1UGPB

Crystal structure of co-type nitrile hydratase complexed with n-butyric acid
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
226
structure length
226
Chain Sequence
MNGVYDVGGTDGLGPINRPADEPVFRAEWEKVAFAMFPATFRAGFMGLDEFRFGIEQMNPAEYLESPYYWHWIRTYIHHGVRTGKIDLEELERRTQYYRENPDAPLPEHEQKPELIEFVNQAVYGGLPASREVDRPPKFKEGDVVRFSTASPKGHARRARYVRGKTGTVVKHHGAYIYPDTAGNGLGECPEHLYTVRFTAQELWGPEGDPNSSVYYDCWEPYIELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile Hydratase alpha subunit
publication title Mutational and structural analysis of cobalt-containing nitrile hydratase on substrate and metal binding
pubmed doi rcsb
source organism Pseudonocardia thermophila
total genus 68
structure length 226
sequence length 226
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ugpB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ugpB02
2PUKB 2ZZDA 1V29B 3VYHB 2QDYB 2DXBB 4OB0B 2PVOB 3QYHB 3QZ9B 1GXIE 2DXCB 1QP3A 3QZ5B 2ZCFB 3HHTB 4OB3B 2CZ7B 3X28B 4XK8E 1JB0E 2DXBA 2DD5A 4Y28E 3X20B 4OB2B 1PSFA 1AHJB 4OB1B 2CZ6B 2CZ0B 3X24B 2PUOB 3QXEB 3A8MB 3VYGB 4L6V5 1QP2A 2DD4B 1UGRB 1DJ7B 2PVDB 1UGSB 3LW5E 2WSEE 2DPPB 3A8LB 2ZPGB 3WVEB 1PSEA 3VYGA 4ZGEB 2DXCA 3WVDB 4ZGDB 2DD4A 3X26B 3QYGB 3A8GB 2WSFE 2CZ1B 2ZPHB 2WSCE 2PU9B 1IREB 4KT0E 2ZPFB 3A8HB 4FM4B 2DD5B 2CYZB 2ZPBB 2O01E 2ZZDB 5L8RE 2ZPEB 2AHJB 2D0QB 1UGPB 3X25B 1UGQB 4ZGJB 2ZPIB 4RKUE 3A8OB 2PVGB
chains in the Genus database with same CATH superfamily
5EJCA 1NZ9A 3G6ET 4ZNXA 2CUDA 3QHRB 1NYGA 3LX7A 4II5B 2DZCA 2MAMA 3CC4T 1H1RB 2RN8A 4XTZA 2JXBA 3HL8A 4Y92A 2JTFA 2RH2A 3TW6A 1G83A 3EGXA 5CKDA 2BE9B 5CKEA 2VASA 2KBTA 3I5SA 1Q81R 3M03A 1QMZB 1TXQA 2O31A 1WNLA 2YSQA 3MEUA 2F69A 2JTMA 4FSSA 2WIHB 2EVRA 4E7SA 3LGLA 3OYNA 4AKGA 3QXEB 4BDYA 1GCQA 2BPMB 4OR5B 3TEEA 4BCJB 2BKDN 4EIKA 3JV3A 3EFOA 2PNIA 3TCJA 3JCMe 1SRLA 4HCZA 4M4ZA 2G3RA 2XIDA 1Y96B 1IB8A 3QYBA 3TN8B 5A2QE 2OTJT 4EOMB 1K0SA 4C0FA 1VQMA 1N4MA 2QA4T 2QQ8A 2C0IA 2DL5A 1VQ4Q 2C6TB 2FRWA 3VUBA 1JSUB 1AZEA 1OYXA 4LDXA 1GFDA 4OMOA 3OS2A 3TNIB 4JJNK 3C12A 4CXAB 1Q86C 4JRPA 1SRMA 1TH7A 1ZA2B 2VKNA 1B34B 1JEGA 3SWNC 1RAEB 2RI5A 2B8AA 1C6VX 2E6NA 2IN3A 2D8HA 4J6XA 1E6GA 2L89A 2IVWA 4C0ZA 2LJ1A 1ARKA 3LGFA 2A36A 1M27C 3EHQA 5HK0A 1PD0A 3V8KA 2DETA 4KRDB 2GTJA 5EFQB 3OW2S 1VA7A 1EIFA 4QVCA 2PZ1A 3RUXA 5I21A 3VYHB 5IDNB 1Q7YU 2PK2A 2UUEB 2R58A 2FYKA 1UTIA 1NBEB 1RI9A 4PJOG 3KHIA 3UDCA 4E7HA 3T9NA 3OY9A 2RI3A 3GIBA 4DQ2A 2WMBB 1IZ6A 1F1BB 4EC8B 5FROA 1FMWA 4ANJA 3RESA 1UNLD 1D0XA 1YWPA 4M7DC 3QHSA 2JTEA 2OTLT 1W70A 3R6OA 1M1KC 3VS6A 4MDXA 3A8MB 2A0FB 4MZPA 1D3UB 4DOVA 1X75C 2KRMA 1YITQ 3DL1A 2QASA 2KE9A 3P8HA 3LW5E 1KD1U 3EFSA 1FKMA 4QT7A 5IHNA 2EJGA 2EYQA 5IN1A 2OTJQ 4YTLA 1RI0A 3TVTA 1RAIB 1AT1B 2HL5C 3JAME 1LVKA 3DLMA 1T0HA 3E9FA 2DKGA 4M75C 1WXTA 1M2OA 1Y96A 4ZTFA 3CCVA 3PGGA 1YHQQ 3ASKA 1GRIA 4XU1A 1OX8A 1BK2A 4A53A 1JJ2A 4NSTB 2HQXA 2O2OA 1G2BA 2CDTA 2ZZDB 2F2XA 4ZN1A 4M77G 2YT6A 3PNWC 1VQ6T 1OX9A 1B34A 1C9BA 2RK1A 2RQWA 2R5MA 1GBRA 3BDUA 1XJWB 2YUOA 1ZBJA 4KGZB 3A8OB 4M7DF 3DB3A 2KROA 2KR3A 1V29B 2EPDA 1QVFA 2X4YA 2FVUA 5A0GA 2FG0A 2J6KA 4HKEA 3UT1A 1VQOQ 4FW2A 2HSPA 4F6SB 2KYBA 3AT1B 1YN8A 3V7RA 3CC7Q 1N27A 1AZGB 1U1SA 1AVZC 5KE3A 1UJ0A 3CCLA 4PJOD 3H41A 1OQKA 5M9OA 1SEMA 4J9CA 3HRSA 2CZ7B 2LCLA 3BE3A 1QVGP 1H8KA 1YBYA 2LMJA 1QW1A 4CFVB 3HZJA 4AKHA 4HXJA 2DRKA 1KC8U 2JS2A 1QVPA 4M75F 2HBWA 2ED0A 3CCRA 2LJ3A 3BG3A 3CBOA 4J9HA 4JX6A 2GBQA 2YUPA 1VQLT 2IW8B 1W2BS 5GAOm 1AWOA 1N8RR 3EH2A 3A98A 1QMCA 1K73R 2PQWA 2DAQA 2DXUA 2BIVA 1UGSB 4R0KA 4BXXX 1RAGB 1CKBA 1RAHB 2HZYA 2W9ZA 2XHCA 3OYBA 4PJOA 2NYSA 3RKYA 1PSEA 1K9MC 4C92B 1AWJA 3I9QA 2X1NB 1C1AA 3H6ZA 1YJ9T 4HCCA 1ZUKA 2JM9A 2FZKB 4BI4A 4I3ZB 4BY6C 4LDUA 4IUUA 1OOTA 2RI2A 4M7AG 2LT1A 1MV0B 1H26B 3CMAA 4CFUB 4QVZA 1D0ZA 5GANj 5HCKA 5IHIA 5FRMA 1YIJA 3O5ZA 1JOWA 4MZTA 1M2VB 4ESRA 1FWZA 2MWPA 5GMKm 3QJ6A 3CMEA 1WHLA 2DBKA 4EMKB 4QVDA 1ZHIA 5IHKA 3G4SA 3JCMV 2HCKA 4J9GA 2H8HA 5AYFA 5HBHB 3LWIA 3OYDA 3CPFA 2EJFA 4EORB 1KQSS 2A37A 1ZLMA 2ZZDA 1D1AA 1Q81U 4RTTA 2W99A 3OYMA 2W96A 1YI2Q 1X43A 1NLPC 3QWLA 2GCXA 2E4HA 1QP3A 1WX6A 4DEYA 3CCUT 3OYAA 3ULRB 3NPFA 5KH6A 3JCMb 1WJQA 2M0OA 5J39A 2GFUA 4A4GA 3GOXA 1VQNT 2DZ9A 3QDFA 4M77A 4GLKA 2H3EB 1XO2A 5DQWA 3OMGA 3HBLA 4EOLB 1IO6A 2FHDA 2KSSA 2MI6A 1HD3A 3THKA 4C92D 1O9KA 1XOVA 1TUCA 3E1SA 2RF0A 4N4GA 1MMNA 1ZA1B 1VQLQ 2E5QA 2JUFA 4C8QC 2GQIA 4HNUA 1X2QA 4CFUD 1QQJA 2O9VA 4AKIA 4MDWA 4BI3A 4C5HA 4KRCB 2JJ9A 4EOIB 3URGA 4EMHA 2KNBB 3UF4A 1S72A 3CPWP 3WVDB 5GJWB 1D3BB 3X26B 3QJYA 2Y90A 2CJMB 4C0DC 2CZ1B 1WZOA 4PJOE 3KBGA 1RADB 2NLUA 4XTUA 3L2VA 5HK3A 3CCJA 2DM1A 1OU9A 3UATA 3JB9F 4M7AD 3OSSC 2XI9A 4M78E 1VIEA 1MMDA 2YWWA 1MV3A 1UJYA 2O01E 1WXBA 1HYOA 5DQVA 2CCHB 1FXXA 2E64A 1VQ8T 4HT8A 3CCET 1VQ9Q 1NPRA 4EC9B 2FO0A 3MJXA 3CC2T 4F7UE 3X25B 5GAOq 1M2VA 2QEXT 4RCBA 3SD4A 4BUGA 2RMOA 2DIQA 3LYIA 4AG1C 3NHNA 1VOMA 1TUDA 2YLCA 4EMKA 4OMFB 5C6SA 3MY5B 4M7AA 2YHTA 3FIFA 2EAYA 4C8QF 4MZMA 4EOPB 3OYKA 4EMGA 9ATCB 2JZ2A 2K3XA 4BDZA 1WDXA 5FRNA 1WHMA 1YJWT 1VQ5T 3X24B 2KGTA 1Q86R 1E9HB 1ABOA 2CP0A 5CKFA 3G71A 2BS3A 2B86A 3I56T 3GNFB 3J7AF 2JN0A 2NUTB 3M0UA 3I55A 4M77E 4YOZA 3VV0A 2HMAA 5KYYB 2C5VB 5BNJB 3GBQA 5LJ3j 2EFIA 1LPLA 4DBHA 1WLPB 4N0AC 3QKJA 1R8OB 1OZ3A 2EWNA 2XK0A 2VGNA 2WSEE 1TWBA 2DPPB 4II1A 2GQVA 2DYIA 2JVVA 3META 3CD6Q 3OYYA 5A0DA 1IHWA 3VS1A 3MHXA 2DXCA 5DLQE 3SWNB 3QYGB 4B9WA 2WSFE 5L23A 4J8OA 2ZPHB 1S1NA 4F7LB 3MP6A 1P92A 2E10A 2JW4A 3VJPA 4E7IA 4PL6A 2KAFA 2MK5A 4FIBA 2HQHA 5FWBA 3C94A 3CCQQ 2DIGA 4F14A 2WXVB 2ESWA 2MYSA 1X6GA 1ZX6A 1WHKA 1ZQ1A 4XTWA 1VYUA 3MY1B 4EOKB 5GMKj 3CCEQ 4M7DG 3QG1A 3OS5A 1M1KR 3CC2Q 2I0NA 1SF9A 1O9SA 3GLXA 5LJ5j 1WQ7A 2QI2A 5EG2A 3C4SA 1SG5A 3S6WA 2QEXQ 4BCGB 3PIOA 1Q82C 3BLRB 5ECAA 1LCKA 1MHNA 2HBPA 1H92A 3QZ9B 1MNDA 2W9FA 2AK5A 1AOJA 2E1HA 3TW7A 2H3JA 2E65A 3ZBDA 2LX7A 3L1AA 1N8RU 4M7DB 3FDRA 3NTKA 4XK8E 2QGSA 4EOQB 1K73U 4FT4A 3L2RA 3OQ5A 4M7AE 3HRTA 4MMLA 4JJDA 1PSFA 3ER0A 4M75G 2LNHB 1IRXA 5KYUB 1B3QA 2P84A 5GAN4 3SHWA 2O4XB 3EG9A 4HL4A 5I11A 5CYIB 1YJWQ 1IGQA 3DB4A 1K8AC 1JXOA 2A3LA 1GUXB 4CC4B 1OKVB 2ED1A 3CCSQ 2KDSA 3H0FA 2YRVA 3QPHA 2L5QA 4D8KA 1M1GA 1H4LD 1WA7A 2LTOA 2DLPA 2DL8A 1FVVB 1NYFA 4RTUA 4XQ3A 2YLBA 1GCPA 5CK9A 4M75B 4OGCA 3EG2A 1U5SA 4Q5WA 3WVEB 3RMSA 3QWYA 2A08A 3CXCS 4PFPA 2RD1A 3ZL7C 3HFNA 3NFCA 1WHJA 2LRQA 1H24B 5CVIA 4E7LA 3JB9H 2ZPFB 4E7JA 1LJOA 4JRQA 4FM4B 4J9DA 2M02A 4KGXB 5KE2A 2OI3A 2M0YA 1X6BA 2P4RA 3JRZA 1VQ4A 1IGUA 2PJQA 2DYBA 2I40B 2RNAA 2RA2A 4VUBA 3OW2A 4PJJA 3M53A 4F16A 5KCOA 5KYWB 4E7KA 3SDZA 2WIPB 1WJSA 3H0HA 5J26A 4KGVB 2LQNA 1H25B 2OJ2A 1GY3B 4RKUE 4M7DD 1VQKT 5GAN5 2M9UA 2XG8D 5ACBA 2E3HA 4JRKA 2NUPB 2CH4A 1FYNA 2DXTA 2CT4A 3ZFJA 4HVUA 1V76A 4QQ6A 2AT1B 5DLOA 4OF1A 3EFRA 4DOWA 2ABLA 4LDWA 4RTWA 1BB9A 2YXYA 2DVEA 2UZDB 1K9MR 3O8VA 3INZA 1PKTA 2JGZB 4FL6A 2FEIA 4PNOA 3X20B 5GMKh 2WMAB 1O75A 4OB1B 2O9SA 2K2VA 3JCMP 1ZSZC 4M75D 4HLQA 2FZCB 1PKDB 2VGMA 2KQWA 1FMVA 5LJ5h 2XKOC 2CP7A 3RKXA 2RB6A 5HBEB 3G6EQ 4M7DA 4KULA 2EGAA 3CC4Q 1DJ7B 4AG2C 5FGKB 2F5KA 4FU6A 2RHYA 1SHGA 3NMZC 3M4YA 1K1ZA 5KYUA 2D8JA 3OW2P 1OPKA 2O4XA 2KT1A 5KYXB 4E2FB 1QCFA 2ZPGB 4AT1B 3BHUB 1N5ZA 4FYYB 4BY6B 1RABB 5HNBB 4GY5A 1WYXA 2QQSA 2DBMA 1NPPA 4IUPA 3FLGA 3OBYA 4B9XA 3OYIA 3MPUB 1YITA 2VWFA 2QAZA 3M4GA 5GAOn 4M75A 4F04B 4QW2A 4Y91A 2GF7A 3A8HB 2X9HA 6AT1B 1NLOC 4XTVA 4P5NA 1PNJA 3HB9A 5IT9E 2ZPBB 3CCRT 4RUGA 2PK9B 3REBB 2V8IA 1N9RA 4F70B 2X51A 4KUIA 4OMQA 4X9DA 2QA4Q 5C0MA 3E19A 4A54A 1YHQA 4ZTJA 2J6FA 2QDJA 1K9AA 7AT1B 3OB9A 4ZGJB 3FEOA 1JO8A 2V1QA 4OMPA 2PHGA 4JZ3A 1ZUYA 4KRTA 1H28B 3V7SA 5HBJB 1BI3A 1VQKQ 1BI2A 3R6NA 1Q86U 3M0TA 3SB2A 5KYWA 1AD6A 1JSTB 4PFZA 3CMAT 2BS4A 1I0CA 5GAMj 5GMKi 1U1TA 2NUPA 5GAMg 3JCMX 3BDLA 1VQOA 1Y0MA 1PKSA 3CC7A 4A4FA 1W2BA 2DNUA 1K76A 3DKMA 4IUQA 3QDRB 5D6YA 5GAN2 1QLBA 2W0ZA 3HKSA 3VS0A 4C8QB 1OKWB 1VIFA 1QVGS 2RHUA 4M6VA 3M57A 1PD1A 1QCOA 3OS0A 1AWWA 2E5KA 4UC4A 1ZSGA 4JDSA 3BHTB 3P8DA 4C0DB 3VS3A 1SPKA 1UDLA 2ATCB 2QGFB 2DL4A 3M56A 3VRYA 4A4HA 3OYHA 1NEBA 4YC3B 3MEAA 4C92G 4ZGEB 2DX1A 4E47A 5J3BA 3MI9B 2OTLQ 2CP3A 1PWTA 1JJ2P 2G9XB 4RTYA 3UWNA 3JB9D 5EC7A 1PM3A 2QDLA 3VS2A 2YDLA 1EZZB 4BCQB 1QWEA 1UHCA 2KXCA 4CC3A 1M1KU 1M90C 2DD5B 2D1XA 2HNIA 1HSQA 1BIBA 2IPOB 4KBMB 2AKLA 4TVRA 1GBQA 2CP5A 1WQWA 1J3TA 5KYNA 3OYLA 3VRZA 2FZGB 1KQSA 4JLGA 2EJ9A 2OX7A 1UGPB 4OGRB 1QVFP 3L2UA 1C0MA 1UGQB 4CC7A 4EDUA 4PLIA 5FU7B 1H1SB 3KUFA 5GANd 5GANg 1S72T 4XU2A 8ATCB 3QWXX 4BCMB 1YFNA 4R56A 1KFZA 5D6WA 2CS7A 4J9IA 1GH6B 4BCNB 5IH2A 4C8QD 1PC0A 2RJFA 4XAXB 3CCJT 3SEMA 1VQ6Q 1M3AA 4BCFB 3UA7A 2VB6A 2CH4W 4AFSC 5ICPB 4J83A 1YI2A 1AHJB 2JNGA 2CZ6B 4M78C 2VVKA 2LT4A 3LH0A 2COZA 1WPYA 1OPLA 1YJNT 2RJEA 3MO8A 4NL3A 5IAYA 4EOJB 2RHZA 4IMYB 2HKNA 2V8JA 2IIMA 1QWFA 1D09B 3MEWA 2XMFA 3BY7A 1CKAA 3G33B 5GAMh 4JLIA 1I07A 4BCQD 2L2PA 3OS1A 2LCSA 2BUDA 4PK4A 4BACA 4RG8A 4J5YA 1FX7A 2I2LA 4NC6A 3VKGA 4ZGDB 2LP5A 3BLQB 3A8GB 1K4US 2C5NB 3VS5A 3M5AA 2QYZA 2EYZA 3GF5A 1Q82R 3EGUA 4KH0B 1YNZA 1AD5A 4OVAA 1WGSA 4LOCA 3E9GA 3J80E 4C5IA 3HO8A 3EIDB 4DBFA 3NDQA 4AMCA 3CPWS 3S3MA 4C5GA 3G71T 4N4HA 2WPAB 3C95A 1RL2A 2EQIA 4BCMD 2ZPEB 4Z8AA 2DE0X 2E70A 1Y57A 1QLYA 4ROCA 5GAN8 1UB4A 2RM4A 3M54A 2AHJB 1E7OA 1VQ7A 4BCND 1D0YA 1N6AA 3M0SA 4BCOB 2LJ0A 3OYEA 1YJ9Q 1UNHD 2D0NA 3G1JA 5GAMf 2RJCA 3EAEA 3VU3C 1K9MU 1I5LA 4M78F 2F2VA 2PUKB 2RPNA 1TSFA 1K8AR 1HXDA 2K79A 1H3ZA 5I5ZB 4C92A 4D8DA 4GLMA 4BE2A 4BI8B 4JS4A 1QKXA 1VQ9A 4YOSA 2ZAEA 1OEBA 5DY9A 4OMMA 1GXIE 2HKQB 2LQWA 1XTDA 3QZ5B 3GTMS 2UZEB 5IXBA 3M59A 2XDPA 4F7UF 2G77A 2K7AA 1SHFA 2KEAA 1RLPC 1JB0E 2KI7A 4X9CA 3CCJQ 1H3HA 3GNGA 1H641 2RK2A 3D7SB 1SSHA 2K5IA 2VV5A 1F5QB 1MNEA 4IUVA 5GANh 4D6WA 3L2QA 5GJVB 4HVWA 2A7YA 5FU7C 2Y4XA 3VS7A 4WCIA 4JX5A 2QQBA 4L6V5 1QP2A 1Z9QA 5HVYB 1G3YA 5A0LA 4AFUC 1YJNQ 1BKBA 3CCMT 2HDAA 3A5ZB 3HTRA 3G7ZA 2QGGA 3F70A 3CCUQ 2FRYA 3VKHA 1UHFA 2GGRA 3TSWA 1VQPT 2DL3A 4N0AA 1UECA 2C0OA 2PMIB 1VQNQ 2L3PA 2LNVA 3MP1A 1VUBA 3DOGB 2VXFA 5IXFA 5IDPB 2DA9A 2MOXA 5CCAA 2PU9B 5LMKB 3EGDB 4Z6YA 1RACB 3EOCB 2KMGA 3M0PA 2DEUA 4G6LB 2DL7A 4OMLA 5LJ3d 2CCIB 4QSHA 5LJ3g 5GAOr 3RKWA 2V22B 1YP5A 2VC8A 3CD6A 2CKKA 5GANf 3POMA 1Q95G 1EX4A 1MUZA 1IHVA 2BZYA 3VUZA 3OA6A 5L8RE 1JBMA 1D1CA 1KHIA 1M30A 4MFEA 4BBRM 3RGFB 2DJQA 1Z9ZA 3EFOB 2PVGB 4BE0A 3S3OA 3CCQA 3RDVA 1GFCA 4LD9K 3EG0A 3PVLA 5HY6A 1KQ2A 1D3BA 4FYWB 1VYTA 1BU2A 4C92E 4ELJA 1OULA 3CCEA 2RQUA 2VXEA 3QUIA 4X34A 1UE9A 1OU8A 1ZSZB 2KT8A 1VQ8Q 1RAFB 3CC2A 3EG1A 4FX3B 4CFWB 1WHGA 2K4YA 2F1LA 2RJDA 1VQMT 2QEXA 5GAMe 4IIOA 4XTXA 1G8XA 4GBQA 5LJ5d 5LJ5g 4HCKA 5FLXE 3A1PA 1I4K1 1SKUB 3EG3A 3CBPA 4AFZC 2BZXA 4BCKB 4BB7A 5IF1B 4WF2A 1R0CB 2DD4B 4J9EA 2G6FX 1UG1A 2LC4A 1BCMA 3FJ5A 3H9NA 2KMTA 1W98B 2OAWA 2DRMA 2PVDB 2X4WA 3CXCA 2BTTA 1H1QB 3CCMQ 2GTOA 5HKCA 3EH1A 4NL2A 3NTIA 2EQJA 4JRIA 1WIEA 1YJWA 4MIMA 2JM8A 1KG1A 2AZSA 3I5RA 1SSFA 1IXDA 1RAAB 1VQPQ 3CCSA 1VQ5Q 1Q7YC 2D9TA 3LH5A 2EKHA 1AWXA 3I56Q 1AISB 2WFYB 1M8VA 3F5XB 2LX9A 4PKCC 2MIOA 2L3SA 1FINB 3L42A 3OYJA 4Z88A 3HPWA 4XU3A 2NUTA 2RQVA 3V8LA 3OYGA 3EGDA 2LQ8A 2BE7D 5KYYA 2EQKA 2AKKA 4EOOB 1TU0B 4J7IA 1MMAA 2EYYA 3UPUA 3M0QA 2P0KA 1TD6A 4JZ4A 4BY7X 2CP6A 2B9RA 5LJ3h 2QDYB 2DXBB 2DFUA 4ELLA 3PO3S 3LQ5B 2MF2A 3SWNA 1PRLC 3JB9I 2LVMA 5GANe 1KD1C 3OYCA 1YITT 1OGUB 4OP0A 1JRIA 2LZ6B 1R0BG 3CXCP 2I53A 2BS2A 3PMIA 3JCMQ 4JPBW 2CUBA 3EHRA 3X28B 3BG9A 1OV3A 2VYTA 5CKHA 2M1HA 1HK9A 1GCQC 4DA4A 2CZ0B 2R7GA 2FPFA 1M5Q1 1VQMQ 4QQDA 1D1BA 2QTVA 1R77A 3EJ1B 1YHQT 3CBMA 1AEYA 4CI0C 1U8RA 1ZSZA 1M90R 1ACMB 2EGEA 3M55A 3CCVT 5L2WB 1WJRA 2AZVA 4HA8A 1FMKA 2KVQG 4X1VA 2KXDA 3VS4A 1YCSB 2E3IA 1Q82U 5LJ3f 2JMAA 1U06A 2EGCA 4FYVB 3A8LB 4QQGA 5FU6C 1EFNA 3DLLA 1TUGB 3G6EA 2DD4A 5GAOp 2ROTA 2K5LA 4O5VA 3CC4A 1BI1A 4QKUA 3BLHB 2EW3A 2XDDA 2COWA 3P8BB 2YUQA 4KT0E 1VQOT 4RODA 2GFAA 4KUDK 2LDMA 2ZGWA 2HD0A 3KFVA 2PTKA 3CC7T 4Z89A 1G3NC 2C4GB 1NJIR 1K8AU 4JS5A 2Y4YA 3CCLT 1GUXA 2QG9B 4F17A 1KC8C 4A4EA 2AIRB 4E7ZA 3IQLA 2OAUA 3HP9A 3JB9G 4M78G 1H1PB 3GPLA 2MWOA 1ZP2A 1W4SA 1OI1A 2DTHA 2GNCA 2E6ZA 1G5VA 3I35A 1CSKA 5I2SA 2OTJA 2LW4A 5CQXA 1JQQA 1KK7A 2EYXA 5LJ5f 4V2SA 4F6WB 3TREA 2QA4A 4PJOB 3NTHA 3H8ZA 4AI6A 2MPXC 4F7UG 2E12A 1PCXA 2EKOA 3FC3A 2M51A 2R5AA 3QBYA 3FB9A 1BI0A 2DK3A 4M78B 3BW1A 2ROLA 4F7JB 2DXBA 4Y28E 2CT3A 4LD6A 4LN2A 1VQKA 4L59A 3HFOA 2P0QA 2EUFA 4ELZC 2RO0A 2IW9B 4ORZA 2COYA 1QVGA 4RMOA 2DMEA 1TS9A 1TTHB 2KY9A 1BBZA 2CSIA 4C8QG 4F7UB 3VYGB 2WACA 1ABQA 1VOLA 1K0XA 2X35A 2JMCA 2NWMA 4CFMB 2YRCA 2EBPA 4HNTA 2F2WA 5GAMd 3CCVQ 2FPEA 1YIJT 4IUTA 4LXCA 4F7NB 3B57A 4F6UB 3NGPA 1W6XA 4EONB 5CKBA 1XNIA 3PFSA 4C5EA 8AT1B 3CMET 4OMNA 3VKIA 2QK0A 3G4ST 1Q81C 2CP2A 3BHVB 3RIRA 2DJZA 2QF7A 4MFDA 2WSCE 3FRNA 4AFQC 4YOOA 3N5BB 4JJBA 1UEBA 1YI2T 2X3XD 3TSZA 4DBQA 2IG0A 4M7DE 4FW1A 2L3RA 3RMQA 5LJ3e 3MCAB 3BG5A 3JCMc 4B6MA 3JB9J 4M77B 1P5EB 3C0CA 2WHBB 2OTLA 3CQTA 1JJ2S 1I1JA 2SRCA 2K2MA 3PIPA 3O0GD 2HL3A 1O9KB 3CCLQ 2D6FA 4FCYA 4CC2A 2ZPIB 3U23A 4FT2A 4M78D 4WTOB 5KYXA 1WI7A 1NEGA 4DBRA 3MP8A 1M9SA 5KCHA 2LCCA 1I5OB 4M75E 2C5XB 3MIAB 4PFOA 4LDYA 4N4IA 4RTXA 1QVFS 2EYWA 3CCRQ 1YCYA 4HVVA 4ROEA 2V8KA 1T3SA 1A0NB 1TG0A 1OZ2A 4BCPB 1W2BP 3PTAA 3QO3A 4PJLA 2JOYA 4EOSB 1OIYB 4JUVA 5GMKe 1H27B 2VUBA 3PVQA 1I8FA 2FPDA 1KJWA 2K3BA 1MGQA 1QCNA 2X4JA 4F7SB 3JCMg 3JCMd 3JCMW 1VQ7T 5LJ5e 1VYVA 4M78A 2L8DA 3OBWA 4BBSM 1NJIC 4Y72B 1VQ6A 2IW6B 5I2MA 3J81E 3OYFA 2XDBA 3M9QA 4PJOC 4E6RA 1B07A 1KQ1A 3CMAQ 4J9BA 2YUNA 3RERA 2X3WD 1X01A 4RCCA 1VQ9T 1YIJQ 1Y7XA 2JT4A 5CEIB 2CREA 4F7UA 3VYGA 5FWCA 1X6OA 4M77D 1UFFA 5IHYA 3CMEQ 1Y07A 4MMKA 4FSXA 4A63B 4M7AB 3G4SQ 5CR2A 3CPWA 1JU5C 2DMOA 4RG2A 1BU1A 4C0GA 2CSQA 3PT9A 3OMCA 2UZLB 2C0TA 1TOVA 2X4XA 4RTVA 2DTIA 5CQYA 3OSVA 1WXUA 1KQSP 2J06A 3RNJA 4OGEA 4C8QA 4LNPA 1N9SA 3H0IA 1MMGA 2RHXA 2F2CA 4CRIA 3LWHA 2MMPA 2ENMA 3TNWB 5D7UA 1VQLA 4BD3A 2P4TA 4HT9A 1WFWA 4ELYC 1KSWA 2KK4A 3ZEHA 4OB0B 4DEXA 5GAN6 1UGVA 2K6DA 1M3CA 4J9FA 1RLQC 2KR6A 1T3LA 1M8MA 3I55T 2RHIA 2WJ9A 2DXCB 1M4ZA 2QQ9A 4PJOF 1G3WA 1ZBXA 2EQUA 2ZCFB 1YJ9A 1M90U 1G3SA 4OB3B 3L2ZA 3REAB 2MCNA 4A4KA 1VYWB 4M77C 2KRNA 4JX4A 3MKDA 3CD6T 1HJDA 4JJCA 2QQRA 4BCHB 4CRLB 1E7PA 2DD5A 2RQTA 3K7AM 4J7FA 1Q7YR 2FL7A 4IKFA 4UN0A 4FYXB 5LL6S 2PUOB 2E41A 3AHUA 1OL2B 4RTZA 1S72Q 2IVXA 1PHTA 1UGRB 1KXUA 2L0AA 1VQ7Q 2DEQA 2DO3A 4IURA 5D6XA 3CCQT 1URCB 2J7IA 5GAN3 3QIIA 2YRDA 4PJNA 1U3OA 1BCOA 4ME7A 2RQRA 2KRSA 2K3YA 1YWOA 5AT1B 2C06A 3SFMA 2W2HA 3E2UA 1NJIU 2BZ8A 3DDQB 2HEQA 1T0JA 4J6YA 3HSBA 3L2WA 1M1FA 2FB7A 1KIKA 3DTOA 4KH1B 4ZN3A 2DF6A 1YJNA 4LUDA 5GAN7 3JCMh 4J6WA 4LUEA 4NS5A 1ENWA 4C92C 4PLLA 4XU0A 3M58A 1UUEA 3CCUA 3CEYA 1KD1R 3RR6A 2BKZB 1OIUB 2SEMA 5CO7A 3S3NA 2K9GA 4O6JA 2CYZB 1N8RC 2DERA 1NG2A 2CGHA 3WXMB 1K73C 1VQNA 2ECZA 1QKWA 2M16A 2NUZA 2LQKA 3JSCA 5LQFB 4BY1X 3EG9B 3Q1JA 4LE9A 1UNGD 2J6OA 4M77F 2F5TX 2W10A 3UA6A 4C8QE 4CFXB 1RUWA 1PG5B 1LNXA 3TQ7P 4CFNB 3PE0A 3EGXB 4IIMA 1XQHA 4EMKC 2L3QA 1X2KA 3M0RA 2V1RA 4XTYA 4M7AC 2PVOB 3CCST 3RBBB 2QXFA 3JCMf 4ATOA 3QYHB 5FW9A 5CIUA 2V26A 3V7CA 3G71Q 3GP8A 4HNVA 3FJPA 3TU4K 5DM7R 1BYMA 3I55Q 2XICA 3HHTB 3TNHB 3V8JA 2DTOA 3HRUA 1Y71A 4OB2B 5HQ0B 1BIAA 3KXTA 1NM7A 1LOJA 1JKWA 1E6HA 2HQEA 1WHHA 2HAXA 2A28A 3PMTA 4HCBA 1TFBA 2HSEB 4C92F 5GAOl 1VQ8A 4Z02A 2QQAA 2DVJA 1JXMA 5I22A 5FU6B 2Z0WA 5CAIA 1G3TA 2EIFA 2K57A 4R55A 3DJBA 1VQ4T 1X69A 1KC8R 2C5OB 2O88A 3DDPB 1OI9B 2EQMA 2J05A 3ME9A 4BCIB 3H4CA 3LLRA 1NE8A 1GL5A 4LDVA 2JS0A 1V1CA 1IREB 1W1FA 1VINA 2WEVB 3CCMA 3BFMA 4K11A 3QSUA 4M7AF 4L5GA 4PJMA 3QHWB 2QTXA 4TTHA 3QYEA 2KYMA 2XD0A 1I81A 5GMKl 3JCMJ 1VQPA 2QFZA 1VQ5A 1B7TA 1ZUUA 2R57A 1PRMC 2DILA 4EPCA 1M3BA 2P0PA 1KHCA 3I56A 4NOYA 2D0QB 2UZBB 2K5FA 2XU8A 4BE1A 1OL1B 1X27A 3MEVA
chains in the Genus database with same CATH topology
5FU7B 2DIQA 3LYIA 5EJCA 3KUFA 5GANd 5GANg 1S72T 5I2SA 4XU2A 2OTJA 5CQXA 1NZ9A 5LJ5f 3G6ET 4R56A 4V2SA 2YLCA 4EMKA 3TREA 2QA4A 3LX7A 4PJOB 2DZCA 2MAMA 3CC4T 3NTHA 3H8ZA 4AI6A 4XTZA 5D6WA 4F7UG 2CS7A 3HL8A 4OMFB 5C6SA 2JTFA 4M7AA 2E12A 2YHTA 3FIFA 2RH2A 2RJFA 2EKOA 2EAYA 4XAXB 4C8QD 3FC3A 3TW6A 2R5AA 4MZMA 4C8QF 3CCJT 3OYKA 4EMGA 3QBYA 5CKDA 3FB9A 1BI0A 2DK3A 4M78B 2JZ2A 2K3XA 3BW1A 5CKEA 2DXBA 4Y28E 4BDZA 4J83A 3MEUA 1WNLA 1AHJB 4LD6A 1YI2A 2F69A 4L59A 3HFOA 1VQKA 2JTMA 2P0QA 5FRNA 4ELZC 2JNGA 2CZ6B 1YJWT 2RO0A 4M78C 1VQ5T 3X24B 1QVGA 2LT4A 3LH0A 3LGLA 3OYNA 4AKGA 4RMOA 3QXEB 5CKFA 3G71A 1WPYA 4BDYA 2BS3A 1YJNT 3I56T 2RJEA 3GNFB 3J7AF 2KY9A 2JN0A 3MO8A 3TEEA 4C8QG 4F7UB 4NL3A 2BKDN 3I55A 5IAYA 3VYGB 2WACA 4M77E 3VV0A 2RHZA 2X35A 3TCJA 3JCMe 4HCZA 5LJ3j 3CCUT 2EFIA 2V8JA 2G3RA 2XIDA 1Y96B 4HNTA 3MEWA 5GAMd 3BY7A 3QYBA 1YIJT 4N0AC 3QKJA 1R8OB 1OZ3A 2EWNA 2XK0A 2VGNA 2WSEE 4IUTA 5GAMh 5A2QE 2OTJT 2DPPB 4JLIA 4II1A 2GQVA 4C0FA 2JVVA 3META 1VQMA 5CKBA 3OS1A 1XNIA 3PFSA 2QQ8A 4C5EA 2QA4T 2BUDA 3OYYA 5A0DA 4BACA 4RG8A 4J5YA 3CMET 1FX7A 3MHXA 2I2LA 3VKIA 3VUBA 2DXCA 4NC6A 3VKGA 4ZGDB 5DLQE 3G4ST 1Q81C 3SWNB 3QYGB 3RIRA 2DJZA 2QF7A 3A8GB 4B9WA 2WSFE 4MFDA 1OYXA 4J8OA 2ZPHB 3M5AA 3OS2A 2WSCE 4LDXA 4JJNK 3C12A 1Q86C 3GF5A 3FRNA 3MP6A 4JRPA 1P92A 1TH7A 2E10A 3N5BB 1B34B 1UEBA 3VJPA 4E7IA 4OVAA 1YI2T 4PL6A 3SWNC 1WGSA 4LOCA 3E9GA 2KAFA 3J80E 2RI5A 4C5IA 3HO8A 2IG0A 2B8AA 2L3RA 4FIBA 4M7DE 3C94A 3CPWS 3RMQA 2E6NA 4C5GA 2DIGA 5LJ3e 3G71T 3MCAB 3S3MA 4N4HA 3BG5A 3C95A 3JCMc 3JB9J 1RL2A 1ZQ1A 4M77B 4XTWA 2ZPEB 2OTLA 4J6XA 2E70A 1JJ2S 2L89A 5GAN8 2IVWA 4C0ZA 3PIPA 1UB4A 3LGFA 2RM4A 3M54A 2AHJB 1VQ7A 1N6AA 2D6FA 5HK0A 3V8KA 5GMKj 4M7DG 3QG1A 3OS5A 3OYEA 3OW2S 5GAMf 2ZPIB 2RJCA 3EAEA 4FT2A 4M78D 3VU3C 1K9MU 1EIFA 4QVCA 1I5LA 1Q7YC 4M78F 1O9SA 2PUKB 3GLXA 5LJ5j 3RUXA 5I21A 3VYHB 1HXDA 1WQ7A 2QI2A 3MP8A 1H3ZA 5EG2A 4C92A 3C4SA 1Q7YU 1M9SA 3S6WA 5KCHA 4BE2A 2R58A 3PIOA 4BI8B 1Q82C 2FYKA 2LCCA 4M75E 4JS4A 1VQ9A 4LDYA 4N4IA 4PJOG 1MHNA 2HBPA 3KHIA 5DY9A 1QVFS 3QZ9B 1GXIE 3UDCA 1XTDA 1YCYA 3QZ5B 2E1HA 4E7HA 3T9NA 3TW7A 2H3JA 2E65A 2V8KA 3M59A 3ZBDA 2XDPA 4F7UF 3L1AA 1N8RU 3OY9A 2RI3A 2G77A 4DQ2A 3FDRA 3NTKA 3GIBA 4M7DB 1OZ2A 4XK8E 1IZ6A 1JB0E 4X9CA 4FT4A 3L2RA 3GNGA 1H641 1K73U 3OQ5A 3PTAA 3HRTA 3QO3A 5FROA 4MMLA 2RK2A 4M7AE 1PSFA 2JOYA 3ER0A 4M75G 2K5IA 2VV5A 3RESA 4IUVA 4JUVA 5GMKe 2VUBA 4M7DC 3QHSA 1I8FA 5GAN4 2OTLT 5GANh 2O4XB 4D6WA 3L2QA 3R6OA 1MGQA 4HL4A 1M1KC 3JCMW 2A7YA 2X4JA 3JCMg 3JCMd 1VQ7T 5LJ5e 5FU7C 2Y4XA 4MDXA 3DB4A 4M78A 2L8DA 3A8MB 4JX5A 2A3LA 2QQBA 4L6V5 3OBWA 4BBSM 1QP2A 4MZPA 1K8AC 1G3YA 2KDSA 5A0LA 1NJIC 4DOVA 1BKBA 1X75C 2YRVA 1VQ6A 5I2MA 3J81E 3QPHA 3OYFA 2L5QA 3DL1A 1M1GA 3CCMT 2XDBA 3M9QA 2LTOA 4PJOC 3A5ZB 3P8HA 3G7ZA 1KQ1A 4XQ3A 3F70A 3LW5E 2YLBA 5CK9A 1KD1U 3EFSA 4M75B 3RERA 1FKMA 3VKHA 4OGCA 1X01A 4RCCA 2EJGA 1VQ9T 2EYQA 4Q5WA 3WVEB 1Y7XA 3RMSA 1VQPT 5IN1A 4YTLA 1RI0A 4N0AA 4F7UA 3CXCS 3VYGA 4BUGA 1X6OA 3JAME 3DLMA 2RD1A 3E9FA 4M77D 2DKGA 2LNVA 3MP1A 1VUBA 3HFNA 3NFCA 4M75C 2VXFA 1Y07A 4MMKA 4FSXA 1Y96A 5CCAA 2PU9B 4ZTFA 4Z6YA 2LRQA 4M7AB 2KMGA 5CR2A 3PGGA 3CCVA 3ASKA 3CPWA 5CVIA 4XU1A 4E7LA 3JB9H 2ZPFB 4E7JA 4RG2A 5LJ3d 5LJ3g 4QSHA 5GAOr 1LJOA 3RKWA 4JRQA 4C0GA 2VC8A 4FM4B 3PT9A 3OMCA 4A53A 3CD6A 5KE2A 2X4XA 2CKKA 5GANf 3JRZA 1VQ4A 1JJ2A 2DTIA 5CQYA 3OSVA 2HQXA 2ZZDB 4OGEA 4C8QA 1N9SA 4ZN1A 2RA2A 3VUZA 4M77G 4VUBA 5L8RE 3OA6A 3OW2A 1JBMA 2RHXA 1KHIA 3PNWC 4CRIA 1VQ6T 3LWHA 3M53A 4MFEA 1B34A 5KCOA 2MMPA 2RK1A 4BBRM 2R5MA 4E7KA 3BDUA 3SDZA 1VQLA 4BD3A 1WJSA 2P4TA 5J26A 4RKUE 4HT9A 4ELYC 4M7DD 3A8OB 1VQKT 2PVGB 5GAN5 4BE0A 3CCQA 2KK4A 3S3OA 4M7DF 2M9UA 2XG8D 3DB3A 4JRKA 1V29B 2DXTA 3ZEHA 1QVFA 2X4YA 2FVUA 3ZFJA 4HKEA 3UT1A 4OB0B 5A0GA 4LD9K 5GAN6 5HY6A 1KQ2A 1D3BA 4QQ6A 3V7RA 1N27A 5DLOA 2KR6A 1U1SA 4OF1A 3I55T 3EFRA 4DOWA 2RHIA 4LDWA 5KE3A 2WJ9A 3CCLA 4C92E 4PJOD 2DXCB 4ELJA 1M4ZA 3CCEA 2QQ9A 2VXEA 4PJOF 1G3WA 1ZBXA 2EQUA 2ZCFB 3QUIA 4X34A 5M9OA 1YJ9A 3HRSA 1M90U 1G3SA 4OB3B 3L2ZA 4A4KA 2CZ7B 2DVEA 2LCLA 4M77C 3CD6T 4JX4A 3O8VA 3CC2A 3INZA 1YBYA 2QQRA 1E7PA 2DD5A 4FL6A 2K4YA 4PNOA 3X20B 2RJDA 1QW1A 5GMKh 1VQMT 4J7FA 2QEXA 2FL7A 5GAMe 3HZJA 4AKHA 1O75A 4OB1B 4XTXA 4IKFA 2K2VA 3JCMP 4M75D 1KC8U 5LJ5d 4HLQA 5LL6S 5LJ5g 2VGMA 5FLXE 2KQWA 1QVPA 2PUOB 4M75F 1I4K1 5LJ5h 2E41A 2XKOC 3CCRA 3RKXA 3AHUA 2RB6A 3BG3A 3CBOA 4JX6A 3CBPA 1VQLT 4M7DA 4KULA 4WF2A 4BB7A 5GAOm 1W2BS 2DD4B 1UGRB 1DJ7B 2LC4A 2DEQA 2DO3A 4IURA 5D6XA 2KMTA 2F5KA 2DAQA 2PQWA 4FU6A 3CCQT 2RHYA 2DXUA 2PVDB 5GAN3 3M4YA 2X4WA 2BIVA 1UGSB 3QIIA 3CXCA 4ME7A 2O4XA 2K3YA 5HKCA 4NL2A 2C06A 3SFMA 2ZPGB 3NTIA 2EQJA 4JRIA 2XHCA 4PJOA 3OYBA 4BY6B 3RKYA 1NJIU 1PSEA 1YJWA 1K9MC 4MIMA 4C92B 1KG1A 4J6YA 3HSBA 4GY5A 2QQSA 1M1FA 3L2WA 2FB7A 3H6ZA 1SSFA 1YJ9T 4HCCA 3CCSA 4ZN3A 1NPPA 4IUPA 1YJNA 4BI4A 5GAN7 2D9TA 3FLGA 3OBYA 4J6WA 4NS5A 3JCMh 4B9XA 3OYIA 1YITA 4BY6C 4LDUA 4IUUA 4C92C 2RI2A 4PLLA 4M7AG 2LT1A 3M4GA 4XU0A 3M58A 5GAOn 4M75A 3CMAA 4QW2A 3CCUA 4QVZA 4Y91A 3CEYA 1M8VA 2GF7A 2LX9A 3A8HB 5GANj 5CO7A 3S3NA 4PKCC 4XTVA 5FRMA 4P5NA 1YIJA 4MZTA 4O6JA 2CYZB 1N8RC 3HB9A 3L42A 3OYJA 5IT9E 2ZPBB 2CGHA 3CCRT 3WXMB 3HPWA 4XU3A 1K73C 1FWZA 2V8IA 2MWPA 3V8LA 1N9RA 3QJ6A 5GMKm 1VQNA 4KUIA 3OYGA 2M16A 3JSCA 2LQKA 3CMEA 4X9DA 1G5VA 2LQ8A 3Q1JA 4EMKB 4QVDA 1ZHIA 5C0MA 2EQKA 3G4SA 3E19A 4M77F 3JCMV 4A54A 2F5TX 1YHQA 4ZTJA 5AYFA 2QDJA 4C8QE 4J7IA 1LNXA 3LWIA 3OB9A 4ZGJB 3FEOA 3OYDA 3CPFA 3UPUA 2EJFA 2P0KA 1XQHA 1KQSS 4EMKC 2ZZDA 5LJ3h 1Q81U 2QDYB 2DXBB 3V7SA 3OYMA 1BI3A 4XTYA 4M7AC 1BI2A 2MF2A 2PVOB 3SWNA 3CCST 3JB9I 2LVMA 5GANe 2QXFA 3QWLA 2GCXA 1Q86U 1KD1C 3SB2A 3JCMf 3OYCA 1YITT 3QYHB 4ATOA 4OP0A 1JRIA 5CIUA 3V7CA 3GP8A 4HNVA 3FJPA 1QP3A 3TU4K 5DM7R 1BYMA 3CMAT 2BS2A 2BS4A 3PMIA 3JCMQ 2XICA 3JCMb 3HHTB 5KH6A 5GAMj 5GMKi 3OYAA 3X28B 3BG9A 1U1TA 3V8JA 5GAMg 3JCMX 1WJQA 2DTOA 2VYTA 2M0OA 3BDLA 5J39A 5CKHA 2M1HA 2GFUA 3HRUA 1HK9A 1Y71A 4OB2B 4A4GA 3GOXA 1BIAA 1VQOA 4DA4A 1VQNT 2DZ9A 3KXTA 2CZ0B 4M77A 1LOJA 3CC7A 4GLKA 4A4FA 2HQEA 1W2BA 3DKMA 1M5Q1 4IUQA 3OMGA 3QDRB 4QQDA 2HAXA 5D6YA 3HBLA 2FHDA 2KSSA 2MI6A 5GAN2 3PMTA 4HCBA 1QLBA 3HKSA 3CBMA 4C8QB 4C92D 1YHQT 4CI0C 4C92F 1VIFA 1XOVA 1U8RA 5GAOl 3M55A 1QVGS 3CCVT 1VQ8A 2RHUA 4M6VA 3E1SA 3M57A 1WJRA 4HA8A 4Z02A 2QQAA 4N4GA 2KVQG 5FU6B 3OS0A 2E5QA 2JUFA 4UC4A 4C8QC 5LJ3f 1Q82U 4JDSA 1G3TA 2EIFA 2K57A 5CAIA 4R55A 1VQ4T 4HNUA 4BI3A 4C5HA 4MDWA 4AKIA 3P8DA 4C0DB 3A8LB 3M56A 4QQGA 4A4HA 3URGA 3OYHA 4EMHA 5FU6C 2EQMA 3ME9A 1S72A 3DLLA 3MEAA 4C92G 4ZGEB 3H4CA 4E47A 3G6EA 3WVDB 2DD4A 5GAOp 1D3BB 3X26B 2K5LA 2Y90A 3LLRA 1NE8A 3QJYA 5J3BA 4C0DC 4O5VA 2CZ1B 1BI1A 3CC4A 4LDVA 4PJOE 3KBGA 2NLUA 4XTUA 2XDDA 3UWNA 3P8BB 5HK3A 3L2VA 3JB9D 3CCJA 1IREB 4KT0E 1VQOT 3JB9F 2GFAA 4KUDK 4M7AD 2LDMA 3CCMA 2ZGWA 2XI9A 2HD0A 3BFMA 3OSSC 1M1KU 3QSUA 4M7AF 4M78E 3CC7T 1M90C 1VIEA 4L5GA 2DD5B 2HNIA 2QTXA 1K8AU 2O01E 4JS5A 1BIBA 2Y4YA 3QYEA 4KBMB 2XD0A 1I81A 5GMKl 4TVRA 3JCMJ 1FXXA 1WQWA 2E64A 2QFZA 1VQPA 3CCLT 1VQ5A 1VQ8T 4HT8A 3CCET 2R57A 4EPCA 1NPRA 3OYLA 1KC8C 2P0PA 4A4EA 1KQSA 1KHCA 4JLGA 2EJ9A 3I56A 4NOYA 2D0QB 2OAUA 2K5FA 3HP9A 1UGPB 3CC2T 3JB9G 3L2UA 4F7UE 4M78G 3X25B 1UGQB 4EDUA 3GPLA 2MWOA 2XU8A 4BE1A 1W4SA 4PLIA 5GAOq 1OI1A 2DTHA 2QEXT 3MEVA 4RCBA 3SD4A 2E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PUK B;  2ZZD A;  1V29 B;  3VYH B;  2QDY B;  2DXB B;  4OB0 B;  2PVO B;  3QYH B;  3QZ9 B;  1GXI E;  2DXC B;  1QP3 A;  3QZ5 B;  2ZCF B;  3HHT B;  4OB3 B;  2CZ7 B;  3X28 B;  4XK8 E;  1JB0 E;  2DXB A;  2DD5 A;  4Y28 E;  3X20 B;  4OB2 B;  1PSF A;  1AHJ B;  4OB1 B;  2CZ6 B;  2CZ0 B;  3X24 B;  2PUO B;  3QXE B;  3A8M B;  3VYG B;  4L6V 5;  1QP2 A;  2DD4 B;  1UGR B;  1DJ7 B;  2PVD B;  1UGS B;  3LW5 E;  2WSE E;  2DPP B;  3A8L B;  2ZPG B;  3WVE B;  1PSE A;  3VYG A;  4ZGE B;  2DXC A;  3WVD B;  4ZGD B;  2DD4 A;  3X26 B;  3QYG B;  3A8G B;  2WSF E;  2CZ1 B;  2ZPH B;  2WSC E;  2PU9 B;  1IRE B;  4KT0 E;  2ZPF B;  3A8H B;  4FM4 B;  2DD5 B;  2CYZ B;  2ZPB B;  2O01 E;  2ZZD B;  5L8R E;  2ZPE B;  2AHJ B;  2D0Q B;  1UGP B;  3X25 B;  1UGQ B;  4ZGJ B;  2ZPI B;  4RKU E;  3A8O B;  2PVG B; 
#chains in the Genus database with same CATH topology
 5EJC A;  1NZ9 A;  3G6E T;  4ZNX A;  2CUD A;  3QHR B;  1NYG A;  3LX7 A;  4II5 B;  2DZC A;  2MAM A;  3CC4 T;  1H1R B;  2RN8 A;  4XTZ A;  2JXB A;  3HL8 A;  4Y92 A;  2JTF A;  2RH2 A;  3TW6 A;  1G83 A;  3EGX A;  5CKD A;  2BE9 B;  5CKE A;  2VAS A;  2KBT A;  3I5S A;  1Q81 R;  3M03 A;  1QMZ B;  1TXQ A;  2O31 A;  1WNL A;  2YSQ A;  3MEU A;  2F69 A;  2JTM A;  4FSS A;  2WIH B;  2EVR A;  4E7S A;  3LGL A;  3OYN A;  4AKG A;  3QXE B;  4BDY A;  1GCQ A;  2BPM B;  4OR5 B;  3TEE A;  4BCJ B;  2BKD N;  4EIK A;  3JV3 A;  3EFO A;  2PNI A;  3TCJ A;  3JCM e;  1SRL A;  4HCZ A;  4M4Z A;  2G3R A;  2XID A;  1Y96 B;  1IB8 A;  3QYB A;  3TN8 B;  5A2Q E;  2OTJ T;  4EOM B;  1K0S A;  4C0F A;  1VQM A;  1N4M A;  2QA4 T;  2QQ8 A;  2C0I A;  2DL5 A;  1VQ4 Q;  2C6T B;  2FRW A;  3VUB A;  1JSU B;  1AZE A;  1OYX A;  4LDX A;  1GFD A;  4OMO A;  3OS2 A;  3TNI B;  4JJN K;  3C12 A;  4CXA B;  1Q86 C;  4JRP A;  1SRM A;  1TH7 A;  1ZA2 B;  2VKN A;  1B34 B;  1JEG A;  3SWN C;  1RAE B;  2RI5 A;  2B8A A;  1C6V X;  2E6N A;  2IN3 A;  2D8H A;  4J6X A;  1E6G A;  2L89 A;  2IVW A;  4C0Z A;  2LJ1 A;  1ARK A;  3LGF A;  2A36 A;  1M27 C;  3EHQ A;  5HK0 A;  1PD0 A;  3V8K A;  2DET A;  4KRD B;  2GTJ A;  5EFQ B;  3OW2 S;  1VA7 A;  1EIF A;  4QVC A;  2PZ1 A;  3RUX A;  5I21 A;  3VYH B;  5IDN B;  1Q7Y U;  2PK2 A;  2UUE B;  2R58 A;  2FYK A;  1UTI A;  1NBE B;  1RI9 A;  4PJO G;  3KHI A;  3UDC A;  4E7H A;  3T9N A;  3OY9 A;  2RI3 A;  3GIB A;  4DQ2 A;  2WMB B;  1IZ6 A;  1F1B B;  4EC8 B;  5FRO A;  1FMW A;  4ANJ A;  3RES A;  1UNL D;  1D0X A;  1YWP A;  4M7D C;  3QHS A;  2JTE A;  2OTL T;  1W70 A;  3R6O A;  1M1K C;  3VS6 A;  4MDX A;  3A8M B;  2A0F B;  4MZP A;  1D3U B;  4DOV A;  1X75 C;  2KRM A;  1YIT Q;  3DL1 A;  2QAS A;  2KE9 A;  3P8H A;  3LW5 E;  1KD1 U;  3EFS A;  1FKM A;  4QT7 A;  5IHN A;  2EJG A;  2EYQ A;  5IN1 A;  2OTJ Q;  4YTL A;  1RI0 A;  3TVT A;  1RAI B;  1AT1 B;  2HL5 C;  3JAM E;  1LVK A;  3DLM A;  1T0H A;  3E9F A;  2DKG A;  4M75 C;  1WXT A;  1M2O A;  1Y96 A;  4ZTF A;  3CCV A;  3PGG A;  1YHQ Q;  3ASK A;  1GRI A;  4XU1 A;  1OX8 A;  1BK2 A;  4A53 A;  1JJ2 A;  4NST B;  2HQX A;  2O2O A;  1G2B A;  2CDT A;  2ZZD B;  2F2X A;  4ZN1 A;  4M77 G;  2YT6 A;  3PNW C;  1VQ6 T;  1OX9 A;  1B34 A;  1C9B A;  2RK1 A;  2RQW A;  2R5M A;  1GBR A;  3BDU A;  1XJW B;  2YUO A;  1ZBJ A;  4KGZ B;  3A8O B;  4M7D F;  3DB3 A;  2KRO A;  2KR3 A;  1V29 B;  2EPD A;  1QVF A;  2X4Y A;  2FVU A;  5A0G A;  2FG0 A;  2J6K A;  4HKE A;  3UT1 A;  1VQO Q;  4FW2 A;  2HSP A;  4F6S B;  2KYB A;  3AT1 B;  1YN8 A;  3V7R A;  3CC7 Q;  1N27 A;  1AZG B;  1U1S A;  1AVZ C;  5KE3 A;  1UJ0 A;  3CCL A;  4PJO D;  3H41 A;  1OQK A;  5M9O A;  1SEM A;  4J9C A;  3HRS A;  2CZ7 B;  2LCL A;  3BE3 A;  1QVG P;  1H8K A;  1YBY A;  2LMJ A;  1QW1 A;  4CFV B;  3HZJ A;  4AKH A;  4HXJ A;  2DRK A;  1KC8 U;  2JS2 A;  1QVP A;  4M75 F;  2HBW A;  2ED0 A;  3CCR A;  2LJ3 A;  3BG3 A;  3CBO A;  4J9H A;  4JX6 A;  2GBQ A;  2YUP A;  1VQL T;  2IW8 B;  1W2B S;  5GAO m;  1AWO A;  1N8R R;  3EH2 A;  3A98 A;  1QMC A;  1K73 R;  2PQW A;  2DAQ A;  2DXU A;  2BIV A;  1UGS B;  4R0K A;  4BXX X;  1RAG B;  1CKB A;  1RAH B;  2HZY A;  2W9Z A;  2XHC A;  3OYB A;  4PJO A;  2NYS A;  3RKY A;  1PSE A;  1K9M C;  4C92 B;  1AWJ A;  3I9Q A;  2X1N B;  1C1A A;  3H6Z A;  1YJ9 T;  4HCC A;  1ZUK A;  2JM9 A;  2FZK B;  4BI4 A;  4I3Z B;  4BY6 C;  4LDU A;  4IUU A;  1OOT A;  2RI2 A;  4M7A G;  2LT1 A;  1MV0 B;  1H26 B;  3CMA A;  4CFU B;  4QVZ A;  1D0Z A;  5GAN j;  5HCK A;  5IHI A;  5FRM A;  1YIJ A;  3O5Z A;  1JOW A;  4MZT A;  1M2V B;  4ESR A;  1FWZ A;  2MWP A;  5GMK m;  3QJ6 A;  3CME A;  1WHL A;  2DBK A;  4EMK B;  4QVD A;  1ZHI A;  5IHK A;  3G4S A;  3JCM V;  2HCK A;  4J9G A;  2H8H A;  5AYF A;  5HBH B;  3LWI A;  3OYD A;  3CPF A;  2EJF A;  4EOR B;  1KQS S;  2A37 A;  1ZLM A;  2ZZD A;  1D1A A;  1Q81 U;  4RTT A;  2W99 A;  3OYM A;  2W96 A;  1YI2 Q;  1X43 A;  1NLP C;  3QWL A;  2GCX A;  2E4H A;  1QP3 A;  1WX6 A;  4DEY A;  3CCU T;  3OYA A;  3ULR B;  3NPF A;  5KH6 A;  3JCM b;  1WJQ A;  2M0O A;  5J39 A;  2GFU A;  4A4G A;  3GOX A;  1VQN T;  2DZ9 A;  3QDF A;  4M77 A;  4GLK A;  2H3E B;  1XO2 A;  5DQW A;  3OMG A;  3HBL A;  4EOL B;  1IO6 A;  2FHD A;  2KSS A;  2MI6 A;  1HD3 A;  3THK A;  4C92 D;  1O9K A;  1XOV A;  1TUC A;  3E1S A;  2RF0 A;  4N4G A;  1MMN A;  1ZA1 B;  1VQL Q;  2E5Q A;  2JUF A;  4C8Q C;  2GQI A;  4HNU A;  1X2Q A;  4CFU D;  1QQJ A;  2O9V A;  4AKI A;  4MDW A;  4BI3 A;  4C5H A;  4KRC B;  2JJ9 A;  4EOI B;  3URG A;  4EMH A;  2KNB B;  3UF4 A;  1S72 A;  3CPW P;  3WVD B;  5GJW B;  1D3B B;  3X26 B;  3QJY A;  2Y90 A;  2CJM B;  4C0D C;  2CZ1 B;  1WZO A;  4PJO E;  3KBG A;  1RAD B;  2NLU A;  4XTU A;  3L2V A;  5HK3 A;  3CCJ A;  2DM1 A;  1OU9 A;  3UAT A;  3JB9 F;  4M7A D;  3OSS C;  2XI9 A;  4M78 E;  1VIE A;  1MMD A;  2YWW A;  1MV3 A;  1UJY A;  2O01 E;  1WXB A;  1HYO A;  5DQV A;  2CCH B;  1FXX A;  2E64 A;  1VQ8 T;  4HT8 A;  3CCE T;  1VQ9 Q;  1NPR A;  4EC9 B;  2FO0 A;  3MJX A;  3CC2 T;  4F7U E;  3X25 B;  5GAO q;  1M2V A;  2QEX T;  4RCB A;  3SD4 A;  4BUG A;  2RMO A;  2DIQ A;  3LYI A;  4AG1 C;  3NHN A;  1VOM A;  1TUD A;  2YLC A;  4EMK A;  4OMF B;  5C6S A;  3MY5 B;  4M7A A;  2YHT A;  3FIF A;  2EAY A;  4C8Q F;  4MZM A;  4EOP B;  3OYK A;  4EMG A;  9ATC B;  2JZ2 A;  2K3X A;  4BDZ A;  1WDX A;  5FRN A;  1WHM A;  1YJW T;  1VQ5 T;  3X24 B;  2KGT A;  1Q86 R;  1E9H B;  1ABO A;  2CP0 A;  5CKF A;  3G71 A;  2BS3 A;  2B86 A;  3I56 T;  3GNF B;  3J7A F;  2JN0 A;  2NUT B;  3M0U A;  3I55 A;  4M77 E;  4YOZ A;  3VV0 A;  2HMA A;  5KYY B;  2C5V B;  5BNJ B;  3GBQ A;  5LJ3 j;  2EFI A;  1LPL A;  4DBH A;  1WLP B;  4N0A C;  3QKJ A;  1R8O B;  1OZ3 A;  2EWN A;  2XK0 A;  2VGN A;  2WSE E;  1TWB A;  2DPP B;  4II1 A;  2GQV A;  2DYI A;  2JVV A;  3MET A;  3CD6 Q;  3OYY A;  5A0D A;  1IHW A;  3VS1 A;  3MHX A;  2DXC A;  5DLQ E;  3SWN B;  3QYG B;  4B9W A;  2WSF E;  5L23 A;  4J8O A;  2ZPH B;  1S1N A;  4F7L B;  3MP6 A;  1P92 A;  2E10 A;  2JW4 A;  3VJP A;  4E7I A;  4PL6 A;  2KAF A;  2MK5 A;  4FIB A;  2HQH A;  5FWB A;  3C94 A;  3CCQ Q;  2DIG A;  4F14 A;  2WXV B;  2ESW A;  2MYS A;  1X6G A;  1ZX6 A;  1WHK A;  1ZQ1 A;  4XTW A;  1VYU A;  3MY1 B;  4EOK B;  5GMK j;  3CCE Q;  4M7D G;  3QG1 A;  3OS5 A;  1M1K R;  3CC2 Q;  2I0N A;  1SF9 A;  1O9S A;  3GLX A;  5LJ5 j;  1WQ7 A;  2QI2 A;  5EG2 A;  3C4S A;  1SG5 A;  3S6W A;  2QEX Q;  4BCG B;  3PIO A;  1Q82 C;  3BLR B;  5ECA A;  1LCK A;  1MHN A;  2HBP A;  1H92 A;  3QZ9 B;  1MND A;  2W9F A;  2AK5 A;  1AOJ A;  2E1H A;  3TW7 A;  2H3J A;  2E65 A;  3ZBD A;  2LX7 A;  3L1A A;  1N8R U;  4M7D B;  3FDR A;  3NTK A;  4XK8 E;  2QGS A;  4EOQ B;  1K73 U;  4FT4 A;  3L2R A;  3OQ5 A;  4M7A E;  3HRT A;  4MML A;  4JJD A;  1PSF A;  3ER0 A;  4M75 G;  2LNH B;  1IRX A;  5KYU B;  1B3Q A;  2P84 A;  5GAN 4;  3SHW A;  2O4X B;  3EG9 A;  4HL4 A;  5I11 A;  5CYI B;  1YJW Q;  1IGQ A;  3DB4 A;  1K8A C;  1JXO A;  2A3L A;  1GUX B;  4CC4 B;  1OKV B;  2ED1 A;  3CCS Q;  2KDS A;  3H0F A;  2YRV A;  3QPH A;  2L5Q A;  4D8K A;  1M1G A;  1H4L D;  1WA7 A;  2LTO A;  2DLP A;  2DL8 A;  1FVV B;  1NYF A;  4RTU A;  4XQ3 A;  2YLB A;  1GCP A;  5CK9 A;  4M75 B;  4OGC A;  3EG2 A;  1U5S A;  4Q5W A;  3WVE B;  3RMS A;  3QWY A;  2A08 A;  3CXC S;  4PFP A;  2RD1 A;  3ZL7 C;  3HFN A;  3NFC A;  1WHJ A;  2LRQ A;  1H24 B;  5CVI A;  4E7L A;  3JB9 H;  2ZPF B;  4E7J A;  1LJO A;  4JRQ A;  4FM4 B;  4J9D A;  2M02 A;  4KGX B;  5KE2 A;  2OI3 A;  2M0Y A;  1X6B A;  2P4R A;  3JRZ A;  1VQ4 A;  1IGU A;  2PJQ A;  2DYB A;  2I40 B;  2RNA A;  2RA2 A;  4VUB A;  3OW2 A;  4PJJ A;  3M53 A;  4F16 A;  5KCO A;  5KYW B;  4E7K A;  3SDZ A;  2WIP B;  1WJS A;  3H0H A;  5J26 A;  4KGV B;  2LQN A;  1H25 B;  2OJ2 A;  1GY3 B;  4RKU E;  4M7D D;  1VQK T;  5GAN 5;  2M9U A;  2XG8 D;  5ACB A;  2E3H A;  4JRK A;  2NUP B;  2CH4 A;  1FYN A;  2DXT A;  2CT4 A;  3ZFJ A;  4HVU A;  1V76 A;  4QQ6 A;  2AT1 B;  5DLO A;  4OF1 A;  3EFR A;  4DOW A;  2ABL A;  4LDW A;  4RTW A;  1BB9 A;  2YXY A;  2DVE A;  2UZD B;  1K9M R;  3O8V A;  3INZ A;  1PKT A;  2JGZ B;  4FL6 A;  2FEI A;  4PNO A;  3X20 B;  5GMK h;  2WMA B;  1O75 A;  4OB1 B;  2O9S A;  2K2V A;  3JCM P;  1ZSZ C;  4M75 D;  4HLQ A;  2FZC B;  1PKD B;  2VGM A;  2KQW A;  1FMV A;  5LJ5 h;  2XKO C;  2CP7 A;  3RKX A;  2RB6 A;  5HBE B;  3G6E Q;  4M7D A;  4KUL A;  2EGA A;  3CC4 Q;  1DJ7 B;  4AG2 C;  5FGK B;  2F5K A;  4FU6 A;  2RHY A;  1SHG A;  3NMZ C;  3M4Y A;  1K1Z A;  5KYU A;  2D8J A;  3OW2 P;  1OPK A;  2O4X A;  2KT1 A;  5KYX B;  4E2F B;  1QCF A;  2ZPG B;  4AT1 B;  3BHU B;  1N5Z A;  4FYY B;  4BY6 B;  1RAB B;  5HNB B;  4GY5 A;  1WYX A;  2QQS A;  2DBM A;  1NPP A;  4IUP A;  3FLG A;  3OBY A;  4B9X A;  3OYI A;  3MPU B;  1YIT A;  2VWF A;  2QAZ A;  3M4G A;  5GAO n;  4M75 A;  4F04 B;  4QW2 A;  4Y91 A;  2GF7 A;  3A8H B;  2X9H A;  6AT1 B;  1NLO C;  4XTV A;  4P5N A;  1PNJ A;  3HB9 A;  5IT9 E;  2ZPB B;  3CCR T;  4RUG A;  2PK9 B;  3REB B;  2V8I A;  1N9R A;  4F70 B;  2X51 A;  4KUI A;  4OMQ A;  4X9D A;  2QA4 Q;  5C0M A;  3E19 A;  4A54 A;  1YHQ A;  4ZTJ A;  2J6F A;  2QDJ A;  1K9A A;  7AT1 B;  3OB9 A;  4ZGJ B;  3FEO A;  1JO8 A;  2V1Q A;  4OMP A;  2PHG A;  4JZ3 A;  1ZUY A;  4KRT A;  1H28 B;  3V7S A;  5HBJ B;  1BI3 A;  1VQK Q;  1BI2 A;  3R6N A;  1Q86 U;  3M0T A;  3SB2 A;  5KYW A;  1AD6 A;  1JST B;  4PFZ A;  3CMA T;  2BS4 A;  1I0C A;  5GAM j;  5GMK i;  1U1T A;  2NUP A;  5GAM g;  3JCM X;  3BDL A;  1VQO A;  1Y0M A;  1PKS A;  3CC7 A;  4A4F A;  1W2B A;  2DNU A;  1K76 A;  3DKM A;  4IUQ A;  3QDR B;  5D6Y A;  5GAN 2;  1QLB A;  2W0Z A;  3HKS A;  3VS0 A;  4C8Q B;  1OKW B;  1VIF A;  1QVG S;  2RHU A;  4M6V A;  3M57 A;  1PD1 A;  1QCO A;  3OS0 A;  1AWW A;  2E5K A;  4UC4 A;  1ZSG A;  4JDS A;  3BHT B;  3P8D A;  4C0D B;  3VS3 A;  1SPK A;  1UDL A;  2ATC B;  2QGF B;  2DL4 A;  3M56 A;  3VRY A;  4A4H A;  3OYH A;  1NEB A;  4YC3 B;  3MEA A;  4C92 G;  4ZGE B;  2DX1 A;  4E47 A;  5J3B A;  3MI9 B;  2OTL Q;  2CP3 A;  1PWT A;  1JJ2 P;  2G9X B;  4RTY A;  3UWN A;  3JB9 D;  5EC7 A;  1PM3 A;  2QDL A;  3VS2 A;  2YDL A;  1EZZ B;  4BCQ B;  1QWE A;  1UHC A;  2KXC A;  4CC3 A;  1M1K U;  1M90 C;  2DD5 B;  2D1X A;  2HNI A;  1HSQ A;  1BIB A;  2IPO B;  4KBM B;  2AKL A;  4TVR A;  1GBQ A;  2CP5 A;  1WQW A;  1J3T A;  5KYN A;  3OYL A;  3VRZ A;  2FZG B;  1KQS A;  4JLG A;  2EJ9 A;  2OX7 A;  1UGP B;  4OGR B;  1QVF P;  3L2U A;  1C0M A;  1UGQ B;  4CC7 A;  4EDU A;  4PLI A;  5FU7 B;  1H1S B;  3KUF A;  5GAN d;  5GAN g;  1S72 T;  4XU2 A;  8ATC B;  3QWX X;  4BCM B;  1YFN A;  4R56 A;  1KFZ A;  5D6W A;  2CS7 A;  4J9I A;  1GH6 B;  4BCN B;  5IH2 A;  4C8Q D;  1PC0 A;  2RJF A;  4XAX B;  3CCJ T;  3SEM A;  1VQ6 Q;  1M3A A;  4BCF B;  3UA7 A;  2VB6 A;  2CH4 W;  4AFS C;  5ICP B;  4J83 A;  1YI2 A;  1AHJ B;  2JNG A;  2CZ6 B;  4M78 C;  2VVK A;  2LT4 A;  3LH0 A;  2COZ A;  1WPY A;  1OPL A;  1YJN T;  2RJE A;  3MO8 A;  4NL3 A;  5IAY A;  4EOJ B;  2RHZ A;  4IMY B;  2HKN A;  2V8J A;  2IIM A;  1QWF A;  1D09 B;  3MEW A;  2XMF A;  3BY7 A;  1CKA A;  3G33 B;  5GAM h;  4JLI A;  1I07 A;  4BCQ D;  2L2P A;  3OS1 A;  2LCS A;  2BUD A;  4PK4 A;  4BAC A;  4RG8 A;  4J5Y A;  1FX7 A;  2I2L A;  4NC6 A;  3VKG A;  4ZGD B;  2LP5 A;  3BLQ B;  3A8G B;  1K4U S;  2C5N B;  3VS5 A;  3M5A A;  2QYZ A;  2EYZ A;  3GF5 A;  1Q82 R;  3EGU A;  4KH0 B;  1YNZ A;  1AD5 A;  4OVA A;  1WGS A;  4LOC A;  3E9G A;  3J80 E;  4C5I A;  3HO8 A;  3EID B;  4DBF A;  3NDQ A;  4AMC A;  3CPW S;  3S3M A;  4C5G A;  3G71 T;  4N4H A;  2WPA B;  3C95 A;  1RL2 A;  2EQI A;  4BCM D;  2ZPE B;  4Z8A A;  2DE0 X;  2E70 A;  1Y57 A;  1QLY A;  4ROC A;  5GAN 8;  1UB4 A;  2RM4 A;  3M54 A;  2AHJ B;  1E7O A;  1VQ7 A;  4BCN D;  1D0Y A;  1N6A A;  3M0S A;  4BCO B;  2LJ0 A;  3OYE A;  1YJ9 Q;  1UNH D;  2D0N A;  3G1J A;  5GAM f;  2RJC A;  3EAE A;  3VU3 C;  1K9M U;  1I5L A;  4M78 F;  2F2V A;  2PUK B;  2RPN A;  1TSF A;  1K8A R;  1HXD A;  2K79 A;  1H3Z A;  5I5Z B;  4C92 A;  4D8D A;  4GLM A;  4BE2 A;  4BI8 B;  4JS4 A;  1QKX A;  1VQ9 A;  4YOS A;  2ZAE A;  1OEB A;  5DY9 A;  4OMM A;  1GXI E;  2HKQ B;  2LQW A;  1XTD A;  3QZ5 B;  3GTM S;  2UZE B;  5IXB A;  3M59 A;  2XDP A;  4F7U F;  2G77 A;  2K7A A;  1SHF A;  2KEA A;  1RLP C;  1JB0 E;  2KI7 A;  4X9C A;  3CCJ Q;  1H3H A;  3GNG A;  1H64 1;  2RK2 A;  3D7S B;  1SSH A;  2K5I A;  2VV5 A;  1F5Q B;  1MNE A;  4IUV A;  5GAN h;  4D6W A;  3L2Q A;  5GJV B;  4HVW A;  2A7Y A;  5FU7 C;  2Y4X A;  3VS7 A;  4WCI A;  4JX5 A;  2QQB A;  4L6V 5;  1QP2 A;  1Z9Q A;  5HVY B;  1G3Y A;  5A0L A;  4AFU C;  1YJN Q;  1BKB A;  3CCM T;  2HDA A;  3A5Z B;  3HTR A;  3G7Z A;  2QGG A;  3F70 A;  3CCU Q;  2FRY A;  3VKH A;  1UHF A;  2GGR A;  3TSW A;  1VQP T;  2DL3 A;  4N0A A;  1UEC A;  2C0O A;  2PMI B;  1VQN Q;  2L3P A;  2LNV A;  3MP1 A;  1VUB A;  3DOG B;  2VXF A;  5IXF A;  5IDP B;  2DA9 A;  2MOX A;  5CCA A;  2PU9 B;  5LMK B;  3EGD B;  4Z6Y A;  1RAC B;  3EOC B;  2KMG A;  3M0P A;  2DEU A;  4G6L B;  2DL7 A;  4OML A;  5LJ3 d;  2CCI B;  4QSH A;  5LJ3 g;  5GAO r;  3RKW A;  2V22 B;  1YP5 A;  2VC8 A;  3CD6 A;  2CKK A;  5GAN f;  3POM A;  1Q95 G;  1EX4 A;  1MUZ A;  1IHV A;  2BZY A;  3VUZ A;  3OA6 A;  5L8R E;  1JBM A;  1D1C A;  1KHI A;  1M30 A;  4MFE A;  4BBR M;  3RGF B;  2DJQ A;  1Z9Z A;  3EFO B;  2PVG B;  4BE0 A;  3S3O A;  3CCQ A;  3RDV A;  1GFC A;  4LD9 K;  3EG0 A;  3PVL A;  5HY6 A;  1KQ2 A;  1D3B A;  4FYW B;  1VYT A;  1BU2 A;  4C92 E;  4ELJ A;  1OUL A;  3CCE A;  2RQU A;  2VXE A;  3QUI A;  4X34 A;  1UE9 A;  1OU8 A;  1ZSZ B;  2KT8 A;  1VQ8 Q;  1RAF B;  3CC2 A;  3EG1 A;  4FX3 B;  4CFW B;  1WHG A;  2K4Y A;  2F1L A;  2RJD A;  1VQM T;  2QEX A;  5GAM e;  4IIO A;  4XTX A;  1G8X A;  4GBQ A;  5LJ5 d;  5LJ5 g;  4HCK A;  5FLX E;  3A1P A;  1I4K 1;  1SKU B;  3EG3 A;  3CBP A;  4AFZ C;  2BZX A;  4BCK B;  4BB7 A;  5IF1 B;  4WF2 A;  1R0C B;  2DD4 B;  4J9E A;  2G6F X;  1UG1 A;  2LC4 A;  1BCM A;  3FJ5 A;  3H9N A;  2KMT A;  1W98 B;  2OAW A;  2DRM A;  2PVD B;  2X4W A;  3CXC A;  2BTT A;  1H1Q B;  3CCM Q;  2GTO A;  5HKC A;  3EH1 A;  4NL2 A;  3NTI A;  2EQJ A;  4JRI A;  1WIE A;  1YJW A;  4MIM A;  2JM8 A;  1KG1 A;  2AZS A;  3I5R A;  1SSF A;  1IXD A;  1RAA B;  1VQP Q;  3CCS A;  1VQ5 Q;  1Q7Y C;  2D9T A;  3LH5 A;  2EKH A;  1AWX A;  3I56 Q;  1AIS B;  2WFY B;  1M8V A;  3F5X B;  2LX9 A;  4PKC C;  2MIO A;  2L3S A;  1FIN B;  3L42 A;  3OYJ A;  4Z88 A;  3HPW A;  4XU3 A;  2NUT A;  2RQV A;  3V8L A;  3OYG A;  3EGD A;  2LQ8 A;  2BE7 D;  5KYY A;  2EQK A;  2AKK A;  4EOO B;  1TU0 B;  4J7I A;  1MMA A;  2EYY A;  3UPU A;  3M0Q A;  2P0K A;  1TD6 A;  4JZ4 A;  4BY7 X;  2CP6 A;  2B9R A;  5LJ3 h;  2QDY B;  2DXB B;  2DFU A;  4ELL A;  3PO3 S;  3LQ5 B;  2MF2 A;  3SWN A;  1PRL C;  3JB9 I;  2LVM A;  5GAN e;  1KD1 C;  3OYC A;  1YIT T;  1OGU B;  4OP0 A;  1JRI A;  2LZ6 B;  1R0B G;  3CXC P;  2I53 A;  2BS2 A;  3PMI A;  3JCM Q;  4JPB W;  2CUB A;  3EHR A;  3X28 B;  3BG9 A;  1OV3 A;  2VYT A;  5CKH A;  2M1H A;  1HK9 A;  1GCQ C;  4DA4 A;  2CZ0 B;  2R7G A;  2FPF A;  1M5Q 1;  1VQM Q;  4QQD A;  1D1B A;  2QTV A;  1R77 A;  3EJ1 B;  1YHQ T;  3CBM A;  1AEY A;  4CI0 C;  1U8R A;  1ZSZ A;  1M90 R;  1ACM B;  2EGE A;  3M55 A;  3CCV T;  5L2W B;  1WJR A;  2AZV A;  4HA8 A;  1FMK A;  2KVQ G;  4X1V A;  2KXD A;  3VS4 A;  1YCS B;  2E3I A;  1Q82 U;  5LJ3 f;  2JMA A;  1U06 A;  2EGC A;  4FYV B;  3A8L B;  4QQG A;  5FU6 C;  1EFN A;  3DLL A;  1TUG B;  3G6E A;  2DD4 A;  5GAO p;  2ROT A;  2K5L A;  4O5V A;  3CC4 A;  1BI1 A;  4QKU A;  3BLH B;  2EW3 A;  2XDD A;  2COW A;  3P8B B;  2YUQ A;  4KT0 E;  1VQO T;  4ROD A;  2GFA A;  4KUD K;  2LDM A;  2ZGW A;  2HD0 A;  3KFV A;  2PTK A;  3CC7 T;  4Z89 A;  1G3N C;  2C4G B;  1NJI R;  1K8A U;  4JS5 A;  2Y4Y A;  3CCL T;  1GUX A;  2QG9 B;  4F17 A;  1KC8 C;  4A4E A;  2AIR B;  4E7Z A;  3IQL A;  2OAU A;  3HP9 A;  3JB9 G;  4M78 G;  1H1P B;  3GPL A;  2MWO A;  1ZP2 A;  1W4S A;  1OI1 A;  2DTH A;  2GNC A;  2E6Z A;  1G5V A;  3I35 A;  1CSK A;  5I2S A;  2OTJ A;  2LW4 A;  5CQX A;  1JQQ A;  1KK7 A;  2EYX A;  5LJ5 f;  4V2S A;  4F6W B;  3TRE A;  2QA4 A;  4PJO B;  3NTH A;  3H8Z A;  4AI6 A;  2MPX C;  4F7U G;  2E12 A;  1PCX A;  2EKO A;  3FC3 A;  2M51 A;  2R5A A;  3QBY A;  3FB9 A;  1BI0 A;  2DK3 A;  4M78 B;  3BW1 A;  2ROL A;  4F7J B;  2DXB A;  4Y28 E;  2CT3 A;  4LD6 A;  4LN2 A;  1VQK A;  4L59 A;  3HFO A;  2P0Q A;  2EUF A;  4ELZ C;  2RO0 A;  2IW9 B;  4ORZ A;  2COY A;  1QVG A;  4RMO A;  2DME A;  1TS9 A;  1TTH B;  2KY9 A;  1BBZ A;  2CSI A;  4C8Q G;  4F7U B;  3VYG B;  2WAC A;  1ABQ A;  1VOL A;  1K0X A;  2X35 A;  2JMC A;  2NWM A;  4CFM B;  2YRC A;  2EBP A;  4HNT A;  2F2W A;  5GAM d;  3CCV Q;  2FPE A;  1YIJ T;  4IUT A;  4LXC A;  4F7N B;  3B57 A;  4F6U B;  3NGP A;  1W6X A;  4EON B;  5CKB A;  1XNI A;  3PFS A;  4C5E A;  8AT1 B;  3CME T;  4OMN A;  3VKI A;  2QK0 A;  3G4S T;  1Q81 C;  2CP2 A;  3BHV B;  3RIR A;  2DJZ A;  2QF7 A;  4MFD A;  2WSC E;  3FRN A;  4AFQ C;  4YOO A;  3N5B B;  4JJB A;  1UEB A;  1YI2 T;  2X3X D;  3TSZ A;  4DBQ A;  2IG0 A;  4M7D E;  4FW1 A;  2L3R A;  3RMQ A;  5LJ3 e;  3MCA B;  3BG5 A;  3JCM c;  4B6M A;  3JB9 J;  4M77 B;  1P5E B;  3C0C A;  2WHB B;  2OTL A;  3CQT A;  1JJ2 S;  1I1J A;  2SRC A;  2K2M A;  3PIP A;  3O0G D;  2HL3 A;  1O9K B;  3CCL Q;  2D6F A;  4FCY A;  4CC2 A;  2ZPI B;  3U23 A;  4FT2 A;  4M78 D;  4WTO B;  5KYX A;  1WI7 A;  1NEG A;  4DBR A;  3MP8 A;  1M9S A;  5KCH A;  2LCC A;  1I5O B;  4M75 E;  2C5X B;  3MIA B;  4PFO A;  4LDY A;  4N4I A;  4RTX A;  1QVF S;  2EYW A;  3CCR Q;  1YCY A;  4HVV A;  4ROE A;  2V8K A;  1T3S A;  1A0N B;  1TG0 A;  1OZ2 A;  4BCP B;  1W2B P;  3PTA A;  3QO3 A;  4PJL A;  2JOY A;  4EOS B;  1OIY B;  4JUV A;  5GMK e;  1H27 B;  2VUB A;  3PVQ A;  1I8F A;  2FPD A;  1KJW A;  2K3B A;  1MGQ A;  1QCN A;  2X4J A;  4F7S B;  3JCM g;  3JCM d;  3JCM W;  1VQ7 T;  5LJ5 e;  1VYV A;  4M78 A;  2L8D A;  3OBW A;  4BBS M;  1NJI C;  4Y72 B;  1VQ6 A;  2IW6 B;  5I2M A;  3J81 E;  3OYF A;  2XDB A;  3M9Q A;  4PJO C;  4E6R A;  1B07 A;  1KQ1 A;  3CMA Q;  4J9B A;  2YUN A;  3RER A;  2X3W D;  1X01 A;  4RCC A;  1VQ9 T;  1YIJ Q;  1Y7X A;  2JT4 A;  5CEI B;  2CRE A;  4F7U A;  3VYG A;  5FWC A;  1X6O A;  4M77 D;  1UFF A;  5IHY A;  3CME Q;  1Y07 A;  4MMK A;  4FSX A;  4A63 B;  4M7A B;  3G4S Q;  5CR2 A;  3CPW A;  1JU5 C;  2DMO A;  4RG2 A;  1BU1 A;  4C0G A;  2CSQ A;  3PT9 A;  3OMC A;  2UZL B;  2C0T A;  1TOV A;  2X4X A;  4RTV A;  2DTI A;  5CQY A;  3OSV A;  1WXU A;  1KQS P;  2J06 A;  3RNJ A;  4OGE A;  4C8Q A;  4LNP A;  1N9S A;  3H0I A;  1MMG A;  2RHX A;  2F2C A;  4CRI A;  3LWH A;  2MMP A;  2ENM A;  3TNW B;  5D7U A;  1VQL A;  4BD3 A;  2P4T A;  4HT9 A;  1WFW A;  4ELY C;  1KSW A;  2KK4 A;  3ZEH A;  4OB0 B;  4DEX A;  5GAN 6;  1UGV A;  2K6D A;  1M3C A;  4J9F A;  1RLQ C;  2KR6 A;  1T3L A;  1M8M A;  3I55 T;  2RHI A;  2WJ9 A;  2DXC B;  1M4Z A;  2QQ9 A;  4PJO F;  1G3W A;  1ZBX A;  2EQU A;  2ZCF B;  1YJ9 A;  1M90 U;  1G3S A;  4OB3 B;  3L2Z A;  3REA B;  2MCN A;  4A4K A;  1VYW B;  4M77 C;  2KRN A;  4JX4 A;  3MKD A;  3CD6 T;  1HJD A;  4JJC A;  2QQR A;  4BCH B;  4CRL B;  1E7P A;  2DD5 A;  2RQT A;  3K7A M;  4J7F A;  1Q7Y R;  2FL7 A;  4IKF A;  4UN0 A;  4FYX B;  5LL6 S;  2PUO B;  2E41 A;  3AHU A;  1OL2 B;  4RTZ A;  1S72 Q;  2IVX A;  1PHT A;  1UGR B;  1KXU A;  2L0A A;  1VQ7 Q;  2DEQ A;  2DO3 A;  4IUR A;  5D6X A;  3CCQ T;  1URC B;  2J7I A;  5GAN 3;  3QII A;  2YRD A;  4PJN A;  1U3O A;  1BCO A;  4ME7 A;  2RQR A;  2KRS A;  2K3Y A;  1YWO A;  5AT1 B;  2C06 A;  3SFM A;  2W2H A;  3E2U A;  1NJI U;  2BZ8 A;  3DDQ B;  2HEQ A;  1T0J A;  4J6Y A;  3HSB A;  3L2W A;  1M1F A;  2FB7 A;  1KIK A;  3DTO A;  4KH1 B;  4ZN3 A;  2DF6 A;  1YJN A;  4LUD A;  5GAN 7;  3JCM h;  4J6W A;  4LUE A;  4NS5 A;  1ENW A;  4C92 C;  4PLL A;  4XU0 A;  3M58 A;  1UUE A;  3CCU A;  3CEY A;  1KD1 R;  3RR6 A;  2BKZ B;  1OIU B;  2SEM A;  5CO7 A;  3S3N A;  2K9G A;  4O6J A;  2CYZ B;  1N8R C;  2DER A;  1NG2 A;  2CGH A;  3WXM B;  1K73 C;  1VQN A;  2ECZ A;  1QKW A;  2M16 A;  2NUZ A;  2LQK A;  3JSC A;  5LQF B;  4BY1 X;  3EG9 B;  3Q1J A;  4LE9 A;  1UNG D;  2J6O A;  4M77 F;  2F5T X;  2W10 A;  3UA6 A;  4C8Q E;  4CFX B;  1RUW A;  1PG5 B;  1LNX A;  3TQ7 P;  4CFN B;  3PE0 A;  3EGX B;  4IIM A;  1XQH A;  4EMK C;  2L3Q A;  1X2K A;  3M0R A;  2V1R A;  4XTY A;  4M7A C;  2PVO B;  3CCS T;  3RBB B;  2QXF A;  3JCM f;  4ATO A;  3QYH B;  5FW9 A;  5CIU A;  2V26 A;  3V7C A;  3G71 Q;  3GP8 A;  4HNV A;  3FJP A;  3TU4 K;  5DM7 R;  1BYM A;  3I55 Q;  2XIC A;  3HHT B;  3TNH B;  3V8J A;  2DTO A;  3HRU A;  1Y71 A;  4OB2 B;  5HQ0 B;  1BIA A;  3KXT A;  1NM7 A;  1LOJ A;  1JKW A;  1E6H A;  2HQE A;  1WHH A;  2HAX A;  2A28 A;  3PMT A;  4HCB A;  1TFB A;  2HSE B;  4C92 F;  5GAO l;  1VQ8 A;  4Z02 A;  2QQA A;  2DVJ A;  1JXM A;  5I22 A;  5FU6 B;  2Z0W A;  5CAI A;  1G3T A;  2EIF A;  2K57 A;  4R55 A;  3DJB A;  1VQ4 T;  1X69 A;  1KC8 R;  2C5O B;  2O88 A;  3DDP B;  1OI9 B;  2EQM A;  2J05 A;  3ME9 A;  4BCI B;  3H4C A;  3LLR A;  1NE8 A;  1GL5 A;  4LDV A;  2JS0 A;  1V1C A;  1IRE B;  1W1F A;  1VIN A;  2WEV B;  3CCM A;  3BFM A;  4K11 A;  3QSU A;  4M7A F;  4L5G A;  4PJM A;  3QHW B;  2QTX A;  4TTH A;  3QYE A;  2KYM A;  2XD0 A;  1I81 A;  5GMK l;  3JCM J;  1VQP A;  2QFZ A;  1VQ5 A;  1B7T A;  1ZUU A;  2R57 A;  1PRM C;  2DIL A;  4EPC A;  1M3B A;  2P0P A;  1KHC A;  3I56 A;  4NOY A;  2D0Q B;  2UZB B;  2K5F A;  2XU8 A;  4BE1 A;  1OL1 B;  1X27 A;  3MEV A; 
#chains in the Genus database with same CATH homology
 5FU7 B;  2DIQ A;  3LYI A;  5EJC A;  3KUF A;  5GAN d;  5GAN g;  1S72 T;  5I2S A;  4XU2 A;  2OTJ A;  5CQX A;  1NZ9 A;  5LJ5 f;  3G6E T;  4R56 A;  4V2S A;  2YLC A;  4EMK A;  3TRE A;  2QA4 A;  3LX7 A;  4PJO B;  2DZC A;  2MAM A;  3CC4 T;  3NTH A;  3H8Z A;  4AI6 A;  4XTZ A;  5D6W A;  4F7U G;  2CS7 A;  3HL8 A;  4OMF B;  5C6S A;  2JTF A;  4M7A A;  2E12 A;  2YHT A;  3FIF A;  2RH2 A;  2RJF A;  2EKO A;  2EAY A;  4XAX B;  4C8Q D;  3FC3 A;  3TW6 A;  2R5A A;  4MZM A;  4C8Q F;  3CCJ T;  3OYK A;  4EMG A;  3QBY A;  5CKD A;  3FB9 A;  1BI0 A;  2DK3 A;  4M78 B;  2JZ2 A;  2K3X A;  3BW1 A;  5CKE A;  2DXB A;  4Y28 E;  4BDZ A;  4J83 A;  3MEU A;  1WNL A;  1AHJ B;  4LD6 A;  1YI2 A;  2F69 A;  4L59 A;  3HFO A;  1VQK A;  2JTM A;  2P0Q A;  5FRN A;  4ELZ C;  2JNG A;  2CZ6 B;  1YJW T;  2RO0 A;  4M78 C;  1VQ5 T;  3X24 B;  1QVG A;  2LT4 A;  3LH0 A;  3LGL A;  3OYN A;  4AKG A;  4RMO A;  3QXE B;  5CKF A;  3G71 A;  1WPY A;  4BDY A;  2BS3 A;  1YJN T;  3I56 T;  2RJE A;  3GNF B;  3J7A F;  2KY9 A;  2JN0 A;  3MO8 A;  3TEE A;  4C8Q G;  4F7U B;  4NL3 A;  2BKD N;  3I55 A;  5IAY A;  3VYG B;  2WAC A;  4M77 E;  3VV0 A;  2RHZ A;  2X35 A;  3TCJ A;  3JCM e;  4HCZ A;  5LJ3 j;  3CCU T;  2EFI A;  2V8J A;  2G3R A;  2XID A;  1Y96 B;  4HNT A;  3MEW A;  5GAM d;  3BY7 A;  3QYB A;  1YIJ T;  4N0A C;  3QKJ A;  1R8O B;  1OZ3 A;  2EWN A;  2XK0 A;  2VGN A;  2WSE E;  4IUT A;  5GAM h;  5A2Q E;  2OTJ T;  2DPP B;  4JLI A;  4II1 A;  2GQV A;  4C0F A;  2JVV A;  3MET A;  1VQM A;  5CKB A;  3OS1 A;  1XNI A;  3PFS A;  2QQ8 A;  4C5E A;  2QA4 T;  2BUD A;  3OYY A;  5A0D A;  4BAC A;  4RG8 A;  4J5Y A;  3CME T;  1FX7 A;  3MHX A;  2I2L A;  3VKI A;  3VUB A;  2DXC A;  4NC6 A;  3VKG A;  4ZGD B;  5DLQ E;  3G4S T;  1Q81 C;  3SWN B;  3QYG B;  3RIR A;  2DJZ A;  2QF7 A;  3A8G B;  4B9W A;  2WSF E;  4MFD A;  1OYX A;  4J8O A;  2ZPH B;  3M5A A;  3OS2 A;  2WSC E;  4LDX A;  4JJN K;  3C12 A;  1Q86 C;  3GF5 A;  3FRN A;  3MP6 A;  4JRP A;  1P92 A;  1TH7 A;  2E10 A;  3N5B B;  1B34 B;  1UEB A;  3VJP A;  4E7I A;  4OVA A;  1YI2 T;  4PL6 A;  3SWN C;  1WGS A;  4LOC A;  3E9G A;  2KAF A;  3J80 E;  2RI5 A;  4C5I A;  3HO8 A;  2IG0 A;  2B8A A;  2L3R A;  4FIB A;  4M7D E;  3C94 A;  3CPW S;  3RMQ A;  2E6N A;  4C5G A;  2DIG A;  5LJ3 e;  3G71 T;  3MCA B;  3S3M A;  4N4H A;  3BG5 A;  3C95 A;  3JCM c;  3JB9 J;  1RL2 A;  1ZQ1 A;  4M77 B;  4XTW A;  2ZPE B;  2OTL A;  4J6X A;  2E70 A;  1JJ2 S;  2L89 A;  5GAN 8;  2IVW A;  4C0Z A;  3PIP A;  1UB4 A;  3LGF A;  2RM4 A;  3M54 A;  2AHJ B;  1VQ7 A;  1N6A A;  2D6F A;  5HK0 A;  3V8K A;  5GMK j;  4M7D G;  3QG1 A;  3OS5 A;  3OYE A;  3OW2 S;  5GAM f;  2ZPI B;  2RJC A;  3EAE A;  4FT2 A;  4M78 D;  3VU3 C;  1K9M U;  1EIF A;  4QVC A;  1I5L A;  1Q7Y C;  4M78 F;  1O9S A;  2PUK B;  3GLX A;  5LJ5 j;  3RUX A;  5I21 A;  3VYH B;  1HXD A;  1WQ7 A;  2QI2 A;  3MP8 A;  1H3Z A;  5EG2 A;  4C92 A;  3C4S A;  1Q7Y U;  1M9S A;  3S6W A;  5KCH A;  4BE2 A;  2R58 A;  3PIO A;  4BI8 B;  1Q82 C;  2FYK A;  2LCC A;  4M75 E;  4JS4 A;  1VQ9 A;  4LDY A;  4N4I A;  4PJO G;  1MHN A;  2HBP A;  3KHI A;  5DY9 A;  1QVF S;  3QZ9 B;  1GXI E;  3UDC A;  1XTD A;  1YCY A;  3QZ5 B;  2E1H A;  4E7H A;  3T9N A;  3TW7 A;  2H3J A;  2E65 A;  2V8K A;  3M59 A;  3ZBD A;  2XDP A;  4F7U F;  3L1A A;  1N8R U;  3OY9 A;  2RI3 A;  2G77 A;  4DQ2 A;  3FDR A;  3NTK A;  3GIB A;  4M7D B;  1OZ2 A;  4XK8 E;  1IZ6 A;  1JB0 E;  4X9C A;  4FT4 A;  3L2R A;  3GNG A;  1H64 1;  1K73 U;  3OQ5 A;  3PTA A;  3HRT A;  3QO3 A;  5FRO A;  4MML A;  2RK2 A;  4M7A E;  1PSF A;  2JOY A;  3ER0 A;  4M75 G;  2K5I A;  2VV5 A;  3RES A;  4IUV A;  4JUV A;  5GMK e;  2VUB A;  4M7D C;  3QHS A;  1I8F A;  5GAN 4;  2OTL T;  5GAN h;  2O4X B;  4D6W A;  3L2Q A;  3R6O A;  1MGQ A;  4HL4 A;  1M1K C;  3JCM W;  2A7Y A;  2X4J A;  3JCM g;  3JCM d;  1VQ7 T;  5LJ5 e;  5FU7 C;  2Y4X A;  4MDX A;  3DB4 A;  4M78 A;  2L8D A;  3A8M B;  4JX5 A;  2A3L A;  2QQB A;  4L6V 5;  3OBW A;  4BBS M;  1QP2 A;  4MZP A;  1K8A C;  1G3Y A;  2KDS A;  5A0L A;  1NJI C;  4DOV A;  1BKB A;  1X75 C;  2YRV A;  1VQ6 A;  5I2M A;  3J81 E;  3QPH A;  3OYF A;  2L5Q A;  3DL1 A;  1M1G A;  3CCM T;  2XDB A;  3M9Q A;  2LTO A;  4PJO C;  3A5Z B;  3P8H A;  3G7Z A;  1KQ1 A;  4XQ3 A;  3F70 A;  3LW5 E;  2YLB A;  5CK9 A;  1KD1 U;  3EFS A;  4M75 B;  3RER A;  1FKM A;  3VKH A;  4OGC A;  1X01 A;  4RCC A;  2EJG A;  1VQ9 T;  2EYQ A;  4Q5W A;  3WVE B;  1Y7X A;  3RMS A;  1VQP T;  5IN1 A;  4YTL A;  1RI0 A;  4N0A A;  4F7U A;  3CXC S;  3VYG A;  4BUG A;  1X6O A;  3JAM E;  3DLM A;  2RD1 A;  3E9F A;  4M77 D;  2DKG A;  2LNV A;  3MP1 A;  1VUB A;  3HFN A;  3NFC A;  4M75 C;  2VXF A;  1Y07 A;  4MMK A;  4FSX A;  1Y96 A;  5CCA A;  2PU9 B;  4ZTF A;  4Z6Y A;  2LRQ A;  4M7A B;  2KMG A;  5CR2 A;  3PGG A;  3CCV A;  3ASK A;  3CPW A;  5CVI A;  4XU1 A;  4E7L A;  3JB9 H;  2ZPF B;  4E7J A;  4RG2 A;  5LJ3 d;  5LJ3 g;  4QSH A;  5GAO r;  1LJO A;  3RKW A;  4JRQ A;  4C0G A;  2VC8 A;  4FM4 B;  3PT9 A;  3OMC A;  4A53 A;  3CD6 A;  5KE2 A;  2X4X A;  2CKK A;  5GAN f;  3JRZ A;  1VQ4 A;  1JJ2 A;  2DTI A;  5CQY A;  3OSV A;  2HQX A;  2ZZD B;  4OGE A;  4C8Q A;  1N9S A;  4ZN1 A;  2RA2 A;  3VUZ A;  4M77 G;  4VUB A;  5L8R E;  3OA6 A;  3OW2 A;  1JBM A;  2RHX A;  1KHI A;  3PNW C;  4CRI A;  1VQ6 T;  3LWH A;  3M53 A;  4MFE A;  1B34 A;  5KCO A;  2MMP A;  2RK1 A;  4BBR M;  2R5M A;  4E7K A;  3BDU A;  3SDZ A;  1VQL A;  4BD3 A;  1WJS A;  2P4T A;  5J26 A;  4RKU E;  4HT9 A;  4ELY C;  4M7D D;  3A8O B;  1VQK T;  2PVG B;  5GAN 5;  4BE0 A;  3CCQ A;  2KK4 A;  3S3O A;  4M7D F;  2M9U A;  2XG8 D;  3DB3 A;  4JRK A;  1V29 B;  2DXT A;  3ZEH A;  1QVF A;  2X4Y A;  2FVU A;  3ZFJ A;  4HKE A;  3UT1 A;  4OB0 B;  5A0G A;  4LD9 K;  5GAN 6;  5HY6 A;  1KQ2 A;  1D3B A;  4QQ6 A;  3V7R A;  1N27 A;  5DLO A;  2KR6 A;  1U1S A;  4OF1 A;  3I55 T;  3EFR A;  4DOW A;  2RHI A;  4LDW A;  5KE3 A;  2WJ9 A;  3CCL A;  4C92 E;  4PJO D;  2DXC B;  4ELJ A;  1M4Z A;  3CCE A;  2QQ9 A;  2VXE A;  4PJO F;  1G3W A;  1ZBX A;  2EQU A;  2ZCF B;  3QUI A;  4X34 A;  5M9O A;  1YJ9 A;  3HRS A;  1M90 U;  1G3S A;  4OB3 B;  3L2Z A;  4A4K A;  2CZ7 B;  2DVE A;  2LCL A;  4M77 C;  3CD6 T;  4JX4 A;  3O8V A;  3CC2 A;  3INZ A;  1YBY A;  2QQR A;  1E7P A;  2DD5 A;  4FL6 A;  2K4Y A;  4PNO A;  3X20 B;  2RJD A;  1QW1 A;  5GMK h;  1VQM T;  4J7F A;  2QEX A;  2FL7 A;  5GAM e;  3HZJ A;  4AKH A;  1O75 A;  4OB1 B;  4XTX A;  4IKF A;  2K2V A;  3JCM P;  4M75 D;  1KC8 U;  5LJ5 d;  4HLQ A;  5LL6 S;  5LJ5 g;  2VGM A;  5FLX E;  2KQW A;  1QVP A;  2PUO B;  4M75 F;  1I4K 1;  5LJ5 h;  2E41 A;  2XKO C;  3CCR A;  3RKX A;  3AHU A;  2RB6 A;  3BG3 A;  3CBO A;  4JX6 A;  3CBP A;  1VQL T;  4M7D A;  4KUL A;  4WF2 A;  4BB7 A;  5GAO m;  1W2B S;  2DD4 B;  1UGR B;  1DJ7 B;  2LC4 A;  2DEQ A;  2DO3 A;  4IUR A;  5D6X A;  2KMT A;  2F5K A;  2DAQ A;  2PQW A;  4FU6 A;  3CCQ T;  2RHY A;  2DXU A;  2PVD B;  5GAN 3;  3M4Y A;  2X4W A;  2BIV A;  1UGS B;  3QII A;  3CXC A;  4ME7 A;  2O4X A;  2K3Y A;  5HKC A;  4NL2 A;  2C06 A;  3SFM A;  2ZPG B;  3NTI A;  2EQJ A;  4JRI A;  2XHC A;  4PJO A;  3OYB A;  4BY6 B;  3RKY A;  1NJI U;  1PSE A;  1YJW A;  1K9M C;  4MIM A;  4C92 B;  1KG1 A;  4J6Y A;  3HSB A;  4GY5 A;  2QQS A;  1M1F A;  3L2W A;  2FB7 A;  3H6Z A;  1SSF A;  1YJ9 T;  4HCC A;  3CCS A;  4ZN3 A;  1NPP A;  4IUP A;  1YJN A;  4BI4 A;  5GAN 7;  2D9T A;  3FLG A;  3OBY A;  4J6W A;  4NS5 A;  3JCM h;  4B9X A;  3OYI A;  1YIT A;  4BY6 C;  4LDU A;  4IUU A;  4C92 C;  2RI2 A;  4PLL A;  4M7A G;  2LT1 A;  3M4G A;  4XU0 A;  3M58 A;  5GAO n;  4M75 A;  3CMA A;  4QW2 A;  3CCU A;  4QVZ A;  4Y91 A;  3CEY A;  1M8V A;  2GF7 A;  2LX9 A;  3A8H B;  5GAN j;  5CO7 A;  3S3N A;  4PKC C;  4XTV A;  5FRM A;  4P5N A;  1YIJ A;  4MZT A;  4O6J A;  2CYZ B;  1N8R C;  3HB9 A;  3L42 A;  3OYJ A;  5IT9 E;  2ZPB B;  2CGH A;  3CCR T;  3WXM B;  3HPW A;  4XU3 A;  1K73 C;  1FWZ A;  2V8I A;  2MWP A;  3V8L A;  1N9R A;  3QJ6 A;  5GMK m;  1VQN A;  4KUI A;  3OYG A;  2M16 A;  3JSC A;  2LQK A;  3CME A;  4X9D A;  1G5V A;  2LQ8 A;  3Q1J A;  4EMK B;  4QVD A;  1ZHI A;  5C0M A;  2EQK A;  3G4S A;  3E19 A;  4M77 F;  3JCM V;  4A54 A;  2F5T X;  1YHQ A;  4ZTJ A;  5AYF A;  2QDJ A;  4C8Q E;  4J7I A;  1LNX A;  3LWI A;  3OB9 A;  4ZGJ B;  3FEO A;  3OYD A;  3CPF A;  3UPU A;  2EJF A;  2P0K A;  1XQH A;  1KQS S;  4EMK C;  2ZZD A;  5LJ3 h;  1Q81 U;  2QDY B;  2DXB B;  3V7S A;  3OYM A;  1BI3 A;  4XTY A;  4M7A C;  1BI2 A;  2MF2 A;  2PVO B;  3SWN A;  3CCS T;  3JB9 I;  2LVM A;  5GAN e;  2QXF A;  3QWL A;  2GCX A;  1Q86 U;  1KD1 C;  3SB2 A;  3JCM f;  3OYC A;  1YIT T;  3QYH B;  4ATO A;  4OP0 A;  1JRI A;  5CIU A;  3V7C A;  3GP8 A;  4HNV A;  3FJP A;  1QP3 A;  3TU4 K;  5DM7 R;  1BYM A;  3CMA T;  2BS2 A;  2BS4 A;  3PMI A;  3JCM Q;  2XIC A;  3JCM b;  3HHT B;  5KH6 A;  5GAM j;  5GMK i;  3OYA A;  3X28 B;  3BG9 A;  1U1T A;  3V8J A;  5GAM g;  3JCM X;  1WJQ A;  2DTO A;  2VYT A;  2M0O A;  3BDL A;  5J39 A;  5CKH A;  2M1H A;  2GFU A;  3HRU A;  1HK9 A;  1Y71 A;  4OB2 B;  4A4G A;  3GOX A;  1BIA A;  1VQO A;  4DA4 A;  1VQN T;  2DZ9 A;  3KXT A;  2CZ0 B;  4M77 A;  1LOJ A;  3CC7 A;  4GLK A;  4A4F A;  2HQE A;  1W2B A;  3DKM A;  1M5Q 1;  4IUQ A;  3OMG A;  3QDR B;  4QQD A;  2HAX A;  5D6Y A;  3HBL A;  2FHD A;  2KSS A;  2MI6 A;  5GAN 2;  3PMT A;  4HCB A;  1QLB A;  3HKS A;  3CBM A;  4C8Q B;  4C92 D;  1YHQ T;  4CI0 C;  4C92 F;  1VIF A;  1XOV A;  1U8R A;  5GAO l;  3M55 A;  1QVG S;  3CCV T;  1VQ8 A;  2RHU A;  4M6V A;  3E1S A;  3M57 A;  1WJR A;  4HA8 A;  4Z02 A;  2QQA A;  4N4G A;  2KVQ G;  5FU6 B;  3OS0 A;  2E5Q A;  2JUF A;  4UC4 A;  4C8Q C;  5LJ3 f;  1Q82 U;  4JDS A;  1G3T A;  2EIF A;  2K57 A;  5CAI A;  4R55 A;  1VQ4 T;  4HNU A;  4BI3 A;  4C5H A;  4MDW A;  4AKI A;  3P8D A;  4C0D B;  3A8L B;  3M56 A;  4QQG A;  4A4H A;  3URG A;  3OYH A;  4EMH A;  5FU6 C;  2EQM A;  3ME9 A;  1S72 A;  3DLL A;  3MEA A;  4C92 G;  4ZGE B;  3H4C A;  4E47 A;  3G6E A;  3WVD B;  2DD4 A;  5GAO p;  1D3B B;  3X26 B;  2K5L A;  2Y90 A;  3LLR A;  1NE8 A;  3QJY A;  5J3B A;  4C0D C;  4O5V A;  2CZ1 B;  1BI1 A;  3CC4 A;  4LDV A;  4PJO E;  3KBG A;  2NLU A;  4XTU A;  2XDD A;  3UWN A;  3P8B B;  5HK3 A;  3L2V A;  3JB9 D;  3CCJ A;  1IRE B;  4KT0 E;  1VQO T;  3JB9 F;  2GFA A;  4KUD K;  4M7A D;  2LDM A;  3CCM A;  2ZGW A;  2XI9 A;  2HD0 A;  3BFM A;  3OSS C;  1M1K U;  3QSU A;  4M7A F;  4M78 E;  3CC7 T;  1M90 C;  1VIE A;  4L5G A;  2DD5 B;  2HNI A;  2QTX A;  1K8A U;  2O01 E;  4JS5 A;  1BIB A;  2Y4Y A;  3QYE A;  4KBM B;  2XD0 A;  1I81 A;  5GMK l;  4TVR A;  3JCM J;  1FXX A;  1WQW A;  2E64 A;  2QFZ A;  1VQP A;  3CCL T;  1VQ5 A;  1VQ8 T;  4HT8 A;  3CCE T;  2R57 A;  4EPC A;  1NPR A;  3OYL A;  1KC8 C;  2P0P A;  4A4E A;  1KQS A;  1KHC A;  4JLG A;  2EJ9 A;  3I56 A;  4NOY A;  2D0Q B;  2OAU A;  2K5F A;  3HP9 A;  1UGP B;  3CC2 T;  3JB9 G;  3L2U A;  4F7U E;  4M78 G;  3X25 B;  1UGQ B;  4EDU A;  3GPL A;  2MWO A;  2XU8 A;  4BE1 A;  1W4S A;  4PLI A;  5GAO q;  1OI1 A;  2DTH A;  2QEX T;  3MEV A;  4RCB A;  3SD4 A;  2E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...