2ZCFB

Mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 56
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zcfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zcfB02
3A8MB 3X26B 2CZ1B 1PSFA 4XK8E 2D0QB 2DXCA 2O01E 2ZZDB 3WVEB 3X28B 3A8HB 3A8GB 2ZPHB 2PUKB 2WSEE 2WSFE 3QZ5B 2DPPB 2PU9B 2CZ0B 2DD5A 4ZGDB 1UGPB 4ZGEB 3X24B 3LW5E 3QYHB 1UGRB 3A8LB 2ZCFB 2QDYB 4ZGJB 3VYGB 1UGQB 2CYZB 1DJ7B 3HHTB 1UGSB 4OB0B 2ZPBB 2DXBA 1PSEA 2ZPEB 3QZ9B 4OB1B 1IREB 3QYGB 2DD4B 2ZPFB 4L6V5 2ZPGB 2CZ7B 1V29B 2ZZDA 3QXEB 3VYGA 1GXIE 4RKUE 3A8OB 1JB0E 4Y28E 3VYHB 4KT0E 2CZ6B 2AHJB 4OB2B 3X25B 2DD4A 2PVDB 2PVOB 1AHJB 2DD5B 3X20B 5L8RE 2PVGB 3WVDB 2PUOB 2DXCB 1QP2A 2ZPIB 4FM4B 2DXBB 2WSCE 1QP3A 4OB3B
chains in the Genus database with same CATH superfamily
4J9HA 1UUEA 3UWNA 2RHYA 1UGVA 1ZA2B 3BG9A 2WIHB 1AZEA 4ROCA 2V8JA 3JCMg 4D8DA 2LTOA 3MHXA 4J7FA 4XK8E 3OA6A 3QDRB 4RTXA 2L0AA 1VQPA 3BDLA 2A08A 1KD1C 4EORB 3CCQQ 4XTUA 5DQVA 3BDUA 2ENMA 4Z88A 4D6WA 2C5VB 5GANd 3QDFA 3G1JA 2EQIA 4BCFB 3DB3A 3DLLA 4X1VA 2DJQA 2FPFA 4M4ZA 5FLXE 4QT7A 3BE3A 2K4YA 4OMPA 2AKKA 5IXBA 3EFOA 1QCNA 1M90C 1YJNT 1YHQQ 4HXJA 1SG5A 4EC9B 1RAAB 4M78B 1T3SA 3BLQB 4BI4A 2CH4A 1KQSP 1SSFA 2F2WA 4FW1A 2RMOA 4KH0B 4NS5A 4PJLA 5IAYA 4BCGB 2NWMA 5GANe 1W4SA 1KG1A 5CVIA 3CCSQ 1U5SA 2ZZDA 1IHVA 4PJOB 1RAEB 3POMA 1I1JA 5I2MA 2XICA 1OX9A 4RCCA 2RJEA 1F5QB 4J9CA 2KRNA 2DFUA 1NJIR 3K7AM 4LDYA 4OMMA 3HTRA 2JNGA 2V8IA 3GNGA 1FX7A 4ZTFA 5GJVB 4C5GA 3EG0A 1WHJA 2DTIA 5FWCA 4F7UA 2JW4A 2ATCB 1MMAA 3EHRA 3VKHA 2EQKA 4TVRA 1Y96B 2K2MA 4ZN3A 1WPYA 1VQ8A 3WVDB 5FU6B 3R6NA 4A54A 3CPWA 4JX4A 1UNHD 2DL8A 3Q1JA 1K9MC 4JZ3A 4M78E 5CKEA 3CMAT 2IW8B 1M3AA 2RF0A 1D0YA 3O8VA 2DXCA 3UATA 4EMGA 2E3IA 2RA2A 3EH2A 2W99A 2KYMA 2EFIA 4PJOE 1M8VA 4J8OA 2JMCA 2LW4A 2RH2A 4GY5A 4F7UF 2LQKA 2BIVA 2DRKA 2EGAA 1ZX6A 1WXUA 1PD1A 2QDLA 2FPEA 3RKXA 2J05A 2EAYA 3H6ZA 2DD5A 4PLLA 4E2FB 3CC7T 4HNTA 1YI2Q 1KHIA 3RESA 4FIBA 3HRUA 5HK3A 1WYXA 3DKMA 3FJ5A 2X3WD 3MY5B 1GRIA 2VB6A 1M1KR 1D3UB 1G83A 5AT1B 5IHIA 3CXCS 3E1SA 1SKUB 4J9DA 4BY1X 1XJWB 2FRWA 3QUIA 3JV3A 5CIUA 2DXUA 2X35A 1K0SA 3E9GA 2B9RA 5LJ5h 3F70A 1TUGB 3V7SA 3PGGA 1A0NB 2MWPA 2ZPEB 3QZ9B 2HQEA 3RNJA 2YUOA 1KXUA 5GAMd 2GQVA 1Q7YR 2CP7A 5J39A 3I56T 3UA7A 1K8AR 4M75E 4M6VA 1M9SA 1XQHA 1QMZB 2WMBB 1AWWA 3PE0A 1ZBXA 2KNBB 1FINB 1GL5A 5CAIA 2VGNA 4BCQB 1AEYA 1TS9A 3OW2P 3G71T 3EFSA 5C0MA 4HA8A 3VRZA 4LN2A 2E3HA 4II1A 1R77A 1WQ7A 3H0HA 2EW3A 3H41A 4JJDA 4CFVB 4ESRA 5IT9E 1TH7A 3ZEHA 1D09B 2K5IA 1WXBA 2MAMA 3MEAA 4ELJA 1RAFB 2DXCB 2GFAA 1B7TA 2DF6A 2FRYA 4KGVB 3SEMA 2CP0A 3CMAQ 3NTKA 3L2UA 1YCYA 1VQ4T 3PFSA 3OYKA 4RTVA 4JUVA 3OYAA 4FYVB 1AWXA 2PNIA 4N4HA 3P8DA 2QQAA 2MF2A 2ZGWA 4EOLB 2YWWA 1YCSB 2SRCA 3CC7Q 4YC3B 1KSWA 3CC4A 2V1QA 4RG2A 3PIPA 3JCMe 1WXTA 4ZGDB 2H8HA 2KT8A 4MDWA 3FLGA 1YHQA 1D0ZA 1VQKT 4R55A 1LVKA 3LWHA 3M58A 4NC6A 2A3LA 3UT1A 1Z9QA 5KCHA 2LCLA 2AZSA 3QPHA 5DM7R 5CQXA 2PJQA 5CCAA 1H3ZA 4M78C 5GAN2 4LDUA 3D7SB 4IIMA 5L23A 1FMVA 2DYIA 3LGFA 3GIBA 4OR5B 4PJOC 1VQPT 1Q81U 1UEBA 3M54A 2WFYB 3EH1A 5HVYB 2QK0A 4RKUE 4KGXB 4R0KA 3QWYA 2QF7A 3M53A 4CC3A 5C6SA 3G71Q 3JCMf 1OL2B 3MKDA 3I35A 5LJ5g 3MIAB 1VQ7A 4NOYA 1ZQ1A 1SSHA 5EJCA 1PRLC 2DMEA 4HT9A 3VS5A 1Q86R 2L5QA 4M77G 3RDVA 2YRCA 2OTLQ 1W6XA 1X2QA 4WTOB 3M9QA 4JS5A 3GBQA 5L8RE 3A1PA 2JGZB 2QEXA 2NUZA 1FWZA 3MP6A 2K3YA 5FU6C 4A4KA 4RTYA 2EYQA 3H4CA 1WGSA 2YUNA 2PUOB 2RNAA 2JJ9A 1JO8A 1R0CB 4EOKB 3O0GD 1VQ4Q 2P84A 2DXBB 4M75C 2X4WA 2UZLB 2CP3A 4F14A 3JCMW 4PL6A 3PT9A 2K6DA 7AT1B 3DJBA 2XG8D 2O31A 3A8MB 2RQWA 1I5OB 5LJ5j 4JDSA 5GAOp 1LPLA 5LL6S 4MZTA 3LQ5B 1BB9A 1YI2A 1LNXA 3QWXX 2BZXA 1OPKA 5GAN8 1W1FA 1RACB 1BIAA 4MDXA 1IZ6A 1I8FA 2HNIA 3LW5E 3X24B 2DK3A 4AKIA 1N27A 2DNUA 2KAFA 1VQ8T 2G9XB 1M2OA 4CFXB 3GTMS 3C12A 1K0XA 4CFNB 2EUFA 3CXCP 1WJQA 4IUTA 1GBQA 1QLYA 1ZUKA 5FROA 1IREB 5DLQE 1VQPQ 2ESWA 4LNPA 2QG9B 1QCOA 4HVUA 1VQ5Q 1BI3A 2LDMA 5GAN7 2KY9A 1WZOA 2DIQA 1YIJQ 1JXOA 3UPUA 3EJ1B 1H26B 3H0IA 2KT1A 1PRMC 4Y28E 1LJOA 5GANg 1Q81C 5FWBA 3OYYA 4EMHA 2FPDA 4C92G 2EPDA 1M2VA 5J26A 1TOVA 3U23A 2QASA 2M51A 2RD1A 4F04B 1KQSA 3NDQA 4MIMA 2PVDB 3HB9A 1ABOA 3KHIA 1T0HA 3KFVA 1QCFA 2FZGB 4Z89A 4WCIA 4FT2A 2C5OB 2D8JA 4ZNXA 2EKOA 2XDDA 3RERA 1JKWA 1AVZC 4M77B 3CEYA 4I3ZB 1E6GA 3M55A 3CCVA 2A0FB 3BW1A 2LQWA 2M0OA 2ZAEA 2VWFA 5GANj 2VV5A 4PJJA 3OYNA 5KYXA 1UE9A 2HKQB 1FVVB 1AWJA 2AIRB 4OP0A 2VXFA 3TN8B 5GMKi 1WFWA 1SRLA 5BNJB 1QVGP 1SF9A 2D0QB 4A4HA 2C06A 1JRIA 1UJYA 2PMIB 4HVVA 2CGHA 3FEOA 2DPPB 1VQLT 2HDAA 4HL4A 2B86A 4BD3A 1OULA 2LRQA 3FIFA 3MP8A 3E19A 4ZGEB 4O5VA 4VUBA 2IVWA 1UGRB 1NE8A 2E5QA 4ROEA 1W98B 4UN0A 1QWEA 4LOCA 2JM8A 1H92A 1V1CA 1X69A 2EYWA 1JQQA 4FU6A 4II5B 4EMKA 3JCMQ 3OYBA 1MHNA 1J3TA 1VOMA 1OOTA 2EQUA 4M77E 2DTOA 5LJ5d 2ZPGB 2XD0A 3L42A 4OMLA 5CEIB 5GMKh 3C95A 4XAXB 1IXDA 1K1ZA 3BFMA 2LCSA 4QSHA 2KEAA 2G3RA 2KQWA 1QVPA 5DY9A 5D6XA 4KRTA 4B6MA 1RLPC 2F1LA 2BPMB 2HCKA 1YHQT 3SB2A 2KYBA 4J9IA 3DDPB 4A4EA 5GMKm 2QQSA 2JS2A 3OB9A 1Q82R 3HRSA 2WXVB 2JUFA 2O2OA 2IW6B 2F5KA 4C92B 2BUDA 5KYYB 1BCOA 3HBLA 1MUZA 1U1TA 5LJ5e 3OYJA 2P4RA 3EHQA 3QKJA 3CC2Q 2K57A 1BCMA 3J81E 2BS2A 2MYSA 2X9HA 3BHTB 1H641 2C5NB 3LX7A 4M78A 4CFUD 1WHGA 4EOMB 4CXAB 5GAMg 4LDWA 8AT1B 4GLMA 2KRSA 2C0OA 1AZGB 2JTEA 3URGA 4J83A 4PJOA 3DOGB 2OJ2A 2JS0A 3JSCA 2R5AA 1VINA 4F7JB 2RJFA 3HP9A 2OTJQ 5CR2A 4RG8A 4M75G 3I5RA 4AFSC 2LJ0A 1OIYB 2I40B 2IIMA 1VQ7T 2PUKB 2MI6A 1ACMB 2VYTA 2Z0WA 3QZ5B 3QSUA 1K9AA 2EJ9A 3EIDB 2CZ0B 2RHUA 3HFOA 3OBYA 1NG2A 2CSIA 2G77A 4EMKB 5LJ5f 2QEXT 4M78F 1Y96A 2RQRA 4AKGA 3GNFB 5GAMj 4HNVA 2XDPA 3N5BB 3V8JA 2DKGA 4C92E 4PJOF 1I0CA 3CCUQ 2CYZB 1VQ5A 2QFZA 3REAB 1VIFA 4M75A 4DBFA 1YIJA 2RI3A 1BI0A 1ZSGA 3THKA 3GF5A 1HJDA 3MCAB 2LC4A 1R0BG 4BDYA 4F17A 2CP2A 1N8RR 3M57A 3SWNB 2CZ7B 1YJ9Q 3MY1B 2HAXA 3MEWA 1YI2T 2LX9A 3OS2A 3V8KA 4RODA 1UTIA 2KSSA 1UB4A 3CC4Q 3OYGA 1YWOA 5LQFB 2JVVA 4J7IA 1K8AU 4F6WB 1KC8C 2JOYA 1KD1R 2DD4A 3CCMQ 3SHWA 1IGQA 4IUPA 2X1NB 4JX5A 4L59A 4ELLA 2QI2A 2DZCA 2DBMA 3CBOA 4M78D 2E5KA 4CI0C 4M75F 1GY3B 3JCMV 1SHFA 5GAOm 2E12A 1H4LD 1PC0A 1VUBA 5EG2A 2M9UA 4PJOD 4G6LB 2X4XA 2COYA 4M77C 3TNWB 5GJWB 5GAN5 1KJWA 4FT4A 1MV0B 2QQ9A 1G3TA 2KXCA 4J9BA 5HBHB 4PFPA 3OSVA 3VKIA 4AG2C 1RAHB 4BY6B 1OKWB 1PM3A 4YOSA 2F2VA 1EX4A 2DLPA 2QGSA 1RADB 3M5AA 4GBQA 4J9EA 3I9QA 1QKXA 2CZ1B 1VQ7Q 4M7DE 2DA9A 2AT1B 3EG2A 3JCMc 4OMFB 2AK5A 1I5LA 3WXMB 2F2CA 4ME7A 4RUGA 3OBWA 2GTJA 5GMKj 4X9DA 5GANf 1VQ6A 2QEXQ 4FX3B 3JB9G 2O9SA 1OQKA 4M75B 1SPKA 1K4US 5IN1A 2RQUA 9ATCB 1VQ9Q 1ZSZB 4M75D 3HO8A 4BI3A 2EJFA 3IQLA 1RLQC 3HKSA 4C8QE 2HQXA 1UGQB 3CCVT 1YFNA 1DJ7B 3CPWS 2E6ZA 4YOOA 4KBMB 3ZL7C 2BS4A 3VS1A 1H27B 1C6VX 1OU8A 1OIUB 4EOOB 1BU2A 2LQ8A 2RB6A 2DD4B 1E7PA 2XDBA 2WEVB 4Z6YA 1GH6B 3L2ZA 1BI2A 5FW9A 1G3WA 4EC8B 5HCKA 3NGPA 4JLGA 3QO3A 3JB9J 1C1AA 4R56A 1K8AC 3OS5A 2CUBA 2P0QA 3O5ZA 2RPNA 3CC2A 1TUDA 4E7IA 4YOZA 3X20B 4C92C 3CCJA 1MMDA 3QYEA 1H8KA 2PVGB 4XTZA 5FGKB 2R5MA 1K73U 1U8RA 2RQVA 4IUQA 2Y4YA 5FU7B 4Q5WA 4TTHA 4RTUA 1OX8A 4QVDA 2OTJA 3E2UA 2WSCE 5ICPB 4BCQD 1X6GA 2D8HA 2WJ9A 2H3EB 2VGMA 4A4GA 1QVFP 1O9SA 2CCHB 5ECAA 3AHUA 2W0ZA 2OTLT 2QQ8A 5GAMe 1Y71A 1B3QA 1VQMA 1UNGD 1ABQA 3OS1A 2E70A 3P8BB 2DMOA 3PNWC 3BLRB 2XI9A 4X9CA 3KUFA 3MI9B 4FYWB 1VIEA 2VXEA 1CSKA 1W2BA 3EGXA 4EMKC 3CCUA 1RL2A 2C0TA 4M7AG 3OYFA 4IURA 2ZCFB 2MWOA 4PNOA 1UFFA 4F6UB 4E7HA 1PD0A 3CCVQ 2H3JA 4BCHB 4ZGJB 1W2BS 1D1BA 1M4ZA 3VS3A 2A7YA 1XTDA 1U06A 1UECA 3OY9A 2DXBA 1YJ9A 1TFBA 3FJPA 2BS3A 4ZTJA 1PSEA 1JSTB 2O4XA 4CC7A 3BLHB 4OB1B 1ZBJA 1GFDA 1YJWA 1IRXA 3SWNC 4M7DC 2E10A 2BTTA 5GAMf 1PG5B 4OF1A 3I5SA 3CCMA 4C0GA 4XU1A 2LJ3A 3C4SA 3TREA 2DL4A 2RJDA 3JCMb 2CCIB 2CZ6B 3OYEA 1AWOA 1I81A 1IGUA 1C0MA 2DRMA 3G6EA 3JB9H 4LUDA 3VUZA 2DZ9A 2F69A 3PMTA 5HY6A 1WHLA 1WHMA 3NHNA 3P8HA 3HFNA 4C8QC 1KK7A 2E1HA 2HKNA 1Y0MA 4KUDK 2M1HA 3VS4A 1VQ5T 3NPFA 2XHCA 3C94A 1YIJT 2EGEA 2OAUA 3HRTA 1KIKA 2I0NA 1WX6A 1K73C 1VYWB 4IMYB 1ZUYA 2BE7D 4BY6C 3QIIA 5IDNB 4FSSA 2FHDA 2FVUA 5GMKe 1JJ2A 1X6BA 2PK2A 1RAGB 3EGXB 1X01A 4E7SA 2NUPB 3V8LA 4E7JA 1PSFA 2HL5C 3G4SQ 2YRDA 3WVEB 1MMGA 2DETA 4OMQA 1VQ9A 4A53A 1H25B 1D3BB 1TUCA 4HNUA 2FZKB 2SEMA 4HT8A 4JJNK 3QHSA 2PU9B 3EOCB 2RN8A 2EYZA 1UGPB 1QWFA 4J9GA 2LVMA 2MK5A 4V2SA 5A0DA 1ZSZC 1OKVB 2EYYA 2O4XB 4UC4A 2BKZB 4YTLA 3PIOA 2CDTA 4MFDA 3CPFA 2W96A 2VVKA 1HD3A 1W70A 4J6XA 3VJPA 4BE2A 2OI3A 4M77A 3L2WA 2D9TA 2LZ6B 1MGQA 1M3BA 4M7AB 1M3CA 4CRLB 2EGCA 1H24B 1H28B 3M59A 4KH1B 4C0FA 3EGDB 1I07A 1JU5C 4PFZA 4QQ6A 4KRCB 4BCNB 2X4YA 5HQ0B 3L1AA 4FL6A 2O88A 1PWTA 5GAOl 5D7UA 2IPOB 3UDCA 5KE3A 1O9KA 1NLOC 3JCMP 2FZCB 2IW9B 1ENWA 3OSSC 1WLPB 5AYFA 3META 2VUBA 2JN0A 4FYYB 3S3MA 1UNLD 1YJNA 3CMEA 4BCPB 5KYWB 1SEMA 2KBTA 2R57A 1XNIA 2LCCA 2V8KA 4M77F 5A2QE 3LGLA 4JPBW 1D0XA 2KMGA 3GLXA 4EOPB 2RK1A 1BK2A 1X43A 1WNLA 3M56A 3HSBA 4AKHA 1G2BA 1TSFA 1AISB 3DDQB 1PKSA 1Q82U 4K11A 5FU7C 2XMFA 5DLOA 4FSXA 2HBWA 3V7CA 2IN3A 3VUBA 4DEXA 4M7AE 1YP5A 2FYKA 4Z8AA 3ULRB 4N0AC 2QQRA 2QAZA 4EIKA 4F70B 2FEIA 3L2VA 1OZ2A 2QTVA 3HPWA 1JOWA 1UDLA 3LH5A 4KULA 1WQWA 2PK9B 1KQSS 2DAQA 2WSEE 1X2KA 1N5ZA 3QYBA 3CC2T 1AOJA 1S1NA 3BG3A 3CCJT 4M77D 5IH2A 4AT1B 1BI1A 4C92A 5KYYA 2L3SA 1OEBA 2OAWA 4JX6A 2C5XB 1YN8A 2K3BA 5GAOq 1MNDA 2VKNA 2ROLA 3RUXA 3GP8A 1O9KB 1BIBA 2DO3A 4C5IA 1KHCA 5D6WA 3TNHB 2OTJT 1TG0A 1B34A 1LOJA 3UF4A 1ZP2A 2J06A 4MFEA 3EAEA 2RI2A 3M0UA 4Y72B 4L6V5 5I21A 1Q95G 3CD6Q 3JCMh 2PHGA 1UHFA 4JLIA 1VQMT 3VYGA 1KFZA 2P4TA 1XO2A 4FW2A 2X51A 4HCKA 4NL2A 1VQ6Q 1FYNA 3QG1A 3QJYA 3VYHB 4C92F 1N8RU 3TSZA 1IO6A 4M7DG 4JZ4A 1GCPA 1OL1B 2LNVA 1NYFA 4EDUA 3CCUT 2DILA 2E64A 4DOWA 2XKOC 1EIFA 1TU0B 2DM1A 5GAOr 1R8OB 4EOIB 3ER0A 4BCMB 1GUXB 2Y90A 2CREA 2YSQA 3ME9A 1KD1U 5I22A 2UZDB 1BKBA 1Y07A 1YITQ 3QHRB 3CCRA 4LD9K 3VRYA 3DL1A 4BI8B 1YJ9T 1BBZA 2ABLA 4HCBA 3CC4T 1CKAA 4C8QG 1GFCA 2ZPIB 2DVEA 2B8AA 1YJWT 3OYMA 2HZYA 2JTFA 2LNHB 3G4SA 2OX7A 3S3NA 4MZPA 4M7DA 3SWNA 2DJZA 3I55A 4BUGA 2GBQA 1FMWA 3CCMT 4PJMA 5KCOA 2D1XA 1NJIU 3OS0A 2FL7A 5LJ3h 2BKDN 2YT6A 2QGFB 1D1CA 2GFUA 2HEQA 2YUPA 2L8DA 2QXFA 3EG9A 4C92D 4BDZA 2DL7A 3CCJQ 3JB9I 4C5EA 3OW2A 1B34B 2LP5A 1EFNA 4C8QA 2KK4A 5GAN3 5IHYA 2RHIA 2K9GA 3A5ZB 1PHTA 3CCEA 4C5HA 3OW2S 4M7DF 1F1BB 3VYGB 1JBMA 3F5XB 4M7AC 3HHTB 2MIOA 3SFMA 2WHBB 2C6TB 5L2WB 2FB7A 4QKUA 3NFCA 4GLKA 4Y92A 4Z02A 1VQMQ 4QVZA 1E9HB 2NUTA 1ZHIA 3TU4K 1V29B 1WA7A 3QXEB 2VASA 2DEQA 3CBPA 2YXYA 1VQ9T 2E41A 3M4YA 4L5GA 4ELYC 3EG3A 4OMNA 4C8QF 2W9FA 1UG1A 3KBGA 5I2SA 2C0IA 1M1KU 1WHHA 1N8RC 1G3NC 2KXDA 4ANJA 2QA4A 3BHUB 1URCB 1XOVA 1ZSZA 5CO7A 3VS2A 1OI1A 1G8XA 1WI7A 2HBPA 1FKMA 4M7DB 3DLMA 1JXMA 3TEEA 4DA4A 1AT1B 5IHNA 4M7DD 4QQDA 1Q7YU 2X3XD 3TSWA 1YJWQ 4DBRA 2YLCA 2WPAB 2K7AA 2BZ8A 4FM4B 3EG9B 2CP5A 2E6NA 4C0DB 1EZZB 2EQJA 1M27C 3J80E 5KYUB 2HMAA 2HL3A 3QBYA 5GAOn 3X26B 3G6EQ 4C8QB 2QTXA 2WMAB 4HCCA 2O01E 3PVQA 1OI9B 2JTMA 1NJIC 2R7GA 4C8QD 3A8GB 2WIPB 2ZPHB 2G6FX 3CMET 1P92A 4QW2A 3LYIA 3OYHA 3KXTA 2EWNA 4F7UG 1M90R 4NSTB 4LD6A 1KC8R 2KGTA 3VS0A 1WJRA 2RM4A 3QYHB 1RABB 4N4IA 1VA7A 3L2QA 5LJ3g 3PTAA 2CUDA 2AKLA 2CT4A 1MNEA 2EKHA 4XQ3A 5HKCA 2NUTB 3A98A 4BBRM 2RI5A 2EBPA 2EQMA 1NZ9A 3CD6A 4BCIB 2UUEB 2YUQA 2DX1A 2Y4XA 1CKBA 1PCXA 2YHTA 4J9FA 1N4MA 4MZMA 2F5TX 4N0AA 1VQOQ 4F6SB 4XTYA 2KVQG 1VQNA 3RKWA 3VS6A 3ZBDA 1IHWA 4DEYA 4EOQB 3BY7A 4B9WA 2QQBA 5I11A 3RKYA 2JZ2A 2EVRA 2E4HA 1BU1A 4BCKB 3M0PA 4CFMB 5KH6A 2FO0A 1RI9A 5LJ3j 1YITA 1N9SA 5CQYA 2A37A 1Y57A 4PKCC 1X75C 3HL8A 1M1KC 2BZYA 4BXXX 4PK4A 1TD6A 4MMLA 5DQWA 1S72A 1HK9A 2JM9A 4QVCA 3TVTA 1K9MR 2VC8A 1VYVA 3OMCA 3JCMJ 2J6OA 3M0QA 1PKTA 1ZA1B 3CXCA 3EFOB 4FYXB 5HK0A 1V76A 2L3QA 5GAN4 4BACA 4C0ZA 1Q7YC 3LLRA 4LDXA 4HLQA 2HQHA 4IKFA 2GGRA 2DL5A 1YJNQ 1GBRA 3CMEQ 2RJCA 4CFWB 2ZZDB 2KRMA 1JEGA 3MO8A 3C0CA 3A8HB 2GF7A 4FCYA 3S6WA 1Q86U 4DBQA 1H1PB 1X27A 1RI0A 4RCBA 3JB9F 4CRIA 2V22B 2A36A 2L3RA 2DVJA 3GPLA 3GOXA 3ZFJA 2DYBA 3OYCA 2F2XA 4BE0A 5A0LA 3CCRT 1NM7A 2DIGA 2CSQA 4HCZA 4OVAA 3A8LB 4CC4B 1YWPA 2M02A 3TW6A 4JS4A 4F7UB 1OU9A 3RBBB 3SDZA 1MMNA 1M8MA 3H8ZA 1GCQC 2LJ1A 2PQWA 3PVLA 1UGSB 4OB0B 1VOLA 4EOSB 2CKKA 3QJ6A 4X34A 3G4ST 3CCLA 2KE9A 3I55T 2I2LA 1VQLA 2ZPFB 3ASKA 5KYNA 2NUPA 2PZ1A 2MMPA 1QW1A 4HVWA 1TTHB 4LDVA 2UZEB 1NEGA 1QVGA 2GNCA 1JB0E 3JCMd 1D3BA 1H1RB 2AHJB 4F7SB 2EYXA 1Y7XA 4PFOA 1ZLMA 3JB9D 3DTOA 4KUIA 5GMKl 1QVGS 3CCQA 3BG5A 3CCET 1UHCA 2DD5B 4JRPA 4RMOA 4ATOA 5CKFA 2DERA 3L2RA 1PKDB 4AI6A 4AFUC 4M7AA 3PMIA 4F7UE 3EFRA 3EGDA 4B9XA 4BB7A 4C0DC 3FDRA 1NBEB 5CKHA 2QGGA 4NL3A 2LX7A 2RHXA 4N4GA 4E6RA 4F7LB 2I53A 1M1FA 2E65A 1E7OA 2KROA 2W2HA 2V26A 5A0GA 5FRNA 1QKWA 5GANh 1HYOA 3X28B 2YRVA 2CH4W 5LJ3d 3QWLA 4EONB 2HD0A 5KYWA 2WSFE 5CKDA 3CCSA 2QA4T 4DBHA 2KDSA 3CCRQ 1Q86C 1K76A 1D1AA 3MP1A 3I56Q 3EGUA 4M7AF 3LWIA 2DEUA 3M0SA 2COZA 4D8KA 1HSQA 1WJSA 3BHVB 4QQGA 4IUVA 4RTTA 2LQNA 2HSPA 1VQOA 5LMKB 5KE2A 1M30A 3M0TA 3I55Q 3NTIA 3R6OA 2ZPBB 1MV3A 4J6YA 1JJ2S 3LH0A 2ROTA 3G7ZA 2P0PA 5LJ3e 4JJCA 3QYGB 1K73R 2L3PA 5I5ZB 2DBKA 1GXIE 2MCNA 3RIRA 4EOJB 1M1GA 4AFZC 2JT4A 1G5VA 4AG1C 2KMTA 1WHKA 2IVXA 2J6FA 3J7AF 3CCEQ 3QHWB 1G3YA 1SHGA 3CPWP 4M7AD 2PVOB 2CJMB 1AHJB 4WF2A 3M0RA 3NMZC 4BE1A 1U1SA 4AMCA 4BCND 3CD6T 4MMKA 1HXDA 2ECZA 4IIOA 4XTWA 5LJ3f 4LXCA 1QLBA 1VQ6T 3H9NA 2COWA 3OYLA 1WDXA 5CKBA 4BCJB 1VQNT 1VQKQ 4E7LA 3TW7A 3CQTA 2J6KA 2KR3A 4J5YA 3RR6A 1H3HA 4OGEA 1T3LA 2GTOA 1ARKA 3MEVA 1E6HA 3PO3S 2KI7A 2ED0A 6AT1B 4KGZB 1FXXA 1QQJA 1G3SA 2LT1A 2IG0A 2MPXC 1P5EB 1NLPC 1NPRA 3TNIB 1JSUB 5ACBA 4OGCA 2QA4Q 1YITT 4OMOA 3MJXA 2AZVA 1IB8A 4PJNA 1H1SB 5M9OA 2LT4A 3M03A 3JAME 2R58A 4Y91A 1GUXA 1S72T 2L89A 4XU0A 3RMSA 3UA6A 3OYDA 5IHKA 1NYGA 4IUUA 4BCOB 1AD5A 2P0KA 3AT1B 5GAN6 3VKGA 2WACA 1WIEA 5J3BA 4AFQC 2M16A 1T0JA 5HBEB 5GAMh 4JRKA 1Q81R 2RHZA 2V1RA 3OQ5A 4CC2A 3CBMA 2XIDA 2D6FA 2W10A 2YLBA 4HKEA 2NLUA 1RUWA 3DB4A 1N9RA 1OYXA 3CMAA 2GQIA 2LMJA 1KQ1A 2BE9B 5CK9A 3A8OB 3OMGA 2K5FA 4KT0E 1M5Q1 1UJ0A 2C4GB 1KQ2A 4OB2B 3NTHA 4BY7X 5CYIB 2XU8A 4JRQA 4E47A 2YDLA 1W2BP 1FMKA 4RTZA 8ATCB 5IDPB 3G33B 3RGFB 3CC7A 4DQ2A 2DTHA 1RAIB 4XTXA 2L2PA 1GCQA 3TCJA 3CCLT 4E7ZA 3V7RA 3MPUB 2K3XA 1VQNQ 2QDJA 1QP2A 4O6JA 4JJBA 2KR6A 1ZUUA 1X6OA 1QP3A 1VQ8Q 4OB3B 2RO0A 4F16A 1OV3A 2HSEB 4LE9A 1BYMA 2CT3A 4LUEA 2DE0X 4ZN1A 3E9FA 2RK2A 2DL3A 4BCMD 3I56A 5EC7A 1B07A 4ORZA 2M0YA 4F7NB 1S72Q 3CCQT 3JCMX 2ED1A 2MOXA 1Q82C 1M2VB 4XTVA 2NYSA 3VU3C 3G71A 3OYIA 4P5NA 4A63B 1YBYA 1H1QB 1M90U 4M78G 2DXTA 2X4JA 2K79A 2K2VA 2QDYB 1KC8U 2EJGA 1O75A 5EFQB 3G6ET 2OTLA 2D0NA 4PJOG 1VYUA 3EG1A 2EIFA 4DOVA 3FC3A 3S3OA 1Z9ZA 2A28A 4XU3A 5KYUA 4OGRB 3MEUA 2O9VA 5FRMA 3B57A 2PTKA 1PNJA 1JJ2P 4J6WA 2K5LA 1U3OA 2CS7A 2RQTA 1YNZA 5D6YA 5KYXB 1QVFA 2FG0A 2JXBA 1OGUB 1VQ4A 3JRZA 4CFUB 5IF1B 3CCST 3X25B 2XK0A 1SRMA 5HNBB 4ELZC 2UZBB 1QVFS 4XU2A 4BBSM 2CP6A 2J7IA 4EPCA 2GCXA 2W9ZA 1C9BA 2JMAA 1AD6A 5HBJB 1TXQA 2QYZA 3FB9A 1VQOT 1OZ3A 3VS7A 3CCLQ 3INZA 1NPPA 3H0FA 1QMCA 4E7KA 1VQKA 3SD4A 3HZJA 1I4K1 1N6AA 3M4GA 1TWBA 1OPLA 4PLIA 3RMQA 4A4FA 5IXFA 1VQLQ 3REBB 1LCKA 1NEBA 3TQ7P 4JRIA 3FRNA 3VV0A 1K9MU 1VYTA 3T9NA 4RTWA 4KRDB
chains in the Genus database with same CATH topology
2FHDA 3OYNA 4HLQA 2FVUA 5GMKe 3UWNA 1JJ2A 4LDXA 2RHYA 3BG9A 2V8JA 4IKFA 1X01A 4OP0A 3JCMg 2VXFA 2LTOA 3MHXA 3V8LA 5GMKi 4E7JA 4V2SA 4J7FA 1PSFA 4XK8E 3OA6A 2D0QB 2RJCA 3QDRB 4A4HA 2ZZDB 2C06A 1JRIA 3MO8A 1VQPA 3WVEB 3BDLA 1KD1C 3A8HB 2GF7A 3S6WA 1Q86U 2CGHA 4XTUA 3BDUA 3FEOA 1VQ9A 4A53A 1RI0A 4D6WA 1D3BB 4HNUA 4RCBA 5GANd 2DPPB 3JB9F 4CRIA 1VQLT 4HL4A 4HT8A 4JJNK 4BD3A 2L3RA 3DB3A 3GPLA 3QHSA 2LRQA 2PU9B 3ZFJA 3FIFA 3MP8A 1UGPB 3OYCA 3E19A 3GOXA 4ZGEB 2LVMA 4BE0A 5FLXE 5A0LA 3CCRT 4O5VA 4VUBA 2DIGA 2IVWA 4HCZA 4OVAA 1UGRB 1NE8A 3A8LB 2E5QA 2O4XB 4UC4A 4YTLA 3PIOA 2K4YA 4MFDA 3TW6A 3CPFA 4JS4A 4F7UB 3SDZA 4LOCA 4J6XA 3VJPA 4BE2A 3H8ZA 4M77A 3L2WA 1M90C 1YJNT 2D9TA 2PQWA 1MGQA 1UGSB 4OB0B 2CKKA 3QJ6A 4X34A 4M7AB 3G4ST 3CCLA 3I55T 3M59A 4FU6A 4C0FA 2I2LA 4EMKA 4M78B 3JCMQ 3OYBA 1MHNA 4BI4A 2EQUA 1SSFA 4QQ6A 4M77E 2DTOA 1VQLA 2ZPFB 5LJ5d 2ZPGB 2X4YA 3ASKA 4NS5A 2XD0A 3L1AA 5IAYA 2MMPA 3L42A 4FL6A 1QW1A 5GANe 5GAOl 1W4SA 1KG1A 5CVIA 3UDCA 2ZZDA 4LDVA 4PJOB 5KE3A 3JCMP 5A0DA 5GMKh 1QVGA 3C95A 5I2MA 4XAXB 2XICA 3OSSC 5AYFA 1JB0E 3BFMA 4RCCA 3JCMd 2RJEA 4QSHA 3META 1D3BA 2AHJB 2VUBA 2G3RA 2KQWA 1QVPA 5DY9A 5D6XA 2JN0A 3S3MA 1Y7XA 1YJNA 4LDYA 3CMEA 3JB9D 2JNGA 2V8IA 3SB2A 1YHQT 3GNGA 1FX7A 2R57A 4ZTFA 1XNIA 2LCCA 4KUIA 4PLLA 2V8KA 5GMKl 4M77F 5A2QE 3LGLA 1QVGS 3CCQA 3BG5A 4A4EA 5GMKm 2KMGA 2QQSA 3GLXA 3OB9A 4C5GA 3CCET 2DD5B 2DTIA 2RK1A 3HRSA 4F7UA 4JRPA 2JUFA 4RMOA 1WNLA 4ATOA 3VKHA 2F5KA 2BUDA 3M56A 5CKFA 2EQKA 4C92B 3HBLA 4TVRA 3HSBA 4AKHA 3L2RA 1U1TA 1Y96B 5LJ5e 4ZN3A 1WPYA 3OYJA 1VQ8A 3WVDB 4AI6A 3QKJA 2K57A 4M7AA 3J81E 5FU6B 1Q82U 3PMIA 2BS2A 4F7UE 5FU7C 1H641 3EFRA 3LX7A 4M78A 4FSXA 4B9XA 5DLOA 4BB7A 4C0DC 5GAMg 3V7CA 4LDWA 3VUBA 4A54A 3FDRA 3CPWA 4M7AE 2FYKA 4JX4A 5CKHA 3URGA 4N0AC 3Q1JA 4J83A 4NL3A 4PJOA 2RHXA 2QQRA 1K9MC 4M78E 4N4GA 5CKEA 3CMAT 1M1FA 2E65A 3JSCA 2R5AA 3L2VA 2RJFA 1OZ2A 3HP9A 3O8VA 5A0GA 5CR2A 4RG8A 2DXCA 3HPWA 5FRNA 4M75G 4EMGA 5GANh 2RA2A 3X28B 2YRVA 2EFIA 4KULA 4PJOE 1M8VA 1WQWA 4J8OA 5LJ3d 1KQSS 1VQ7T 2PUKB 2RH2A 3QWLA 4GY5A 2DAQA 2MI6A 2WSEE 2HD0A 4F7UF 2LQKA 2WSFE 2BIVA 5CKDA 3CCSA 2QA4T 3QYBA 2VYTA 3QZ5B 3CC2T 2KDSA 3QSUA 1Q86C 2EJ9A 3RKXA 3MP1A 2CZ0B 3BG3A 2EAYA 2DD5A 2RHUA 3H6ZA 3HFOA 4HNTA 3OBYA 4M77D 1BI1A 1KHIA 4M7AF 2G77A 3RESA 4EMKB 4FIBA 3HRUA 4C92A 5HK3A 5LJ5f 3DKMA 3LWIA 4M78F 2QEXT 4JX6A 3LLRA 1Y96A 4AKGA 5GAOq 1WJSA 3GNFB 5GAMj 1VQ9T 3CXCS 4HNVA 4QQGA 3E1SA 4IUVA 2XDPA 3N5BB 1VQOA 3RUXA 3GP8A 5KE2A 3QUIA 3V8JA 2DKGA 5CIUA 4C92E 4PJOF 1BIBA 2DXUA 2X35A 2DO3A 3NTIA 2CYZB 3R6OA 4C5IA 1KHCA 5D6WA 2OTJT 3E9GA 1B34A 1VQ5A 2QFZA 2ZPBB 1LOJA 4J6YA 5LJ5h 1VIFA 1JJ2S 3EAEA 4MFEA 3G7ZA 3LH0A 2P0PA 3F70A 4M75A 1YIJA 2RI3A 1BI0A 3V7SA 3GF5A 2RI2A 3PGGA 3MCAB 2MWPA 2ZPEB 3QZ9B 2HQEA 2LC4A 5LJ3e 3QYGB 4L6V5 5I21A 5GAMd 4BDYA 2GQVA 5J39A 3M57A 3SWNB 2CZ7B 3JCMh 3I56T 4M75E 4M6VA 4JLIA 1M9SA 2HAXA 1VQMT 3MEWA 3VYGA 1XQHA 2LX9A 1YI2T 2P4TA 1GXIE 3OS2A 3V8KA 3RIRA 2KSSA 4NL2A 1UB4A 1ZBXA 3QG1A 1M1GA 3QJYA 3OYGA 3VYHB 1G5VA 4C92F 1N8RU 5CAIA 2JVVA 4J7IA 2VGNA 4M7DG 1K8AU 2KMTA 1KC8C 2JOYA 2LNVA 2DD4A 3G71T 4EDUA 3CCUT 3EFSA 5C0MA 4HA8A 2E64A 4DOWA 3J7AF 2XKOC 1EIFA 4II1A 1WQ7A 4IUPA 1G3YA 4JX5A 4L59A 4M7AD 2PVOB 5GAOr 1R8OB 2QI2A 2DZCA 3ER0A 2Y90A 1AHJB 3CBOA 4M78D 4WF2A 3ME9A 5IT9E 1KD1U 4CI0C 1TH7A 4M75F 3JCMV 1BKBA 3ZEHA 1Y07A 3CCRA 1U1SA 5GAOm 2K5IA 2E12A 4BE1A 4LD9K 3CD6T 3DL1A 1VUBA 4MMKA 1HXDA 2MAMA 3MEAA 5EG2A 4BI8B 4XTWA 1YJ9T 4ELJA 2M9UA 4PJOD 2X4XA 2DXCB 4M77C 5LJ3f 1QLBA 2GFAA 3CC4T 4HCBA 1VQ6T 4C8QG 3OYLA 5GAN5 2ZPIB 4FT4A 5CKBA 2DVEA 1VQNT 2B8AA 1YJWT 2QQ9A 1G3TA 3OYMA 4E7LA 2JTFA 3TW7A 3OSVA 3VKIA 4BY6B 4MZPA 3G4SA 3SWNA 2DJZA 3NTKA 3I55A 4M7DA 4BUGA 3L2UA 4J5YA 1YCYA 1VQ4T 3CCMT 4OGEA 3PFSA 5KCOA 3OYKA 4JUVA 3MEVA 3OYAA 3M5AA 1NJIU 3OS0A 2FL7A 5LJ3h 2BKDN 2CZ1B 1FXXA 4N4HA 1G3SA 2LT1A 2IG0A 3P8DA 4M7DE 1NPRA 2GFUA 2L8DA 2QQAA 2QXFA 4OGCA 2MF2A 2ZGWA 1YITT 4C92D 3JCMc 4OMFB 1I5LA 3WXMB 4BDZA 4ME7A 3OBWA 4C5EA 5M9OA 3JB9I 3OW2A 3CC4A 2LT4A 4X9DA 4RG2A 5GMKj 5GANf 3PIPA 1VQ6A 3JAME 1B34B 2R58A 3JCMe 4Y91A 3JB9G 4ZGDB 1S72T 4M75B 4MDWA 4C8QA 2KK4A 5IN1A 2L89A 3FLGA 4XU0A 3RMSA 5GAN3 3OYDA 1YHQA 1VQKT 4R55A 4IUUA 2RHIA 3A5ZB 3LWHA 2P0KA 3M58A 3HO8A 4M75D 5GAN6 4BI3A 3VKGA 4NC6A 2EJFA 2A3LA 2WACA 3CCEA 3UT1A 5J3BA 4C5HA 3OW2S 4M7DF 3HKSA 3VYGB 2HQXA 1UGQB 1JBMA 2LCLA 4C8QE 2M16A 5KCHA 3CCVT 1DJ7B 3CPWS 2E6ZA 3QPHA 5DM7R 3HHTB 5CQXA 4M7AC 3SFMA 4KBMB 5CCAA 5GAMh 1H3ZA 4JRKA 2BS4A 4M78C 5GAN2 2RHZA 4LDUA 2FB7A 3OQ5A 2LQ8A 2RB6A 2DD4B 3CBMA 3NFCA 4GLKA 1E7PA 4Z02A 2XIDA 3LGFA 2D6FA 2XDBA 3GIBA 4QVZA 4Z6YA 4PJOC 1ZHIA 3TU4K 1V29B 2YLBA 4HKEA 1VQPT 1Q81U 3QXEB 3L2ZA 1UEBA 2DEQA 2NLUA 1BI2A 3CBPA 3M54A 3DB4A 1N9RA 1OYXA 4RKUE 3CMAA 2E41A 1KQ1A 3M4YA 1G3WA 4L5GA 5CK9A 3A8OB 4ELYC 3OMGA 2K5FA 2QF7A 4KT0E 3M53A 4C8QF 1M5Q1 4JLGA 3QO3A 5C6SA 3JB9J 4OB2B 4R56A 3NTHA 3JCMf 1KQ2A 3KBGA 5I2SA 5LJ5g 2XU8A 4JRQA 1M1KU 1VQ7A 4E47A 1N8RC 4NOYA 1ZQ1A 3S3NA 5EJCA 1K8AC 3OS5A 2QA4A 2P0QA 1XOVA 4HT9A 5CO7A 3CC2A 1OI1A 2L5QA 4M77G 4E7IA 2HBPA 3X20B 3M9QA 3CC7A 4C92C 1FKMA 2DTHA 4DQ2A 3DLMA 3QYEA 3CCJA 4JS5A 3TEEA 4DA4A 4M7DB 5L8RE 2PVGB 4XTZA 2QEXA 1FWZA 3MP6A 4XTXA 2K3YA 3TCJA 4M7DD 2R5MA 3CCLT 4QQDA 5FU6C 3V7RA 4A4KA 1K73U 2EYQA 1U8RA 3H4CA 2K3XA 1WGSA 2QDJA 1Q7YU 2PUOB 4IUQA 2Y4YA 1QP2A 2YLCA 4O6JA 4Q5WA 5FU7B 4FM4B 2E6NA 2KR6A 4C0DB 4QVDA 2DXBB 4M75C 2OTJA 1X6OA 2EQJA 2WSCE 2X4WA 3JCMW 1QP3A 4OB3B 2RO0A 3J80E 2WJ9A 4PL6A 1BYMA 3PT9A 2VGMA 2XG8D 4A4GA 3QBYA 3A8MB 4ZN1A 3E9FA 5LJ5j 4JDSA 5GAOp 3X26B 5GAOn 1O9SA 4C8QB 2QTXA 5LL6S 4MZTA 3AHUA 2RK2A 4HCCA 2O01E 2OTLT 3I56A 2QQ8A 2JTMA 5GAMe 1Y71A 1VQMA 1NJIC 1YI2A 4C8QD 3A8GB 2ZPHB 1LNXA 3OS1A 3CMET 1P92A 2E70A 3LYIA 4QW2A 3OYHA 3P8BB 3PNWC 3KXTA 2EWNA 2XI9A 4F7UG 5GAN8 4X9CA 3KUFA 3JCMX 3CCQT 1VIEA 1BIAA 2VXEA 4LD6A 1IZ6A 1I8FA 1W2BA 1Q82C 4MDXA 2HNIA 4XTVA 3VU3C 4EMKC 3LW5E 3X24B 3G71A 1WJRA 3OYIA 2DK3A 4AKIA 1RL2A 3CCUA 2RM4A 3QYHB 4P5NA 3OYFA 4M7AG 1YBYA 1N27A 4IURA 4N4IA 2ZCFB 2MWOA 2KAFA 3L2QA 1M90U 4M78G 4PNOA 5LJ3g 2DXTA 3PTAA 2X4JA 4E7HA 2K2VA 2QDYB 4XQ3A 5HKCA 1KC8U 2EJGA 2H3JA 1O75A 3C12A 4BBRM 2RI5A 4ZGJB 1W2BS 1M4ZA 3G6ET 2EQMA 2A7YA 1NZ9A 1XTDA 2OTLA 3CD6A 4PJOG 3OY9A 2DXBA 1YJ9A 3FJPA 1WJQA 2EIFA 2Y4XA 4DOVA 3FC3A 3S3OA 2YHTA 4IUTA 2BS3A 4XU3A 4ZTJA 1PSEA 3MEUA 4MZMA 2F5TX 2O4XA 4N0AA 3CCJT 5FRMA 4OB1B 5FROA 1IREB 4XTYA 2KVQG 5DLQE 3RKWA 1VQNA 4J6WA 2K5LA 1YJWA 3SWNC 4M7DC 3ZBDA 2CS7A 2E10A 5GAMf 1BI3A 2LDMA 3BY7A 2KY9A 5D6YA 5GAN7 4B9WA 1QVFA 4OF1A 2QQBA 2DIQA 1VQ4A 3JRZA 3CCMA 3RKYA 4C0GA 2JZ2A 4XU1A 3UPUA 3C4SA 3TREA 3CCST 2RJDA 4Y28E 3JCMb 1LJOA 5GANg 1Q81C 2CZ6B 1VQ8T 3OYYA 4EMHA 3OYEA 3DLLA 4C92G 3X25B 1I81A 5KH6A 3G6EA 3JB9H 2XK0A 5LJ3j 5J26A 3VUZA 1YITA 2RD1A 4ELZC 2DZ9A 1QVFS 2F69A 3PMTA 4BBSM 1N9SA 4XU2A 5CQYA 4MIMA 5HY6A 1KQSA 3CC7T 4EPCA 2PVDB 2GCXA 4PKCC 1X75C 3HL8A 1M1KC 3HB9A 3P8HA 3HFNA 3KHIA 4C8QC 4MMLA 3FB9A 2E1HA 1VQOT 1OZ3A 1S72A 1HK9A 3INZA 1NPPA 4FT2A 4QVCA 4E7KA 4KUDK 2M1HA 1VQKA 2VC8A 3SD4A 3HZJA 2EKOA 2XDDA 1VQ5T 3RERA 1I4K1 3OMCA 1N6AA 3M4GA 4PLIA 3RMQA 2XHCA 3C94A 4A4FA 3JCMJ 1YIJT 2OAUA 3HRTA 3CXCA 5HK0A 4M77B 4JRIA 3CEYA 3M55A 3CCVA 3FRNA 1K73C 3VV0A 5GAN4 4BACA 1K9MU 4C0ZA 1Q7YC 4BY6C 3BW1A 3QIIA 2M0OA 3T9NA 5GANj 2VV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8M B;  3X26 B;  2CZ1 B;  1PSF A;  4XK8 E;  2D0Q B;  2DXC A;  2O01 E;  2ZZD B;  3WVE B;  3X28 B;  3A8H B;  3A8G B;  2ZPH B;  2PUK B;  2WSE E;  2WSF E;  3QZ5 B;  2DPP B;  2PU9 B;  2CZ0 B;  2DD5 A;  4ZGD B;  1UGP B;  4ZGE B;  3X24 B;  3LW5 E;  3QYH B;  1UGR B;  3A8L B;  2ZCF B;  2QDY B;  4ZGJ B;  3VYG B;  1UGQ B;  2CYZ B;  1DJ7 B;  3HHT B;  1UGS B;  4OB0 B;  2ZPB B;  2DXB A;  1PSE A;  2ZPE B;  3QZ9 B;  4OB1 B;  1IRE B;  3QYG B;  2DD4 B;  2ZPF B;  4L6V 5;  2ZPG B;  2CZ7 B;  1V29 B;  2ZZD A;  3QXE B;  3VYG A;  1GXI E;  4RKU E;  3A8O B;  1JB0 E;  4Y28 E;  3VYH B;  4KT0 E;  2CZ6 B;  2AHJ B;  4OB2 B;  3X25 B;  2DD4 A;  2PVD B;  2PVO B;  1AHJ B;  2DD5 B;  3X20 B;  5L8R E;  2PVG B;  3WVD B;  2PUO B;  2DXC B;  1QP2 A;  2ZPI B;  4FM4 B;  2DXB B;  2WSC E;  1QP3 A;  4OB3 B; 
#chains in the Genus database with same CATH topology
 4J9H A;  1UUE A;  3UWN A;  2RHY A;  1UGV A;  1ZA2 B;  3BG9 A;  2WIH B;  1AZE A;  4ROC A;  2V8J A;  3JCM g;  4D8D A;  2LTO A;  3MHX A;  4J7F A;  4XK8 E;  3OA6 A;  3QDR B;  4RTX A;  2L0A A;  1VQP A;  3BDL A;  2A08 A;  1KD1 C;  4EOR B;  3CCQ Q;  4XTU A;  5DQV A;  3BDU A;  2ENM A;  4Z88 A;  4D6W A;  2C5V B;  5GAN d;  3QDF A;  3G1J A;  2EQI A;  4BCF B;  3DB3 A;  3DLL A;  4X1V A;  2DJQ A;  2FPF A;  4M4Z A;  5FLX E;  4QT7 A;  3BE3 A;  2K4Y A;  4OMP A;  2AKK A;  5IXB A;  3EFO A;  1QCN A;  1M90 C;  1YJN T;  1YHQ Q;  4HXJ A;  1SG5 A;  4EC9 B;  1RAA B;  4M78 B;  1T3S A;  3BLQ B;  4BI4 A;  2CH4 A;  1KQS P;  1SSF A;  2F2W A;  4FW1 A;  2RMO A;  4KH0 B;  4NS5 A;  4PJL A;  5IAY A;  4BCG B;  2NWM A;  5GAN e;  1W4S A;  1KG1 A;  5CVI A;  3CCS Q;  1U5S A;  2ZZD A;  1IHV A;  4PJO B;  1RAE B;  3POM A;  1I1J A;  5I2M A;  2XIC A;  1OX9 A;  4RCC A;  2RJE A;  1F5Q B;  4J9C A;  2KRN A;  2DFU A;  1NJI R;  3K7A M;  4LDY A;  4OMM A;  3HTR A;  2JNG A;  2V8I A;  3GNG A;  1FX7 A;  4ZTF A;  5GJV B;  4C5G A;  3EG0 A;  1WHJ A;  2DTI A;  5FWC A;  4F7U A;  2JW4 A;  2ATC B;  1MMA A;  3EHR A;  3VKH A;  2EQK A;  4TVR A;  1Y96 B;  2K2M A;  4ZN3 A;  1WPY A;  1VQ8 A;  3WVD B;  5FU6 B;  3R6N A;  4A54 A;  3CPW A;  4JX4 A;  1UNH D;  2DL8 A;  3Q1J A;  1K9M C;  4JZ3 A;  4M78 E;  5CKE A;  3CMA T;  2IW8 B;  1M3A A;  2RF0 A;  1D0Y A;  3O8V A;  2DXC A;  3UAT A;  4EMG A;  2E3I A;  2RA2 A;  3EH2 A;  2W99 A;  2KYM A;  2EFI A;  4PJO E;  1M8V A;  4J8O A;  2JMC A;  2LW4 A;  2RH2 A;  4GY5 A;  4F7U F;  2LQK A;  2BIV A;  2DRK A;  2EGA A;  1ZX6 A;  1WXU A;  1PD1 A;  2QDL A;  2FPE A;  3RKX A;  2J05 A;  2EAY A;  3H6Z A;  2DD5 A;  4PLL A;  4E2F B;  3CC7 T;  4HNT A;  1YI2 Q;  1KHI A;  3RES A;  4FIB A;  3HRU A;  5HK3 A;  1WYX A;  3DKM A;  3FJ5 A;  2X3W D;  3MY5 B;  1GRI A;  2VB6 A;  1M1K R;  1D3U B;  1G83 A;  5AT1 B;  5IHI A;  3CXC S;  3E1S A;  1SKU B;  4J9D A;  4BY1 X;  1XJW B;  2FRW A;  3QUI A;  3JV3 A;  5CIU A;  2DXU A;  2X35 A;  1K0S A;  3E9G A;  2B9R A;  5LJ5 h;  3F70 A;  1TUG B;  3V7S A;  3PGG A;  1A0N B;  2MWP A;  2ZPE B;  3QZ9 B;  2HQE A;  3RNJ A;  2YUO A;  1KXU A;  5GAM d;  2GQV A;  1Q7Y R;  2CP7 A;  5J39 A;  3I56 T;  3UA7 A;  1K8A R;  4M75 E;  4M6V A;  1M9S A;  1XQH A;  1QMZ B;  2WMB B;  1AWW A;  3PE0 A;  1ZBX A;  2KNB B;  1FIN B;  1GL5 A;  5CAI A;  2VGN A;  4BCQ B;  1AEY A;  1TS9 A;  3OW2 P;  3G71 T;  3EFS A;  5C0M A;  4HA8 A;  3VRZ A;  4LN2 A;  2E3H A;  4II1 A;  1R77 A;  1WQ7 A;  3H0H A;  2EW3 A;  3H41 A;  4JJD A;  4CFV B;  4ESR A;  5IT9 E;  1TH7 A;  3ZEH A;  1D09 B;  2K5I A;  1WXB A;  2MAM A;  3MEA A;  4ELJ A;  1RAF B;  2DXC B;  2GFA A;  1B7T A;  2DF6 A;  2FRY A;  4KGV B;  3SEM A;  2CP0 A;  3CMA Q;  3NTK A;  3L2U A;  1YCY A;  1VQ4 T;  3PFS A;  3OYK A;  4RTV A;  4JUV A;  3OYA A;  4FYV B;  1AWX A;  2PNI A;  4N4H A;  3P8D A;  2QQA A;  2MF2 A;  2ZGW A;  4EOL B;  2YWW A;  1YCS B;  2SRC A;  3CC7 Q;  4YC3 B;  1KSW A;  3CC4 A;  2V1Q A;  4RG2 A;  3PIP A;  3JCM e;  1WXT A;  4ZGD B;  2H8H A;  2KT8 A;  4MDW A;  3FLG A;  1YHQ A;  1D0Z A;  1VQK T;  4R55 A;  1LVK A;  3LWH A;  3M58 A;  4NC6 A;  2A3L A;  3UT1 A;  1Z9Q A;  5KCH A;  2LCL A;  2AZS A;  3QPH A;  5DM7 R;  5CQX A;  2PJQ A;  5CCA A;  1H3Z A;  4M78 C;  5GAN 2;  4LDU A;  3D7S B;  4IIM A;  5L23 A;  1FMV A;  2DYI A;  3LGF A;  3GIB A;  4OR5 B;  4PJO C;  1VQP T;  1Q81 U;  1UEB A;  3M54 A;  2WFY B;  3EH1 A;  5HVY B;  2QK0 A;  4RKU E;  4KGX B;  4R0K A;  3QWY A;  2QF7 A;  3M53 A;  4CC3 A;  5C6S A;  3G71 Q;  3JCM f;  1OL2 B;  3MKD A;  3I35 A;  5LJ5 g;  3MIA B;  1VQ7 A;  4NOY A;  1ZQ1 A;  1SSH A;  5EJC A;  1PRL C;  2DME A;  4HT9 A;  3VS5 A;  1Q86 R;  2L5Q A;  4M77 G;  3RDV A;  2YRC A;  2OTL Q;  1W6X A;  1X2Q A;  4WTO B;  3M9Q A;  4JS5 A;  3GBQ A;  5L8R E;  3A1P A;  2JGZ B;  2QEX A;  2NUZ A;  1FWZ A;  3MP6 A;  2K3Y A;  5FU6 C;  4A4K A;  4RTY A;  2EYQ A;  3H4C A;  1WGS A;  2YUN A;  2PUO B;  2RNA A;  2JJ9 A;  1JO8 A;  1R0C B;  4EOK B;  3O0G D;  1VQ4 Q;  2P84 A;  2DXB B;  4M75 C;  2X4W A;  2UZL B;  2CP3 A;  4F14 A;  3JCM W;  4PL6 A;  3PT9 A;  2K6D A;  7AT1 B;  3DJB A;  2XG8 D;  2O31 A;  3A8M B;  2RQW A;  1I5O B;  5LJ5 j;  4JDS A;  5GAO p;  1LPL A;  5LL6 S;  4MZT A;  3LQ5 B;  1BB9 A;  1YI2 A;  1LNX A;  3QWX X;  2BZX A;  1OPK A;  5GAN 8;  1W1F A;  1RAC B;  1BIA A;  4MDX A;  1IZ6 A;  1I8F A;  2HNI A;  3LW5 E;  3X24 B;  2DK3 A;  4AKI A;  1N27 A;  2DNU A;  2KAF A;  1VQ8 T;  2G9X B;  1M2O A;  4CFX B;  3GTM S;  3C12 A;  1K0X A;  4CFN B;  2EUF A;  3CXC P;  1WJQ A;  4IUT A;  1GBQ A;  1QLY A;  1ZUK A;  5FRO A;  1IRE B;  5DLQ E;  1VQP Q;  2ESW A;  4LNP A;  2QG9 B;  1QCO A;  4HVU A;  1VQ5 Q;  1BI3 A;  2LDM A;  5GAN 7;  2KY9 A;  1WZO A;  2DIQ A;  1YIJ Q;  1JXO A;  3UPU A;  3EJ1 B;  1H26 B;  3H0I A;  2KT1 A;  1PRM C;  4Y28 E;  1LJO A;  5GAN g;  1Q81 C;  5FWB A;  3OYY A;  4EMH A;  2FPD A;  4C92 G;  2EPD A;  1M2V A;  5J26 A;  1TOV A;  3U23 A;  2QAS A;  2M51 A;  2RD1 A;  4F04 B;  1KQS A;  3NDQ A;  4MIM A;  2PVD B;  3HB9 A;  1ABO A;  3KHI A;  1T0H A;  3KFV A;  1QCF A;  2FZG B;  4Z89 A;  4WCI A;  4FT2 A;  2C5O B;  2D8J A;  4ZNX A;  2EKO A;  2XDD A;  3RER A;  1JKW A;  1AVZ C;  4M77 B;  3CEY A;  4I3Z B;  1E6G A;  3M55 A;  3CCV A;  2A0F B;  3BW1 A;  2LQW A;  2M0O A;  2ZAE A;  2VWF A;  5GAN j;  2VV5 A;  4PJJ A;  3OYN A;  5KYX A;  1UE9 A;  2HKQ B;  1FVV B;  1AWJ A;  2AIR B;  4OP0 A;  2VXF A;  3TN8 B;  5GMK i;  1WFW A;  1SRL A;  5BNJ B;  1QVG P;  1SF9 A;  2D0Q B;  4A4H A;  2C06 A;  1JRI A;  1UJY A;  2PMI B;  4HVV A;  2CGH A;  3FEO A;  2DPP B;  1VQL T;  2HDA A;  4HL4 A;  2B86 A;  4BD3 A;  1OUL A;  2LRQ A;  3FIF A;  3MP8 A;  3E19 A;  4ZGE B;  4O5V A;  4VUB A;  2IVW A;  1UGR B;  1NE8 A;  2E5Q A;  4ROE A;  1W98 B;  4UN0 A;  1QWE A;  4LOC A;  2JM8 A;  1H92 A;  1V1C A;  1X69 A;  2EYW A;  1JQQ A;  4FU6 A;  4II5 B;  4EMK A;  3JCM Q;  3OYB A;  1MHN A;  1J3T A;  1VOM A;  1OOT A;  2EQU A;  4M77 E;  2DTO A;  5LJ5 d;  2ZPG B;  2XD0 A;  3L42 A;  4OML A;  5CEI B;  5GMK h;  3C95 A;  4XAX B;  1IXD A;  1K1Z A;  3BFM A;  2LCS A;  4QSH A;  2KEA A;  2G3R A;  2KQW A;  1QVP A;  5DY9 A;  5D6X A;  4KRT A;  4B6M A;  1RLP C;  2F1L A;  2BPM B;  2HCK A;  1YHQ T;  3SB2 A;  2KYB A;  4J9I A;  3DDP B;  4A4E A;  5GMK m;  2QQS A;  2JS2 A;  3OB9 A;  1Q82 R;  3HRS A;  2WXV B;  2JUF A;  2O2O A;  2IW6 B;  2F5K A;  4C92 B;  2BUD A;  5KYY B;  1BCO A;  3HBL A;  1MUZ A;  1U1T A;  5LJ5 e;  3OYJ A;  2P4R A;  3EHQ A;  3QKJ A;  3CC2 Q;  2K57 A;  1BCM A;  3J81 E;  2BS2 A;  2MYS A;  2X9H A;  3BHT B;  1H64 1;  2C5N B;  3LX7 A;  4M78 A;  4CFU D;  1WHG A;  4EOM B;  4CXA B;  5GAM g;  4LDW A;  8AT1 B;  4GLM A;  2KRS A;  2C0O A;  1AZG B;  2JTE A;  3URG A;  4J83 A;  4PJO A;  3DOG B;  2OJ2 A;  2JS0 A;  3JSC A;  2R5A A;  1VIN A;  4F7J B;  2RJF A;  3HP9 A;  2OTJ Q;  5CR2 A;  4RG8 A;  4M75 G;  3I5R A;  4AFS C;  2LJ0 A;  1OIY B;  2I40 B;  2IIM A;  1VQ7 T;  2PUK B;  2MI6 A;  1ACM B;  2VYT A;  2Z0W A;  3QZ5 B;  3QSU A;  1K9A A;  2EJ9 A;  3EID B;  2CZ0 B;  2RHU A;  3HFO A;  3OBY A;  1NG2 A;  2CSI A;  2G77 A;  4EMK B;  5LJ5 f;  2QEX T;  4M78 F;  1Y96 A;  2RQR A;  4AKG A;  3GNF B;  5GAM j;  4HNV A;  2XDP A;  3N5B B;  3V8J A;  2DKG A;  4C92 E;  4PJO F;  1I0C A;  3CCU Q;  2CYZ B;  1VQ5 A;  2QFZ A;  3REA B;  1VIF A;  4M75 A;  4DBF A;  1YIJ A;  2RI3 A;  1BI0 A;  1ZSG A;  3THK A;  3GF5 A;  1HJD A;  3MCA B;  2LC4 A;  1R0B G;  4BDY A;  4F17 A;  2CP2 A;  1N8R R;  3M57 A;  3SWN B;  2CZ7 B;  1YJ9 Q;  3MY1 B;  2HAX A;  3MEW A;  1YI2 T;  2LX9 A;  3OS2 A;  3V8K A;  4ROD A;  1UTI A;  2KSS A;  1UB4 A;  3CC4 Q;  3OYG A;  1YWO A;  5LQF B;  2JVV A;  4J7I A;  1K8A U;  4F6W B;  1KC8 C;  2JOY A;  1KD1 R;  2DD4 A;  3CCM Q;  3SHW A;  1IGQ A;  4IUP A;  2X1N B;  4JX5 A;  4L59 A;  4ELL A;  2QI2 A;  2DZC A;  2DBM A;  3CBO A;  4M78 D;  2E5K A;  4CI0 C;  4M75 F;  1GY3 B;  3JCM V;  1SHF A;  5GAO m;  2E12 A;  1H4L D;  1PC0 A;  1VUB A;  5EG2 A;  2M9U A;  4PJO D;  4G6L B;  2X4X A;  2COY A;  4M77 C;  3TNW B;  5GJW B;  5GAN 5;  1KJW A;  4FT4 A;  1MV0 B;  2QQ9 A;  1G3T A;  2KXC A;  4J9B A;  5HBH B;  4PFP A;  3OSV A;  3VKI A;  4AG2 C;  1RAH B;  4BY6 B;  1OKW B;  1PM3 A;  4YOS A;  2F2V A;  1EX4 A;  2DLP A;  2QGS A;  1RAD B;  3M5A A;  4GBQ A;  4J9E A;  3I9Q A;  1QKX A;  2CZ1 B;  1VQ7 Q;  4M7D E;  2DA9 A;  2AT1 B;  3EG2 A;  3JCM c;  4OMF B;  2AK5 A;  1I5L A;  3WXM B;  2F2C A;  4ME7 A;  4RUG A;  3OBW A;  2GTJ A;  5GMK j;  4X9D A;  5GAN f;  1VQ6 A;  2QEX Q;  4FX3 B;  3JB9 G;  2O9S A;  1OQK A;  4M75 B;  1SPK A;  1K4U S;  5IN1 A;  2RQU A;  9ATC B;  1VQ9 Q;  1ZSZ B;  4M75 D;  3HO8 A;  4BI3 A;  2EJF A;  3IQL A;  1RLQ C;  3HKS A;  4C8Q E;  2HQX A;  1UGQ B;  3CCV T;  1YFN A;  1DJ7 B;  3CPW S;  2E6Z A;  4YOO A;  4KBM B;  3ZL7 C;  2BS4 A;  3VS1 A;  1H27 B;  1C6V X;  1OU8 A;  1OIU B;  4EOO B;  1BU2 A;  2LQ8 A;  2RB6 A;  2DD4 B;  1E7P A;  2XDB A;  2WEV B;  4Z6Y A;  1GH6 B;  3L2Z A;  1BI2 A;  5FW9 A;  1G3W A;  4EC8 B;  5HCK A;  3NGP A;  4JLG A;  3QO3 A;  3JB9 J;  1C1A A;  4R56 A;  1K8A C;  3OS5 A;  2CUB A;  2P0Q A;  3O5Z A;  2RPN A;  3CC2 A;  1TUD A;  4E7I A;  4YOZ A;  3X20 B;  4C92 C;  3CCJ A;  1MMD A;  3QYE A;  1H8K A;  2PVG B;  4XTZ A;  5FGK B;  2R5M A;  1K73 U;  1U8R A;  2RQV A;  4IUQ A;  2Y4Y A;  5FU7 B;  4Q5W A;  4TTH A;  4RTU A;  1OX8 A;  4QVD A;  2OTJ A;  3E2U A;  2WSC E;  5ICP B;  4BCQ D;  1X6G A;  2D8H A;  2WJ9 A;  2H3E B;  2VGM A;  4A4G A;  1QVF P;  1O9S A;  2CCH B;  5ECA A;  3AHU A;  2W0Z A;  2OTL T;  2QQ8 A;  5GAM e;  1Y71 A;  1B3Q A;  1VQM A;  1UNG D;  1ABQ A;  3OS1 A;  2E70 A;  3P8B B;  2DMO A;  3PNW C;  3BLR B;  2XI9 A;  4X9C A;  3KUF A;  3MI9 B;  4FYW B;  1VIE A;  2VXE A;  1CSK A;  1W2B A;  3EGX A;  4EMK C;  3CCU A;  1RL2 A;  2C0T A;  4M7A G;  3OYF A;  4IUR A;  2ZCF B;  2MWO A;  4PNO A;  1UFF A;  4F6U B;  4E7H A;  1PD0 A;  3CCV Q;  2H3J A;  4BCH B;  4ZGJ B;  1W2B S;  1D1B A;  1M4Z A;  3VS3 A;  2A7Y A;  1XTD A;  1U06 A;  1UEC A;  3OY9 A;  2DXB A;  1YJ9 A;  1TFB A;  3FJP A;  2BS3 A;  4ZTJ A;  1PSE A;  1JST B;  2O4X A;  4CC7 A;  3BLH B;  4OB1 B;  1ZBJ A;  1GFD A;  1YJW A;  1IRX A;  3SWN C;  4M7D C;  2E10 A;  2BTT A;  5GAM f;  1PG5 B;  4OF1 A;  3I5S A;  3CCM A;  4C0G A;  4XU1 A;  2LJ3 A;  3C4S A;  3TRE A;  2DL4 A;  2RJD A;  3JCM b;  2CCI B;  2CZ6 B;  3OYE A;  1AWO A;  1I81 A;  1IGU A;  1C0M A;  2DRM A;  3G6E A;  3JB9 H;  4LUD A;  3VUZ A;  2DZ9 A;  2F69 A;  3PMT A;  5HY6 A;  1WHL A;  1WHM A;  3NHN A;  3P8H A;  3HFN A;  4C8Q C;  1KK7 A;  2E1H A;  2HKN A;  1Y0M A;  4KUD K;  2M1H A;  3VS4 A;  1VQ5 T;  3NPF A;  2XHC A;  3C94 A;  1YIJ T;  2EGE A;  2OAU A;  3HRT A;  1KIK A;  2I0N A;  1WX6 A;  1K73 C;  1VYW B;  4IMY B;  1ZUY A;  2BE7 D;  4BY6 C;  3QII A;  5IDN B;  4FSS A;  2FHD A;  2FVU A;  5GMK e;  1JJ2 A;  1X6B A;  2PK2 A;  1RAG B;  3EGX B;  1X01 A;  4E7S A;  2NUP B;  3V8L A;  4E7J A;  1PSF A;  2HL5 C;  3G4S Q;  2YRD A;  3WVE B;  1MMG A;  2DET A;  4OMQ A;  1VQ9 A;  4A53 A;  1H25 B;  1D3B B;  1TUC A;  4HNU A;  2FZK B;  2SEM A;  4HT8 A;  4JJN K;  3QHS A;  2PU9 B;  3EOC B;  2RN8 A;  2EYZ A;  1UGP B;  1QWF A;  4J9G A;  2LVM A;  2MK5 A;  4V2S A;  5A0D A;  1ZSZ C;  1OKV B;  2EYY A;  2O4X B;  4UC4 A;  2BKZ B;  4YTL A;  3PIO A;  2CDT A;  4MFD A;  3CPF A;  2W96 A;  2VVK A;  1HD3 A;  1W70 A;  4J6X A;  3VJP A;  4BE2 A;  2OI3 A;  4M77 A;  3L2W A;  2D9T A;  2LZ6 B;  1MGQ A;  1M3B A;  4M7A B;  1M3C A;  4CRL B;  2EGC A;  1H24 B;  1H28 B;  3M59 A;  4KH1 B;  4C0F A;  3EGD B;  1I07 A;  1JU5 C;  4PFZ A;  4QQ6 A;  4KRC B;  4BCN B;  2X4Y A;  5HQ0 B;  3L1A A;  4FL6 A;  2O88 A;  1PWT A;  5GAO l;  5D7U A;  2IPO B;  3UDC A;  5KE3 A;  1O9K A;  1NLO C;  3JCM P;  2FZC B;  2IW9 B;  1ENW A;  3OSS C;  1WLP B;  5AYF A;  3MET A;  2VUB A;  2JN0 A;  4FYY B;  3S3M A;  1UNL D;  1YJN A;  3CME A;  4BCP B;  5KYW B;  1SEM A;  2KBT A;  2R57 A;  1XNI A;  2LCC A;  2V8K A;  4M77 F;  5A2Q E;  3LGL A;  4JPB W;  1D0X A;  2KMG A;  3GLX A;  4EOP B;  2RK1 A;  1BK2 A;  1X43 A;  1WNL A;  3M56 A;  3HSB A;  4AKH A;  1G2B A;  1TSF A;  1AIS B;  3DDQ B;  1PKS A;  1Q82 U;  4K11 A;  5FU7 C;  2XMF A;  5DLO A;  4FSX A;  2HBW A;  3V7C A;  2IN3 A;  3VUB A;  4DEX A;  4M7A E;  1YP5 A;  2FYK A;  4Z8A A;  3ULR B;  4N0A C;  2QQR A;  2QAZ A;  4EIK A;  4F70 B;  2FEI A;  3L2V A;  1OZ2 A;  2QTV A;  3HPW A;  1JOW A;  1UDL A;  3LH5 A;  4KUL A;  1WQW A;  2PK9 B;  1KQS S;  2DAQ A;  2WSE E;  1X2K A;  1N5Z A;  3QYB A;  3CC2 T;  1AOJ A;  1S1N A;  3BG3 A;  3CCJ T;  4M77 D;  5IH2 A;  4AT1 B;  1BI1 A;  4C92 A;  5KYY A;  2L3S A;  1OEB A;  2OAW A;  4JX6 A;  2C5X B;  1YN8 A;  2K3B A;  5GAO q;  1MND A;  2VKN A;  2ROL A;  3RUX A;  3GP8 A;  1O9K B;  1BIB A;  2DO3 A;  4C5I A;  1KHC A;  5D6W A;  3TNH B;  2OTJ T;  1TG0 A;  1B34 A;  1LOJ A;  3UF4 A;  1ZP2 A;  2J06 A;  4MFE A;  3EAE A;  2RI2 A;  3M0U A;  4Y72 B;  4L6V 5;  5I21 A;  1Q95 G;  3CD6 Q;  3JCM h;  2PHG A;  1UHF A;  4JLI A;  1VQM T;  3VYG A;  1KFZ A;  2P4T A;  1XO2 A;  4FW2 A;  2X51 A;  4HCK A;  4NL2 A;  1VQ6 Q;  1FYN A;  3QG1 A;  3QJY A;  3VYH B;  4C92 F;  1N8R U;  3TSZ A;  1IO6 A;  4M7D G;  4JZ4 A;  1GCP A;  1OL1 B;  2LNV A;  1NYF A;  4EDU A;  3CCU T;  2DIL A;  2E64 A;  4DOW A;  2XKO C;  1EIF A;  1TU0 B;  2DM1 A;  5GAO r;  1R8O B;  4EOI B;  3ER0 A;  4BCM B;  1GUX B;  2Y90 A;  2CRE A;  2YSQ A;  3ME9 A;  1KD1 U;  5I22 A;  2UZD B;  1BKB A;  1Y07 A;  1YIT Q;  3QHR B;  3CCR A;  4LD9 K;  3VRY A;  3DL1 A;  4BI8 B;  1YJ9 T;  1BBZ A;  2ABL A;  4HCB A;  3CC4 T;  1CKA A;  4C8Q G;  1GFC A;  2ZPI B;  2DVE A;  2B8A A;  1YJW T;  3OYM A;  2HZY A;  2JTF A;  2LNH B;  3G4S A;  2OX7 A;  3S3N A;  4MZP A;  4M7D A;  3SWN A;  2DJZ A;  3I55 A;  4BUG A;  2GBQ A;  1FMW A;  3CCM T;  4PJM A;  5KCO A;  2D1X A;  1NJI U;  3OS0 A;  2FL7 A;  5LJ3 h;  2BKD N;  2YT6 A;  2QGF B;  1D1C A;  2GFU A;  2HEQ A;  2YUP A;  2L8D A;  2QXF A;  3EG9 A;  4C92 D;  4BDZ A;  2DL7 A;  3CCJ Q;  3JB9 I;  4C5E A;  3OW2 A;  1B34 B;  2LP5 A;  1EFN A;  4C8Q A;  2KK4 A;  5GAN 3;  5IHY A;  2RHI A;  2K9G A;  3A5Z B;  1PHT A;  3CCE A;  4C5H A;  3OW2 S;  4M7D F;  1F1B B;  3VYG B;  1JBM A;  3F5X B;  4M7A C;  3HHT B;  2MIO A;  3SFM A;  2WHB B;  2C6T B;  5L2W B;  2FB7 A;  4QKU A;  3NFC A;  4GLK A;  4Y92 A;  4Z02 A;  1VQM Q;  4QVZ A;  1E9H B;  2NUT A;  1ZHI A;  3TU4 K;  1V29 B;  1WA7 A;  3QXE B;  2VAS A;  2DEQ A;  3CBP A;  2YXY A;  1VQ9 T;  2E41 A;  3M4Y A;  4L5G A;  4ELY C;  3EG3 A;  4OMN A;  4C8Q F;  2W9F A;  1UG1 A;  3KBG A;  5I2S A;  2C0I A;  1M1K U;  1WHH A;  1N8R C;  1G3N C;  2KXD A;  4ANJ A;  2QA4 A;  3BHU B;  1URC B;  1XOV A;  1ZSZ A;  5CO7 A;  3VS2 A;  1OI1 A;  1G8X A;  1WI7 A;  2HBP A;  1FKM A;  4M7D B;  3DLM A;  1JXM A;  3TEE A;  4DA4 A;  1AT1 B;  5IHN A;  4M7D D;  4QQD A;  1Q7Y U;  2X3X D;  3TSW A;  1YJW Q;  4DBR A;  2YLC A;  2WPA B;  2K7A A;  2BZ8 A;  4FM4 B;  3EG9 B;  2CP5 A;  2E6N A;  4C0D B;  1EZZ B;  2EQJ A;  1M27 C;  3J80 E;  5KYU B;  2HMA A;  2HL3 A;  3QBY A;  5GAO n;  3X26 B;  3G6E Q;  4C8Q B;  2QTX A;  2WMA B;  4HCC A;  2O01 E;  3PVQ A;  1OI9 B;  2JTM A;  1NJI C;  2R7G A;  4C8Q D;  3A8G B;  2WIP B;  2ZPH B;  2G6F X;  3CME T;  1P92 A;  4QW2 A;  3LYI A;  3OYH A;  3KXT A;  2EWN A;  4F7U G;  1M90 R;  4NST B;  4LD6 A;  1KC8 R;  2KGT A;  3VS0 A;  1WJR A;  2RM4 A;  3QYH B;  1RAB B;  4N4I A;  1VA7 A;  3L2Q A;  5LJ3 g;  3PTA A;  2CUD A;  2AKL A;  2CT4 A;  1MNE A;  2EKH A;  4XQ3 A;  5HKC A;  2NUT B;  3A98 A;  4BBR M;  2RI5 A;  2EBP A;  2EQM A;  1NZ9 A;  3CD6 A;  4BCI B;  2UUE B;  2YUQ A;  2DX1 A;  2Y4X A;  1CKB A;  1PCX A;  2YHT A;  4J9F A;  1N4M A;  4MZM A;  2F5T X;  4N0A A;  1VQO Q;  4F6S B;  4XTY A;  2KVQ G;  1VQN A;  3RKW A;  3VS6 A;  3ZBD A;  1IHW A;  4DEY A;  4EOQ B;  3BY7 A;  4B9W A;  2QQB A;  5I11 A;  3RKY A;  2JZ2 A;  2EVR A;  2E4H A;  1BU1 A;  4BCK B;  3M0P A;  4CFM B;  5KH6 A;  2FO0 A;  1RI9 A;  5LJ3 j;  1YIT A;  1N9S A;  5CQY A;  2A37 A;  1Y57 A;  4PKC C;  1X75 C;  3HL8 A;  1M1K C;  2BZY A;  4BXX X;  4PK4 A;  1TD6 A;  4MML A;  5DQW A;  1S72 A;  1HK9 A;  2JM9 A;  4QVC A;  3TVT A;  1K9M R;  2VC8 A;  1VYV A;  3OMC A;  3JCM J;  2J6O A;  3M0Q A;  1PKT A;  1ZA1 B;  3CXC A;  3EFO B;  4FYX B;  5HK0 A;  1V76 A;  2L3Q A;  5GAN 4;  4BAC A;  4C0Z A;  1Q7Y C;  3LLR A;  4LDX A;  4HLQ A;  2HQH A;  4IKF A;  2GGR A;  2DL5 A;  1YJN Q;  1GBR A;  3CME Q;  2RJC A;  4CFW B;  2ZZD B;  2KRM A;  1JEG A;  3MO8 A;  3C0C A;  3A8H B;  2GF7 A;  4FCY A;  3S6W A;  1Q86 U;  4DBQ A;  1H1P B;  1X27 A;  1RI0 A;  4RCB A;  3JB9 F;  4CRI A;  2V22 B;  2A36 A;  2L3R A;  2DVJ A;  3GPL A;  3GOX A;  3ZFJ A;  2DYB A;  3OYC A;  2F2X A;  4BE0 A;  5A0L A;  3CCR T;  1NM7 A;  2DIG A;  2CSQ A;  4HCZ A;  4OVA A;  3A8L B;  4CC4 B;  1YWP A;  2M02 A;  3TW6 A;  4JS4 A;  4F7U B;  1OU9 A;  3RBB B;  3SDZ A;  1MMN A;  1M8M A;  3H8Z A;  1GCQ C;  2LJ1 A;  2PQW A;  3PVL A;  1UGS B;  4OB0 B;  1VOL A;  4EOS B;  2CKK A;  3QJ6 A;  4X34 A;  3G4S T;  3CCL A;  2KE9 A;  3I55 T;  2I2L A;  1VQL A;  2ZPF B;  3ASK A;  5KYN A;  2NUP A;  2PZ1 A;  2MMP A;  1QW1 A;  4HVW A;  1TTH B;  4LDV A;  2UZE B;  1NEG A;  1QVG A;  2GNC A;  1JB0 E;  3JCM d;  1D3B A;  1H1R B;  2AHJ B;  4F7S B;  2EYX A;  1Y7X A;  4PFO A;  1ZLM A;  3JB9 D;  3DTO A;  4KUI A;  5GMK l;  1QVG S;  3CCQ A;  3BG5 A;  3CCE T;  1UHC A;  2DD5 B;  4JRP A;  4RMO A;  4ATO A;  5CKF A;  2DER A;  3L2R A;  1PKD B;  4AI6 A;  4AFU C;  4M7A A;  3PMI A;  4F7U E;  3EFR A;  3EGD A;  4B9X A;  4BB7 A;  4C0D C;  3FDR A;  1NBE B;  5CKH A;  2QGG A;  4NL3 A;  2LX7 A;  2RHX A;  4N4G A;  4E6R A;  4F7L B;  2I53 A;  1M1F A;  2E65 A;  1E7O A;  2KRO A;  2W2H A;  2V26 A;  5A0G A;  5FRN A;  1QKW A;  5GAN h;  1HYO A;  3X28 B;  2YRV A;  2CH4 W;  5LJ3 d;  3QWL A;  4EON B;  2HD0 A;  5KYW A;  2WSF E;  5CKD A;  3CCS A;  2QA4 T;  4DBH A;  2KDS A;  3CCR Q;  1Q86 C;  1K76 A;  1D1A A;  3MP1 A;  3I56 Q;  3EGU A;  4M7A F;  3LWI A;  2DEU A;  3M0S A;  2COZ A;  4D8K A;  1HSQ A;  1WJS A;  3BHV B;  4QQG A;  4IUV A;  4RTT A;  2LQN A;  2HSP A;  1VQO A;  5LMK B;  5KE2 A;  1M30 A;  3M0T A;  3I55 Q;  3NTI A;  3R6O A;  2ZPB B;  1MV3 A;  4J6Y A;  1JJ2 S;  3LH0 A;  2ROT A;  3G7Z A;  2P0P A;  5LJ3 e;  4JJC A;  3QYG B;  1K73 R;  2L3P A;  5I5Z B;  2DBK A;  1GXI E;  2MCN A;  3RIR A;  4EOJ B;  1M1G A;  4AFZ C;  2JT4 A;  1G5V A;  4AG1 C;  2KMT A;  1WHK A;  2IVX A;  2J6F A;  3J7A F;  3CCE Q;  3QHW B;  1G3Y A;  1SHG A;  3CPW P;  4M7A D;  2PVO B;  2CJM B;  1AHJ B;  4WF2 A;  3M0R A;  3NMZ C;  4BE1 A;  1U1S A;  4AMC A;  4BCN D;  3CD6 T;  4MMK A;  1HXD A;  2ECZ A;  4IIO A;  4XTW A;  5LJ3 f;  4LXC A;  1QLB A;  1VQ6 T;  3H9N A;  2COW A;  3OYL A;  1WDX A;  5CKB A;  4BCJ B;  1VQN T;  1VQK Q;  4E7L A;  3TW7 A;  3CQT A;  2J6K A;  2KR3 A;  4J5Y A;  3RR6 A;  1H3H A;  4OGE A;  1T3L A;  2GTO A;  1ARK A;  3MEV A;  1E6H A;  3PO3 S;  2KI7 A;  2ED0 A;  6AT1 B;  4KGZ B;  1FXX A;  1QQJ A;  1G3S A;  2LT1 A;  2IG0 A;  2MPX C;  1P5E B;  1NLP C;  1NPR A;  3TNI B;  1JSU B;  5ACB A;  4OGC A;  2QA4 Q;  1YIT T;  4OMO A;  3MJX A;  2AZV A;  1IB8 A;  4PJN A;  1H1S B;  5M9O A;  2LT4 A;  3M03 A;  3JAM E;  2R58 A;  4Y91 A;  1GUX A;  1S72 T;  2L89 A;  4XU0 A;  3RMS A;  3UA6 A;  3OYD A;  5IHK A;  1NYG A;  4IUU A;  4BCO B;  1AD5 A;  2P0K A;  3AT1 B;  5GAN 6;  3VKG A;  2WAC A;  1WIE A;  5J3B A;  4AFQ C;  2M16 A;  1T0J A;  5HBE B;  5GAM h;  4JRK A;  1Q81 R;  2RHZ A;  2V1R A;  3OQ5 A;  4CC2 A;  3CBM A;  2XID A;  2D6F A;  2W10 A;  2YLB A;  4HKE A;  2NLU A;  1RUW A;  3DB4 A;  1N9R A;  1OYX A;  3CMA A;  2GQI A;  2LMJ A;  1KQ1 A;  2BE9 B;  5CK9 A;  3A8O B;  3OMG A;  2K5F A;  4KT0 E;  1M5Q 1;  1UJ0 A;  2C4G B;  1KQ2 A;  4OB2 B;  3NTH A;  4BY7 X;  5CYI B;  2XU8 A;  4JRQ A;  4E47 A;  2YDL A;  1W2B P;  1FMK A;  4RTZ A;  8ATC B;  5IDP B;  3G33 B;  3RGF B;  3CC7 A;  4DQ2 A;  2DTH A;  1RAI B;  4XTX A;  2L2P A;  1GCQ A;  3TCJ A;  3CCL T;  4E7Z A;  3V7R A;  3MPU B;  2K3X A;  1VQN Q;  2QDJ A;  1QP2 A;  4O6J A;  4JJB A;  2KR6 A;  1ZUU A;  1X6O A;  1QP3 A;  1VQ8 Q;  4OB3 B;  2RO0 A;  4F16 A;  1OV3 A;  2HSE B;  4LE9 A;  1BYM A;  2CT3 A;  4LUE A;  2DE0 X;  4ZN1 A;  3E9F A;  2RK2 A;  2DL3 A;  4BCM D;  3I56 A;  5EC7 A;  1B07 A;  4ORZ A;  2M0Y A;  4F7N B;  1S72 Q;  3CCQ T;  3JCM X;  2ED1 A;  2MOX A;  1Q82 C;  1M2V B;  4XTV A;  2NYS A;  3VU3 C;  3G71 A;  3OYI A;  4P5N A;  4A63 B;  1YBY A;  1H1Q B;  1M90 U;  4M78 G;  2DXT A;  2X4J A;  2K79 A;  2K2V A;  2QDY B;  1KC8 U;  2EJG A;  1O75 A;  5EFQ B;  3G6E T;  2OTL A;  2D0N A;  4PJO G;  1VYU A;  3EG1 A;  2EIF A;  4DOV A;  3FC3 A;  3S3O A;  1Z9Z A;  2A28 A;  4XU3 A;  5KYU A;  4OGR B;  3MEU A;  2O9V A;  5FRM A;  3B57 A;  2PTK A;  1PNJ A;  1JJ2 P;  4J6W A;  2K5L A;  1U3O A;  2CS7 A;  2RQT A;  1YNZ A;  5D6Y A;  5KYX B;  1QVF A;  2FG0 A;  2JXB A;  1OGU B;  1VQ4 A;  3JRZ A;  4CFU B;  5IF1 B;  3CCS T;  3X25 B;  2XK0 A;  1SRM A;  5HNB B;  4ELZ C;  2UZB B;  1QVF S;  4XU2 A;  4BBS M;  2CP6 A;  2J7I A;  4EPC A;  2GCX A;  2W9Z A;  1C9B A;  2JMA A;  1AD6 A;  5HBJ B;  1TXQ A;  2QYZ A;  3FB9 A;  1VQO T;  1OZ3 A;  3VS7 A;  3CCL Q;  3INZ A;  1NPP A;  3H0F A;  1QMC A;  4E7K A;  1VQK A;  3SD4 A;  3HZJ A;  1I4K 1;  1N6A A;  3M4G A;  1TWB A;  1OPL A;  4PLI A;  3RMQ A;  4A4F A;  5IXF A;  1VQL Q;  3REB B;  1LCK A;  1NEB A;  3TQ7 P;  4JRI A;  3FRN A;  3VV0 A;  1K9M U;  1VYT A;  3T9N A;  4RTW A;  4KRD B; 
#chains in the Genus database with same CATH homology
 2FHD A;  3OYN A;  4HLQ A;  2FVU A;  5GMK e;  3UWN A;  1JJ2 A;  4LDX A;  2RHY A;  3BG9 A;  2V8J A;  4IKF A;  1X01 A;  4OP0 A;  3JCM g;  2VXF A;  2LTO A;  3MHX A;  3V8L A;  5GMK i;  4E7J A;  4V2S A;  4J7F A;  1PSF A;  4XK8 E;  3OA6 A;  2D0Q B;  2RJC A;  3QDR B;  4A4H A;  2ZZD B;  2C06 A;  1JRI A;  3MO8 A;  1VQP A;  3WVE B;  3BDL A;  1KD1 C;  3A8H B;  2GF7 A;  3S6W A;  1Q86 U;  2CGH A;  4XTU A;  3BDU A;  3FEO A;  1VQ9 A;  4A53 A;  1RI0 A;  4D6W A;  1D3B B;  4HNU A;  4RCB A;  5GAN d;  2DPP B;  3JB9 F;  4CRI A;  1VQL T;  4HL4 A;  4HT8 A;  4JJN K;  4BD3 A;  2L3R A;  3DB3 A;  3GPL A;  3QHS A;  2LRQ A;  2PU9 B;  3ZFJ A;  3FIF A;  3MP8 A;  1UGP B;  3OYC A;  3E19 A;  3GOX A;  4ZGE B;  2LVM A;  4BE0 A;  5FLX E;  5A0L A;  3CCR T;  4O5V A;  4VUB A;  2DIG A;  2IVW A;  4HCZ A;  4OVA A;  1UGR B;  1NE8 A;  3A8L B;  2E5Q A;  2O4X B;  4UC4 A;  4YTL A;  3PIO A;  2K4Y A;  4MFD A;  3TW6 A;  3CPF A;  4JS4 A;  4F7U B;  3SDZ A;  4LOC A;  4J6X A;  3VJP A;  4BE2 A;  3H8Z A;  4M77 A;  3L2W A;  1M90 C;  1YJN T;  2D9T A;  2PQW A;  1MGQ A;  1UGS B;  4OB0 B;  2CKK A;  3QJ6 A;  4X34 A;  4M7A B;  3G4S T;  3CCL A;  3I55 T;  3M59 A;  4FU6 A;  4C0F A;  2I2L A;  4EMK A;  4M78 B;  3JCM Q;  3OYB A;  1MHN A;  4BI4 A;  2EQU A;  1SSF A;  4QQ6 A;  4M77 E;  2DTO A;  1VQL A;  2ZPF B;  5LJ5 d;  2ZPG B;  2X4Y A;  3ASK A;  4NS5 A;  2XD0 A;  3L1A A;  5IAY A;  2MMP A;  3L42 A;  4FL6 A;  1QW1 A;  5GAN e;  5GAO l;  1W4S A;  1KG1 A;  5CVI A;  3UDC A;  2ZZD A;  4LDV A;  4PJO B;  5KE3 A;  3JCM P;  5A0D A;  5GMK h;  1QVG A;  3C95 A;  5I2M A;  4XAX B;  2XIC A;  3OSS C;  5AYF A;  1JB0 E;  3BFM A;  4RCC A;  3JCM d;  2RJE A;  4QSH A;  3MET A;  1D3B A;  2AHJ B;  2VUB A;  2G3R A;  2KQW A;  1QVP A;  5DY9 A;  5D6X A;  2JN0 A;  3S3M A;  1Y7X A;  1YJN A;  4LDY A;  3CME A;  3JB9 D;  2JNG A;  2V8I A;  3SB2 A;  1YHQ T;  3GNG A;  1FX7 A;  2R57 A;  4ZTF A;  1XNI A;  2LCC A;  4KUI A;  4PLL A;  2V8K A;  5GMK l;  4M77 F;  5A2Q E;  3LGL A;  1QVG S;  3CCQ A;  3BG5 A;  4A4E A;  5GMK m;  2KMG A;  2QQS A;  3GLX A;  3OB9 A;  4C5G A;  3CCE T;  2DD5 B;  2DTI A;  2RK1 A;  3HRS A;  4F7U A;  4JRP A;  2JUF A;  4RMO A;  1WNL A;  4ATO A;  3VKH A;  2F5K A;  2BUD A;  3M56 A;  5CKF A;  2EQK A;  4C92 B;  3HBL A;  4TVR A;  3HSB A;  4AKH A;  3L2R A;  1U1T A;  1Y96 B;  5LJ5 e;  4ZN3 A;  1WPY A;  3OYJ A;  1VQ8 A;  3WVD B;  4AI6 A;  3QKJ A;  2K57 A;  4M7A A;  3J81 E;  5FU6 B;  1Q82 U;  3PMI A;  2BS2 A;  4F7U E;  5FU7 C;  1H64 1;  3EFR A;  3LX7 A;  4M78 A;  4FSX A;  4B9X A;  5DLO A;  4BB7 A;  4C0D C;  5GAM g;  3V7C A;  4LDW A;  3VUB A;  4A54 A;  3FDR A;  3CPW A;  4M7A E;  2FYK A;  4JX4 A;  5CKH A;  3URG A;  4N0A C;  3Q1J A;  4J83 A;  4NL3 A;  4PJO A;  2RHX A;  2QQR A;  1K9M C;  4M78 E;  4N4G A;  5CKE A;  3CMA T;  1M1F A;  2E65 A;  3JSC A;  2R5A A;  3L2V A;  2RJF A;  1OZ2 A;  3HP9 A;  3O8V A;  5A0G A;  5CR2 A;  4RG8 A;  2DXC A;  3HPW A;  5FRN A;  4M75 G;  4EMG A;  5GAN h;  2RA2 A;  3X28 B;  2YRV A;  2EFI A;  4KUL A;  4PJO E;  1M8V A;  1WQW A;  4J8O A;  5LJ3 d;  1KQS S;  1VQ7 T;  2PUK B;  2RH2 A;  3QWL A;  4GY5 A;  2DAQ A;  2MI6 A;  2WSE E;  2HD0 A;  4F7U F;  2LQK A;  2WSF E;  2BIV A;  5CKD A;  3CCS A;  2QA4 T;  3QYB A;  2VYT A;  3QZ5 B;  3CC2 T;  2KDS A;  3QSU A;  1Q86 C;  2EJ9 A;  3RKX A;  3MP1 A;  2CZ0 B;  3BG3 A;  2EAY A;  2DD5 A;  2RHU A;  3H6Z A;  3HFO A;  4HNT A;  3OBY A;  4M77 D;  1BI1 A;  1KHI A;  4M7A F;  2G77 A;  3RES A;  4EMK B;  4FIB A;  3HRU A;  4C92 A;  5HK3 A;  5LJ5 f;  3DKM A;  3LWI A;  4M78 F;  2QEX T;  4JX6 A;  3LLR A;  1Y96 A;  4AKG A;  5GAO q;  1WJS A;  3GNF B;  5GAM j;  1VQ9 T;  3CXC S;  4HNV A;  4QQG A;  3E1S A;  4IUV A;  2XDP A;  3N5B B;  1VQO A;  3RUX A;  3GP8 A;  5KE2 A;  3QUI A;  3V8J A;  2DKG A;  5CIU A;  4C92 E;  4PJO F;  1BIB A;  2DXU A;  2X35 A;  2DO3 A;  3NTI A;  2CYZ B;  3R6O A;  4C5I A;  1KHC A;  5D6W A;  2OTJ T;  3E9G A;  1B34 A;  1VQ5 A;  2QFZ A;  2ZPB B;  1LOJ A;  4J6Y A;  5LJ5 h;  1VIF A;  1JJ2 S;  3EAE A;  4MFE A;  3G7Z A;  3LH0 A;  2P0P A;  3F70 A;  4M75 A;  1YIJ A;  2RI3 A;  1BI0 A;  3V7S A;  3GF5 A;  2RI2 A;  3PGG A;  3MCA B;  2MWP A;  2ZPE B;  3QZ9 B;  2HQE A;  2LC4 A;  5LJ3 e;  3QYG B;  4L6V 5;  5I21 A;  5GAM d;  4BDY A;  2GQV A;  5J39 A;  3M57 A;  3SWN B;  2CZ7 B;  3JCM h;  3I56 T;  4M75 E;  4M6V A;  4JLI A;  1M9S A;  2HAX A;  1VQM T;  3MEW A;  3VYG A;  1XQH A;  2LX9 A;  1YI2 T;  2P4T A;  1GXI E;  3OS2 A;  3V8K A;  3RIR A;  2KSS A;  4NL2 A;  1UB4 A;  1ZBX A;  3QG1 A;  1M1G A;  3QJY A;  3OYG A;  3VYH B;  1G5V A;  4C92 F;  1N8R U;  5CAI A;  2JVV A;  4J7I A;  2VGN A;  4M7D G;  1K8A U;  2KMT A;  1KC8 C;  2JOY A;  2LNV A;  2DD4 A;  3G71 T;  4EDU A;  3CCU T;  3EFS A;  5C0M A;  4HA8 A;  2E64 A;  4DOW A;  3J7A F;  2XKO C;  1EIF A;  4II1 A;  1WQ7 A;  4IUP A;  1G3Y A;  4JX5 A;  4L59 A;  4M7A D;  2PVO B;  5GAO r;  1R8O B;  2QI2 A;  2DZC A;  3ER0 A;  2Y90 A;  1AHJ B;  3CBO A;  4M78 D;  4WF2 A;  3ME9 A;  5IT9 E;  1KD1 U;  4CI0 C;  1TH7 A;  4M75 F;  3JCM V;  1BKB A;  3ZEH A;  1Y07 A;  3CCR A;  1U1S A;  5GAO m;  2K5I A;  2E12 A;  4BE1 A;  4LD9 K;  3CD6 T;  3DL1 A;  1VUB A;  4MMK A;  1HXD A;  2MAM A;  3MEA A;  5EG2 A;  4BI8 B;  4XTW A;  1YJ9 T;  4ELJ A;  2M9U A;  4PJO D;  2X4X A;  2DXC B;  4M77 C;  5LJ3 f;  1QLB A;  2GFA A;  3CC4 T;  4HCB A;  1VQ6 T;  4C8Q G;  3OYL A;  5GAN 5;  2ZPI B;  4FT4 A;  5CKB A;  2DVE A;  1VQN T;  2B8A A;  1YJW T;  2QQ9 A;  1G3T A;  3OYM A;  4E7L A;  2JTF A;  3TW7 A;  3OSV A;  3VKI A;  4BY6 B;  4MZP A;  3G4S A;  3SWN A;  2DJZ A;  3NTK A;  3I55 A;  4M7D A;  4BUG A;  3L2U A;  4J5Y A;  1YCY A;  1VQ4 T;  3CCM T;  4OGE A;  3PFS A;  5KCO A;  3OYK A;  4JUV A;  3MEV A;  3OYA A;  3M5A A;  1NJI U;  3OS0 A;  2FL7 A;  5LJ3 h;  2BKD N;  2CZ1 B;  1FXX A;  4N4H A;  1G3S A;  2LT1 A;  2IG0 A;  3P8D A;  4M7D E;  1NPR A;  2GFU A;  2L8D A;  2QQA A;  2QXF A;  4OGC A;  2MF2 A;  2ZGW A;  1YIT T;  4C92 D;  3JCM c;  4OMF B;  1I5L A;  3WXM B;  4BDZ A;  4ME7 A;  3OBW A;  4C5E A;  5M9O A;  3JB9 I;  3OW2 A;  3CC4 A;  2LT4 A;  4X9D A;  4RG2 A;  5GMK j;  5GAN f;  3PIP A;  1VQ6 A;  3JAM E;  1B34 B;  2R58 A;  3JCM e;  4Y91 A;  3JB9 G;  4ZGD B;  1S72 T;  4M75 B;  4MDW A;  4C8Q A;  2KK4 A;  5IN1 A;  2L89 A;  3FLG A;  4XU0 A;  3RMS A;  5GAN 3;  3OYD A;  1YHQ A;  1VQK T;  4R55 A;  4IUU A;  2RHI A;  3A5Z B;  3LWH A;  2P0K A;  3M58 A;  3HO8 A;  4M75 D;  5GAN 6;  4BI3 A;  3VKG A;  4NC6 A;  2EJF A;  2A3L A;  2WAC A;  3CCE A;  3UT1 A;  5J3B A;  4C5H A;  3OW2 S;  4M7D F;  3HKS A;  3VYG B;  2HQX A;  1UGQ B;  1JBM A;  2LCL A;  4C8Q E;  2M16 A;  5KCH A;  3CCV T;  1DJ7 B;  3CPW S;  2E6Z A;  3QPH A;  5DM7 R;  3HHT B;  5CQX A;  4M7A C;  3SFM A;  4KBM B;  5CCA A;  5GAM h;  1H3Z A;  4JRK A;  2BS4 A;  4M78 C;  5GAN 2;  2RHZ A;  4LDU A;  2FB7 A;  3OQ5 A;  2LQ8 A;  2RB6 A;  2DD4 B;  3CBM A;  3NFC A;  4GLK A;  1E7P A;  4Z02 A;  2XID A;  3LGF A;  2D6F A;  2XDB A;  3GIB A;  4QVZ A;  4Z6Y A;  4PJO C;  1ZHI A;  3TU4 K;  1V29 B;  2YLB A;  4HKE A;  1VQP T;  1Q81 U;  3QXE B;  3L2Z A;  1UEB A;  2DEQ A;  2NLU A;  1BI2 A;  3CBP A;  3M54 A;  3DB4 A;  1N9R A;  1OYX A;  4RKU E;  3CMA A;  2E41 A;  1KQ1 A;  3M4Y A;  1G3W A;  4L5G A;  5CK9 A;  3A8O B;  4ELY C;  3OMG A;  2K5F A;  2QF7 A;  4KT0 E;  3M53 A;  4C8Q F;  1M5Q 1;  4JLG A;  3QO3 A;  5C6S A;  3JB9 J;  4OB2 B;  4R56 A;  3NTH A;  3JCM f;  1KQ2 A;  3KBG A;  5I2S A;  5LJ5 g;  2XU8 A;  4JRQ A;  1M1K U;  1VQ7 A;  4E47 A;  1N8R C;  4NOY A;  1ZQ1 A;  3S3N A;  5EJC A;  1K8A C;  3OS5 A;  2QA4 A;  2P0Q A;  1XOV A;  4HT9 A;  5CO7 A;  3CC2 A;  1OI1 A;  2L5Q A;  4M77 G;  4E7I A;  2HBP A;  3X20 B;  3M9Q A;  3CC7 A;  4C92 C;  1FKM A;  2DTH A;  4DQ2 A;  3DLM A;  3QYE A;  3CCJ A;  4JS5 A;  3TEE A;  4DA4 A;  4M7D B;  5L8R E;  2PVG B;  4XTZ A;  2QEX A;  1FWZ A;  3MP6 A;  4XTX A;  2K3Y A;  3TCJ A;  4M7D D;  2R5M A;  3CCL T;  4QQD A;  5FU6 C;  3V7R A;  4A4K A;  1K73 U;  2EYQ A;  1U8R A;  3H4C A;  2K3X A;  1WGS A;  2QDJ A;  1Q7Y U;  2PUO B;  4IUQ A;  2Y4Y A;  1QP2 A;  2YLC A;  4O6J A;  4Q5W A;  5FU7 B;  4FM4 B;  2E6N A;  2KR6 A;  4C0D B;  4QVD A;  2DXB B;  4M75 C;  2OTJ A;  1X6O A;  2EQJ A;  2WSC E;  2X4W A;  3JCM W;  1QP3 A;  4OB3 B;  2RO0 A;  3J80 E;  2WJ9 A;  4PL6 A;  1BYM A;  3PT9 A;  2VGM A;  2XG8 D;  4A4G A;  3QBY A;  3A8M B;  4ZN1 A;  3E9F A;  5LJ5 j;  4JDS A;  5GAO p;  3X26 B;  5GAO n;  1O9S A;  4C8Q B;  2QTX A;  5LL6 S;  4MZT A;  3AHU A;  2RK2 A;  4HCC A;  2O01 E;  2OTL T;  3I56 A;  2QQ8 A;  2JTM A;  5GAM e;  1Y71 A;  1VQM A;  1NJI C;  1YI2 A;  4C8Q D;  3A8G B;  2ZPH B;  1LNX A;  3OS1 A;  3CME T;  1P92 A;  2E70 A;  3LYI A;  4QW2 A;  3OYH A;  3P8B B;  3PNW C;  3KXT A;  2EWN A;  2XI9 A;  4F7U G;  5GAN 8;  4X9C A;  3KUF A;  3JCM X;  3CCQ T;  1VIE A;  1BIA A;  2VXE A;  4LD6 A;  1IZ6 A;  1I8F A;  1W2B A;  1Q82 C;  4MDX A;  2HNI A;  4XTV A;  3VU3 C;  4EMK C;  3LW5 E;  3X24 B;  3G71 A;  1WJR A;  3OYI A;  2DK3 A;  4AKI A;  1RL2 A;  3CCU A;  2RM4 A;  3QYH B;  4P5N A;  3OYF A;  4M7A G;  1YBY A;  1N27 A;  4IUR A;  4N4I A;  2ZCF B;  2MWO A;  2KAF A;  3L2Q A;  1M90 U;  4M78 G;  4PNO A;  5LJ3 g;  2DXT A;  3PTA A;  2X4J A;  4E7H A;  2K2V A;  2QDY B;  4XQ3 A;  5HKC A;  1KC8 U;  2EJG A;  2H3J A;  1O75 A;  3C12 A;  4BBR M;  2RI5 A;  4ZGJ B;  1W2B S;  1M4Z A;  3G6E T;  2EQM A;  2A7Y A;  1NZ9 A;  1XTD A;  2OTL A;  3CD6 A;  4PJO G;  3OY9 A;  2DXB A;  1YJ9 A;  3FJP A;  1WJQ A;  2EIF A;  2Y4X A;  4DOV A;  3FC3 A;  3S3O A;  2YHT A;  4IUT A;  2BS3 A;  4XU3 A;  4ZTJ A;  1PSE A;  3MEU A;  4MZM A;  2F5T X;  2O4X A;  4N0A A;  3CCJ T;  5FRM A;  4OB1 B;  5FRO A;  1IRE B;  4XTY A;  2KVQ G;  5DLQ E;  3RKW A;  1VQN A;  4J6W A;  2K5L A;  1YJW A;  3SWN C;  4M7D C;  3ZBD A;  2CS7 A;  2E10 A;  5GAM f;  1BI3 A;  2LDM A;  3BY7 A;  2KY9 A;  5D6Y A;  5GAN 7;  4B9W A;  1QVF A;  4OF1 A;  2QQB A;  2DIQ A;  1VQ4 A;  3JRZ A;  3CCM A;  3RKY A;  4C0G A;  2JZ2 A;  4XU1 A;  3UPU A;  3C4S A;  3TRE A;  3CCS T;  2RJD A;  4Y28 E;  3JCM b;  1LJO A;  5GAN g;  1Q81 C;  2CZ6 B;  1VQ8 T;  3OYY A;  4EMH A;  3OYE A;  3DLL A;  4C92 G;  3X25 B;  1I81 A;  5KH6 A;  3G6E A;  3JB9 H;  2XK0 A;  5LJ3 j;  5J26 A;  3VUZ A;  1YIT A;  2RD1 A;  4ELZ C;  2DZ9 A;  1QVF S;  2F69 A;  3PMT A;  4BBS M;  1N9S A;  4XU2 A;  5CQY A;  4MIM A;  5HY6 A;  1KQS A;  3CC7 T;  4EPC A;  2PVD B;  2GCX A;  4PKC C;  1X75 C;  3HL8 A;  1M1K C;  3HB9 A;  3P8H A;  3HFN A;  3KHI A;  4C8Q C;  4MML A;  3FB9 A;  2E1H A;  1VQO T;  1OZ3 A;  1S72 A;  1HK9 A;  3INZ A;  1NPP A;  4FT2 A;  4QVC A;  4E7K A;  4KUD K;  2M1H A;  1VQK A;  2VC8 A;  3SD4 A;  3HZJ A;  2EKO A;  2XDD A;  1VQ5 T;  3RER A;  1I4K 1;  3OMC A;  1N6A A;  3M4G A;  4PLI A;  3RMQ A;  2XHC A;  3C94 A;  4A4F A;  3JCM J;  1YIJ T;  2OAU A;  3HRT A;  3CXC A;  5HK0 A;  4M77 B;  4JRI A;  3CEY A;  3M55 A;  3CCV A;  3FRN A;  1K73 C;  3VV0 A;  5GAN 4;  4BAC A;  1K9M U;  4C0Z A;  1Q7Y C;  4BY6 C;  3BW1 A;  3QII A;  2M0O A;  3T9N A;  5GAN j;  2VV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...