1UGPB

Crystal structure of co-type nitrile hydratase complexed with n-butyric acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
total genus 68
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugpB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugpB02
3QYHB 4OB3B 1PSFA 1QP2A 2PU9B 2WSFE 2DXBB 2CZ6B 2ZZDB 2ZPEB 4ZGJB 4Y28E 2ZPHB 4KT0E 3QZ9B 1UGRB 2ZPFB 2CZ7B 1UGSB 3WVDB 3QXEB 1GXIE 1UGPB 3VYHB 1AHJB 2DXBA 2WSCE 2ZZDA 2CYZB 2QDYB 4XK8E 1V29B 3A8HB 2O01E 4L6V5 2DXCB 4ZGEB 1IREB 1JB0E 3WVEB 4FM4B 3HHTB 2DD4B 1PSEA 3X20B 2ZPBB 2PUOB 3X25B 3X24B 3LW5E 3A8GB 2DXCA 2PVGB 2PVOB 4ZGDB 2CZ0B 3A8OB 2ZPIB 3X26B 2DD4A 1QP3A 3A8LB 3QYGB 1UGQB 1DJ7B 2DD5B 4OB0B 2WSEE 2PVDB 5L8RE 2AHJB 2DPPB 4OB2B 3X28B 4OB1B 3VYGA 4RKUE 2CZ1B 2PUKB 3VYGB 2D0QB 2DD5A 3A8MB 2ZCFB 2ZPGB 3QZ5B
chains in the Genus database with same CATH superfamily
1N8RC 1N5ZA 4D8KA 3I55A 1BIAA 3TU4K 3GNGA 3EJ1B 2L3PA 3OMGA 3P8HA 3DDQB 1URCB 1MMDA 2ZPEB 4N4IA 3TVTA 3CC7T 3LGLA 4BI3A 4KT0E 1YHQA 1H641 2DK3A 3JCMe 1UGRB 2XICA 3G6ET 3EGXB 1QVPA 4ELJA 1UG1A 4PNOA 4HT8A 4BUGA 3G4SQ 2DXUA 2XHCA 4RTWA 5FWBA 3GTMS 1WA7A 3CCMQ 1OL2B 1H92A 3OA6A 3A8HB 1QVGA 2PJQA 1M90U 4Q5WA 5LJ3f 1ZQ1A 1Q86R 4GY5A 1AVZC 5GAOm 1XOVA 2HAXA 1ZSZC 4ELYC 1K73C 2E70A 3G33B 5KE2A 1M3AA 1VYWB 1TXQA 3VRZA 4Z02A 1VQKA 1MV0B 3CXCA 5FU6B 1VQMT 3G71Q 1P92A 2DILA 1ZA1B 4F04B 3Q1JA 2C6TB 1U8RA 4J9DA 3EIDB 1PRLC 1VA7A 2KNBB 3RBBB 2XK0A 2WHBB 2F2WA 5GAN8 2PHGA 1RAGB 1NBEB 3CCSA 1KJWA 1VQ4Q 5KE3A 3URGA 2CKKA 3M4YA 3UF4A 5LJ5j 4TTHA 1BCMA 1RAFB 1TUDA 3NTIA 3QHSA 1UE9A 1QCFA 5GANh 3RKYA 1BI1A 1UECA 3HFOA 4LD6A 3CCVA 1C6VX 3INZA 4ZN3A 2MOXA 1MNDA 1G83A 1T3LA 1Y96B 5I22A 2J06A 1D0ZA 4Z89A 3KUFA 1AT1B 4Z6YA 3DLMA 4ZGJB 3KHIA 2RQRA 5C6SA 2EQKA 2QTVA 1RI0A 4A54A 1YNZA 3DL1A 1QW1A 3G4SA 2C5OB 1PHTA 4ELZC 3J7AF 2E64A 1ZSZA 3CCMA 2CP0A 5GANf 2HBPA 1VQOQ 1PCXA 2CP7A 3GPLA 5KYYB 1D3BB 1G8XA 3LYIA 5KYXA 5FRNA 2KRNA 1YIJQ 2DLPA 4LUEA 2M02A 3EG2A 1YJWA 4F17A 4BY7X 2NUZA 3GF5A 3L2ZA 4PFZA 2BE9B 5CAIA 3RMQA 1JBMA 2LTOA 4RTYA 1GUXA 1MHNA 2GF7A 3JRZA 4BXXX 1Q7YC 3L2WA 4C8QB 4CFXB 2FRYA 5CO7A 3LWHA 2LDMA 3OYJA 2PVOB 3ZL7C 4ZGDB 5I21A 2CZ0B 4PJJA 3S6WA 1G3YA 2F1LA 2NUTA 2EQMA 2MYSA 3JCMX 4LNPA 3BY7A 2W99A 2DO3A 2FHDA 3H0IA 1TFBA 2JGZB 2HKNA 3CCJA 2QQRA 3MPUB 2DKGA 4X34A 5CVIA 2QGGA 4LE9A 1H1RB 5CKHA 2JXBA 2ROLA 2QQSA 4CFUD 5LJ5g 2KXCA 2X4WA 1X2KA 4EPCA 3CCEA 5GAOp 3CQTA 2K7AA 2R5AA 3DB4A 2DVEA 3VS7A 3I55T 3M5AA 1K9AA 4LOCA 5CR2A 4JJDA 2G3RA 3NPFA 1GCPA 2IG0A 8AT1B 1M1FA 2GQIA 4O5VA 2RHUA 4AFZC 2J05A 5IH2A 3QYEA 4CFVB 1NLOC 3L2RA 4NOYA 4EOIB 1YHQT 1M3CA 1QCOA 4F7LB 3SWNB 1O9KB 1SPKA 5GAMd 2MWOA 3S3NA 1WHLA 2KK4A 1UHCA 2I0NA 1M2VA 1ACMB 4KBMB 3BDUA 2WPAB 2JN0A 4OGEA 1VQOA 1QKWA 1N9SA 2LQ8A 4IUQA 1W4SA 2JOYA 1YIJA 2VKNA 4CFWB 1FKMA 2RHXA 4FYVB 3M0PA 1PG5B 3NFCA 3CC7Q 4OMOA 5C0MA 1VYVA 4EOJB 2DL5A 2IW9B 2L2PA 2J6FA 5GAMj 1B34B 2EKHA 2P0QA 3GOXA 4LD9K 4FT4A 1EFNA 2KVQG 1W1FA 3CMEQ 1VQKT 4C0FA 2M51A 2RM4A 4C0DB 1G3WA 4A53A 2UZBB 4J6YA 1QVFP 2YUPA 2IW6B 1WJQA 4YOZA 2LZ6B 4RTZA 3TCJA 1K8AU 2DD4A 3DLLA 3PMIA 4EORB 4C8QG 5LJ3d 4BCQD 3R6OA 1VQMQ 3CCST 4PJOF 3PFSA 2R5MA 2EGEA 2RB6A 5HCKA 4OB2B 4EOPB 4ORZA 4M7DD 2EGAA 3QWYA 1H27B 3EG1A 2C5VB 2MPXC 3JB9J 3PGGA 4M7DE 1OPKA 2F2CA 2F5TX 4F7UE 1X69A 3PIPA 3NMZC 4C5GA 1KD1C 1N27A 1U1TA 3FJPA 2AZVA 4AFQC 2KMGA 3CCVT 2OI3A 1VYUA 4JPBW 1IHWA 3CCLA 4YOOA 3MI9B 3NTKA 4IIMA 4BE0A 4E7JA 4M7DC 1GBRA 5LJ5h 1RAAB 1YI2A 4MZPA 1X43A 2D0NA 3RUXA 4M77F 5FU7B 1JJ2P 2CT3A 1NPRA 1K73U 1JRIA 2X3WD 4J9FA 4MMKA 2EQJA 4BB7A 3TNWB 2K3YA 1M27C 3M57A 3QPHA 3G4ST 1BBZA 1OU9A 3QWXX 1UUEA 3MP6A 2DX1A 1UNLD 3CCMT 1EIFA 8ATCB 1V29B 4PJOD 4QQDA 4FYWB 5D7UA 1M1KC 5HNBB 4PJOE 4C92D 3CMAQ 3QKJA 1RADB 2EYXA 3EHRA 4C92E 2KROA 1QQJA 1YJWT 1TUCA 2RF0A 3CMEA 4F14A 1W2BP 4D6WA 2LC4A 5CEIB 2RQVA 2PK2A 1ZA2B 4D8DA 3G71T 4BDYA 5D6XA 2KQWA 3L2VA 1BYMA 4EC8B 1E7OA 1PD0A 1T0HA 4BCPB 4KGZB 2DYBA 2LRQA 5IXFA 4PJOC 1D09B 3RKWA 3FEOA 1NPPA 1HK9A 4C92C 2DMEA 5GANd 2O4XB 4QKUA 4GBQA 4LXCA 3DKMA 4M77E 2COZA 3G7ZA 3M53A 2XDDA 5KYUB 1QVGS 1FINB 4JS5A 2RQTA 1C0MA 3VJPA 2L3SA 2RJFA 3PTAA 3CCJT 2DXTA 3H0FA 3OY9A 3VYGA 2CZ1B 2L3RA 2RI2A 4F16A 3CCUQ 3CXCS 3V7CA 1K8AR 3M0UA 2RJCA 1WXUA 2F2VA 4M77C 3JCMJ 4M7DA 4IUTA 1AWXA 3CCET 4RODA 4JZ4A 4C5IA 4F7UA 1FMVA 3EHQA 4XTXA 1GL5A 1HYOA 1SHGA 3JB9G 2KSSA 4OMNA 2KMTA 2CREA 1OZ3A 1WHHA 3FIFA 1Q82R 1I5LA 4HCBA 5I2MA 3VUZA 1D1CA 2ZPHB 2H8HA 5CYIB 2CH4W 4CRLB 2JM9A 4HNTA 2Y4YA 3CBMA 4MDXA 2JTFA 3PE0A 4TVRA 1F5QB 2YUQA 4DEXA 2O31A 4XK8E 2CYZB 1IHVA 1VQOT 5FRMA 3JCMg 4AMCA 1BI0A 3HRTA 1Q7YU 3PT9A 2VB6A 3M03A 5CQYA 3CMAA 1YIJT 5FGKB 5FWCA 2YRVA 2RH2A 4OVAA 4LDYA 2EPDA 3FJ5A 4WCIA 4PJOA 4FM4B 2VASA 2C5XB 1YHQQ 3EGDB 1H24B 3UATA 2CSQA 4PJMA 2PQWA 5GAN5 2BZ8A 3X24B 3I5SA 4C92A 3A8GB 2WXVB 3OYKA 4FU6A 2VGNA 3OS2A 2H3JA 1I07A 2BIVA 2WIHB 3LH5A 4M75B 1ZUKA 1U06A 2VWFA 1KC8U 2D9TA 4HVWA 3MEUA 2VVKA 1OZ2A 1YFNA 2G6FX 1Y57A 2GFAA 2OAWA 4DBRA 5DQWA 4MMLA 1SHFA 5GAOr 3I35A 1JKWA 2JZ2A 1NJIC 4J9EA 5GAMh 4MFDA 4E7ZA 1JJ2S 3OYBA 4BCGB 1GRIA 2QQAA 1VQKQ 1R8OB 2AHJB 4JUVA 2DPPB 5HK3A 1Q81U 5I5ZB 2RI5A 3LX7A 2KGTA 3CEYA 3CCUA 4KUDK 1QCNA 3IQLA 3OYHA 2P4TA 3DDPB 3JCMc 1XQHA 3PIOA 3QZ5B 4EOLB 4HVVA 5HBJB 4F6SB 1MMGA 2LQNA 5CQXA 1GH6B 2YLBA 4RTUA 2DE0X 2GFUA 3F70A 5IHNA 1CKAA 3V8KA 3CCLT 1VQ9Q 1G3TA 4ANJA 4J6XA 1B07A 5GAMf 1YI2T 4OMLA 4X9DA 2PTKA 1TSFA 3EH2A 3J81E 1KFZA 1RLPC 3JCMb 2EYWA 1HXDA 2P84A 4HCCA 2JT4A 1WPYA 2FVUA 3MCAB 2DJQA 4PKCC 4LDXA 5GMKi 2WSCE 4JZ3A 5DLOA 1VQ7Q 2ZZDA 3RERA 4C5EA 2LP5A 2JVVA 2O01E 3VS5A 2QDJA 3QDFA 2COYA 2JMAA 3EG9A 4XTWA 5LJ3e 2FPFA 3GP8A 4ZNXA 4C0ZA 3J80E 2CGHA 2MAMA 5IN1A 5I2SA 1JU5C 2A36A 1SSHA 3CMET 1VIFA 3VS1A 1VQNQ 3E1SA 4K11A 4R56A 2K9GA 1K9MR 2RQWA 4XAXB 3L1AA 2FEIA 4PLLA 2FZKB 1FMWA 4JRIA 4PFPA 1CSKA 3HZJA 1IO6A 2FRWA 5IDPB 2KR3A 4M78G 3X26B 2OTLQ 1AEYA 1G2BA 4J83A 1KD1U 1YJWQ 1JQQA 3BLQB 4N0AC 4M75G 1V76A 4B9WA 1SRMA 1LCKA 1OI9B 4DBQA 2W9FA 4HKEA 4EC9B 2ECZA 5LJ5d 1KC8R 2YRDA 2C06A 5ICPB 1N6AA 2Y90A 1S1NA 1U3OA 4NL3A 1H1QB 2EVRA 1VQ6A 1EZZB 1UGVA 1OKVB 1VQ8Q 3LWIA 1Q81R 1VQ9A 3BLHB 3E19A 1ZSZB 1YJNQ 3FC3A 2PK9B 3CCJQ 3CPWS 3M59A 2RD1A 2C0TA 4BCND 1I81A 4R55A 1IGUA 5CIUA 1M1KU 4Y28E 2V8JA 2HBWA 3EGXA 1FX7A 2LQKA 4OR5B 2V8KA 2A08A 4RG2A 3OYCA 2CZ7B 2QI2A 3QXEB 2FZCB 3VS2A 2HD0A 3MKDA 3CCEQ 3UWNA 1WQWA 4JS4A 1VQ7A 2ZAEA 3QHRB 1ZHIA 1GUXB 2IW8B 5GANe 2ATCB 3JCMP 4F6UB 3PNWC 2LNHB 4QQGA 4F7JB 2DL3A 4EOQB 2WMAB 4C8QD 3S3OA 3CMAT 3GLXA 4M7AF 5GAN4 1N9RA 4C8QE 2LJ1A 2SEMA 1YWPA 2AK5A 3L42A 1VQNA 4I3ZB 2X35A 1YITA 2YT6A 5HQ0B 4HCKA 3TSWA 3TNHB 2EJFA 2DFUA 2O2OA 4N0AA 4WTOB 3OB9A 2K2MA 3VV0A 4C8QC 4BCJB 4FL6A 2OTLA 2LX7A 2XDPA 1QP3A 3VKHA 3QYBA 4XU2A 1TG0A 2CT4A 2UUEB 1AZGB 1QLYA 2LMJA 3V8JA 2HDAA 3V8LA 2K3XA 1M90R 4FW2A 1BCOA 1GFCA 3CCUT 5GAOn 5HBHB 2X4YA 2W0ZA 2XD0A 1MV3A 1KQSS 2CH4A 4M7AD 1JSTB 3O5ZA 2QK0A 3QG1A 2C4GB 4M7AE 3VS4A 1RUWA 1VQ8A 1UJ0A 4OB3B 1YJNA 1BU1A 3VKIA 2SRCA 5D6YA 1WIEA 1X6GA 3DB3A 1Q86C 4HNUA 1NEBA 3R6NA 3D7SB 3OS5A 3OBWA 2RHIA 1B3QA 2FYKA 2DL4A 5DY9A 2QASA 1UJYA 4BCFB 5CK9A 4B6MA 4M7AC 1RLQC 3JCMW 1KK7A 2WACA 1W70A 3TW6A 2HZYA 4BCMB 2QF7A 1GFDA 2X4XA 2BS4A 2DEUA 2K5FA 3CCLQ 2NWMA 1UNHD 1Z9QA 2JW4A 2R7GA 2YSQA 3BG5A 1VIEA 1U1SA 4ZGEB 5J39A 3OW2A 1S72Q 1YI2Q 2I2LA 1OGUB 1X01A 2E6ZA 3CPFA 3MY5B 2BTTA 4CRIA 2ED1A 4JRPA 4HL4A 1QVGP 3HHTB 2DD4B 1FVVB 2MWPA 5GMKm 1BI3A 2BKZB 1NJIU 4C8QA 4M7DF 3C12A 3QIIA 3RESA 2DMOA 3CCQA 4F7UF 3CXCP 1MMAA 1WFWA 2DM1A 1IGQA 3DTOA 4C0DC 4F70B 9ATCB 1PM3A 4BY6C 2QA4A 4Y92A 2RHYA 3QYGB 1K0XA 3FLGA 3MP1A 1RAIB 1OV3A 2QAZA 4OP0A 5HBEB 4OB0B 4ROEA 3JB9D 3DOGB 4N4GA 2KAFA 1MGQA 2NYSA 4MZTA 3OS1A 4EMGA 1AD5A 1ZBXA 2EIFA 2E4HA 2J7IA 1JXOA 3OSSC 4YTLA 4PLIA 4OB1B 3H9NA 3CC2A 4J6WA 4JLGA 4UC4A 4CXAB 4BCIB 4HLQA 1JO8A 4VUBA 3MIAB 4QVZA 2KE9A 2GQVA 5IF1B 1Y71A 1VQ6T 1M30A 1MNEA 3N5BB 1IB8A 2VYTA 3H41A 4IMYB 4NL2A 4FYXB 3RIRA 3U23A 2I53A 3PMTA 4L59A 1VQLA 1PSFA 2PU9B 4HXJA 4M7AA 1N8RU 1VQ9T 2WJ9A 2RMOA 2FG0A 2QDLA 4E7IA 3HBLA 4C92F 4A4GA 1ZX6A 5GAOl 1ZBJA 3HFNA 3SWNA 4V2SA 3H4CA 3C94A 2F69A 2HQXA 3JCMV 1FWZA 4PL6A 2FB7A 3RDVA 2OTJQ 3VKGA 4RG8A 3JCMd 1VQ7T 4N4HA 1K76A 4XU0A 1VQ5Q 1SG5A 3GBQA 1KIKA 1PWTA 4IUPA 1S72A 1OIYB 1J3TA 2MI6A 1B34A 4EOKB 2RK2A 2QFZA 4X1VA 4J7FA 2EFIA 4DA4A 2FZGB 2HSEB 3CCRQ 1H3HA 5CCAA 2ZPBB 3X25B 2E65A 2ESWA 1VQNT 2HCKA 4AKIA 3OMCA 1YITT 4AT1B 4NS5A 5A2QE 4E7HA 3TN8B 2M16A 3M58A 2KYBA 4BCQB 2OJ2A 3VS6A 2E1HA 2OTLT 4DQ2A 7AT1B 4BDZA 1XO2A 1X2QA 4ATOA 2WSEE 1YCYA 3G1JA 5GMKe 5LJ5f 2KT1A 3OYEA 2UZEB 2EYYA 1SEMA 4M78F 3S3MA 3TQ7P 1TOVA 3JV3A 2YUOA 2YLCA 4HVUA 2Z0WA 1PD1A 1UHFA 1I1JA 1O9SA 3GNFB 3L2UA 2DD5A 2MCNA 2NUPA 1RACB 1M1GA 1SSFA 2V1RA 4M6VA 1UTIA 4RTVA 5A0GA 3QYHB 1VQ8T 2W10A 4BCHB 1K0SA 4KRCB 1YJNT 1YBYA 3M0TA 5KYWA 2HMAA 1OOTA 3EG0A 1OX8A 2YUNA 1OULA 2CP5A 2BPMB 2LJ3A 1UB4A 2K6DA 2K2VA 1O75A 2EWNA 2DYIA 1M2OA 5LQFB 3FB9A 2OTJA 2H3EB 1M8MA 2CSIA 4BI8B 4PJOB 1TUGB 4CC3A 3VYHB 2DZ9A 3ER0A 4JRQA 3RKXA 1N8RR 2LW4A 1VQ5A 1TH7A 3SDZA 2QDYB 4M78D 2KI7A 2BZYA 4F6WB 4M78E 3GIBA 3BHTB 3LQ5B 2L5QA 4EMKC 1BU2A 4JX4A 1M9SA 2E5QA 1IREB 1ZLMA 4M75D 2ENMA 1AOJA 3CCRA 1H26B 2BS3A 3M0RA 1IXDA 2P0KA 3O8VA 5KCOA 4AI6A 4J9GA 1PSEA 3X20B 4E7SA 2DJZA 3UDCA 2IVWA 3M0QA 2QGFB 1NEGA 1WHGA 1NG2A 2BUDA 4M78C 4BE1A 5KYNA 3CCQT 4FYYB 2CCHB 4M77B 4FX3B 1OQKA 3QHWB 3HRUA 2E41A 3ME9A 3QWLA 2UZDB 2HKQB 3FRNA 2QA4T 4Y72B 1K73R 2VV5A 1HJDA 2BE7D 1I0CA 3BW1A 5AYFA 3CBPA 3CPWP 2K4YA 1E6HA 3X28B 3JB9I 2JM8A 2MMPA 3C95A 1T0JA 4MZMA 3A5ZB 2WIPB 1Y0MA 1Q86U 3CC2T 2XU8A 4ZN1A 1QMZB 5M9OA 3A8MB 2V1QA 3BFMA 1RI9A 2IPOB 2COWA 5GMKl 1R0CB 4J8OA 1ABOA 3EFOA 2LQWA 1Q95G 5BNJB 2RI3A 1Y7XA 2ZZDB 3QDRB 1UFFA 5L2WB 2HL5C 5FLXE 2DTHA 5GAMe 3KXTA 3META 1WXBA 3O0GD 1MUZA 2YDLA 1VQ6Q 3QUIA 4EMKA 4A4HA 2KRSA 2K5IA 4FT2A 4ROCA 2DXBA 2XKOC 4AFSC 1C1AA 3BDLA 4WF2A 1OIUB 1X6OA 1GCQA 4J9HA 4AKGA 3ZEHA 1S72T 4CFNB 1H4LD 5A0LA 3OYLA 1JB0E 3CD6A 4O6JA 4PJOG 4M78A 5GANg 3PVQA 3OYAA 2M0OA 2K3BA 3EGUA 1NZ9A 3MY1B 4Y91A 5ECAA 1ARKA 2EYZA 4QQ6A 1I4K1 1KHIA 1M3BA 2E10A 3OYFA 4M75A 1PC0A 1NM7A 3K7AM 2DL7A 2DXCA 4FIBA 2EJGA 2HQHA 2QXFA 2EUFA 4XU3A 4CC7A 2PVGB 3TREA 5GAOq 1OEBA 1K8AC 1KQSP 3A8OB 2JTMA 2KXDA 2O9SA 2GNCA 5HVYB 1PKSA 2MIOA 1UEBA 3EAEA 1JXMA 1H3ZA 2LCLA 1VINA 2KRMA 2DIGA 4RUGA 2C0IA 1VOLA 2L0AA 2R58A 4M77G 3H6ZA 3C0CA 4B9XA 3KFVA 3I56Q 1D1BA 1KSWA 3JCMh 3OW2S 2XDBA 4IKFA 3BE3A 2LX9A 1Q7YR 1YITQ 1Q82C 4X9CA 5FU6C 3JB9H 4LN2A 3RR6A 2QQBA 5CKDA 1HD3A 3MEAA 2V8IA 2CJMB 5HK0A 2D0QB 2YWWA 3BHUB 4EIKA 2X1NB 5CKFA 3EG3A 4XTZA 4A4EA 2DZCA 2RJDA 2O9VA 1PRMC 1ZP2A 1RL2A 4OF1A 5D6WA 2B8AA 2WFYB 2JUFA 2AIRB 1M8VA 2ROTA 1X75C 1QLBA 1C9BA 1YJ9Q 4C8QF 2DERA 1XTDA 2W96A 2XG8D 1AWJA 1QKXA 2QQ9A 2CDTA 3JCMf 2DRKA 3QZ9B 4OGCA 1VYTA 5GJVB 2JTEA 4OMPA 2OTJT 4MDWA 3HP9A 4KULA 2EQIA 5GAN6 1VQ5T 1WLPB 2RJEA 3WXMB 2P4RA 2L3QA 1ZSGA 4L6V5 3C4SA 5EJCA 3TW7A 4QVCA 5KYXB 4JX6A 3UPUA 2HL3A 4II5B 2EYQA 1JOWA 3BHVB 1OYXA 4LDUA 2QEXA 3HB9A 2C5NB 3CCRT 1QVFA 2PMIB 3BG3A 5GAN7 1LJOA 4DOVA 4YOSA 2VXFA 4R0KA 4UN0A 4E2FB 2JS2A 3OYIA 3TNIB 2CUBA 3P8BB 3I9QA 1X27A 2DTIA 4FSXA 3BLRB 2B86A 5IT9E 5EC7A 2FL7A 3REBB 1UGQB 2I40B 2D6FA 3CC4A 1D0YA 2NUTB 3RNJA 3T9NA 2D1XA 5DLQE 4AG1C 4AG2C 2EBPA 3I56A 1K4US 4G6LB 4XTVA 1XJWB 1N4MA 5GMKj 2RNAA 1JEGA 4A4FA 4BCOB 1NYFA 3F5XB 2FPDA 3LLRA 3BG9A 2QYZA 3CCQQ 1WX6A 1AZEA 2BKDN 3NDQA 2KDSA 3A1PA 2M0YA 2QA4Q 4DEYA 1W98B 2KR6A 2KYMA 4J9BA 2JJ9A 3E2UA 5EG2A 3SD4A 4KRTA 4OMMA 4C0GA 4NC6A 4BCNB 3OSVA 4FCYA 1TS9A 2J6OA 1HSQA 1YJ9A 4BCMD 3OYGA 1JJ2A 3EFSA 2D8JA 2HEQA 1LOJA 1KG1A 5J26A 4C5HA 2AKKA 2P0PA 4EOOB 4J7IA 4E6RA 2O88A 3CC2Q 4IIOA 4ME7A 3E9FA 1KD1R 3WVDB 1H1PB 4BY1X 4GLMA 1LPLA 3G71A 1Y96A 2D8HA 2DEQA 1UGPB 2EQUA 1AHJB 1K9MC 3QJ6A 2PNIA 1WHJA 2AZSA 4PJLA 3ZFJA 4XTYA 1M2VB 1VUBA 4GLKA 1VQLQ 2R57A 3EH1A 4RTTA 2W2HA 4A4KA 1W2BA 5EFQB 1VQPQ 1VOMA 2QG9B 1AWWA 2JS0A 2JMCA 2DETA 3ZBDA 2DA9A 3CD6T 1I8FA 1WHKA 4L5GA 4BBSM 3LGFA 3JB9F 1T3SA 1VQ4A 1UNGD 4HT9A 5GJWB 1EX4A 1D1AA 2DL8A 1H25B 2MF2A 3LW5E 3RGFB 1R0BG 3M9QA 3OYNA 4EOSB 2VC8A 3MP8A 1D3BA 5KYYA 1G3NC 1WQ7A 2DRMA 1WHMA 3SWNC 4DBFA 4RMOA 4RTXA 5FROA 4QW2A 1KC8C 4F7SB 2LT1A 2M9UA 1WDXA 1H1SB 1M1KR 1KQ2A 4KH1B 2G9XB 1CKBA 3ASKA 4E7LA 3A8LB 3RMSA 3OYYA 3ULRB 1DJ7B 5CKEA 3FDRA 5I11A 1Q81C 2EAYA 2RO0A 1TTHB 3OYDA 2ED0A 3PVLA 4RKUE 4M7AB 2PUKB 3TSZA 3OYMA 3SEMA 2WEVB 4XU1A 4F7NB 4AKHA 3OBYA 1FXXA 4JJCA 3UA7A 3HO8A 2ZCFB 1GBQA 2E5KA 4LUDA 3M54A 2LT4A 3QBYA 2A7YA 2CCIB 5AT1B 1KHCA 4EDUA 5FW9A 2DNUA 4JRKA 4BI4A 1M5Q1 4HCZA 1RABB 2W9ZA 4CFUB 4KUIA 2CZ6B 4E7KA 4CC4B 4M4ZA 4Z88A 2YHTA 4NSTB 3POMA 3H8ZA 1KXUA 1PKTA 4QSHA 1H8KA 1SF9A 2DIQA 1F1BB 1U5SA 2OAUA 1M4ZA 3G6EQ 4BE2A 4BCKB 1GXIE 4KGVB 2EKOA 2NLUA 2OX7A 4QVDA 2K79A 5IHKA 3MJXA 2E3HA 5GAN3 4LDWA 4BY6B 1UDLA 3HTRA 2GCXA 4JX5A 1Y07A 4KRDB 3AT1B 1VQPA 3MEVA 1O9KA 3A98A 3CPWA 3VU3C 3WVEB 1NYGA 2QEXT 4MFEA 1OL1B 2BS2A 3E9GA 4XQ3A 4DOWA 5FU7C 2X51A 4P5NA 1OPLA 2X9HA 4MIMA 1M90C 2J6KA 1BB9A 1E9HB 2M1HA 2GTOA 2CP6A 2VXEA 4FW1A 1X6BA 4CI0C 1Q82U 2ZPIB 2A37A 5LMKB 4FSSA 4BACA 1AD6A 2F5KA 2LNVA 5LJ3j 2DD5B 3CC4T 1K1ZA 2NUPB 4PJNA 3QO3A 2EW3A 3I56T 4BBRM 1YP5A 1I5OB 5LJ5e 1PKDB 3JAME 4XTUA 2VGMA 1W6XA 2LCSA 3M0SA 4JJBA 4OMFB 2UZLB 1YN8A 1RAHB 2V26A 4JDSA 5KYWB 2YRCA 1E7PA 1FMKA 3VYGB 1OX9A 3HKSA 1FYNA 2CS7A 1Z9ZA 1WJRA 4KGXB 4A63B 2RPNA 5J3BA 2A3LA 2GBQA 1NJIR 4M7DB 1WI7A 1YWOA 4J9CA 4M7AG 1BI2A 4QT7A 5L23A 1BK2A 4PK4A 4F7UB 1QP2A 2DVJA 5GMKh 3VS3A 1H28B 2WSFE 1D0XA 5LL6S 2XIDA 3B57A 2KBTA 1YJ9T 3H0HA 5HY6A 4M75F 3CC7A 2RN8A 3AHUA 5IHYA 1E6GA 2IIMA 2FPEA 3VRYA 2DBMA 2IVXA 2ZPFB 3G6EA 1UGSB 2G77A 2PZ1A 2KY9A 1WGSA 6AT1B 1D3UB 4J5YA 3JCMQ 1KQSA 5GAMg 3VS0A 2AKLA 2GGRA 4KH0B 1PNJA 1QMCA 4OGRB 2Y4XA 2LCCA 2B9RA 2QGSA 1R77A 2WMBB 2KT8A 1B7TA 4PFOA 4M77D 1ABQA 2CUDA 1AISB 1SKUB 1A0NB 1VQMA 2LJ0A 3OW2P 1VQ4T 2HSPA 4IURA 1WXTA 3L2QA 5IHIA 3NHNA 3CBOA 1P5EB 3LH0A 2XMFA 4C92B 1IZ6A 5IDNB 1ZUYA 2XI9A 3UT1A 1GY3B 1NE8A 3HRSA 5GANj 3QJYA 4OMQA 3CD6Q 5DQVA 1NLPC 4M75E 3TEEA 4HNVA 1LVKA 3THKA 1V1CA 2A28A 2E3IA 2PVDB 3MEWA 3SB2A 2QTXA 1GCQC 1MMNA 5LJ3g 3REAB 4LDVA 1WNLA 4ZTFA 3HL8A 4RCCA 2ZGWA 3EFOB 1IRXA 1JSUB 2X3XD 2O4XA 3JSCA 1QWFA 5KH6A 1QVFS 5KCHA 4M75C 3HSBA 2EGCA 5KYUA 2GTJA 2X4JA 5GAN2 4EMKB 2HQEA 1WJSA 2LVMA 1K9MU 3OS0A 2DXBB 4E47A 3I55Q 2YXYA 2V22B 3EFRA 3SHWA 1KQ1A 4JJNK 4M7DG 4ESRA 5A0DA 1OI1A 1TU0B 4CFMB 1G3SA 4F7UG 5CKBA 2K5LA 4IUUA 4M78B 2L8DA 1BKBA 3HPWA 1SRLA 3QSUA 2RHZA 3NGPA 4YC3B 2KEAA 2DF6A 3MHXA 2HNIA 4ELLA 1VQLT 3M56A 2DXCB 1ENWA 1YCSB 3NTHA 4J9IA 2VUBA 1VQPT 2MK5A 4EONB 3EG9B 1ZUUA 2C0OA 4AFUC 3P8DA 2E12A 2DTOA 2PUOB 4EOMB 1XNIA 3MO8A 2ABLA 2RQUA 4M77A 2JNGA 3SFMA 2RA2A 2IN3A 3V7SA 3KBGA 3PO3S 3M55A 2CP2A 2DBKA 4DBHA 4CC2A 2EJ9A 1QWEA 3EGDA 5IXBA 2RK1A 2A0FB 1RAEB 2FO0A 2CP3A 2QEXQ 1AWOA 4C92G 2BZXA 1OKWB 5L8RE 4HA8A 1TWBA 2F2XA 2L89A 4JLIA 2AT1B 3CCSQ 1W2BS 1TD6A 3M4GA 1WYXA 1LNXA 2DAQA 1BIBA 5HKCA 3VUBA 3V7RA 3DJBA 5IAYA 1WZOA 4IUVA 1OU8A 3OQ5A 2QQ8A 4RCBA 5DM7R 4EMHA 4ZTJA 3EOCB 4II1A 5ACBA 3I5RA 4Z8AA 5LJ3h 2ZPGB 3CCVQ 3UA6A 3CC4Q 1G5VA 2E6NA 2K57A 4BD3A
chains in the Genus database with same CATH topology
1N8RC 3PMTA 4L59A 4XTXA 4NC6A 4C0GA 3OSVA 1VQLA 1PSFA 2PU9B 3I55A 1BIAA 1N8RU 1VQ9T 1YJ9A 4M7AA 2WJ9A 3OYGA 3TU4K 3JB9G 2KSSA 3GNGA 3EFSA 1JJ2A 4E7IA 2KMTA 1OZ3A 3HBLA 3FIFA 3OMGA 3P8HA 4C92F 1I5LA 4A4GA 4HCBA 5I2MA 1LOJA 1KG1A 3VUZA 5J26A 2ZPEB 4C5HA 5GAOl 3HFNA 4N4IA 3SWNA 4V2SA 2P0PA 2ZPHB 3H4CA 3LGLA 4J7IA 3C94A 3CC7T 2F69A 2HQXA 4KT0E 4ME7A 1H641 4BI3A 1YHQA 3JCMV 2DK3A 4HNTA 3E9FA 1UGRB 2XICA 1FWZA 2Y4YA 3WVDB 3JCMe 3G6ET 3CBMA 4MDXA 1QVPA 4ELJA 4PNOA 4PL6A 1Y96A 3G71A 2DEQA 1UGPB 2EQUA 2FB7A 2JTFA 4BUGA 4TVRA 2DXUA 2XHCA 1AHJB 1K9MC 3QJ6A 3VKGA 4RG8A 3JCMd 1VQ7T 4N4HA 3ZFJA 4XK8E 2CYZB 4XTYA 4XU0A 1VQOT 5FRMA 3JCMg 4GLKA 1VUBA 1BI0A 3HRTA 3OA6A 3A8HB 1Q7YU 3PT9A 1QVGA 1M90U 4IUPA 4Q5WA 1ZQ1A 2R57A 5CQYA 5LJ3f 4GY5A 3CMAA 1YIJT 4A4KA 1S72A 1W2BA 5GAOm 1XOVA 2HAXA 2YRVA 2MI6A 1B34A 4ELYC 1K73C 2RH2A 4OVAA 2E70A 4LDYA 3ZBDA 3CD6T 2RK2A 1I8FA 5KE2A 2QFZA 4L5GA 4J7FA 4BBSM 2EFIA 4FM4B 3LGFA 4DA4A 3JB9F 4PJOA 1VQ4A 4Z02A 4HT9A 1VQKA 3CXCA 2PQWA 2ZPBB 3X25B 2E65A 5FU6B 5CCAA 3X24B 5GAN5 1VQMT 4C92A 2MF2A 3A8GB 3LW5E 3M9QA 1VQNT 3OYNA 3OYKA 2VC8A 3MP8A 1D3BA 4AKIA 1WQ7A 2VGNA 3OMCA 4FU6A 3SWNC 4RMOA 3OS2A 2H3JA 5FROA 1YITT 4QW2A 1KC8C 2BIVA 1P92A 2LT1A 2M9UA 4M75B 4NS5A 5A2QE 4E7HA 2M16A 3M58A 1KQ2A 1KC8U 2D9TA 3Q1JA 3MEUA 1OZ2A 4HT8A 2GFAA 2E1HA 3ASKA 4MMLA 2OTLT 5GAOr 4E7LA 3A8LB 3RMSA 1U8RA 3OYYA 4DQ2A 4BDZA 1DJ7B 2JZ2A 5CKEA 1NJIC 2XK0A 5GAMh 4ATOA 2WSEE 5GAN8 3FDRA 4MFDA 1YCYA 5GMKe 5LJ5f 3OYBA 3OYEA 3CCSA 1JJ2S 3S3MA 1Q81C 4M78F 5KE3A 2EAYA 2QQAA 1R8OB 3URGA 2AHJB 4JUVA 2DPPB 2CKKA 2RO0A 5HK3A 3M4YA 1Q81U 2YLCA 3OYDA 5LJ5j 2RI5A 3LX7A 4RKUE 3CEYA 2PUKB 4M7AB 3CCUA 3OYMA 4KUDK 1O9SA 3GNFB 3NTIA 3QHSA 4XU1A 4AKHA 3OBYA 5GANh 3OYHA 3L2UA 2DD5A 1FXXA 3RKYA 1BI1A 2P4TA 3HFOA 1XQHA 4LD6A 3HO8A 3JCMc 3PIOA 2ZCFB 1M1GA 3CCVA 1SSFA 3INZA 3QZ5B 4M6VA 2LT4A 3M54A 4ZN3A 3QBYA 2A7YA 4BD3A 5A0GA 3QYHB 5CQXA 1KHCA 4EDUA 2YLBA 1VQ8T 1Y96B 4JRKA 2GFUA 3F70A 3V8KA 4BI4A 3CCLT 1M5Q1 4HCZA 1YJNT 1YBYA 4KUIA 1G3TA 2CZ6B 3KUFA 4J6XA 4Z6YA 3DLMA 5GAMf 1YI2T 4E7KA 1UB4A 4ZGJB 2K2VA 3KHIA 1O75A 2YHTA 3H8ZA 4X9DA 2EWNA 5C6SA 2EQKA 3J81E 4QSHA 1RI0A 4A54A 2DIQA 3JCMb 3DL1A 1HXDA 1QW1A 3FB9A 4HCCA 3G4SA 2OTJA 2OAUA 1M4ZA 4BE2A 1WPYA 1GXIE 4BI8B 4PJOB 2FVUA 3MCAB 4PKCC 2EKOA 4ELZC 3VYHB 2DZ9A 2E64A 2NLUA 3ER0A 4QVDA 4JRQA 3RKXA 3CCMA 4LDXA 5GMKi 2WSCE 1VQ5A 5DLOA 1TH7A 3SDZA 5GANf 2ZZDA 2QDYB 4M78D 4C5EA 2HBPA 4LDWA 4BY6B 5GAN3 3RERA 3GPLA 2GCXA 4JX5A 1D3BB 1Y07A 2JVVA 2O01E 3LYIA 2QDJA 4M78E 5FRNA 3GIBA 1VQPA 2L5QA 4EMKC 4XTWA 5LJ3e 4JX4A 1M9SA 2E5QA 1IREB 3MEVA 3GP8A 4C0ZA 4M75D 3J80E 3CPWA 1YJWA 3CCRA 3VU3C 3WVEB 2CGHA 2MAMA 2BS3A 5IN1A 2QEXT 4MFEA 5I2SA 3GF5A 2BS2A 3E9GA 3L2ZA 2P0KA 3O8VA 4XQ3A 4AI6A 4DOWA 5CAIA 1PSEA 5FU7C 3X20B 5KCOA 2DJZA 3RMQA 1JBMA 2LTOA 1VIFA 3CMET 3UDCA 2IVWA 1MHNA 2GF7A 3E1SA 3JRZA 4P5NA 4R56A 1Q7YC 3L2WA 4XAXB 4MIMA 3L1AA 1M90C 4C8QB 2BUDA 4M78C 4BE1A 4PLLA 5CO7A 3CCQT 3LWHA 2LDMA 3OYJA 4M77B 4JRIA 2M1HA 2PVOB 2VXEA 4ZGDB 5I21A 2CZ0B 3HZJA 3HRUA 2E41A 4CI0C 3ME9A 1Q82U 3S6WA 1G3YA 2ZPIB 3QWLA 4M78G 3X26B 2EQMA 3FRNA 4BACA 2F5KA 2LNVA 3JCMX 2QA4T 3BY7A 4J83A 5LJ3j 2DD5B 2VV5A 1KD1U 3CC4T 2DO3A 3QO3A 4N0AC 2FHDA 4M75G 3J7AF 3I56T 4BBRM 3BW1A 5LJ5e 5AYFA 3CBPA 4B9WA 3JAME 4XTUA 2VGMA 3CCJA 2QQRA 2K4YA 2DKGA 3X28B 4OMFB 4X34A 4HKEA 5CVIA 3JB9I 5LJ5d 2MMPA 3C95A 5CKHA 4JDSA 2C06A 2QQSA 4MZMA 3A5ZB 1Q86U 3CC2T 1N6AA 2XU8A 5LJ5g 1E7PA 4ZN1A 3VYGB 2Y90A 3HKSA 2X4WA 2CS7A 1VQ6A 4NL3A 5M9OA 1WJRA 3A8MB 3BFMA 4EPCA 3CCEA 5GAOp 5J3BA 2A3LA 5GMKl 4M7DB 2R5AA 3DB4A 4M7AG 2DVEA 1BI2A 3LWIA 4J8OA 4F7UB 1VQ9A 1QP2A 3E19A 5GMKh 2RI3A 2WSFE 3FC3A 3I55T 1Y7XA 3M5AA 5LL6S 4LOCA 2XIDA 3CPWS 1YJ9T 2ZZDB 2RD1A 3M59A 1I81A 5CR2A 4R55A 3QDRB 4M7AF 2G3RA 5CIUA 2IG0A 4M75F 5HY6A 2DTHA 5FLXE 3CC7A 5GAMe 4Y28E 3KXTA 2V8JA 1M1KU 3META 3AHUA 1M1FA 4O5VA 2RHUA 1FX7A 2LQKA 2V8KA 3QYEA 3L2RA 4RG2A 4NOYA 2ZPFB 3OYCA 3G6EA 1YHQT 2CZ7B 1UGSB 2QI2A 2G77A 3QXEB 3SWNB 2KY9A 5GAMd 2MWOA 1WGSA 2HD0A 3QUIA 3S3NA 4EMKA 4A4HA 2KK4A 2K5IA 4J5YA 3JCMQ 1KQSA 3UWNA 1WQWA 4FT2A 5GAMg 4JS4A 1VQ7A 4KBMB 3BDUA 2DXBA 2JN0A 4OGEA 1VQOA 2XKOC 1N9SA 1ZHIA 2LQ8A 4IUQA 2Y4XA 5GANe 1W4SA 3BDLA 2LCCA 4WF2A 3JCMP 2JOYA 3PNWC 1X6OA 4QQGA 1YIJA 4AKGA 4C8QD 3ZEHA 3S3OA 1FKMA 1S72T 2RHXA 3GLXA 5A0LA 3OYLA 3CMAT 5GAN4 1JB0E 3CD6A 4O6JA 1N9RA 4PJOG 4M77D 3NFCA 4C8QE 5C0MA 4M78A 5GANg 3OYAA 2M0OA 5GAMj 1B34B 1NZ9A 1VQMA 4Y91A 2P0QA 3GOXA 1VQ4T 4QQ6A 3L42A 4FT4A 2KVQG 1I4K1 4IURA 2X35A 1VQKT 4LD9K 1VQNA 4C0FA 1KHIA 3L2QA 2E10A 2RM4A 3CBOA 3OYFA 4M75A 1YITA 4C0DB 1G3WA 3LH0A 4C92B 2DXCA 1IZ6A 4FIBA 2EJGA 4XU3A 2QXFA 4A53A 2EJFA 2XI9A 2PVGB 3UT1A 4N0AA 1NE8A 3HRSA 3OB9A 3TREA 4J6YA 5GAOq 1K8AC 3A8OB 2JTMA 3VV0A 4C8QC 5GANj 3QJYA 1WJQA 4FL6A 2OTLA 3TCJA 1K8AU 2DD4A 1QP3A 2XDPA 3VKHA 1UEBA 3QYBA 3EAEA 4XU2A 1H3ZA 2LCLA 4M75E 2DIGA 3TEEA 4HNVA 3PMIA 3DLLA 4C8QG 5LJ3d 2PVDB 4NL2A 3MEWA 3SB2A 2QTXA 2R58A 3R6OA 4M77G 3H6ZA 4B9XA 5LJ3g 3CCST 4PJOF 3JCMh 3OW2S 3PFSA 4IKFA 2R5MA 2XDBA 2RB6A 1WNLA 4LDVA 4OB2B 2LX9A 3V8JA 4ZTFA 4M7DD 3HL8A 3V8LA 4RCCA 2K3XA 2ZGWA 4X9CA 5FU6C 1Q82C 3JB9J 3JB9H 3PGGA 4M7DE 2QQBA 5CKDA 3CCUT 5GAOn 2O4XA 3MEAA 2F5TX 2V8IA 2X4YA 4F7UE 3JSCA 3PIPA 5HK0A 2D0QB 2XD0A 4C5GA 5KH6A 5KCHA 1KQSS 1KD1C 1QVFS 1N27A 1U1TA 4M7AD 3FJPA 4M75C 5CKFA 3HSBA 4XTZA 4A4EA 2DZCA 3QG1A 2KMGA 3CCVT 2RJDA 4M7AE 1RL2A 4OF1A 1VQ8A 2X4JA 4OB3B 5D6WA 2B8AA 2JUFA 5GAN2 3CCLA 3NTKA 4EMKB 4BE0A 1M8VA 2HQEA 1YJNA 1WJSA 2LVMA 3VKIA 1K9MU 1X75C 3OS0A 1QLBA 2DXBB 3DB3A 5D6YA 4E47A 4E7JA 1Q86C 4HNUA 5LJ5h 4M7DC 1YI2A 3EFRA 4C8QF 4MZPA 3OS5A 1XTDA 3OBWA 2RHIA 2XG8D 4M77F 3RUXA 2FYKA 5DY9A 5FU7B 1KQ1A 2QQ9A 4JJNK 4M7DG 5A0DA 3JCMf 1OI1A 5CK9A 3QZ9B 4OGCA 1NPRA 1G3SA 4F7UG 1K73U 4M7AC 1JRIA 5CKBA 3JCMW 2K5LA 4MMKA 2EQJA 4IUUA 4M78B 4BB7A 2WACA 2K3YA 2L8DA 3M57A 3QPHA 3TW6A 1BKBA 3RIRA 3G4ST 3HPWA 4MDWA 2OTJT 3QSUA 3HP9A 2QF7A 2RHZA 3MP6A 2X4XA 4KULA 2BS4A 3CCMT 2K5FA 1EIFA 3MHXA 5GAN6 1V29B 2HNIA 1VQ5T 4PJOD 2RJEA 3M56A 4QQDA 3WXMB 1VQLT 4L6V5 1M1KC 3BG5A 4PJOE 2DXCB 1VIEA 3C4SA 1U1SA 4ZGEB 3SD4A 3NTHA 5EJCA 4C92D 5J39A 2VUBA 2I2LA 3OW2A 1VQPT 3QKJA 3TW7A 1X01A 4QVCA 2E6ZA 4JX6A 3UPUA 3CPFA 4CRIA 4C92E 2EYQA 2QEXA 4JRPA 1OYXA 4HL4A 4LDUA 3HB9A 1YJWT 3P8DA 3HHTB 3CCRT 2DD4B 2MWPA 3CMEA 2E12A 2DTOA 5GMKm 2PUOB 1BI3A 4D6WA 1NJIU 2LC4A 4C8QA 1QVFA 3BG3A 5GAN7 1XNIA 3G71T 3MO8A 1LJOA 5D6XA 4DOVA 4BDYA 4M7DF 3C12A 4M77A 2JNGA 2KQWA 3QIIA 3RESA 2VXFA 3SFMA 3L2VA 2RA2A 1BYMA 3CCQA 4F7UF 2LRQA 4PJOC 3V7SA 3OYIA 3KBGA 3P8BB 3RKWA 3M55A 4C0DC 3FEOA 1NPPA 1HK9A 4C92C 4BY6C 2DTIA 2QA4A 4FSXA 2EJ9A 5GANd 2RK1A 2O4XB 5IT9E 2RHYA 3QYGB 2FL7A 1UGQB 3DKMA 2D6FA 3FLGA 3MP1A 4OP0A 3CC4A 4M77E 4OB0B 3G7ZA 3M53A 5DLQE 3T9NA 4C92G 2XDDA 3I56A 3JB9D 5L8RE 1QVGS 4HA8A 4XTVA 4N4GA 4JLIA 2KAFA 2L89A 4JS5A 1MGQA 4MZTA 1W2BS 3VJPA 3M4GA 3OS1A 1LNXA 2DAQA 1BIBA 4EMGA 5HKCA 5GMKj 3VUBA 1ZBXA 2RJFA 3V7RA 2EIFA 2DXTA 3PTAA 4A4FA 5IAYA 3CCJT 4IUVA 3LLRA 3OSSC 4YTLA 4PLIA 4OB1B 3BG9A 3VYGA 3OY9A 2CZ1B 3CC2A 3OQ5A 4J6WA 2L3RA 4JLGA 2RI2A 4UC4A 2BKDN 2QQ8A 3CXCS 4RCBA 4HLQA 3V7CA 5DM7R 2KDSA 4VUBA 4EMHA 2RJCA 4QVZA 4ZTJA 2GQVA 4M77C 3JCMJ 4M7DA 1Y71A 4II1A 1VQ6T 4IUTA 3N5BB 5LJ3h 2ZPGB 3CCET 4C5IA 4F7UA 2VYTA 2KR6A 1G5VA 2E6NA 2K57A 5EG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QYH B;  4OB3 B;  1PSF A;  1QP2 A;  2PU9 B;  2WSF E;  2DXB B;  2CZ6 B;  2ZZD B;  2ZPE B;  4ZGJ B;  4Y28 E;  2ZPH B;  4KT0 E;  3QZ9 B;  1UGR B;  2ZPF B;  2CZ7 B;  1UGS B;  3WVD B;  3QXE B;  1GXI E;  1UGP B;  3VYH B;  1AHJ B;  2DXB A;  2WSC E;  2ZZD A;  2CYZ B;  2QDY B;  4XK8 E;  1V29 B;  3A8H B;  2O01 E;  4L6V 5;  2DXC B;  4ZGE B;  1IRE B;  1JB0 E;  3WVE B;  4FM4 B;  3HHT B;  2DD4 B;  1PSE A;  3X20 B;  2ZPB B;  2PUO B;  3X25 B;  3X24 B;  3LW5 E;  3A8G B;  2DXC A;  2PVG B;  2PVO B;  4ZGD B;  2CZ0 B;  3A8O B;  2ZPI B;  3X26 B;  2DD4 A;  1QP3 A;  3A8L B;  3QYG B;  1UGQ B;  1DJ7 B;  2DD5 B;  4OB0 B;  2WSE E;  2PVD B;  5L8R E;  2AHJ B;  2DPP B;  4OB2 B;  3X28 B;  4OB1 B;  3VYG A;  4RKU E;  2CZ1 B;  2PUK B;  3VYG B;  2D0Q B;  2DD5 A;  3A8M B;  2ZCF B;  2ZPG B;  3QZ5 B; 
#chains in the Genus database with same CATH topology
 1N8R C;  1N5Z A;  4D8K A;  3I55 A;  1BIA A;  3TU4 K;  3GNG A;  3EJ1 B;  2L3P A;  3OMG A;  3P8H A;  3DDQ B;  1URC B;  1MMD A;  2ZPE B;  4N4I A;  3TVT A;  3CC7 T;  3LGL A;  4BI3 A;  4KT0 E;  1YHQ A;  1H64 1;  2DK3 A;  3JCM e;  1UGR B;  2XIC A;  3G6E T;  3EGX B;  1QVP A;  4ELJ A;  1UG1 A;  4PNO A;  4HT8 A;  4BUG A;  3G4S Q;  2DXU A;  2XHC A;  4RTW A;  5FWB A;  3GTM S;  1WA7 A;  3CCM Q;  1OL2 B;  1H92 A;  3OA6 A;  3A8H B;  1QVG A;  2PJQ A;  1M90 U;  4Q5W A;  5LJ3 f;  1ZQ1 A;  1Q86 R;  4GY5 A;  1AVZ C;  5GAO m;  1XOV A;  2HAX A;  1ZSZ C;  4ELY C;  1K73 C;  2E70 A;  3G33 B;  5KE2 A;  1M3A A;  1VYW B;  1TXQ A;  3VRZ A;  4Z02 A;  1VQK A;  1MV0 B;  3CXC A;  5FU6 B;  1VQM T;  3G71 Q;  1P92 A;  2DIL A;  1ZA1 B;  4F04 B;  3Q1J A;  2C6T B;  1U8R A;  4J9D A;  3EID B;  1PRL C;  1VA7 A;  2KNB B;  3RBB B;  2XK0 A;  2WHB B;  2F2W A;  5GAN 8;  2PHG A;  1RAG B;  1NBE B;  3CCS A;  1KJW A;  1VQ4 Q;  5KE3 A;  3URG A;  2CKK A;  3M4Y A;  3UF4 A;  5LJ5 j;  4TTH A;  1BCM A;  1RAF B;  1TUD A;  3NTI A;  3QHS A;  1UE9 A;  1QCF A;  5GAN h;  3RKY A;  1BI1 A;  1UEC A;  3HFO A;  4LD6 A;  3CCV A;  1C6V X;  3INZ A;  4ZN3 A;  2MOX A;  1MND A;  1G83 A;  1T3L A;  1Y96 B;  5I22 A;  2J06 A;  1D0Z A;  4Z89 A;  3KUF A;  1AT1 B;  4Z6Y A;  3DLM A;  4ZGJ B;  3KHI A;  2RQR A;  5C6S A;  2EQK A;  2QTV A;  1RI0 A;  4A54 A;  1YNZ A;  3DL1 A;  1QW1 A;  3G4S A;  2C5O B;  1PHT A;  4ELZ C;  3J7A F;  2E64 A;  1ZSZ A;  3CCM A;  2CP0 A;  5GAN f;  2HBP A;  1VQO Q;  1PCX A;  2CP7 A;  3GPL A;  5KYY B;  1D3B B;  1G8X A;  3LYI A;  5KYX A;  5FRN A;  2KRN A;  1YIJ Q;  2DLP A;  4LUE A;  2M02 A;  3EG2 A;  1YJW A;  4F17 A;  4BY7 X;  2NUZ A;  3GF5 A;  3L2Z A;  4PFZ A;  2BE9 B;  5CAI A;  3RMQ A;  1JBM A;  2LTO A;  4RTY A;  1GUX A;  1MHN A;  2GF7 A;  3JRZ A;  4BXX X;  1Q7Y C;  3L2W A;  4C8Q B;  4CFX B;  2FRY A;  5CO7 A;  3LWH A;  2LDM A;  3OYJ A;  2PVO B;  3ZL7 C;  4ZGD B;  5I21 A;  2CZ0 B;  4PJJ A;  3S6W A;  1G3Y A;  2F1L A;  2NUT A;  2EQM A;  2MYS A;  3JCM X;  4LNP A;  3BY7 A;  2W99 A;  2DO3 A;  2FHD A;  3H0I A;  1TFB A;  2JGZ B;  2HKN A;  3CCJ A;  2QQR A;  3MPU B;  2DKG A;  4X34 A;  5CVI A;  2QGG A;  4LE9 A;  1H1R B;  5CKH A;  2JXB A;  2ROL A;  2QQS A;  4CFU D;  5LJ5 g;  2KXC A;  2X4W A;  1X2K A;  4EPC A;  3CCE A;  5GAO p;  3CQT A;  2K7A A;  2R5A A;  3DB4 A;  2DVE A;  3VS7 A;  3I55 T;  3M5A A;  1K9A A;  4LOC A;  5CR2 A;  4JJD A;  2G3R A;  3NPF A;  1GCP A;  2IG0 A;  8AT1 B;  1M1F A;  2GQI A;  4O5V A;  2RHU A;  4AFZ C;  2J05 A;  5IH2 A;  3QYE A;  4CFV B;  1NLO C;  3L2R A;  4NOY A;  4EOI B;  1YHQ T;  1M3C A;  1QCO A;  4F7L B;  3SWN B;  1O9K B;  1SPK A;  5GAM d;  2MWO A;  3S3N A;  1WHL A;  2KK4 A;  1UHC A;  2I0N A;  1M2V A;  1ACM B;  4KBM B;  3BDU A;  2WPA B;  2JN0 A;  4OGE A;  1VQO A;  1QKW A;  1N9S A;  2LQ8 A;  4IUQ A;  1W4S A;  2JOY A;  1YIJ A;  2VKN A;  4CFW B;  1FKM A;  2RHX A;  4FYV B;  3M0P A;  1PG5 B;  3NFC A;  3CC7 Q;  4OMO A;  5C0M A;  1VYV A;  4EOJ B;  2DL5 A;  2IW9 B;  2L2P A;  2J6F A;  5GAM j;  1B34 B;  2EKH A;  2P0Q A;  3GOX A;  4LD9 K;  4FT4 A;  1EFN A;  2KVQ G;  1W1F A;  3CME Q;  1VQK T;  4C0F A;  2M51 A;  2RM4 A;  4C0D B;  1G3W A;  4A53 A;  2UZB B;  4J6Y A;  1QVF P;  2YUP A;  2IW6 B;  1WJQ A;  4YOZ A;  2LZ6 B;  4RTZ A;  3TCJ A;  1K8A U;  2DD4 A;  3DLL A;  3PMI A;  4EOR B;  4C8Q G;  5LJ3 d;  4BCQ D;  3R6O A;  1VQM Q;  3CCS T;  4PJO F;  3PFS A;  2R5M A;  2EGE A;  2RB6 A;  5HCK A;  4OB2 B;  4EOP B;  4ORZ A;  4M7D D;  2EGA A;  3QWY A;  1H27 B;  3EG1 A;  2C5V B;  2MPX C;  3JB9 J;  3PGG A;  4M7D E;  1OPK A;  2F2C A;  2F5T X;  4F7U E;  1X69 A;  3PIP A;  3NMZ C;  4C5G A;  1KD1 C;  1N27 A;  1U1T A;  3FJP A;  2AZV A;  4AFQ C;  2KMG A;  3CCV T;  2OI3 A;  1VYU A;  4JPB W;  1IHW A;  3CCL A;  4YOO A;  3MI9 B;  3NTK A;  4IIM A;  4BE0 A;  4E7J A;  4M7D C;  1GBR A;  5LJ5 h;  1RAA B;  1YI2 A;  4MZP A;  1X43 A;  2D0N A;  3RUX A;  4M77 F;  5FU7 B;  1JJ2 P;  2CT3 A;  1NPR A;  1K73 U;  1JRI A;  2X3W D;  4J9F A;  4MMK A;  2EQJ A;  4BB7 A;  3TNW B;  2K3Y A;  1M27 C;  3M57 A;  3QPH A;  3G4S T;  1BBZ A;  1OU9 A;  3QWX X;  1UUE A;  3MP6 A;  2DX1 A;  1UNL D;  3CCM T;  1EIF A;  8ATC B;  1V29 B;  4PJO D;  4QQD A;  4FYW B;  5D7U A;  1M1K C;  5HNB B;  4PJO E;  4C92 D;  3CMA Q;  3QKJ A;  1RAD B;  2EYX A;  3EHR A;  4C92 E;  2KRO A;  1QQJ A;  1YJW T;  1TUC A;  2RF0 A;  3CME A;  4F14 A;  1W2B P;  4D6W A;  2LC4 A;  5CEI B;  2RQV A;  2PK2 A;  1ZA2 B;  4D8D A;  3G71 T;  4BDY A;  5D6X A;  2KQW A;  3L2V A;  1BYM A;  4EC8 B;  1E7O A;  1PD0 A;  1T0H A;  4BCP B;  4KGZ B;  2DYB A;  2LRQ A;  5IXF A;  4PJO C;  1D09 B;  3RKW A;  3FEO A;  1NPP A;  1HK9 A;  4C92 C;  2DME A;  5GAN d;  2O4X B;  4QKU A;  4GBQ A;  4LXC A;  3DKM A;  4M77 E;  2COZ A;  3G7Z A;  3M53 A;  2XDD A;  5KYU B;  1QVG S;  1FIN B;  4JS5 A;  2RQT A;  1C0M A;  3VJP A;  2L3S A;  2RJF A;  3PTA A;  3CCJ T;  2DXT A;  3H0F A;  3OY9 A;  3VYG A;  2CZ1 B;  2L3R A;  2RI2 A;  4F16 A;  3CCU Q;  3CXC S;  3V7C A;  1K8A R;  3M0U A;  2RJC A;  1WXU A;  2F2V A;  4M77 C;  3JCM J;  4M7D A;  4IUT A;  1AWX A;  3CCE T;  4ROD A;  4JZ4 A;  4C5I A;  4F7U A;  1FMV A;  3EHQ A;  4XTX A;  1GL5 A;  1HYO A;  1SHG A;  3JB9 G;  2KSS A;  4OMN A;  2KMT A;  2CRE A;  1OZ3 A;  1WHH A;  3FIF A;  1Q82 R;  1I5L A;  4HCB A;  5I2M A;  3VUZ A;  1D1C A;  2ZPH B;  2H8H A;  5CYI B;  2CH4 W;  4CRL B;  2JM9 A;  4HNT A;  2Y4Y A;  3CBM A;  4MDX A;  2JTF A;  3PE0 A;  4TVR A;  1F5Q B;  2YUQ A;  4DEX A;  2O31 A;  4XK8 E;  2CYZ B;  1IHV A;  1VQO T;  5FRM A;  3JCM g;  4AMC A;  1BI0 A;  3HRT A;  1Q7Y U;  3PT9 A;  2VB6 A;  3M03 A;  5CQY A;  3CMA A;  1YIJ T;  5FGK B;  5FWC A;  2YRV A;  2RH2 A;  4OVA A;  4LDY A;  2EPD A;  3FJ5 A;  4WCI A;  4PJO A;  4FM4 B;  2VAS A;  2C5X B;  1YHQ Q;  3EGD B;  1H24 B;  3UAT A;  2CSQ A;  4PJM A;  2PQW A;  5GAN 5;  2BZ8 A;  3X24 B;  3I5S A;  4C92 A;  3A8G B;  2WXV B;  3OYK A;  4FU6 A;  2VGN A;  3OS2 A;  2H3J A;  1I07 A;  2BIV A;  2WIH B;  3LH5 A;  4M75 B;  1ZUK A;  1U06 A;  2VWF A;  1KC8 U;  2D9T A;  4HVW A;  3MEU A;  2VVK A;  1OZ2 A;  1YFN A;  2G6F X;  1Y57 A;  2GFA A;  2OAW A;  4DBR A;  5DQW A;  4MML A;  1SHF A;  5GAO r;  3I35 A;  1JKW A;  2JZ2 A;  1NJI C;  4J9E A;  5GAM h;  4MFD A;  4E7Z A;  1JJ2 S;  3OYB A;  4BCG B;  1GRI A;  2QQA A;  1VQK Q;  1R8O B;  2AHJ B;  4JUV A;  2DPP B;  5HK3 A;  1Q81 U;  5I5Z B;  2RI5 A;  3LX7 A;  2KGT A;  3CEY A;  3CCU A;  4KUD K;  1QCN A;  3IQL A;  3OYH A;  2P4T A;  3DDP B;  3JCM c;  1XQH A;  3PIO A;  3QZ5 B;  4EOL B;  4HVV A;  5HBJ B;  4F6S B;  1MMG A;  2LQN A;  5CQX A;  1GH6 B;  2YLB A;  4RTU A;  2DE0 X;  2GFU A;  3F70 A;  5IHN A;  1CKA A;  3V8K A;  3CCL T;  1VQ9 Q;  1G3T A;  4ANJ A;  4J6X A;  1B07 A;  5GAM f;  1YI2 T;  4OML A;  4X9D A;  2PTK A;  1TSF A;  3EH2 A;  3J81 E;  1KFZ A;  1RLP C;  3JCM b;  2EYW A;  1HXD A;  2P84 A;  4HCC A;  2JT4 A;  1WPY A;  2FVU A;  3MCA B;  2DJQ A;  4PKC C;  4LDX A;  5GMK i;  2WSC E;  4JZ3 A;  5DLO A;  1VQ7 Q;  2ZZD A;  3RER A;  4C5E A;  2LP5 A;  2JVV A;  2O01 E;  3VS5 A;  2QDJ A;  3QDF A;  2COY A;  2JMA A;  3EG9 A;  4XTW A;  5LJ3 e;  2FPF A;  3GP8 A;  4ZNX A;  4C0Z A;  3J80 E;  2CGH A;  2MAM A;  5IN1 A;  5I2S A;  1JU5 C;  2A36 A;  1SSH A;  3CME T;  1VIF A;  3VS1 A;  1VQN Q;  3E1S A;  4K11 A;  4R56 A;  2K9G A;  1K9M R;  2RQW A;  4XAX B;  3L1A A;  2FEI A;  4PLL A;  2FZK B;  1FMW A;  4JRI A;  4PFP A;  1CSK A;  3HZJ A;  1IO6 A;  2FRW A;  5IDP B;  2KR3 A;  4M78 G;  3X26 B;  2OTL Q;  1AEY A;  1G2B A;  4J83 A;  1KD1 U;  1YJW Q;  1JQQ A;  3BLQ B;  4N0A C;  4M75 G;  1V76 A;  4B9W A;  1SRM A;  1LCK A;  1OI9 B;  4DBQ A;  2W9F A;  4HKE A;  4EC9 B;  2ECZ A;  5LJ5 d;  1KC8 R;  2YRD A;  2C06 A;  5ICP B;  1N6A A;  2Y90 A;  1S1N A;  1U3O A;  4NL3 A;  1H1Q B;  2EVR A;  1VQ6 A;  1EZZ B;  1UGV A;  1OKV B;  1VQ8 Q;  3LWI A;  1Q81 R;  1VQ9 A;  3BLH B;  3E19 A;  1ZSZ B;  1YJN Q;  3FC3 A;  2PK9 B;  3CCJ Q;  3CPW S;  3M59 A;  2RD1 A;  2C0T A;  4BCN D;  1I81 A;  4R55 A;  1IGU A;  5CIU A;  1M1K U;  4Y28 E;  2V8J A;  2HBW A;  3EGX A;  1FX7 A;  2LQK A;  4OR5 B;  2V8K A;  2A08 A;  4RG2 A;  3OYC A;  2CZ7 B;  2QI2 A;  3QXE B;  2FZC B;  3VS2 A;  2HD0 A;  3MKD A;  3CCE Q;  3UWN A;  1WQW A;  4JS4 A;  1VQ7 A;  2ZAE A;  3QHR B;  1ZHI A;  1GUX B;  2IW8 B;  5GAN e;  2ATC B;  3JCM P;  4F6U B;  3PNW C;  2LNH B;  4QQG A;  4F7J B;  2DL3 A;  4EOQ B;  2WMA B;  4C8Q D;  3S3O A;  3CMA T;  3GLX A;  4M7A F;  5GAN 4;  1N9R A;  4C8Q E;  2LJ1 A;  2SEM A;  1YWP A;  2AK5 A;  3L42 A;  1VQN A;  4I3Z B;  2X35 A;  1YIT A;  2YT6 A;  5HQ0 B;  4HCK A;  3TSW A;  3TNH B;  2EJF A;  2DFU A;  2O2O A;  4N0A A;  4WTO B;  3OB9 A;  2K2M A;  3VV0 A;  4C8Q C;  4BCJ B;  4FL6 A;  2OTL A;  2LX7 A;  2XDP A;  1QP3 A;  3VKH A;  3QYB A;  4XU2 A;  1TG0 A;  2CT4 A;  2UUE B;  1AZG B;  1QLY A;  2LMJ A;  3V8J A;  2HDA A;  3V8L A;  2K3X A;  1M90 R;  4FW2 A;  1BCO A;  1GFC A;  3CCU T;  5GAO n;  5HBH B;  2X4Y A;  2W0Z A;  2XD0 A;  1MV3 A;  1KQS S;  2CH4 A;  4M7A D;  1JST B;  3O5Z A;  2QK0 A;  3QG1 A;  2C4G B;  4M7A E;  3VS4 A;  1RUW A;  1VQ8 A;  1UJ0 A;  4OB3 B;  1YJN A;  1BU1 A;  3VKI A;  2SRC A;  5D6Y A;  1WIE A;  1X6G A;  3DB3 A;  1Q86 C;  4HNU A;  1NEB A;  3R6N A;  3D7S B;  3OS5 A;  3OBW A;  2RHI A;  1B3Q A;  2FYK A;  2DL4 A;  5DY9 A;  2QAS A;  1UJY A;  4BCF B;  5CK9 A;  4B6M A;  4M7A C;  1RLQ C;  3JCM W;  1KK7 A;  2WAC A;  1W70 A;  3TW6 A;  2HZY A;  4BCM B;  2QF7 A;  1GFD A;  2X4X A;  2BS4 A;  2DEU A;  2K5F A;  3CCL Q;  2NWM A;  1UNH D;  1Z9Q A;  2JW4 A;  2R7G A;  2YSQ A;  3BG5 A;  1VIE A;  1U1S A;  4ZGE B;  5J39 A;  3OW2 A;  1S72 Q;  1YI2 Q;  2I2L A;  1OGU B;  1X01 A;  2E6Z A;  3CPF A;  3MY5 B;  2BTT A;  4CRI A;  2ED1 A;  4JRP A;  4HL4 A;  1QVG P;  3HHT B;  2DD4 B;  1FVV B;  2MWP A;  5GMK m;  1BI3 A;  2BKZ B;  1NJI U;  4C8Q A;  4M7D F;  3C12 A;  3QII A;  3RES A;  2DMO A;  3CCQ A;  4F7U F;  3CXC P;  1MMA A;  1WFW A;  2DM1 A;  1IGQ A;  3DTO A;  4C0D C;  4F70 B;  9ATC B;  1PM3 A;  4BY6 C;  2QA4 A;  4Y92 A;  2RHY A;  3QYG B;  1K0X A;  3FLG A;  3MP1 A;  1RAI B;  1OV3 A;  2QAZ A;  4OP0 A;  5HBE B;  4OB0 B;  4ROE A;  3JB9 D;  3DOG B;  4N4G A;  2KAF A;  1MGQ A;  2NYS A;  4MZT A;  3OS1 A;  4EMG A;  1AD5 A;  1ZBX A;  2EIF A;  2E4H A;  2J7I A;  1JXO A;  3OSS C;  4YTL A;  4PLI A;  4OB1 B;  3H9N A;  3CC2 A;  4J6W A;  4JLG A;  4UC4 A;  4CXA B;  4BCI B;  4HLQ A;  1JO8 A;  4VUB A;  3MIA B;  4QVZ A;  2KE9 A;  2GQV A;  5IF1 B;  1Y71 A;  1VQ6 T;  1M30 A;  1MNE A;  3N5B B;  1IB8 A;  2VYT A;  3H41 A;  4IMY B;  4NL2 A;  4FYX B;  3RIR A;  3U23 A;  2I53 A;  3PMT A;  4L59 A;  1VQL A;  1PSF A;  2PU9 B;  4HXJ A;  4M7A A;  1N8R U;  1VQ9 T;  2WJ9 A;  2RMO A;  2FG0 A;  2QDL A;  4E7I A;  3HBL A;  4C92 F;  4A4G A;  1ZX6 A;  5GAO l;  1ZBJ A;  3HFN A;  3SWN A;  4V2S A;  3H4C A;  3C94 A;  2F69 A;  2HQX A;  3JCM V;  1FWZ A;  4PL6 A;  2FB7 A;  3RDV A;  2OTJ Q;  3VKG A;  4RG8 A;  3JCM d;  1VQ7 T;  4N4H A;  1K76 A;  4XU0 A;  1VQ5 Q;  1SG5 A;  3GBQ A;  1KIK A;  1PWT A;  4IUP A;  1S72 A;  1OIY B;  1J3T A;  2MI6 A;  1B34 A;  4EOK B;  2RK2 A;  2QFZ A;  4X1V A;  4J7F A;  2EFI A;  4DA4 A;  2FZG B;  2HSE B;  3CCR Q;  1H3H A;  5CCA A;  2ZPB B;  3X25 B;  2E65 A;  2ESW A;  1VQN T;  2HCK A;  4AKI A;  3OMC A;  1YIT T;  4AT1 B;  4NS5 A;  5A2Q E;  4E7H A;  3TN8 B;  2M16 A;  3M58 A;  2KYB A;  4BCQ B;  2OJ2 A;  3VS6 A;  2E1H A;  2OTL T;  4DQ2 A;  7AT1 B;  4BDZ A;  1XO2 A;  1X2Q A;  4ATO A;  2WSE E;  1YCY A;  3G1J A;  5GMK e;  5LJ5 f;  2KT1 A;  3OYE A;  2UZE B;  2EYY A;  1SEM A;  4M78 F;  3S3M A;  3TQ7 P;  1TOV A;  3JV3 A;  2YUO A;  2YLC A;  4HVU A;  2Z0W A;  1PD1 A;  1UHF A;  1I1J A;  1O9S A;  3GNF B;  3L2U A;  2DD5 A;  2MCN A;  2NUP A;  1RAC B;  1M1G A;  1SSF A;  2V1R A;  4M6V A;  1UTI A;  4RTV A;  5A0G A;  3QYH B;  1VQ8 T;  2W10 A;  4BCH B;  1K0S A;  4KRC B;  1YJN T;  1YBY A;  3M0T A;  5KYW A;  2HMA A;  1OOT A;  3EG0 A;  1OX8 A;  2YUN A;  1OUL A;  2CP5 A;  2BPM B;  2LJ3 A;  1UB4 A;  2K6D A;  2K2V A;  1O75 A;  2EWN A;  2DYI A;  1M2O A;  5LQF B;  3FB9 A;  2OTJ A;  2H3E B;  1M8M A;  2CSI A;  4BI8 B;  4PJO B;  1TUG B;  4CC3 A;  3VYH B;  2DZ9 A;  3ER0 A;  4JRQ A;  3RKX A;  1N8R R;  2LW4 A;  1VQ5 A;  1TH7 A;  3SDZ A;  2QDY B;  4M78 D;  2KI7 A;  2BZY A;  4F6W B;  4M78 E;  3GIB A;  3BHT B;  3LQ5 B;  2L5Q A;  4EMK C;  1BU2 A;  4JX4 A;  1M9S A;  2E5Q A;  1IRE B;  1ZLM A;  4M75 D;  2ENM A;  1AOJ A;  3CCR A;  1H26 B;  2BS3 A;  3M0R A;  1IXD A;  2P0K A;  3O8V A;  5KCO A;  4AI6 A;  4J9G A;  1PSE A;  3X20 B;  4E7S A;  2DJZ A;  3UDC A;  2IVW A;  3M0Q A;  2QGF B;  1NEG A;  1WHG A;  1NG2 A;  2BUD A;  4M78 C;  4BE1 A;  5KYN A;  3CCQ T;  4FYY B;  2CCH B;  4M77 B;  4FX3 B;  1OQK A;  3QHW B;  3HRU A;  2E41 A;  3ME9 A;  3QWL A;  2UZD B;  2HKQ B;  3FRN A;  2QA4 T;  4Y72 B;  1K73 R;  2VV5 A;  1HJD A;  2BE7 D;  1I0C A;  3BW1 A;  5AYF A;  3CBP A;  3CPW P;  2K4Y A;  1E6H A;  3X28 B;  3JB9 I;  2JM8 A;  2MMP A;  3C95 A;  1T0J A;  4MZM A;  3A5Z B;  2WIP B;  1Y0M A;  1Q86 U;  3CC2 T;  2XU8 A;  4ZN1 A;  1QMZ B;  5M9O A;  3A8M B;  2V1Q A;  3BFM A;  1RI9 A;  2IPO B;  2COW A;  5GMK l;  1R0C B;  4J8O A;  1ABO A;  3EFO A;  2LQW A;  1Q95 G;  5BNJ B;  2RI3 A;  1Y7X A;  2ZZD B;  3QDR B;  1UFF A;  5L2W B;  2HL5 C;  5FLX E;  2DTH A;  5GAM e;  3KXT A;  3MET A;  1WXB A;  3O0G D;  1MUZ A;  2YDL A;  1VQ6 Q;  3QUI A;  4EMK A;  4A4H A;  2KRS A;  2K5I A;  4FT2 A;  4ROC A;  2DXB A;  2XKO C;  4AFS C;  1C1A A;  3BDL A;  4WF2 A;  1OIU B;  1X6O A;  1GCQ A;  4J9H A;  4AKG A;  3ZEH A;  1S72 T;  4CFN B;  1H4L D;  5A0L A;  3OYL A;  1JB0 E;  3CD6 A;  4O6J A;  4PJO G;  4M78 A;  5GAN g;  3PVQ A;  3OYA A;  2M0O A;  2K3B A;  3EGU A;  1NZ9 A;  3MY1 B;  4Y91 A;  5ECA A;  1ARK A;  2EYZ A;  4QQ6 A;  1I4K 1;  1KHI A;  1M3B A;  2E10 A;  3OYF A;  4M75 A;  1PC0 A;  1NM7 A;  3K7A M;  2DL7 A;  2DXC A;  4FIB A;  2EJG A;  2HQH A;  2QXF A;  2EUF A;  4XU3 A;  4CC7 A;  2PVG B;  3TRE A;  5GAO q;  1OEB A;  1K8A C;  1KQS P;  3A8O B;  2JTM A;  2KXD A;  2O9S A;  2GNC A;  5HVY B;  1PKS A;  2MIO A;  1UEB A;  3EAE A;  1JXM A;  1H3Z A;  2LCL A;  1VIN A;  2KRM A;  2DIG A;  4RUG A;  2C0I A;  1VOL A;  2L0A A;  2R58 A;  4M77 G;  3H6Z A;  3C0C A;  4B9X A;  3KFV A;  3I56 Q;  1D1B A;  1KSW A;  3JCM h;  3OW2 S;  2XDB A;  4IKF A;  3BE3 A;  2LX9 A;  1Q7Y R;  1YIT Q;  1Q82 C;  4X9C A;  5FU6 C;  3JB9 H;  4LN2 A;  3RR6 A;  2QQB A;  5CKD A;  1HD3 A;  3MEA A;  2V8I A;  2CJM B;  5HK0 A;  2D0Q B;  2YWW A;  3BHU B;  4EIK A;  2X1N B;  5CKF A;  3EG3 A;  4XTZ A;  4A4E A;  2DZC A;  2RJD A;  2O9V A;  1PRM C;  1ZP2 A;  1RL2 A;  4OF1 A;  5D6W A;  2B8A A;  2WFY B;  2JUF A;  2AIR B;  1M8V A;  2ROT A;  1X75 C;  1QLB A;  1C9B A;  1YJ9 Q;  4C8Q F;  2DER A;  1XTD A;  2W96 A;  2XG8 D;  1AWJ A;  1QKX A;  2QQ9 A;  2CDT A;  3JCM f;  2DRK A;  3QZ9 B;  4OGC A;  1VYT A;  5GJV B;  2JTE A;  4OMP A;  2OTJ T;  4MDW A;  3HP9 A;  4KUL A;  2EQI A;  5GAN 6;  1VQ5 T;  1WLP B;  2RJE A;  3WXM B;  2P4R A;  2L3Q A;  1ZSG A;  4L6V 5;  3C4S A;  5EJC A;  3TW7 A;  4QVC A;  5KYX B;  4JX6 A;  3UPU A;  2HL3 A;  4II5 B;  2EYQ A;  1JOW A;  3BHV B;  1OYX A;  4LDU A;  2QEX A;  3HB9 A;  2C5N B;  3CCR T;  1QVF A;  2PMI B;  3BG3 A;  5GAN 7;  1LJO A;  4DOV A;  4YOS A;  2VXF A;  4R0K A;  4UN0 A;  4E2F B;  2JS2 A;  3OYI A;  3TNI B;  2CUB A;  3P8B B;  3I9Q A;  1X27 A;  2DTI A;  4FSX A;  3BLR B;  2B86 A;  5IT9 E;  5EC7 A;  2FL7 A;  3REB B;  1UGQ B;  2I40 B;  2D6F A;  3CC4 A;  1D0Y A;  2NUT B;  3RNJ A;  3T9N A;  2D1X A;  5DLQ E;  4AG1 C;  4AG2 C;  2EBP A;  3I56 A;  1K4U S;  4G6L B;  4XTV A;  1XJW B;  1N4M A;  5GMK j;  2RNA A;  1JEG A;  4A4F A;  4BCO B;  1NYF A;  3F5X B;  2FPD A;  3LLR A;  3BG9 A;  2QYZ A;  3CCQ Q;  1WX6 A;  1AZE A;  2BKD N;  3NDQ A;  2KDS A;  3A1P A;  2M0Y A;  2QA4 Q;  4DEY A;  1W98 B;  2KR6 A;  2KYM A;  4J9B A;  2JJ9 A;  3E2U A;  5EG2 A;  3SD4 A;  4KRT A;  4OMM A;  4C0G A;  4NC6 A;  4BCN B;  3OSV A;  4FCY A;  1TS9 A;  2J6O A;  1HSQ A;  1YJ9 A;  4BCM D;  3OYG A;  1JJ2 A;  3EFS A;  2D8J A;  2HEQ A;  1LOJ A;  1KG1 A;  5J26 A;  4C5H A;  2AKK A;  2P0P A;  4EOO B;  4J7I A;  4E6R A;  2O88 A;  3CC2 Q;  4IIO A;  4ME7 A;  3E9F A;  1KD1 R;  3WVD B;  1H1P B;  4BY1 X;  4GLM A;  1LPL A;  3G71 A;  1Y96 A;  2D8H A;  2DEQ A;  1UGP B;  2EQU A;  1AHJ B;  1K9M C;  3QJ6 A;  2PNI A;  1WHJ A;  2AZS A;  4PJL A;  3ZFJ A;  4XTY A;  1M2V B;  1VUB A;  4GLK A;  1VQL Q;  2R57 A;  3EH1 A;  4RTT A;  2W2H A;  4A4K A;  1W2B A;  5EFQ B;  1VQP Q;  1VOM A;  2QG9 B;  1AWW A;  2JS0 A;  2JMC A;  2DET A;  3ZBD A;  2DA9 A;  3CD6 T;  1I8F A;  1WHK A;  4L5G A;  4BBS M;  3LGF A;  3JB9 F;  1T3S A;  1VQ4 A;  1UNG D;  4HT9 A;  5GJW B;  1EX4 A;  1D1A A;  2DL8 A;  1H25 B;  2MF2 A;  3LW5 E;  3RGF B;  1R0B G;  3M9Q A;  3OYN A;  4EOS B;  2VC8 A;  3MP8 A;  1D3B A;  5KYY A;  1G3N C;  1WQ7 A;  2DRM A;  1WHM A;  3SWN C;  4DBF A;  4RMO A;  4RTX A;  5FRO A;  4QW2 A;  1KC8 C;  4F7S B;  2LT1 A;  2M9U A;  1WDX A;  1H1S B;  1M1K R;  1KQ2 A;  4KH1 B;  2G9X B;  1CKB A;  3ASK A;  4E7L A;  3A8L B;  3RMS A;  3OYY A;  3ULR B;  1DJ7 B;  5CKE A;  3FDR A;  5I11 A;  1Q81 C;  2EAY A;  2RO0 A;  1TTH B;  3OYD A;  2ED0 A;  3PVL A;  4RKU E;  4M7A B;  2PUK B;  3TSZ A;  3OYM A;  3SEM A;  2WEV B;  4XU1 A;  4F7N B;  4AKH A;  3OBY A;  1FXX A;  4JJC A;  3UA7 A;  3HO8 A;  2ZCF B;  1GBQ A;  2E5K A;  4LUD A;  3M54 A;  2LT4 A;  3QBY A;  2A7Y A;  2CCI B;  5AT1 B;  1KHC A;  4EDU A;  5FW9 A;  2DNU A;  4JRK A;  4BI4 A;  1M5Q 1;  4HCZ A;  1RAB B;  2W9Z A;  4CFU B;  4KUI A;  2CZ6 B;  4E7K A;  4CC4 B;  4M4Z A;  4Z88 A;  2YHT A;  4NST B;  3POM A;  3H8Z A;  1KXU A;  1PKT A;  4QSH A;  1H8K A;  1SF9 A;  2DIQ A;  1F1B B;  1U5S A;  2OAU A;  1M4Z A;  3G6E Q;  4BE2 A;  4BCK B;  1GXI E;  4KGV B;  2EKO A;  2NLU A;  2OX7 A;  4QVD A;  2K79 A;  5IHK A;  3MJX A;  2E3H A;  5GAN 3;  4LDW A;  4BY6 B;  1UDL A;  3HTR A;  2GCX A;  4JX5 A;  1Y07 A;  4KRD B;  3AT1 B;  1VQP A;  3MEV A;  1O9K A;  3A98 A;  3CPW A;  3VU3 C;  3WVE B;  1NYG A;  2QEX T;  4MFE A;  1OL1 B;  2BS2 A;  3E9G A;  4XQ3 A;  4DOW A;  5FU7 C;  2X51 A;  4P5N A;  1OPL A;  2X9H A;  4MIM A;  1M90 C;  2J6K A;  1BB9 A;  1E9H B;  2M1H A;  2GTO A;  2CP6 A;  2VXE A;  4FW1 A;  1X6B A;  4CI0 C;  1Q82 U;  2ZPI B;  2A37 A;  5LMK B;  4FSS A;  4BAC A;  1AD6 A;  2F5K A;  2LNV A;  5LJ3 j;  2DD5 B;  3CC4 T;  1K1Z A;  2NUP B;  4PJN A;  3QO3 A;  2EW3 A;  3I56 T;  4BBR M;  1YP5 A;  1I5O B;  5LJ5 e;  1PKD B;  3JAM E;  4XTU A;  2VGM A;  1W6X A;  2LCS A;  3M0S A;  4JJB A;  4OMF B;  2UZL B;  1YN8 A;  1RAH B;  2V26 A;  4JDS A;  5KYW B;  2YRC A;  1E7P A;  1FMK A;  3VYG B;  1OX9 A;  3HKS A;  1FYN A;  2CS7 A;  1Z9Z A;  1WJR A;  4KGX B;  4A63 B;  2RPN A;  5J3B A;  2A3L A;  2GBQ A;  1NJI R;  4M7D B;  1WI7 A;  1YWO A;  4J9C A;  4M7A G;  1BI2 A;  4QT7 A;  5L23 A;  1BK2 A;  4PK4 A;  4F7U B;  1QP2 A;  2DVJ A;  5GMK h;  3VS3 A;  1H28 B;  2WSF E;  1D0X A;  5LL6 S;  2XID A;  3B57 A;  2KBT A;  1YJ9 T;  3H0H A;  5HY6 A;  4M75 F;  3CC7 A;  2RN8 A;  3AHU A;  5IHY A;  1E6G A;  2IIM A;  2FPE A;  3VRY A;  2DBM A;  2IVX A;  2ZPF B;  3G6E A;  1UGS B;  2G77 A;  2PZ1 A;  2KY9 A;  1WGS A;  6AT1 B;  1D3U B;  4J5Y A;  3JCM Q;  1KQS A;  5GAM g;  3VS0 A;  2AKL A;  2GGR A;  4KH0 B;  1PNJ A;  1QMC A;  4OGR B;  2Y4X A;  2LCC A;  2B9R A;  2QGS A;  1R77 A;  2WMB B;  2KT8 A;  1B7T A;  4PFO A;  4M77 D;  1ABQ A;  2CUD A;  1AIS B;  1SKU B;  1A0N B;  1VQM A;  2LJ0 A;  3OW2 P;  1VQ4 T;  2HSP A;  4IUR A;  1WXT A;  3L2Q A;  5IHI A;  3NHN A;  3CBO A;  1P5E B;  3LH0 A;  2XMF A;  4C92 B;  1IZ6 A;  5IDN B;  1ZUY A;  2XI9 A;  3UT1 A;  1GY3 B;  1NE8 A;  3HRS A;  5GAN j;  3QJY A;  4OMQ A;  3CD6 Q;  5DQV A;  1NLP C;  4M75 E;  3TEE A;  4HNV A;  1LVK A;  3THK A;  1V1C A;  2A28 A;  2E3I A;  2PVD B;  3MEW A;  3SB2 A;  2QTX A;  1GCQ C;  1MMN A;  5LJ3 g;  3REA B;  4LDV A;  1WNL A;  4ZTF A;  3HL8 A;  4RCC A;  2ZGW A;  3EFO B;  1IRX A;  1JSU B;  2X3X D;  2O4X A;  3JSC A;  1QWF A;  5KH6 A;  1QVF S;  5KCH A;  4M75 C;  3HSB A;  2EGC A;  5KYU A;  2GTJ A;  2X4J A;  5GAN 2;  4EMK B;  2HQE A;  1WJS A;  2LVM A;  1K9M U;  3OS0 A;  2DXB B;  4E47 A;  3I55 Q;  2YXY A;  2V22 B;  3EFR A;  3SHW A;  1KQ1 A;  4JJN K;  4M7D G;  4ESR A;  5A0D A;  1OI1 A;  1TU0 B;  4CFM B;  1G3S A;  4F7U G;  5CKB A;  2K5L A;  4IUU A;  4M78 B;  2L8D A;  1BKB A;  3HPW A;  1SRL A;  3QSU A;  2RHZ A;  3NGP A;  4YC3 B;  2KEA A;  2DF6 A;  3MHX A;  2HNI A;  4ELL A;  1VQL T;  3M56 A;  2DXC B;  1ENW A;  1YCS B;  3NTH A;  4J9I A;  2VUB A;  1VQP T;  2MK5 A;  4EON B;  3EG9 B;  1ZUU A;  2C0O A;  4AFU C;  3P8D A;  2E12 A;  2DTO A;  2PUO B;  4EOM B;  1XNI A;  3MO8 A;  2ABL A;  2RQU A;  4M77 A;  2JNG A;  3SFM A;  2RA2 A;  2IN3 A;  3V7S A;  3KBG A;  3PO3 S;  3M55 A;  2CP2 A;  2DBK A;  4DBH A;  4CC2 A;  2EJ9 A;  1QWE A;  3EGD A;  5IXB A;  2RK1 A;  2A0F B;  1RAE B;  2FO0 A;  2CP3 A;  2QEX Q;  1AWO A;  4C92 G;  2BZX A;  1OKW B;  5L8R E;  4HA8 A;  1TWB A;  2F2X A;  2L89 A;  4JLI A;  2AT1 B;  3CCS Q;  1W2B S;  1TD6 A;  3M4G A;  1WYX A;  1LNX A;  2DAQ A;  1BIB A;  5HKC A;  3VUB A;  3V7R A;  3DJB A;  5IAY A;  1WZO A;  4IUV A;  1OU8 A;  3OQ5 A;  2QQ8 A;  4RCB A;  5DM7 R;  4EMH A;  4ZTJ A;  3EOC B;  4II1 A;  5ACB A;  3I5R A;  4Z8A A;  5LJ3 h;  2ZPG B;  3CCV Q;  3UA6 A;  3CC4 Q;  1G5V A;  2E6N A;  2K57 A;  4BD3 A; 
#chains in the Genus database with same CATH homology
 1N8R C;  3PMT A;  4L59 A;  4XTX A;  4NC6 A;  4C0G A;  3OSV A;  1VQL A;  1PSF A;  2PU9 B;  3I55 A;  1BIA A;  1N8R U;  1VQ9 T;  1YJ9 A;  4M7A A;  2WJ9 A;  3OYG A;  3TU4 K;  3JB9 G;  2KSS A;  3GNG A;  3EFS A;  1JJ2 A;  4E7I A;  2KMT A;  1OZ3 A;  3HBL A;  3FIF A;  3OMG A;  3P8H A;  4C92 F;  1I5L A;  4A4G A;  4HCB A;  5I2M A;  1LOJ A;  1KG1 A;  3VUZ A;  5J26 A;  2ZPE B;  4C5H A;  5GAO l;  3HFN A;  4N4I A;  3SWN A;  4V2S A;  2P0P A;  2ZPH B;  3H4C A;  3LGL A;  4J7I A;  3C94 A;  3CC7 T;  2F69 A;  2HQX A;  4KT0 E;  4ME7 A;  1H64 1;  4BI3 A;  1YHQ A;  3JCM V;  2DK3 A;  4HNT A;  3E9F A;  1UGR B;  2XIC A;  1FWZ A;  2Y4Y A;  3WVD B;  3JCM e;  3G6E T;  3CBM A;  4MDX A;  1QVP A;  4ELJ A;  4PNO A;  4PL6 A;  1Y96 A;  3G71 A;  2DEQ A;  1UGP B;  2EQU A;  2FB7 A;  2JTF A;  4BUG A;  4TVR A;  2DXU A;  2XHC A;  1AHJ B;  1K9M C;  3QJ6 A;  3VKG A;  4RG8 A;  3JCM d;  1VQ7 T;  4N4H A;  3ZFJ A;  4XK8 E;  2CYZ B;  4XTY A;  4XU0 A;  1VQO T;  5FRM A;  3JCM g;  4GLK A;  1VUB A;  1BI0 A;  3HRT A;  3OA6 A;  3A8H B;  1Q7Y U;  3PT9 A;  1QVG A;  1M90 U;  4IUP A;  4Q5W A;  1ZQ1 A;  2R57 A;  5CQY A;  5LJ3 f;  4GY5 A;  3CMA A;  1YIJ T;  4A4K A;  1S72 A;  1W2B A;  5GAO m;  1XOV A;  2HAX A;  2YRV A;  2MI6 A;  1B34 A;  4ELY C;  1K73 C;  2RH2 A;  4OVA A;  2E70 A;  4LDY A;  3ZBD A;  3CD6 T;  2RK2 A;  1I8F A;  5KE2 A;  2QFZ A;  4L5G A;  4J7F A;  4BBS M;  2EFI A;  4FM4 B;  3LGF A;  4DA4 A;  3JB9 F;  4PJO A;  1VQ4 A;  4Z02 A;  4HT9 A;  1VQK A;  3CXC A;  2PQW A;  2ZPB B;  3X25 B;  2E65 A;  5FU6 B;  5CCA A;  3X24 B;  5GAN 5;  1VQM T;  4C92 A;  2MF2 A;  3A8G B;  3LW5 E;  3M9Q A;  1VQN T;  3OYN A;  3OYK A;  2VC8 A;  3MP8 A;  1D3B A;  4AKI A;  1WQ7 A;  2VGN A;  3OMC A;  4FU6 A;  3SWN C;  4RMO A;  3OS2 A;  2H3J A;  5FRO A;  1YIT T;  4QW2 A;  1KC8 C;  2BIV A;  1P92 A;  2LT1 A;  2M9U A;  4M75 B;  4NS5 A;  5A2Q E;  4E7H A;  2M16 A;  3M58 A;  1KQ2 A;  1KC8 U;  2D9T A;  3Q1J A;  3MEU A;  1OZ2 A;  4HT8 A;  2GFA A;  2E1H A;  3ASK A;  4MML A;  2OTL T;  5GAO r;  4E7L A;  3A8L B;  3RMS A;  1U8R A;  3OYY A;  4DQ2 A;  4BDZ A;  1DJ7 B;  2JZ2 A;  5CKE A;  1NJI C;  2XK0 A;  5GAM h;  4ATO A;  2WSE E;  5GAN 8;  3FDR A;  4MFD A;  1YCY A;  5GMK e;  5LJ5 f;  3OYB A;  3OYE A;  3CCS A;  1JJ2 S;  3S3M A;  1Q81 C;  4M78 F;  5KE3 A;  2EAY A;  2QQA A;  1R8O B;  3URG A;  2AHJ B;  4JUV A;  2DPP B;  2CKK A;  2RO0 A;  5HK3 A;  3M4Y A;  1Q81 U;  2YLC A;  3OYD A;  5LJ5 j;  2RI5 A;  3LX7 A;  4RKU E;  3CEY A;  2PUK B;  4M7A B;  3CCU A;  3OYM A;  4KUD K;  1O9S A;  3GNF B;  3NTI A;  3QHS A;  4XU1 A;  4AKH A;  3OBY A;  5GAN h;  3OYH A;  3L2U A;  2DD5 A;  1FXX A;  3RKY A;  1BI1 A;  2P4T A;  3HFO A;  1XQH A;  4LD6 A;  3HO8 A;  3JCM c;  3PIO A;  2ZCF B;  1M1G A;  3CCV A;  1SSF A;  3INZ A;  3QZ5 B;  4M6V A;  2LT4 A;  3M54 A;  4ZN3 A;  3QBY A;  2A7Y A;  4BD3 A;  5A0G A;  3QYH B;  5CQX A;  1KHC A;  4EDU A;  2YLB A;  1VQ8 T;  1Y96 B;  4JRK A;  2GFU A;  3F70 A;  3V8K A;  4BI4 A;  3CCL T;  1M5Q 1;  4HCZ A;  1YJN T;  1YBY A;  4KUI A;  1G3T A;  2CZ6 B;  3KUF A;  4J6X A;  4Z6Y A;  3DLM A;  5GAM f;  1YI2 T;  4E7K A;  1UB4 A;  4ZGJ B;  2K2V A;  3KHI A;  1O75 A;  2YHT A;  3H8Z A;  4X9D A;  2EWN A;  5C6S A;  2EQK A;  3J81 E;  4QSH A;  1RI0 A;  4A54 A;  2DIQ A;  3JCM b;  3DL1 A;  1HXD A;  1QW1 A;  3FB9 A;  4HCC A;  3G4S A;  2OTJ A;  2OAU A;  1M4Z A;  4BE2 A;  1WPY A;  1GXI E;  4BI8 B;  4PJO B;  2FVU A;  3MCA B;  4PKC C;  2EKO A;  4ELZ C;  3VYH B;  2DZ9 A;  2E64 A;  2NLU A;  3ER0 A;  4QVD A;  4JRQ A;  3RKX A;  3CCM A;  4LDX A;  5GMK i;  2WSC E;  1VQ5 A;  5DLO A;  1TH7 A;  3SDZ A;  5GAN f;  2ZZD A;  2QDY B;  4M78 D;  4C5E A;  2HBP A;  4LDW A;  4BY6 B;  5GAN 3;  3RER A;  3GPL A;  2GCX A;  4JX5 A;  1D3B B;  1Y07 A;  2JVV A;  2O01 E;  3LYI A;  2QDJ A;  4M78 E;  5FRN A;  3GIB A;  1VQP A;  2L5Q A;  4EMK C;  4XTW A;  5LJ3 e;  4JX4 A;  1M9S A;  2E5Q A;  1IRE B;  3MEV A;  3GP8 A;  4C0Z A;  4M75 D;  3J80 E;  3CPW A;  1YJW A;  3CCR A;  3VU3 C;  3WVE B;  2CGH A;  2MAM A;  2BS3 A;  5IN1 A;  2QEX T;  4MFE A;  5I2S A;  3GF5 A;  2BS2 A;  3E9G A;  3L2Z A;  2P0K A;  3O8V A;  4XQ3 A;  4AI6 A;  4DOW A;  5CAI A;  1PSE A;  5FU7 C;  3X20 B;  5KCO A;  2DJZ A;  3RMQ A;  1JBM A;  2LTO A;  1VIF A;  3CME T;  3UDC A;  2IVW A;  1MHN A;  2GF7 A;  3E1S A;  3JRZ A;  4P5N A;  4R56 A;  1Q7Y C;  3L2W A;  4XAX B;  4MIM A;  3L1A A;  1M90 C;  4C8Q B;  2BUD A;  4M78 C;  4BE1 A;  4PLL A;  5CO7 A;  3CCQ T;  3LWH A;  2LDM A;  3OYJ A;  4M77 B;  4JRI A;  2M1H A;  2PVO B;  2VXE A;  4ZGD B;  5I21 A;  2CZ0 B;  3HZJ A;  3HRU A;  2E41 A;  4CI0 C;  3ME9 A;  1Q82 U;  3S6W A;  1G3Y A;  2ZPI B;  3QWL A;  4M78 G;  3X26 B;  2EQM A;  3FRN A;  4BAC A;  2F5K A;  2LNV A;  3JCM X;  2QA4 T;  3BY7 A;  4J83 A;  5LJ3 j;  2DD5 B;  2VV5 A;  1KD1 U;  3CC4 T;  2DO3 A;  3QO3 A;  4N0A C;  2FHD A;  4M75 G;  3J7A F;  3I56 T;  4BBR M;  3BW1 A;  5LJ5 e;  5AYF A;  3CBP A;  4B9W A;  3JAM E;  4XTU A;  2VGM A;  3CCJ A;  2QQR A;  2K4Y A;  2DKG A;  3X28 B;  4OMF B;  4X34 A;  4HKE A;  5CVI A;  3JB9 I;  5LJ5 d;  2MMP A;  3C95 A;  5CKH A;  4JDS A;  2C06 A;  2QQS A;  4MZM A;  3A5Z B;  1Q86 U;  3CC2 T;  1N6A A;  2XU8 A;  5LJ5 g;  1E7P A;  4ZN1 A;  3VYG B;  2Y90 A;  3HKS A;  2X4W A;  2CS7 A;  1VQ6 A;  4NL3 A;  5M9O A;  1WJR A;  3A8M B;  3BFM A;  4EPC A;  3CCE A;  5GAO p;  5J3B A;  2A3L A;  5GMK l;  4M7D B;  2R5A A;  3DB4 A;  4M7A G;  2DVE A;  1BI2 A;  3LWI A;  4J8O A;  4F7U B;  1VQ9 A;  1QP2 A;  3E19 A;  5GMK h;  2RI3 A;  2WSF E;  3FC3 A;  3I55 T;  1Y7X A;  3M5A A;  5LL6 S;  4LOC A;  2XID A;  3CPW S;  1YJ9 T;  2ZZD B;  2RD1 A;  3M59 A;  1I81 A;  5CR2 A;  4R55 A;  3QDR B;  4M7A F;  2G3R A;  5CIU A;  2IG0 A;  4M75 F;  5HY6 A;  2DTH A;  5FLX E;  3CC7 A;  5GAM e;  4Y28 E;  3KXT A;  2V8J A;  1M1K U;  3MET A;  3AHU A;  1M1F A;  4O5V A;  2RHU A;  1FX7 A;  2LQK A;  2V8K A;  3QYE A;  3L2R A;  4RG2 A;  4NOY A;  2ZPF B;  3OYC A;  3G6E A;  1YHQ T;  2CZ7 B;  1UGS B;  2QI2 A;  2G77 A;  3QXE B;  3SWN B;  2KY9 A;  5GAM d;  2MWO A;  1WGS A;  2HD0 A;  3QUI A;  3S3N A;  4EMK A;  4A4H A;  2KK4 A;  2K5I A;  4J5Y A;  3JCM Q;  1KQS A;  3UWN A;  1WQW A;  4FT2 A;  5GAM g;  4JS4 A;  1VQ7 A;  4KBM B;  3BDU A;  2DXB A;  2JN0 A;  4OGE A;  1VQO A;  2XKO C;  1N9S A;  1ZHI A;  2LQ8 A;  4IUQ A;  2Y4X A;  5GAN e;  1W4S A;  3BDL A;  2LCC A;  4WF2 A;  3JCM P;  2JOY A;  3PNW C;  1X6O A;  4QQG A;  1YIJ A;  4AKG A;  4C8Q D;  3ZEH A;  3S3O A;  1FKM A;  1S72 T;  2RHX A;  3GLX A;  5A0L A;  3OYL A;  3CMA T;  5GAN 4;  1JB0 E;  3CD6 A;  4O6J A;  1N9R A;  4PJO G;  4M77 D;  3NFC A;  4C8Q E;  5C0M A;  4M78 A;  5GAN g;  3OYA A;  2M0O A;  5GAM j;  1B34 B;  1NZ9 A;  1VQM A;  4Y91 A;  2P0Q A;  3GOX A;  1VQ4 T;  4QQ6 A;  3L42 A;  4FT4 A;  2KVQ G;  1I4K 1;  4IUR A;  2X35 A;  1VQK T;  4LD9 K;  1VQN A;  4C0F A;  1KHI A;  3L2Q A;  2E10 A;  2RM4 A;  3CBO A;  3OYF A;  4M75 A;  1YIT A;  4C0D B;  1G3W A;  3LH0 A;  4C92 B;  2DXC A;  1IZ6 A;  4FIB A;  2EJG A;  4XU3 A;  2QXF A;  4A53 A;  2EJF A;  2XI9 A;  2PVG B;  3UT1 A;  4N0A A;  1NE8 A;  3HRS A;  3OB9 A;  3TRE A;  4J6Y A;  5GAO q;  1K8A C;  3A8O B;  2JTM A;  3VV0 A;  4C8Q C;  5GAN j;  3QJY A;  1WJQ A;  4FL6 A;  2OTL A;  3TCJ A;  1K8A U;  2DD4 A;  1QP3 A;  2XDP A;  3VKH A;  1UEB A;  3QYB A;  3EAE A;  4XU2 A;  1H3Z A;  2LCL A;  4M75 E;  2DIG A;  3TEE A;  4HNV A;  3PMI A;  3DLL A;  4C8Q G;  5LJ3 d;  2PVD B;  4NL2 A;  3MEW A;  3SB2 A;  2QTX A;  2R58 A;  3R6O A;  4M77 G;  3H6Z A;  4B9X A;  5LJ3 g;  3CCS T;  4PJO F;  3JCM h;  3OW2 S;  3PFS A;  4IKF A;  2R5M A;  2XDB A;  2RB6 A;  1WNL A;  4LDV A;  4OB2 B;  2LX9 A;  3V8J A;  4ZTF A;  4M7D D;  3HL8 A;  3V8L A;  4RCC A;  2K3X A;  2ZGW A;  4X9C A;  5FU6 C;  1Q82 C;  3JB9 J;  3JB9 H;  3PGG A;  4M7D E;  2QQB A;  5CKD A;  3CCU T;  5GAO n;  2O4X A;  3MEA A;  2F5T X;  2V8I A;  2X4Y A;  4F7U E;  3JSC A;  3PIP A;  5HK0 A;  2D0Q B;  2XD0 A;  4C5G A;  5KH6 A;  5KCH A;  1KQS S;  1KD1 C;  1QVF S;  1N27 A;  1U1T A;  4M7A D;  3FJP A;  4M75 C;  5CKF A;  3HSB A;  4XTZ A;  4A4E A;  2DZC A;  3QG1 A;  2KMG A;  3CCV T;  2RJD A;  4M7A E;  1RL2 A;  4OF1 A;  1VQ8 A;  2X4J A;  4OB3 B;  5D6W A;  2B8A A;  2JUF A;  5GAN 2;  3CCL A;  3NTK A;  4EMK B;  4BE0 A;  1M8V A;  2HQE A;  1YJN A;  1WJS A;  2LVM A;  3VKI A;  1K9M U;  1X75 C;  3OS0 A;  1QLB A;  2DXB B;  3DB3 A;  5D6Y A;  4E47 A;  4E7J A;  1Q86 C;  4HNU A;  5LJ5 h;  4M7D C;  1YI2 A;  3EFR A;  4C8Q F;  4MZP A;  3OS5 A;  1XTD A;  3OBW A;  2RHI A;  2XG8 D;  4M77 F;  3RUX A;  2FYK A;  5DY9 A;  5FU7 B;  1KQ1 A;  2QQ9 A;  4JJN K;  4M7D G;  5A0D A;  3JCM f;  1OI1 A;  5CK9 A;  3QZ9 B;  4OGC A;  1NPR A;  1G3S A;  4F7U G;  1K73 U;  4M7A C;  1JRI A;  5CKB A;  3JCM W;  2K5L A;  4MMK A;  2EQJ A;  4IUU A;  4M78 B;  4BB7 A;  2WAC A;  2K3Y A;  2L8D A;  3M57 A;  3QPH A;  3TW6 A;  1BKB A;  3RIR A;  3G4S T;  3HPW A;  4MDW A;  2OTJ T;  3QSU A;  3HP9 A;  2QF7 A;  2RHZ A;  3MP6 A;  2X4X A;  4KUL A;  2BS4 A;  3CCM T;  2K5F A;  1EIF A;  3MHX A;  5GAN 6;  1V29 B;  2HNI A;  1VQ5 T;  4PJO D;  2RJE A;  3M56 A;  4QQD A;  3WXM B;  1VQL T;  4L6V 5;  1M1K C;  3BG5 A;  4PJO E;  2DXC B;  1VIE A;  3C4S A;  1U1S A;  4ZGE B;  3SD4 A;  3NTH A;  5EJC A;  4C92 D;  5J39 A;  2VUB A;  2I2L A;  3OW2 A;  1VQP T;  3QKJ A;  3TW7 A;  1X01 A;  4QVC A;  2E6Z A;  4JX6 A;  3UPU A;  3CPF A;  4CRI A;  4C92 E;  2EYQ A;  2QEX A;  4JRP A;  1OYX A;  4HL4 A;  4LDU A;  3HB9 A;  1YJW T;  3P8D A;  3HHT B;  3CCR T;  2DD4 B;  2MWP A;  3CME A;  2E12 A;  2DTO A;  5GMK m;  2PUO B;  1BI3 A;  4D6W A;  1NJI U;  2LC4 A;  4C8Q A;  1QVF A;  3BG3 A;  5GAN 7;  1XNI A;  3G71 T;  3MO8 A;  1LJO A;  5D6X A;  4DOV A;  4BDY A;  4M7D F;  3C12 A;  4M77 A;  2JNG A;  2KQW A;  3QII A;  3RES A;  2VXF A;  3SFM A;  3L2V A;  2RA2 A;  1BYM A;  3CCQ A;  4F7U F;  2LRQ A;  4PJO C;  3V7S A;  3OYI A;  3KBG A;  3P8B B;  3RKW A;  3M55 A;  4C0D C;  3FEO A;  1NPP A;  1HK9 A;  4C92 C;  4BY6 C;  2DTI A;  2QA4 A;  4FSX A;  2EJ9 A;  5GAN d;  2RK1 A;  2O4X B;  5IT9 E;  2RHY A;  3QYG B;  2FL7 A;  1UGQ B;  3DKM A;  2D6F A;  3FLG A;  3MP1 A;  4OP0 A;  3CC4 A;  4M77 E;  4OB0 B;  3G7Z A;  3M53 A;  5DLQ E;  3T9N A;  4C92 G;  2XDD A;  3I56 A;  3JB9 D;  5L8R E;  1QVG S;  4HA8 A;  4XTV A;  4N4G A;  4JLI A;  2KAF A;  2L89 A;  4JS5 A;  1MGQ A;  4MZT A;  1W2B S;  3VJP A;  3M4G A;  3OS1 A;  1LNX A;  2DAQ A;  1BIB A;  4EMG A;  5HKC A;  5GMK j;  3VUB A;  1ZBX A;  2RJF A;  3V7R A;  2EIF A;  2DXT A;  3PTA A;  4A4F A;  5IAY A;  3CCJ T;  4IUV A;  3LLR A;  3OSS C;  4YTL A;  4PLI A;  4OB1 B;  3BG9 A;  3VYG A;  3OY9 A;  2CZ1 B;  3CC2 A;  3OQ5 A;  4J6W A;  2L3R A;  4JLG A;  2RI2 A;  4UC4 A;  2BKD N;  2QQ8 A;  3CXC S;  4RCB A;  4HLQ A;  3V7C A;  5DM7 R;  2KDS A;  4VUB A;  4EMH A;  2RJC A;  4QVZ A;  4ZTJ A;  2GQV A;  4M77 C;  3JCM J;  4M7D A;  1Y71 A;  4II1 A;  1VQ6 T;  4IUT A;  3N5B B;  5LJ3 h;  2ZPG B;  3CCE T;  4C5I A;  4F7U A;  2VYT A;  2KR6 A;  1G5V A;  2E6N A;  2K57 A;  5EG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...