1UGPB

Crystal structure of co-type nitrile hydratase complexed with n-butyric acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
total genus 68
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugpB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugpB02
4KT0E 2PU9B 3VYHB 2WSCE 4RKUE 3QZ5B 1IREB 3X24B 2DPPB 2ZPBB 2DD5B 2ZPFB 3A8MB 1AHJB 3QZ9B 1V29B 4FM4B 1QP2A 2DXCA 2CYZB 3HHTB 3A8HB 4ZGDB 4ZGEB 4OB3B 3WVDB 2DD4A 2WSEE 4OB2B 4OB0B 2ZPIB 2DXBB 3QYGB 3VYGA 2O01E 2DD5A 1DJ7B 4OB1B 2PUKB 2ZPHB 1JB0E 3A8OB 2CZ6B 2PVGB 2ZPEB 2PVDB 2DXBA 4Y28E 3A8GB 3VYGB 3X25B 4L6V5 3A8LB 2ZZDB 3X28B 1PSEA 2PUOB 3QYHB 2AHJB 2PVOB 1UGPB 1QP3A 1UGRB 4XK8E 2WSFE 3QXEB 1GXIE 3LW5E 2D0QB 4ZGJB 5L8RE 1PSFA 3WVEB 2ZZDA 3X26B 3X20B 2CZ7B 2DXCB 2CZ1B 2ZCFB 2CZ0B 1UGSB 2ZPGB 2DD4B 1UGQB 2QDYB
chains in the Genus database with same CATH superfamily
5LJ3g 1RACB 4EC9B 4LDUA 4A4EA 1OKVB 2W9ZA 2VXEA 4PLLA 1KD1C 3JCMQ 4JRPA 1VQ8T 4F04B 1UTIA 4Q5WA 2DFUA 2OTLA 2D6FA 1WJSA 3HO8A 4C5GA 1VQ9A 4ZGEB 1VQPQ 1X2KA 3VRYA 1NPRA 1QVGP 3OB9A 3TVTA 3QWYA 1VOLA 3FJ5A 2W0ZA 3VS1A 2O9VA 2RI3A 2RM4A 1GUXB 4PJJA 2D8JA 2K7AA 3OYAA 4LE9A 4J7IA 1ZSZB 2K79A 3M57A 5CEIB 4BY7X 2CP5A 2MPXC 3BHTB 4HLQA 4WF2A 2HQXA 4F70B 3BHVB 4EPCA 2LRQA 3MP6A 1PG5B 2DBMA 5DLQE 2DERA 2QEXT 4ORZA 3OS0A 3CBOA 2QA4T 1PSEA 2L3QA 1UJYA 4HCZA 3QJYA 4RTZA 4MMKA 1D1CA 4C92A 2DO3A 4CRIA 2XICA 2R57A 2DL3A 3N5BB 1AISB 5FWBA 2UZLB 1KHIA 4R0KA 2EKHA 1VQPT 2EQMA 4LOCA 2COYA 2LNVA 2BZXA 1SHFA 1Q7YU 5GMKh 4DBQA 4OGRB 5IT9E 2XKOC 4KUDK 4JX6A 3CCMT 2DJQA 3QDRB 3QJ6A 1PSFA 4BCQB 1QMCA 2YRDA 2G77A 3H0HA 4E6RA 2CZ7B 3DLMA 3F5XB 2ENMA 4JX5A 5CKHA 3OYYA 3CPWP 3BW1A 4CFNB 2GTJA 2YRVA 2QQRA 4C0DC 2PTKA 2C5VB 3META 1SRLA 3DOGB 3UPUA 2C06A 1ZSGA 2KRSA 3PVQA 5CQYA 5CKFA 3P8HA 2ZPBB 3UWNA 4C8QB 2P4RA 1TG0A 2P0QA 4HKEA 4JRIA 3BY7A 1VYUA 3EFRA 1QWEA 1E6HA 3SWNC 4C92E 2QXFA 3T9NA 3A8HB 5L2WB 1N6AA 4A4KA 3FIFA 5J3BA 4ZGDB 2FHDA 2YUQA 4PKCC 4E7LA 3OY9A 4OB3B 3R6OA 2DEUA 2WXVB 4OB0B 4OP0A 1KG1A 3HRTA 3VS0A 2E5KA 3M0PA 2YRCA 2K5LA 5HBEB 2V1QA 2LJ3A 1EX4A 4OMFB 2KDSA 4XU2A 2DL8A 4BY6B 2KE9A 2UZEB 2NYSA 2OTLQ 4M75E 2WIPB 2LX7A 1IRXA 4RTUA 1C1AA 2JW4A 4J8OA 1UFFA 1TH7A 3BG5A 2FVUA 2EQJA 2V8JA 1M3BA 4HXJA 2O2OA 4F7UE 4OMQA 2HEQA 1Q7YC 4JS5A 2KT1A 1NZ9A 3EFSA 4Y92A 5IDPB 2LDMA 1K9MR 2KYBA 1FX7A 1X6BA 2VWFA 4TVRA 1K9MU 1S72Q 4RG2A 5HBJB 3FC3A 3R6NA 3J81E 1U1SA 4MMLA 5CQXA 3QWXX 2C5OB 3C0CA 1QVFP 4O5VA 4BE1A 2X1NB 5I21A 4FYWB 2Y4XA 1AWOA 3JCMd 1BU2A 3HFNA 1BYMA 2EAYA 2K5FA 5HQ0B 2OTLT 4BCND 1RLQC 3OYFA 1OULA 1W70A 4HNTA 1GCPA 3GNGA 4OVAA 5LQFB 2E3IA 4BE0A 3JRZA 4RUGA 1H1RB 1YBYA 1QVFS 4M78D 1K4US 3CC2A 5CCAA 2LCLA 1SG5A 2VB6A 4BCOB 3V7SA 4F14A 1V29B 5CAIA 3VRZA 2R7GA 4ROEA 1WIEA 5CO7A 1S72T 2F1LA 2WACA 3BG3A 5GAN2 3MP1A 3CCSA 4MFEA 2ZPIB 3TU4K 2VASA 1Y7XA 2M0YA 3CMET 4KULA 4DA4A 4BDZA 4PFPA 4R56A 2VGMA 3SWNB 1YWPA 4PJLA 2EPDA 1PKSA 4M77D 1G3WA 1OIYB 3LLRA 4BI3A 2XMFA 5GJWB 2YLCA 2XDDA 1UHCA 1M1KU 1AEYA 4KUIA 4CC4B 3PIOA 1IGUA 3RKWA 4C0GA 3UT1A 2W10A 4C0DB 2QQAA 1IHVA 1WHHA 2DBKA 1AWJA 2K5IA 3RGFB 4QT7A 3CCQQ 3S3NA 1UDLA 2OAUA 2F2XA 2XDPA 2OTJT 4EOJB 2JS2A 3I55A 2R5AA 2JMCA 1C9BA 3GNFB 1EFNA 2J6FA 4XK8E 2DK3A 1X27A 2YUOA 5GAOm 4CFMB 3JCMW 1Y96B 2GCXA 1AOJA 1M1GA 1JOWA 3QHSA 3M55A 3SHWA 1UNHD 5HK0A 2AZSA 1AWXA 5EC7A 1NEGA 4IIOA 2WJ9A 4BCHB 3MKDA 2V26A 2ZCFB 3CXCA 5GAN5 1RAEB 3SD4A 2DD4B 1RABB 4J83A 2CUBA 2IW6B 1PD0A 1UJ0A 4FYYB 1FVVB 2CGHA 2LCCA 4JJCA 3L2UA 2CUDA 4HT9A 1D3BA 3VS6A 1ARKA 3JCMP 2EYZA 2LX9A 2EJGA 4F17A 1NG2A 1NPPA 1K9AA 1TXQA 1WJQA 4Y72B 1LCKA 4C92G 1LVKA 2JGZB 2HL3A 1UNGD 1H8KA 1OL1B 2KMTA 3QBYA 1PNJA 3NHNA 2IVXA 1OL2B 3OSVA 1WGSA 1KHCA 4Z89A 1AWWA 4EOLB 3OW2A 1PWTA 2HL5C 1OOTA 5KE2A 1YNZA 4JX4A 2K6DA 3FRNA 3I55Q 2PVGB 4BD3A 3I9QA 2C6TB 4M77C 3H8ZA 4F7UF 1MNDA 2G9XB 4MFDA 2CP6A 1G3SA 4JUVA 4M75B 4Y28E 3JB9D 4HCBA 2KNBB 3PO3S 1TU0B 3C12A 3QHRB 2BUDA 3TSWA 5GAOn 2YSQA 3OYJA 1AZEA 3V8LA 1N8RC 2LQ8A 1M30A 5GAMe 1N27A 1ZLMA 5KYWA 3E2UA 5J39A 2M9UA 4KGZB 5GAOr 2DL7A 4KRTA 4II5B 1TUCA 4AFSC 2CP3A 4RTTA 5CYIB 3L42A 4M7AA 1YCSB 4E7JA 3EGDA 2HSPA 2C5XB 2QQSA 5J26A 5KH6A 1ZUYA 2LQNA 4BBSM 2HZYA 2DXCB 1OZ2A 3EG0A 1JQQA 1UGQB 5FLXE 3CC4Q 2L3RA 1VQMT 4M7AE 1ZBJA 2QASA 4FYVB 1MV3A 2K9GA 3GLXA 1PCXA 4QVDA 3QYBA 2X35A 2DD5B 1LJOA 2ZPFB 1HK9A 5CK9A 5I22A 1KC8R 5KYUA 3I5RA 2DE0X 3QPHA 4Y91A 4E2FB 2LT1A 3HHTB 2EFIA 2HMAA 2L5QA 2HAXA 3RESA 1N9RA 1I4K1 1QCFA 1YP5A 5GMKe 2PK9B 3KBGA 1VQ7A 2FL7A 2HQHA 2DLPA 4E7ZA 4OB1B 5DLOA 4OMOA 4XU1A 3A8OB 2QQBA 2GQVA 5L23A 4PLIA 2JTFA 2RK1A 1V76A 4CI0C 2CREA 2PVDB 4M7DE 2EVRA 1OZ3A 2V1RA 1B34B 2X4JA 1FINB 3TSZA 1T0JA 4AT1B 4E7HA 1Y71A 1P92A 4BACA 4UN0A 2YXYA 4M7AB 1K8AU 2DVJA 1WA7A 3UA6A 3A8LB 4FT4A 2KI7A 1YIJT 3TREA 4J7FA 2QG9B 3QYHB 4CRLB 1X2QA 4JJDA 2QEXQ 2XI9A 2DYIA 4A54A 4NS5A 3PGGA 1O9KA 1XJWB 1IHWA 4II1A 2QA4Q 4IIMA 1OIUB 1MUZA 4XU0A 4KGXB 3FLGA 2OTJA 1WXUA 2CDTA 1K73R 2C0IA 3OYCA 1Q82C 5GMKi 4ZTFA 1OI9B 1O9SA 2YHTA 3L1AA 5D7UA 2QGSA 3G4SQ 4AI6A 4C5HA 2E70A 2OX7A 1D0ZA 4J9BA 3EHRA 1BK2A 1RAHB 2WHBB 3MPUB 2M16A 2ZPGB 3A5ZB 1W2BP 1YFNA 4ZTJA 3FEOA 1BIBA 4FCYA 4ATOA 1ZBXA 4AKIA 1VOMA 4XTVA 1QWFA 2JNGA 2DPPB 1VIFA 3NTKA 4PNOA 1BBZA 2E3HA 1FXXA 4X9DA 1QP2A 4AFUC 5LJ3h 1RAIB 1HD3A 1BIAA 3OYBA 2W99A 1YITA 4JPBW 2DKGA 1UE9A 2DXBB 1VUBA 2X51A 4EOOB 4BY1X 2EUFA 1X69A 2IPOB 2SRCA 3KUFA 5FU6B 3CCSQ 4OGCA 3S3MA 2B86A 4AMCA 2XDBA 2D9TA 3H0FA 4L5GA 3JCMf 2EWNA 1VQOQ 4HVWA 1VQNT 4M7AC 4KGVB 2RJFA 4RTYA 4F7LB 3VUBA 2J06A 3PVLA 1QVFA 4OGEA 3CCUT 4XTWA 3OW2P 2XD0A 2BKZB 4QQ6A 1JBMA 2V22B 2DTHA 3M59A 3CPWS 3CD6Q 2UZDB 1UGPB 4EOQB 1TWBA 3OYNA 2DTOA 1F5QB 1XO2A 2BE9B 4M7DC 4JLGA 2KRNA 3DL1A 1H24B 1SPKA 2K57A 1K73C 2CP0A 1WZOA 3M53A 1I5LA 5AT1B 1JRIA 5CKEA 1UUEA 4Z02A 3OYEA 1UG1A 4BB7A 1WHGA 3CCST 2L3PA 2W96A 1PRMC 1R0CB 3HL8A 3OMCA 2QTXA 1S72A 1M8MA 4ZN3A 1O9KB 3DB4A 5LJ5d 4PJOA 1VQOT 1D0XA 5EFQB 4PFOA 1ZA2B 1UGSB 1VQNQ 1N4MA 2QDJA 2E6ZA 3G6EA 4HT8A 1BCOA 1HXDA 1VQ4Q 2P0PA 3CCUQ 1Z9QA 3X24B 1AZGB 5LMKB 3E9FA 5GANf 1HJDA 1GL5A 1JEGA 4C8QF 1JO8A 2M51A 2G3RA 8ATCB 2LQKA 2B9RA 3WVDB 4HVVA 2QK0A 5HK3A 5GAOp 3HKSA 2VGNA 4D8DA 2RO0A 2GFUA 2FPEA 4HCKA 1IZ6A 1JU5C 2JXBA 4NC6A 3H9NA 1NBEB 4AKGA 8AT1B 5EG2A 3OS2A 2DD5A 4NSTB 3CCVA 3VKHA 2QQ9A 2PUKB 3EHQA 1JB0E 4HCCA 4OR5B 4E47A 4KRCB 2K3XA 3TQ7P 2LC4A 2YLBA 3CMEQ 3VV0A 1IGQA 2CCIB 1TFBA 3QYEA 1M8VA 3I35A 4J9DA 1U3OA 4I3ZB 2HKNA 4R55A 2H3JA 1F1BB 1VQ4T 4CFVB 3VJPA 2K2MA 2L8DA 2DIGA 4YOOA 2RJEA 3X28B 4EMGA 2PUOB 1T0HA 3MI9B 2HQEA 4C5EA 2ED1A 1YHQQ 3CC7A 2KROA 2SEMA 3VS2A 1M1KC 3JSCA 2JOYA 2KXDA 2ZAEA 4PJOF 1VQLT 3CCQT 1ZHIA 2CSQA 3RBBB 4F7UG 1YJNT 1KK7A 4LD9K 1BI1A 2CKKA 3TNHB 3G6EQ 1K9MC 3DKMA 2PQWA 3JCMV 2JJ9A 4LN2A 5KYUB 1U8RA 4JZ4A 2AT1B 3POMA 3NFCA 3BFMA 2C5NB 2DMOA 3PE0A 3OS5A 4KRDB 3PFSA 4F7UB 5LJ5j 1QLYA 1PRLC 2MWPA 1VQLA 5CKBA 3J7AF 1MV0B 4EMKA 4NL2A 1BB9A 2QI2A 5DM7R 1KXUA 4BCMD 5I2MA 2O4XB 5HBHB 4EOSB 3QZ9B 2VXFA 4K11A 3LWHA 1YHQT 2DA9A 4AG1C 3VS7A 3CPFA 5FU7B 3V7RA 2JMAA 2JTMA 5LJ3f 2WSEE 3VS3A 4A53A 2DZ9A 5IH2A 1W2BA 3VUZA 4F6SB 4E7KA 3JCMX 4C0FA 4M77E 2HDAA 3G6ET 1YJNA 4M78E 3H41A 4BI4A 3V8KA 3GF5A 4BUGA 4G6LB 1TD6A 3BG9A 1YJWT 1OYXA 4C92B 4J9GA 2QQ8A 1AD6A 1WX6A 4PJNA 5GANd 4A4FA 1M3CA 2E4HA 1X6GA 2D1XA 2AZVA 1H28B 3ER0A 3I55T 1K1ZA 4CFUB 4TTHA 2NUTB 4IUPA 1FMWA 2CCHB 3ZEHA 2BZ8A 4F7NB 4D6WA 2PK2A 2EGEA 1CKAA 1M90R 2AHJB 5CR2A 3EGUA 1VQ6Q 2X9HA 2JUFA 3OYMA 3DTOA 4ELLA 2FYKA 4M75F 1UGRB 1E9HB 3ASKA 3OA6A 4AFZC 4F6WB 1SEMA 2WSFE 2W9FA 3BDLA 2J6KA 2ROTA 4RCCA 4DQ2A 4ZGJB 5L8RE 1D1BA 3WVEB 4IUQA 4BY6C 1TUGB 4JLIA 1Q81U 2M02A 1SRMA 2IN3A 3UF4A 4M7DG 3EG2A 1ZA1B 1NE8A 3HP9A 4ROCA 3LH5A 3EH1A 3TCJA 1KSWA 1S1NA 1BI2A 2FEIA 1Q86R 2E12A 3P8BB 1UGVA 3MEAA 3QUIA 2K3YA 4PFZA 5FGKB 3JCMe 5ACBA 3QIIA 4J9HA 4OMLA 3QWLA 2DZCA 3KFVA 4MZMA 1XNIA 4OF1A 3SWNA 2BS2A 1AHJB 2KQWA 1N5ZA 1VQ5T 4A63B 4M6VA 5M9OA 3CMEA 4GBQA 4OB2B 1SF9A 4BI8B 4YTLA 4MIMA 3M58A 3TW7A 1AD5A 3SEMA 2LMJA 2O01E 4DOVA 4C8QA 3JCMJ 4JRKA 4HNVA 5IN1A 4M7AF 2BS3A 1Q95G 4ZN1A 2MK5A 1W2BS 4JDSA 4ELZC 3QSUA 2C0TA 2ZGWA 2ZPEB 4L59A 3S3OA 2NUZA 1WPYA 4M77G 2YWWA 5LJ5e 1KIKA 4RTVA 1E6GA 4QW2A 1K8AR 1I81A 4M7DB 1SSFA 3REBB 2KR6A 3A8GB 2EKOA 3GPLA 4XTZA 3X25B 1X75C 2J05A 1UHFA 3EG9A 1B7TA 4HVUA 5GAMh 2A28A 1RL2A 3LX7A 4M75G 2FZGB 2GGRA 1WHLA 3DDPB 1VQ5Q 2RQVA 1OX8A 3THKA 2RB6A 1YIJQ 3V8JA 4LUDA 1QCOA 1PKTA 2I53A 5LL6S 2RJDA 5LJ3j 3EG3A 2P4TA 3HRUA 4BE2A 3EGXB 4EORB 3MO8A 1D3BB 1IO6A 5GMKj 3LYIA 1H641 2FZKB 2MYSA 3LGFA 1VYVA 2HBPA 3PTAA 3OYHA 2LVMA 4Z88A 5ICPB 3ZL7C 1KQ1A 4M75D 1KD1R 2L89A 5FRMA 3CCJQ 2HBWA 3OBYA 4M4ZA 5GAOq 1KQSA 2HKQB 3QKJA 3G4ST 3M03A 4C8QG 2F69A 5FU7C 5GAMf 3VU3C 4C0ZA 2KSSA 1G3TA 5GANe 2E10A 3JCMc 3CCRT 1Q81R 1OGUB 3S6WA 2QGGA 3H6ZA 1OI1A 1D3UB 2LJ1A 4BCNB 1SHGA 2RN8A 4M7DD 1VQ6A 2ED0A 3RMQA 1YN8A 5KCHA 4F7SB 5DQWA 1BU1A 5D6WA 3OYDA 1XOVA 2Y4YA 2C0OA 2X3WD 1WJRA 4M77B 1JXMA 3C94A 5IF1B 4HNUA 3QHWB 3A1PA 1QLBA 4BCGB 1WLPB 2EYYA 5A2QE 2IW8B 3SDZA 2BZYA 5GJVB 2L0AA 2CZ6B 2H3EB 3G71A 2EBPA 2MAMA 3HSBA 3CCJT 3CEYA 3PMTA 4IKFA 1QCNA 1I8FA 2JM8A 2RQRA 5KCOA 2MMPA 5LJ5f 4QSHA 1G2BA 2DAQA 2BE7D 5C0MA 3EG1A 3CCRQ 2DYBA 4BCFB 4E7SA 4A4HA 2IIMA 4DBHA 1NM7A 5LJ5g 1ZSZA 2I40B 3CCEQ 1I0CA 3ZFJA 2KGTA 4DOWA 1D09B 3MY5B 4PJOB 3VKGA 3HRSA 2NUPA 3EAEA 2EGAA 2GQIA 1R0BG 5HKCA 5HVYB 3QXEB 2KY9A 2JZ2A 2AIRB 3CD6T 4M7DA 1LNXA 1QW1A 1QMZB 2D0QB 4E7IA 3M0RA 1TS9A 4XU3A 1VQ9Q 1H1QB 2VYTA 1SSHA 3MHXA 5FU6C 2CZ1B 4JJNK 1URCB 3GBQA 4M75C 1N8RR 3SB2A 1J3TA 3M0QA 3B57A 2KR3A 2F2CA 4JZ3A 2DMEA 4PJMA 4EDUA 1FWZA 1VQKQ 5C6SA 4DBRA 2WSCE 4RKUE 2WPAB 3GP8A 2RHUA 1B3QA 4XTXA 1KQSS 3CCET 4DEYA 3CQTA 5GMKm 3M0SA 1VQMA 1WQ7A 3FB9A 5LJ3e 2QFZA 4O6JA 4CXAB 5KYNA 3LWIA 2HNIA 2RHIA 2ECZA 4IUVA 4F7UA 2CT3A 2A7YA 1YI2A 3QYGB 4XTYA 3JB9J 1ABOA 1NEBA 2PHGA 4D8KA 1DJ7B 1VQ9T 4FU6A 2EQUA 2KEAA 3CBPA 1G3NC 1UB4A 1BI0A 2GFAA 2QF7A 3DJBA 2RQTA 3MEWA 3VKIA 3BHUB 1LOJA 1Q81C 5DQVA 1X01A 3P8DA 4OMMA 2AK5A 1QVPA 3RMSA 5KE3A 1ZX6A 2KT8A 2M0OA 3MY1B 2FPFA 3G1JA 4L6V5 2ZZDB 3O5ZA 3GOXA 4DEXA 3G33B 2DEQA 1VQOA 3OS1A 3BDUA 2M1HA 3G71Q 2WMAB 4Z6YA 4M78F 1O75A 3CC4A 2EQIA 2LZ6B 2XHCA 2RHZA 2QAZA 2RQUA 3MJXA 5A0GA 3V7CA 4CC2A 3JB9I 1EZZB 5IHKA 3TN8B 4XQ3A 1VYWB 4PL6A 1TUDA 3EOCB 2A3LA 1SKUB 2O31A 3I56Q 1H27B 3NTHA 1D1AA 2ZZDA 2DJZA 2RK2A 1VQLQ 4WCIA 2JT4A 3EJ1B 5IHYA 3K7AM 1RUWA 1MGQA 1YJNQ 5LJ3d 2CP7A 3CCMA 3ZBDA 3BE3A 5KYYA 2E64A 5KYWB 1PHTA 4J6YA 3HPWA 1RADB 4N4GA 1H3HA 2EGCA 1GBRA 1WHMA 2RHYA 3Q1JA 1U06A 5GAN3 2MCNA 1ZUKA 4FW1A 1M4ZA 3CCLT 2XU8A 2X4YA 2DVEA 3CC7T 2PU9B 2K4YA 2KK4A 3UDCA 1XTDA 1IREB 2EYXA 4IMYB 1MMDA 3CCRA 3NDQA 1M2VB 1RAGB 1JJ2P 3G71T 2MI6A 4FM4B 3HFOA 4FIBA 5KYYB 2DXCA 2EYQA 3G7ZA 3INZA 1CSKA 4PJOE 1I5OB 3PIPA 1YCYA 2JVVA 2Z0WA 3PT9A 1MMNA 2BTTA 1M90U 3NGPA 2CH4W 5FWCA 2LT4A 5GAOl 3QO3A 2W2HA 4QVCA 1Q86U 4P5NA 3OBWA 1PKDB 2J7IA 4FX3B 3C4SA 3ULRB 3FDRA 1OV3A 1X43A 2CT4A 3UATA 4M7AG 3L2VA 1D0YA 1R8OB 4PJOG 3M56A 4LD6A 1NYGA 2EYWA 2RMOA 3RDVA 1VQNA 2V8KA 3BLHB 1Y0MA 1YJWQ 3UA7A 3CCLQ 2AKKA 3M0TA 2DXBA 4BBRM 2GTOA 3CC2Q 3CC7Q 1M1FA 3VYGB 3HZJA 1ZP2A 1IB8A 1GUXA 1GBQA 4KH1B 1Q86C 2COWA 3KHIA 1YJ9T 4KH0B 3JCMh 2JS0A 3VS4A 2K2VA 2OJ2A 1K0XA 2UUEB 3ME9A 3KXTA 2MOXA 1H1SB 3QG1A 1TOVA 4X1VA 1I07A 3MEVA 2A0FB 1VQ6T 2DRKA 1W98B 3LW5E 3M0UA 1H92A 4RTWA 1M90C 4YC3B 4Z8AA 3RERA 1M2VA 1EIFA 2R5MA 4WTOB 3X20B 2D0NA 1JXOA 2RPNA 2XK0A 2RHXA 1E7OA 3BLQB 4PK4A 2NWMA 2FG0A 3O8VA 1YIJA 9ATCB 1OU8A 1WYXA 2JN0A 1WXBA 1BKBA 3M9QA 4M77A 3HB9A 4DBFA 1OEBA 4V2SA 4FSSA 1T3SA 1GCQC 2DNUA 3QZ5B 1RAAB 2YUPA 4XTUA 4PJOC 4M78G 2X4WA 3WXMB 5ECAA 3QDFA 4B6MA 1K0SA 4LDYA 2P84A 2X4XA 2RI2A 2XIDA 2WFYB 2CYZB 2OAWA 4ELJA 1GY3B 3AT1B 3CMAT 4GLMA 5IDNB 5GAN8 2QYZA 2DD4A 1VINA 1YWOA 4F16A 2RJCA 1U5SA 4HL4A 2EW3A 2GNCA 4LNPA 4FW2A 2FRYA 2KBTA 2KYMA 3EFOB 1JSTB 4GY5A 1K76A 2OI3A 2AKLA 2HSEB 2QDLA 4LDWA 4EMKC 1HSQA 2BPMB 1UNLD 2YT6A 1Y57A 2VVKA 5D6XA 1H1PB 2EJFA 2LNHB 3C95A 1K8AC 2NUPB 1M5Q1 2KXCA 4J9CA 5GANj 4MDWA 5IAYA 3DDQB 5FW9A 1LPLA 1Y96A 2F5TX 2CJMB 2DXUA 2E65A 1JKWA 4OMPA 1M2OA 4J6WA 3U23A 4X34A 2KAFA 1M3AA 5GAMd 2CSIA 1V1CA 2PVOB 1T3LA 2KVQG 2E1HA 4JJBA 2V8IA 3CCMQ 3CMAQ 1BI3A 4EIKA 1KQSP 4RMOA 4ANJA 3JB9F 1MMGA 1GXIE 2ROLA 2XG8D 2CH4A 3I56A 2HD0A 2PJQA 2DM1A 5CIUA 4M77F 1OU9A 2PZ1A 1QVGS 3VS5A 3X26B 2YDLA 1KD1U 4J9FA 2VV5A 3RIRA 4RG8A 1ZQ1A 4QVZA 4QQDA 2I2LA 4B9WA 4M7DF 3H4CA 4LDVA 1VYTA 1GH6B 5HY6A 3E1SA 1MNEA 3E19A 4BCJB 2ABLA 2A08A 1ACMB 2BIVA 5HCKA 4C92F 2G6FX 5GAN7 3E9GA 3RNJA 1NJIR 2VUBA 3JV3A 2GF7A 3CCLA 1U1TA 1W1FA 3M5AA 4LUEA 4C5IA 1G83A 1C0MA 2PMIB 1NYFA 3L2RA 3CPWA 4LDXA 1GCQA 2QGFB 4IUUA 2DL4A 3IQLA 2MIOA 1G3YA 3L2ZA 2KRMA 3AHUA 2H8HA 1UECA 2ATCB 4JS4A 3VYGA 2DILA 3L2QA 2NLUA 2VKNA 1YI2Q 4EMKB 3RUXA 5HNBB 4QQGA 1N8RU 1W4SA 2E41A 3H0IA 1VQPA 7AT1B 1NLPC 3FJPA 3OYGA 3RKYA 2RI5A 3CCQA 5DY9A 3JCMb 4LXCA 2RF0A 1Y07A 3JB9G 4JRQA 2LQWA 1TTHB 4N4IA 4MZPA 2DIQA 3M54A 1VQ4A 3EGDB 2RNAA 3TEEA 5GANh 4NL3A 5LJ5h 3LGLA 1VQKA 2A37A 5GAN6 4M78B 4ZNXA 1VA7A 5I11A 4RCBA 2A36A 3MEUA 1NLOC 1MHNA 4C92D 3JCMg 2X3XD 3TNWB 2MWOA 3MP8A 2IW9B 4FYXB 4EOKB 1KC8U 3NMZC 1BCMA 3D7SB 4RODA 1ABQA 2HCKA 1VIEA 1QQJA 5KYXB 2WEVB 1OKWB 2NUTA 2RA2A 1Z9ZA 4NOYA 2CP2A 1H25B 2DXTA 3CCVT 1YI2T 3EG9B 3O0GD 2JTEA 4M78A 3EH2A 4F6UB 2UZBB 2F2VA 1KC8C 3SFMA 4HA8A 6AT1B 5GAMg 1C6VX 1QVGA 2WIHB 2QDYB 5A0LA 1WFWA 4ESRA 4J5YA 3MIAB 2LCSA 2O88A 1FMVA 2RH2A 4KT0E 1YITQ 2FPDA 2I0NA 3NPFA 3VYHB 1R77A 1KQ2A 4EOMB 3A8MB 1W6XA 5IXFA 5IHNA 1VQKT 3GIBA 4PJOD 1PC0A 2BKDN 4YOZA 2BS4A 3RKXA 1RAFB 1B34A 1CKBA 2CS7A 2RD1A 1JSUB 3M4GA 4A4GA 4CC7A 5BNJB 4M75A 1IXDA 5CKDA 2QTVA 4EOPB 3MCAB 1MMAA 3PNWC 5FRNA 3CCVQ 2J6OA 1ENWA 4VUBA 4BCPB 1I1JA 1H26B 2DRMA 3OYKA 3F70A 1H3ZA 4EONB 4AG2C 1WHJA 4FT2A 3CD6A 1M9SA 4N4HA 4BCIB 1FYNA 2DL5A 2DETA 2OTJQ 1PD1A 2DX1A 1YITT 1JJ2S 2F5KA 3OW2S 4BDYA 5CVIA 1P5EB 4BCMB 5AYFA 1XQHA 1ZSZC 2WMBB 4AFQC 1KFZA 1HYOA 3DB3A 5I5ZB 4N0AC 1GFCA 1FKMA 3CCJA 4J9IA 5GAN4 1Q82R 5IXBA 4N0AA 4FL6A 3J80E 2K3BA 4J9EA 4C8QD 4J6XA 2O9SA 1AVZC 3TNIB 4IURA 5GMKl 4C92C 4IUTA 1RI9A 4BCQD 5FROA 3JAME 1WDXA 1WNLA 1OPLA 4UC4A 1N9SA 2O4XA 3PMIA 2JM9A 1JJ2A 5EJCA 2B8AA 1K73U 4F7JB 4YOSA 5GANg 3DLLA 3I56T 1G8XA 2D8HA 2IVWA 2DTIA 1Q7YR 3URGA 4QKUA 2F2WA 2IG0A 3OYIA 2COZA 3OMGA 5KYXA 4B9XA 5I2SA 2L3SA 4OMNA 3GTMS 5GAMj 4AKHA 1VQ7T 3M4YA 1RLPC 2RQWA 1G5VA 4M7AD 3LH0A 1WQWA 4CC3A 2DF6A 2FB7A 1YJWA 1WI7A 3G4SA 1M27C 2ESWA 4FSXA 3LQ5B 4CFWB 3CXCP 3TW6A 3I5SA 1RI0A 2QEXA 4ME7A 2R58A 2L2PA 1UEBA 3JB9H 3BLRB 4EC8B 3RR6A 1M1KR 1OPKA 4BXXX 2ZPHB 1YHQA 3CCUA 1TSFA 4EMHA 1GFDA 2FO0A 4M78C 2EIFA 2VC8A 3CXCS 1ZUUA 4C8QE 1NJIU 5A0DA 3HBLA 1OQKA 3CMAA 4XAXB 2EJ9A 2LJ0A 3A98A 3EGXA 2EQKA 4CFUD 2GBQA 3EFOA 3HTRA 3OSSC 1VQ7Q 2FRWA 4X9CA 2LP5A 2P0KA 1VQ8A 5D6YA 3CC2T 3CCEA 1QKWA 1VQ8Q 1QP3A 1WHKA 2C4GB 3L2WA 1X6OA 1YJ9A 2Y90A 4EOIB 1KJWA 2LTOA 2YUNA 4RTXA 4MDXA 3OQ5A 5IHIA 1YJ9Q 3CBMA 1QKXA 3REAB 1AT1B 2KMGA 2E6NA 4ELYC 4GLKA 4BCKB 1FMKA 4KBMB 1B07A 2PNIA 1A0NB 3EIDB 4C8QC 3CC4T 1VQMQ 1Q82U 1GRIA 1H4LD 4CFXB 1OX9A 2LW4A 3OYLA 1NJIC 2CZ0B 2FZCB 2QA4A 1VQ5A 2MF2A 1E7PA 2E5QA 4MZTA 3NTIA 1WXTA 1PM3A
chains in the Genus database with same CATH topology
5LJ3g 3QIIA 4V2SA 3GLXA 4QVDA 3QYBA 2X35A 3QZ5B 3QWLA 2DD5B 1LJOA 2DZCA 4LDUA 4A4EA 2ZPFB 4XTUA 4PJOC 1HK9A 4M78G 5CK9A 4MZMA 2VXEA 2X4WA 4PLLA 1XNIA 3WXMB 4OF1A 3SWNA 3JCMQ 1KD1C 2BS2A 1AHJB 4LDYA 4Y91A 3QPHA 4JRPA 2KQWA 2X4XA 2RI2A 1VQ8T 2XIDA 2LT1A 2CYZB 3HHTB 4ELJA 4Q5WA 2OTLA 2D6FA 1VQ5T 2EFIA 4M6VA 3HO8A 1WJSA 4C5GA 5M9OA 1VQ9A 3CMAT 4ZGEB 5GAN8 3CMEA 1NPRA 2L5QA 2DD4A 3OB9A 4OB2B 2RJCA 4HL4A 2HAXA 3RESA 1N9RA 1I4K1 4BI8B 4YTLA 5GMKe 4MIMA 3M58A 3TW7A 2RI3A 3KBGA 5GANj 2RM4A 2O01E 1VQ7A 4DOVA 2FL7A 4C8QA 3JCMJ 4JRKA 4HNVA 5IN1A 4GY5A 4M7AF 2BS3A 4OB1B 4ZN1A 5DLOA 3OYAA 4J7IA 4LDWA 4XU1A 4EMKC 1W2BS 4JDSA 3A8OB 2QQBA 3M57A 4ELZC 3QSUA 2GQVA 5D6XA 4PLIA 2JTFA 2RK1A 2ZGWA 2ZPEB 2EJFA 4L59A 2PVDB 4CI0C 3S3OA 1WPYA 4M77G 4M7DE 1OZ3A 1B34B 3C95A 1K8AC 4HLQA 2X4JA 5LJ5e 4WF2A 2HQXA 1M5Q1 4QW2A 4EPCA 1I81A 2LRQA 3MP6A 4M7DB 5DLQE 1SSFA 4MDWA 5IAYA 1Y71A 1P92A 2QEXT 4BACA 2KR6A 3A8GB 2EKOA 4E7HA 1Y96A 4M7AB 2F5TX 3GPLA 2DXUA 2E65A 3OS0A 1K8AU 4XTZA 3X25B 3A8LB 1X75C 4FT4A 4J6WA 1VQ6A 3CBOA 2QA4T 3TREA 1YIJT 4M7AE 1PSEA 4X34A 4J7FA 2KAFA 5GAMd 5GAMh 3QYHB 4HCZA 3QJYA 1RL2A 2PVOB 3LX7A 2XI9A 4MMKA 4C92A 2DO3A 4M75G 4A54A 4CRIA 2KVQG 2XICA 2E1HA 2R57A 4NS5A 3N5BB 2V8IA 3PGGA 4II1A 1KHIA 1BI3A 2RB6A 1VQPT 2EQMA 3V8JA 4LOCA 2LNVA 4RMOA 4XU0A 5LL6S 2RJDA 5LJ3j 1Q7YU 2P4TA 3JB9F 3FLGA 2OTJA 1GXIE 2XG8D 5GMKh 3HRUA 4BE2A 3OYCA 1Q82C 5IT9E 2XKOC 3I56A 2HD0A 4KUDK 4JX6A 3CCMT 3MO8A 3QDRB 5GMKi 3QJ6A 4M77F 1D3BB 1PSFA 5CIUA 1QVGS 5GMKj 3LYIA 1H641 4ZTFA 1O9SA 3LGFA 2G77A 2HBPA 3X26B 2YHTA 3L1AA 3OYHA 3PTAA 1KD1U 2VV5A 2CZ7B 4AI6A 2E70A 2LVMA 3DLMA 3RIRA 4RG8A 4C5HA 1KQ1A 1ZQ1A 4JX5A 4M75D 4QVZA 4QQDA 2I2LA 2L89A 5CKHA 3OYYA 5FRMA 3OBYA 4B9WA 4M7DF 5GAOq 3H4CA 2M16A 3BW1A 1KQSA 2ZPGB 3A5ZB 3QKJA 4LDVA 2YRVA 4ZTJA 3FEOA 3G4ST 1BIBA 2QQRA 4C0DC 4C8QG 2F69A 5FU7C 5GAMf 4ATOA 3META 5HY6A 1ZBXA 4AKIA 3E1SA 3VU3C 4C0ZA 3E19A 2KSSA 2C06A 3UPUA 4XTVA 1G3TA 5GANe 2E10A 2JNGA 5CQYA 5CKFA 3JCMc 3CCRT 2BIVA 3P8HA 2DPPB 2ZPBB 1VIFA 3UWNA 3E9GA 3S6WA 4C8QB 2VUBA 4C92F 3NTKA 5GAN7 2P0QA 4HKEA 4PNOA 3H6ZA 1OI1A 3BY7A 4JRIA 3EFRA 2GF7A 3CCLA 1U1TA 3SWNC 1FXXA 3M5AA 4X9DA 2QXFA 4C92E 1QP2A 3T9NA 4M7DD 3A8HB 5LJ3h 1N6AA 4A4KA 4C5IA 3FIFA 5J3BA 4ZGDB 2FHDA 3L2RA 3CPWA 4PKCC 4LDXA 3RMQA 5KCHA 3OY9A 4E7LA 4OB3B 1BIAA 3R6OA 4IUUA 3OYBA 1G3YA 5D6WA 1YITA 4OB0B 4OP0A 3L2ZA 1KG1A 3HRTA 3OYDA 2DKGA 1XOVA 2Y4YA 3AHUA 2DXBB 1VUBA 1WJRA 4M77B 2K5LA 4JS4A 3C94A 3VYGA 4HNUA 3L2QA 2NLUA 1QLBA 4EMKB 3RUXA 4OMFB 2KDSA 4QQGA 1N8RU 1W4SA 3KUFA 5FU6B 4XU2A 2E41A 5A2QE 3SDZA 4OGCA 4BY6B 3S3MA 1VQPA 2CZ6B 3FJPA 3G71A 3HSBA 2MAMA 4M75E 2XDBA 3OYGA 3RKYA 2RI5A 2D9TA 4L5GA 3CCJT 3JCMf 2EWNA 3CEYA 5DY9A 3JCMb 3CCQA 3PMTA 4IKFA 1VQNT 1Y07A 4M7AC 3JB9G 1I8FA 2RJFA 4J8OA 5KCOA 4JRQA 2MMPA 1TH7A 3BG5A 4N4IA 5LJ5f 4QSHA 2FVUA 2DAQA 4MZPA 2EQJA 3VUBA 2DIQA 5C0MA 2V8JA 3M54A 4F7UE 1VQ4A 1QVFA 4OGEA 3TEEA 4NL3A 5GANh 3CCUT 4XTWA 5LJ5h 4A4HA 3LGLA 1Q7YC 2XD0A 1VQKA 4QQ6A 1JBMA 3M59A 1NZ9A 2DTHA 5GAN6 3CPWS 4JS5A 3EFSA 4M78B 5LJ5g 2LDMA 1UGPB 1FX7A 4RCBA 3ZFJA 3MEUA 3OYNA 4DOWA 1MHNA 4C92D 2DTOA 4TVRA 4PJOB 3JCMg 1K9MU 2MWOA 3VKGA 3MP8A 3HRSA 1KC8U 4RG2A 3EAEA 4M7DC 5HKCA 4JLGA 3QXEB 3DL1A 1VIEA 2JZ2A 2KY9A 3J81E 3FC3A 3CD6T 4M7DA 1U1SA 2K57A 4MMLA 5CQXA 1LNXA 2RA2A 3M53A 1K73C 1I5LA 1QW1A 1JRIA 4NOYA 2D0QB 5CKEA 2DXTA 4E7IA 4O5VA 4Z02A 3CCVT 4BE1A 1YI2T 3OYEA 4XU3A 4BB7A 5I21A 2Y4XA 4M78A 3JCMd 3CCST 3HFNA 1BYMA 2EAYA 2K5FA 1S72A 2VYTA 3HL8A 3OMCA 2QTXA 2OTLT 3MHXA 4ZN3A 5FU6C 3DB4A 3SFMA 5LJ5d 1KC8C 1VQOT 4HA8A 4PJOA 2CZ1B 3OYFA 4JJNK 4M75C 5GAMg 3SB2A 1UGSB 4HNTA 3GNGA 4OVAA 1QVGA 4BE0A 2QDYB 5A0LA 4J5YA 2QDJA 1FWZA 2E6ZA 3JRZA 4EDUA 1YBYA 5C6SA 3G6EA 2RH2A 4HT8A 4KT0E 1HXDA 2P0PA 3VYHB 1QVFS 2WSCE 4M78D 4RKUE 3X24B 5CCAA 3CC2A 2LCLA 3GP8A 1KQ2A 3E9FA 5GANf 2RHUA 4XTXA 3A8MB 1KQSS 3V7SA 3CCET 1VQKT 4C8QF 3GIBA 4PJOD 1V29B 5CAIA 2G3RA 2BKDN 5GMKm 1VQMA 2BS4A 1WQ7A 3FB9A 3RKXA 5CO7A 5LJ3e 2LQKA 2WACA 2QFZA 4O6JA 3BG3A 1B34A 1S72T 2CS7A 3LWIA 2HNIA 5GAN2 2RHIA 3WVDB 3MP1A 2RD1A 3M4GA 4A4GA 4MFEA 5HK3A 3CCSA 5GAOp 4IUVA 3HKSA 2VGNA 2ZPIB 4F7UA 4M75A 5CKDA 2A7YA 2RO0A 2GFUA 1YI2A 3QYGB 4XTYA 1IZ6A 3MCAB 3PNWC 3JB9J 5FRNA 4NC6A 3TU4K 4AKGA 1Y7XA 5EG2A 3OS2A 3CMET 2DD5A 1DJ7B 1VQ9T 4KULA 4DA4A 4VUBA 3CCVA 4FU6A 4BDZA 3VKHA 4R56A 2QQ9A 2VGMA 2PUKB 2EQUA 3CBPA 3F70A 3SWNB 3OYKA 1JB0E 4HCCA 1H3ZA 1UB4A 1BI0A 2GFAA 2QF7A 4FT2A 4E47A 2K3XA 4M77D 1G3WA 2LC4A 3MEWA 3VKIA 3LLRA 3CD6A 1M9SA 1LOJA 2YLBA 4N4HA 4BI3A 2XDDA 2YLCA 3VV0A 1Q81C 3QYEA 1M1KU 1M8VA 4KUIA 3PIOA 3RKWA 1X01A 3P8DA 4C0GA 1QVPA 3UT1A 4C0DB 3RMSA 2QQAA 5KE3A 4R55A 1YITT 2H3JA 1VQ4T 1JJ2S 2M0OA 2F5KA 3VJPA 3OW2S 4BDYA 5CVIA 2L8DA 5AYFA 2K5IA 4L6V5 2ZZDB 2DIGA 2RJEA 1XQHA 3X28B 4EMGA 3GOXA 2PUOB 3DB3A 4N0AC 2DEQA 1VQOA 3S3NA 2OAUA 1FKMA 3OS1A 3BDUA 2XDPA 2M1HA 2OTJT 2HQEA 3CCJA 4Z6YA 4M78F 5GAN4 1O75A 4C5EA 3CC4A 3I55A 3CC7A 4N0AA 2R5AA 2RHZA 2XHCA 5A0GA 3GNFB 4FL6A 1M1KC 3JSCA 2JOYA 4XK8E 3V7CA 3J80E 4PJOF 4C8QD 1VQLT 3CCQT 2DK3A 3JB9I 1ZHIA 4J6XA 5GAOm 4XQ3A 4F7UG 3JCMW 1YJNT 4PL6A 4LD9K 1Y96B 1BI1A 2CKKA 2A3LA 2GCXA 1M1GA 3QHSA 4IURA 3NTHA 5GMKl 4C92C 1K9MC 2ZZDA 3M55A 4IUTA 2DJZA 3DKMA 5FROA 2RK2A 3JAME 1WNLA 4UC4A 5HK0A 2PQWA 1N9SA 2O4XA 3PMIA 3JCMV 1U8RA 1JJ2A 5EJCA 2B8AA 2WJ9A 1MGQA 1K73U 5GANg 5LJ3d 3DLLA 3CCMA 3ZBDA 3I56T 2E64A 3NFCA 3BFMA 4J6YA 3HPWA 2IVWA 2ZCFB 4N4GA 2DTIA 3CXCA 5GAN5 3URGA 3SD4A 3Q1JA 2DD4B 2RHYA 5GAN3 4J83A 2IG0A 3OS5A 3OYIA 3OMGA 4F7UB 3PFSA 2CGHA 5LJ5j 3CCLT 1M4ZA 4B9XA 5I2SA 2XU8A 2X4YA 2LCCA 2DVEA 3CC7T 2PU9B 2MWPA 3L2UA 1VQLA 2K4YA 2KK4A 5GAMj 4HT9A 1D3BA 3UDCA 1XTDA 5CKBA 3JCMP 1IREB 4AKHA 3J7AF 4EMKA 4NL2A 1VQ7T 2QI2A 5DM7R 3M4YA 3CCRA 5I2MA 2EJGA 2LX9A 2O4XB 1NPPA 1WJQA 1G5VA 3QZ9B 3G71T 2MI6A 3LH0A 4M7AD 1WQWA 2VXFA 4FM4B 3HFOA 4C92G 2FB7A 4FIBA 3LWHA 1YHQT 3G4SA 2DXCA 1YJWA 2EYQA 3CPFA 5FU7B 4FSXA 3V7RA 3G7ZA 3TW6A 3INZA 2JTMA 5LJ3f 2WSEE 4A53A 1W2BA 2DZ9A 1RI0A 2KMTA 2QEXA 4PJOE 3PIPA 3QBYA 4ME7A 1YCYA 2JVVA 3VUZA 4E7KA 3JCMX 2R58A 3PT9A 4C0FA 1UEBA 3OSVA 4M77E 1WGSA 1KHCA 1M90U 3G6ET 3JB9H 1YJNA 4M78E 2LT4A 5GAOl 3OW2A 4BI4A 3QO3A 3V8KA 3GF5A 4BUGA 4QVCA 5KE2A 1Q86U 4JX4A 3OBWA 4P5NA 3BG9A 3C4SA 2ZPHB 3FRNA 1YJWT 1OYXA 3FDRA 3CCUA 1YHQA 4EMHA 4C92B 4M7AG 2QQ8A 2PVGB 3L2VA 1R8OB 4M78C 4PJOG 4BD3A 2EIFA 5GANd 2VC8A 3M56A 4M77C 4LD6A 3H8ZA 4A4FA 3CXCS 4F7UF 1VQNA 4C8QE 2V8KA 1NJIU 4MFDA 3ER0A 5A0DA 3I55T 1G3SA 4JUVA 4M75B 3HBLA 2DXBA 3CMAA 4IUPA 4BBRM 2EJ9A 4XAXB 4Y28E 3JB9D 4HCBA 1M1FA 3VYGB 2EQKA 3C12A 3ZEHA 3HZJA 2BUDA 5GAOn 3OSSC 4D6WA 3OYJA 1Q86C 3V8LA 1N8RC 2LQ8A 4X9CA 5GAMe 1VQ8A 2P0KA 3KHIA 5D6YA 1YJ9T 2AHJB 5CR2A 3JCMh 3CC2T 3CCEA 1N27A 2K2VA 2JUFA 3OYMA 1QP3A 3ME9A 3L2WA 2FYKA 5J39A 1X6OA 2M9UA 4M75F 1UGRB 2Y90A 3KXTA 3OA6A 3ASKA 1YJ9A 3QG1A 2LTOA 2WSFE 4MDXA 5GAOr 3OQ5A 3BDLA 3MEVA 3CBMA 4RCCA 1VQ6T 4DQ2A 3L42A 3LW5E 4ZGJB 5L8RE 4M7AA 4E7JA 2KMGA 2E6NA 3WVEB 4IUQA 1M90C 4BY6C 2QQSA 4GLKA 4ELYC 3RERA 4JLIA 4KBMB 1Q81U 5J26A 1EIFA 2R5MA 4C8QC 3CC4T 1Q82U 3X20B 4M7DG 5KH6A 1NE8A 4BBSM 3HP9A 2XK0A 2DXCB 1OZ2A 2RHXA 3TCJA 3OYLA 1NJIC 2CZ0B 1BI2A 3O8VA 2QA4A 1YIJA 2E12A 2JN0A 3P8BB 1UGQB 1VQ5A 5FLXE 2MF2A 1BKBA 1E7PA 2L3RA 1VQMT 3M9QA 3MEAA 2E5QA 3QUIA 4MZTA 2K3YA 3NTIA 4M77A 3HB9A 3JCMe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT0 E;  2PU9 B;  3VYH B;  2WSC E;  4RKU E;  3QZ5 B;  1IRE B;  3X24 B;  2DPP B;  2ZPB B;  2DD5 B;  2ZPF B;  3A8M B;  1AHJ B;  3QZ9 B;  1V29 B;  4FM4 B;  1QP2 A;  2DXC A;  2CYZ B;  3HHT B;  3A8H B;  4ZGD B;  4ZGE B;  4OB3 B;  3WVD B;  2DD4 A;  2WSE E;  4OB2 B;  4OB0 B;  2ZPI B;  2DXB B;  3QYG B;  3VYG A;  2O01 E;  2DD5 A;  1DJ7 B;  4OB1 B;  2PUK B;  2ZPH B;  1JB0 E;  3A8O B;  2CZ6 B;  2PVG B;  2ZPE B;  2PVD B;  2DXB A;  4Y28 E;  3A8G B;  3VYG B;  3X25 B;  4L6V 5;  3A8L B;  2ZZD B;  3X28 B;  1PSE A;  2PUO B;  3QYH B;  2AHJ B;  2PVO B;  1UGP B;  1QP3 A;  1UGR B;  4XK8 E;  2WSF E;  3QXE B;  1GXI E;  3LW5 E;  2D0Q B;  4ZGJ B;  5L8R E;  1PSF A;  3WVE B;  2ZZD A;  3X26 B;  3X20 B;  2CZ7 B;  2DXC B;  2CZ1 B;  2ZCF B;  2CZ0 B;  1UGS B;  2ZPG B;  2DD4 B;  1UGQ B;  2QDY B; 
#chains in the Genus database with same CATH topology
 5LJ3 g;  1RAC B;  4EC9 B;  4LDU A;  4A4E A;  1OKV B;  2W9Z A;  2VXE A;  4PLL A;  1KD1 C;  3JCM Q;  4JRP A;  1VQ8 T;  4F04 B;  1UTI A;  4Q5W A;  2DFU A;  2OTL A;  2D6F A;  1WJS A;  3HO8 A;  4C5G A;  1VQ9 A;  4ZGE B;  1VQP Q;  1X2K A;  3VRY A;  1NPR A;  1QVG P;  3OB9 A;  3TVT A;  3QWY A;  1VOL A;  3FJ5 A;  2W0Z A;  3VS1 A;  2O9V A;  2RI3 A;  2RM4 A;  1GUX B;  4PJJ A;  2D8J A;  2K7A A;  3OYA A;  4LE9 A;  4J7I A;  1ZSZ B;  2K79 A;  3M57 A;  5CEI B;  4BY7 X;  2CP5 A;  2MPX C;  3BHT B;  4HLQ A;  4WF2 A;  2HQX A;  4F70 B;  3BHV B;  4EPC A;  2LRQ A;  3MP6 A;  1PG5 B;  2DBM A;  5DLQ E;  2DER A;  2QEX T;  4ORZ A;  3OS0 A;  3CBO A;  2QA4 T;  1PSE A;  2L3Q A;  1UJY A;  4HCZ A;  3QJY A;  4RTZ A;  4MMK A;  1D1C A;  4C92 A;  2DO3 A;  4CRI A;  2XIC A;  2R57 A;  2DL3 A;  3N5B B;  1AIS B;  5FWB A;  2UZL B;  1KHI A;  4R0K A;  2EKH A;  1VQP T;  2EQM A;  4LOC A;  2COY A;  2LNV A;  2BZX A;  1SHF A;  1Q7Y U;  5GMK h;  4DBQ A;  4OGR B;  5IT9 E;  2XKO C;  4KUD K;  4JX6 A;  3CCM T;  2DJQ A;  3QDR B;  3QJ6 A;  1PSF A;  4BCQ B;  1QMC A;  2YRD A;  2G77 A;  3H0H A;  4E6R A;  2CZ7 B;  3DLM A;  3F5X B;  2ENM A;  4JX5 A;  5CKH A;  3OYY A;  3CPW P;  3BW1 A;  4CFN B;  2GTJ A;  2YRV A;  2QQR A;  4C0D C;  2PTK A;  2C5V B;  3MET A;  1SRL A;  3DOG B;  3UPU A;  2C06 A;  1ZSG A;  2KRS A;  3PVQ A;  5CQY A;  5CKF A;  3P8H A;  2ZPB B;  3UWN A;  4C8Q B;  2P4R A;  1TG0 A;  2P0Q A;  4HKE A;  4JRI A;  3BY7 A;  1VYU A;  3EFR A;  1QWE A;  1E6H A;  3SWN C;  4C92 E;  2QXF A;  3T9N A;  3A8H B;  5L2W B;  1N6A A;  4A4K A;  3FIF A;  5J3B A;  4ZGD B;  2FHD A;  2YUQ A;  4PKC C;  4E7L A;  3OY9 A;  4OB3 B;  3R6O A;  2DEU A;  2WXV B;  4OB0 B;  4OP0 A;  1KG1 A;  3HRT A;  3VS0 A;  2E5K A;  3M0P A;  2YRC A;  2K5L A;  5HBE B;  2V1Q A;  2LJ3 A;  1EX4 A;  4OMF B;  2KDS A;  4XU2 A;  2DL8 A;  4BY6 B;  2KE9 A;  2UZE B;  2NYS A;  2OTL Q;  4M75 E;  2WIP B;  2LX7 A;  1IRX A;  4RTU A;  1C1A A;  2JW4 A;  4J8O A;  1UFF A;  1TH7 A;  3BG5 A;  2FVU A;  2EQJ A;  2V8J A;  1M3B A;  4HXJ A;  2O2O A;  4F7U E;  4OMQ A;  2HEQ A;  1Q7Y C;  4JS5 A;  2KT1 A;  1NZ9 A;  3EFS A;  4Y92 A;  5IDP B;  2LDM A;  1K9M R;  2KYB A;  1FX7 A;  1X6B A;  2VWF A;  4TVR A;  1K9M U;  1S72 Q;  4RG2 A;  5HBJ B;  3FC3 A;  3R6N A;  3J81 E;  1U1S A;  4MML A;  5CQX A;  3QWX X;  2C5O B;  3C0C A;  1QVF P;  4O5V A;  4BE1 A;  2X1N B;  5I21 A;  4FYW B;  2Y4X A;  1AWO A;  3JCM d;  1BU2 A;  3HFN A;  1BYM A;  2EAY A;  2K5F A;  5HQ0 B;  2OTL T;  4BCN D;  1RLQ C;  3OYF A;  1OUL A;  1W70 A;  4HNT A;  1GCP A;  3GNG A;  4OVA A;  5LQF B;  2E3I A;  4BE0 A;  3JRZ A;  4RUG A;  1H1R B;  1YBY A;  1QVF S;  4M78 D;  1K4U S;  3CC2 A;  5CCA A;  2LCL A;  1SG5 A;  2VB6 A;  4BCO B;  3V7S A;  4F14 A;  1V29 B;  5CAI A;  3VRZ A;  2R7G A;  4ROE A;  1WIE A;  5CO7 A;  1S72 T;  2F1L A;  2WAC A;  3BG3 A;  5GAN 2;  3MP1 A;  3CCS A;  4MFE A;  2ZPI B;  3TU4 K;  2VAS A;  1Y7X A;  2M0Y A;  3CME T;  4KUL A;  4DA4 A;  4BDZ A;  4PFP A;  4R56 A;  2VGM A;  3SWN B;  1YWP A;  4PJL A;  2EPD A;  1PKS A;  4M77 D;  1G3W A;  1OIY B;  3LLR A;  4BI3 A;  2XMF A;  5GJW B;  2YLC A;  2XDD A;  1UHC A;  1M1K U;  1AEY A;  4KUI A;  4CC4 B;  3PIO A;  1IGU A;  3RKW A;  4C0G A;  3UT1 A;  2W10 A;  4C0D B;  2QQA A;  1IHV A;  1WHH A;  2DBK A;  1AWJ A;  2K5I A;  3RGF B;  4QT7 A;  3CCQ Q;  3S3N A;  1UDL A;  2OAU A;  2F2X A;  2XDP A;  2OTJ T;  4EOJ B;  2JS2 A;  3I55 A;  2R5A A;  2JMC A;  1C9B A;  3GNF B;  1EFN A;  2J6F A;  4XK8 E;  2DK3 A;  1X27 A;  2YUO A;  5GAO m;  4CFM B;  3JCM W;  1Y96 B;  2GCX A;  1AOJ A;  1M1G A;  1JOW A;  3QHS A;  3M55 A;  3SHW A;  1UNH D;  5HK0 A;  2AZS A;  1AWX A;  5EC7 A;  1NEG A;  4IIO A;  2WJ9 A;  4BCH B;  3MKD A;  2V26 A;  2ZCF B;  3CXC A;  5GAN 5;  1RAE B;  3SD4 A;  2DD4 B;  1RAB B;  4J83 A;  2CUB A;  2IW6 B;  1PD0 A;  1UJ0 A;  4FYY B;  1FVV B;  2CGH A;  2LCC A;  4JJC A;  3L2U A;  2CUD A;  4HT9 A;  1D3B A;  3VS6 A;  1ARK A;  3JCM P;  2EYZ A;  2LX9 A;  2EJG A;  4F17 A;  1NG2 A;  1NPP A;  1K9A A;  1TXQ A;  1WJQ A;  4Y72 B;  1LCK A;  4C92 G;  1LVK A;  2JGZ B;  2HL3 A;  1UNG D;  1H8K A;  1OL1 B;  2KMT A;  3QBY A;  1PNJ A;  3NHN A;  2IVX A;  1OL2 B;  3OSV A;  1WGS A;  1KHC A;  4Z89 A;  1AWW A;  4EOL B;  3OW2 A;  1PWT A;  2HL5 C;  1OOT A;  5KE2 A;  1YNZ A;  4JX4 A;  2K6D A;  3FRN A;  3I55 Q;  2PVG B;  4BD3 A;  3I9Q A;  2C6T B;  4M77 C;  3H8Z A;  4F7U F;  1MND A;  2G9X B;  4MFD A;  2CP6 A;  1G3S A;  4JUV A;  4M75 B;  4Y28 E;  3JB9 D;  4HCB A;  2KNB B;  3PO3 S;  1TU0 B;  3C12 A;  3QHR B;  2BUD A;  3TSW A;  5GAO n;  2YSQ A;  3OYJ A;  1AZE A;  3V8L A;  1N8R C;  2LQ8 A;  1M30 A;  5GAM e;  1N27 A;  1ZLM A;  5KYW A;  3E2U A;  5J39 A;  2M9U A;  4KGZ B;  5GAO r;  2DL7 A;  4KRT A;  4II5 B;  1TUC A;  4AFS C;  2CP3 A;  4RTT A;  5CYI B;  3L42 A;  4M7A A;  1YCS B;  4E7J A;  3EGD A;  2HSP A;  2C5X B;  2QQS A;  5J26 A;  5KH6 A;  1ZUY A;  2LQN A;  4BBS M;  2HZY A;  2DXC B;  1OZ2 A;  3EG0 A;  1JQQ A;  1UGQ B;  5FLX E;  3CC4 Q;  2L3R A;  1VQM T;  4M7A E;  1ZBJ A;  2QAS A;  4FYV B;  1MV3 A;  2K9G A;  3GLX A;  1PCX A;  4QVD A;  3QYB A;  2X35 A;  2DD5 B;  1LJO A;  2ZPF B;  1HK9 A;  5CK9 A;  5I22 A;  1KC8 R;  5KYU A;  3I5R A;  2DE0 X;  3QPH A;  4Y91 A;  4E2F B;  2LT1 A;  3HHT B;  2EFI A;  2HMA A;  2L5Q A;  2HAX A;  3RES A;  1N9R A;  1I4K 1;  1QCF A;  1YP5 A;  5GMK e;  2PK9 B;  3KBG A;  1VQ7 A;  2FL7 A;  2HQH A;  2DLP A;  4E7Z A;  4OB1 B;  5DLO A;  4OMO A;  4XU1 A;  3A8O B;  2QQB A;  2GQV A;  5L23 A;  4PLI A;  2JTF A;  2RK1 A;  1V76 A;  4CI0 C;  2CRE A;  2PVD B;  4M7D E;  2EVR A;  1OZ3 A;  2V1R A;  1B34 B;  2X4J A;  1FIN B;  3TSZ A;  1T0J A;  4AT1 B;  4E7H A;  1Y71 A;  1P92 A;  4BAC A;  4UN0 A;  2YXY A;  4M7A B;  1K8A U;  2DVJ A;  1WA7 A;  3UA6 A;  3A8L B;  4FT4 A;  2KI7 A;  1YIJ T;  3TRE A;  4J7F A;  2QG9 B;  3QYH B;  4CRL B;  1X2Q A;  4JJD A;  2QEX Q;  2XI9 A;  2DYI A;  4A54 A;  4NS5 A;  3PGG A;  1O9K A;  1XJW B;  1IHW A;  4II1 A;  2QA4 Q;  4IIM A;  1OIU B;  1MUZ A;  4XU0 A;  4KGX B;  3FLG A;  2OTJ A;  1WXU A;  2CDT A;  1K73 R;  2C0I A;  3OYC A;  1Q82 C;  5GMK i;  4ZTF A;  1OI9 B;  1O9S A;  2YHT A;  3L1A A;  5D7U A;  2QGS A;  3G4S Q;  4AI6 A;  4C5H A;  2E70 A;  2OX7 A;  1D0Z A;  4J9B A;  3EHR A;  1BK2 A;  1RAH B;  2WHB B;  3MPU B;  2M16 A;  2ZPG B;  3A5Z B;  1W2B P;  1YFN A;  4ZTJ A;  3FEO A;  1BIB A;  4FCY A;  4ATO A;  1ZBX A;  4AKI A;  1VOM A;  4XTV A;  1QWF A;  2JNG A;  2DPP B;  1VIF A;  3NTK A;  4PNO A;  1BBZ A;  2E3H A;  1FXX A;  4X9D A;  1QP2 A;  4AFU C;  5LJ3 h;  1RAI B;  1HD3 A;  1BIA A;  3OYB A;  2W99 A;  1YIT A;  4JPB W;  2DKG A;  1UE9 A;  2DXB B;  1VUB A;  2X51 A;  4EOO B;  4BY1 X;  2EUF A;  1X69 A;  2IPO B;  2SRC A;  3KUF A;  5FU6 B;  3CCS Q;  4OGC A;  3S3M A;  2B86 A;  4AMC A;  2XDB A;  2D9T A;  3H0F A;  4L5G A;  3JCM f;  2EWN A;  1VQO Q;  4HVW A;  1VQN T;  4M7A C;  4KGV B;  2RJF A;  4RTY A;  4F7L B;  3VUB A;  2J06 A;  3PVL A;  1QVF A;  4OGE A;  3CCU T;  4XTW A;  3OW2 P;  2XD0 A;  2BKZ B;  4QQ6 A;  1JBM A;  2V22 B;  2DTH A;  3M59 A;  3CPW S;  3CD6 Q;  2UZD B;  1UGP B;  4EOQ B;  1TWB A;  3OYN A;  2DTO A;  1F5Q B;  1XO2 A;  2BE9 B;  4M7D C;  4JLG A;  2KRN A;  3DL1 A;  1H24 B;  1SPK A;  2K57 A;  1K73 C;  2CP0 A;  1WZO A;  3M53 A;  1I5L A;  5AT1 B;  1JRI A;  5CKE A;  1UUE A;  4Z02 A;  3OYE A;  1UG1 A;  4BB7 A;  1WHG A;  3CCS T;  2L3P A;  2W96 A;  1PRM C;  1R0C B;  3HL8 A;  3OMC A;  2QTX A;  1S72 A;  1M8M A;  4ZN3 A;  1O9K B;  3DB4 A;  5LJ5 d;  4PJO A;  1VQO T;  1D0X A;  5EFQ B;  4PFO A;  1ZA2 B;  1UGS B;  1VQN Q;  1N4M A;  2QDJ A;  2E6Z A;  3G6E A;  4HT8 A;  1BCO A;  1HXD A;  1VQ4 Q;  2P0P A;  3CCU Q;  1Z9Q A;  3X24 B;  1AZG B;  5LMK B;  3E9F A;  5GAN f;  1HJD A;  1GL5 A;  1JEG A;  4C8Q F;  1JO8 A;  2M51 A;  2G3R A;  8ATC B;  2LQK A;  2B9R A;  3WVD B;  4HVV A;  2QK0 A;  5HK3 A;  5GAO p;  3HKS A;  2VGN A;  4D8D A;  2RO0 A;  2GFU A;  2FPE A;  4HCK A;  1IZ6 A;  1JU5 C;  2JXB A;  4NC6 A;  3H9N A;  1NBE B;  4AKG A;  8AT1 B;  5EG2 A;  3OS2 A;  2DD5 A;  4NST B;  3CCV A;  3VKH A;  2QQ9 A;  2PUK B;  3EHQ A;  1JB0 E;  4HCC A;  4OR5 B;  4E47 A;  4KRC B;  2K3X A;  3TQ7 P;  2LC4 A;  2YLB A;  3CME Q;  3VV0 A;  1IGQ A;  2CCI B;  1TFB A;  3QYE A;  1M8V A;  3I35 A;  4J9D A;  1U3O A;  4I3Z B;  2HKN A;  4R55 A;  2H3J A;  1F1B B;  1VQ4 T;  4CFV B;  3VJP A;  2K2M A;  2L8D A;  2DIG A;  4YOO A;  2RJE A;  3X28 B;  4EMG A;  2PUO B;  1T0H A;  3MI9 B;  2HQE A;  4C5E A;  2ED1 A;  1YHQ Q;  3CC7 A;  2KRO A;  2SEM A;  3VS2 A;  1M1K C;  3JSC A;  2JOY A;  2KXD A;  2ZAE A;  4PJO F;  1VQL T;  3CCQ T;  1ZHI A;  2CSQ A;  3RBB B;  4F7U G;  1YJN T;  1KK7 A;  4LD9 K;  1BI1 A;  2CKK A;  3TNH B;  3G6E Q;  1K9M C;  3DKM A;  2PQW A;  3JCM V;  2JJ9 A;  4LN2 A;  5KYU B;  1U8R A;  4JZ4 A;  2AT1 B;  3POM A;  3NFC A;  3BFM A;  2C5N B;  2DMO A;  3PE0 A;  3OS5 A;  4KRD B;  3PFS A;  4F7U B;  5LJ5 j;  1QLY A;  1PRL C;  2MWP A;  1VQL A;  5CKB A;  3J7A F;  1MV0 B;  4EMK A;  4NL2 A;  1BB9 A;  2QI2 A;  5DM7 R;  1KXU A;  4BCM D;  5I2M A;  2O4X B;  5HBH B;  4EOS B;  3QZ9 B;  2VXF A;  4K11 A;  3LWH A;  1YHQ T;  2DA9 A;  4AG1 C;  3VS7 A;  3CPF A;  5FU7 B;  3V7R A;  2JMA A;  2JTM A;  5LJ3 f;  2WSE E;  3VS3 A;  4A53 A;  2DZ9 A;  5IH2 A;  1W2B A;  3VUZ A;  4F6S B;  4E7K A;  3JCM X;  4C0F A;  4M77 E;  2HDA A;  3G6E T;  1YJN A;  4M78 E;  3H41 A;  4BI4 A;  3V8K A;  3GF5 A;  4BUG A;  4G6L B;  1TD6 A;  3BG9 A;  1YJW T;  1OYX A;  4C92 B;  4J9G A;  2QQ8 A;  1AD6 A;  1WX6 A;  4PJN A;  5GAN d;  4A4F A;  1M3C A;  2E4H A;  1X6G A;  2D1X A;  2AZV A;  1H28 B;  3ER0 A;  3I55 T;  1K1Z A;  4CFU B;  4TTH A;  2NUT B;  4IUP A;  1FMW A;  2CCH B;  3ZEH A;  2BZ8 A;  4F7N B;  4D6W A;  2PK2 A;  2EGE A;  1CKA A;  1M90 R;  2AHJ B;  5CR2 A;  3EGU A;  1VQ6 Q;  2X9H A;  2JUF A;  3OYM A;  3DTO A;  4ELL A;  2FYK A;  4M75 F;  1UGR B;  1E9H B;  3ASK A;  3OA6 A;  4AFZ C;  4F6W B;  1SEM A;  2WSF E;  2W9F A;  3BDL A;  2J6K A;  2ROT A;  4RCC A;  4DQ2 A;  4ZGJ B;  5L8R E;  1D1B A;  3WVE B;  4IUQ A;  4BY6 C;  1TUG B;  4JLI A;  1Q81 U;  2M02 A;  1SRM A;  2IN3 A;  3UF4 A;  4M7D G;  3EG2 A;  1ZA1 B;  1NE8 A;  3HP9 A;  4ROC A;  3LH5 A;  3EH1 A;  3TCJ A;  1KSW A;  1S1N A;  1BI2 A;  2FEI A;  1Q86 R;  2E12 A;  3P8B B;  1UGV A;  3MEA A;  3QUI A;  2K3Y A;  4PFZ A;  5FGK B;  3JCM e;  5ACB A;  3QII A;  4J9H A;  4OML A;  3QWL A;  2DZC A;  3KFV A;  4MZM A;  1XNI A;  4OF1 A;  3SWN A;  2BS2 A;  1AHJ B;  2KQW A;  1N5Z A;  1VQ5 T;  4A63 B;  4M6V A;  5M9O A;  3CME A;  4GBQ A;  4OB2 B;  1SF9 A;  4BI8 B;  4YTL A;  4MIM A;  3M58 A;  3TW7 A;  1AD5 A;  3SEM A;  2LMJ A;  2O01 E;  4DOV A;  4C8Q A;  3JCM J;  4JRK A;  4HNV A;  5IN1 A;  4M7A F;  2BS3 A;  1Q95 G;  4ZN1 A;  2MK5 A;  1W2B S;  4JDS A;  4ELZ C;  3QSU A;  2C0T A;  2ZGW A;  2ZPE B;  4L59 A;  3S3O A;  2NUZ A;  1WPY A;  4M77 G;  2YWW A;  5LJ5 e;  1KIK A;  4RTV A;  1E6G A;  4QW2 A;  1K8A R;  1I81 A;  4M7D B;  1SSF A;  3REB B;  2KR6 A;  3A8G B;  2EKO A;  3GPL A;  4XTZ A;  3X25 B;  1X75 C;  2J05 A;  1UHF A;  3EG9 A;  1B7T A;  4HVU A;  5GAM h;  2A28 A;  1RL2 A;  3LX7 A;  4M75 G;  2FZG B;  2GGR A;  1WHL A;  3DDP B;  1VQ5 Q;  2RQV A;  1OX8 A;  3THK A;  2RB6 A;  1YIJ Q;  3V8J A;  4LUD A;  1QCO A;  1PKT A;  2I53 A;  5LL6 S;  2RJD A;  5LJ3 j;  3EG3 A;  2P4T A;  3HRU A;  4BE2 A;  3EGX B;  4EOR B;  3MO8 A;  1D3B B;  1IO6 A;  5GMK j;  3LYI A;  1H64 1;  2FZK B;  2MYS A;  3LGF A;  1VYV A;  2HBP A;  3PTA A;  3OYH A;  2LVM A;  4Z88 A;  5ICP B;  3ZL7 C;  1KQ1 A;  4M75 D;  1KD1 R;  2L89 A;  5FRM A;  3CCJ Q;  2HBW A;  3OBY A;  4M4Z A;  5GAO q;  1KQS A;  2HKQ B;  3QKJ A;  3G4S T;  3M03 A;  4C8Q G;  2F69 A;  5FU7 C;  5GAM f;  3VU3 C;  4C0Z A;  2KSS A;  1G3T A;  5GAN e;  2E10 A;  3JCM c;  3CCR T;  1Q81 R;  1OGU B;  3S6W A;  2QGG A;  3H6Z A;  1OI1 A;  1D3U B;  2LJ1 A;  4BCN B;  1SHG A;  2RN8 A;  4M7D D;  1VQ6 A;  2ED0 A;  3RMQ A;  1YN8 A;  5KCH A;  4F7S B;  5DQW A;  1BU1 A;  5D6W A;  3OYD A;  1XOV A;  2Y4Y A;  2C0O A;  2X3W D;  1WJR A;  4M77 B;  1JXM A;  3C94 A;  5IF1 B;  4HNU A;  3QHW B;  3A1P A;  1QLB A;  4BCG B;  1WLP B;  2EYY A;  5A2Q E;  2IW8 B;  3SDZ A;  2BZY A;  5GJV B;  2L0A A;  2CZ6 B;  2H3E B;  3G71 A;  2EBP A;  2MAM A;  3HSB A;  3CCJ T;  3CEY A;  3PMT A;  4IKF A;  1QCN A;  1I8F A;  2JM8 A;  2RQR A;  5KCO A;  2MMP A;  5LJ5 f;  4QSH A;  1G2B A;  2DAQ A;  2BE7 D;  5C0M A;  3EG1 A;  3CCR Q;  2DYB A;  4BCF B;  4E7S A;  4A4H A;  2IIM A;  4DBH A;  1NM7 A;  5LJ5 g;  1ZSZ A;  2I40 B;  3CCE Q;  1I0C A;  3ZFJ A;  2KGT A;  4DOW A;  1D09 B;  3MY5 B;  4PJO B;  3VKG A;  3HRS A;  2NUP A;  3EAE A;  2EGA A;  2GQI A;  1R0B G;  5HKC A;  5HVY B;  3QXE B;  2KY9 A;  2JZ2 A;  2AIR B;  3CD6 T;  4M7D A;  1LNX A;  1QW1 A;  1QMZ B;  2D0Q B;  4E7I A;  3M0R A;  1TS9 A;  4XU3 A;  1VQ9 Q;  1H1Q B;  2VYT A;  1SSH A;  3MHX A;  5FU6 C;  2CZ1 B;  4JJN K;  1URC B;  3GBQ A;  4M75 C;  1N8R R;  3SB2 A;  1J3T A;  3M0Q A;  3B57 A;  2KR3 A;  2F2C A;  4JZ3 A;  2DME A;  4PJM A;  4EDU A;  1FWZ A;  1VQK Q;  5C6S A;  4DBR A;  2WSC E;  4RKU E;  2WPA B;  3GP8 A;  2RHU A;  1B3Q A;  4XTX A;  1KQS S;  3CCE T;  4DEY A;  3CQT A;  5GMK m;  3M0S A;  1VQM A;  1WQ7 A;  3FB9 A;  5LJ3 e;  2QFZ A;  4O6J A;  4CXA B;  5KYN A;  3LWI A;  2HNI A;  2RHI A;  2ECZ A;  4IUV A;  4F7U A;  2CT3 A;  2A7Y A;  1YI2 A;  3QYG B;  4XTY A;  3JB9 J;  1ABO A;  1NEB A;  2PHG A;  4D8K A;  1DJ7 B;  1VQ9 T;  4FU6 A;  2EQU A;  2KEA A;  3CBP A;  1G3N C;  1UB4 A;  1BI0 A;  2GFA A;  2QF7 A;  3DJB A;  2RQT A;  3MEW A;  3VKI A;  3BHU B;  1LOJ A;  1Q81 C;  5DQV A;  1X01 A;  3P8D A;  4OMM A;  2AK5 A;  1QVP A;  3RMS A;  5KE3 A;  1ZX6 A;  2KT8 A;  2M0O A;  3MY1 B;  2FPF A;  3G1J A;  4L6V 5;  2ZZD B;  3O5Z A;  3GOX A;  4DEX A;  3G33 B;  2DEQ A;  1VQO A;  3OS1 A;  3BDU A;  2M1H A;  3G71 Q;  2WMA B;  4Z6Y A;  4M78 F;  1O75 A;  3CC4 A;  2EQI A;  2LZ6 B;  2XHC A;  2RHZ A;  2QAZ A;  2RQU A;  3MJX A;  5A0G A;  3V7C A;  4CC2 A;  3JB9 I;  1EZZ B;  5IHK A;  3TN8 B;  4XQ3 A;  1VYW B;  4PL6 A;  1TUD A;  3EOC B;  2A3L A;  1SKU B;  2O31 A;  3I56 Q;  1H27 B;  3NTH A;  1D1A A;  2ZZD A;  2DJZ A;  2RK2 A;  1VQL Q;  4WCI A;  2JT4 A;  3EJ1 B;  5IHY A;  3K7A M;  1RUW A;  1MGQ A;  1YJN Q;  5LJ3 d;  2CP7 A;  3CCM A;  3ZBD A;  3BE3 A;  5KYY A;  2E64 A;  5KYW B;  1PHT A;  4J6Y A;  3HPW A;  1RAD B;  4N4G A;  1H3H A;  2EGC A;  1GBR A;  1WHM A;  2RHY A;  3Q1J A;  1U06 A;  5GAN 3;  2MCN A;  1ZUK A;  4FW1 A;  1M4Z A;  3CCL T;  2XU8 A;  2X4Y A;  2DVE A;  3CC7 T;  2PU9 B;  2K4Y A;  2KK4 A;  3UDC A;  1XTD A;  1IRE B;  2EYX A;  4IMY B;  1MMD A;  3CCR A;  3NDQ A;  1M2V B;  1RAG B;  1JJ2 P;  3G71 T;  2MI6 A;  4FM4 B;  3HFO A;  4FIB A;  5KYY B;  2DXC A;  2EYQ A;  3G7Z A;  3INZ A;  1CSK A;  4PJO E;  1I5O B;  3PIP A;  1YCY A;  2JVV A;  2Z0W A;  3PT9 A;  1MMN A;  2BTT A;  1M90 U;  3NGP A;  2CH4 W;  5FWC A;  2LT4 A;  5GAO l;  3QO3 A;  2W2H A;  4QVC A;  1Q86 U;  4P5N A;  3OBW A;  1PKD B;  2J7I A;  4FX3 B;  3C4S A;  3ULR B;  3FDR A;  1OV3 A;  1X43 A;  2CT4 A;  3UAT A;  4M7A G;  3L2V A;  1D0Y A;  1R8O B;  4PJO G;  3M56 A;  4LD6 A;  1NYG A;  2EYW A;  2RMO A;  3RDV A;  1VQN A;  2V8K A;  3BLH B;  1Y0M A;  1YJW Q;  3UA7 A;  3CCL Q;  2AKK A;  3M0T A;  2DXB A;  4BBR M;  2GTO A;  3CC2 Q;  3CC7 Q;  1M1F A;  3VYG B;  3HZJ A;  1ZP2 A;  1IB8 A;  1GUX A;  1GBQ A;  4KH1 B;  1Q86 C;  2COW A;  3KHI A;  1YJ9 T;  4KH0 B;  3JCM h;  2JS0 A;  3VS4 A;  2K2V A;  2OJ2 A;  1K0X A;  2UUE B;  3ME9 A;  3KXT A;  2MOX A;  1H1S B;  3QG1 A;  1TOV A;  4X1V A;  1I07 A;  3MEV A;  2A0F B;  1VQ6 T;  2DRK A;  1W98 B;  3LW5 E;  3M0U A;  1H92 A;  4RTW A;  1M90 C;  4YC3 B;  4Z8A A;  3RER A;  1M2V A;  1EIF A;  2R5M A;  4WTO B;  3X20 B;  2D0N A;  1JXO A;  2RPN A;  2XK0 A;  2RHX A;  1E7O A;  3BLQ B;  4PK4 A;  2NWM A;  2FG0 A;  3O8V A;  1YIJ A;  9ATC B;  1OU8 A;  1WYX A;  2JN0 A;  1WXB A;  1BKB A;  3M9Q A;  4M77 A;  3HB9 A;  4DBF A;  1OEB A;  4V2S A;  4FSS A;  1T3S A;  1GCQ C;  2DNU A;  3QZ5 B;  1RAA B;  2YUP A;  4XTU A;  4PJO C;  4M78 G;  2X4W A;  3WXM B;  5ECA A;  3QDF A;  4B6M A;  1K0S A;  4LDY A;  2P84 A;  2X4X A;  2RI2 A;  2XID A;  2WFY B;  2CYZ B;  2OAW A;  4ELJ A;  1GY3 B;  3AT1 B;  3CMA T;  4GLM A;  5IDN B;  5GAN 8;  2QYZ A;  2DD4 A;  1VIN A;  1YWO A;  4F16 A;  2RJC A;  1U5S A;  4HL4 A;  2EW3 A;  2GNC A;  4LNP A;  4FW2 A;  2FRY A;  2KBT A;  2KYM A;  3EFO B;  1JST B;  4GY5 A;  1K76 A;  2OI3 A;  2AKL A;  2HSE B;  2QDL A;  4LDW A;  4EMK C;  1HSQ A;  2BPM B;  1UNL D;  2YT6 A;  1Y57 A;  2VVK A;  5D6X A;  1H1P B;  2EJF A;  2LNH B;  3C95 A;  1K8A C;  2NUP B;  1M5Q 1;  2KXC A;  4J9C A;  5GAN j;  4MDW A;  5IAY A;  3DDQ B;  5FW9 A;  1LPL A;  1Y96 A;  2F5T X;  2CJM B;  2DXU A;  2E65 A;  1JKW A;  4OMP A;  1M2O A;  4J6W A;  3U23 A;  4X34 A;  2KAF A;  1M3A A;  5GAM d;  2CSI A;  1V1C A;  2PVO B;  1T3L A;  2KVQ G;  2E1H A;  4JJB A;  2V8I A;  3CCM Q;  3CMA Q;  1BI3 A;  4EIK A;  1KQS P;  4RMO A;  4ANJ A;  3JB9 F;  1MMG A;  1GXI E;  2ROL A;  2XG8 D;  2CH4 A;  3I56 A;  2HD0 A;  2PJQ A;  2DM1 A;  5CIU A;  4M77 F;  1OU9 A;  2PZ1 A;  1QVG S;  3VS5 A;  3X26 B;  2YDL A;  1KD1 U;  4J9F A;  2VV5 A;  3RIR A;  4RG8 A;  1ZQ1 A;  4QVZ A;  4QQD A;  2I2L A;  4B9W A;  4M7D F;  3H4C A;  4LDV A;  1VYT A;  1GH6 B;  5HY6 A;  3E1S A;  1MNE A;  3E19 A;  4BCJ B;  2ABL A;  2A08 A;  1ACM B;  2BIV A;  5HCK A;  4C92 F;  2G6F X;  5GAN 7;  3E9G A;  3RNJ A;  1NJI R;  2VUB A;  3JV3 A;  2GF7 A;  3CCL A;  1U1T A;  1W1F A;  3M5A A;  4LUE A;  4C5I A;  1G83 A;  1C0M A;  2PMI B;  1NYF A;  3L2R A;  3CPW A;  4LDX A;  1GCQ A;  2QGF B;  4IUU A;  2DL4 A;  3IQL A;  2MIO A;  1G3Y A;  3L2Z A;  2KRM A;  3AHU A;  2H8H A;  1UEC A;  2ATC B;  4JS4 A;  3VYG A;  2DIL A;  3L2Q A;  2NLU A;  2VKN A;  1YI2 Q;  4EMK B;  3RUX A;  5HNB B;  4QQG A;  1N8R U;  1W4S A;  2E41 A;  3H0I A;  1VQP A;  7AT1 B;  1NLP C;  3FJP A;  3OYG A;  3RKY A;  2RI5 A;  3CCQ A;  5DY9 A;  3JCM b;  4LXC A;  2RF0 A;  1Y07 A;  3JB9 G;  4JRQ A;  2LQW A;  1TTH B;  4N4I A;  4MZP A;  2DIQ A;  3M54 A;  1VQ4 A;  3EGD B;  2RNA A;  3TEE A;  5GAN h;  4NL3 A;  5LJ5 h;  3LGL A;  1VQK A;  2A37 A;  5GAN 6;  4M78 B;  4ZNX A;  1VA7 A;  5I11 A;  4RCB A;  2A36 A;  3MEU A;  1NLO C;  1MHN A;  4C92 D;  3JCM g;  2X3X D;  3TNW B;  2MWO A;  3MP8 A;  2IW9 B;  4FYX B;  4EOK B;  1KC8 U;  3NMZ C;  1BCM A;  3D7S B;  4ROD A;  1ABQ A;  2HCK A;  1VIE A;  1QQJ A;  5KYX B;  2WEV B;  1OKW B;  2NUT A;  2RA2 A;  1Z9Z A;  4NOY A;  2CP2 A;  1H25 B;  2DXT A;  3CCV T;  1YI2 T;  3EG9 B;  3O0G D;  2JTE A;  4M78 A;  3EH2 A;  4F6U B;  2UZB B;  2F2V A;  1KC8 C;  3SFM A;  4HA8 A;  6AT1 B;  5GAM g;  1C6V X;  1QVG A;  2WIH B;  2QDY B;  5A0L A;  1WFW A;  4ESR A;  4J5Y A;  3MIA B;  2LCS A;  2O88 A;  1FMV A;  2RH2 A;  4KT0 E;  1YIT Q;  2FPD A;  2I0N A;  3NPF A;  3VYH B;  1R77 A;  1KQ2 A;  4EOM B;  3A8M B;  1W6X A;  5IXF A;  5IHN A;  1VQK T;  3GIB A;  4PJO D;  1PC0 A;  2BKD N;  4YOZ A;  2BS4 A;  3RKX A;  1RAF B;  1B34 A;  1CKB A;  2CS7 A;  2RD1 A;  1JSU B;  3M4G A;  4A4G A;  4CC7 A;  5BNJ B;  4M75 A;  1IXD A;  5CKD A;  2QTV A;  4EOP B;  3MCA B;  1MMA A;  3PNW C;  5FRN A;  3CCV Q;  2J6O A;  1ENW A;  4VUB A;  4BCP B;  1I1J A;  1H26 B;  2DRM A;  3OYK A;  3F70 A;  1H3Z A;  4EON B;  4AG2 C;  1WHJ A;  4FT2 A;  3CD6 A;  1M9S A;  4N4H A;  4BCI B;  1FYN A;  2DL5 A;  2DET A;  2OTJ Q;  1PD1 A;  2DX1 A;  1YIT T;  1JJ2 S;  2F5K A;  3OW2 S;  4BDY A;  5CVI A;  1P5E B;  4BCM B;  5AYF A;  1XQH A;  1ZSZ C;  2WMB B;  4AFQ C;  1KFZ A;  1HYO A;  3DB3 A;  5I5Z B;  4N0A C;  1GFC A;  1FKM A;  3CCJ A;  4J9I A;  5GAN 4;  1Q82 R;  5IXB A;  4N0A A;  4FL6 A;  3J80 E;  2K3B A;  4J9E A;  4C8Q D;  4J6X A;  2O9S A;  1AVZ C;  3TNI B;  4IUR A;  5GMK l;  4C92 C;  4IUT A;  1RI9 A;  4BCQ D;  5FRO A;  3JAM E;  1WDX A;  1WNL A;  1OPL A;  4UC4 A;  1N9S A;  2O4X A;  3PMI A;  2JM9 A;  1JJ2 A;  5EJC A;  2B8A A;  1K73 U;  4F7J B;  4YOS A;  5GAN g;  3DLL A;  3I56 T;  1G8X A;  2D8H A;  2IVW A;  2DTI A;  1Q7Y R;  3URG A;  4QKU A;  2F2W A;  2IG0 A;  3OYI A;  2COZ A;  3OMG A;  5KYX A;  4B9X A;  5I2S A;  2L3S A;  4OMN A;  3GTM S;  5GAM j;  4AKH A;  1VQ7 T;  3M4Y A;  1RLP C;  2RQW A;  1G5V A;  4M7A D;  3LH0 A;  1WQW A;  4CC3 A;  2DF6 A;  2FB7 A;  1YJW A;  1WI7 A;  3G4S A;  1M27 C;  2ESW A;  4FSX A;  3LQ5 B;  4CFW B;  3CXC P;  3TW6 A;  3I5S A;  1RI0 A;  2QEX A;  4ME7 A;  2R58 A;  2L2P A;  1UEB A;  3JB9 H;  3BLR B;  4EC8 B;  3RR6 A;  1M1K R;  1OPK A;  4BXX X;  2ZPH B;  1YHQ A;  3CCU A;  1TSF A;  4EMH A;  1GFD A;  2FO0 A;  4M78 C;  2EIF A;  2VC8 A;  3CXC S;  1ZUU A;  4C8Q E;  1NJI U;  5A0D A;  3HBL A;  1OQK A;  3CMA A;  4XAX B;  2EJ9 A;  2LJ0 A;  3A98 A;  3EGX A;  2EQK A;  4CFU D;  2GBQ A;  3EFO A;  3HTR A;  3OSS C;  1VQ7 Q;  2FRW A;  4X9C A;  2LP5 A;  2P0K A;  1VQ8 A;  5D6Y A;  3CC2 T;  3CCE A;  1QKW A;  1VQ8 Q;  1QP3 A;  1WHK A;  2C4G B;  3L2W A;  1X6O A;  1YJ9 A;  2Y90 A;  4EOI B;  1KJW A;  2LTO A;  2YUN A;  4RTX A;  4MDX A;  3OQ5 A;  5IHI A;  1YJ9 Q;  3CBM A;  1QKX A;  3REA B;  1AT1 B;  2KMG A;  2E6N A;  4ELY C;  4GLK A;  4BCK B;  1FMK A;  4KBM B;  1B07 A;  2PNI A;  1A0N B;  3EID B;  4C8Q C;  3CC4 T;  1VQM Q;  1Q82 U;  1GRI A;  1H4L D;  4CFX B;  1OX9 A;  2LW4 A;  3OYL A;  1NJI C;  2CZ0 B;  2FZC B;  2QA4 A;  1VQ5 A;  2MF2 A;  1E7P A;  2E5Q A;  4MZT A;  3NTI A;  1WXT A;  1PM3 A; 
#chains in the Genus database with same CATH homology
 5LJ3 g;  3QII A;  4V2S A;  3GLX A;  4QVD A;  3QYB A;  2X35 A;  3QZ5 B;  3QWL A;  2DD5 B;  1LJO A;  2DZC A;  4LDU A;  4A4E A;  2ZPF B;  4XTU A;  4PJO C;  1HK9 A;  4M78 G;  5CK9 A;  4MZM A;  2VXE A;  2X4W A;  4PLL A;  1XNI A;  3WXM B;  4OF1 A;  3SWN A;  3JCM Q;  1KD1 C;  2BS2 A;  1AHJ B;  4LDY A;  4Y91 A;  3QPH A;  4JRP A;  2KQW A;  2X4X A;  2RI2 A;  1VQ8 T;  2XID A;  2LT1 A;  2CYZ B;  3HHT B;  4ELJ A;  4Q5W A;  2OTL A;  2D6F A;  1VQ5 T;  2EFI A;  4M6V A;  3HO8 A;  1WJS A;  4C5G A;  5M9O A;  1VQ9 A;  3CMA T;  4ZGE B;  5GAN 8;  3CME A;  1NPR A;  2L5Q A;  2DD4 A;  3OB9 A;  4OB2 B;  2RJC A;  4HL4 A;  2HAX A;  3RES A;  1N9R A;  1I4K 1;  4BI8 B;  4YTL A;  5GMK e;  4MIM A;  3M58 A;  3TW7 A;  2RI3 A;  3KBG A;  5GAN j;  2RM4 A;  2O01 E;  1VQ7 A;  4DOV A;  2FL7 A;  4C8Q A;  3JCM J;  4JRK A;  4HNV A;  5IN1 A;  4GY5 A;  4M7A F;  2BS3 A;  4OB1 B;  4ZN1 A;  5DLO A;  3OYA A;  4J7I A;  4LDW A;  4XU1 A;  4EMK C;  1W2B S;  4JDS A;  3A8O B;  2QQB A;  3M57 A;  4ELZ C;  3QSU A;  2GQV A;  5D6X A;  4PLI A;  2JTF A;  2RK1 A;  2ZGW A;  2ZPE B;  2EJF A;  4L59 A;  2PVD B;  4CI0 C;  3S3O A;  1WPY A;  4M77 G;  4M7D E;  1OZ3 A;  1B34 B;  3C95 A;  1K8A C;  4HLQ A;  2X4J A;  5LJ5 e;  4WF2 A;  2HQX A;  1M5Q 1;  4QW2 A;  4EPC A;  1I81 A;  2LRQ A;  3MP6 A;  4M7D B;  5DLQ E;  1SSF A;  4MDW A;  5IAY A;  1Y71 A;  1P92 A;  2QEX T;  4BAC A;  2KR6 A;  3A8G B;  2EKO A;  4E7H A;  1Y96 A;  4M7A B;  2F5T X;  3GPL A;  2DXU A;  2E65 A;  3OS0 A;  1K8A U;  4XTZ A;  3X25 B;  3A8L B;  1X75 C;  4FT4 A;  4J6W A;  1VQ6 A;  3CBO A;  2QA4 T;  3TRE A;  1YIJ T;  4M7A E;  1PSE A;  4X34 A;  4J7F A;  2KAF A;  5GAM d;  5GAM h;  3QYH B;  4HCZ A;  3QJY A;  1RL2 A;  2PVO B;  3LX7 A;  2XI9 A;  4MMK A;  4C92 A;  2DO3 A;  4M75 G;  4A54 A;  4CRI A;  2KVQ G;  2XIC A;  2E1H A;  2R57 A;  4NS5 A;  3N5B B;  2V8I A;  3PGG A;  4II1 A;  1KHI A;  1BI3 A;  2RB6 A;  1VQP T;  2EQM A;  3V8J A;  4LOC A;  2LNV A;  4RMO A;  4XU0 A;  5LL6 S;  2RJD A;  5LJ3 j;  1Q7Y U;  2P4T A;  3JB9 F;  3FLG A;  2OTJ A;  1GXI E;  2XG8 D;  5GMK h;  3HRU A;  4BE2 A;  3OYC A;  1Q82 C;  5IT9 E;  2XKO C;  3I56 A;  2HD0 A;  4KUD K;  4JX6 A;  3CCM T;  3MO8 A;  3QDR B;  5GMK i;  3QJ6 A;  4M77 F;  1D3B B;  1PSF A;  5CIU A;  1QVG S;  5GMK j;  3LYI A;  1H64 1;  4ZTF A;  1O9S A;  3LGF A;  2G77 A;  2HBP A;  3X26 B;  2YHT A;  3L1A A;  3OYH A;  3PTA A;  1KD1 U;  2VV5 A;  2CZ7 B;  4AI6 A;  2E70 A;  2LVM A;  3DLM A;  3RIR A;  4RG8 A;  4C5H A;  1KQ1 A;  1ZQ1 A;  4JX5 A;  4M75 D;  4QVZ A;  4QQD A;  2I2L A;  2L89 A;  5CKH A;  3OYY A;  5FRM A;  3OBY A;  4B9W A;  4M7D F;  5GAO q;  3H4C A;  2M16 A;  3BW1 A;  1KQS A;  2ZPG B;  3A5Z B;  3QKJ A;  4LDV A;  2YRV A;  4ZTJ A;  3FEO A;  3G4S T;  1BIB A;  2QQR A;  4C0D C;  4C8Q G;  2F69 A;  5FU7 C;  5GAM f;  4ATO A;  3MET A;  5HY6 A;  1ZBX A;  4AKI A;  3E1S A;  3VU3 C;  4C0Z A;  3E19 A;  2KSS A;  2C06 A;  3UPU A;  4XTV A;  1G3T A;  5GAN e;  2E10 A;  2JNG A;  5CQY A;  5CKF A;  3JCM c;  3CCR T;  2BIV A;  3P8H A;  2DPP B;  2ZPB B;  1VIF A;  3UWN A;  3E9G A;  3S6W A;  4C8Q B;  2VUB A;  4C92 F;  3NTK A;  5GAN 7;  2P0Q A;  4HKE A;  4PNO A;  3H6Z A;  1OI1 A;  3BY7 A;  4JRI A;  3EFR A;  2GF7 A;  3CCL A;  1U1T A;  3SWN C;  1FXX A;  3M5A A;  4X9D A;  2QXF A;  4C92 E;  1QP2 A;  3T9N A;  4M7D D;  3A8H B;  5LJ3 h;  1N6A A;  4A4K A;  4C5I A;  3FIF A;  5J3B A;  4ZGD B;  2FHD A;  3L2R A;  3CPW A;  4PKC C;  4LDX A;  3RMQ A;  5KCH A;  3OY9 A;  4E7L A;  4OB3 B;  1BIA A;  3R6O A;  4IUU A;  3OYB A;  1G3Y A;  5D6W A;  1YIT A;  4OB0 B;  4OP0 A;  3L2Z A;  1KG1 A;  3HRT A;  3OYD A;  2DKG A;  1XOV A;  2Y4Y A;  3AHU A;  2DXB B;  1VUB A;  1WJR A;  4M77 B;  2K5L A;  4JS4 A;  3C94 A;  3VYG A;  4HNU A;  3L2Q A;  2NLU A;  1QLB A;  4EMK B;  3RUX A;  4OMF B;  2KDS A;  4QQG A;  1N8R U;  1W4S A;  3KUF A;  5FU6 B;  4XU2 A;  2E41 A;  5A2Q E;  3SDZ A;  4OGC A;  4BY6 B;  3S3M A;  1VQP A;  2CZ6 B;  3FJP A;  3G71 A;  3HSB A;  2MAM A;  4M75 E;  2XDB A;  3OYG A;  3RKY A;  2RI5 A;  2D9T A;  4L5G A;  3CCJ T;  3JCM f;  2EWN A;  3CEY A;  5DY9 A;  3JCM b;  3CCQ A;  3PMT A;  4IKF A;  1VQN T;  1Y07 A;  4M7A C;  3JB9 G;  1I8F A;  2RJF A;  4J8O A;  5KCO A;  4JRQ A;  2MMP A;  1TH7 A;  3BG5 A;  4N4I A;  5LJ5 f;  4QSH A;  2FVU A;  2DAQ A;  4MZP A;  2EQJ A;  3VUB A;  2DIQ A;  5C0M A;  2V8J A;  3M54 A;  4F7U E;  1VQ4 A;  1QVF A;  4OGE A;  3TEE A;  4NL3 A;  5GAN h;  3CCU T;  4XTW A;  5LJ5 h;  4A4H A;  3LGL A;  1Q7Y C;  2XD0 A;  1VQK A;  4QQ6 A;  1JBM A;  3M59 A;  1NZ9 A;  2DTH A;  5GAN 6;  3CPW S;  4JS5 A;  3EFS A;  4M78 B;  5LJ5 g;  2LDM A;  1UGP B;  1FX7 A;  4RCB A;  3ZFJ A;  3MEU A;  3OYN A;  4DOW A;  1MHN A;  4C92 D;  2DTO A;  4TVR A;  4PJO B;  3JCM g;  1K9M U;  2MWO A;  3VKG A;  3MP8 A;  3HRS A;  1KC8 U;  4RG2 A;  3EAE A;  4M7D C;  5HKC A;  4JLG A;  3QXE B;  3DL1 A;  1VIE A;  2JZ2 A;  2KY9 A;  3J81 E;  3FC3 A;  3CD6 T;  4M7D A;  1U1S A;  2K57 A;  4MML A;  5CQX A;  1LNX A;  2RA2 A;  3M53 A;  1K73 C;  1I5L A;  1QW1 A;  1JRI A;  4NOY A;  2D0Q B;  5CKE A;  2DXT A;  4E7I A;  4O5V A;  4Z02 A;  3CCV T;  4BE1 A;  1YI2 T;  3OYE A;  4XU3 A;  4BB7 A;  5I21 A;  2Y4X A;  4M78 A;  3JCM d;  3CCS T;  3HFN A;  1BYM A;  2EAY A;  2K5F A;  1S72 A;  2VYT A;  3HL8 A;  3OMC A;  2QTX A;  2OTL T;  3MHX A;  4ZN3 A;  5FU6 C;  3DB4 A;  3SFM A;  5LJ5 d;  1KC8 C;  1VQO T;  4HA8 A;  4PJO A;  2CZ1 B;  3OYF A;  4JJN K;  4M75 C;  5GAM g;  3SB2 A;  1UGS B;  4HNT A;  3GNG A;  4OVA A;  1QVG A;  4BE0 A;  2QDY B;  5A0L A;  4J5Y A;  2QDJ A;  1FWZ A;  2E6Z A;  3JRZ A;  4EDU A;  1YBY A;  5C6S A;  3G6E A;  2RH2 A;  4HT8 A;  4KT0 E;  1HXD A;  2P0P A;  3VYH B;  1QVF S;  2WSC E;  4M78 D;  4RKU E;  3X24 B;  5CCA A;  3CC2 A;  2LCL A;  3GP8 A;  1KQ2 A;  3E9F A;  5GAN f;  2RHU A;  4XTX A;  3A8M B;  1KQS S;  3V7S A;  3CCE T;  1VQK T;  4C8Q F;  3GIB A;  4PJO D;  1V29 B;  5CAI A;  2G3R A;  2BKD N;  5GMK m;  1VQM A;  2BS4 A;  1WQ7 A;  3FB9 A;  3RKX A;  5CO7 A;  5LJ3 e;  2LQK A;  2WAC A;  2QFZ A;  4O6J A;  3BG3 A;  1B34 A;  1S72 T;  2CS7 A;  3LWI A;  2HNI A;  5GAN 2;  2RHI A;  3WVD B;  3MP1 A;  2RD1 A;  3M4G A;  4A4G A;  4MFE A;  5HK3 A;  3CCS A;  5GAO p;  4IUV A;  3HKS A;  2VGN A;  2ZPI B;  4F7U A;  4M75 A;  5CKD A;  2A7Y A;  2RO0 A;  2GFU A;  1YI2 A;  3QYG B;  4XTY A;  1IZ6 A;  3MCA B;  3PNW C;  3JB9 J;  5FRN A;  4NC6 A;  3TU4 K;  4AKG A;  1Y7X A;  5EG2 A;  3OS2 A;  3CME T;  2DD5 A;  1DJ7 B;  1VQ9 T;  4KUL A;  4DA4 A;  4VUB A;  3CCV A;  4FU6 A;  4BDZ A;  3VKH A;  4R56 A;  2QQ9 A;  2VGM A;  2PUK B;  2EQU A;  3CBP A;  3F70 A;  3SWN B;  3OYK A;  1JB0 E;  4HCC A;  1H3Z A;  1UB4 A;  1BI0 A;  2GFA A;  2QF7 A;  4FT2 A;  4E47 A;  2K3X A;  4M77 D;  1G3W A;  2LC4 A;  3MEW A;  3VKI A;  3LLR A;  3CD6 A;  1M9S A;  1LOJ A;  2YLB A;  4N4H A;  4BI3 A;  2XDD A;  2YLC A;  3VV0 A;  1Q81 C;  3QYE A;  1M1K U;  1M8V A;  4KUI A;  3PIO A;  3RKW A;  1X01 A;  3P8D A;  4C0G A;  1QVP A;  3UT1 A;  4C0D B;  3RMS A;  2QQA A;  5KE3 A;  4R55 A;  1YIT T;  2H3J A;  1VQ4 T;  1JJ2 S;  2M0O A;  2F5K A;  3VJP A;  3OW2 S;  4BDY A;  5CVI A;  2L8D A;  5AYF A;  2K5I A;  4L6V 5;  2ZZD B;  2DIG A;  2RJE A;  1XQH A;  3X28 B;  4EMG A;  3GOX A;  2PUO B;  3DB3 A;  4N0A C;  2DEQ A;  1VQO A;  3S3N A;  2OAU A;  1FKM A;  3OS1 A;  3BDU A;  2XDP A;  2M1H A;  2OTJ T;  2HQE A;  3CCJ A;  4Z6Y A;  4M78 F;  5GAN 4;  1O75 A;  4C5E A;  3CC4 A;  3I55 A;  3CC7 A;  4N0A A;  2R5A A;  2RHZ A;  2XHC A;  5A0G A;  3GNF B;  4FL6 A;  1M1K C;  3JSC A;  2JOY A;  4XK8 E;  3V7C A;  3J80 E;  4PJO F;  4C8Q D;  1VQL T;  3CCQ T;  2DK3 A;  3JB9 I;  1ZHI A;  4J6X A;  5GAO m;  4XQ3 A;  4F7U G;  3JCM W;  1YJN T;  4PL6 A;  4LD9 K;  1Y96 B;  1BI1 A;  2CKK A;  2A3L A;  2GCX A;  1M1G A;  3QHS A;  4IUR A;  3NTH A;  5GMK l;  4C92 C;  1K9M C;  2ZZD A;  3M55 A;  4IUT A;  2DJZ A;  3DKM A;  5FRO A;  2RK2 A;  3JAM E;  1WNL A;  4UC4 A;  5HK0 A;  2PQW A;  1N9S A;  2O4X A;  3PMI A;  3JCM V;  1U8R A;  1JJ2 A;  5EJC A;  2B8A A;  2WJ9 A;  1MGQ A;  1K73 U;  5GAN g;  5LJ3 d;  3DLL A;  3CCM A;  3ZBD A;  3I56 T;  2E64 A;  3NFC A;  3BFM A;  4J6Y A;  3HPW A;  2IVW A;  2ZCF B;  4N4G A;  2DTI A;  3CXC A;  5GAN 5;  3URG A;  3SD4 A;  3Q1J A;  2DD4 B;  2RHY A;  5GAN 3;  4J83 A;  2IG0 A;  3OS5 A;  3OYI A;  3OMG A;  4F7U B;  3PFS A;  2CGH A;  5LJ5 j;  3CCL T;  1M4Z A;  4B9X A;  5I2S A;  2XU8 A;  2X4Y A;  2LCC A;  2DVE A;  3CC7 T;  2PU9 B;  2MWP A;  3L2U A;  1VQL A;  2K4Y A;  2KK4 A;  5GAM j;  4HT9 A;  1D3B A;  3UDC A;  1XTD A;  5CKB A;  3JCM P;  1IRE B;  4AKH A;  3J7A F;  4EMK A;  4NL2 A;  1VQ7 T;  2QI2 A;  5DM7 R;  3M4Y A;  3CCR A;  5I2M A;  2EJG A;  2LX9 A;  2O4X B;  1NPP A;  1WJQ A;  1G5V A;  3QZ9 B;  3G71 T;  2MI6 A;  3LH0 A;  4M7A D;  1WQW A;  2VXF A;  4FM4 B;  3HFO A;  4C92 G;  2FB7 A;  4FIB A;  3LWH A;  1YHQ T;  3G4S A;  2DXC A;  1YJW A;  2EYQ A;  3CPF A;  5FU7 B;  4FSX A;  3V7R A;  3G7Z A;  3TW6 A;  3INZ A;  2JTM A;  5LJ3 f;  2WSE E;  4A53 A;  1W2B A;  2DZ9 A;  1RI0 A;  2KMT A;  2QEX A;  4PJO E;  3PIP A;  3QBY A;  4ME7 A;  1YCY A;  2JVV A;  3VUZ A;  4E7K A;  3JCM X;  2R58 A;  3PT9 A;  4C0F A;  1UEB A;  3OSV A;  4M77 E;  1WGS A;  1KHC A;  1M90 U;  3G6E T;  3JB9 H;  1YJN A;  4M78 E;  2LT4 A;  5GAO l;  3OW2 A;  4BI4 A;  3QO3 A;  3V8K A;  3GF5 A;  4BUG A;  4QVC A;  5KE2 A;  1Q86 U;  4JX4 A;  3OBW A;  4P5N A;  3BG9 A;  3C4S A;  2ZPH B;  3FRN A;  1YJW T;  1OYX A;  3FDR A;  3CCU A;  1YHQ A;  4EMH A;  4C92 B;  4M7A G;  2QQ8 A;  2PVG B;  3L2V A;  1R8O B;  4M78 C;  4PJO G;  4BD3 A;  2EIF A;  5GAN d;  2VC8 A;  3M56 A;  4M77 C;  4LD6 A;  3H8Z A;  4A4F A;  3CXC S;  4F7U F;  1VQN A;  4C8Q E;  2V8K A;  1NJI U;  4MFD A;  3ER0 A;  5A0D A;  3I55 T;  1G3S A;  4JUV A;  4M75 B;  3HBL A;  2DXB A;  3CMA A;  4IUP A;  4BBR M;  2EJ9 A;  4XAX B;  4Y28 E;  3JB9 D;  4HCB A;  1M1F A;  3VYG B;  2EQK A;  3C12 A;  3ZEH A;  3HZJ A;  2BUD A;  5GAO n;  3OSS C;  4D6W A;  3OYJ A;  1Q86 C;  3V8L A;  1N8R C;  2LQ8 A;  4X9C A;  5GAM e;  1VQ8 A;  2P0K A;  3KHI A;  5D6Y A;  1YJ9 T;  2AHJ B;  5CR2 A;  3JCM h;  3CC2 T;  3CCE A;  1N27 A;  2K2V A;  2JUF A;  3OYM A;  1QP3 A;  3ME9 A;  3L2W A;  2FYK A;  5J39 A;  1X6O A;  2M9U A;  4M75 F;  1UGR B;  2Y90 A;  3KXT A;  3OA6 A;  3ASK A;  1YJ9 A;  3QG1 A;  2LTO A;  2WSF E;  4MDX A;  5GAO r;  3OQ5 A;  3BDL A;  3MEV A;  3CBM A;  4RCC A;  1VQ6 T;  4DQ2 A;  3L42 A;  3LW5 E;  4ZGJ B;  5L8R E;  4M7A A;  4E7J A;  2KMG A;  2E6N A;  3WVE B;  4IUQ A;  1M90 C;  4BY6 C;  2QQS A;  4GLK A;  4ELY C;  3RER A;  4JLI A;  4KBM B;  1Q81 U;  5J26 A;  1EIF A;  2R5M A;  4C8Q C;  3CC4 T;  1Q82 U;  3X20 B;  4M7D G;  5KH6 A;  1NE8 A;  4BBS M;  3HP9 A;  2XK0 A;  2DXC B;  1OZ2 A;  2RHX A;  3TCJ A;  3OYL A;  1NJI C;  2CZ0 B;  1BI2 A;  3O8V A;  2QA4 A;  1YIJ A;  2E12 A;  2JN0 A;  3P8B B;  1UGQ B;  1VQ5 A;  5FLX E;  2MF2 A;  1BKB A;  1E7P A;  2L3R A;  1VQM T;  3M9Q A;  3MEA A;  2E5Q A;  3QUI A;  4MZT A;  2K3Y A;  3NTI A;  4M77 A;  3HB9 A;  3JCM e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...