2ZCFB

Mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
pubmed doi rcsb
source organism Rhodococcus erythropolis
total genus 56
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zcfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zcfB02
1AHJB 3QYGB 3X26B 2DXBA 4ZGJB 2ZPHB 4OB0B 2CZ7B 2CZ6B 2CZ0B 2DD5A 1PSFA 3X28B 3WVEB 3A8MB 2PVOB 1UGPB 1UGRB 4FM4B 4ZGEB 2ZPFB 2PU9B 2DD4B 2DPPB 2WSCE 2PUKB 2DXCB 3A8OB 3QXEB 3LW5E 3A8HB 3A8LB 4KT0E 5L8RE 3X20B 3QZ9B 3X24B 2CZ1B 2WSEE 2DD4A 3X25B 3VYGB 2ZZDB 1QP3A 2ZPBB 2ZPGB 3VYHB 2DXBB 2QDYB 1UGQB 2PVGB 2DD5B 1V29B 4OB3B 2CYZB 2PUOB 3WVDB 2ZPEB 3VYGA 4RKUE 2ZZDA 4ZGDB 2DXCA 3HHTB 3A8GB 4XK8E 4OB2B 1GXIE 2O01E 4OB1B 1UGSB 2AHJB 1QP2A 4Y28E 3QZ5B 1PSEA 2ZCFB 1DJ7B 2WSFE 2ZPIB 4L6V5 2D0QB 3QYHB 1IREB 1JB0E 2PVDB
chains in the Genus database with same CATH superfamily
4HA8A 3G6EA 3LQ5B 1TU0B 5GJWB 2IW8B 2ZPHB 4OB0B 3G4ST 3JB9J 3UWNA 1H24B 3GP8A 3BDUA 2K9GA 2E4HA 2LQKA 5C0MA 1VQ4T 2PTKA 2HMAA 3ULRB 1VQ6A 3X28B 3EFSA 1OZ2A 3WVEB 2DL3A 1U1SA 4YOOA 2RD1A 1TD6A 2E6ZA 3G71A 1MMAA 3A8OB 1IGUA 2D9TA 2L8DA 4EONB 3AT1B 1FWZA 1QVFP 2NYSA 2RHZA 3FJPA 4BI3A 4PJNA 5IAYA 4BCQD 2GTOA 2YRCA 1G8XA 1VQKA 4F04B 1E6HA 4PJOF 1ZUYA 1M4ZA 4X9DA 3CQTA 4BCHB 2AK5A 5LJ5e 1TUDA 4Z6YA 4R56A 4E7SA 3CCUT 2DNUA 4Y72B 3HBLA 4OGEA 1KXUA 2L2PA 2C5VB 4F6UB 2ZPBB 4AG2C 2G9XB 2DL7A 1TFBA 4PLIA 2DL5A 2DTOA 4KGZB 2DETA 2XKOC 4QVZA 3CC2T 1UUEA 3S6WA 2EPDA 2P4TA 3GF5A 2GNCA 1W1FA 3BW1A 4FCYA 3M55A 3G4SQ 2W9FA 1GFDA 1ZSZA 4M78C 3M5AA 4RKUE 1VQ4Q 2ZZDA 2UZEB 1M2OA 1NLPC 2BS2A 1JJ2A 1VQMA 1NYGA 3QBYA 4JS4A 3TSZA 5GAN4 4EOMB 4ELZC 3OSSC 4JX6A 1FVVB 1VQNA 2COZA 2RI2A 3I55Q 3CCRA 4OGRB 5CKDA 1QWEA 3QO3A 1RAIB 3VS6A 3BG9A 4AFUC 1G3TA 1VQ7Q 4A63B 1RAAB 1QMCA 3MY1B 2IW6B 2Y90A 2YWWA 5CR2A 5GAN8 1ZSZC 1K0SA 3CCUQ 3QYBA 3S3NA 3CBMA 5FU7B 4BY6B 2EYZA 1QCFA 2FRYA 1N8RR 2EJFA 1K9AA 2DRMA 4AFZC 5KYUB 4LDUA 2WPAB 2DMOA 4C92E 2CSQA 2VASA 2DMEA 2CSIA 1YI2A 4GY5A 3L2RA 3CC2Q 3O8VA 2RN8A 3TVTA 1Q86R 4M75D 2QGGA 1U3OA 1YN8A 3I9QA 1S1NA 4FT2A 1VUBA 5AT1B 1OIUB 2PJQA 1F5QB 4M75G 2ECZA 5L8RE 1YJ9T 3VU3C 2GCXA 4CFWB 3VS1A 2XMFA 4AKGA 3PNWC 1RABB 2WSEE 5LJ5g 4HT9A 4OF1A 4XQ3A 1RAGB 5I22A 3JB9F 4M7DB 4M77F 1KC8R 3BG3A 2HNIA 2OTLA 1SG5A 1WXUA 2WMBB 1LVKA 4L59A 5LQFB 1OGUB 4CI0C 2DD5B 1OU8A 4RTYA 1X2QA 2KT1A 3WVDB 2CUBA 4EMHA 1JQQA 4O6JA 4PJOD 4XU3A 4C8QE 2FO0A 4E7LA 2K3YA 1GXIE 2OI3A 2RI5A 4PJOG 2QASA 3HSBA 2RQUA 2CS7A 2KMGA 1M27C 3KXTA 3PIPA 1DJ7B 1VYUA 2FHDA 4L6V5 2CCIB 2PNIA 4J9GA 3QYHB 1SHFA 1YJ9Q 5KCHA 2PVDB 3G4SA 3EHRA 4LDWA 1TG0A 4Z89A 3ASKA 3QYGB 3PMTA 3THKA 2CZ7B 3L2ZA 1SPKA 3U23A 4HKEA 3PMIA 4C0FA 3JCMf 3I56Q 4OMFB 1SRMA 3DL1A 2DX1A 4Q5WA 1X6GA 1N8RC 5I2SA 1FX7A 4BY1X 3LW5E 1SKUB 1H25B 2L89A 2LC4A 1ZHIA 4M7AB 3PTAA 2QA4A 4KGXB 1P92A 1YIJQ 2FZCB 2EYWA 2JOYA 1K9MR 1VOLA 3CCUA 1Q86C 3I5RA 4Y91A 3SHWA 2G3RA 2E65A 3DOGB 3V8KA 2EAYA 2XDBA 4ATOA 1K4US 1U8RA 2DD4A 1OI1A 2RHIA 1H92A 1RLQC 4XTXA 2AIRB 2O31A 2M0YA 4CFUD 3RMQA 1BI2A 4FW1A 1PD0A 5CAIA 5IHKA 2YRDA 5KYUA 4C0DB 1AOJA 2QDJA 3CXCS 2EQIA 3VRZA 1VA7A 1KC8C 3B57A 4CC2A 4B6MA 3HRSA 5EC7A 4MZTA 4NC6A 1M3CA 2GQIA 1PCXA 4ORZA 4PJOB 2FL7A 1YFNA 5IHYA 3C94A 2QGSA 4ZN1A 2WMAB 2F1LA 2LT4A 3EG3A 1WXTA 4MIMA 4MZPA 1NZ9A 4CC7A 2CREA 2D8HA 2X3WD 3CCST 3F70A 4JRQA 2DFUA 2RB6A 2JS2A 2MK5A 5FU7C 3RUXA 4BY6C 3TNHB 2PK9B 2A08A 2XDPA 2COYA 3CXCA 1JB0E 1OPLA 1PNJA 3V7RA 4M7DA 3RNJA 4XAXB 3BHUB 5KYWA 3X26B 2O2OA 2RHYA 3H41A 2EFIA 2BUDA 2C6TB 2HDAA 5GMKj 2X51A 2DL8A 3EGDB 2QYZA 2QQBA 2DD5A 3QUIA 5FGKB 3JRZA 1PKSA 4DEXA 3JCMQ 1PKDB 3A5ZB 5GAMh 1UGPB 1T0JA 4HCKA 1M90U 5FRMA 2F2XA 2WHBB 1YJ9A 2DF6A 1TXQA 3REBB 4C0GA 4NSTB 4M7DC 1VYWB 9ATCB 2RA2A 4Y92A 2EVRA 2I2LA 3HRTA 1YNZA 1S72T 3CBOA 2DZCA 3CCSQ 2YLCA 2D6FA 1KK7A 2RQVA 1K9MC 4J6XA 4C8QF 5DLQE 2JM8A 4HVVA 1GH6B 4OR5B 5LJ3h 1IO6A 2LNHB 4CFMB 4YOZA 2HQXA 3CPWP 3CMAT 4E47A 4PNOA 2W10A 2DA9A 1W6XA 2MAMA 3D7SB 1ZP2A 4IMYB 3SB2A 1PD1A 3DDPB 4IUUA 4RCBA 4IUTA 5GANf 1Z9ZA 3VYGA 4QT7A 4JRIA 4ZGDB 5LJ5d 1LNXA 4M7AA 4TTHA 1WJQA 1NJIU 2UZBB 4X9CA 1PWTA 3A1PA 5DY9A 4AMCA 1KQ2A 1IHVA 2CGHA 2DIGA 2MYSA 4LDXA 3MO8A 2BZXA 3EGUA 1RACB 4M77B 1I0CA 2KI7A 2WSFE 4F14A 1IGQA 2J06A 4QKUA 3SEMA 4QQDA 1UB4A 3LWIA 1X6BA 1JJ2P 2E10A 3EFOB 2FZKB 1FMWA 2DYBA 4FYXB 3S3OA 1BIBA 2V8JA 2I53A 4J7IA 3VKIA 3QG1A 5CKHA 2CJMB 1FINB 1H27B 2KY9A 3CBPA 1TUGB 4M7AC 4CRLB 3CCVT 2EQKA 5L23A 2CT3A 1H1SB 1SHGA 4F70B 3CMAQ 3MCAB 2I0NA 3WXMB 4ZGEB 4JUVA 5LJ3j 1WA7A 4BCKB 1R0BG 1Q7YU 1ZX6A 4EIKA 4GBQA 2XG8D 4F6WB 2RO0A 3PE0A 1M1KR 2CDTA 2X1NB 1M1GA 4HVWA 3OA6A 1K8AU 1HJDA 2O88A 3FB9A 2CZ1B 4FX3B 2VWFA 3EG1A 1WHJA 4IUVA 3JCMJ 2JXBA 1O75A 2BKDN 3M4GA 4C0DC 3JB9I 4AT1B 2DVJA 2ZZDB 2VB6A 3FLGA 2LCSA 1VQPQ 1QP3A 3GIBA 4PJOC 4JX4A 4PJLA 5IDPB 2QDLA 4BE2A 4MDXA 2HL5C 3JV3A 2YUOA 2HL3A 2LMJA 2LQWA 2QXFA 1ZUUA 3EGDA 4OB3B 4PLLA 3BHTB 2PUOB 3CMET 3M9QA 1K73U 1BK2A 1BYMA 5IHNA 3CCVQ 5CKFA 1KD1R 4EOQB 1FMKA 4HLQA 3OYNA 4XK8E 5A2QE 1P5EB 3UPUA 5AYFA 1IB8A 2J05A 3Q1JA 3OYLA 2IN3A 5D6YA 3HTRA 3M0QA 1UGSB 2QQSA 3MEAA 4Y28E 2ZCFB 2EKOA 1WHGA 3J7AF 5D6WA 1NG2A 2J6FA 4II5B 1UE9A 2C0OA 5IH2A 3PO3S 3L42A 4F7UE 2VGNA 1R77A 1ABOA 3L2UA 3QDFA 3M58A 3JCMX 2K4YA 1C0MA 1WLPB 3EOCB 2DL4A 3VS3A 2D1XA 1FXXA 1OL1B 4LOCA 1AZGB 3OS1A 3HB9A 4J9HA 1BIAA 1UTIA 2LQNA 3FRNA 3DDQB 2KSSA 3JCMe 3MKDA 5GAOr 2JTEA 2FPFA 2LW4A 4FM4B 2KAFA 2LQ8A 1KIKA 5I5ZB 3JCMV 5J39A 4BY7X 3RIRA 1QMZB 3CMEQ 3QSUA 2CP3A 1YITA 1S72A 3CPFA 3VJPA 2R7GA 2QGFB 4QVDA 5DLOA 3TNWB 4EORB 2VGMA 3OYGA 3IQLA 4C5EA 2DIQA 3NHNA 4M77A 2PMIB 2EIFA 2DTHA 4FT4A 2Z0WA 1W2BS 2R58A 3CMAA 1ABQA 2DKGA 1JU5C 3EFOA 2BZ8A 2ZAEA 2KR6A 3MP8A 3I55T 4M78E 2KXCA 1WQ7A 1WGSA 1MHNA 1JSTB 5FU6B 5FRNA 1VQ7T 1BI1A 1D0ZA 2FYKA 3FIFA 4O5VA 3E1SA 2E3IA 2KK4A 5GMKe 5CQXA 1M1FA 4YOSA 1X69A 2JM9A 4M77C 2ROLA 2UZLB 4ROEA 2H8HA 3NTKA 2AKLA 1MNDA 4RG2A 3CCET 2UUEB 2K7AA 1W2BA 1W4SA 4M7DD 3EGXB 1NEGA 1TH7A 4KUIA 2AHJB 1Y57A 2H3JA 1VQLQ 3MEUA 4N4HA 5L2WB 4IIMA 4M7DG 2C5XB 1YHQT 1SEMA 1UFFA 3K7AM 3VRYA 4M6VA 2ESWA 2WXVB 2RQRA 3KHIA 1ZA2B 3P8DA 1AHJB 4AKIA 2HZYA 2L0AA 3CC4T 4HNTA 3CCVA 1U5SA 1XJWB 4JZ3A 4BCGB 3VS0A 5IDNB 3H4CA 4MMKA 1V76A 3TCJA 3MEWA 1QCOA 3BHVB 2BTTA 4J9DA 1X2KA 1IZ6A 3H0IA 3BY7A 3M53A 3JCMg 2DD4B 3KBGA 3URGA 3LLRA 3PVQA 4KBMB 2DEQA 4KRCB 2FZGB 2JJ9A 2XHCA 4KRDB 5EFQB 2KDSA 2KR3A 2KRMA 3EG2A 2IIMA 1FKMA 1BI3A 3EG9B 1HYOA 2JUFA 3NTHA 5DM7R 1QLBA 2Y4YA 3CCEQ 1UJYA 1JEGA 4NL3A 1RADB 5J26A 3OS2A 2EGEA 1RL2A 3OW2P 1UJ0A 8AT1B 5LL6S 1QVGS 4F6SB 4BCJB 2AZSA 1RAFB 1YHQQ 5GAN6 2E64A 2ZPGB 2FG0A 1WIEA 2SEMA 3DB4A 3OY9A 3VYHB 3VS4A 4M7AD 3OYIA 3CC4Q 3GNGA 2KYMA 2PVGB 4M7AG 5GANe 2P0KA 1GCPA 2MMPA 2YUQA 4KULA 2K2VA 3E9FA 4RG8A 4G6LB 1D3BB 1JXOA 4LNPA 2FVUA 2KNBB 5M9OA 1Y07A 1MMNA 3OB9A 2E70A 5LJ3e 1N9RA 3BLHB 4B9WA 3VUZA 5KYWB 4D6WA 3I56T 3I35A 1QP2A 2DBMA 2K3BA 4XU0A 2IVXA 2MWPA 4XTYA 4A53A 1KQSS 2DVEA 2AT1B 3CCQQ 1WXBA 1YIJT 1ZQ1A 1BBZA 1NLOC 2R5MA 1NPPA 1R8OB 5KH6A 2K3XA 1OX8A 1ZLMA 2JNGA 3DTOA 4J9IA 4BI4A 2X3XD 1UGRB 1EFNA 2A3LA 2BE7D 4JX5A 4OMQA 2DYIA 2HSEB 1T0HA 3QDRB 1XO2A 2PU9B 4AI6A 4IIOA 4M78F 2E3HA 3PFSA 3AHUA 1E7OA 1KQSA 1GY3B 1I81A 4EC8B 1VQ4A 3ER0A 4P5NA 1C1AA 2EJGA 5CK9A 3EGXA 4C8QA 1IXDA 2GFUA 4KRTA 4ZN3A 4GLKA 1WDXA 5FU6C 1XOVA 2FEIA 4MZMA 1IHWA 1SSFA 1VIEA 1M8MA 3I55A 1WX6A 3C0CA 3UA7A 3VYGB 2RQTA 3H6ZA 2CT4A 1VQ7A 1O9KB 5GAOl 2IW9B 5KCOA 1RAEB 3FC3A 5FLXE 2DXBB 1H3HA 2LCLA 3QKJA 2LX7A 1JKWA 4YC3B 4EOOB 3G7ZA 3JCMW 5HKCA 1XQHA 2CYZB 1WYXA 1K76A 3C95A 3META 3OBWA 4EDUA 2KEAA 5GANg 2VC8A 1AWOA 4MMLA 1KFZA 3HHTB 4ME7A 2EWNA 4RMOA 3A8GB 1IRXA 4J9FA 4D8DA 1AEYA 4CFVB 2FB7A 2J7IA 4DBHA 3CC2A 3OYDA 3GOXA 1YHQA 4BCND 3QHSA 2LRQA 3EG9A 5LJ5h 4JJDA 1PSEA 4LE9A 1G5VA 4DBRA 4ELJA 1PC0A 3NFCA 1NBEB 2OJ2A 3CC4A 1WQWA 1Q81U 4ZNXA 2IPOB 2JN0A 2HAXA 4EOIB 2KMTA 2QI2A 2LCCA 3V7SA 1VQOQ 2EUFA 1KSWA 4C92F 2EYXA 1CKBA 2JZ2A 2HQHA 2OTJQ 2AKKA 2WJ9A 2X4YA 3M0RA 4XTZA 2DBKA 4GLMA 3VKHA 2ED0A 3CC7Q 1UDLA 1ZSGA 1T3SA 4HCZA 1I4K1 3JB9D 4X1VA 1D3BA 3FEOA 4M77D 3OYBA 3RERA 2ROTA 1JSUB 5HNBB 3CCJT 1E7PA 3JB9G 3HL8A 4ELLA 4M77G 1Q82U 5DQWA 4I3ZB 4HCBA 2EBPA 1VQ5T 3X20B 5KYYA 3QJ6A 4NS5A 2J6KA 4VUBA 1OZ3A 4UN0A 2QAZA 3G33B 3HO8A 1OI9B 1H1RB 4WF2A 3JCMd 2EKHA 4JRPA 3QHRB 2E12A 3QYEA 4CRIA 2L3QA 4A4KA 1NYFA 2ENMA 3V8JA 3NGPA 2JVVA 4HNVA 3CCMT 3VUBA 3MIAB 1B34B 2BE9B 2MIOA 1TSFA 4JJNK 3V8LA 5CCAA 1V29B 4K11A 1MV0B 4J9CA 3OYAA 3RKYA 1PM3A 5IXFA 3OYHA 2RQWA 4PJJA 2DRKA 2V26A 5CIUA 2M02A 5GAMf 3I56A 1VYTA 1X75C 3OYEA 2F5TX 4ANJA 3HKSA 1YJNT 1R0CB 3OYFA 4BCNB 2EQMA 2CH4W 1M3AA 3H9NA 2DJQA 2Y4XA 3DB3A 2QK0A 3BG5A 3CCJQ 4A4GA 2O9SA 2JGZB 1YIJA 1MMGA 4RTUA 4NOYA 1VQ8T 4JS5A 1JXMA 1W98B 4M75E 3CD6Q 1YWPA 1TTHB 4CFNB 1VQ5Q 1VQ6T 5CYIB 4BUGA 2BKZB 3QWXX 4LD9K 1O9KA 4FW2A 3UATA 3A98A 4LUDA 2GGRA 5GAOq 3L2QA 3RMSA 2DXBA 4IUPA 3JB9H 5LJ3f 1UNGD 5FWCA 2MCNA 1VQ9T 4QW2A 1UEBA 4E2FB 5GAMj 3QWLA 1PSFA 4LXCA 3LH5A 4D8KA 2UZDB 2QTVA 1VQPT 3CCMQ 5GAOn 5HBHB 1TOVA 2DPPB 3QXEB 3MI9B 2BS4A 2GBQA 1XNIA 1C6VX 3GLXA 5EG2A 1OV3A 3OQ5A 4KT0E 3DKMA 4XU1A 3OYYA 3T9NA 3DLLA 1M5Q1 4PL6A 1LPLA 4RTXA 2WIHB 1YJNQ 1M90R 1ZA1B 3X24B 2LVMA 2XDDA 1PG5B 4PJOE 1AWXA 4BE1A 3G6EQ 4F7NB 2C06A 3EH2A 1WNLA 2X4WA 1X6OA 4JPBW 1VQ8Q 4C92D 2PK2A 4F17A 1MMDA 3SWNB 1VOMA 1VQ6Q 4Z8AA 4C92G 2JT4A 2A7YA 1ZBXA 2NLUA 1SSHA 1GCQA 3GBQA 1N4MA 1YJWT 1G3NC 3G71Q 2BPMB 3OMGA 5ECAA 2YRVA 1VQ9Q 2A28A 3C12A 3CCRT 4M4ZA 3JAME 3MJXA 3M57A 2YDLA 2W99A 1RI0A 3H0HA 4DQ2A 4EOPB 4RODA 1HD3A 2JTMA 2W9ZA 2P0QA 4HNUA 1F1BB 1M30A 3EJ1B 2BS3A 2C5OB 2QF7A 3M59A 1X01A 2OAUA 3HZJA 2YSQA 1AD6A 4LDYA 2KROA 2W0ZA 1NJIR 1GCQC 4QQGA 5GANd 3DJBA 2VYTA 4EC9B 3CCSA 1YI2T 2W2HA 1JRIA 1OQKA 5HY6A 2C5NB 4ZGJB 4AKHA 2EGAA 4F16A 2HBPA 2YLBA 1B34A 2CZ6B 1CKAA 1WJSA 1B3QA 4C8QD 1ACMB 3PIOA 4EOKB 1ZBJA 2M9UA 3CCJA 5IF1B 2DO3A 5GMKm 1VQMQ 4C8QG 2ED1A 1A0NB 2YHTA 1SF9A 2C0IA 4BDYA 2EQJA 1YJWQ 1VQ5A 1ZUKA 2KRSA 3CCRQ 1UECA 2RI3A 3F5XB 1GUXA 2XU8A 2RHXA 1Q7YR 2QFZA 2JW4A 2LJ1A 5D7UA 4C92B 2L3RA 3M4YA 4BCPB 1M90C 5CO7A 1K8AR 3MPUB 3CCMA 3PVLA 4ELYC 2A0FB 4OMOA 2DXUA 1VQLT 8ATCB 2PHGA 3INZA 4E6RA 4BCMB 2JS0A 3PT9A 3RKWA 1YP5A 4M75F 5GJVB 3OS5A 1G3SA 1YI2Q 2HBWA 4YTLA 2PZ1A 2DTIA 2ZGWA 4EMKB 1M1KC 1M2VB 1YJNA 2QQ8A 3CPWS 3OBYA 1H28B 1UG1A 3CCLT 5GMKi 3MEVA 2F2VA 4OB2B 1OIYB 3EH1A 4A4FA 1VQ8A 4ESRA 3QIIA 2CP2A 2CUDA 1U1TA 1K73R 4RTZA 3OYCA 2JTFA 2HD0A 1E9HB 2CH4A 2EQUA 1VINA 3GTMS 2ZPIB 1KQ1A 4MFEA 3EHQA 3MP6A 2FRWA 1N8RU 2WIPB 3HPWA 1AVZC 1LCKA 1UNHD 1VQ9A 2OTLQ 3SWNA 4FSXA 4NL2A 2VUBA 4BXXX 2X4XA 2HSPA 3CPWA 2EJ9A 1YWOA 3OYKA 1NJIC 3FDRA 5HBEB 2HKNA 1WI7A 4M78A 4C8QB 3JCMb 2QA4T 1QKWA 1VQPA 1Q86U 1KD1C 3UF4A 5CKBA 2GFAA 2CZ0B 1JJ2S 3A8MB 3POMA 4LDVA 4BDZA 1Y71A 1T3LA 3M56A 4J8OA 4KH0B 2LTOA 1RAHB 4BE0A 2F2CA 3EFRA 2VVKA 3SFMA 5GAN5 1NPRA 3HP9A 1OX9A 1WHMA 4Z88A 6AT1B 1C9BA 2B86A 4E7IA 4RTVA 4A4HA 2W96A 3CCLQ 1KHIA 2XICA 3SWNC 2JMCA 4II1A 3RGFB 3DLMA 4RCCA 2RHUA 1KC8U 5CEIB 1V1CA 1SRLA 2V22B 2KQWA 3KFVA 3EIDB 4PFPA 3VS7A 2NUTA 1D09B 3E19A 3O0GD 1UNLD 4EOJB 2VKNA 2HCKA 2K5LA 3RESA 3CXCP 1Q7YC 2XK0A 2RPNA 3TW7A 1YJWA 4R55A 1D0XA 3CCQT 1K8AC 4J83A 4JZ4A 1D1BA 4HVUA 4KGVB 2YXYA 1H641 2QQAA 2E1HA 4Z02A 3P8BB 4BCOB 5I11A 3QPHA 5GAMe 2QA4Q 2A37A 3TU4K 5HQ0B 1WPYA 2M0OA 2YT6A 3HFNA 2YUPA 4DBQA 2QQRA 2KXDA 4C5GA 1UHCA 3FJ5A 1BCOA 5IT9E 1YCSB 3CMEA 4CC4B 2RK2A 3VS2A 4F7UF 1RLPC 2DERA 5CQYA 5CVIA 4J7FA 4E7ZA 1N5ZA 4E7JA 4MFDA 4C92A 2LDMA 1K73C 4BCQB 2CP0A 5HCKA 2O4XB 3M0PA 2X35A 2RMOA 4EMGA 4RUGA 3EAEA 5C6SA 1VIFA 2M16A 1XTDA 2DJZA 3TNIB 4J5YA 3N5BB 5D6XA 1QVGA 4N4IA 4WTOB 4PFZA 5KYYB 1D1CA 4EMKA 5HK0A 1M2VA 4CFXB 3R6OA 1K9MU 1UGVA 3MP1A 2DEUA 3SD4A 4LUEA 2DXCB 1WHLA 2RF0A 1D1AA 2RM4A 4DOVA 5EJCA 4C92C 5HBJB 4BACA 3A8LB 4AG1C 2EYQA 1RI9A 4ZTFA 2I40B 2CP6A 4OMNA 3RKXA 7AT1B 3TEEA 4HCCA 1MV3A 1HK9A 4HL4A 4L5GA 1VQLA 1UHFA 3E9GA 3X25B 2XIDA 4EMKC 1QLYA 2LZ6B 5HK3A 1G3YA 1BU2A 2EYYA 1URCB 4E7HA 1H26B 3J81E 1KJWA 2J6OA 2M51A 2XI9A 3TSWA 4C5IA 4HXJA 4QVCA 1ARKA 1Y0MA 1WFWA 3UA6A 3JCMh 3E2UA 2RH2A 3LGFA 3CCLA 1GFCA 1QVFS 2KT8A 3MHXA 5KYNA 1KG1A 3L1AA 4J9EA 2A36A 1I1JA 2H3EB 4IUQA 4ROCA 2ZPEB 3REAB 5GMKl 3H8ZA 4EOSB 1YBYA 1VQOT 5GAMg 2OTJT 3BE3A 2HKQB 2QTXA 2K79A 2O01E 3CC7T 3TQ7P 2QQ9A 4DBFA 1JBMA 4N4GA 1AT1B 2RJDA 2AZVA 3BLQB 3LWHA 3JCMc 2MWOA 4C8QC 5CKEA 4JLGA 1H1QB 2V8IA 4CC3A 3BLRB 1JO8A 1O9SA 1IREB 4M75B 4BBRM 2X9HA 3ZFJA 3CCEA 3JCMP 1GBRA 1QVFA 3I5SA 1BKBA 1AZEA 4JDSA 2DM1A 4RTTA 4JJBA 3OYMA 3CEYA 3C4SA 1Q95G 3S3MA 5DQVA 2GTJA 5LJ3g 2LX9A 2HQEA 5GMKh 1OL2B 4E7KA 2VV5A 1B07A 2KBTA 2G6FX 2E41A 3UT1A 2ABLA 5IXBA 2WSCE 4FL6A 3HRUA 1PKTA 2PUKB 2RJFA 4FYVB 2O9VA 1X43A 4EPCA 1PRLC 1Y7XA 1OKWB 3J80E 2B8AA 1JOWA 2WACA 4J9BA 2VXEA 4F7UG 3QZ9B 1AISB 1FMVA 1OYXA 1TUCA 5LMKB 1N9SA 1B7TA 1M3BA 5LJ5f 3LYIA 5FWBA 3ZL7C 4FYYB 4OP0A 4M7DE 4OMPA 2NUPB 4OMLA 2CP5A 2O4XA 3CCQA 5GAN3 4OVAA 2DXTA 1K0XA 1QKXA 5GAN2 4QSHA 4KUDK 3CD6T 1VYVA 3OW2S 3NDQA 1AWJA 3GPLA 1UGQB 1OKVB 4BCIB 1HSQA 1G3WA 3MY5B 1W70A 4LD6A 4BD3A 2L5QA 2V1QA 2DXCA 3OYJA 3GNFB 2BZYA 4FU6A 2QEXT 4PKCC 4TVRA 4CXAB 2D0NA 2CP7A 1BU1A 3RR6A 2MF2A 5LJ5j 1OULA 4DA4A 4J6YA 5KE2A 4UC4A 4OB1B 5GAOp 4IURA 3HFOA 4BCFB 4M78D 2M1HA 1N27A 3H0FA 3L2VA 3OW2A 1MNEA 1E6GA 2PQWA 4PJMA 2R5AA 2KE9A 4M78G 5I2MA 1N6AA 4J6WA 2F69A 4IKFA 1OPKA 1I07A 3M0UA 2VXFA 4BBSM 2K57A 3G1JA 2RJCA 1AWWA 5KYXB 3G6ET 2ATCB 1YITT 5GANh 3QJYA 1Q81R 1M1KU 2SRCA 1I8FA 1GUXB 2PVOB 4FIBA 4JLIA 2BIVA 4JJCA 1D3UB 1U06A 2MI6A 2ZPFB 1EX4A 1LJOA 4M7AE 5BNJB 1M9SA 4CFUB 4F7UB 1I5OB 1NEBA 2RJEA 1Y96B 2GF7A 3V7CA 3LX7A 4DEYA 3G71T 2RNAA 3VS5A 2QEXQ 1W2BP 4OGCA 5ICPB 2FPEA 2OAWA 2E5KA 2CCHB 2R57A 4BI8B 1VQKT 2JMAA 4XTWA 2LNVA 3RDVA 2LJ0A 1OEBA 4M75A 2KGTA 3LH0A 1QVPA 3LGLA 1Q82R 1MGQA 1D0YA 3L2WA 4F7SB 4PK4A 5A0DA 2COWA 3OS0A 2E6NA 1KD1U 2QDYB 5FROA 4N0AA 2K2MA 1QW1A 1EIFA 2K5IA 1ENWA 1VQOA 2KYBA 1NE8A 2GQVA 2MPXC 2OTJA 2IG0A 3VV0A 2EGCA 2IVWA 2CKKA 3CC7A 2E5QA 1YITQ 2EW3A 2C4GB 1S72Q 2NUZA 4M75C 4HT8A 2WFYB 4XU2A 1OU9A 3O5ZA 1H1PB 3BFMA 1BCMA 5GANj 1EZZB 2P4RA 1VQMT 2X4JA 2DK3A 3OMCA 4M78B 4C5HA 4EOLB 4BCMD 1Z9QA 2DAQA 2L3SA 2K5FA 2D0QB 2NWMA 1VQNT 4PJOA 1WHKA 4N0AC 1LOJA 2V8KA 2NUPA 4JRKA 4V2SA 1VQKQ 5GAMd 5A0LA 4A4EA 3EG0A 5HVYB 3ZEHA 4QQ6A 2C0TA 2XD0A 1H8KA 4LN2A 1WZOA 2LJ3A 2YUNA 1QWFA 1BI0A 3NMZC 3RBBB 4C0ZA 1TS9A 1FYNA 4M7DF 2B9RA 2F2WA 1H4LD 1KHCA 1ZSZB 2NUTB 4RTWA 2WEVB 4F7JB 1PRMC 4AFQC 1AD5A 1Q81C 2V1RA 2P84A 3VKGA 3QWYA 1GRIA 3JSCA 3A8HB 4A54A 1X27A 2G77A 2KRNA 3NPFA 4ZTJA 1QCNA 5LJ3d 2QG9B 1QVGP 5A0GA 1K1ZA 5GAN7 2DZ9A 4FSSA 4BB7A 3BDLA 2FPDA 4WCIA 4PFOA 2D8JA 3PGGA 3M0TA 1QQJA 3CD6A 2RK1A 1H3ZA 4XTVA 3ZBDA 4R0KA 1GL5A 5J3BA 2F5KA 1VQNQ 1M8VA 1Q82C 3ME9A 5KYXA 1CSKA 2DILA 2L3PA 3QHWB 1WHHA 3TN8B 1OOTA 1G2BA 5ACBA 3M0SA 2QEXA 2KVQG 1G83A 2OTLT 2K6DA 2HEQA 1BB9A 3SDZA 4AFSC 1HXDA 3OSVA 4B9XA 3M54A 1I5LA 2DE0X 4KH1B 4F7UA 5GAOm 3M03A 1Y96A 5FW9A 1NM7A 2LP5A 2DLPA 1KQSP 4FYWB 1PHTA 1YCYA 2OX7A 3P8HA 4M77E 4MDWA 3UDCA 5KE3A 3NTIA 3QZ5B 2P0PA 4X34A 1GBQA 3KUFA 1J3TA 4M7AF 1RUWA 4F7LB 3R6NA 1TWBA 2LT1A 3TW6A 4OMMA 2MOXA 5IN1A 3TREA 4XTUA 1WJRA 5IHIA 5I21A 4DOWA 1MUZA
chains in the Genus database with same CATH topology
4HA8A 2O4XB 3G6EA 2JN0A 2HAXA 2X35A 2E10A 4EMGA 2KMTA 3EAEA 2QI2A 2LCCA 5C6SA 1VIFA 2M16A 3V7SA 1XTDA 3S3OA 1BIBA 2V8JA 2ZPHB 4OB0B 4J7IA 2DJZA 3VKIA 3UWNA 3G4ST 3JB9J 3GP8A 3BDUA 3QG1A 5CKHA 4J5YA 4C92F 2JZ2A 2LQKA 2KY9A 3N5BB 3CBPA 4N4IA 5D6XA 5C0MA 1VQ4T 1QVGA 3CCVT 1VQ6A 2WJ9A 2EQKA 2X4YA 4XTZA 3X28B 3VKHA 1OZ2A 3WVEB 3EFSA 4EMKA 5HK0A 4HCZA 1I4K1 1U1SA 3R6OA 3JB9D 3MCAB 1K9MU 3WXMB 3MP1A 4ZGEB 4JUVA 5LJ3j 1D3BA 2RD1A 3FEOA 4M77D 3SD4A 3OYBA 3RERA 2E6ZA 3G71A 2DXCB 3A8OB 2D9TA 3CCJT 1E7PA 3JB9G 1Q7YU 2L8DA 2RM4A 1FWZA 4DOVA 3HL8A 5EJCA 2RHZA 3FJPA 4BI3A 2XG8D 4M77G 5IAYA 4C92C 4BACA 2RO0A 3A8LB 1Q82U 1M1GA 3OA6A 1K8AU 4HCBA 1VQKA 1VQ5T 3X20B 4PJOF 2EYQA 1M4ZA 4X9DA 3QJ6A 4NS5A 4ZTFA 3FB9A 2CZ1B 4VUBA 1OZ3A 3RKXA 5LJ5e 3TEEA 4HCCA 4Z6YA 4IUVA 4R56A 1HK9A 4HL4A 3JCMJ 4L5GA 3CCUT 3HO8A 1O75A 2BKDN 3M4GA 4C0DC 1VQLA 3JB9I 4WF2A 3E9GA 3JCMd 3HBLA 3X25B 2XIDA 4OGEA 2ZZDB 4JRPA 3FLGA 4EMKC 5HK3A 2E12A 3QYEA 1G3YA 1QP3A 4CRIA 2ZPBB 4E7HA 3GIBA 4PJOC 4JX4A 4A4KA 3J81E 4MDXA 2XI9A 4BE2A 3V8JA 4C5IA 2JVVA 4PLIA 4HNVA 2QXFA 4QVCA 3VUBA 3CCMT 1B34B 2DTOA 4JJNK 3JCMh 2RH2A 3V8LA 2XKOC 3LGFA 4QVZA 3CC2T 3CCLA 3S6WA 2P4TA 5CCAA 1V29B 1QVFS 4OB3B 3GF5A 3MHXA 4M7AC 3BW1A 4PLLA 3OYAA 1KG1A 3L1AA 3M55A 3CMEA 2PUOB 3CMET 3M9QA 4M78C 4IUQA 1K73U 2ZPEB 3RKYA 3M5AA 5GMKl 3OYHA 4RKUE 1BYMA 2ZZDA 3H8ZA 1YBYA 5CIUA 5CKFA 5GAMf 1VQOT 4HLQA 5GAMg 2BS2A 3OYNA 3I56A 1X75C 4XK8E 2F5TX 5A2QE 3HKSA 3OYEA 5AYFA 3UPUA 1YJNT 4JS4A 3QBYA 1VQMA 2OTJT 2QTXA 3OYFA 2O01E 2EQMA 3CC7T 3Q1JA 5GAN4 2Y4XA 3DB3A 3OYLA 4ELZC 3BG5A 3OSSC 5D6YA 4JX6A 4A4GA 1VQNA 4Y28E 1UGSB 2QQSA 2QQ9A 3MEAA 1JBMA 4N4GA 2RI2A 1YIJA 2ZCFB 2EKOA 2RJDA 4NOYA 5CKDA 3LWHA 3CCRA 5D6WA 4JS5A 1VQ8T 3J7AF 3QO3A 4M75E 3JCMc 2MWOA 4C8QC 3BG9A 1G3TA 4JLGA 5CKEA 1VQ6T 3L42A 4F7UE 2VGNA 2V8IA 4BUGA 4M75B 1O9SA 1IREB 3ZFJA 4BBRM 3L2UA 3CCEA 4LD9K 3JCMP 3M58A 1QVFA 1BKBA 3JCMX 2K4YA 2Y90A 5GAN8 5CR2A 4JDSA 5GAOq 3S3NA 3QYBA 3L2QA 3RMSA 2DXBA 4IUPA 3CEYA 5LJ3f 3CBMA 3OYMA 3JB9H 3C4SA 5FU7B 4BY6B 3S3MA 1VQ9T 4QW2A 1FXXA 5LJ3g 1UEBA 4LOCA 2EJFA 2LX9A 5GAMj 3HB9A 3QWLA 1BIAA 3OS1A 4LDUA 3FRNA 2HQEA 1PSFA 5GMKh 4C92E 2VV5A 2KSSA 4E7KA 3JCMe 5GAOr 1VQPT 2E41A 3UT1A 4FM4B 5GAOn 1YI2A 2KAFA 2LQ8A 2DPPB 2WSCE 3HRUA 2PUKB 4FL6A 4GY5A 3L2RA 3O8VA 3QXEB 2RJFA 3JCMV 5J39A 4M75D 2BS4A 3RIRA 4EPCA 1Y7XA 1XNIA 3GLXA 3QSUA 1YITA 5EG2A 4FT2A 3J80E 1VUBA 3CPFA 1S72A 2B8AA 3OQ5A 3DKMA 4KT0E 3VJPA 4QVDA 4XU1A 3OYYA 4M75G 2WACA 3T9NA 5L8RE 5DLOA 1M5Q1 2VGMA 3OYGA 3DLLA 1YJ9T 2VXEA 4PL6A 4F7UG 3QZ9B 1OYXA 3VU3C 4C5EA 3X24B 2LVMA 2GCXA 2DIQA 2XDDA 1N9SA 4M77A 4PJOE 4AKGA 3PNWC 2EIFA 5LJ5f 2DTHA 3LYIA 4FT4A 2WSEE 4BE1A 2C06A 5LJ5g 1W2BS 4OP0A 4HT9A 1WNLA 2X4WA 1X6OA 4OF1A 4XQ3A 2R58A 4M7DE 3CMAA 4C92D 2DKGA 2O4XA 3CCQA 3JB9F 5GAN3 4OVAA 2DXTA 2KR6A 3MP8A 3SWNB 3I55T 4M7DB 4M78E 4M77F 5GAN2 3BG3A 4QSHA 1WQ7A 1WGSA 4C92G 1MHNA 4KUDK 5FU6B 2HNIA 3OW2S 3CD6T 2OTLA 2A7YA 1ZBXA 5FRNA 2NLUA 3GPLA 1BI1A 1UGQB 1VQ7T 4L59A 2FYKA 3FIFA 4O5VA 3E1SA 1YJWT 4CI0C 2DD5B 1G3WA 2KK4A 5GMKe 5CQXA 3OMGA 1M1FA 4LD6A 4BD3A 3WVDB 2YRVA 2L5QA 3C12A 3CCRT 4EMHA 2DXCA 3OYJA 3GNFB 4FU6A 2QEXT 4PKCC 4M77C 4O6JA 4TVRA 3JAME 4PJOD 3M57A 3NTKA 4XU3A 4C8QE 4RG2A 4E7LA 1RI0A 4DQ2A 3CCET 2K3YA 1GXIE 2MF2A 1W2BA 1W4SA 2RI5A 4PJOG 5LJ5j 4M7DD 4DA4A 4J6YA 3HSBA 2JTMA 5KE2A 4UC4A 2CS7A 1TH7A 4KUIA 4OB1B 2AHJB 2P0QA 5GAOp 2H3JA 2KMGA 4HNUA 3KXTA 3MEUA 4IURA 4N4HA 1DJ7B 3HFOA 3PIPA 2BS3A 4M78D 4M7DG 2M1HA 2FHDA 3M59A 2QF7A 1N27A 1X01A 2OAUA 1YHQT 4L6V5 3HZJA 3L2VA 3OW2A 4M6VA 4LDYA 3QYHB 2PQWA 2R5AA 5KCHA 4M78G 5I2MA 1N6AA 3KHIA 2PVDB 4J6WA 4QQGA 2VYTA 5GANd 3G4SA 2F69A 3P8DA 4LDWA 1AHJB 4AKIA 3CC4T 3CCSA 4IKFA 4HNTA 2VXFA 4BBSM 1YI2T 3ASKA 3CCVA 3QYGB 1JRIA 5HY6A 2K57A 3PMTA 4ZGJB 4AKHA 2CZ7B 2RJCA 2HBPA 2YLBA 3L2ZA 1B34A 3H4CA 4MMKA 3G6ET 2CZ6B 1WJSA 3TCJA 3MEWA 4C8QD 3PIOA 5GANh 3QJYA 1YITT 1M1KU 4HKEA 1I8FA 2M9UA 3CCJA 2PVOB 4FIBA 3PMIA 4JLIA 2BIVA 4C0FA 3JCMf 2DO3A 4OMFB 3DL1A 1IZ6A 5GMKm 4C8QG 2MI6A 3BY7A 3M53A 2ZPFB 4Q5WA 3JCMg 2YHTA 1N8RC 1LJOA 4M7AE 2DD4B 4BDYA 5I2SA 3KBGA 1M9SA 2EQJA 1FX7A 3URGA 1VQ5A 3LLRA 4F7UB 2RJEA 3LW5E 1Y96B 3PTAA 2GF7A 2L89A 2LC4A 1ZHIA 4KBMB 4M7AB 2DEQA 3V7CA 3LX7A 2QA4A 2XHCA 1P92A 2KDSA 3G71T 2RI3A 2JOYA 4OGCA 3CCUA 1FKMA 1Q86C 1BI3A 4Y91A 2JUFA 3NTHA 2XU8A 5DM7R 1QLBA 2G3RA 2Y4YA 2E65A 4NL3A 2R57A 2RHXA 2QFZA 4BI8B 3V8KA 1VQKT 2EAYA 4XTWA 2LNVA 2XDBA 5J26A 3OS2A 4ATOA 1U8RA 2DD4A 4M75A 1OI1A 1RL2A 3LH0A 2L3RA 4C92B 1QVPA 3LGLA 3M4YA 1M90C 1MGQA 5CO7A 5LL6S 2RHIA 1QVGS 3CCMA 3L2WA 4XTXA 4ELYC 5GAN6 5A0DA 3OS0A 2E64A 2DXUA 1VQLT 2E6NA 2ZPGB 3INZA 3DB4A 3RMQA 3OY9A 1KD1U 1BI2A 3VYHB 4M7AD 2QDYB 5CAIA 3PT9A 3RKWA 3OYIA 4M75F 5FROA 3GNGA 4N0AA 4C0DB 2QDJA 3OS5A 1QW1A 1EIFA 1G3SA 2K5IA 3CXCS 2PVGB 4YTLA 1VQOA 4M7AG 5GANe 2DTIA 1NE8A 2P0KA 2GQVA 2ZGWA 4EMKB 1KC8C 3HRSA 1YJNA 1M1KC 4MZTA 2OTJA 2MMPA 2QQ8A 3CPWS 2IG0A 3OBYA 2K2VA 4NC6A 4KULA 3E9FA 4RG8A 3VV0A 2IVWA 4PJOB 1D3BB 2CKKA 2FL7A 2E5QA 3CC7A 3CCLT 5GMKi 3C94A 3MEVA 2FVUA 4ZN1A 5M9OA 2LT4A 1Y07A 3OB9A 2E70A 5LJ3e 4OB2B 4MIMA 4MZPA 1N9RA 4M75C 4A4FA 1VQ8A 1NZ9A 4HT8A 4XU2A 4B9WA 3VUZA 3QIIA 3BFMA 3CCST 3F70A 4D6WA 5GANj 4JRQA 1JJ2A 3I56T 1U1TA 1VQMT 2X4JA 2DK3A 3OMCA 4M78B 1QP2A 4XU0A 4C5HA 3OYCA 2JTFA 2RB6A 2HD0A 2DAQA 2K5FA 2EQUA 2MWPA 4XTYA 5FU7C 3RUXA 4A53A 4BY6C 2ZPIB 1KQ1A 4MFEA 2DVEA 1KQSS 2D0QB 3MP6A 1N8RU 1VQNT 4PJOA 4N0AC 1LOJA 1ZQ1A 1YIJT 3HPWA 2XDPA 2V8KA 1JB0E 4JRKA 3CXCA 1VQ9A 2R5MA 3V7RA 4V2SA 4M7DA 5GAMd 4XAXB 3SWNA 5A0LA 4FSXA 1NPPA 1R8OB 2VUBA 4NL2A 2X4XA 4A4EA 3CPWA 3ZEHA 2EJ9A 4QQ6A 3X26B 2RHYA 3OYKA 5KH6A 3FDRA 1NJIC 2XD0A 2EFIA 2BUDA 2K3XA 4M78A 3JCMb 4C8QB 3LWIA 1Q86U 5GMKj 2QA4T 1VQPA 1KD1C 5CKBA 2GFAA 1BI0A 2CZ0B 2QQBA 2DD5A 2JNGA 3QUIA 4C0ZA 1JJ2S 3JRZA 3A8MB 3JCMQ 3A5ZB 4LDVA 4BI4A 5GAMh 1UGPB 1UGRB 1Y71A 2A3LA 4BDZA 4M7DF 4JX5A 3M56A 1KHCA 1M90U 4J8OA 2LTOA 3QDRB 2PU9B 4AI6A 4BE0A 1Q81C 4M78F 5FRMA 3PFSA 3AHUA 3EFRA 3VKGA 3SFMA 5GAN5 1YJ9A 1NPRA 3HP9A 3JSCA 1I81A 1KQSA 1VQ4A 3ER0A 4P5NA 3A8HB 2EJGA 4A54A 5CK9A 4E7IA 4C8QA 2G77A 4A4HA 4C0GA 2GFUA 4ZTJA 1KHIA 4M7DC 2XICA 4ZN3A 3SWNC 5LJ3d 4II1A 2RA2A 5A0GA 3DLMA 4RCCA 2RHUA 1KC8U 2I2LA 4GLKA 2DZ9A 3HRTA 5GAN7 1S72T 3CBOA 2DZCA 1XOVA 2KQWA 4MZMA 5FU6C 1SSFA 4BB7A 1VIEA 3BDLA 2YLCA 3E19A 3I55A 1K9MC 2D6FA 4J6XA 4C8QF 5DLQE 3VYGB 3H6ZA 3PGGA 2K5LA 3RESA 3CD6A 2RK1A 1H3ZA 4XTVA 5LJ3h 3ZBDA 1VQ7A 5GAOl 1Q7YC 5J3BA 5KCOA 2F5KA 2XK0A 3TW7A 2HQXA 1YJWA 1M8VA 3FC3A 4R55A 5FLXE 2DXBB 3CMAT 1Q82C 3ME9A 4E47A 4PNOA 3CCQT 1K8AC 2LCLA 3QKJA 4J83A 3G7ZA 2MAMA 3JCMW 2QEXA 3SB2A 1H641 2KVQG 2QQAA 5HKCA 2E1HA 1XQHA 2CYZB 4Z02A 4IUUA 2OTLT 3P8BB 4RCBA 3C95A 3META 4IUTA 5GANf 3OBWA 3QPHA 5GAMe 3VYGA 3SDZA 4EDUA 4JRIA 1HXDA 4ZGDB 3OSVA 4B9XA 3M54A 2VC8A 5LJ5d 5GANg 3TU4K 1WPYA 4MMLA 2M0OA 1I5LA 3HFNA 4F7UA 5GAOm 3HHTB 4ME7A 1Y96A 2EWNA 4RMOA 3A8GB 1LNXA 4M7AA 1WJQA 1NJIU 2QQRA 4X9CA 2FB7A 5DY9A 4C5GA 3CC2A 3OYDA 3GOXA 1YHQA 1YCYA 1KQ2A 2CGHA 5IT9E 3QHSA 3P8HA 2DIGA 2LRQA 4M77E 4MDWA 3UDCA 5KE3A 3NTIA 3QZ5B 1PSEA 2P0PA 4X34A 5LJ5h 4LDXA 2RK2A 3KUFA 3MO8A 1G5VA 4F7UF 4ELJA 4M77B 3NFCA 5CQYA 5CVIA 2WSFE 4J7FA 3CC4A 4M7AF 2LT1A 4E7JA 1WQWA 4MFDA 4C92A 3TW6A 1Q81U 4QQDA 2LDMA 1UB4A 5IN1A 3TREA 1K73C 4XTUA 1WJRA 5I21A 4DOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHJ B;  3QYG B;  3X26 B;  2DXB A;  4ZGJ B;  2ZPH B;  4OB0 B;  2CZ7 B;  2CZ6 B;  2CZ0 B;  2DD5 A;  1PSF A;  3X28 B;  3WVE B;  3A8M B;  2PVO B;  1UGP B;  1UGR B;  4FM4 B;  4ZGE B;  2ZPF B;  2PU9 B;  2DD4 B;  2DPP B;  2WSC E;  2PUK B;  2DXC B;  3A8O B;  3QXE B;  3LW5 E;  3A8H B;  3A8L B;  4KT0 E;  5L8R E;  3X20 B;  3QZ9 B;  3X24 B;  2CZ1 B;  2WSE E;  2DD4 A;  3X25 B;  3VYG B;  2ZZD B;  1QP3 A;  2ZPB B;  2ZPG B;  3VYH B;  2DXB B;  2QDY B;  1UGQ B;  2PVG B;  2DD5 B;  1V29 B;  4OB3 B;  2CYZ B;  2PUO B;  3WVD B;  2ZPE B;  3VYG A;  4RKU E;  2ZZD A;  4ZGD B;  2DXC A;  3HHT B;  3A8G B;  4XK8 E;  4OB2 B;  1GXI E;  2O01 E;  4OB1 B;  1UGS B;  2AHJ B;  1QP2 A;  4Y28 E;  3QZ5 B;  1PSE A;  2ZCF B;  1DJ7 B;  2WSF E;  2ZPI B;  4L6V 5;  2D0Q B;  3QYH B;  1IRE B;  1JB0 E;  2PVD B; 
#chains in the Genus database with same CATH topology
 4HA8 A;  3G6E A;  3LQ5 B;  1TU0 B;  5GJW B;  2IW8 B;  2ZPH B;  4OB0 B;  3G4S T;  3JB9 J;  3UWN A;  1H24 B;  3GP8 A;  3BDU A;  2K9G A;  2E4H A;  2LQK A;  5C0M A;  1VQ4 T;  2PTK A;  2HMA A;  3ULR B;  1VQ6 A;  3X28 B;  3EFS A;  1OZ2 A;  3WVE B;  2DL3 A;  1U1S A;  4YOO A;  2RD1 A;  1TD6 A;  2E6Z A;  3G71 A;  1MMA A;  3A8O B;  1IGU A;  2D9T A;  2L8D A;  4EON B;  3AT1 B;  1FWZ A;  1QVF P;  2NYS A;  2RHZ A;  3FJP A;  4BI3 A;  4PJN A;  5IAY A;  4BCQ D;  2GTO A;  2YRC A;  1G8X A;  1VQK A;  4F04 B;  1E6H A;  4PJO F;  1ZUY A;  1M4Z A;  4X9D A;  3CQT A;  4BCH B;  2AK5 A;  5LJ5 e;  1TUD A;  4Z6Y A;  4R56 A;  4E7S A;  3CCU T;  2DNU A;  4Y72 B;  3HBL A;  4OGE A;  1KXU A;  2L2P A;  2C5V B;  4F6U B;  2ZPB B;  4AG2 C;  2G9X B;  2DL7 A;  1TFB A;  4PLI A;  2DL5 A;  2DTO A;  4KGZ B;  2DET A;  2XKO C;  4QVZ A;  3CC2 T;  1UUE A;  3S6W A;  2EPD A;  2P4T A;  3GF5 A;  2GNC A;  1W1F A;  3BW1 A;  4FCY A;  3M55 A;  3G4S Q;  2W9F A;  1GFD A;  1ZSZ A;  4M78 C;  3M5A A;  4RKU E;  1VQ4 Q;  2ZZD A;  2UZE B;  1M2O A;  1NLP C;  2BS2 A;  1JJ2 A;  1VQM A;  1NYG A;  3QBY A;  4JS4 A;  3TSZ A;  5GAN 4;  4EOM B;  4ELZ C;  3OSS C;  4JX6 A;  1FVV B;  1VQN A;  2COZ A;  2RI2 A;  3I55 Q;  3CCR A;  4OGR B;  5CKD A;  1QWE A;  3QO3 A;  1RAI B;  3VS6 A;  3BG9 A;  4AFU C;  1G3T A;  1VQ7 Q;  4A63 B;  1RAA B;  1QMC A;  3MY1 B;  2IW6 B;  2Y90 A;  2YWW A;  5CR2 A;  5GAN 8;  1ZSZ C;  1K0S A;  3CCU Q;  3QYB A;  3S3N A;  3CBM A;  5FU7 B;  4BY6 B;  2EYZ A;  1QCF A;  2FRY A;  1N8R R;  2EJF A;  1K9A A;  2DRM A;  4AFZ C;  5KYU B;  4LDU A;  2WPA B;  2DMO A;  4C92 E;  2CSQ A;  2VAS A;  2DME A;  2CSI A;  1YI2 A;  4GY5 A;  3L2R A;  3CC2 Q;  3O8V A;  2RN8 A;  3TVT A;  1Q86 R;  4M75 D;  2QGG A;  1U3O A;  1YN8 A;  3I9Q A;  1S1N A;  4FT2 A;  1VUB A;  5AT1 B;  1OIU B;  2PJQ A;  1F5Q B;  4M75 G;  2ECZ A;  5L8R E;  1YJ9 T;  3VU3 C;  2GCX A;  4CFW B;  3VS1 A;  2XMF A;  4AKG A;  3PNW C;  1RAB B;  2WSE E;  5LJ5 g;  4HT9 A;  4OF1 A;  4XQ3 A;  1RAG B;  5I22 A;  3JB9 F;  4M7D B;  4M77 F;  1KC8 R;  3BG3 A;  2HNI A;  2OTL A;  1SG5 A;  1WXU A;  2WMB B;  1LVK A;  4L59 A;  5LQF B;  1OGU B;  4CI0 C;  2DD5 B;  1OU8 A;  4RTY A;  1X2Q A;  2KT1 A;  3WVD B;  2CUB A;  4EMH A;  1JQQ A;  4O6J A;  4PJO D;  4XU3 A;  4C8Q E;  2FO0 A;  4E7L A;  2K3Y A;  1GXI E;  2OI3 A;  2RI5 A;  4PJO G;  2QAS A;  3HSB A;  2RQU A;  2CS7 A;  2KMG A;  1M27 C;  3KXT A;  3PIP A;  1DJ7 B;  1VYU A;  2FHD A;  4L6V 5;  2CCI B;  2PNI A;  4J9G A;  3QYH B;  1SHF A;  1YJ9 Q;  5KCH A;  2PVD B;  3G4S A;  3EHR A;  4LDW A;  1TG0 A;  4Z89 A;  3ASK A;  3QYG B;  3PMT A;  3THK A;  2CZ7 B;  3L2Z A;  1SPK A;  3U23 A;  4HKE A;  3PMI A;  4C0F A;  3JCM f;  3I56 Q;  4OMF B;  1SRM A;  3DL1 A;  2DX1 A;  4Q5W A;  1X6G A;  1N8R C;  5I2S A;  1FX7 A;  4BY1 X;  3LW5 E;  1SKU B;  1H25 B;  2L89 A;  2LC4 A;  1ZHI A;  4M7A B;  3PTA A;  2QA4 A;  4KGX B;  1P92 A;  1YIJ Q;  2FZC B;  2EYW A;  2JOY A;  1K9M R;  1VOL A;  3CCU A;  1Q86 C;  3I5R A;  4Y91 A;  3SHW A;  2G3R A;  2E65 A;  3DOG B;  3V8K A;  2EAY A;  2XDB A;  4ATO A;  1K4U S;  1U8R A;  2DD4 A;  1OI1 A;  2RHI A;  1H92 A;  1RLQ C;  4XTX A;  2AIR B;  2O31 A;  2M0Y A;  4CFU D;  3RMQ A;  1BI2 A;  4FW1 A;  1PD0 A;  5CAI A;  5IHK A;  2YRD A;  5KYU A;  4C0D B;  1AOJ A;  2QDJ A;  3CXC S;  2EQI A;  3VRZ A;  1VA7 A;  1KC8 C;  3B57 A;  4CC2 A;  4B6M A;  3HRS A;  5EC7 A;  4MZT A;  4NC6 A;  1M3C A;  2GQI A;  1PCX A;  4ORZ A;  4PJO B;  2FL7 A;  1YFN A;  5IHY A;  3C94 A;  2QGS A;  4ZN1 A;  2WMA B;  2F1L A;  2LT4 A;  3EG3 A;  1WXT A;  4MIM A;  4MZP A;  1NZ9 A;  4CC7 A;  2CRE A;  2D8H A;  2X3W D;  3CCS T;  3F70 A;  4JRQ A;  2DFU A;  2RB6 A;  2JS2 A;  2MK5 A;  5FU7 C;  3RUX A;  4BY6 C;  3TNH B;  2PK9 B;  2A08 A;  2XDP A;  2COY A;  3CXC A;  1JB0 E;  1OPL A;  1PNJ A;  3V7R A;  4M7D A;  3RNJ A;  4XAX B;  3BHU B;  5KYW A;  3X26 B;  2O2O A;  2RHY A;  3H41 A;  2EFI A;  2BUD A;  2C6T B;  2HDA A;  5GMK j;  2X51 A;  2DL8 A;  3EGD B;  2QYZ A;  2QQB A;  2DD5 A;  3QUI A;  5FGK B;  3JRZ A;  1PKS A;  4DEX A;  3JCM Q;  1PKD B;  3A5Z B;  5GAM h;  1UGP B;  1T0J A;  4HCK A;  1M90 U;  5FRM A;  2F2X A;  2WHB B;  1YJ9 A;  2DF6 A;  1TXQ A;  3REB B;  4C0G A;  4NST B;  4M7D C;  1VYW B;  9ATC B;  2RA2 A;  4Y92 A;  2EVR A;  2I2L A;  3HRT A;  1YNZ A;  1S72 T;  3CBO A;  2DZC A;  3CCS Q;  2YLC A;  2D6F A;  1KK7 A;  2RQV A;  1K9M C;  4J6X A;  4C8Q F;  5DLQ E;  2JM8 A;  4HVV A;  1GH6 B;  4OR5 B;  5LJ3 h;  1IO6 A;  2LNH B;  4CFM B;  4YOZ A;  2HQX A;  3CPW P;  3CMA T;  4E47 A;  4PNO A;  2W10 A;  2DA9 A;  1W6X A;  2MAM A;  3D7S B;  1ZP2 A;  4IMY B;  3SB2 A;  1PD1 A;  3DDP B;  4IUU A;  4RCB A;  4IUT A;  5GAN f;  1Z9Z A;  3VYG A;  4QT7 A;  4JRI A;  4ZGD B;  5LJ5 d;  1LNX A;  4M7A A;  4TTH A;  1WJQ A;  1NJI U;  2UZB B;  4X9C A;  1PWT A;  3A1P A;  5DY9 A;  4AMC A;  1KQ2 A;  1IHV A;  2CGH A;  2DIG A;  2MYS A;  4LDX A;  3MO8 A;  2BZX A;  3EGU A;  1RAC B;  4M77 B;  1I0C A;  2KI7 A;  2WSF E;  4F14 A;  1IGQ A;  2J06 A;  4QKU A;  3SEM A;  4QQD A;  1UB4 A;  3LWI A;  1X6B A;  1JJ2 P;  2E10 A;  3EFO B;  2FZK B;  1FMW A;  2DYB A;  4FYX B;  3S3O A;  1BIB A;  2V8J A;  2I53 A;  4J7I A;  3VKI A;  3QG1 A;  5CKH A;  2CJM B;  1FIN B;  1H27 B;  2KY9 A;  3CBP A;  1TUG B;  4M7A C;  4CRL B;  3CCV T;  2EQK A;  5L23 A;  2CT3 A;  1H1S B;  1SHG A;  4F70 B;  3CMA Q;  3MCA B;  2I0N A;  3WXM B;  4ZGE B;  4JUV A;  5LJ3 j;  1WA7 A;  4BCK B;  1R0B G;  1Q7Y U;  1ZX6 A;  4EIK A;  4GBQ A;  2XG8 D;  4F6W B;  2RO0 A;  3PE0 A;  1M1K R;  2CDT A;  2X1N B;  1M1G A;  4HVW A;  3OA6 A;  1K8A U;  1HJD A;  2O88 A;  3FB9 A;  2CZ1 B;  4FX3 B;  2VWF A;  3EG1 A;  1WHJ A;  4IUV A;  3JCM J;  2JXB A;  1O75 A;  2BKD N;  3M4G A;  4C0D C;  3JB9 I;  4AT1 B;  2DVJ A;  2ZZD B;  2VB6 A;  3FLG A;  2LCS A;  1VQP Q;  1QP3 A;  3GIB A;  4PJO C;  4JX4 A;  4PJL A;  5IDP B;  2QDL A;  4BE2 A;  4MDX A;  2HL5 C;  3JV3 A;  2YUO A;  2HL3 A;  2LMJ A;  2LQW A;  2QXF A;  1ZUU A;  3EGD A;  4OB3 B;  4PLL A;  3BHT B;  2PUO B;  3CME T;  3M9Q A;  1K73 U;  1BK2 A;  1BYM A;  5IHN A;  3CCV Q;  5CKF A;  1KD1 R;  4EOQ B;  1FMK A;  4HLQ A;  3OYN A;  4XK8 E;  5A2Q E;  1P5E B;  3UPU A;  5AYF A;  1IB8 A;  2J05 A;  3Q1J A;  3OYL A;  2IN3 A;  5D6Y A;  3HTR A;  3M0Q A;  1UGS B;  2QQS A;  3MEA A;  4Y28 E;  2ZCF B;  2EKO A;  1WHG A;  3J7A F;  5D6W A;  1NG2 A;  2J6F A;  4II5 B;  1UE9 A;  2C0O A;  5IH2 A;  3PO3 S;  3L42 A;  4F7U E;  2VGN A;  1R77 A;  1ABO A;  3L2U A;  3QDF A;  3M58 A;  3JCM X;  2K4Y A;  1C0M A;  1WLP B;  3EOC B;  2DL4 A;  3VS3 A;  2D1X A;  1FXX A;  1OL1 B;  4LOC A;  1AZG B;  3OS1 A;  3HB9 A;  4J9H A;  1BIA A;  1UTI A;  2LQN A;  3FRN A;  3DDQ B;  2KSS A;  3JCM e;  3MKD A;  5GAO r;  2JTE A;  2FPF A;  2LW4 A;  4FM4 B;  2KAF A;  2LQ8 A;  1KIK A;  5I5Z B;  3JCM V;  5J39 A;  4BY7 X;  3RIR A;  1QMZ B;  3CME Q;  3QSU A;  2CP3 A;  1YIT A;  1S72 A;  3CPF A;  3VJP A;  2R7G A;  2QGF B;  4QVD A;  5DLO A;  3TNW B;  4EOR B;  2VGM A;  3OYG A;  3IQL A;  4C5E A;  2DIQ A;  3NHN A;  4M77 A;  2PMI B;  2EIF A;  2DTH A;  4FT4 A;  2Z0W A;  1W2B S;  2R58 A;  3CMA A;  1ABQ A;  2DKG A;  1JU5 C;  3EFO A;  2BZ8 A;  2ZAE A;  2KR6 A;  3MP8 A;  3I55 T;  4M78 E;  2KXC A;  1WQ7 A;  1WGS A;  1MHN A;  1JST B;  5FU6 B;  5FRN A;  1VQ7 T;  1BI1 A;  1D0Z A;  2FYK A;  3FIF A;  4O5V A;  3E1S A;  2E3I A;  2KK4 A;  5GMK e;  5CQX A;  1M1F A;  4YOS A;  1X69 A;  2JM9 A;  4M77 C;  2ROL A;  2UZL B;  4ROE A;  2H8H A;  3NTK A;  2AKL A;  1MND A;  4RG2 A;  3CCE T;  2UUE B;  2K7A A;  1W2B A;  1W4S A;  4M7D D;  3EGX B;  1NEG A;  1TH7 A;  4KUI A;  2AHJ B;  1Y57 A;  2H3J A;  1VQL Q;  3MEU A;  4N4H A;  5L2W B;  4IIM A;  4M7D G;  2C5X B;  1YHQ T;  1SEM A;  1UFF A;  3K7A M;  3VRY A;  4M6V A;  2ESW A;  2WXV B;  2RQR A;  3KHI A;  1ZA2 B;  3P8D A;  1AHJ B;  4AKI A;  2HZY A;  2L0A A;  3CC4 T;  4HNT A;  3CCV A;  1U5S A;  1XJW B;  4JZ3 A;  4BCG B;  3VS0 A;  5IDN B;  3H4C A;  4MMK A;  1V76 A;  3TCJ A;  3MEW A;  1QCO A;  3BHV B;  2BTT A;  4J9D A;  1X2K A;  1IZ6 A;  3H0I A;  3BY7 A;  3M53 A;  3JCM g;  2DD4 B;  3KBG A;  3URG A;  3LLR A;  3PVQ A;  4KBM B;  2DEQ A;  4KRC B;  2FZG B;  2JJ9 A;  2XHC A;  4KRD B;  5EFQ B;  2KDS A;  2KR3 A;  2KRM A;  3EG2 A;  2IIM A;  1FKM A;  1BI3 A;  3EG9 B;  1HYO A;  2JUF A;  3NTH A;  5DM7 R;  1QLB A;  2Y4Y A;  3CCE Q;  1UJY A;  1JEG A;  4NL3 A;  1RAD B;  5J26 A;  3OS2 A;  2EGE A;  1RL2 A;  3OW2 P;  1UJ0 A;  8AT1 B;  5LL6 S;  1QVG S;  4F6S B;  4BCJ B;  2AZS A;  1RAF B;  1YHQ Q;  5GAN 6;  2E64 A;  2ZPG B;  2FG0 A;  1WIE A;  2SEM A;  3DB4 A;  3OY9 A;  3VYH B;  3VS4 A;  4M7A D;  3OYI A;  3CC4 Q;  3GNG A;  2KYM A;  2PVG B;  4M7A G;  5GAN e;  2P0K A;  1GCP A;  2MMP A;  2YUQ A;  4KUL A;  2K2V A;  3E9F A;  4RG8 A;  4G6L B;  1D3B B;  1JXO A;  4LNP A;  2FVU A;  2KNB B;  5M9O A;  1Y07 A;  1MMN A;  3OB9 A;  2E70 A;  5LJ3 e;  1N9R A;  3BLH B;  4B9W A;  3VUZ A;  5KYW B;  4D6W A;  3I56 T;  3I35 A;  1QP2 A;  2DBM A;  2K3B A;  4XU0 A;  2IVX A;  2MWP A;  4XTY A;  4A53 A;  1KQS S;  2DVE A;  2AT1 B;  3CCQ Q;  1WXB A;  1YIJ T;  1ZQ1 A;  1BBZ A;  1NLO C;  2R5M A;  1NPP A;  1R8O B;  5KH6 A;  2K3X A;  1OX8 A;  1ZLM A;  2JNG A;  3DTO A;  4J9I A;  4BI4 A;  2X3X D;  1UGR B;  1EFN A;  2A3L A;  2BE7 D;  4JX5 A;  4OMQ A;  2DYI A;  2HSE B;  1T0H A;  3QDR B;  1XO2 A;  2PU9 B;  4AI6 A;  4IIO A;  4M78 F;  2E3H A;  3PFS A;  3AHU A;  1E7O A;  1KQS A;  1GY3 B;  1I81 A;  4EC8 B;  1VQ4 A;  3ER0 A;  4P5N A;  1C1A A;  2EJG A;  5CK9 A;  3EGX A;  4C8Q A;  1IXD A;  2GFU A;  4KRT A;  4ZN3 A;  4GLK A;  1WDX A;  5FU6 C;  1XOV A;  2FEI A;  4MZM A;  1IHW A;  1SSF A;  1VIE A;  1M8M A;  3I55 A;  1WX6 A;  3C0C A;  3UA7 A;  3VYG B;  2RQT A;  3H6Z A;  2CT4 A;  1VQ7 A;  1O9K B;  5GAO l;  2IW9 B;  5KCO A;  1RAE B;  3FC3 A;  5FLX E;  2DXB B;  1H3H A;  2LCL A;  3QKJ A;  2LX7 A;  1JKW A;  4YC3 B;  4EOO B;  3G7Z A;  3JCM W;  5HKC A;  1XQH A;  2CYZ B;  1WYX A;  1K76 A;  3C95 A;  3MET A;  3OBW A;  4EDU A;  2KEA A;  5GAN g;  2VC8 A;  1AWO A;  4MML A;  1KFZ A;  3HHT B;  4ME7 A;  2EWN A;  4RMO A;  3A8G B;  1IRX A;  4J9F A;  4D8D A;  1AEY A;  4CFV B;  2FB7 A;  2J7I A;  4DBH A;  3CC2 A;  3OYD A;  3GOX A;  1YHQ A;  4BCN D;  3QHS A;  2LRQ A;  3EG9 A;  5LJ5 h;  4JJD A;  1PSE A;  4LE9 A;  1G5V A;  4DBR A;  4ELJ A;  1PC0 A;  3NFC A;  1NBE B;  2OJ2 A;  3CC4 A;  1WQW A;  1Q81 U;  4ZNX A;  2IPO B;  2JN0 A;  2HAX A;  4EOI B;  2KMT A;  2QI2 A;  2LCC A;  3V7S A;  1VQO Q;  2EUF A;  1KSW A;  4C92 F;  2EYX A;  1CKB A;  2JZ2 A;  2HQH A;  2OTJ Q;  2AKK A;  2WJ9 A;  2X4Y A;  3M0R A;  4XTZ A;  2DBK A;  4GLM A;  3VKH A;  2ED0 A;  3CC7 Q;  1UDL A;  1ZSG A;  1T3S A;  4HCZ A;  1I4K 1;  3JB9 D;  4X1V A;  1D3B A;  3FEO A;  4M77 D;  3OYB A;  3RER A;  2ROT A;  1JSU B;  5HNB B;  3CCJ T;  1E7P A;  3JB9 G;  3HL8 A;  4ELL A;  4M77 G;  1Q82 U;  5DQW A;  4I3Z B;  4HCB A;  2EBP A;  1VQ5 T;  3X20 B;  5KYY A;  3QJ6 A;  4NS5 A;  2J6K A;  4VUB A;  1OZ3 A;  4UN0 A;  2QAZ A;  3G33 B;  3HO8 A;  1OI9 B;  1H1R B;  4WF2 A;  3JCM d;  2EKH A;  4JRP A;  3QHR B;  2E12 A;  3QYE A;  4CRI A;  2L3Q A;  4A4K A;  1NYF A;  2ENM A;  3V8J A;  3NGP A;  2JVV A;  4HNV A;  3CCM T;  3VUB A;  3MIA B;  1B34 B;  2BE9 B;  2MIO A;  1TSF A;  4JJN K;  3V8L A;  5CCA A;  1V29 B;  4K11 A;  1MV0 B;  4J9C A;  3OYA A;  3RKY A;  1PM3 A;  5IXF A;  3OYH A;  2RQW A;  4PJJ A;  2DRK A;  2V26 A;  5CIU A;  2M02 A;  5GAM f;  3I56 A;  1VYT A;  1X75 C;  3OYE A;  2F5T X;  4ANJ A;  3HKS A;  1YJN T;  1R0C B;  3OYF A;  4BCN B;  2EQM A;  2CH4 W;  1M3A A;  3H9N A;  2DJQ A;  2Y4X A;  3DB3 A;  2QK0 A;  3BG5 A;  3CCJ Q;  4A4G A;  2O9S A;  2JGZ B;  1YIJ A;  1MMG A;  4RTU A;  4NOY A;  1VQ8 T;  4JS5 A;  1JXM A;  1W98 B;  4M75 E;  3CD6 Q;  1YWP A;  1TTH B;  4CFN B;  1VQ5 Q;  1VQ6 T;  5CYI B;  4BUG A;  2BKZ B;  3QWX X;  4LD9 K;  1O9K A;  4FW2 A;  3UAT A;  3A98 A;  4LUD A;  2GGR A;  5GAO q;  3L2Q A;  3RMS A;  2DXB A;  4IUP A;  3JB9 H;  5LJ3 f;  1UNG D;  5FWC A;  2MCN A;  1VQ9 T;  4QW2 A;  1UEB A;  4E2F B;  5GAM j;  3QWL A;  1PSF A;  4LXC A;  3LH5 A;  4D8K A;  2UZD B;  2QTV A;  1VQP T;  3CCM Q;  5GAO n;  5HBH B;  1TOV A;  2DPP B;  3QXE B;  3MI9 B;  2BS4 A;  2GBQ A;  1XNI A;  1C6V X;  3GLX A;  5EG2 A;  1OV3 A;  3OQ5 A;  4KT0 E;  3DKM A;  4XU1 A;  3OYY A;  3T9N A;  3DLL A;  1M5Q 1;  4PL6 A;  1LPL A;  4RTX A;  2WIH B;  1YJN Q;  1M90 R;  1ZA1 B;  3X24 B;  2LVM A;  2XDD A;  1PG5 B;  4PJO E;  1AWX A;  4BE1 A;  3G6E Q;  4F7N B;  2C06 A;  3EH2 A;  1WNL A;  2X4W A;  1X6O A;  4JPB W;  1VQ8 Q;  4C92 D;  2PK2 A;  4F17 A;  1MMD A;  3SWN B;  1VOM A;  1VQ6 Q;  4Z8A A;  4C92 G;  2JT4 A;  2A7Y A;  1ZBX A;  2NLU A;  1SSH A;  1GCQ A;  3GBQ A;  1N4M A;  1YJW T;  1G3N C;  3G71 Q;  2BPM B;  3OMG A;  5ECA A;  2YRV A;  1VQ9 Q;  2A28 A;  3C12 A;  3CCR T;  4M4Z A;  3JAM E;  3MJX A;  3M57 A;  2YDL A;  2W99 A;  1RI0 A;  3H0H A;  4DQ2 A;  4EOP B;  4ROD A;  1HD3 A;  2JTM A;  2W9Z A;  2P0Q A;  4HNU A;  1F1B B;  1M30 A;  3EJ1 B;  2BS3 A;  2C5O B;  2QF7 A;  3M59 A;  1X01 A;  2OAU A;  3HZJ A;  2YSQ A;  1AD6 A;  4LDY A;  2KRO A;  2W0Z A;  1NJI R;  1GCQ C;  4QQG A;  5GAN d;  3DJB A;  2VYT A;  4EC9 B;  3CCS A;  1YI2 T;  2W2H A;  1JRI A;  1OQK A;  5HY6 A;  2C5N B;  4ZGJ B;  4AKH A;  2EGA A;  4F16 A;  2HBP A;  2YLB A;  1B34 A;  2CZ6 B;  1CKA A;  1WJS A;  1B3Q A;  4C8Q D;  1ACM B;  3PIO A;  4EOK B;  1ZBJ A;  2M9U A;  3CCJ A;  5IF1 B;  2DO3 A;  5GMK m;  1VQM Q;  4C8Q G;  2ED1 A;  1A0N B;  2YHT A;  1SF9 A;  2C0I A;  4BDY A;  2EQJ A;  1YJW Q;  1VQ5 A;  1ZUK A;  2KRS A;  3CCR Q;  1UEC A;  2RI3 A;  3F5X B;  1GUX A;  2XU8 A;  2RHX A;  1Q7Y R;  2QFZ A;  2JW4 A;  2LJ1 A;  5D7U A;  4C92 B;  2L3R A;  3M4Y A;  4BCP B;  1M90 C;  5CO7 A;  1K8A R;  3MPU B;  3CCM A;  3PVL A;  4ELY C;  2A0F B;  4OMO A;  2DXU A;  1VQL T;  8ATC B;  2PHG A;  3INZ A;  4E6R A;  4BCM B;  2JS0 A;  3PT9 A;  3RKW A;  1YP5 A;  4M75 F;  5GJV B;  3OS5 A;  1G3S A;  1YI2 Q;  2HBW A;  4YTL A;  2PZ1 A;  2DTI A;  2ZGW A;  4EMK B;  1M1K C;  1M2V B;  1YJN A;  2QQ8 A;  3CPW S;  3OBY A;  1H28 B;  1UG1 A;  3CCL T;  5GMK i;  3MEV A;  2F2V A;  4OB2 B;  1OIY B;  3EH1 A;  4A4F A;  1VQ8 A;  4ESR A;  3QII A;  2CP2 A;  2CUD A;  1U1T A;  1K73 R;  4RTZ A;  3OYC A;  2JTF A;  2HD0 A;  1E9H B;  2CH4 A;  2EQU A;  1VIN A;  3GTM S;  2ZPI B;  1KQ1 A;  4MFE A;  3EHQ A;  3MP6 A;  2FRW A;  1N8R U;  2WIP B;  3HPW A;  1AVZ C;  1LCK A;  1UNH D;  1VQ9 A;  2OTL Q;  3SWN A;  4FSX A;  4NL2 A;  2VUB A;  4BXX X;  2X4X A;  2HSP A;  3CPW A;  2EJ9 A;  1YWO A;  3OYK A;  1NJI C;  3FDR A;  5HBE B;  2HKN A;  1WI7 A;  4M78 A;  4C8Q B;  3JCM b;  2QA4 T;  1QKW A;  1VQP A;  1Q86 U;  1KD1 C;  3UF4 A;  5CKB A;  2GFA A;  2CZ0 B;  1JJ2 S;  3A8M B;  3POM A;  4LDV A;  4BDZ A;  1Y71 A;  1T3L A;  3M56 A;  4J8O A;  4KH0 B;  2LTO A;  1RAH B;  4BE0 A;  2F2C A;  3EFR A;  2VVK A;  3SFM A;  5GAN 5;  1NPR A;  3HP9 A;  1OX9 A;  1WHM A;  4Z88 A;  6AT1 B;  1C9B A;  2B86 A;  4E7I A;  4RTV A;  4A4H A;  2W96 A;  3CCL Q;  1KHI A;  2XIC A;  3SWN C;  2JMC A;  4II1 A;  3RGF B;  3DLM A;  4RCC A;  2RHU A;  1KC8 U;  5CEI B;  1V1C A;  1SRL A;  2V22 B;  2KQW A;  3KFV A;  3EID B;  4PFP A;  3VS7 A;  2NUT A;  1D09 B;  3E19 A;  3O0G D;  1UNL D;  4EOJ B;  2VKN A;  2HCK A;  2K5L A;  3RES A;  3CXC P;  1Q7Y C;  2XK0 A;  2RPN A;  3TW7 A;  1YJW A;  4R55 A;  1D0X A;  3CCQ T;  1K8A C;  4J83 A;  4JZ4 A;  1D1B A;  4HVU A;  4KGV B;  2YXY A;  1H64 1;  2QQA A;  2E1H A;  4Z02 A;  3P8B B;  4BCO B;  5I11 A;  3QPH A;  5GAM e;  2QA4 Q;  2A37 A;  3TU4 K;  5HQ0 B;  1WPY A;  2M0O A;  2YT6 A;  3HFN A;  2YUP A;  4DBQ A;  2QQR A;  2KXD A;  4C5G A;  1UHC A;  3FJ5 A;  1BCO A;  5IT9 E;  1YCS B;  3CME A;  4CC4 B;  2RK2 A;  3VS2 A;  4F7U F;  1RLP C;  2DER A;  5CQY A;  5CVI A;  4J7F A;  4E7Z A;  1N5Z A;  4E7J A;  4MFD A;  4C92 A;  2LDM A;  1K73 C;  4BCQ B;  2CP0 A;  5HCK A;  2O4X B;  3M0P A;  2X35 A;  2RMO A;  4EMG A;  4RUG A;  3EAE A;  5C6S A;  1VIF A;  2M16 A;  1XTD A;  2DJZ A;  3TNI B;  4J5Y A;  3N5B B;  5D6X A;  1QVG A;  4N4I A;  4WTO B;  4PFZ A;  5KYY B;  1D1C A;  4EMK A;  5HK0 A;  1M2V A;  4CFX B;  3R6O A;  1K9M U;  1UGV A;  3MP1 A;  2DEU A;  3SD4 A;  4LUE A;  2DXC B;  1WHL A;  2RF0 A;  1D1A A;  2RM4 A;  4DOV A;  5EJC A;  4C92 C;  5HBJ B;  4BAC A;  3A8L B;  4AG1 C;  2EYQ A;  1RI9 A;  4ZTF A;  2I40 B;  2CP6 A;  4OMN A;  3RKX A;  7AT1 B;  3TEE A;  4HCC A;  1MV3 A;  1HK9 A;  4HL4 A;  4L5G A;  1VQL A;  1UHF A;  3E9G A;  3X25 B;  2XID A;  4EMK C;  1QLY A;  2LZ6 B;  5HK3 A;  1G3Y A;  1BU2 A;  2EYY A;  1URC B;  4E7H A;  1H26 B;  3J81 E;  1KJW A;  2J6O A;  2M51 A;  2XI9 A;  3TSW A;  4C5I A;  4HXJ A;  4QVC A;  1ARK A;  1Y0M A;  1WFW A;  3UA6 A;  3JCM h;  3E2U A;  2RH2 A;  3LGF A;  3CCL A;  1GFC A;  1QVF S;  2KT8 A;  3MHX A;  5KYN A;  1KG1 A;  3L1A A;  4J9E A;  2A36 A;  1I1J A;  2H3E B;  4IUQ A;  4ROC A;  2ZPE B;  3REA B;  5GMK l;  3H8Z A;  4EOS B;  1YBY A;  1VQO T;  5GAM g;  2OTJ T;  3BE3 A;  2HKQ B;  2QTX A;  2K79 A;  2O01 E;  3CC7 T;  3TQ7 P;  2QQ9 A;  4DBF A;  1JBM A;  4N4G A;  1AT1 B;  2RJD A;  2AZV A;  3BLQ B;  3LWH A;  3JCM c;  2MWO A;  4C8Q C;  5CKE A;  4JLG A;  1H1Q B;  2V8I A;  4CC3 A;  3BLR B;  1JO8 A;  1O9S A;  1IRE B;  4M75 B;  4BBR M;  2X9H A;  3ZFJ A;  3CCE A;  3JCM P;  1GBR A;  1QVF A;  3I5S A;  1BKB A;  1AZE A;  4JDS A;  2DM1 A;  4RTT A;  4JJB A;  3OYM A;  3CEY A;  3C4S A;  1Q95 G;  3S3M A;  5DQV A;  2GTJ A;  5LJ3 g;  2LX9 A;  2HQE A;  5GMK h;  1OL2 B;  4E7K A;  2VV5 A;  1B07 A;  2KBT A;  2G6F X;  2E41 A;  3UT1 A;  2ABL A;  5IXB A;  2WSC E;  4FL6 A;  3HRU A;  1PKT A;  2PUK B;  2RJF A;  4FYV B;  2O9V A;  1X43 A;  4EPC A;  1PRL C;  1Y7X A;  1OKW B;  3J80 E;  2B8A A;  1JOW A;  2WAC A;  4J9B A;  2VXE A;  4F7U G;  3QZ9 B;  1AIS B;  1FMV A;  1OYX A;  1TUC A;  5LMK B;  1N9S A;  1B7T A;  1M3B A;  5LJ5 f;  3LYI A;  5FWB A;  3ZL7 C;  4FYY B;  4OP0 A;  4M7D E;  4OMP A;  2NUP B;  4OML A;  2CP5 A;  2O4X A;  3CCQ A;  5GAN 3;  4OVA A;  2DXT A;  1K0X A;  1QKX A;  5GAN 2;  4QSH A;  4KUD K;  3CD6 T;  1VYV A;  3OW2 S;  3NDQ A;  1AWJ A;  3GPL A;  1UGQ B;  1OKV B;  4BCI B;  1HSQ A;  1G3W A;  3MY5 B;  1W70 A;  4LD6 A;  4BD3 A;  2L5Q A;  2V1Q A;  2DXC A;  3OYJ A;  3GNF B;  2BZY A;  4FU6 A;  2QEX T;  4PKC C;  4TVR A;  4CXA B;  2D0N A;  2CP7 A;  1BU1 A;  3RR6 A;  2MF2 A;  5LJ5 j;  1OUL A;  4DA4 A;  4J6Y A;  5KE2 A;  4UC4 A;  4OB1 B;  5GAO p;  4IUR A;  3HFO A;  4BCF B;  4M78 D;  2M1H A;  1N27 A;  3H0F A;  3L2V A;  3OW2 A;  1MNE A;  1E6G A;  2PQW A;  4PJM A;  2R5A A;  2KE9 A;  4M78 G;  5I2M A;  1N6A A;  4J6W A;  2F69 A;  4IKF A;  1OPK A;  1I07 A;  3M0U A;  2VXF A;  4BBS M;  2K57 A;  3G1J A;  2RJC A;  1AWW A;  5KYX B;  3G6E T;  2ATC B;  1YIT T;  5GAN h;  3QJY A;  1Q81 R;  1M1K U;  2SRC A;  1I8F A;  1GUX B;  2PVO B;  4FIB A;  4JLI A;  2BIV A;  4JJC A;  1D3U B;  1U06 A;  2MI6 A;  2ZPF B;  1EX4 A;  1LJO A;  4M7A E;  5BNJ B;  1M9S A;  4CFU B;  4F7U B;  1I5O B;  1NEB A;  2RJE A;  1Y96 B;  2GF7 A;  3V7C A;  3LX7 A;  4DEY A;  3G71 T;  2RNA A;  3VS5 A;  2QEX Q;  1W2B P;  4OGC A;  5ICP B;  2FPE A;  2OAW A;  2E5K A;  2CCH B;  2R57 A;  4BI8 B;  1VQK T;  2JMA A;  4XTW A;  2LNV A;  3RDV A;  2LJ0 A;  1OEB A;  4M75 A;  2KGT A;  3LH0 A;  1QVP A;  3LGL A;  1Q82 R;  1MGQ A;  1D0Y A;  3L2W A;  4F7S B;  4PK4 A;  5A0D A;  2COW A;  3OS0 A;  2E6N A;  1KD1 U;  2QDY B;  5FRO A;  4N0A A;  2K2M A;  1QW1 A;  1EIF A;  2K5I A;  1ENW A;  1VQO A;  2KYB A;  1NE8 A;  2GQV A;  2MPX C;  2OTJ A;  2IG0 A;  3VV0 A;  2EGC A;  2IVW A;  2CKK A;  3CC7 A;  2E5Q A;  1YIT Q;  2EW3 A;  2C4G B;  1S72 Q;  2NUZ A;  4M75 C;  4HT8 A;  2WFY B;  4XU2 A;  1OU9 A;  3O5Z A;  1H1P B;  3BFM A;  1BCM A;  5GAN j;  1EZZ B;  2P4R A;  1VQM T;  2X4J A;  2DK3 A;  3OMC A;  4M78 B;  4C5H A;  4EOL B;  4BCM D;  1Z9Q A;  2DAQ A;  2L3S A;  2K5F A;  2D0Q B;  2NWM A;  1VQN T;  4PJO A;  1WHK A;  4N0A C;  1LOJ A;  2V8K A;  2NUP A;  4JRK A;  4V2S A;  1VQK Q;  5GAM d;  5A0L A;  4A4E A;  3EG0 A;  5HVY B;  3ZEH A;  4QQ6 A;  2C0T A;  2XD0 A;  1H8K A;  4LN2 A;  1WZO A;  2LJ3 A;  2YUN A;  1QWF A;  1BI0 A;  3NMZ C;  3RBB B;  4C0Z A;  1TS9 A;  1FYN A;  4M7D F;  2B9R A;  2F2W A;  1H4L D;  1KHC A;  1ZSZ B;  2NUT B;  4RTW A;  2WEV B;  4F7J B;  1PRM C;  4AFQ C;  1AD5 A;  1Q81 C;  2V1R A;  2P84 A;  3VKG A;  3QWY A;  1GRI A;  3JSC A;  3A8H B;  4A54 A;  1X27 A;  2G77 A;  2KRN A;  3NPF A;  4ZTJ A;  1QCN A;  5LJ3 d;  2QG9 B;  1QVG P;  5A0G A;  1K1Z A;  5GAN 7;  2DZ9 A;  4FSS A;  4BB7 A;  3BDL A;  2FPD A;  4WCI A;  4PFO A;  2D8J A;  3PGG A;  3M0T A;  1QQJ A;  3CD6 A;  2RK1 A;  1H3Z A;  4XTV A;  3ZBD A;  4R0K A;  1GL5 A;  5J3B A;  2F5K A;  1VQN Q;  1M8V A;  1Q82 C;  3ME9 A;  5KYX A;  1CSK A;  2DIL A;  2L3P A;  3QHW B;  1WHH A;  3TN8 B;  1OOT A;  1G2B A;  5ACB A;  3M0S A;  2QEX A;  2KVQ G;  1G83 A;  2OTL T;  2K6D A;  2HEQ A;  1BB9 A;  3SDZ A;  4AFS C;  1HXD A;  3OSV A;  4B9X A;  3M54 A;  1I5L A;  2DE0 X;  4KH1 B;  4F7U A;  5GAO m;  3M03 A;  1Y96 A;  5FW9 A;  1NM7 A;  2LP5 A;  2DLP A;  1KQS P;  4FYW B;  1PHT A;  1YCY A;  2OX7 A;  3P8H A;  4M77 E;  4MDW A;  3UDC A;  5KE3 A;  3NTI A;  3QZ5 B;  2P0P A;  4X34 A;  1GBQ A;  3KUF A;  1J3T A;  4M7A F;  1RUW A;  4F7L B;  3R6N A;  1TWB A;  2LT1 A;  3TW6 A;  4OMM A;  2MOX A;  5IN1 A;  3TRE A;  4XTU A;  1WJR A;  5IHI A;  5I21 A;  4DOW A;  1MUZ A; 
#chains in the Genus database with same CATH homology
 4HA8 A;  2O4X B;  3G6E A;  2JN0 A;  2HAX A;  2X35 A;  2E10 A;  4EMG A;  2KMT A;  3EAE A;  2QI2 A;  2LCC A;  5C6S A;  1VIF A;  2M16 A;  3V7S A;  1XTD A;  3S3O A;  1BIB A;  2V8J A;  2ZPH B;  4OB0 B;  4J7I A;  2DJZ A;  3VKI A;  3UWN A;  3G4S T;  3JB9 J;  3GP8 A;  3BDU A;  3QG1 A;  5CKH A;  4J5Y A;  4C92 F;  2JZ2 A;  2LQK A;  2KY9 A;  3N5B B;  3CBP A;  4N4I A;  5D6X A;  5C0M A;  1VQ4 T;  1QVG A;  3CCV T;  1VQ6 A;  2WJ9 A;  2EQK A;  2X4Y A;  4XTZ A;  3X28 B;  3VKH A;  1OZ2 A;  3WVE B;  3EFS A;  4EMK A;  5HK0 A;  4HCZ A;  1I4K 1;  1U1S A;  3R6O A;  3JB9 D;  3MCA B;  1K9M U;  3WXM B;  3MP1 A;  4ZGE B;  4JUV A;  5LJ3 j;  1D3B A;  2RD1 A;  3FEO A;  4M77 D;  3SD4 A;  3OYB A;  3RER A;  2E6Z A;  3G71 A;  2DXC B;  3A8O B;  2D9T A;  3CCJ T;  1E7P A;  3JB9 G;  1Q7Y U;  2L8D A;  2RM4 A;  1FWZ A;  4DOV A;  3HL8 A;  5EJC A;  2RHZ A;  3FJP A;  4BI3 A;  2XG8 D;  4M77 G;  5IAY A;  4C92 C;  4BAC A;  2RO0 A;  3A8L B;  1Q82 U;  1M1G A;  3OA6 A;  1K8A U;  4HCB A;  1VQK A;  1VQ5 T;  3X20 B;  4PJO F;  2EYQ A;  1M4Z A;  4X9D A;  3QJ6 A;  4NS5 A;  4ZTF A;  3FB9 A;  2CZ1 B;  4VUB A;  1OZ3 A;  3RKX A;  5LJ5 e;  3TEE A;  4HCC A;  4Z6Y A;  4IUV A;  4R56 A;  1HK9 A;  4HL4 A;  3JCM J;  4L5G A;  3CCU T;  3HO8 A;  1O75 A;  2BKD N;  3M4G A;  4C0D C;  1VQL A;  3JB9 I;  4WF2 A;  3E9G A;  3JCM d;  3HBL A;  3X25 B;  2XID A;  4OGE A;  2ZZD B;  4JRP A;  3FLG A;  4EMK C;  5HK3 A;  2E12 A;  3QYE A;  1G3Y A;  1QP3 A;  4CRI A;  2ZPB B;  4E7H A;  3GIB A;  4PJO C;  4JX4 A;  4A4K A;  3J81 E;  4MDX A;  2XI9 A;  4BE2 A;  3V8J A;  4C5I A;  2JVV A;  4PLI A;  4HNV A;  2QXF A;  4QVC A;  3VUB A;  3CCM T;  1B34 B;  2DTO A;  4JJN K;  3JCM h;  2RH2 A;  3V8L A;  2XKO C;  3LGF A;  4QVZ A;  3CC2 T;  3CCL A;  3S6W A;  2P4T A;  5CCA A;  1V29 B;  1QVF S;  4OB3 B;  3GF5 A;  3MHX A;  4M7A C;  3BW1 A;  4PLL A;  3OYA A;  1KG1 A;  3L1A A;  3M55 A;  3CME A;  2PUO B;  3CME T;  3M9Q A;  4M78 C;  4IUQ A;  1K73 U;  2ZPE B;  3RKY A;  3M5A A;  5GMK l;  3OYH A;  4RKU E;  1BYM A;  2ZZD A;  3H8Z A;  1YBY A;  5CIU A;  5CKF A;  5GAM f;  1VQO T;  4HLQ A;  5GAM g;  2BS2 A;  3OYN A;  3I56 A;  1X75 C;  4XK8 E;  2F5T X;  5A2Q E;  3HKS A;  3OYE A;  5AYF A;  3UPU A;  1YJN T;  4JS4 A;  3QBY A;  1VQM A;  2OTJ T;  2QTX A;  3OYF A;  2O01 E;  2EQM A;  3CC7 T;  3Q1J A;  5GAN 4;  2Y4X A;  3DB3 A;  3OYL A;  4ELZ C;  3BG5 A;  3OSS C;  5D6Y A;  4JX6 A;  4A4G A;  1VQN A;  4Y28 E;  1UGS B;  2QQS A;  2QQ9 A;  3MEA A;  1JBM A;  4N4G A;  2RI2 A;  1YIJ A;  2ZCF B;  2EKO A;  2RJD A;  4NOY A;  5CKD A;  3LWH A;  3CCR A;  5D6W A;  4JS5 A;  1VQ8 T;  3J7A F;  3QO3 A;  4M75 E;  3JCM c;  2MWO A;  4C8Q C;  3BG9 A;  1G3T A;  4JLG A;  5CKE A;  1VQ6 T;  3L42 A;  4F7U E;  2VGN A;  2V8I A;  4BUG A;  4M75 B;  1O9S A;  1IRE B;  3ZFJ A;  4BBR M;  3L2U A;  3CCE A;  4LD9 K;  3JCM P;  3M58 A;  1QVF A;  1BKB A;  3JCM X;  2K4Y A;  2Y90 A;  5GAN 8;  5CR2 A;  4JDS A;  5GAO q;  3S3N A;  3QYB A;  3L2Q A;  3RMS A;  2DXB A;  4IUP A;  3CEY A;  5LJ3 f;  3CBM A;  3OYM A;  3JB9 H;  3C4S A;  5FU7 B;  4BY6 B;  3S3M A;  1VQ9 T;  4QW2 A;  1FXX A;  5LJ3 g;  1UEB A;  4LOC A;  2EJF A;  2LX9 A;  5GAM j;  3HB9 A;  3QWL A;  1BIA A;  3OS1 A;  4LDU A;  3FRN A;  2HQE A;  1PSF A;  5GMK h;  4C92 E;  2VV5 A;  2KSS A;  4E7K A;  3JCM e;  5GAO r;  1VQP T;  2E41 A;  3UT1 A;  4FM4 B;  5GAO n;  1YI2 A;  2KAF A;  2LQ8 A;  2DPP B;  2WSC E;  3HRU A;  2PUK B;  4FL6 A;  4GY5 A;  3L2R A;  3O8V A;  3QXE B;  2RJF A;  3JCM V;  5J39 A;  4M75 D;  2BS4 A;  3RIR A;  4EPC A;  1Y7X A;  1XNI A;  3GLX A;  3QSU A;  1YIT A;  5EG2 A;  4FT2 A;  3J80 E;  1VUB A;  3CPF A;  1S72 A;  2B8A A;  3OQ5 A;  3DKM A;  4KT0 E;  3VJP A;  4QVD A;  4XU1 A;  3OYY A;  4M75 G;  2WAC A;  3T9N A;  5L8R E;  5DLO A;  1M5Q 1;  2VGM A;  3OYG A;  3DLL A;  1YJ9 T;  2VXE A;  4PL6 A;  4F7U G;  3QZ9 B;  1OYX A;  3VU3 C;  4C5E A;  3X24 B;  2LVM A;  2GCX A;  2DIQ A;  2XDD A;  1N9S A;  4M77 A;  4PJO E;  4AKG A;  3PNW C;  2EIF A;  5LJ5 f;  2DTH A;  3LYI A;  4FT4 A;  2WSE E;  4BE1 A;  2C06 A;  5LJ5 g;  1W2B S;  4OP0 A;  4HT9 A;  1WNL A;  2X4W A;  1X6O A;  4OF1 A;  4XQ3 A;  2R58 A;  4M7D E;  3CMA A;  4C92 D;  2DKG A;  2O4X A;  3CCQ A;  3JB9 F;  5GAN 3;  4OVA A;  2DXT A;  2KR6 A;  3MP8 A;  3SWN B;  3I55 T;  4M7D B;  4M78 E;  4M77 F;  5GAN 2;  3BG3 A;  4QSH A;  1WQ7 A;  1WGS A;  4C92 G;  1MHN A;  4KUD K;  5FU6 B;  2HNI A;  3OW2 S;  3CD6 T;  2OTL A;  2A7Y A;  1ZBX A;  5FRN A;  2NLU A;  3GPL A;  1BI1 A;  1UGQ B;  1VQ7 T;  4L59 A;  2FYK A;  3FIF A;  4O5V A;  3E1S A;  1YJW T;  4CI0 C;  2DD5 B;  1G3W A;  2KK4 A;  5GMK e;  5CQX A;  3OMG A;  1M1F A;  4LD6 A;  4BD3 A;  3WVD B;  2YRV A;  2L5Q A;  3C12 A;  3CCR T;  4EMH A;  2DXC A;  3OYJ A;  3GNF B;  4FU6 A;  2QEX T;  4PKC C;  4M77 C;  4O6J A;  4TVR A;  3JAM E;  4PJO D;  3M57 A;  3NTK A;  4XU3 A;  4C8Q E;  4RG2 A;  4E7L A;  1RI0 A;  4DQ2 A;  3CCE T;  2K3Y A;  1GXI E;  2MF2 A;  1W2B A;  1W4S A;  2RI5 A;  4PJO G;  5LJ5 j;  4M7D D;  4DA4 A;  4J6Y A;  3HSB A;  2JTM A;  5KE2 A;  4UC4 A;  2CS7 A;  1TH7 A;  4KUI A;  4OB1 B;  2AHJ B;  2P0Q A;  5GAO p;  2H3J A;  2KMG A;  4HNU A;  3KXT A;  3MEU A;  4IUR A;  4N4H A;  1DJ7 B;  3HFO A;  3PIP A;  2BS3 A;  4M78 D;  4M7D G;  2M1H A;  2FHD A;  3M59 A;  2QF7 A;  1N27 A;  1X01 A;  2OAU A;  1YHQ T;  4L6V 5;  3HZJ A;  3L2V A;  3OW2 A;  4M6V A;  4LDY A;  3QYH B;  2PQW A;  2R5A A;  5KCH A;  4M78 G;  5I2M A;  1N6A A;  3KHI A;  2PVD B;  4J6W A;  4QQG A;  2VYT A;  5GAN d;  3G4S A;  2F69 A;  3P8D A;  4LDW A;  1AHJ B;  4AKI A;  3CC4 T;  3CCS A;  4IKF A;  4HNT A;  2VXF A;  4BBS M;  1YI2 T;  3ASK A;  3CCV A;  3QYG B;  1JRI A;  5HY6 A;  2K57 A;  3PMT A;  4ZGJ B;  4AKH A;  2CZ7 B;  2RJC A;  2HBP A;  2YLB A;  3L2Z A;  1B34 A;  3H4C A;  4MMK A;  3G6E T;  2CZ6 B;  1WJS A;  3TCJ A;  3MEW A;  4C8Q D;  3PIO A;  5GAN h;  3QJY A;  1YIT T;  1M1K U;  4HKE A;  1I8F A;  2M9U A;  3CCJ A;  2PVO B;  4FIB A;  3PMI A;  4JLI A;  2BIV A;  4C0F A;  3JCM f;  2DO3 A;  4OMF B;  3DL1 A;  1IZ6 A;  5GMK m;  4C8Q G;  2MI6 A;  3BY7 A;  3M53 A;  2ZPF B;  4Q5W A;  3JCM g;  2YHT A;  1N8R C;  1LJO A;  4M7A E;  2DD4 B;  4BDY A;  5I2S A;  3KBG A;  1M9S A;  2EQJ A;  1FX7 A;  3URG A;  1VQ5 A;  3LLR A;  4F7U B;  2RJE A;  3LW5 E;  1Y96 B;  3PTA A;  2GF7 A;  2L89 A;  2LC4 A;  1ZHI A;  4KBM B;  4M7A B;  2DEQ A;  3V7C A;  3LX7 A;  2QA4 A;  2XHC A;  1P92 A;  2KDS A;  3G71 T;  2RI3 A;  2JOY A;  4OGC A;  3CCU A;  1FKM A;  1Q86 C;  1BI3 A;  4Y91 A;  2JUF A;  3NTH A;  2XU8 A;  5DM7 R;  1QLB A;  2G3R A;  2Y4Y A;  2E65 A;  4NL3 A;  2R57 A;  2RHX A;  2QFZ A;  4BI8 B;  3V8K A;  1VQK T;  2EAY A;  4XTW A;  2LNV A;  2XDB A;  5J26 A;  3OS2 A;  4ATO A;  1U8R A;  2DD4 A;  4M75 A;  1OI1 A;  1RL2 A;  3LH0 A;  2L3R A;  4C92 B;  1QVP A;  3LGL A;  3M4Y A;  1M90 C;  1MGQ A;  5CO7 A;  5LL6 S;  2RHI A;  1QVG S;  3CCM A;  3L2W A;  4XTX A;  4ELY C;  5GAN 6;  5A0D A;  3OS0 A;  2E64 A;  2DXU A;  1VQL T;  2E6N A;  2ZPG B;  3INZ A;  3DB4 A;  3RMQ A;  3OY9 A;  1KD1 U;  1BI2 A;  3VYH B;  4M7A D;  2QDY B;  5CAI A;  3PT9 A;  3RKW A;  3OYI A;  4M75 F;  5FRO A;  3GNG A;  4N0A A;  4C0D B;  2QDJ A;  3OS5 A;  1QW1 A;  1EIF A;  1G3S A;  2K5I A;  3CXC S;  2PVG B;  4YTL A;  1VQO A;  4M7A G;  5GAN e;  2DTI A;  1NE8 A;  2P0K A;  2GQV A;  2ZGW A;  4EMK B;  1KC8 C;  3HRS A;  1YJN A;  1M1K C;  4MZT A;  2OTJ A;  2MMP A;  2QQ8 A;  3CPW S;  2IG0 A;  3OBY A;  2K2V A;  4NC6 A;  4KUL A;  3E9F A;  4RG8 A;  3VV0 A;  2IVW A;  4PJO B;  1D3B B;  2CKK A;  2FL7 A;  2E5Q A;  3CC7 A;  3CCL T;  5GMK i;  3C94 A;  3MEV A;  2FVU A;  4ZN1 A;  5M9O A;  2LT4 A;  1Y07 A;  3OB9 A;  2E70 A;  5LJ3 e;  4OB2 B;  4MIM A;  4MZP A;  1N9R A;  4M75 C;  4A4F A;  1VQ8 A;  1NZ9 A;  4HT8 A;  4XU2 A;  4B9W A;  3VUZ A;  3QII A;  3BFM A;  3CCS T;  3F70 A;  4D6W A;  5GAN j;  4JRQ A;  1JJ2 A;  3I56 T;  1U1T A;  1VQM T;  2X4J A;  2DK3 A;  3OMC A;  4M78 B;  1QP2 A;  4XU0 A;  4C5H A;  3OYC A;  2JTF A;  2RB6 A;  2HD0 A;  2DAQ A;  2K5F A;  2EQU A;  2MWP A;  4XTY A;  5FU7 C;  3RUX A;  4A53 A;  4BY6 C;  2ZPI B;  1KQ1 A;  4MFE A;  2DVE A;  1KQS S;  2D0Q B;  3MP6 A;  1N8R U;  1VQN T;  4PJO A;  4N0A C;  1LOJ A;  1ZQ1 A;  1YIJ T;  3HPW A;  2XDP A;  2V8K A;  1JB0 E;  4JRK A;  3CXC A;  1VQ9 A;  2R5M A;  3V7R A;  4V2S A;  4M7D A;  5GAM d;  4XAX B;  3SWN A;  5A0L A;  4FSX A;  1NPP A;  1R8O B;  2VUB A;  4NL2 A;  2X4X A;  4A4E A;  3CPW A;  3ZEH A;  2EJ9 A;  4QQ6 A;  3X26 B;  2RHY A;  3OYK A;  5KH6 A;  3FDR A;  1NJI C;  2XD0 A;  2EFI A;  2BUD A;  2K3X A;  4M78 A;  3JCM b;  4C8Q B;  3LWI A;  1Q86 U;  5GMK j;  2QA4 T;  1VQP A;  1KD1 C;  5CKB A;  2GFA A;  1BI0 A;  2CZ0 B;  2QQB A;  2DD5 A;  2JNG A;  3QUI A;  4C0Z A;  1JJ2 S;  3JRZ A;  3A8M B;  3JCM Q;  3A5Z B;  4LDV A;  4BI4 A;  5GAM h;  1UGP B;  1UGR B;  1Y71 A;  2A3L A;  4BDZ A;  4M7D F;  4JX5 A;  3M56 A;  1KHC A;  1M90 U;  4J8O A;  2LTO A;  3QDR B;  2PU9 B;  4AI6 A;  4BE0 A;  1Q81 C;  4M78 F;  5FRM A;  3PFS A;  3AHU A;  3EFR A;  3VKG A;  3SFM A;  5GAN 5;  1YJ9 A;  1NPR A;  3HP9 A;  3JSC A;  1I81 A;  1KQS A;  1VQ4 A;  3ER0 A;  4P5N A;  3A8H B;  2EJG A;  4A54 A;  5CK9 A;  4E7I A;  4C8Q A;  2G77 A;  4A4H A;  4C0G A;  2GFU A;  4ZTJ A;  1KHI A;  4M7D C;  2XIC A;  4ZN3 A;  3SWN C;  5LJ3 d;  4II1 A;  2RA2 A;  5A0G A;  3DLM A;  4RCC A;  2RHU A;  1KC8 U;  2I2L A;  4GLK A;  2DZ9 A;  3HRT A;  5GAN 7;  1S72 T;  3CBO A;  2DZC A;  1XOV A;  2KQW A;  4MZM A;  5FU6 C;  1SSF A;  4BB7 A;  1VIE A;  3BDL A;  2YLC A;  3E19 A;  3I55 A;  1K9M C;  2D6F A;  4J6X A;  4C8Q F;  5DLQ E;  3VYG B;  3H6Z A;  3PGG A;  2K5L A;  3RES A;  3CD6 A;  2RK1 A;  1H3Z A;  4XTV A;  5LJ3 h;  3ZBD A;  1VQ7 A;  5GAO l;  1Q7Y C;  5J3B A;  5KCO A;  2F5K A;  2XK0 A;  3TW7 A;  2HQX A;  1YJW A;  1M8V A;  3FC3 A;  4R55 A;  5FLX E;  2DXB B;  3CMA T;  1Q82 C;  3ME9 A;  4E47 A;  4PNO A;  3CCQ T;  1K8A C;  2LCL A;  3QKJ A;  4J83 A;  3G7Z A;  2MAM A;  3JCM W;  2QEX A;  3SB2 A;  1H64 1;  2KVQ G;  2QQA A;  5HKC A;  2E1H A;  1XQH A;  2CYZ B;  4Z02 A;  4IUU A;  2OTL T;  3P8B B;  4RCB A;  3C95 A;  3MET A;  4IUT A;  5GAN f;  3OBW A;  3QPH A;  5GAM e;  3VYG A;  3SDZ A;  4EDU A;  4JRI A;  1HXD A;  4ZGD B;  3OSV A;  4B9X A;  3M54 A;  2VC8 A;  5LJ5 d;  5GAN g;  3TU4 K;  1WPY A;  4MML A;  2M0O A;  1I5L A;  3HFN A;  4F7U A;  5GAO m;  3HHT B;  4ME7 A;  1Y96 A;  2EWN A;  4RMO A;  3A8G B;  1LNX A;  4M7A A;  1WJQ A;  1NJI U;  2QQR A;  4X9C A;  2FB7 A;  5DY9 A;  4C5G A;  3CC2 A;  3OYD A;  3GOX A;  1YHQ A;  1YCY A;  1KQ2 A;  2CGH A;  5IT9 E;  3QHS A;  3P8H A;  2DIG A;  2LRQ A;  4M77 E;  4MDW A;  3UDC A;  5KE3 A;  3NTI A;  3QZ5 B;  1PSE A;  2P0P A;  4X34 A;  5LJ5 h;  4LDX A;  2RK2 A;  3KUF A;  3MO8 A;  1G5V A;  4F7U F;  4ELJ A;  4M77 B;  3NFC A;  5CQY A;  5CVI A;  2WSF E;  4J7F A;  3CC4 A;  4M7A F;  2LT1 A;  4E7J A;  1WQW A;  4MFD A;  4C92 A;  3TW6 A;  1Q81 U;  4QQD A;  2LDM A;  1UB4 A;  5IN1 A;  3TRE A;  1K73 C;  4XTU A;  1WJR A;  5I21 A;  4DOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...