CXAB 4L6V5 3BHVB 3PVLA 2CZ6B 1BBZA 4M7DE 4V2SA 2HL5C 2FPDA 1X69A 4BE1A 2I53A 1SG5A 1VIEA 2YLCA 1X43A 4CRLB 2WSCE 2K5FA 1TWBA 4F14A 1U1TA 3RERA 2E10A 2E6NA 1TXQA 4KULA 1QVGS 3G71A 2VGNA 3H0IA 2ESWA 3JB9D 4ZTJA 2E4HA 5GAMh 4IUVA 4BBRM 4ZN1A 1SSFA 2SRCA 2VC8A 2CCHB 3HFOA 2EJGA 4FYXB 4YOOA 4EOQB 3JCMJ 1TOVA 1UG1A 1JEGA 1SEMA 2KR6A 1RABB 2F1LA 4AKIA 4M77G 4RUGA 3VS2A 1KFZA 1Q81C 1T3SA 4OR5B 5LJ5g 1K0SA 2E41A 4FU6A 2FRWA 5A2QE 4RCCA 1B07A 2K5LA 3VS0A 3CC2T 2EQKA 2HKQB 4R56A 4AT1B 4FT2A 1OU9A 5CK9A 1X6GA 1VQLQ 4M78C 1OX8A 2C06A 5GMKh 4MFEA 3CCSQ 2RJFA 3KHIA 2QEXA 4O5VA 4E7SA 2GTOA 1ZSGA 3M56A 3VJPA 3CCEA 1ZA2B 1SSHA 2LVMA 4E7ZA 1TG0A 5J39A 1P92A 3G6EA 1X6BA 3HO8A 3HBLA 1D1BA 2C5XB 5HCKA 1FX7A 2M0OA 2EAYA 1YCSB 4M7DB 3JB9G 4IUQA 5IHYA 3V8LA 3MP8A 1RAEB 1UE9A 4C8QG 1F1BB 1Q95G 5DY9A 4CFNB 4EMKB 2NYSA 3NFCA 1G3WA 3PT9A 1OQKA 3BLHB 1X75C 2KMTA 1YWPA 1VQ4A 3ZEHA 5HKCA 2I40B 2LNVA 2CP6A 4PLLA 3OYGA 2DD5B 4HCZA 1H92A 1VQOA 2LJ0A 2F69A 3H0FA 4F7UG 4LUDA 3AT1B 1MV0B 2G6FX 1URCB 4MZPA 3S3MA 2K2MA 2OTJA 5A0LA 1XJWB 5LJ5f 3PGGA 1M4ZA 4RTXA 3KUFA 1WHMA 3IQLA 3CCMT 1M3CA 1XTDA 3VRYA 4M78D 2P84A 2NUTA 2EPDA 1G3SA 1E6GA 4EOIB 1AWJA 2HZYA 2XU8A 1F5QB 4LDVA 2JT4A 3KFVA 3CCLT 5LJ3j 3JCMe 4EC9B 1G2BA 3LX7A 2DZ9A 1TUDA 4HNTA 2R58A 4M77A 4XTUA 4YOSA 4Y28E 2C5NB 2V8JA 2LQWA 3CMEQ 3SFMA 5GAMg 2VB6A 4AG2C 2RI2A 4DEYA 2PQWA 2V1RA 2YUNA 3M5AA 1YJ9A 2KK4A 8ATCB 2NUZA 3O5ZA 1JJ2S 2NUPB 3H9NA 1OI9B 1QLBA 4QQGA 1VQ6Q 1QLYA 1WYXA 2K6DA 4F6UB 4D8DA 5LJ3e 2LDMA 4C92C 5A0GA 8AT1B 4IUUA 1KIKA 1PKDB 2P4TA 1AWXA 1TFBA 4LD6A 1HYOA 1ZUYA 3M57A 2NLUA 2CSQA 1DJ7B 3I56A 1QVGP 5KE3A 4LUEA 4JLGA 3RKWA 1N9RA 4B9WA 4JJNK 5IHNA 1NZ9A 4JX6A 4M78G 3E9FA 2CZ7B 1YJNT 4JX4A 2L89A 4E47A 2Y90A 3TSZA 5KH6A 4BCND 3UA6A 3SD4A 2WACA 4M75C 5ICPB 1U06A 2HBPA 1I81A 2ZGWA 2D9TA 2D8HA 2W0ZA 5KYUB 1Q86R 1YJWT 2QDJA 4C5EA 4NL3A 4M7DF 2EGAA 1WQWA 3REAB 4YOZA 3BLQB 2CDTA 1TSFA 3HFNA 1U3OA 2LZ6B 4BCIB 3FLGA 2BZ8A 4MDXA 1UGPB 3M03A 4JX5A 1VQ8A 1Q81U 2XD0A 4XU2A 4JPBW 3JRZA 1QP3A 1R0BG 5CKEA 1UHFA 4XU1A 2EJFA 3OS5A 1QVGA 3L1AA 2LTOA 1WLPB 1AOJA 1VQ7T 3M9QA 2RK2A 1PKSA 1BI0A 4C92D 4FYVB 4F7NB 1PD0A 2EYYA 3BDUA 5DLQE 2J6OA 1AEYA 2OTLA 4PJOE 2NUPA 1Q7YR 1XQHA 2DD4A 1VUBA 2IG0A 2GCXA 4C8QF 3C94A 5KCHA 2CS7A 4OB2B 3FEOA 2XMFA 2DILA 1WJQA 1HK9A 4J6WA 2E5QA 4GBQA 4M75D 1VQ9A 5IN1A 4JS5A 1AZGB 2ZAEA 3CXCS 3OYMA 2M02A 3O8VA 4PFPA 2IW8B 2DJZA 2RN8A 2XHCA 4OMMA 1AD6A 1VQNA 2K9GA 1VQKA 2L3PA 2DAQA 3MJXA 3GNFB 1OYXA 2VVKA 1Y07A 1U8RA 1JQQA 2V22B 3G7ZA 2JXBA 1A0NB 3OYLA 1IREB 4HNVA 3EGDA 2DIQA 2EYXA 3HZJA 3CCUQ 4IUTA 5FRMA 2X3WD 1RAFB 4CC7A 1GUXA 1W4SA 3DLMA 2WFYB 1VQLT 1WDXA 4QVCA 3MEUA 2B9RA 1WIEA 1B34B 4JJCA 2R5MA 3CCST 2MWPA 3RMSA 3HSBA 1D0ZA 3GTMS 4C0DC 5GANg 4J5YA 3G6EQ 1TUCA 4FSXA 4ZTFA 4RTUA 1X6OA 4DQ2A 3H6ZA 3NDQA 2E6ZA 1X2KA 1I0CA 4HCCA 2RK1A 5KYNA 1EIFA 1R77A 1WFWA 3B57A 1JRIA 4CC3A 2FRYA 1BB9A 4M75G 4PJOB 1VOMA 3J81E 2PU9B 4P5NA 1VQ4Q 3EG9B 3MP6A 1ZSZB 4LE9A 2PMIB 1WNLA 3JCMW 1P5EB 1K1ZA 4AG1C 3EGXA 2D8JA 4IKFA 3CC4A 4BACA 2KVQG 2L0AA 4BCPB 4ELLA 4DBQA 1W70A 3N5BB 2AKKA 2AIRB 1TTHB 4XAXB 1WZOA 4HKEA 2WIHB 3DB4A 2K79A 1WJSA 1YIJQ 4JRPA 4K11A 3QIIA 3C12A 1YITA 2DYBA 1IRXA 3LLRA 3CC7A 1N27A 1UEBA 1S72A 2DFUA 5CKHA 4CRIA 2DMEA 1G8XA 2PVGB 4M7AE 4XTWA 2DXCB 5IH2A 1PG5B 1K0XA 2P0QA 5GANf 2QTXA 4A4HA 1OULA 2EQIA 1LPLA 2RJCA 2P0KA 1OIYB 2JGZB 1D1CA 3QHSA 2C0OA 2IVXA 3EGUA 2KT8A 3EG1A 2DL7A 3RR6A 3UT1A 2AT1B 2FZCB 3FJ5A 3MI9B 2PUKB 3CMET 3UA7A 2ZPBB 1Q82R 1ZA1B 3OA6A 5EC7A 2LCCA 3HKSA 3VS6A 1K9AA 1H641 2ED1A 1MMAA 5LL6S 4KH0B 4C92A 3HL8A 2PNIA 2HCKA 2QYZA 1KC8U 3RIRA 1AWOA 4AFSC 2P4RA 3QWYA 1VQ6T 3BFMA 2J05A 2LQKA 4KH1B 4F7JB 3DB3A 5AT1B 5EJCA 2CUBA 3CCRA 4HT8A 1OX9A 2BS3A 1WHGA 1H8KA 2DE0X 1O9SA 2FPFA 4M75A 1M1KU 3EG2A 1GH6B 2JW4A 2CSIA 4LXCA 2L3SA 3OB9A 3V7SA 2EQUA 3SDZA 3C0CA 2WSFE 4BBSM 4ROCA 4CFMB 3MEWA 3I5SA 4BCHB 1NG2A 1Y57A 4AKHA 1W6XA 3JSCA 2O31A 1ZX6A 3META 4FL6A 1I07A 5GMKi 3SWNB 3VS3A 1G5VA 3OBYA 3HRUA 4J7IA 4KRTA 4FYYB 4J9CA 1AD5A 4M7AB 4II5B 3DOGB 1HSQA 3JCMg 1OPLA 1H1QB 4EMKC 2G9XB 1NPRA 2XG8D 3VS1A 1OKVB 1R0CB 4BY1X 4BCQB 1UNHD 4JS4A 3A98A 2RNAA 4II1A 4DA4A 5CIUA 1E9HB 3TU4K 4E7IA 3QO3A 5FU6B 2JM9A 4FX3B 1JXOA 2OI3A 1WXBA 1NLPC 1MHNA 5C6SA 4RTYA 4QVZA 4WF2A 5D6WA 3OMGA 4QKUA 1C1AA 4EMGA 1RAHB 1I8FA 5D6YA 3FJPA 2HEQA 2MF2A 3OYKA 4ZGEB 4EOMB 3CD6T 5LJ3g 3JB9J 1UJYA 4KUDK 4BB7A 4Y72B 2PK9B 1VYTA 1VOLA 3CCQA 4Y91A 3M59A 2K4YA 4WCIA 2RQUA 3VS7A 1WX6A 4O6JA 4CFUB 3RESA 3UPUA 3DLLA 3NTKA 4N4GA 1UGRB 3G33B 5FGKB 5L23A 4RMOA 2A36A 3EAEA 4QT7A 1QCNA 1OPKA 2DL8A 1VQMQ 3OW2P 4RG2A 4J9BA 2DO3A 1J3TA 1X27A 4BI3A 4BCGB 2DBMA 2F2VA 2BS4A 1ZBXA 5GAN2 1NEGA 4PLIA 1K73U 4XQ3A 3QUIA 2IW6B 3POMA 3LH0A 3CCUT 1HD3A 4PFZA 1I4K1 2EIFA 1BU1A 2EJ9A 4ESRA 1ZQ1A 3H0HA 3CMAQ 2ROTA 2LW4A 1YI2A 3A5ZB 4E7LA 1Q81R 4LN2A 4KBMB 1UDLA 4B9XA 2XDPA 4LDWA 1KD1C 1LOJA 3EFOB 4AFUC 2LQ8A 4XTYA 1W2BS 2KDSA 5FW9A 3OW2A 2QGSA 3I55A 1KJWA 2G3RA 4VUBA 1FMWA 2HNIA 2F5TX 3EFRA 2CT4A 4C8QE 1KHIA 1QKWA 3OYEA 3GLXA 4PNOA 2I2LA 2RQTA 2KI7A 3PTAA 3CPWP 3CCVA 4GY5A 2RHXA 2PJQA 4M7AF 2HL3A 5DLOA 4B6MA 5IT9E 2DL4A 3D7SB 4J9FA 1WJRA 4ATOA 2COZA 4PJNA 2IN3A 5I21A 2QA4T 2D6FA 1VQ5T 4F7UE 1JO8A 4FM4B 1O9KB 2I0NA 1UNGD 1ENWA 4DOWA 1K9MU 4R55A 4C5GA 3QG1A 2MPXC 1RLQC 2KT1A 4XTXA 5GAN6 2YRCA 4EC8B 1YIJT 2CCIB 2QG9B 4KT0E 4EIKA 2JTMA 2XIDA 1FINB 2GBQA 4JDSA 4OMPA 3G4SQ 2X4XA 4D6WA 2BZXA 1GFDA 1I5OB 3CPWA 3V8KA 3OYDA 1RADB 2K7AA 4C0FA 5L8RE 4NL2A 2DEQA 3GOXA 1FWZA 4F16A 1NM7A 1OV3A 2QASA 3ZL7C 5CQXA 1VQPQ 3M54A 4Q5WA 3MIAB 1UGQB 1AWWA 4E7KA 1H1SB 1OU8A 4LDXA 2DLPA 3I5RA 2C0IA 3BE3A 1M5Q1 2F2CA 4M6VA 2DXTA 5KCOA 3RGFB 2DPPB 3RMQA 5GAOl 5CKDA 3CC2A 3M55A 2XICA 2KQWA 2BKZB 4TTHA 4DOVA 2W96A 3TEEA 3PIOA 2KROA 4C8QB 2AZVA 1WHLA 1OL2B 1FYNA 1BI1A 5FU7C 1H24B 3X26B 2CP5A 2IPOB 1KQSP 1D0XA 1QVFP 3PVQA 2YDLA 4EOLB 2E3IA 1RUWA 4OF1A 2H8HA 1XNIA 4M78E 3VS5A 2JOYA 3J7AF 5GMKl 4FT4A 1D3UB 4F7UB 5ECAA 3L2QA 4ZGJB 1YBYA 3QYGB 4JUVA 4GLKA 1M8VA 2DVJA 3C4SA 3JCMc 4M7DA 2O4XB 3DKMA 3PMIA 3RDVA 1QVPA 4CFWB 2L2PA 4A53A 3X25B 2DF6A 4Z8AA 1N8RU 5L2WB 4EMKA 2EQMA 4PJOC 1AVZC 2M51A 3GPLA 2LX9A 2WXVB 2V26A 2HAXA 1H3HA 1UUEA 1KQSA 1QVFA 2KBTA 3OYIA 4J9IA 5I11A 3CCMA 3E9GA 2DD5A 1QW1A 3L42A 1KQ1A 3OMCA 3BHUB 2QK0A 2HQEA 2JM8A 5IAYA 4DEXA 5IF1B 1D0YA 4MMLA 1YHQT 1AISB 5D7UA 3LH5A 5LJ5d 3CCLA 1Z9ZA 3NGPA 3ASKA 2MMPA 2FEIA 3RKXA 1U5SA 4M77F 2E70A 3LGLA 1ABQA 1Z9QA 1KD1U 1AZEA 5GAN8 3CCQQ 4E6RA 1UGVA 3CCJQ 4L5GA 3JAME 5GJVB 3BDLA 1FMVA 1RACB 2AHJB 1NLOC 2RQVA 1IGQA 2YRDA 2CP3A 1NYFA 3VKIA 4BCKB 5I22A 5GAMf 2LCSA 2DJQA 1QCFA 1H1RB 4BD3A 4EORB 3JCMP 1GCQC 4OP0A 2FO0A 2ED0A 2AZSA 3GP8A 2RQWA 4M78B 1KC8C 1JXMA 4PJOD 1VYVA 3TNWB 3TVTA 1M1KR 3INZA 5GAOm 1VQMT 3V8JA 1QKXA 2GFAA 2EYZA 2RJEA 1T0HA 2QGFB 1KSWA 3EOCB 3G71Q 3M0UA 4E7JA 3JB9F 2C5OB 3ZFJA 3VS4A 4A54A 3H4CA 1TU0B 2W9ZA 1M1KC 2OAUA 3QZ5B 4OGCA 1SF9A 3X20B 4PKCC 1YJNA 2A28A 2EKOA 2RA2A 1NJIC 3JCMV 3CMAT 1FKMA 2KR3A 1YJWA 2FPEA 4L59A 2D0QB 5A0DA 2A37A 5GMKm 5FLXE 4XU3A 4F7UF 2HQXA 2ZZDB 3MY5B 2JTFA 4JZ3A 4JJBA 4MZTA 5KYUA 3JCMb 1VYWB 2X3XD 3EG3A 3LQ5B 1GBRA 2E65A 4M75E 2EYWA 2QDLA 4A4KA 3L2UA 3QDFA 1QMZB 2HD0A 2X4JA 1M30A 4BCFB 5J3BA 1KQ2A 1VQ7A 4AKGA 1MUZA 2LT4A 2QEXQ 3R6NA 4RTZA 3SWNC 4OB1B 3JB9I 2C5VB 1SRMA 2WMAB 2LQNA 4LDYA 3CCEQ 4C92G 1M1FA 1NYGA 1JSUB 4PJOG 5GAMd 2Z0WA 1LCKA 2YLBA 4LOCA 4HVWA 5KYWB 2QQAA 3M0TA 3QWLA 1G3YA 4ZN3A 2DRKA 3QKJA 2RHZA 3REBB 3EH2A 5KYXB 3UF4A 4NS5A 3QHRB 2JJ9A 3QHWB 5FU6C 3G4ST 3S3OA 4Y92A 2RI3A 4J6XA 5J26A 2E5KA 2RQRA 4EDUA 2CH4W 4ROEA 1M2OA 1JJ2P 1UJ0A 2W9FA 3EIDB 1WPYA 2JZ2A 1D1AA 2KRSA 1K73R 1C9BA 2KNBB 1W98B 1VQOQ 3VKGA 4KGZB 2PHGA 1VQPT 2COYA 2OTJQ 1OZ2A 4BCMB 4M78F 2CREA 1ABOA 2JS0A 3M0RA 3QPHA 4QVDA 4BCOB 1K73C 3OS2A 2J6KA 5I5ZB 3BHTB 3TNIB 1ZUKA 2MK5A 1O75A 4OMNA 5KE2A 2GTJA 4YC3B 1WHHA 4GLMA 2X51A 2DXBB 3DDQB 1VQLA 2GNCA 3S3NA 1MNDA 2ATCB 1MNEA 2GQIA 2M9UA 3CCSA 9ATCB 2LT1A 1MMNA 2LC4A 5KYYB 1JJ2A 5LQFB 2HSPA 1TUGB 5GAN3 4IMYB 4J7FA 5I2MA 2YSQA 3ME9A 4EPCA 4BI4A 1Y96B 1B34A 2L3RA 3TNHB 2V8IA 4AMCA 1CKBA 4X9CA 2DETA 2DX1A 3LW5E 1YJ9Q 3OBWA 1D3BB 2ZPEB 5GAN4 7AT1B 2HMAA 1ZBJA 4KGVB 1X01A 4F6WB 4OVAA 4CC2A 2QQSA 4AFZC 1XOVA 4BUGA 1BKBA 4PJOA 5BNJB 4A63B 4J8OA 4FW2A 4UN0A 1H25B 3QBYA 2EBPA 3EG9A 2KAFA 3TW6A 2K2VA 4CFUD 2KRMA 1ZSZA 3P8BB 2E3HA 3QWXX 2IW9B 2JMAA 2ENMA 3I56Q 2A7YA 5M9OA 1K9MC 4MMKA 5HK3A 4N4HA 1GFCA 2QDYB 2KGTA 2MOXA 2M16A 4J6YA 1WA7A 4IURA 2VKNA 2YXYA 2CP2A 2O9VA 2HDAA 1NJIU 2ECZA 1H4LD 2VWFA 3CXCP 2WEVB 4FIBA 4RKUE 1W1FA 1M9SA 5GAN5 1OIUB 2DEUA 1N5ZA 2F2WA 1VQ8Q 1PSFA 1GXIE 2DIGA 2QGGA 4M7DC 1Q7YU 1JKWA 2DXCA 3NTHA 1M2VB 1SHGA 2MAMA 3CCJT 5LJ5h 2RF0A 3GF5A 2DL3A 3CMEA 1GCQA 3X24B 1K8AU 1CSKA 1VYUA 4FYWB 3PNWC 2MWOA 5GANd 3QJ6A 3E1SA 4C92F 2VUBA 2HBWA 1N6AA 3LWHA 4BY6B 1FXXA 1X2QA 3T9NA 2OTLQ 5DQVA 2GQVA 2L8DA 2DTIA 2BKDN 2JN0A 3THKA 2GFUA 1VQ6A 5GAOp 3CXCA 3FRNA 4D8KA 3L2ZA 4Z88A 1IHWA 5C0MA 4ELZC 2RM4A 1UHCA 2SEMA 1TD6A 2LRQA 4J83A 4XU0A 1H26B 3MO8A 4HCKA 1WGSA 3G71T 1YP5A 3RNJA 4M75F 3LGFA 4ORZA 1YJNQ 2R57A 1G3TA 3U23A 1VQ9Q 5IXBA 1BK2A 3O0GD 4PK4A 1AT1B 3FDRA 5AYFA 2YUQA 2VXEA 2X4WA 2E12A 1PM3A 4C8QC 1N8RR 1FMKA 2DERA 1VQNQ 1FVVB 2XK0A 1VQKQ 2IVWA 4RCBA 4EONB 4M7DD 1V1CA 3NMZC 4KRDB 1VIFA 2H3JA 3OS1A 1N8RC 4M77E 4RG8A 4WTOB 2YHTA 2EYQA 1YWOA 3M4GA 2WHBB 4MFDA 1QCOA 1ZP2A 3H8ZA 5GANe 2YWWA 2EW3A 3JCMf 2L3QA 3SWNA 1MMDA 3SB2A 2LCLA 4BI8B 2DTHA 4M7AA 3VUBA 1KD1R 4MIMA 3A8MB 2QEXT 2XI9A 3CCET 1ZLMA 2RHYA 4X9DA 3EH1A 3WVDB 2QF7A 1JBMA 2YUOA 3OYCA 3G6ET 3SHWA 4IIOA 1OGUB 1NE8A 1S1NA 1VINA 1YNZA 5CAIA 4KRCB 2RB6A 2ABLA 3E19A 3CD6A 2CGHA 1B7TA 2IIMA 4C8QD 3JCMX 5LJ3f 1PHTA 1BYMA 3EHRA 1QWFA 2H3EB 3OS0A 3TCJA 3L2RA 1PCXA 3KXTA 2UUEB 3OYJA 4YTLA 3MY1B 2R5AA 4J9GA 3ULRB 2AK5A 5CCAA 4F70B 3CC4Q 1YCYA 1VQ4T 3MPUB 3EG0A 2XDDA 1M1GA 2KYBA 2Y4YA 1GRIA 4M7DG 2C0TA 1RAAB 1KK7A 1VQOT 3GBQA 2NUTB 2NWMA 3FB9A 3M4YA 4CI0C 5GAOn 2DZCA 2OTJT 5CYIB 1N9SA 1UTIA 1JB0E 1YITQ 1V76A 2M1HA 4HLQA 3CC7Q 1KHCA 1U1SA 2D1XA 2VASA 5HBEB 2BE7D 2UZEB 1S72Q 3X28B 5ACBA 3VRZA 2RHUA 2LJ3A 2CT3A 5GJWB 3CCUA 2ZPGB 4EOSB 4M77B 1Q82U 1UECA 1Y0MA 4A4EA 3WXMB 3RUXA 3HB9A 3JCMd 2QI2A 3FC3A 4AI6A 4HL4A 2DVEA 2EFIA 3ZBDA 4QSHA 3A8GB 3OSVA 1MMGA 1M90U 2QQRA 5IHKA 2WSEE 1E6HA 1YJ9T 3EFOA 1Y7XA 1SPKA 4J9HA 2XDBA 3I9QA 5FWCA 2EGCA 2KMGA 1Y71A 5LJ3d 1EZZB 1T3LA 3OQ5A 1SKUB 1ACMB 1HXDA 4RTTA 3CCRQ 2QA4A 4TVRA 1VQ5A 4HA8A 2JTEA 2Y4XA 4XTZA 1E7PA 3I56T 2KSSA 3PE0A 3HRTA 3HPWA 3K7AM 4DBHA 1YIJA 4EOJB 1O9KA 3PFSA 4MDWA 3VU3C 2OAWA 2C6TB 2CP0A 3R6OA 5LMKB 1BI2A 2QFZA 1OZ3A 2OX7A 4JZ4A 2W99A 4N0AC 2W10A 4F04B 1C0MA 2VGMA 3OYBA 1NBEB 4A4GA 2FL7A 1PD1A 2M0YA 3L2VA 1JU5C 4EOOB 4BDYA 3BG9A 2G77A 2O9SA 4LDUA 1VQ8T 3AHUA 4HVUA 3P8HA 1UGSB 3HTRA 4CFVB 2LX7A 2CUDA 1NPPA 3TQ7P 4Z6YA 4ZNXA 1ZSZC 1ARKA 3WVEB 3A8HB 3CQTA 3I35A 4DBFA 3EFSA 2DD4B 3HP9A 3C95A 1RI0A 4E7HA 2DKGA 1OOTA 2OTLT 4XTVA 2DK3A 2J7IA 1WI7A 1JOWA 2DBKA 5D6XA 2RD1A 2DL5A 1OEBA 3L2WA 5GANh 4BXXX 5GAOq 2QQBA 1V29B 3A8OB 4R0KA 2CKKA 4HVVA 2QQ8A 4QQ6A 1GL5A 2B86A 3TSWA 2BS2A 2QTVA 2EQJA 3MEAA 1W2BP 4C8QA 1VQ9T 1G83A 4EMHA 1T0JA 1KC8R 3BY7A 4C0ZA 5CQYA 4E2FB 2BE9B 3KBGA 2KRNA 2WMBB 3QXEB 1ZUUA 2WJ9A 2DRMA 6AT1B 1VQNT 1D09B 1VQKT 2PVDB 1PC0A 4C5HA 2HSEB 4MZMA 3EGDB 4RTVA 5LJ5j 3PIPA 3VYHB 1R8OB 5HBJB 4F7UA 1EFNA 3DJBA 3QYEA 3QDRB 1Q86C 1OI1A 4A4FA 1QQJA 1UB4A 3LYIA 1GUXB 2O4XA 2K3YA 5HY6A 4G6LB 1SRLA 4ANJA 2K3XA 5I2SA 3TN8B 2XKOC 3OYFA 3PMTA 3VYGB 3FIFA 5EFQB 2VXFA 3NTIA 1NJIR 1W2BA 2X1NB 3CPFA 1QP2A 1BU2A 4RODA 2FG0A 3M53A 1NEBA 1PRLC 3NPFA 3PO3S 5FWBA 1YI2Q 3RKYA 4C92E 3VKHA 2PUOB 4BCMD 2CH4A 1YHQA 2K57A 4F7LB 5LJ5e 1PRMC 2RPNA 2ZCFB 2BTTA 1K8AR 3GIBA 1WQ7A 3I55Q 2UZDB 1B3QA 3CD6Q 4FSSA 1TS9A 1XO2A 4OB3B 3QZ9B 1Q7YC 2EUFA 3CBPA 5GAN7 2DXUA 4IIMA 3V7RA 4DBRA 2UZLB 3EGXB 3CCVQ 2EKHA 2W2HA 2MI6A 1K8AC 1IGUA 2GF7A 2DM1A 5HQ0B 2YUPA 3JV3A 2CP7A 3UWNA 1M3BA 4X34A 1RAIB 1YN8A 5CVIA 3CC4T 1UFFA 2RHIA 1GBQA 1BIBA 2CZ0B 2K5IA 2FZKB 3BG3A 1GCPA 5IDPB 4M7AC 1VQMA 4BCNB 3MEVA 2ROLA 1YFNA 4ELYC 4RTWA 5EG2A 5FU7B 4KGXB 4F6SB 4M78A 1LNXA 4BE2A 4BY6C 5IDNB 1YITT 4NC6A 2BUDA 2KEAA 3CC7T 1H1PB 3Q1JA 4OMFB 1S72T 3EJ1B 2V8KA 2VV5A 3CBMA 1IB8A 1MGQA 1E7OA 2HQHA 3MP1A 4QW2A 1K4US 3VYGA 4I3ZB 4J9EA 1RL2A 2L5QA 2EVRA 4NOYA 4N4IA 3CMAA 1H3ZA 3A8LB 4CFXB 5CKBA 5GAMj 3QYHB 2O88A 3VV0A 2F5KA 3S6WA 3OYAA 3F5XB 5GAOr 2FVUA 4PJMA 2X4YA 3DTOA 4C92B 4F7SB 2VYTA 2BIVA 3JCMh 2J06A 4HXJA 2UZBB 2KY9A 2ZZDA 3CC2Q 3OSSC 1HJDA 4IUPA 1OL1B 2ZPHB 2AKLA 4HCBA 2QA4Q 2EWNA 2EGEA 3OW2S 1VQ5Q 1VA7A 2DYIA 4M7AD 2B8AA 3P8DA 2CZ1B 4M75B 5GAMe 2KXCA 2JUFA 3CCRT 4OMQA 1K76A 3TW7A 4OMLA 5GMKj 4BCQD 2PVOB 3DDPB 2X9HA 3GNGA 3RBBB 3M0SA 4UC4A 3LWIA 5LJ3h 4ELJA 4BY7X 4QQDA 1AHJB 2FHDA 2JS2A 1LJOA 1BCOA 2WPAB 5KYWA 3URGA 5IHIA 2LMJA 4NSTB 3J80E 1H28B 4JRKA 2MCNA 2BPMB 4N0AA 2YT6A 2JMCA 5FRNA 4ME7A 3G4SA 3M0PA 4JJDA 2DTOA 4OB0B 2MIOA 3MHXA 1IXDA 3QSUA 5KYXA 2RI5A 5HBHB 1I5LA 1K9MR 4LNPA 1M27C 5FROA 1ZHIA 1RAGB 4PFOA 2HKNA 2COWA 3UATA 4FCYA 4PJLA 1MV3A 1Q86U 1VQPA 5GMKe 2R7GA 5HVYB 2RO0A 2F2XA 4KUIA 1M8MA 5HK0A 1WXTA 3CBOA 4M4ZA 1BI3A 3CPWS 2QAZA 3CCMQ 5CKFA 3SEMA 4OMOA 2O01E 4XK8E 2A0FB 2YRVA 3MCAB 1WHKA 3BW1A 5DQWA 3G1JA 3OYNA 1PWTA 3HRSA 2RH2A 1Q82C 3CCLQ 4JRQA 4CC4B 5CO7A 4BCJB 4M7AG 3MKDA 2PZ1A 3UDCA 1M90R 2WIPB 2X35A 1G3NC 2E1HA 5HNBB 2KE9A 2P0PA 1I1JA 2A3LA 3F70A 2DXBA 2A08A 1IO6A 2RMOA 3EHQA 4EOKB 2JVVA 3BG5A 4Z89A 1OKWB 1EX4A 1N4MA 3OY9A 2OJ2A 4M77C 3CCQT 5KYYA 2CJMB 1M90C 2LNHB 3JB9H 2V1QA 1GY3B 1UNLD 3OYYA 2E64A 1RLPC 1PNJA 1QWEA 1Y96A 1CKAA
chains in the Genus database with same CATH topology
2QQ9A 2RK1A 4HCCA 3M4YA 5IAYA 1EIFA 4CI0C 5GAOn 5DM7R 2DZCA 4BE0A 2OTJT 4PJOF 4Z02A 1N9SA 4MMLA 1JRIA 5CR2A 1JB0E 1YHQT 3VUZA 2FB7A 3HHTB 1D3BA 4C0GA 5LJ5d 2ZPFB 4HLQA 2M1HA 3CCLA 1KHCA 1U1SA 3DL1A 3ASKA 2MMPA 4M75G 4PJOB 3RKXA 4M77F 2E70A 3LGLA 3J81E 3X28B 2RJDA 2PU9B 2RHUA 1KD1U 4LD9K 2CYZB 4P5NA 3CCUA 5GAN8 2ZPGB 3MP6A 4M77B 1Q82U 4OGEA 1KG1A 4C0DB 4BDZA 1WNLA 4L5GA 4A4EA 3WXMB 3JAME 3JCMW 3RUXA 3HB9A 3BDLA 2AHJB 2JNGA 3ER0A 3JCMd 2QI2A 3CC4A 3FC3A 4AI6A 4ZGDB 4BACA 4IKFA 2KVQG 4HL4A 3VKIA 2QXFA 1TH7A 5GAMf 5GANj 3N5BB 2DVEA 2ZPIB 2EFIA 4JRIA 4BD3A 3ZBDA 3JCMP 3CEYA 3JCMQ 4XAXB 4QSHA 3A8GB 3FB9A 3OSVA 4OP0A 3TREA 4HT9A 4HKEA 1YI2T 3DB4A 1WJSA 3GP8A 1M90U 3QJYA 2QQRA 4JRPA 2WSEE 4M78B 2FYKA 1KC8C 1KQSS 1QVFS 3QIIA 3C12A 4C5IA 4PJOD 1YITA 1YJ9T 3LLRA 3CC7A 3INZA 4JLIA 5GAOm 1VQMT 1N27A 3V8JA 1UEBA 2GFAA 1S72A 1Y7XA 2RJEA 3I55T 4M77D 4PL6A 5CKHA 4CRIA 2XDBA 2PVGB 4E7JA 4M7AE 4XTWA 3JB9F 3ZFJA 4A54A 2KMGA 3QYBA 2DXCB 3CCJA 3H4CA 1Y71A 5LJ3d 2P0QA 3OQ5A 3OYHA 5GANf 1PSEA 2QTXA 2OAUA 3CCVT 1M1KC 3QZ5B 1HXDA 4OGCA 4A4HA 2QA4A 4TVRA 3X20B 2P0KA 2RJCA 4PKCC 1YJNA 1VQ5A 3QHSA 4HA8A 4HNUA 1IZ6A 2Y4XA 1BIAA 2EKOA 2RA2A 3M58A 3UT1A 4XTZA 1NJIC 3JCMV 3V7CA 1E7PA 4L6V5 3I56T 2KSSA 3CMAT 1FKMA 2PUKB 3HRTA 2CZ6B 3CMET 3HPWA 1YJWA 4M7DE 4V2SA 4L59A 2D0QB 2ZPBB 5A0DA 4BE1A 5GMKm 5FLXE 4XU3A 1YIJA 3OA6A 4F7UF 2HQXA 2LCCA 3HKSA 3PFSA 2ZZDB 2JTFA 1H641 1VIEA 2YLCA 4MDWA 2WSCE 2K5FA 3VU3C 5LL6S 4MZTA 1U1TA 3R6OA 3RERA 4C92A 2E10A 1BI2A 2QFZA 3HL8A 2E6NA 1OZ3A 4KULA 3JCMb 1QVGS 3G71A 2E65A 4M75E 1KC8U 2VGNA 4N0AC 3RIRA 4A4KA 2VGMA 1VQ6T 3OYBA 3JB9D 3BFMA 4ZTJA 4A4GA 3L2UA 2FL7A 2LQKA 2HD0A 5GAMh 4IUVA 2X4JA 3DB3A 3L2VA 5J3BA 4BBRM 5EJCA 1SSFA 4ZN1A 3CCRA 4BDYA 1VQ7A 3BG9A 4AKGA 2VC8A 4HT8A 1KQ2A 2G77A 4LDUA 2LT4A 1VQ8T 3AHUA 3P8HA 3HFOA 2EJGA 2BS3A 3SWNC 4OB1B 3JB9I 1UGSB 4LDYA 1O9SA 4C92G 1M1KU 4M75A 3JCMJ 1M1FA 4PJOG 5GAMd 1NPPA 4Z6YA 2YLBA 4LOCA 3WVEB 3OB9A 3A8HB 3V7SA 2QQAA 2KR6A 3EFSA 4AKIA 2EQUA 2DD4B 3HP9A 3QWLA 4M77G 3SDZA 2WSFE 3C95A 4BBSM 1Q81C 1RI0A 4E7HA 1G3YA 2DKGA 3MEWA 4ZN3A 3QKJA 2RHZA 2OTLT 4XTVA 5LJ5g 2DK3A 4AKHA 3JSCA 2E41A 4FU6A 5D6XA 2RD1A 5A2QE 3L2WA 4NS5A 3META 4FL6A 4RCCA 5GANh 2QQBA 5GAOq 2K5LA 1V29B 5GMKi 3CC2T 2EQKA 4R56A 3SWNB 4FT2A 3A8OB 3OBYA 2CKKA 5FU6C 5CK9A 3HRUA 4J7IA 3G4ST 1G5VA 2QQ8A 3S3OA 4M78C 2RI3A 4J6XA 4QQ6A 5J26A 5GMKh 2C06A 4MFEA 4M7AB 4EDUA 2BS2A 3MEAA 2EQJA 2RJFA 3KHIA 3JCMg 2QEXA 4O5VA 4EMKC 4C8QA 1NPRA 2XG8D 1WPYA 2JZ2A 3M56A 3VJPA 1VQ9T 3CCEA 4EMHA 3VKGA 2LVMA 3BY7A 4C0ZA 5CQYA 1VQPT 4JS4A 4DA4A 4II1A 5J39A 3KBGA 1P92A 5CIUA 3G6EA 3HO8A 3HBLA 1OZ2A 3QXEB 2WJ9A 4M78F 3TU4K 1VQNT 4E7IA 1VQKT 1FX7A 2M0OA 2PVDB 3QPHA 2EAYA 4C5HA 4QVDA 3QO3A 5FU6B 4M7DB 3PIPA 4MZMA 3JB9G 1K73C 5LJ5j 3OS2A 3VYHB 1R8OB 4IUQA 3V8LA 3MP8A 1MHNA 4F7UA 5C6SA 5KE2A 1O75A 3QYEA 3QDRB 4C8QG 4QVZA 1Q86C 4WF2A 5D6WA 3OMGA 1OI1A 5DY9A 1UB4A 3LYIA 4A4FA 3NFCA 4EMGA 1G3WA 1I8FA 4EMKB 2DXBB 5D6YA 3FJPA 3OYKA 2MF2A 2O4XA 2K3YA 3PT9A 5HY6A 3S3NA 1VQLA 4ZGEB 2K3XA 2KMTA 1X75C 5I2SA 2XKOC 5LJ3g 3JB9J 3CD6T 4KUDK 4BB7A 3OYFA 1VQ4A 3PMTA 2M9UA 3ZEHA 3VYGB 3FIFA 5HKCA 2VXFA 2LT1A 3NTIA 3CCSA 2LNVA 3CCQA 4Y91A 1W2BA 2LC4A 3M59A 1JJ2A 4PLLA 3OYGA 2K4YA 3CPFA 1QP2A 5GAN3 4J7FA 4O6JA 5I2MA 3RESA 2DD5B 3UPUA 4HCZA 3DLLA 3ME9A 3M53A 1VQOA 2F69A 3NTKA 4N4GA 4EPCA 4F7UG 4BI4A 1UGRB 1Y96B 1B34A 3RKYA 4C92E 2L3RA 4MZPA 4RMOA 3VKHA 3S3MA 2PUOB 2V8IA 2OTJA 5A0LA 5LJ5f 3EAEA 3PGGA 1M4ZA 1YHQA 4X9CA 2K57A 3KUFA 3LW5E 3CCMT 5LJ5e 3OBWA 1D3BB 2ZPEB 1XTDA 5GAN4 4M78D 2ZCFB 4OVAA 1X01A 1G3SA 4RG2A 3GIBA 1WQ7A 2DO3A 2XU8A 4BI3A 4LDVA 4OB3B 2QQSA 3QZ9B 2BS4A 1ZBXA 5GAN2 3CCLT 1XOVA 4PLIA 1Q7YC 5GAN7 3CBPA 1BKBA 4XQ3A 4BUGA 2DXUA 3QUIA 1K73U 4PJOA 3V7RA 4J8OA 5LJ3j 3JCMe 3QBYA 3LX7A 2DZ9A 2MI6A 3LH0A 3CCUT 2KAFA 3TW6A 1K8AC 2K2VA 2GF7A 4HNTA 2R58A 3P8BB 4M77A 1I4K1 4XTUA 1YJNT 2EIFA 2EJ9A 1ZQ1A 3UWNA 4Y28E 2V8JA 4X34A 2A7YA 5CVIA 5M9OA 1K9MC 3CC4T 3SFMA 3A5ZB 4MMKA 5HK3A 1YI2A 2RHIA 4N4HA 5GAMg 4E7LA 2QDYB 2RI2A 1BIBA 2CZ0B 2PQWA 4KBMB 2K5IA 4B9XA 2XDPA 4LDWA 2M16A 3BG3A 1KD1C 4J6YA 3M5AA 1YJ9A 1LOJA 2KK4A 4M7AC 4IURA 2LQ8A 4XTYA 1VQMA 2KDSA 1W2BS 1JJ2S 3MEVA 4ELYC 3OW2A 5EG2A 3I55A 5FU7B 2G3RA 4VUBA 1NJIU 4M78A 1LNXA 2HNIA 4BE2A 2F5TX 4BY6C 3EFRA 1QLBA 4QQGA 1YITT 4C8QE 5LJ3e 4NC6A 2LDMA 1KHIA 2BUDA 4FIBA 4RKUE 4C92C 5A0GA 3OYEA 1M9SA 3GLXA 3CC7T 4PNOA 4IUUA 3Q1JA 2I2LA 4OMFB 5GAN5 2V8KA 2VV5A 3CBMA 3PTAA 3CCVA 1S72T 2P4TA 1MGQA 4GY5A 1GXIE 3MP1A 1PSFA 4QW2A 3VYGA 2DIGA 2RHXA 4M7AF 4LD6A 5DLOA 4M7DC 1Q7YU 1RL2A 2L5QA 3M57A 2NLUA 2DXCA 4NOYA 3NTHA 2MAMA 1DJ7B 3CCJT 5IT9E 4N4IA 3I56A 5LJ5h 5KE3A 1WJRA 4JLGA 3RKWA 1N9RA 4B9WA 3CMAA 4JJNK 4ATOA 3GF5A 3A8LB 3CMEA 2QA4T 3X24B 5I21A 1NZ9A 5CKBA 1K8AU 2D6FA 4JX6A 4M78G 5GAMj 3E9FA 2CZ7B 3QYHB 2MWOA 3PNWC 4JX4A 3QJ6A 2L89A 4E47A 4F7UE 4FM4B 5GANd 3E1SA 2Y90A 4C92F 3VV0A 5KH6A 2VUBA 2F5KA 3S6WA 3OYAA 5GAOr 1N6AA 2FVUA 4BY6B 3SD4A 2WACA 4M75C 4DOWA 3LWHA 2HBPA 1I81A 2ZGWA 2D9TA 4C5GA 3QG1A 4R55A 1U8RA 1K9MU 1FXXA 2X4YA 3T9NA 2GQVA 4C92B 1YJWT 2QDJA 2VYTA 2BIVA 4XTXA 4C5EA 2L8DA 2DTIA 3JCMh 5GAN6 4NL3A 1VQ5T 4M7DF 2BKDN 1WQWA 1YIJT 2KY9A 2JN0A 4KT0E 2ZZDA 2JTMA 2GFUA 2XIDA 1VQ6A 4JDSA 3OSSC 5GAOp 3FRNA 3HFNA 3CXCA 3L2ZA 4IUPA 2X4XA 4ELZC 4D6WA 3FLGA 5C0MA 2RM4A 4MDXA 4XU0A 2ZPHB 2LRQA 4J83A 1UGPB 3V8KA 3CPWA 4HCBA 3MO8A 1WGSA 3OYDA 3G71T 4JX5A 2EWNA 1VQ8A 1Q81U 2XD0A 4M75F 4XU2A 3LGFA 4C0FA 3OW2S 2R57A 1G3TA 3JRZA 5L8RE 4NL2A 1QP3A 2DEQA 5CKEA 4M7AD 2B8AA 4XU1A 2EJFA 3OS5A 3P8DA 3GOXA 1FWZA 3FDRA 2CZ1B 4M75B 5GAMe 3L1AA 5AYFA 1QVGA 2VXEA 2LTOA 2JUFA 5CQXA 5GAOl 2X4WA 3CCRT 3M54A 4Q5WA 1VQ7T 1UGQB 3M9QA 2E12A 4E7KA 4C8QC 2RK2A 3TW7A 5GMKj 2PVOB 3GNGA 4LDXA 1BI0A 4C92D 2XK0A 3BDUA 4UC4A 3LWIA 5DLQE 4ELJA 4QQDA 5LJ3h 1AHJB 2OTLA 2FHDA 4PJOE 2IVWA 1LJOA 1M5Q1 4RCBA 3URGA 4M6VA 2DXTA 4M7DD 5KCOA 3J80E 4JRKA 2DPPB 1XQHA 1VIFA 2DD4A 2H3JA 4N0AA 3RMQA 5CKDA 1VUBA 2IG0A 3OS1A 3M55A 1N8RC 4M77E 3CC2A 5FRNA 4RG8A 4ME7A 3G4SA 2XICA 2KQWA 2GCXA 2DTOA 4OB0B 2YHTA 3MHXA 4C8QF 2EYQA 3C94A 5KCHA 2CS7A 4DOVA 4OB2B 3QSUA 3TEEA 3M4GA 3FEOA 4MFDA 2RI5A 3PIOA 1WJQA 1HK9A 4J6WA 3H8ZA 5GANe 1I5LA 2E5QA 4C8QB 3JCMf 4M75D 5FROA 3SWNA 1ZHIA 1VQ9A 1H3ZA 3SB2A 1BI1A 5FU7C 5IN1A 4JS5A 3X26B 2LCLA 4BI8B 2DTHA 1Q86U 1VQPA 3CXCS 3VUBA 5GMKe 3OYMA 4MIMA 2RO0A 4M7AA 3A8MB 3O8VA 2QEXT 2DJZA 4KUIA 4OF1A 2XHCA 5HK0A 1XNIA 2XI9A 3CBOA 1BI3A 4M78E 3CPWS 2JOYA 1VQNA 5CKFA 3CCET 1VQKA 3J7AF 2RHYA 2DAQA 5GMKl 4FT4A 4X9DA 2O01E 4XK8E 3WVDB 4F7UB 2YRVA 3GNFB 2QF7A 1JBMA 3L2QA 4ZGJB 1OYXA 3MCAB 1Y07A 3OYCA 1YBYA 3G6ET 3QYGB 3BW1A 4JUVA 3OYNA 1NE8A 4GLKA 3HRSA 3G7ZA 2RH2A 1M8VA 1Q82C 5CAIA 3C4SA 3JCMc 1IREB 3OYLA 4JRQA 4M7DA 4HNVA 2O4XB 2RB6A 3DKMA 3PMIA 1QVPA 5CO7A 4M7AG 2DIQA 3E19A 3CD6A 2CGHA 3JCMX 4A53A 3UDCA 4C8QD 3HZJA 2X35A 5LJ3f 4IUTA 1BYMA 3X25B 3OS0A 2E1HA 1N8RU 5FRMA 2P0PA 3TCJA 2EQMA 4EMKA 2A3LA 3L2RA 3F70A 1W4SA 3DLMA 2DXBA 4PJOC 3KXTA 3GPLA 2LX9A 3OYJA 4YTLA 1VQLT 2R5AA 4QVCA 2JVVA 3MEUA 3BG5A 1KQSA 2HAXA 5CCAA 1QVFA 1YCYA 1VQ4T 1B34B 3CCST 2R5MA 2XDDA 3OY9A 1M1GA 2MWPA 4M77C 3RMSA 3CCQT 3HSBA 4C0DC 1M90C 5GANg 2Y4YA 4J5YA 3OYIA 3CCMA 3JB9H 4FSXA 4ZTFA 3E9GA 2DD5A 4M7DG 1X6OA 1QW1A 1VQOT 3L42A 4DQ2A 3H6ZA 2E64A 2E6ZA 1KQ1A 3OYYA 3OMCA 1Y96A 2HQEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 E;  2ZPE B;  5L8R E;  1QP3 A;  2ZCF B;  1JB0 E;  2CZ1 B;  3HHT B;  4OB1 B;  2ZPF B;  1UGS B;  1UGQ B;  4OB3 B;  3X28 B;  3QZ9 B;  2PU9 B;  2CYZ B;  2PVO B;  2ZPG B;  3WVE B;  3A8H B;  1AHJ B;  2DD4 B;  2WSF E;  2AHJ B;  4ZGD B;  2DPP B;  2DD4 A;  4Y28 E;  4OB0 B;  2ZPI B;  2QDY B;  1V29 B;  4OB2 B;  2CZ0 B;  3A8G B;  3A8O B;  2WSE E;  3X26 B;  3A8M B;  2PVG B;  4RKU E;  2DXC B;  1GXI E;  2O01 E;  1PSF A;  3QXE B;  4XK8 E;  3VYG A;  3WVD B;  1PSE A;  4ZGJ B;  2PVD B;  3QZ5 B;  3QYG B;  2DXC A;  3X20 B;  1DJ7 B;  3VYH B;  3A8L B;  1IRE B;  3X24 B;  2CZ7 B;  3QYH B;  4L6V 5;  4FM4 B;  2DXB B;  2PUK B;  2CZ6 B;  3X25 B;  2D0Q B;  4ZGE B;  2ZPB B;  3VYG B;  2DXB A;  2ZZD B;  2WSC E;  1QP2 A;  4KT0 E;  2ZZD A;  2DD5 B;  1UGR B;  2DD5 A;  2PUO B;  2ZPH B;  1UGP B; 
#chains in the Genus database with same CATH topology
 2QQ9 A;  1PKT A;  2DMO A;  2KYM A;  5DM7 R;  4BE0 A;  4PJO F;  4Z02 A;  1BCM A;  5CR2 A;  2DNU A;  3VUZ A;  2FB7 A;  2BZY A;  3HHT B;  1D3B A;  4C0G A;  2ZPF B;  3DL1 A;  2MYS A;  2RJD A;  3H41 A;  4LD9 K;  2CYZ B;  4OGE A;  1KG1 A;  4C0D B;  4BDZ A;  1KXU A;  2O2O A;  4PJJ A;  2LJ1 A;  2JNG A;  3ER0 A;  2KXD A;  1WXU A;  2K3B A;  4ZGD B;  4EOP B;  2QXF A;  1TH7 A;  4OGR B;  5GAN j;  4AFQ C;  2ZPI B;  2FZG B;  4JRI A;  1YHQ Q;  1WHJ A;  2J6F A;  3CEY A;  2LP5 A;  3JCM Q;  3TRE A;  4HT9 A;  1YJW Q;  1YI2 T;  5IXF A;  3QJY A;  5CEI B;  2FYK A;  1KQS S;  1QVF S;  4C5I A;  1IHV A;  4JLI A;  2C4G B;  1JST B;  1SHF A;  1M3A A;  1RI9 A;  3I55 T;  4M77 D;  4PL6 A;  2GGR A;  3E2U A;  1LVK A;  4F17 A;  2PTK A;  3BLR B;  3QYB A;  1C6V X;  3CCJ A;  1QMC A;  4J9D A;  4FW1 A;  3OYH A;  3A1P A;  3M0Q A;  1PSE A;  3CCV T;  3NHN A;  2PK2 A;  2DA9 A;  1VQ7 Q;  4X1V A;  4HNU A;  1IZ6 A;  1H27 B;  1BIA A;  2D0N A;  1M2V A;  3M58 A;  3V7C A;  4CXA B;  4L6V 5;  3BHV B;  3PVL A;  2CZ6 B;  1BBZ A;  4M7D E;  4V2S A;  2HL5 C;  2FPD A;  1X69 A;  4BE1 A;  2I53 A;  1SG5 A;  1VIE A;  2YLC A;  1X43 A;  4CRL B;  2WSC E;  2K5F A;  1TWB A;  4F14 A;  1U1T A;  3RER A;  2E10 A;  2E6N A;  1TXQ A;  4KUL A;  1QVG S;  3G71 A;  2VGN A;  3H0I A;  2ESW A;  3JB9 D;  4ZTJ A;  2E4H A;  5GAM h;  4IUV A;  4BBR M;  4ZN1 A;  1SSF A;  2SRC A;  2VC8 A;  2CCH B;  3HFO A;  2EJG A;  4FYX B;  4YOO A;  4EOQ B;  3JCM J;  1TOV A;  1UG1 A;  1JEG A;  1SEM A;  2KR6 A;  1RAB B;  2F1L A;  4AKI A;  4M77 G;  4RUG A;  3VS2 A;  1KFZ A;  1Q81 C;  1T3S A;  4OR5 B;  5LJ5 g;  1K0S A;  2E41 A;  4FU6 A;  2FRW A;  5A2Q E;  4RCC A;  1B07 A;  2K5L A;  3VS0 A;  3CC2 T;  2EQK A;  2HKQ B;  4R56 A;  4AT1 B;  4FT2 A;  1OU9 A;  5CK9 A;  1X6G A;  1VQL Q;  4M78 C;  1OX8 A;  2C06 A;  5GMK h;  4MFE A;  3CCS Q;  2RJF A;  3KHI A;  2QEX A;  4O5V A;  4E7S A;  2GTO A;  1ZSG A;  3M56 A;  3VJP A;  3CCE A;  1ZA2 B;  1SSH A;  2LVM A;  4E7Z A;  1TG0 A;  5J39 A;  1P92 A;  3G6E A;  1X6B A;  3HO8 A;  3HBL A;  1D1B A;  2C5X B;  5HCK A;  1FX7 A;  2M0O A;  2EAY A;  1YCS B;  4M7D B;  3JB9 G;  4IUQ A;  5IHY A;  3V8L A;  3MP8 A;  1RAE B;  1UE9 A;  4C8Q G;  1F1B B;  1Q95 G;  5DY9 A;  4CFN B;  4EMK B;  2NYS A;  3NFC A;  1G3W A;  3PT9 A;  1OQK A;  3BLH B;  1X75 C;  2KMT A;  1YWP A;  1VQ4 A;  3ZEH A;  5HKC A;  2I40 B;  2LNV A;  2CP6 A;  4PLL A;  3OYG A;  2DD5 B;  4HCZ A;  1H92 A;  1VQO A;  2LJ0 A;  2F69 A;  3H0F A;  4F7U G;  4LUD A;  3AT1 B;  1MV0 B;  2G6F X;  1URC B;  4MZP A;  3S3M A;  2K2M A;  2OTJ A;  5A0L A;  1XJW B;  5LJ5 f;  3PGG A;  1M4Z A;  4RTX A;  3KUF A;  1WHM A;  3IQL A;  3CCM T;  1M3C A;  1XTD A;  3VRY A;  4M78 D;  2P84 A;  2NUT A;  2EPD A;  1G3S A;  1E6G A;  4EOI B;  1AWJ A;  2HZY A;  2XU8 A;  1F5Q B;  4LDV A;  2JT4 A;  3KFV A;  3CCL T;  5LJ3 j;  3JCM e;  4EC9 B;  1G2B A;  3LX7 A;  2DZ9 A;  1TUD A;  4HNT A;  2R58 A;  4M77 A;  4XTU A;  4YOS A;  4Y28 E;  2C5N B;  2V8J A;  2LQW A;  3CME Q;  3SFM A;  5GAM g;  2VB6 A;  4AG2 C;  2RI2 A;  4DEY A;  2PQW A;  2V1R A;  2YUN A;  3M5A A;  1YJ9 A;  2KK4 A;  8ATC B;  2NUZ A;  3O5Z A;  1JJ2 S;  2NUP B;  3H9N A;  1OI9 B;  1QLB A;  4QQG A;  1VQ6 Q;  1QLY A;  1WYX A;  2K6D A;  4F6U B;  4D8D A;  5LJ3 e;  2LDM A;  4C92 C;  5A0G A;  8AT1 B;  4IUU A;  1KIK A;  1PKD B;  2P4T A;  1AWX A;  1TFB A;  4LD6 A;  1HYO A;  1ZUY A;  3M57 A;  2NLU A;  2CSQ A;  1DJ7 B;  3I56 A;  1QVG P;  5KE3 A;  4LUE A;  4JLG A;  3RKW A;  1N9R A;  4B9W A;  4JJN K;  5IHN A;  1NZ9 A;  4JX6 A;  4M78 G;  3E9F A;  2CZ7 B;  1YJN T;  4JX4 A;  2L89 A;  4E47 A;  2Y90 A;  3TSZ A;  5KH6 A;  4BCN D;  3UA6 A;  3SD4 A;  2WAC A;  4M75 C;  5ICP B;  1U06 A;  2HBP A;  1I81 A;  2ZGW A;  2D9T A;  2D8H A;  2W0Z A;  5KYU B;  1Q86 R;  1YJW T;  2QDJ A;  4C5E A;  4NL3 A;  4M7D F;  2EGA A;  1WQW A;  3REA B;  4YOZ A;  3BLQ B;  2CDT A;  1TSF A;  3HFN A;  1U3O A;  2LZ6 B;  4BCI B;  3FLG A;  2BZ8 A;  4MDX A;  1UGP B;  3M03 A;  4JX5 A;  1VQ8 A;  1Q81 U;  2XD0 A;  4XU2 A;  4JPB W;  3JRZ A;  1QP3 A;  1R0B G;  5CKE A;  1UHF A;  4XU1 A;  2EJF A;  3OS5 A;  1QVG A;  3L1A A;  2LTO A;  1WLP B;  1AOJ A;  1VQ7 T;  3M9Q A;  2RK2 A;  1PKS A;  1BI0 A;  4C92 D;  4FYV B;  4F7N B;  1PD0 A;  2EYY A;  3BDU A;  5DLQ E;  2J6O A;  1AEY A;  2OTL A;  4PJO E;  2NUP A;  1Q7Y R;  1XQH A;  2DD4 A;  1VUB A;  2IG0 A;  2GCX A;  4C8Q F;  3C94 A;  5KCH A;  2CS7 A;  4OB2 B;  3FEO A;  2XMF A;  2DIL A;  1WJQ A;  1HK9 A;  4J6W A;  2E5Q A;  4GBQ A;  4M75 D;  1VQ9 A;  5IN1 A;  4JS5 A;  1AZG B;  2ZAE A;  3CXC S;  3OYM A;  2M02 A;  3O8V A;  4PFP A;  2IW8 B;  2DJZ A;  2RN8 A;  2XHC A;  4OMM A;  1AD6 A;  1VQN A;  2K9G A;  1VQK A;  2L3P A;  2DAQ A;  3MJX A;  3GNF B;  1OYX A;  2VVK A;  1Y07 A;  1U8R A;  1JQQ A;  2V22 B;  3G7Z A;  2JXB A;  1A0N B;  3OYL A;  1IRE B;  4HNV A;  3EGD A;  2DIQ A;  2EYX A;  3HZJ A;  3CCU Q;  4IUT A;  5FRM A;  2X3W D;  1RAF B;  4CC7 A;  1GUX A;  1W4S A;  3DLM A;  2WFY B;  1VQL T;  1WDX A;  4QVC A;  3MEU A;  2B9R A;  1WIE A;  1B34 B;  4JJC A;  2R5M A;  3CCS T;  2MWP A;  3RMS A;  3HSB A;  1D0Z A;  3GTM S;  4C0D C;  5GAN g;  4J5Y A;  3G6E Q;  1TUC A;  4FSX A;  4ZTF A;  4RTU A;  1X6O A;  4DQ2 A;  3H6Z A;  3NDQ A;  2E6Z A;  1X2K A;  1I0C A;  4HCC A;  2RK1 A;  5KYN A;  1EIF A;  1R77 A;  1WFW A;  3B57 A;  1JRI A;  4CC3 A;  2FRY A;  1BB9 A;  4M75 G;  4PJO B;  1VOM A;  3J81 E;  2PU9 B;  4P5N A;  1VQ4 Q;  3EG9 B;  3MP6 A;  1ZSZ B;  4LE9 A;  2PMI B;  1WNL A;  3JCM W;  1P5E B;  1K1Z A;  4AG1 C;  3EGX A;  2D8J A;  4IKF A;  3CC4 A;  4BAC A;  2KVQ G;  2L0A A;  4BCP B;  4ELL A;  4DBQ A;  1W70 A;  3N5B B;  2AKK A;  2AIR B;  1TTH B;  4XAX B;  1WZO A;  4HKE A;  2WIH B;  3DB4 A;  2K79 A;  1WJS A;  1YIJ Q;  4JRP A;  4K11 A;  3QII A;  3C12 A;  1YIT A;  2DYB A;  1IRX A;  3LLR A;  3CC7 A;  1N27 A;  1UEB A;  1S72 A;  2DFU A;  5CKH A;  4CRI A;  2DME A;  1G8X A;  2PVG B;  4M7A E;  4XTW A;  2DXC B;  5IH2 A;  1PG5 B;  1K0X A;  2P0Q A;  5GAN f;  2QTX A;  4A4H A;  1OUL A;  2EQI A;  1LPL A;  2RJC A;  2P0K A;  1OIY B;  2JGZ B;  1D1C A;  3QHS A;  2C0O A;  2IVX A;  3EGU A;  2KT8 A;  3EG1 A;  2DL7 A;  3RR6 A;  3UT1 A;  2AT1 B;  2FZC B;  3FJ5 A;  3MI9 B;  2PUK B;  3CME T;  3UA7 A;  2ZPB B;  1Q82 R;  1ZA1 B;  3OA6 A;  5EC7 A;  2LCC A;  3HKS A;  3VS6 A;  1K9A A;  1H64 1;  2ED1 A;  1MMA A;  5LL6 S;  4KH0 B;  4C92 A;  3HL8 A;  2PNI A;  2HCK A;  2QYZ A;  1KC8 U;  3RIR A;  1AWO A;  4AFS C;  2P4R A;  3QWY A;  1VQ6 T;  3BFM A;  2J05 A;  2LQK A;  4KH1 B;  4F7J B;  3DB3 A;  5AT1 B;  5EJC A;  2CUB A;  3CCR A;  4HT8 A;  1OX9 A;  2BS3 A;  1WHG A;  1H8K A;  2DE0 X;  1O9S A;  2FPF A;  4M75 A;  1M1K U;  3EG2 A;  1GH6 B;  2JW4 A;  2CSI A;  4LXC A;  2L3S A;  3OB9 A;  3V7S A;  2EQU A;  3SDZ A;  3C0C A;  2WSF E;  4BBS M;  4ROC A;  4CFM B;  3MEW A;  3I5S A;  4BCH B;  1NG2 A;  1Y57 A;  4AKH A;  1W6X A;  3JSC A;  2O31 A;  1ZX6 A;  3MET A;  4FL6 A;  1I07 A;  5GMK i;  3SWN B;  3VS3 A;  1G5V A;  3OBY A;  3HRU A;  4J7I A;  4KRT A;  4FYY B;  4J9C A;  1AD5 A;  4M7A B;  4II5 B;  3DOG B;  1HSQ A;  3JCM g;  1OPL A;  1H1Q B;  4EMK C;  2G9X B;  1NPR A;  2XG8 D;  3VS1 A;  1OKV B;  1R0C B;  4BY1 X;  4BCQ B;  1UNH D;  4JS4 A;  3A98 A;  2RNA A;  4II1 A;  4DA4 A;  5CIU A;  1E9H B;  3TU4 K;  4E7I A;  3QO3 A;  5FU6 B;  2JM9 A;  4FX3 B;  1JXO A;  2OI3 A;  1WXB A;  1NLP C;  1MHN A;  5C6S A;  4RTY A;  4QVZ A;  4WF2 A;  5D6W A;  3OMG A;  4QKU A;  1C1A A;  4EMG A;  1RAH B;  1I8F A;  5D6Y A;  3FJP A;  2HEQ A;  2MF2 A;  3OYK A;  4ZGE B;  4EOM B;  3CD6 T;  5LJ3 g;  3JB9 J;  1UJY A;  4KUD K;  4BB7 A;  4Y72 B;  2PK9 B;  1VYT A;  1VOL A;  3CCQ A;  4Y91 A;  3M59 A;  2K4Y A;  4WCI A;  2RQU A;  3VS7 A;  1WX6 A;  4O6J A;  4CFU B;  3RES A;  3UPU A;  3DLL A;  3NTK A;  4N4G A;  1UGR B;  3G33 B;  5FGK B;  5L23 A;  4RMO A;  2A36 A;  3EAE A;  4QT7 A;  1QCN A;  1OPK A;  2DL8 A;  1VQM Q;  3OW2 P;  4RG2 A;  4J9B A;  2DO3 A;  1J3T A;  1X27 A;  4BI3 A;  4BCG B;  2DBM A;  2F2V A;  2BS4 A;  1ZBX A;  5GAN 2;  1NEG A;  4PLI A;  1K73 U;  4XQ3 A;  3QUI A;  2IW6 B;  3POM A;  3LH0 A;  3CCU T;  1HD3 A;  4PFZ A;  1I4K 1;  2EIF A;  1BU1 A;  2EJ9 A;  4ESR A;  1ZQ1 A;  3H0H A;  3CMA Q;  2ROT A;  2LW4 A;  1YI2 A;  3A5Z B;  4E7L A;  1Q81 R;  4LN2 A;  4KBM B;  1UDL A;  4B9X A;  2XDP A;  4LDW A;  1KD1 C;  1LOJ A;  3EFO B;  4AFU C;  2LQ8 A;  4XTY A;  1W2B S;  2KDS A;  5FW9 A;  3OW2 A;  2QGS A;  3I55 A;  1KJW A;  2G3R A;  4VUB A;  1FMW A;  2HNI A;  2F5T X;  3EFR A;  2CT4 A;  4C8Q E;  1KHI A;  1QKW A;  3OYE A;  3GLX A;  4PNO A;  2I2L A;  2RQT A;  2KI7 A;  3PTA A;  3CPW P;  3CCV A;  4GY5 A;  2RHX A;  2PJQ A;  4M7A F;  2HL3 A;  5DLO A;  4B6M A;  5IT9 E;  2DL4 A;  3D7S B;  4J9F A;  1WJR A;  4ATO A;  2COZ A;  4PJN A;  2IN3 A;  5I21 A;  2QA4 T;  2D6F A;  1VQ5 T;  4F7U E;  1JO8 A;  4FM4 B;  1O9K B;  2I0N A;  1UNG D;  1ENW A;  4DOW A;  1K9M U;  4R55 A;  4C5G A;  3QG1 A;  2MPX C;  1RLQ C;  2KT1 A;  4XTX A;  5GAN 6;  2YRC A;  4EC8 B;  1YIJ T;  2CCI B;  2QG9 B;  4KT0 E;  4EIK A;  2JTM A;  2XID A;  1FIN B;  2GBQ A;  4JDS A;  4OMP A;  3G4S Q;  2X4X A;  4D6W A;  2BZX A;  1GFD A;  1I5O B;  3CPW A;  3V8K A;  3OYD A;  1RAD B;  2K7A A;  4C0F A;  5L8R E;  4NL2 A;  2DEQ A;  3GOX A;  1FWZ A;  4F16 A;  1NM7 A;  1OV3 A;  2QAS A;  3ZL7 C;  5CQX A;  1VQP Q;  3M54 A;  4Q5W A;  3MIA B;  1UGQ B;  1AWW A;  4E7K A;  1H1S B;  1OU8 A;  4LDX A;  2DLP A;  3I5R A;  2C0I A;  3BE3 A;  1M5Q 1;  2F2C A;  4M6V A;  2DXT A;  5KCO A;  3RGF B;  2DPP B;  3RMQ A;  5GAO l;  5CKD A;  3CC2 A;  3M55 A;  2XIC A;  2KQW A;  2BKZ B;  4TTH A;  4DOV A;  2W96 A;  3TEE A;  3PIO A;  2KRO A;  4C8Q B;  2AZV A;  1WHL A;  1OL2 B;  1FYN A;  1BI1 A;  5FU7 C;  1H24 B;  3X26 B;  2CP5 A;  2IPO B;  1KQS P;  1D0X A;  1QVF P;  3PVQ A;  2YDL A;  4EOL B;  2E3I A;  1RUW A;  4OF1 A;  2H8H A;  1XNI A;  4M78 E;  3VS5 A;  2JOY A;  3J7A F;  5GMK l;  4FT4 A;  1D3U B;  4F7U B;  5ECA A;  3L2Q A;  4ZGJ B;  1YBY A;  3QYG B;  4JUV A;  4GLK A;  1M8V A;  2DVJ A;  3C4S A;  3JCM c;  4M7D A;  2O4X B;  3DKM A;  3PMI A;  3RDV A;  1QVP A;  4CFW B;  2L2P A;  4A53 A;  3X25 B;  2DF6 A;  4Z8A A;  1N8R U;  5L2W B;  4EMK A;  2EQM A;  4PJO C;  1AVZ C;  2M51 A;  3GPL A;  2LX9 A;  2WXV B;  2V26 A;  2HAX A;  1H3H A;  1UUE A;  1KQS A;  1QVF A;  2KBT A;  3OYI A;  4J9I A;  5I11 A;  3CCM A;  3E9G A;  2DD5 A;  1QW1 A;  3L42 A;  1KQ1 A;  3OMC A;  3BHU B;  2QK0 A;  2HQE A;  2JM8 A;  5IAY A;  4DEX A;  5IF1 B;  1D0Y A;  4MML A;  1YHQ T;  1AIS B;  5D7U A;  3LH5 A;  5LJ5 d;  3CCL A;  1Z9Z A;  3NGP A;  3ASK A;  2MMP A;  2FEI A;  3RKX A;  1U5S A;  4M77 F;  2E70 A;  3LGL A;  1ABQ A;  1Z9Q A;  1KD1 U;  1AZE A;  5GAN 8;  3CCQ Q;  4E6R A;  1UGV A;  3CCJ Q;  4L5G A;  3JAM E;  5GJV B;  3BDL A;  1FMV A;  1RAC B;  2AHJ B;  1NLO C;  2RQV A;  1IGQ A;  2YRD A;  2CP3 A;  1NYF A;  3VKI A;  4BCK B;  5I22 A;  5GAM f;  2LCS A;  2DJQ A;  1QCF A;  1H1R B;  4BD3 A;  4EOR B;  3JCM P;  1GCQ C;  4OP0 A;  2FO0 A;  2ED0 A;  2AZS A;  3GP8 A;  2RQW A;  4M78 B;  1KC8 C;  1JXM A;  4PJO D;  1VYV A;  3TNW B;  3TVT A;  1M1K R;  3INZ A;  5GAO m;  1VQM T;  3V8J A;  1QKX A;  2GFA A;  2EYZ A;  2RJE A;  1T0H A;  2QGF B;  1KSW A;  3EOC B;  3G71 Q;  3M0U A;  4E7J A;  3JB9 F;  2C5O B;  3ZFJ A;  3VS4 A;  4A54 A;  3H4C A;  1TU0 B;  2W9Z A;  1M1K C;  2OAU A;  3QZ5 B;  4OGC A;  1SF9 A;  3X20 B;  4PKC C;  1YJN A;  2A28 A;  2EKO A;  2RA2 A;  1NJI C;  3JCM V;  3CMA T;  1FKM A;  2KR3 A;  1YJW A;  2FPE A;  4L59 A;  2D0Q B;  5A0D A;  2A37 A;  5GMK m;  5FLX E;  4XU3 A;  4F7U F;  2HQX A;  2ZZD B;  3MY5 B;  2JTF A;  4JZ3 A;  4JJB A;  4MZT A;  5KYU A;  3JCM b;  1VYW B;  2X3X D;  3EG3 A;  3LQ5 B;  1GBR A;  2E65 A;  4M75 E;  2EYW A;  2QDL A;  4A4K A;  3L2U A;  3QDF A;  1QMZ B;  2HD0 A;  2X4J A;  1M30 A;  4BCF B;  5J3B A;  1KQ2 A;  1VQ7 A;  4AKG A;  1MUZ A;  2LT4 A;  2QEX Q;  3R6N A;  4RTZ A;  3SWN C;  4OB1 B;  3JB9 I;  2C5V B;  1SRM A;  2WMA B;  2LQN A;  4LDY A;  3CCE Q;  4C92 G;  1M1F A;  1NYG A;  1JSU B;  4PJO G;  5GAM d;  2Z0W A;  1LCK A;  2YLB A;  4LOC A;  4HVW A;  5KYW B;  2QQA A;  3M0T A;  3QWL A;  1G3Y A;  4ZN3 A;  2DRK A;  3QKJ A;  2RHZ A;  3REB B;  3EH2 A;  5KYX B;  3UF4 A;  4NS5 A;  3QHR B;  2JJ9 A;  3QHW B;  5FU6 C;  3G4S T;  3S3O A;  4Y92 A;  2RI3 A;  4J6X A;  5J26 A;  2E5K A;  2RQR A;  4EDU A;  2CH4 W;  4ROE A;  1M2O A;  1JJ2 P;  1UJ0 A;  2W9F A;  3EID B;  1WPY A;  2JZ2 A;  1D1A A;  2KRS A;  1K73 R;  1C9B A;  2KNB B;  1W98 B;  1VQO Q;  3VKG A;  4KGZ B;  2PHG A;  1VQP T;  2COY A;  2OTJ Q;  1OZ2 A;  4BCM B;  4M78 F;  2CRE A;  1ABO A;  2JS0 A;  3M0R A;  3QPH A;  4QVD A;  4BCO B;  1K73 C;  3OS2 A;  2J6K A;  5I5Z B;  3BHT B;  3TNI B;  1ZUK A;  2MK5 A;  1O75 A;  4OMN A;  5KE2 A;  2GTJ A;  4YC3 B;  1WHH A;  4GLM A;  2X51 A;  2DXB B;  3DDQ B;  1VQL A;  2GNC A;  3S3N A;  1MND A;  2ATC B;  1MNE A;  2GQI A;  2M9U A;  3CCS A;  9ATC B;  2LT1 A;  1MMN A;  2LC4 A;  5KYY B;  1JJ2 A;  5LQF B;  2HSP A;  1TUG B;  5GAN 3;  4IMY B;  4J7F A;  5I2M A;  2YSQ A;  3ME9 A;  4EPC A;  4BI4 A;  1Y96 B;  1B34 A;  2L3R A;  3TNH B;  2V8I A;  4AMC A;  1CKB A;  4X9C A;  2DET A;  2DX1 A;  3LW5 E;  1YJ9 Q;  3OBW A;  1D3B B;  2ZPE B;  5GAN 4;  7AT1 B;  2HMA A;  1ZBJ A;  4KGV B;  1X01 A;  4F6W B;  4OVA A;  4CC2 A;  2QQS A;  4AFZ C;  1XOV A;  4BUG A;  1BKB A;  4PJO A;  5BNJ B;  4A63 B;  4J8O A;  4FW2 A;  4UN0 A;  1H25 B;  3QBY A;  2EBP A;  3EG9 A;  2KAF A;  3TW6 A;  2K2V A;  4CFU D;  2KRM A;  1ZSZ A;  3P8B B;  2E3H A;  3QWX X;  2IW9 B;  2JMA A;  2ENM A;  3I56 Q;  2A7Y A;  5M9O A;  1K9M C;  4MMK A;  5HK3 A;  4N4H A;  1GFC A;  2QDY B;  2KGT A;  2MOX A;  2M16 A;  4J6Y A;  1WA7 A;  4IUR A;  2VKN A;  2YXY A;  2CP2 A;  2O9V A;  2HDA A;  1NJI U;  2ECZ A;  1H4L D;  2VWF A;  3CXC P;  2WEV B;  4FIB A;  4RKU E;  1W1F A;  1M9S A;  5GAN 5;  1OIU B;  2DEU A;  1N5Z A;  2F2W A;  1VQ8 Q;  1PSF A;  1GXI E;  2DIG A;  2QGG A;  4M7D C;  1Q7Y U;  1JKW A;  2DXC A;  3NTH A;  1M2V B;  1SHG A;  2MAM A;  3CCJ T;  5LJ5 h;  2RF0 A;  3GF5 A;  2DL3 A;  3CME A;  1GCQ A;  3X24 B;  1K8A U;  1CSK A;  1VYU A;  4FYW B;  3PNW C;  2MWO A;  5GAN d;  3QJ6 A;  3E1S A;  4C92 F;  2VUB A;  2HBW A;  1N6A A;  3LWH A;  4BY6 B;  1FXX A;  1X2Q A;  3T9N A;  2OTL Q;  5DQV A;  2GQV A;  2L8D A;  2DTI A;  2BKD N;  2JN0 A;  3THK A;  2GFU A;  1VQ6 A;  5GAO p;  3CXC A;  3FRN A;  4D8K A;  3L2Z A;  4Z88 A;  1IHW A;  5C0M A;  4ELZ C;  2RM4 A;  1UHC A;  2SEM A;  1TD6 A;  2LRQ A;  4J83 A;  4XU0 A;  1H26 B;  3MO8 A;  4HCK A;  1WGS A;  3G71 T;  1YP5 A;  3RNJ A;  4M75 F;  3LGF A;  4ORZ A;  1YJN Q;  2R57 A;  1G3T A;  3U23 A;  1VQ9 Q;  5IXB A;  1BK2 A;  3O0G D;  4PK4 A;  1AT1 B;  3FDR A;  5AYF A;  2YUQ A;  2VXE A;  2X4W A;  2E12 A;  1PM3 A;  4C8Q C;  1N8R R;  1FMK A;  2DER A;  1VQN Q;  1FVV B;  2XK0 A;  1VQK Q;  2IVW A;  4RCB A;  4EON B;  4M7D D;  1V1C A;  3NMZ C;  4KRD B;  1VIF A;  2H3J A;  3OS1 A;  1N8R C;  4M77 E;  4RG8 A;  4WTO B;  2YHT A;  2EYQ A;  1YWO A;  3M4G A;  2WHB B;  4MFD A;  1QCO A;  1ZP2 A;  3H8Z A;  5GAN e;  2YWW A;  2EW3 A;  3JCM f;  2L3Q A;  3SWN A;  1MMD A;  3SB2 A;  2LCL A;  4BI8 B;  2DTH A;  4M7A A;  3VUB A;  1KD1 R;  4MIM A;  3A8M B;  2QEX T;  2XI9 A;  3CCE T;  1ZLM A;  2RHY A;  4X9D A;  3EH1 A;  3WVD B;  2QF7 A;  1JBM A;  2YUO A;  3OYC A;  3G6E T;  3SHW A;  4IIO A;  1OGU B;  1NE8 A;  1S1N A;  1VIN A;  1YNZ A;  5CAI A;  4KRC B;  2RB6 A;  2ABL A;  3E19 A;  3CD6 A;  2CGH A;  1B7T A;  2IIM A;  4C8Q D;  3JCM X;  5LJ3 f;  1PHT A;  1BYM A;  3EHR A;  1QWF A;  2H3E B;  3OS0 A;  3TCJ A;  3L2R A;  1PCX A;  3KXT A;  2UUE B;  3OYJ A;  4YTL A;  3MY1 B;  2R5A A;  4J9G A;  3ULR B;  2AK5 A;  5CCA A;  4F70 B;  3CC4 Q;  1YCY A;  1VQ4 T;  3MPU B;  3EG0 A;  2XDD A;  1M1G A;  2KYB A;  2Y4Y A;  1GRI A;  4M7D G;  2C0T A;  1RAA B;  1KK7 A;  1VQO T;  3GBQ A;  2NUT B;  2NWM A;  3FB9 A;  3M4Y A;  4CI0 C;  5GAO n;  2DZC A;  2OTJ T;  5CYI B;  1N9S A;  1UTI A;  1JB0 E;  1YIT Q;  1V76 A;  2M1H A;  4HLQ A;  3CC7 Q;  1KHC A;  1U1S A;  2D1X A;  2VAS A;  5HBE B;  2BE7 D;  2UZE B;  1S72 Q;  3X28 B;  5ACB A;  3VRZ A;  2RHU A;  2LJ3 A;  2CT3 A;  5GJW B;  3CCU A;  2ZPG B;  4EOS B;  4M77 B;  1Q82 U;  1UEC A;  1Y0M A;  4A4E A;  3WXM B;  3RUX A;  3HB9 A;  3JCM d;  2QI2 A;  3FC3 A;  4AI6 A;  4HL4 A;  2DVE A;  2EFI A;  3ZBD A;  4QSH A;  3A8G B;  3OSV A;  1MMG A;  1M90 U;  2QQR A;  5IHK A;  2WSE E;  1E6H A;  1YJ9 T;  3EFO A;  1Y7X A;  1SPK A;  4J9H A;  2XDB A;  3I9Q A;  5FWC A;  2EGC A;  2KMG A;  1Y71 A;  5LJ3 d;  1EZZ B;  1T3L A;  3OQ5 A;  1SKU B;  1ACM B;  1HXD A;  4RTT A;  3CCR Q;  2QA4 A;  4TVR A;  1VQ5 A;  4HA8 A;  2JTE A;  2Y4X A;  4XTZ A;  1E7P A;  3I56 T;  2KSS A;  3PE0 A;  3HRT A;  3HPW A;  3K7A M;  4DBH A;  1YIJ A;  4EOJ B;  1O9K A;  3PFS A;  4MDW A;  3VU3 C;  2OAW A;  2C6T B;  2CP0 A;  3R6O A;  5LMK B;  1BI2 A;  2QFZ A;  1OZ3 A;  2OX7 A;  4JZ4 A;  2W99 A;  4N0A C;  2W10 A;  4F04 B;  1C0M A;  2VGM A;  3OYB A;  1NBE B;  4A4G A;  2FL7 A;  1PD1 A;  2M0Y A;  3L2V A;  1JU5 C;  4EOO B;  4BDY A;  3BG9 A;  2G77 A;  2O9S A;  4LDU A;  1VQ8 T;  3AHU A;  4HVU A;  3P8H A;  1UGS B;  3HTR A;  4CFV B;  2LX7 A;  2CUD A;  1NPP A;  3TQ7 P;  4Z6Y A;  4ZNX A;  1ZSZ C;  1ARK A;  3WVE B;  3A8H B;  3CQT A;  3I35 A;  4DBF A;  3EFS A;  2DD4 B;  3HP9 A;  3C95 A;  1RI0 A;  4E7H A;  2DKG A;  1OOT A;  2OTL T;  4XTV A;  2DK3 A;  2J7I A;  1WI7 A;  1JOW A;  2DBK A;  5D6X A;  2RD1 A;  2DL5 A;  1OEB A;  3L2W A;  5GAN h;  4BXX X;  5GAO q;  2QQB A;  1V29 B;  3A8O B;  4R0K A;  2CKK A;  4HVV A;  2QQ8 A;  4QQ6 A;  1GL5 A;  2B86 A;  3TSW A;  2BS2 A;  2QTV A;  2EQJ A;  3MEA A;  1W2B P;  4C8Q A;  1VQ9 T;  1G83 A;  4EMH A;  1T0J A;  1KC8 R;  3BY7 A;  4C0Z A;  5CQY A;  4E2F B;  2BE9 B;  3KBG A;  2KRN A;  2WMB B;  3QXE B;  1ZUU A;  2WJ9 A;  2DRM A;  6AT1 B;  1VQN T;  1D09 B;  1VQK T;  2PVD B;  1PC0 A;  4C5H A;  2HSE B;  4MZM A;  3EGD B;  4RTV A;  5LJ5 j;  3PIP A;  3VYH B;  1R8O B;  5HBJ B;  4F7U A;  1EFN A;  3DJB A;  3QYE A;  3QDR B;  1Q86 C;  1OI1 A;  4A4F A;  1QQJ A;  1UB4 A;  3LYI A;  1GUX B;  2O4X A;  2K3Y A;  5HY6 A;  4G6L B;  1SRL A;  4ANJ A;  2K3X A;  5I2S A;  3TN8 B;  2XKO C;  3OYF A;  3PMT A;  3VYG B;  3FIF A;  5EFQ B;  2VXF A;  3NTI A;  1NJI R;  1W2B A;  2X1N B;  3CPF A;  1QP2 A;  1BU2 A;  4ROD A;  2FG0 A;  3M53 A;  1NEB A;  1PRL C;  3NPF A;  3PO3 S;  5FWB A;  1YI2 Q;  3RKY A;  4C92 E;  3VKH A;  2PUO B;  4BCM D;  2CH4 A;  1YHQ A;  2K57 A;  4F7L B;  5LJ5 e;  1PRM C;  2RPN A;  2ZCF B;  2BTT A;  1K8A R;  3GIB A;  1WQ7 A;  3I55 Q;  2UZD B;  1B3Q A;  3CD6 Q;  4FSS A;  1TS9 A;  1XO2 A;  4OB3 B;  3QZ9 B;  1Q7Y C;  2EUF A;  3CBP A;  5GAN 7;  2DXU A;  4IIM A;  3V7R A;  4DBR A;  2UZL B;  3EGX B;  3CCV Q;  2EKH A;  2W2H A;  2MI6 A;  1K8A C;  1IGU A;  2GF7 A;  2DM1 A;  5HQ0 B;  2YUP A;  3JV3 A;  2CP7 A;  3UWN A;  1M3B A;  4X34 A;  1RAI B;  1YN8 A;  5CVI A;  3CC4 T;  1UFF A;  2RHI A;  1GBQ A;  1BIB A;  2CZ0 B;  2K5I A;  2FZK B;  3BG3 A;  1GCP A;  5IDP B;  4M7A C;  1VQM A;  4BCN B;  3MEV A;  2ROL A;  1YFN A;  4ELY C;  4RTW A;  5EG2 A;  5FU7 B;  4KGX B;  4F6S B;  4M78 A;  1LNX A;  4BE2 A;  4BY6 C;  5IDN B;  1YIT T;  4NC6 A;  2BUD A;  2KEA A;  3CC7 T;  1H1P B;  3Q1J A;  4OMF B;  1S72 T;  3EJ1 B;  2V8K A;  2VV5 A;  3CBM A;  1IB8 A;  1MGQ A;  1E7O A;  2HQH A;  3MP1 A;  4QW2 A;  1K4U S;  3VYG A;  4I3Z B;  4J9E A;  1RL2 A;  2L5Q A;  2EVR A;  4NOY A;  4N4I A;  3CMA A;  1H3Z A;  3A8L B;  4CFX B;  5CKB A;  5GAM j;  3QYH B;  2O88 A;  3VV0 A;  2F5K A;  3S6W A;  3OYA A;  3F5X B;  5GAO r;  2FVU A;  4PJM A;  2X4Y A;  3DTO A;  4C92 B;  4F7S B;  2VYT A;  2BIV A;  3JCM h;  2J06 A;  4HXJ A;  2UZB B;  2KY9 A;  2ZZD A;  3CC2 Q;  3OSS C;  1HJD A;  4IUP A;  1OL1 B;  2ZPH B;  2AKL A;  4HCB A;  2QA4 Q;  2EWN A;  2EGE A;  3OW2 S;  1VQ5 Q;  1VA7 A;  2DYI A;  4M7A D;  2B8A A;  3P8D A;  2CZ1 B;  4M75 B;  5GAM e;  2KXC A;  2JUF A;  3CCR T;  4OMQ A;  1K76 A;  3TW7 A;  4OML A;  5GMK j;  4BCQ D;  2PVO B;  3DDP B;  2X9H A;  3GNG A;  3RBB B;  3M0S A;  4UC4 A;  3LWI A;  5LJ3 h;  4ELJ A;  4BY7 X;  4QQD A;  1AHJ B;  2FHD A;  2JS2 A;  1LJO A;  1BCO A;  2WPA B;  5KYW A;  3URG A;  5IHI A;  2LMJ A;  4NST B;  3J80 E;  1H28 B;  4JRK A;  2MCN A;  2BPM B;  4N0A A;  2YT6 A;  2JMC A;  5FRN A;  4ME7 A;  3G4S A;  3M0P A;  4JJD A;  2DTO A;  4OB0 B;  2MIO A;  3MHX A;  1IXD A;  3QSU A;  5KYX A;  2RI5 A;  5HBH B;  1I5L A;  1K9M R;  4LNP A;  1M27 C;  5FRO A;  1ZHI A;  1RAG B;  4PFO A;  2HKN A;  2COW A;  3UAT A;  4FCY A;  4PJL A;  1MV3 A;  1Q86 U;  1VQP A;  5GMK e;  2R7G A;  5HVY B;  2RO0 A;  2F2X A;  4KUI A;  1M8M A;  5HK0 A;  1WXT A;  3CBO A;  4M4Z A;  1BI3 A;  3CPW S;  2QAZ A;  3CCM Q;  5CKF A;  3SEM A;  4OMO A;  2O01 E;  4XK8 E;  2A0F B;  2YRV A;  3MCA B;  1WHK A;  3BW1 A;  5DQW A;  3G1J A;  3OYN A;  1PWT A;  3HRS A;  2RH2 A;  1Q82 C;  3CCL Q;  4JRQ A;  4CC4 B;  5CO7 A;  4BCJ B;  4M7A G;  3MKD A;  2PZ1 A;  3UDC A;  1M90 R;  2WIP B;  2X35 A;  1G3N C;  2E1H A;  5HNB B;  2KE9 A;  2P0P A;  1I1J A;  2A3L A;  3F70 A;  2DXB A;  2A08 A;  1IO6 A;  2RMO A;  3EHQ A;  4EOK B;  2JVV A;  3BG5 A;  4Z89 A;  1OKW B;  1EX4 A;  1N4M A;  3OY9 A;  2OJ2 A;  4M77 C;  3CCQ T;  5KYY A;  2CJM B;  1M90 C;  2LNH B;  3JB9 H;  2V1Q A;  1GY3 B;  1UNL D;  3OYY A;  2E64 A;  1RLP C;  1PNJ A;  1QWE A;  1Y96 A;  1CKA A; 
#chains in the Genus database with same CATH homology
 2QQ9 A;  2RK1 A;  4HCC A;  3M4Y A;  5IAY A;  1EIF A;  4CI0 C;  5GAO n;  5DM7 R;  2DZC A;  4BE0 A;  2OTJ T;  4PJO F;  4Z02 A;  1N9S A;  4MML A;  1JRI A;  5CR2 A;  1JB0 E;  1YHQ T;  3VUZ A;  2FB7 A;  3HHT B;  1D3B A;  4C0G A;  5LJ5 d;  2ZPF B;  4HLQ A;  2M1H A;  3CCL A;  1KHC A;  1U1S A;  3DL1 A;  3ASK A;  2MMP A;  4M75 G;  4PJO B;  3RKX A;  4M77 F;  2E70 A;  3LGL A;  3J81 E;  3X28 B;  2RJD A;  2PU9 B;  2RHU A;  1KD1 U;  4LD9 K;  2CYZ B;  4P5N A;  3CCU A;  5GAN 8;  2ZPG B;  3MP6 A;  4M77 B;  1Q82 U;  4OGE A;  1KG1 A;  4C0D B;  4BDZ A;  1WNL A;  4L5G A;  4A4E A;  3WXM B;  3JAM E;  3JCM W;  3RUX A;  3HB9 A;  3BDL A;  2AHJ B;  2JNG A;  3ER0 A;  3JCM d;  2QI2 A;  3CC4 A;  3FC3 A;  4AI6 A;  4ZGD B;  4BAC A;  4IKF A;  2KVQ G;  4HL4 A;  3VKI A;  2QXF A;  1TH7 A;  5GAM f;  5GAN j;  3N5B B;  2DVE A;  2ZPI B;  2EFI A;  4JRI A;  4BD3 A;  3ZBD A;  3JCM P;  3CEY A;  3JCM Q;  4XAX B;  4QSH A;  3A8G B;  3FB9 A;  3OSV A;  4OP0 A;  3TRE A;  4HT9 A;  4HKE A;  1YI2 T;  3DB4 A;  1WJS A;  3GP8 A;  1M90 U;  3QJY A;  2QQR A;  4JRP A;  2WSE E;  4M78 B;  2FYK A;  1KC8 C;  1KQS S;  1QVF S;  3QII A;  3C12 A;  4C5I A;  4PJO D;  1YIT A;  1YJ9 T;  3LLR A;  3CC7 A;  3INZ A;  4JLI A;  5GAO m;  1VQM T;  1N27 A;  3V8J A;  1UEB A;  2GFA A;  1S72 A;  1Y7X A;  2RJE A;  3I55 T;  4M77 D;  4PL6 A;  5CKH A;  4CRI A;  2XDB A;  2PVG B;  4E7J A;  4M7A E;  4XTW A;  3JB9 F;  3ZFJ A;  4A54 A;  2KMG A;  3QYB A;  2DXC B;  3CCJ A;  3H4C A;  1Y71 A;  5LJ3 d;  2P0Q A;  3OQ5 A;  3OYH A;  5GAN f;  1PSE A;  2QTX A;  2OAU A;  3CCV T;  1M1K C;  3QZ5 B;  1HXD A;  4OGC A;  4A4H A;  2QA4 A;  4TVR A;  3X20 B;  2P0K A;  2RJC A;  4PKC C;  1YJN A;  1VQ5 A;  3QHS A;  4HA8 A;  4HNU A;  1IZ6 A;  2Y4X A;  1BIA A;  2EKO A;  2RA2 A;  3M58 A;  3UT1 A;  4XTZ A;  1NJI C;  3JCM V;  3V7C A;  1E7P A;  4L6V 5;  3I56 T;  2KSS A;  3CMA T;  1FKM A;  2PUK B;  3HRT A;  2CZ6 B;  3CME T;  3HPW A;  1YJW A;  4M7D E;  4V2S A;  4L59 A;  2D0Q B;  2ZPB B;  5A0D A;  4BE1 A;  5GMK m;  5FLX E;  4XU3 A;  1YIJ A;  3OA6 A;  4F7U F;  2HQX A;  2LCC A;  3HKS A;  3PFS A;  2ZZD B;  2JTF A;  1H64 1;  1VIE A;  2YLC A;  4MDW A;  2WSC E;  2K5F A;  3VU3 C;  5LL6 S;  4MZT A;  1U1T A;  3R6O A;  3RER A;  4C92 A;  2E10 A;  1BI2 A;  2QFZ A;  3HL8 A;  2E6N A;  1OZ3 A;  4KUL A;  3JCM b;  1QVG S;  3G71 A;  2E65 A;  4M75 E;  1KC8 U;  2VGN A;  4N0A C;  3RIR A;  4A4K A;  2VGM A;  1VQ6 T;  3OYB A;  3JB9 D;  3BFM A;  4ZTJ A;  4A4G A;  3L2U A;  2FL7 A;  2LQK A;  2HD0 A;  5GAM h;  4IUV A;  2X4J A;  3DB3 A;  3L2V A;  5J3B A;  4BBR M;  5EJC A;  1SSF A;  4ZN1 A;  3CCR A;  4BDY A;  1VQ7 A;  3BG9 A;  4AKG A;  2VC8 A;  4HT8 A;  1KQ2 A;  2G77 A;  4LDU A;  2LT4 A;  1VQ8 T;  3AHU A;  3P8H A;  3HFO A;  2EJG A;  2BS3 A;  3SWN C;  4OB1 B;  3JB9 I;  1UGS B;  4LDY A;  1O9S A;  4C92 G;  1M1K U;  4M75 A;  3JCM J;  1M1F A;  4PJO G;  5GAM d;  1NPP A;  4Z6Y A;  2YLB A;  4LOC A;  3WVE B;  3OB9 A;  3A8H B;  3V7S A;  2QQA A;  2KR6 A;  3EFS A;  4AKI A;  2EQU A;  2DD4 B;  3HP9 A;  3QWL A;  4M77 G;  3SDZ A;  2WSF E;  3C95 A;  4BBS M;  1Q81 C;  1RI0 A;  4E7H A;  1G3Y A;  2DKG A;  3MEW A;  4ZN3 A;  3QKJ A;  2RHZ A;  2OTL T;  4XTV A;  5LJ5 g;  2DK3 A;  4AKH A;  3JSC A;  2E41 A;  4FU6 A;  5D6X A;  2RD1 A;  5A2Q E;  3L2W A;  4NS5 A;  3MET A;  4FL6 A;  4RCC A;  5GAN h;  2QQB A;  5GAO q;  2K5L A;  1V29 B;  5GMK i;  3CC2 T;  2EQK A;  4R56 A;  3SWN B;  4FT2 A;  3A8O B;  3OBY A;  2CKK A;  5FU6 C;  5CK9 A;  3HRU A;  4J7I A;  3G4S T;  1G5V A;  2QQ8 A;  3S3O A;  4M78 C;  2RI3 A;  4J6X A;  4QQ6 A;  5J26 A;  5GMK h;  2C06 A;  4MFE A;  4M7A B;  4EDU A;  2BS2 A;  3MEA A;  2EQJ A;  2RJF A;  3KHI A;  3JCM g;  2QEX A;  4O5V A;  4EMK C;  4C8Q A;  1NPR A;  2XG8 D;  1WPY A;  2JZ2 A;  3M56 A;  3VJP A;  1VQ9 T;  3CCE A;  4EMH A;  3VKG A;  2LVM A;  3BY7 A;  4C0Z A;  5CQY A;  1VQP T;  4JS4 A;  4DA4 A;  4II1 A;  5J39 A;  3KBG A;  1P92 A;  5CIU A;  3G6E A;  3HO8 A;  3HBL A;  1OZ2 A;  3QXE B;  2WJ9 A;  4M78 F;  3TU4 K;  1VQN T;  4E7I A;  1VQK T;  1FX7 A;  2M0O A;  2PVD B;  3QPH A;  2EAY A;  4C5H A;  4QVD A;  3QO3 A;  5FU6 B;  4M7D B;  3PIP A;  4MZM A;  3JB9 G;  1K73 C;  5LJ5 j;  3OS2 A;  3VYH B;  1R8O B;  4IUQ A;  3V8L A;  3MP8 A;  1MHN A;  4F7U A;  5C6S A;  5KE2 A;  1O75 A;  3QYE A;  3QDR B;  4C8Q G;  4QVZ A;  1Q86 C;  4WF2 A;  5D6W A;  3OMG A;  1OI1 A;  5DY9 A;  1UB4 A;  3LYI A;  4A4F A;  3NFC A;  4EMG A;  1G3W A;  1I8F A;  4EMK B;  2DXB B;  5D6Y A;  3FJP A;  3OYK A;  2MF2 A;  2O4X A;  2K3Y A;  3PT9 A;  5HY6 A;  3S3N A;  1VQL A;  4ZGE B;  2K3X A;  2KMT A;  1X75 C;  5I2S A;  2XKO C;  5LJ3 g;  3JB9 J;  3CD6 T;  4KUD K;  4BB7 A;  3OYF A;  1VQ4 A;  3PMT A;  2M9U A;  3ZEH A;  3VYG B;  3FIF A;  5HKC A;  2VXF A;  2LT1 A;  3NTI A;  3CCS A;  2LNV A;  3CCQ A;  4Y91 A;  1W2B A;  2LC4 A;  3M59 A;  1JJ2 A;  4PLL A;  3OYG A;  2K4Y A;  3CPF A;  1QP2 A;  5GAN 3;  4J7F A;  4O6J A;  5I2M A;  3RES A;  2DD5 B;  3UPU A;  4HCZ A;  3DLL A;  3ME9 A;  3M53 A;  1VQO A;  2F69 A;  3NTK A;  4N4G A;  4EPC A;  4F7U G;  4BI4 A;  1UGR B;  1Y96 B;  1B34 A;  3RKY A;  4C92 E;  2L3R A;  4MZP A;  4RMO A;  3VKH A;  3S3M A;  2PUO B;  2V8I A;  2OTJ A;  5A0L A;  5LJ5 f;  3EAE A;  3PGG A;  1M4Z A;  1YHQ A;  4X9C A;  2K57 A;  3KUF A;  3LW5 E;  3CCM T;  5LJ5 e;  3OBW A;  1D3B B;  2ZPE B;  1XTD A;  5GAN 4;  4M78 D;  2ZCF B;  4OVA A;  1X01 A;  1G3S A;  4RG2 A;  3GIB A;  1WQ7 A;  2DO3 A;  2XU8 A;  4BI3 A;  4LDV A;  4OB3 B;  2QQS A;  3QZ9 B;  2BS4 A;  1ZBX A;  5GAN 2;  3CCL T;  1XOV A;  4PLI A;  1Q7Y C;  5GAN 7;  3CBP A;  1BKB A;  4XQ3 A;  4BUG A;  2DXU A;  3QUI A;  1K73 U;  4PJO A;  3V7R A;  4J8O A;  5LJ3 j;  3JCM e;  3QBY A;  3LX7 A;  2DZ9 A;  2MI6 A;  3LH0 A;  3CCU T;  2KAF A;  3TW6 A;  1K8A C;  2K2V A;  2GF7 A;  4HNT A;  2R58 A;  3P8B B;  4M77 A;  1I4K 1;  4XTU A;  1YJN T;  2EIF A;  2EJ9 A;  1ZQ1 A;  3UWN A;  4Y28 E;  2V8J A;  4X34 A;  2A7Y A;  5CVI A;  5M9O A;  1K9M C;  3CC4 T;  3SFM A;  3A5Z B;  4MMK A;  5HK3 A;  1YI2 A;  2RHI A;  4N4H A;  5GAM g;  4E7L A;  2QDY B;  2RI2 A;  1BIB A;  2CZ0 B;  2PQW A;  4KBM B;  2K5I A;  4B9X A;  2XDP A;  4LDW A;  2M16 A;  3BG3 A;  1KD1 C;  4J6Y A;  3M5A A;  1YJ9 A;  1LOJ A;  2KK4 A;  4M7A C;  4IUR A;  2LQ8 A;  4XTY A;  1VQM A;  2KDS A;  1W2B S;  1JJ2 S;  3MEV A;  4ELY C;  3OW2 A;  5EG2 A;  3I55 A;  5FU7 B;  2G3R A;  4VUB A;  1NJI U;  4M78 A;  1LNX A;  2HNI A;  4BE2 A;  2F5T X;  4BY6 C;  3EFR A;  1QLB A;  4QQG A;  1YIT T;  4C8Q E;  5LJ3 e;  4NC6 A;  2LDM A;  1KHI A;  2BUD A;  4FIB A;  4RKU E;  4C92 C;  5A0G A;  3OYE A;  1M9S A;  3GLX A;  3CC7 T;  4PNO A;  4IUU A;  3Q1J A;  2I2L A;  4OMF B;  5GAN 5;  2V8K A;  2VV5 A;  3CBM A;  3PTA A;  3CCV A;  1S72 T;  2P4T A;  1MGQ A;  4GY5 A;  1GXI E;  3MP1 A;  1PSF A;  4QW2 A;  3VYG A;  2DIG A;  2RHX A;  4M7A F;  4LD6 A;  5DLO A;  4M7D C;  1Q7Y U;  1RL2 A;  2L5Q A;  3M57 A;  2NLU A;  2DXC A;  4NOY A;  3NTH A;  2MAM A;  1DJ7 B;  3CCJ T;  5IT9 E;  4N4I A;  3I56 A;  5LJ5 h;  5KE3 A;  1WJR A;  4JLG A;  3RKW A;  1N9R A;  4B9W A;  3CMA A;  4JJN K;  4ATO A;  3GF5 A;  3A8L B;  3CME A;  2QA4 T;  3X24 B;  5I21 A;  1NZ9 A;  5CKB A;  1K8A U;  2D6F A;  4JX6 A;  4M78 G;  5GAM j;  3E9F A;  2CZ7 B;  3QYH B;  2MWO A;  3PNW C;  4JX4 A;  3QJ6 A;  2L89 A;  4E47 A;  4F7U E;  4FM4 B;  5GAN d;  3E1S A;  2Y90 A;  4C92 F;  3VV0 A;  5KH6 A;  2VUB A;  2F5K A;  3S6W A;  3OYA A;  5GAO r;  1N6A A;  2FVU A;  4BY6 B;  3SD4 A;  2WAC A;  4M75 C;  4DOW A;  3LWH A;  2HBP A;  1I81 A;  2ZGW A;  2D9T A;  4C5G A;  3QG1 A;  4R55 A;  1U8R A;  1K9M U;  1FXX A;  2X4Y A;  3T9N A;  2GQV A;  4C92 B;  1YJW T;  2QDJ A;  2VYT A;  2BIV A;  4XTX A;  4C5E A;  2L8D A;  2DTI A;  3JCM h;  5GAN 6;  4NL3 A;  1VQ5 T;  4M7D F;  2BKD N;  1WQW A;  1YIJ T;  2KY9 A;  2JN0 A;  4KT0 E;  2ZZD A;  2JTM A;  2GFU A;  2XID A;  1VQ6 A;  4JDS A;  3OSS C;  5GAO p;  3FRN A;  3HFN A;  3CXC A;  3L2Z A;  4IUP A;  2X4X A;  4ELZ C;  4D6W A;  3FLG A;  5C0M A;  2RM4 A;  4MDX A;  4XU0 A;  2ZPH B;  2LRQ A;  4J83 A;  1UGP B;  3V8K A;  3CPW A;  4HCB A;  3MO8 A;  1WGS A;  3OYD A;  3G71 T;  4JX5 A;  2EWN A;  1VQ8 A;  1Q81 U;  2XD0 A;  4M75 F;  4XU2 A;  3LGF A;  4C0F A;  3OW2 S;  2R57 A;  1G3T A;  3JRZ A;  5L8R E;  4NL2 A;  1QP3 A;  2DEQ A;  5CKE A;  4M7A D;  2B8A A;  4XU1 A;  2EJF A;  3OS5 A;  3P8D A;  3GOX A;  1FWZ A;  3FDR A;  2CZ1 B;  4M75 B;  5GAM e;  3L1A A;  5AYF A;  1QVG A;  2VXE A;  2LTO A;  2JUF A;  5CQX A;  5GAO l;  2X4W A;  3CCR T;  3M54 A;  4Q5W A;  1VQ7 T;  1UGQ B;  3M9Q A;  2E12 A;  4E7K A;  4C8Q C;  2RK2 A;  3TW7 A;  5GMK j;  2PVO B;  3GNG A;  4LDX A;  1BI0 A;  4C92 D;  2XK0 A;  3BDU A;  4UC4 A;  3LWI A;  5DLQ E;  4ELJ A;  4QQD A;  5LJ3 h;  1AHJ B;  2OTL A;  2FHD A;  4PJO E;  2IVW A;  1LJO A;  1M5Q 1;  4RCB A;  3URG A;  4M6V A;  2DXT A;  4M7D D;  5KCO A;  3J80 E;  4JRK A;  2DPP B;  1XQH A;  1VIF A;  2DD4 A;  2H3J A;  4N0A A;  3RMQ A;  5CKD A;  1VUB A;  2IG0 A;  3OS1 A;  3M55 A;  1N8R C;  4M77 E;  3CC2 A;  5FRN A;  4RG8 A;  4ME7 A;  3G4S A;  2XIC A;  2KQW A;  2GCX A;  2DTO A;  4OB0 B;  2YHT A;  3MHX A;  4C8Q F;  2EYQ A;  3C94 A;  5KCH A;  2CS7 A;  4DOV A;  4OB2 B;  3QSU A;  3TEE A;  3M4G A;  3FEO A;  4MFD A;  2RI5 A;  3PIO A;  1WJQ A;  1HK9 A;  4J6W A;  3H8Z A;  5GAN e;  1I5L A;  2E5Q A;  4C8Q B;  3JCM f;  4M75 D;  5FRO A;  3SWN A;  1ZHI A;  1VQ9 A;  1H3Z A;  3SB2 A;  1BI1 A;  5FU7 C;  5IN1 A;  4JS5 A;  3X26 B;  2LCL A;  4BI8 B;  2DTH A;  1Q86 U;  1VQP A;  3CXC S;  3VUB A;  5GMK e;  3OYM A;  4MIM A;  2RO0 A;  4M7A A;  3A8M B;  3O8V A;  2QEX T;  2DJZ A;  4KUI A;  4OF1 A;  2XHC A;  5HK0 A;  1XNI A;  2XI9 A;  3CBO A;  1BI3 A;  4M78 E;  3CPW S;  2JOY A;  1VQN A;  5CKF A;  3CCE T;  1VQK A;  3J7A F;  2RHY A;  2DAQ A;  5GMK l;  4FT4 A;  4X9D A;  2O01 E;  4XK8 E;  3WVD B;  4F7U B;  2YRV A;  3GNF B;  2QF7 A;  1JBM A;  3L2Q A;  4ZGJ B;  1OYX A;  3MCA B;  1Y07 A;  3OYC A;  1YBY A;  3G6E T;  3QYG B;  3BW1 A;  4JUV A;  3OYN A;  1NE8 A;  4GLK A;  3HRS A;  3G7Z A;  2RH2 A;  1M8V A;  1Q82 C;  5CAI A;  3C4S A;  3JCM c;  1IRE B;  3OYL A;  4JRQ A;  4M7D A;  4HNV A;  2O4X B;  2RB6 A;  3DKM A;  3PMI A;  1QVP A;  5CO7 A;  4M7A G;  2DIQ A;  3E19 A;  3CD6 A;  2CGH A;  3JCM X;  4A53 A;  3UDC A;  4C8Q D;  3HZJ A;  2X35 A;  5LJ3 f;  4IUT A;  1BYM A;  3X25 B;  3OS0 A;  2E1H A;  1N8R U;  5FRM A;  2P0P A;  3TCJ A;  2EQM A;  4EMK A;  2A3L A;  3L2R A;  3F70 A;  1W4S A;  3DLM A;  2DXB A;  4PJO C;  3KXT A;  3GPL A;  2LX9 A;  3OYJ A;  4YTL A;  1VQL T;  2R5A A;  4QVC A;  2JVV A;  3MEU A;  3BG5 A;  1KQS A;  2HAX A;  5CCA A;  1QVF A;  1YCY A;  1VQ4 T;  1B34 B;  3CCS T;  2R5M A;  2XDD A;  3OY9 A;  1M1G A;  2MWP A;  4M77 C;  3RMS A;  3CCQ T;  3HSB A;  4C0D C;  1M90 C;  5GAN g;  2Y4Y A;  4J5Y A;  3OYI A;  3CCM A;  3JB9 H;  4FSX A;  4ZTF A;  3E9G A;  2DD5 A;  4M7D G;  1X6O A;  1QW1 A;  1VQO T;  3L42 A;  4DQ2 A;  3H6Z A;  2E64 A;  2E6Z A;  1KQ1 A;  3OYY A;  3OMC A;  1Y96 A;  2HQE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...