2ZCFB

Mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
total genus 56
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zcfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zcfB02
4RKUE 4FM4B 4Y28E 2DXBA 1UGQB 3A8MB 1UGSB 2ZZDB 3X20B 4OB3B 4ZGDB 2DPPB 1DJ7B 4ZGEB 2DXCB 5L8RE 2QDYB 3QZ5B 2ZPFB 2DD5A 3A8LB 3VYGA 3A8GB 2CZ1B 2CZ7B 4OB2B 3HHTB 1JB0E 2ZZDA 3QZ9B 3QXEB 2DD4A 1IREB 2WSEE 4KT0E 3X25B 2AHJB 2PVOB 2ZPEB 4OB0B 4L6V5 2ZPBB 3QYGB 2PUOB 1UGPB 1AHJB 3WVDB 2DXBB 2WSCE 3WVEB 2CZ0B 3A8OB 1UGRB 4XK8E 1QP3A 2DXCA 1PSFA 2D0QB 2O01E 2ZPIB 2PUKB 3QYHB 3LW5E 2DD5B 3VYGB 1GXIE 1V29B 4ZGJB 3VYHB 3X28B 2CZ6B 2DD4B 2PVGB 3X26B 1PSEA 2PU9B 2WSFE 2CYZB 1QP2A 2ZPGB 2PVDB 2ZPHB 4OB1B 2ZCFB 3X24B 3A8HB
chains in the Genus database with same CATH superfamily
1PC0A 3CC7Q 2QGGA 4EOLB 1A0NB 3A8MB 2D9TA 3BE3A 1VQOA 3M0UA 2PQWA 3X20B 4HT8A 2FPDA 1C0MA 4Z6YA 1OV3A 1OULA 4HA8A 3VS2A 2VVKA 3V8KA 2GGRA 1TSFA 1F5QB 3HKSA 2QDYB 3URGA 2DIGA 2E1HA 4IUQA 8ATCB 3QHWB 3EG1A 3S3MA 4KUDK 3SHWA 3OYYA 1D3UB 1GCPA 4J7FA 4BCQD 2CZ7B 4F70B 5HVYB 4D8DA 5LJ5h 4B9XA 1ZQ1A 2DD4A 3RMQA 3H4CA 2K2MA 2GQIA 4Y92A 3EFSA 1WHMA 1FWZA 2QQAA 1VQ9T 1RI9A 4C0FA 1OYXA 4AI6A 3OYKA 4O6JA 2NUPB 4B6MA 4G6LB 2DJQA 1KQ2A 3CC2A 3OYGA 5HNBB 4BCQB 2V8KA 4DBRA 4M77D 2G6FX 3KBGA 3HL8A 4KRDB 1WQ7A 2F2XA 1VIFA 1U1SA 2ROTA 3I55A 3LWIA 5ACBA 1W2BS 3QUIA 3J7AF 2KDSA 3JCMb 1YIJQ 2JW4A 2E12A 1VINA 1QMCA 3KUFA 3C4SA 4A4EA 4DBQA 2LQKA 2RI3A 2NLUA 3C95A 3RESA 2JTFA 3MEUA 1SRMA 2O01E 2KI7A 5IHIA 2BPMB 4C5GA 1WJRA 2DL8A 3JCMc 2DMEA 2KT8A 2CZ6B 3EGXA 1I4K1 2OTLQ 1IHVA 1PD0A 1N8RR 4MZPA 2D6FA 1AWWA 4LN2A 3CCJQ 2E10A 3JV3A 3SWNA 2RK2A 1JJ2S 3T9NA 1AD5A 1CKAA 2MCNA 3MIAB 4FYXB 3CXCA 3X24B 1AOJA 1RAGB 4PL6A 1M90U 1YCSB 4QQ6A 4RKUE 3NGPA 4FM4B 3CMEQ 4JJBA 3NTKA 4AKHA 1ABOA 4EMKA 3QDRB 2DKGA 4MFDA 2RHXA 2HMAA 4PFZA 1LPLA 1FKMA 5CIUA 1OKWB 3BHTB 2KEAA 1VYTA 4M78C 3CCVT 4PJJA 2FRWA 2DTIA 4D6WA 3A98A 4F7UF 1UGVA 2XHCA 2A7YA 2V8IA 2FL7A 4BY6B 3EG2A 1R0CB 1D1CA 4E7IA 1H92A 5GAOn 2RJDA 1XJWB 3N5BB 3G6EA 4F6SB 1AT1B 2C4GB 5CYIB 2FHDA 2X35A 1O9KA 5HBEB 3I56T 1YJ9T 1G3WA 3TNHB 1TD6A 4EOOB 3HFNA 3JSCA 1VQMQ 2WSCE 1Q95G 5KYXA 4C0DC 4PLLA 4M4ZA 1VQPQ 1KSWA 2K5IA 3EG0A 3FJ5A 3VKHA 2ABLA 1GY3B 4Y72B 3E19A 4LDWA 1OOTA 2QQSA 3QWXX 4YOOA 3GIBA 3H0IA 4F7LB 2A36A 4EOIB 3EIDB 3QYHB 3HTRA 4JX4A 3BDLA 5A0GA 2YRDA 5LJ5e 1BYMA 1SRLA 1VQ8Q 2LT1A 3HRSA 4R0KA 4ATOA 4OMQA 3H0FA 1I5OB 3BG3A 1KD1R 2NWMA 3VUZA 2NUZA 2BTTA 3PT9A 4YOSA 1M8MA 3CCLQ 5D6XA 1OEBA 1PG5B 1KIKA 1VQNT 4JRQA 4BCMD 3V8JA 3QSUA 4M75E 4F16A 2VXEA 1M30A 2BZXA 5I22A 2HBPA 1LCKA 3ZL7C 3G4ST 1UGSB 4YC3B 1EX4A 1RAEB 1UECA 4QVDA 4OB3B 1W1FA 2C5VB 3M4GA 3CCET 1RAIB 3INZA 2VB6A 1OX8A 4EC9B 2RQVA 1JXMA 2EAYA 1VQKQ 3OYMA 2JZ2A 1RL2A 4DEXA 1Y0MA 1VOMA 3UATA 3L2WA 2OTLT 4ORZA 3VS0A 4BD3A 1V76A 4ELYC 2HSEB 3PTAA 1WZOA 2WPAB 3CC4Q 2K7AA 2O4XB 3FRNA 5IT9E 5L23A 4RUGA 1VUBA 1BI2A 2HKQB 2A3LA 4LDUA 1BBZA 5HY6A 4M78A 4M75F 1K73U 4IURA 3FDRA 3NPFA 1BI0A 4OB0B 3HRUA 2DYBA 5KYYA 3CMET 1TTHB 3K7AM 5EFQB 1VQ9A 2DBMA 1ZSZC 3FIFA 1AVZC 2Y90A 3MP1A 5KCHA 1Q81R 4HCBA 2KRSA 1VQ4Q 3NHNA 4J5YA 3QWYA 2LRQA 2V8JA 4KUIA 1WA7A 4KH1B 2CZ0B 1X6BA 5GMKh 1MNEA 2LJ1A 1ENWA 4C92E 4M78G 5DLQE 3MI9B 1W4SA 2O2OA 2DL4A 2JN0A 2D0QB 1BU2A 3MKDA 1KQSP 5CO7A 2J7IA 3DOGB 4JRKA 2LNHB 3CCSQ 2EJ9A 2YRVA 4RCCA 4LNPA 3META 2XDPA 5KYNA 2DE0X 3L2ZA 2V1QA 2RD1A 1PWTA 2KVQG 2PVGB 4LDVA 1T0HA 2QEXT 1QVGP 4ZNXA 3E9GA 4R56A 2BS4A 4FIBA 3LYIA 3EFOB 3LH5A 3OYIA 3BLHB 2LVMA 2R58A 2JUFA 4ELLA 1B34A 4N4GA 4M7DC 3GP8A 1RUWA 3M59A 4J9IA 4NL3A 2M02A 1IZ6A 4E7ZA 3JB9H 1HXDA 2M16A 2COYA 4XQ3A 2BZYA 4BCND 3LX7A 2EQJA 3CMAQ 4JS4A 4EOMB 3QPHA 1TFBA 1IGQA 1QKXA 3QHRB 3VYGA 1D0ZA 4XU1A 2B9RA 2X3WD 5CQXA 1OL1B 3CCVA 1BI1A 2ESWA 2PZ1A 3TNIB 2EGEA 1QVFP 4BCNB 5LJ3g 4RG8A 2BKZB 4A4FA 1M9SA 4E7LA 2HNIA 2EQUA 5AT1B 2ZPBB 2LJ3A 2RI5A 4EDUA 2YXYA 8AT1B 5CKEA 2YLBA 4FSSA 4B9WA 1B3QA 2JTEA 2QG9B 2DXBB 2D8JA 2IPOB 1FX7A 3G71Q 1VQ6Q 3FLGA 1VQ5Q 3I56A 1YHQT 1YJ9A 4CRLB 3CC2T 2Y4XA 2DX1A 1H24B 1Q86R 1RAFB 5IHNA 1IHWA 2RN8A 1ZSZA 4BCKB 2F5KA 2I40B 4M77C 3OSSC 1C9BA 4BI8B 2PHGA 5J26A 3HP9A 1AZGB 2KXDA 1PKTA 1TOVA 2CP0A 2X4XA 3LWHA 4OMOA 3PVQA 3CCUT 2QFZA 4PJMA 3GLXA 3QBYA 4CFNB 5HCKA 2ZPGB 1RACB 2HEQA 3OMCA 5KE3A 3JB9G 3QWLA 1E9HB 1H1PB 2DL7A 1VQ4T 5CK9A 4HVVA 2JTMA 2MK5A 4ESRA 4F6WB 2EIFA 4F04B 2UZBB 3UT1A 5J3BA 1R0BG 3JCMd 4X9CA 2KNBB 1VQNA 2BE7D 1NJIR 4QKUA 5GMKe 2LCSA 2ED0A 1NLOC 1EIFA 3R6OA 1QVGS 4DOWA 5M9OA 1M4ZA 1SSHA 4LUDA 3G4SA 1VQLT 3C94A 1Q82C 4ZGEB 4C5IA 1HD3A 2W2HA 2DXCB 3ZFJA 3CCST 1MNDA 1G3SA 3CCEA 2CUDA 1JSTB 1VYVA 3QDFA 3OW2S 4F14A 4M7DA 4BY1X 2RHYA 5L2WB 2C0IA 3U23A 5GAMd 2PK9B 1JB0E 2OTJQ 3GNFB 4JZ3A 4NL2A 4BY6C 2CS7A 3DL1A 1R77A 3TSZA 2OTLA 2W96A 4EOQB 2M1HA 5IXFA 1MMDA 2AHJB 2R7GA 3CCJA 4M75D 1H641 4N0AC 1I07A 3V7SA 3ULRB 1BIBA 2X51A 2PUOB 3BDUA 4CI0C 4OMMA 1KD1U 4BCHB 4M7DG 6AT1B 4YTLA 2LDMA 4EMHA 2E6NA 2C5OB 3CMEA 2E5KA 4PNOA 3PIPA 5IAYA 1W2BP 1QVFS 2L3QA 2RQUA 1FMVA 1H3HA 4C8QE 5GAOr 1M1KR 4M75B 5I2MA 3NDQA 5LJ5g 2LJ0A 1M27C 3DLMA 3MPUB 3H0HA 1PSFA 1YWPA 2L89A 2JGZB 1TWBA 2ZPIB 3L2RA 5LMKB 3HSBA 2FYKA 2WIPB 1K9MR 1AWJA 4IKFA 2EKOA 1H1SB 3GOXA 1U06A 1QLBA 4A4HA 2A37A 2WMBB 2CT4A 2KROA 3M58A 3OYDA 1JJ2P 4P5NA 1S72T 3VKIA 4M77A 2QEXA 1Q7YR 2A28A 2VXFA 3G71T 2GFUA 4BCIB 5KE2A 1VQ6T 3JCMW 3L2UA 4MMLA 3VV0A 1Y96B 4PJNA 4C8QF 2F5TX 2VUBA 2X1NB 1KK7A 3JRZA 2K5FA 1VQPA 2DPPB 3JCMV 1Q81U 3KXTA 4HL4A 1G3YA 2SEMA 2CP7A 2QA4T 5GANg 2HQEA 4EC8B 2RPNA 4M77G 2CCHB 1YJWQ 4C5EA 4DBFA 2EJFA 3VU3C 3O8VA 1TH7A 4C92B 4DQ2A 2QF7A 3UF4A 2PTKA 2F2VA 4BI4A 2E65A 1MGQA 3CCQQ 1WXTA 3QG1A 2W0ZA 2R5MA 2ZPEB 1H26B 5FWCA 1KQSA 2NUTB 3RMSA 2E4HA 5LQFB 1PM3A 4ME7A 4A4GA 1UDLA 3SB2A 2EWNA 2HL5C 1TU0B 1UB4A 1KC8R 1OU9A 4BUGA 4EPCA 4M7AE 5GAN8 1EZZB 4AKGA 5FW9A 1QP3A 1SF9A 3LLRA 4N0AA 3CCRQ 5IDNB 5GAOp 1YHQA 2DTHA 4XU3A 4E7HA 3J81E 1NEGA 1VQKA 4PJOA 1M3BA 4EORB 3EGDA 5EG2A 3SDZA 4ZGJB 2FB7A 3EGUA 4MIMA 1SHGA 2KE9A 2YUOA 1YITT 4C0GA 5IXBA 2WACA 1M90C 4HCCA 2RQWA 2C0OA 4LD6A 2PU9B 3G7ZA 2PVDB 1G5VA 3JB9I 3CCUA 3QIIA 1QWFA 2RA2A 3JAME 2L3RA 4WTOB 5GAN5 2J6KA 4PJOG 2GNCA 3JCMh 2L0AA 1YNZA 1AWXA 2GFAA 3CQTA 4BDZA 4M7AF 2EVRA 1VQ4A 3RIRA 4E47A 1XNIA 3H9NA 4GLMA 1BCOA 3LGLA 3LH0A 5J39A 5FU7B 4ZTJA 1X27A 4EOKB 2DXUA 2IW6B 3M4YA 3OYAA 4M78E 2P84A 1VQLA 3BLQB 3CD6Q 2RO0A 5EC7A 1W98B 3KHIA 4JLIA 2VGMA 3CCSA 5DY9A 1Q86U 3MY5B 4Z88A 4A54A 1D0XA 3ZEHA 4HNVA 3BW1A 5FU6B 2DZCA 4OR5B 4ELJA 3C12A 2KYBA 3UPUA 1BB9A 1O75A 2I2LA 3TCJA 2DA9A 3QO3A 4JJDA 2RJEA 1VYWB 1N9RA 1O9SA 5HK0A 4PLIA 4FT2A 2KAFA 1SKUB 1V1CA 2CSIA 1OU8A 1WDXA 2MF2A 2O4XA 2I0NA 1KFZA 3A8OB 4R55A 2EW3A 3TSWA 2X4WA 2DNUA 2DZ9A 2ED1A 2ATCB 1OI9B 3CC7T 1Y71A 3I9QA 1NJIU 1ZBXA 3VS3A 5KYUB 4ROEA 4RTVA 1ZA2B 2WFYB 2J6FA 3QJ6A 4IIOA 5DQWA 2Y4YA 2DD4B 3BG5A 3CBPA 5GAN7 1X01A 1YWOA 1HJDA 1ZUUA 4JS5A 5GMKj 4FYVB 2RK1A 1NEBA 1GUXB 1K4US 3ASKA 5KYWA 1VYUA 1MMNA 3UA6A 3M9QA 4QQDA 1JO8A 1B07A 1N6AA 3M55A 4LE9A 2E6ZA 2LQ8A 3V8LA 2GTJA 2K5LA 3P8BB 3I35A 1YJNQ 2WHBB 1MV3A 3S6WA 2J6OA 2JMCA 4PFOA 1QWEA 3MP8A 4JDSA 4MMKA 1S72A 4KRTA 4ELZC 2QQRA 2E3IA 2AIRB 3G71A 1K8AR 3HB9A 4BE1A 4C8QD 1LVKA 1VQ6A 4ZGDB 1VQ5A 4CC3A 4E7SA 5EJCA 4CFMB 2W99A 2EQMA 1ZBJA 2QI2A 5I21A 1D0YA 3R6NA 1Q7YC 1VQ7Q 3LQ5B 5ECAA 1PRLC 1UFFA 2AZSA 2C6TB 1VQOQ 3E9FA 1WPYA 1BKBA 2X3XD 1K73C 2QA4A 1M1KU 1WX6A 2K3XA 3EGXB 3HHTB 4C8QB 5CCAA 1YIJT 1W2BA 1ZP2A 3DTOA 2EPDA 2LCLA 3OYCA 5DQVA 2DYIA 2XG8D 2BS2A 4BCGB 3CPWS 3SWNB 1K9MU 1X6OA 2PVOB 3EG9B 1WHJA 3GNGA 3QKJA 3MO8A 2JS2A 4IMYB 4OMFB 1UGPB 1T0JA 9ATCB 3JCMe 2YUPA 3BY7A 2YLCA 2DJZA 1OQKA 2RJFA 4ZN3A 2XMFA 1YFNA 4EMKB 7AT1B 3M0QA 2UZLB 2QYZA 3CCJT 1Q7YU 1G3TA 1E6GA 2BE9B 3CBMA 4OVAA 4XK8E 4DEYA 1OL2B 2DEQA 2P4TA 4M75C 1H8KA 1I1JA 4FU6A 3CD6T 3A1PA 4E6RA 1JEGA 4F7UA 3RKXA 5CKDA 1HSQA 1GXIE 4EIKA 3OS2A 4O5VA 1UNLD 2PK2A 3I55Q 5LJ3d 2MWOA 1W6XA 4HCKA 1Y07A 2JT4A 2L3SA 3VRYA 2DAQA 1CSKA 2JM9A 2QQBA 2HQHA 2G9XB 2BZ8A 1QP2A 3TW7A 1YITA 4LUEA 4F7UG 3A8HB 1O9KB 2W10A 4K11A 2AZVA 1ABQA 4FYWB 5IN1A 1PNJA 2DF6A 2KBTA 5KYXB 1X75C 4M7DE 3HFOA 2P0QA 4M7AD 5I11A 2X4JA 2QGFB 3GF5A 3ER0A 3WXMB 2QGSA 2C5NB 2H8HA 2LNVA 2FPEA 3TVTA 1DJ7B 2QTVA 4IUTA 1LJOA 1WXBA 2DTOA 1KC8U 1VQMT 3OW2P 4OF1A 2QQ8A 2DD5A 4M7AB 1VQPT 5IHKA 1X2KA 1KG1A 2RQRA 4CC2A 1SEMA 4C92F 1TG0A 3L1AA 1N8RC 2CJMB 5A0LA 1S1NA 2JS0A 3JCMf 2DVJA 3X25B 4MFEA 2K3BA 2M9UA 1E6HA 1ZHIA 3OA6A 5IHYA 2CKKA 2K3YA 4BY7X 2BS3A 2L5QA 3HZJA 1UG1A 1JKWA 1VQ8T 1NBEB 1U5SA 1X6GA 1JQQA 2V22B 3BG9A 3IQLA 2FZKB 1QCNA 3G6EQ 3QYBA 4ZN1A 2MYSA 3CCLT 2F1LA 5GAMf 2M51A 1VQ7T 3OBWA 3AT1B 5GANf 2F2WA 5AYFA 2YHTA 5BNJB 3JCMX 2CT3A 3LW5E 4PFPA 2XK0A 4Y91A 2M0OA 1N8RU 4M77E 3P8HA 2CP3A 3DLLA 1D09B 4AG1C 3CC7A 1ZA1B 4RMOA 4A53A 5C0MA 1GBQA 2CCIB 4M75A 3EAEA 2JOYA 2KR3A 4M78B 1UNHD 5CVIA 1VQKT 2CYZB 1WHHA 3CCQA 2IIMA 2V1RA 5GAN4 4RTYA 4AFSC 3M5AA 5D6YA 2F69A 2VV5A 3OSVA 4FT4A 1NM7A 3OYHA 4BI3A 1XQHA 1E7PA 3CC4T 2GBQA 1D3BB 1GL5A 3V7RA 5LJ5d 1WJQA 2RI2A 3EH1A 1QKWA 3QYEA 1R8OB 2E41A 5FROA 3TU4K 1WNLA 2KT1A 1B7TA 1KHCA 4M75G 4C5HA 5FU7C 5D7UA 2D8HA 1NPPA 2HBWA 3RDVA 4J9DA 1WI7A 1H25B 4IUVA 1PHTA 3FB9A 4KULA 5FWBA 2C5XB 1MMGA 4XU2A 5HQ0B 2WEVB 1JBMA 1NPRA 1KD1C 4KT0E 4XTXA 5FU6C 1KXUA 2FZCB 3B57A 1YIJA 3O5ZA 2EYYA 4LXCA 2RF0A 1N9SA 1B34B 2VYTA 4RG2A 4F7SB 4AKIA 1JSUB 4KH0B 3LGFA 2KMTA 4PJOE 5CEIB 2GCXA 1TUDA 4J9HA 3REBB 1P92A 4QSHA 5GANd 2LQNA 2UZEB 4I3ZB 3GPLA 3PGGA 2EQIA 1NG2A 3OS0A 1VQ9Q 2NUTA 2EQKA 1WYXA 3MP6A 5KCOA 1K8AU 3VYGB 4J6XA 2H3JA 2DO3A 3MCAB 3CCMQ 1K0SA 5LJ3h 3CD6A 1ZX6A 3MEWA 2HDAA 3F5XB 2OAWA 2HCKA 4NSTB 4TTHA 2QDLA 1M2VB 2XI9A 3VKGA 3CMAT 1X69A 2WSFE 2CP2A 1UHCA 2NUPA 1SG5A 2ZPHB 2LX9A 3DB3A 3CEYA 3TW6A 1YP5A 2Z0WA 3POMA 1Q81C 2MMPA 2E64A 2DETA 2KY9A 5DLOA 1VA7A 4OMLA 5D6WA 1ARKA 1Z9ZA 3MJXA 1UHFA 1T3LA 2PMIB 2RB6A 4WCIA 4HNTA 1U8RA 2EUFA 1EFNA 2EYXA 4E7JA 3VRZA 2EFIA 2DM1A 2MIOA 2ZPFB 3CXCS 2LT4A 2C0TA 1QW1A 1VQ5T 4II1A 4AMCA 1VQMA 4LD9K 1ZLMA 4C8QC 1K0XA 3RGFB 3Q1JA 3BLRB 4C92D 5I5ZB 4E7KA 4HVWA 4J9FA 2G3RA 1M1GA 1UTIA 2K2VA 3M0PA 2H3EB 4L6V5 1GFCA 1ZSGA 1BCMA 1QVPA 1NZ9A 3RERA 5GAMj 2JXBA 2LCCA 4IIMA 3M56A 4L59A 3HPWA 1RLPC 5GJVB 1PCXA 2XIDA 4CXAB 2HSPA 5GMKi 3DKMA 5IF1B 1I8FA 5GAN2 1VQ8A 4EOPB 3ZBDA 2VASA 3FJPA 3M53A 3CPFA 5GMKl 1VIEA 2V26A 4F7NB 2J06A 4PK4A 4LOCA 4CC7A 3CCLA 4M7DB 3VJPA 2QXFA 1VQ7A 2DILA 5IDPB 3I56Q 4HVUA 3H41A 1YJ9Q 3X28B 4BCJB 1YN8A 1QVGA 4LDXA 4A4KA 2OX7A 2KYMA 3FC3A 2JNGA 1NYGA 2VKNA 2MI6A 1VOLA 1Z9QA 2YWWA 2EYZA 3PMIA 4CFUB 4KGXB 2DMOA 3OW2A 2QASA 1ZUYA 1NLPC 3H8ZA 2A0FB 5CAIA 2BKDN 2DIQA 3RKWA 1MHNA 1Y7XA 2L2PA 1MMAA 5I2SA 3OYJA 2MPXC 1BU1A 2OTJT 5KYUA 3VS4A 2C06A 3V7CA 3ME9A 1UGQB 4HLQA 3NTIA 4J8OA 2ZZDB 3EHRA 3RKYA 3OYFA 4BACA 1WIEA 4XTVA 1KQ1A 2W9ZA 3CC4A 1GUXA 4HNUA 1FYNA 1RAHB 1QCFA 2LX7A 2LQWA 1Q86C 4BE2A 2BUDA 4OMNA 5FRMA 3QHSA 4M6VA 3CCMT 4J9GA 1WHGA 4KGVB 3RR6A 2WXVB 4E2FB 4CFXB 4JX6A 1FXXA 5LJ3e 5GAOm 3A8LB 1VQNQ 2COWA 3M57A 4II5B 4OGEA 3EG3A 4KGZB 3QJYA 4PKCC 4M7AC 3HRTA 2K6DA 5A0DA 1N5ZA 2HAXA 1QVFA 3QXEB 1I0CA 3TN8B 3G4SQ 2QAZA 4RTUA 2EGAA 2EBPA 2J05A 3CPWP 3CCEQ 5ICPB 2VWFA 1OIUB 2FZGB 5GAN3 4NC6A 1F1BB 2NYSA 1GRIA 4M77B 3FEOA 1BIAA 5C6SA 4N4HA 2RQTA 3A5ZB 2UUEB 4F7UE 3WVDB 1YI2Q 5GAMh 1UEBA 3KFVA 4CFWB 4C8QA 1HYOA 1XOVA 2RMOA 1RADB 1WQWA 4X9DA 2KXCA 2CH4A 5GANh 1NJIC 1TS9A 1YBYA 4RCBA 2DXTA 4IUPA 2COZA 5CKHA 2HD0A 4BE0A 3EG9A 3REAB 4J6WA 3PO3S 1I81A 1IB8A 1C1AA 5GAN6 4RTTA 1E7OA 1NYFA 4JRIA 4ROCA 1MV0B 4C8QG 3G33B 1P5EB 2O9SA 3TNWB 1G2BA 2ROLA 3PVLA 3CBOA 1PSEA 2AKKA 1U3OA 4M78F 1YJWT 4HXJA 5HBJB 3OMGA 2XDBA 2QQ9A 4CRIA 3D7SB 3P8DA 3CMAA 5A2QE 3RNJA 3OS1A 3DJBA 1XTDA 1G8XA 4PJOD 3EH2A 5CR2A 4GBQA 1GFDA 3CCQT 1FINB 2WJ9A 3THKA 4MDXA 4ZTFA 4V2SA 1KHIA 2B8AA 4FCYA 5LJ3f 1M1KC 2XDDA 2QEXQ 3EOCB 4TVRA 4OGCA 4PJOB 4HT9A 3EGDB 1K9MC 1WHLA 2CZ1B 4FSXA 4J9BA 2E5QA 4BXXX 3E2UA 4FW1A 3MHXA 2EJGA 3CCRT 2DVEA 4AG2C 3EHQA 2IVXA 2WIHB 2BIVA 5GAOq 3EFOA 2YUNA 2R5AA 2IW9B 4J7IA 4EMGA 3VUBA 2RHUA 2CGHA 3QYGB 1ZUKA 2XU8A 2P0PA 4M7AA 1H27B 3O0GD 1FMWA 1URCB 1N27A 1H3ZA 4BCOB 5CQYA 2MWPA 4DA4A 1Q82R 2IG0A 1M1FA 2HKNA 2IVWA 2VGNA 1G3NC 2PUKB 3GTMS 2OAUA 3L42A 4M7AG 1V29B 1FVVB 2GF7A 2KRMA 3GBQA 1OGUB 5GMKm 4L5GA 2OI3A 4MDWA 4XAXB 4F17A 1M8VA 1RI0A 1UJ0A 4BCMB 4JJCA 1JJ2A 2FPFA 2KGTA 1YHQQ 3CC2Q 5DM7R 1KJWA 1YI2T 2WMAB 2ECZA 4MZTA 3S3NA 1RAAB 3BFMA 2HZYA 3TEEA 4QVCA 5GAMe 1C6VX 4J9EA 1AISB 4JX5A 4Y28E 2DXBA 3RUXA 2EYWA 2JM8A 4N4IA 5GJWB 4JPBW 3MEVA 5GANe 1KC8C 1OPKA 2M0YA 3NFCA 4LDYA 2OTJA 4XTUA 1T3SA 3I5RA 3CCUQ 4GY5A 4BCFB 2QDJA 1SPKA 3JB9F 3QZ5B 1QCOA 1M3AA 2RJCA 1WGSA 1D3BA 2MAMA 3BHUB 1IXDA 3JCMJ 1PKDB 2X4YA 4J9CA 3CCMA 1J3TA 4J83A 2O9VA 2I53A 2G77A 1UNGD 3UDCA 1GBRA 1AWOA 5KYWB 4J6YA 1M2OA 3PFSA 3SD4A 5LJ5f 4AFUC 1G83A 4YOZA 1VQLQ 2DFUA 1GCQC 5HBHB 4BCPB 4EOSB 2DK3A 2CUBA 5IH2A 2DL5A 3AHUA 3WVEB 2JVVA 4HKEA 4JUVA 2GTOA 3VS7A 4FL6A 5CKFA 4C92C 1M5Q1 1UGRB 4XU0A 4UN0A 2KMGA 3H6ZA 1YJNT 1IRXA 4Z02A 1W70A 2DXCA 2R57A 2D1XA 2ZAEA 2RH2A 5LL6S 3MEAA 4MZMA 3S3OA 4AFQC 3DDQB 1BK2A 4M7DF 4BBRM 2E70A 2QK0A 2EKHA 3M0RA 1X43A 2DL3A 4XTZA 4Z8AA 3JCMQ 1UUEA 4OGRB 4BDYA 2HL3A 3TQ7P 4IUUA 1VQOT 2KSSA 4M78D 3SFMA 2DEUA 2A08A 4PJLA 1XO2A 4FYYB 4DOVA 1JXOA 3UA7A 1TUGB 3DB4A 5LJ3j 2LZ6B 3M03A 2YT6A 3NMZC 2LTOA 5CKBA 3PIOA 2K57A 1YJWA 3OY9A 1N4MA 1NE8A 5FRNA 1M2VA 3CPWA 1OIYB 4JJNK 1Y57A 4NS5A 4Q5WA 4RODA 5L8RE 4F7UB 3M54A 4FX3B 3OS5A 5KYYB 2YDLA 4F7JB 4CFVB 1S72Q 3L2VA 3OB9A 3CXCP 3BHVB 2KR6A 3A8GB 2IW8B 4OB2B 4NOYA 1D1AA 1OZ2A 3QZ9B 4AT1B 4A63B 1H4LD 1UJYA 1M90R 2PNIA 1IREB 2WSEE 2JMAA 3PE0A 1OX9A 1ACMB 2P4RA 1RLQC 2XD0A 1JU5C 5GAOl 3PNWC 2ENMA 4QVZA 2YRCA 1LNXA 2CSQA 2AK5A 4M77F 3G1JA 3I55T 3CCRA 2QA4Q 3UWNA 1WJSA 1AHJB 2O31A 4RTZA 1WLPB 2O88A 4OP0A 3OYBA 2JJ9A 2FG0A 2ZGWA 4C0DB 2W9FA 2DRKA 1M3CA 3TREA 1Y96A 1OPLA 1K8AC 1JRIA 4FW2A 4AFZC 4BB7A 5KH6A 2AKLA 3DDPB 2YSQA 2YUQA 5HKCA 4D8KA 1GCQA 1H1QB 1IO6A 3JCMP 1KQSS 3F70A 2DD5B 4C0ZA 2RHZA 4OMPA 3J80E 1YCYA 3OBYA 2HQXA 2KK4A 4X34A 2L8DA 2FEIA 4C92A 2EYQA 1AD6A 4F6UB 2F2CA 2DLPA 2KRNA 2SRCA 2E3HA 1UE9A 1PKSA 3PMTA 2UZDB 2L3PA 2LMJA 1QQJA 5FGKB 1H28B 2ZCFB 2FO0A 2X9HA 2LW4A 1OI1A 3C0CA 1FMKA 1AZEA 3OYNA 3I5SA 1IGUA 4HCZA 1YI2A 4RTWA 2KQWA 3HBLA 1OZ3A 1PD1A 4C92G 4QW2A 1K9AA 1D1BA 1YITQ 2VC8A 2EGCA 3MY1B 1TXQA 2K4YA 4QT7A 1SSFA 5HK3A 4VUBA 3M0TA 4WF2A 2MOXA 2RM4A 2CH4W 4DBHA 3NTHA 3JB9D 1K76A 1AEYA 1H1RB 4GLKA 3RBBB 4PJOC 4PJOF 4EOJB 3G6ET 5LJ5j 1Q82U 2XKOC 3L2QA 2K79A 2ZZDA 3EJ1B 1HK9A 2DERA 2QTXA 3OQ5A 1SHFA 4CC4B 1QMZB 1GH6B 1RABB 4JLGA 2GQVA 4BBSM 4XTWA 2B86A 2CREA 3HO8A 4ANJA 2CDTA 1ZSZB 2P0KA 1X2QA 1K1ZA 2OJ2A 3VS1A 3OYEA 3JB9J 2AT1B 3JCMg 4KBMB 3M0SA 4EONB 2FVUA 2XICA 4Z89A 2DRMA 4QQGA 1OKVB 4UC4A 1WFWA 3SWNC 2D0NA 2RHIA 1JOWA 1MUZA 1PRMC 2RNAA 3EFRA 1LOJA 3CCVQ 1YJNA 3VS5A 4KRCB 1K73R 3VS6A 2CP5A 1WHKA 4M7DD 2PJQA 3VYHB 1U1TA 1BI3A 5GANj 1WXUA 1I5LA 4X1VA 5FLXE 3X26B 4EMKC 5GAMg 2CP6A 2IN3A 2LC4A 2FRYA 3SEMA 4XTYA 2K9GA 3OYLA 3E1SA 2LP5A 4JRPA 1CKBA 1QLYA 4RTXA 2DBKA 4JZ4A 4OB1B 1TUCA 4CFUD
chains in the Genus database with same CATH topology
2JTMA 3P8DA 3CMAA 5A2QE 2EIFA 5IN1A 3UT1A 5J3BA 3OS1A 1XTDA 3JCMd 4PJOD 3A8MB 2D9TA 4X9CA 1X75C 5CR2A 1VQOA 1VQNA 2PQWA 4M7DE 3HFOA 3X20B 3CCQT 2P0QA 4HT8A 4M7AD 2WJ9A 2X4JA 5GMKe 3GF5A 4MDXA 3ER0A 3WXMB 1EIFA 3R6OA 4ZTFA 4V2SA 1QVGS 2LNVA 4DOWA 1KHIA 2B8AA 4Z6YA 1M4ZA 5M9OA 1DJ7B 4HA8A 3G4SA 4IUTA 5LJ3f 3C94A 1M1KC 1VQLT 1LJOA 2XDDA 4ZGEB 4C5IA 1Q82C 3CCVA 3V8KA 3HKSA 4TVRA 2DXCB 3ZFJA 3CCST 2QDYB 4OGCA 1G3SA 3URGA 3CCEA 2DTOA 2DIGA 2E1HA 1KC8U 3OW2S 1VQMT 4IUQA 3S3MA 4PJOB 4OF1A 4M7DA 4KUDK 4HT9A 2QQ8A 2DD5A 1K9MC 3OYYA 4M7AB 2RHYA 1VQPT 4J7FA 5GAMd 2CZ1B 2CZ7B 4FSXA 1JB0E 2E5QA 3GNFB 1KG1A 4NL2A 5LJ5h 4B9XA 1ZQ1A 2CS7A 2DD4A 3DL1A 3H4CA 3RMQA 4BY6C 4C92F 3EFSA 3L1AA 2OTLA 1N8RC 1FWZA 3MHXA 2QQAA 2EJGA 5A0LA 1VQ9T 4C0FA 1OYXA 4AI6A 3OYKA 3JCMf 2DVEA 2M1HA 3CCRT 3X25B 4MFEA 2AHJB 4O6JA 2M9UA 1ZHIA 2BIVA 3CCJA 3OA6A 2CKKA 4M75D 5GAOq 2K3YA 1H641 3I55T 3OYGA 2R5AA 4J7IA 4N0AC 4EMGA 3CC2A 3VUBA 2BS3A 2L5QA 2CGHA 3QYGB 1BIBA 2RHUA 3V7SA 3HZJA 2PUOB 3BDUA 2XU8A 2P0PA 4CI0C 1KD1U 4M7DG 2V8KA 1VQ8T 4M77D 4M7AA 1VQLA 3KBGA 3HL8A 3BG9A 4YTLA 2LDMA 4EMHA 2E6NA 1WQ7A 3CMEA 4PNOA 1VIFA 1U1SA 3QYBA 3I55A 1N27A 3PIPA 3LWIA 4ZN1A 5IAYA 3QUIA 1W2BS 2KDSA 3J7AF 1QVFS 3JCMb 1H3ZA 2E12A 3CCLT 5CQYA 4C8QE 5GAOr 4M75B 5I2MA 5GAMf 2MWPA 5LJ5g 4DA4A 3KUFA 3C4SA 4A4EA 1VQ7T 2IG0A 3OBWA 3DLMA 2LQKA 2RI3A 2NLUA 1M1FA 2IVWA 5GANf 1PSFA 2VGNA 2L89A 3C95A 5AYFA 2YHTA 3RESA 2JTFA 5HK0A 3MEUA 2O01E 2ZPIB 2PUKB 3JCMX 3L2RA 3LW5E 3HSBA 2FYKA 2XK0A 4Y91A 2M0OA 1N8RU 2OAUA 3L42A 4IKFA 1V29B 4M77E 2EKOA 1WJRA 4C5GA 3P8HA 3JCMc 3DLLA 2GF7A 3CC7A 2CZ6B 5GMKm 3GOXA 1I4K1 4L5GA 1QLBA 4RMOA 4A53A 5C0MA 4MDWA 4XAXB 4A4HA 1M8VA 2D6FA 4MZPA 1RI0A 4M75A 3EAEA 2JOYA 1JJ2A 4M78B 5CVIA 1VQKT 2E10A 3M58A 2CYZB 3OYDA 3CCQA 3SWNA 2RK2A 1JJ2S 3T9NA 5GAN4 4M7AC 4P5NA 1S72T 3VKIA 3M5AA 5D6YA 5DM7R 1YI2T 4M77A 3CXCA 3X24B 4MZTA 4PL6A 2F69A 2QEXA 2VV5A 3OSVA 3S3NA 1M90U 2VXFA 3BFMA 4FT4A 3G71T 2GFUA 3OYHA 4QQ6A 3TEEA 1XQHA 4BI3A 4RKUE 1E7PA 5GAMe 4QVCA 4FM4B 5KE2A 3CC4T 1VQ6T 1D3BB 3JCMW 3L2UA 3RUXA 4Y28E 4JX5A 4MMLA 2DXBA 3V7RA 3VV0A 3NTKA 4N4IA 4AKHA 1Y96B 3MEVA 5GANe 5LJ5d 4C8QF 1KC8C 1WJQA 2F5TX 2RI2A 2VUBA 4EMKA 3QDRB 2DKGA 3JRZA 3NFCA 4MFDA 4LDYA 3QYEA 4XTUA 2OTJA 1R8OB 2K5FA 1VQPA 2E41A 2RHXA 5FROA 1WNLA 3TU4K 1FKMA 2DPPB 3JCMV 1Q81U 1KHCA 4M75G 5CIUA 3KXTA 4C5HA 4HL4A 5FU7C 1G3YA 4GY5A 2QA4T 5GANg 2HQEA 4M78C 3CCVT 2QDJA 3JB9F 4M77G 1NPPA 2DTIA 4D6WA 4F7UF 3QZ5B 2XHCA 2RJCA 1WGSA 2A7YA 4IUVA 4C5EA 2V8IA 1D3BA 2FL7A 2MAMA 2EJFA 3FB9A 3VU3C 4KULA 4BY6B 3O8VA 3JCMJ 1TH7A 2X4YA 3CCMA 4C92B 4DQ2A 4J83A 4XU2A 4E7IA 2G77A 2QF7A 5GAOn 4M7AG 1JBMA 3UDCA 2RJDA 1NPRA 1KD1C 4BI4A 4KT0E 2E65A 1MGQA 3N5BB 4XTXA 3G6EA 4J6YA 5FU6C 3QG1A 3PFSA 3SD4A 1YIJA 2R5MA 2ZPEB 5LJ5f 2FHDA 1KQSA 2X35A 3RMSA 1N9SA 3I56T 1YJ9T 1G3WA 1B34B 2DK3A 3HFNA 3JSCA 4A4GA 4ME7A 2VYTA 4RG2A 3SB2A 2EWNA 4AKIA 2WSCE 1Q82U 1UB4A 3LGFA 2KMTA 3WVEB 2JVVA 4PLLA 4C0DC 3AHUA 4PJOE 4HKEA 4JUVA 4BUGA 4EPCA 2GCXA 4M7AE 4FL6A 2K5IA 5CKFA 1P92A 4QSHA 4C92C 5GANd 3VKHA 1M5Q1 5GAN8 4AKGA 1UGRB 4XU0A 3GPLA 2KMGA 3PGGA 1QP3A 3H6ZA 3E19A 1YJNT 4LDWA 4Z02A 3LLRA 4N0AA 2QQSA 3OS0A 2DXCA 2R57A 5GAOp 1YHQA 2EQKA 3MP6A 5KCOA 2DTHA 2RH2A 4XU3A 3GIBA 5LL6S 4E7HA 3J81E 1K8AU 1VQKA 3QYHB 3MEAA 4MZMA 4PJOA 3VYGB 4J6XA 3S3OA 2H3JA 2DO3A 3MCAB 4M7DF 5EG2A 4BBRM 5LJ3h 3SDZA 4ZGJB 4JX4A 2E70A 4MIMA 2FB7A 3BDLA 5A0GA 5LJ5e 3CD6A 3MEWA 1BYMA 1YITT 2LT1A 4C0GA 3HRSA 2WACA 4ATOA 1M90C 3BG3A 4XTZA 4HCCA 2XI9A 3VUZA 3JCMQ 3VKGA 3CMAT 4LD6A 2PU9B 2WSFE 3PT9A 4PJOC 3G7ZA 4BDYA 2PVDB 2ZPHB 1G5VA 3JB9I 5D6XA 4IUUA 2LX9A 3DB3A 3CCUA 3QIIA 1VQOT 4JRQA 1VQNT 3CEYA 2KSSA 4M78D 3TW6A 3SFMA 3V8JA 4M75E 3QSUA 2RA2A 3JAME 2L3RA 2VXEA 5GAN5 1Q81C 4DOVA 4PJOG 2MMPA 3DB4A 5LJ3j 3JCMh 2E64A 2GFAA 2HBPA 2LTOA 5CKBA 3PIOA 2K57A 3G4ST 4BDZA 3OY9A 1UGSB 1YJWA 4M7AF 2KY9A 5DLOA 1VQ4A 3RIRA 4QVDA 4OB3B 1NE8A 5D6WA 4E47A 3M4GA 5FRNA 1XNIA 3CCET 3CPWA 3LGLA 3LH0A 3INZA 5J39A 2RB6A 5FU7B 4ZTJA 2DXUA 4HNTA 4JJNK 1U8RA 3M4YA 4NS5A 4Q5WA 2EAYA 4E7JA 5L8RE 4F7UB 3OYAA 3M54A 3OS5A 3OYMA 2JZ2A 2EFIA 1RL2A 4M78E 2ZPFB 3L2VA 2LT4A 3OB9A 2RO0A 3L2WA 3KHIA 4JLIA 4BD3A 3CXCS 2OTLT 2VGMA 2KR6A 3A8GB 3CCSA 1QW1A 5DY9A 1Q86U 1VQ5T 4OB2B 4II1A 4NOYA 4ELYC 3PTAA 1OZ2A 3QZ9B 4A54A 3ZEHA 1VQMA 4LD9K 2O4XB 4C8QC 4HNVA 3FRNA 5IT9E 1IREB 2WSEE 3Q1JA 3BW1A 5FU6B 1VUBA 1BI2A 2DZCA 2A3LA 4LDUA 4C92D 4E7KA 4ELJA 3C12A 2G3RA 1O75A 5HY6A 3UPUA 4M78A 1M1GA 4M75F 2XD0A 1K73U 4IURA 3FDRA 5GAOl 2I2LA 2K2VA 1BI0A 4OB0B 3HRUA 3PNWC 3QO3A 4L6V5 3TCJA 4QVZA 3CMET 2RJEA 1LNXA 4M77F 1N9RA 1O9SA 5KCHA 3FIFA 3MP1A 4PLIA 1QVPA 2Y90A 1WJSA 4FT2A 1NZ9A 2KAFA 3UWNA 4HCBA 3RERA 1AHJB 5GAMj 2LCCA 3M56A 4OP0A 4J5YA 3OYBA 2ZGWA 4C0DB 4L59A 3HPWA 3TREA 1Y96A 2LRQA 2V8JA 2MF2A 2O4XA 2XIDA 4KUIA 5GMKi 1K8AC 1JRIA 2CZ0B 3DKMA 1I8FA 3A8OB 5GAN2 4R55A 5GMKh 1VQ8A 4BB7A 3ZBDA 5KH6A 4C92E 2X4WA 2DZ9A 4M78G 5DLQE 5HKCA 3FJPA 1W4SA 3M53A 3CPFA 3CC7T 2JN0A 2D0QB 5GMKl 3JCMP 1VIEA 1Y71A 1KQSS 1NJIU 4LOCA 1ZBXA 3F70A 5CO7A 3CCLA 4M7DB 4JRKA 3VJPA 2QXFA 2DD5B 4C0ZA 1VQ7A 2RHZA 3J80E 1YCYA 2EJ9A 3QJ6A 2YRVA 3OBYA 4RCCA 2HQXA 3META 2KK4A 2XDPA 3X28B 2Y4YA 4X34A 2DD4B 3BG5A 2L8DA 3CBPA 1X01A 4C92A 3L2ZA 2EYQA 4CRIA 5GAN7 2RD1A 4A4KA 4JS5A 1QVGA 4LDXA 2KVQG 2PVGB 4LDVA 3FC3A 2JNGA 5GMKj 2QEXT 2RK1A 2MI6A 3ASKA 3E9GA 4R56A 3PMIA 3M9QA 3PMTA 4QQDA 1N6AA 3M55A 3OW2A 2BS4A 4FIBA 2E6ZA 3LYIA 2LQ8A 3V8LA 2K5LA 3H8ZA 5CAIA 3P8BB 2ZCFB 3OYIA 2BKDN 2DIQA 3RKWA 1MHNA 1Y7XA 5I2SA 3OYJA 2LVMA 3CCRA 1OI1A 3S6WA 2R58A 2JUFA 2OTJT 1B34A 4N4GA 4M7DC 3OYNA 3MP8A 4JDSA 3V7CA 3M59A 4MMKA 3GP8A 3ME9A 1UGQB 4HLQA 3NTIA 4HCZA 1S72A 4NL3A 1YI2A 4J8OA 2ZZDB 1IZ6A 2KQWA 3RKYA 3HBLA 1OZ3A 2QQRA 4ELZC 3OYFA 4BACA 4C92G 1VQ9A 2C06A 4QW2A 3G71A 3JB9H 3HB9A 1HXDA 2M16A 4XTVA 4BE1A 4C8QD 1VQ6A 4ZGDB 1KQ1A 4XQ3A 2VC8A 3CC4A 1VQ5A 4HNUA 1Q86C 4BE2A 3LX7A 5EJCA 2K4YA 2BUDA 1SSFA 2EQJA 2EQMA 5I21A 2QI2A 4VUBA 4WF2A 5HK3A 4JS4A 2RM4A 3QHSA 4M6VA 3CCMT 5FRMA 1Q7YC 3NTHA 3QPHA 3JB9D 4JX6A 1FXXA 3E9FA 5LJ3e 3A8LB 1WPYA 4GLKA 1BKBA 3M57A 4PJOF 3VYGA 5GAOm 3G6ET 4XU1A 4OGEA 2QA4A 1K73C 1M1KU 3QJYA 2K3XA 4PKCC 5CQXA 5LJ5j 1BI1A 2XKOC 3HHTB 3HRTA 2ZZDA 4C8QB 5A0DA 5CCAA 3L2QA 1YIJT 1W2BA 2HAXA 1KQ2A 3QXEB 1QVFA 1HK9A 2QTXA 3OYCA 2LCLA 2XG8D 5LJ3g 2BS2A 3OQ5A 4RG8A 4A4FA 3CPWS 4JLGA 3SWNB 1K9MU 2GQVA 1X6OA 2PVOB 4BBSM 1M9SA 5GAN3 4NC6A 4E7LA 3GNGA 2HNIA 3QKJA 2EQUA 4XTWA 4M77B 2ZPBB 3MO8A 3HO8A 2RI5A 3FEOA 1BIAA 4EDUA 2P0KA 4OMFB 4N4HA 5CKEA 1UGPB 5C6SA 2YLBA 3A5ZB 3JCMe 3BY7A 4B9WA 2YLCA 2DJZA 4F7UE 3WVDB 2RJFA 4ZN3A 2DXBB 5GAMh 1UEBA 4C8QA 1FX7A 1XOVA 5CK9A 1WQWA 4X9DA 4EMKB 3OYEA 3JB9J 5GANh 3FLGA 3CCJT 1NJIC 3I56A 1YHQT 1YJ9A 1YBYA 4RCBA 2DXTA 3CC2T 4IUPA 1Q7YU 3JCMg 4KBMB 1G3TA 2Y4XA 3CBMA 2FVUA 4OVAA 4XK8E 5CKHA 2HD0A 2DEQA 2P4TA 4BE0A 2XICA 4J6WA 4M75C 4FU6A 4QQGA 3CD6T 4UC4A 1I81A 3SWNC 4F7UA 2RHIA 3RKXA 5GAN6 5CKDA 2F5KA 3EFRA 1LOJA 4M77C 3OSSC 4BI8B 5J26A 1YJNA 1GXIE 4JRIA 3HP9A 3OS2A 4O5VA 5LJ3d 2MWOA 3VYHB 4M7DD 1U1TA 4C8QG 2X4XA 3LWHA 1BI3A 1Y07A 5GANj 1I5LA 3CCUT 5FLXE 3X26B 2DAQA 2QFZA 4EMKC 5GAMg 3CBOA 1PSEA 2LC4A 2QQBA 4XTYA 3GLXA 1QP2A 3OYLA 3E1SA 3QBYA 4JRPA 3TW7A 2ZPGB 1YITA 4M78F 3OMCA 5KE3A 4OB1B 1YJWT 3JB9G 3QWLA 3OMGA 4F7UG 1VQ4T 2XDBA 3A8HB 2QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU E;  4FM4 B;  4Y28 E;  2DXB A;  1UGQ B;  3A8M B;  1UGS B;  2ZZD B;  3X20 B;  4OB3 B;  4ZGD B;  2DPP B;  1DJ7 B;  4ZGE B;  2DXC B;  5L8R E;  2QDY B;  3QZ5 B;  2ZPF B;  2DD5 A;  3A8L B;  3VYG A;  3A8G B;  2CZ1 B;  2CZ7 B;  4OB2 B;  3HHT B;  1JB0 E;  2ZZD A;  3QZ9 B;  3QXE B;  2DD4 A;  1IRE B;  2WSE E;  4KT0 E;  3X25 B;  2AHJ B;  2PVO B;  2ZPE B;  4OB0 B;  4L6V 5;  2ZPB B;  3QYG B;  2PUO B;  1UGP B;  1AHJ B;  3WVD B;  2DXB B;  2WSC E;  3WVE B;  2CZ0 B;  3A8O B;  1UGR B;  4XK8 E;  1QP3 A;  2DXC A;  1PSF A;  2D0Q B;  2O01 E;  2ZPI B;  2PUK B;  3QYH B;  3LW5 E;  2DD5 B;  3VYG B;  1GXI E;  1V29 B;  4ZGJ B;  3VYH B;  3X28 B;  2CZ6 B;  2DD4 B;  2PVG B;  3X26 B;  1PSE A;  2PU9 B;  2WSF E;  2CYZ B;  1QP2 A;  2ZPG B;  2PVD B;  2ZPH B;  4OB1 B;  2ZCF B;  3X24 B;  3A8H B; 
#chains in the Genus database with same CATH topology
 1PC0 A;  3CC7 Q;  2QGG A;  4EOL B;  1A0N B;  3A8M B;  2D9T A;  3BE3 A;  1VQO A;  3M0U A;  2PQW A;  3X20 B;  4HT8 A;  2FPD A;  1C0M A;  4Z6Y A;  1OV3 A;  1OUL A;  4HA8 A;  3VS2 A;  2VVK A;  3V8K A;  2GGR A;  1TSF A;  1F5Q B;  3HKS A;  2QDY B;  3URG A;  2DIG A;  2E1H A;  4IUQ A;  8ATC B;  3QHW B;  3EG1 A;  3S3M A;  4KUD K;  3SHW A;  3OYY A;  1D3U B;  1GCP A;  4J7F A;  4BCQ D;  2CZ7 B;  4F70 B;  5HVY B;  4D8D A;  5LJ5 h;  4B9X A;  1ZQ1 A;  2DD4 A;  3RMQ A;  3H4C A;  2K2M A;  2GQI A;  4Y92 A;  3EFS A;  1WHM A;  1FWZ A;  2QQA A;  1VQ9 T;  1RI9 A;  4C0F A;  1OYX A;  4AI6 A;  3OYK A;  4O6J A;  2NUP B;  4B6M A;  4G6L B;  2DJQ A;  1KQ2 A;  3CC2 A;  3OYG A;  5HNB B;  4BCQ B;  2V8K A;  4DBR A;  4M77 D;  2G6F X;  3KBG A;  3HL8 A;  4KRD B;  1WQ7 A;  2F2X A;  1VIF A;  1U1S A;  2ROT A;  3I55 A;  3LWI A;  5ACB A;  1W2B S;  3QUI A;  3J7A F;  2KDS A;  3JCM b;  1YIJ Q;  2JW4 A;  2E12 A;  1VIN A;  1QMC A;  3KUF A;  3C4S A;  4A4E A;  4DBQ A;  2LQK A;  2RI3 A;  2NLU A;  3C95 A;  3RES A;  2JTF A;  3MEU A;  1SRM A;  2O01 E;  2KI7 A;  5IHI A;  2BPM B;  4C5G A;  1WJR A;  2DL8 A;  3JCM c;  2DME A;  2KT8 A;  2CZ6 B;  3EGX A;  1I4K 1;  2OTL Q;  1IHV A;  1PD0 A;  1N8R R;  4MZP A;  2D6F A;  1AWW A;  4LN2 A;  3CCJ Q;  2E10 A;  3JV3 A;  3SWN A;  2RK2 A;  1JJ2 S;  3T9N A;  1AD5 A;  1CKA A;  2MCN A;  3MIA B;  4FYX B;  3CXC A;  3X24 B;  1AOJ A;  1RAG B;  4PL6 A;  1M90 U;  1YCS B;  4QQ6 A;  4RKU E;  3NGP A;  4FM4 B;  3CME Q;  4JJB A;  3NTK A;  4AKH A;  1ABO A;  4EMK A;  3QDR B;  2DKG A;  4MFD A;  2RHX A;  2HMA A;  4PFZ A;  1LPL A;  1FKM A;  5CIU A;  1OKW B;  3BHT B;  2KEA A;  1VYT A;  4M78 C;  3CCV T;  4PJJ A;  2FRW A;  2DTI A;  4D6W A;  3A98 A;  4F7U F;  1UGV A;  2XHC A;  2A7Y A;  2V8I A;  2FL7 A;  4BY6 B;  3EG2 A;  1R0C B;  1D1C A;  4E7I A;  1H92 A;  5GAO n;  2RJD A;  1XJW B;  3N5B B;  3G6E A;  4F6S B;  1AT1 B;  2C4G B;  5CYI B;  2FHD A;  2X35 A;  1O9K A;  5HBE B;  3I56 T;  1YJ9 T;  1G3W A;  3TNH B;  1TD6 A;  4EOO B;  3HFN A;  3JSC A;  1VQM Q;  2WSC E;  1Q95 G;  5KYX A;  4C0D C;  4PLL A;  4M4Z A;  1VQP Q;  1KSW A;  2K5I A;  3EG0 A;  3FJ5 A;  3VKH A;  2ABL A;  1GY3 B;  4Y72 B;  3E19 A;  4LDW A;  1OOT A;  2QQS A;  3QWX X;  4YOO A;  3GIB A;  3H0I A;  4F7L B;  2A36 A;  4EOI B;  3EID B;  3QYH B;  3HTR A;  4JX4 A;  3BDL A;  5A0G A;  2YRD A;  5LJ5 e;  1BYM A;  1SRL A;  1VQ8 Q;  2LT1 A;  3HRS A;  4R0K A;  4ATO A;  4OMQ A;  3H0F A;  1I5O B;  3BG3 A;  1KD1 R;  2NWM A;  3VUZ A;  2NUZ A;  2BTT A;  3PT9 A;  4YOS A;  1M8M A;  3CCL Q;  5D6X A;  1OEB A;  1PG5 B;  1KIK A;  1VQN T;  4JRQ A;  4BCM D;  3V8J A;  3QSU A;  4M75 E;  4F16 A;  2VXE A;  1M30 A;  2BZX A;  5I22 A;  2HBP A;  1LCK A;  3ZL7 C;  3G4S T;  1UGS B;  4YC3 B;  1EX4 A;  1RAE B;  1UEC A;  4QVD A;  4OB3 B;  1W1F A;  2C5V B;  3M4G A;  3CCE T;  1RAI B;  3INZ A;  2VB6 A;  1OX8 A;  4EC9 B;  2RQV A;  1JXM A;  2EAY A;  1VQK Q;  3OYM A;  2JZ2 A;  1RL2 A;  4DEX A;  1Y0M A;  1VOM A;  3UAT A;  3L2W A;  2OTL T;  4ORZ A;  3VS0 A;  4BD3 A;  1V76 A;  4ELY C;  2HSE B;  3PTA A;  1WZO A;  2WPA B;  3CC4 Q;  2K7A A;  2O4X B;  3FRN A;  5IT9 E;  5L23 A;  4RUG A;  1VUB A;  1BI2 A;  2HKQ B;  2A3L A;  4LDU A;  1BBZ A;  5HY6 A;  4M78 A;  4M75 F;  1K73 U;  4IUR A;  3FDR A;  3NPF A;  1BI0 A;  4OB0 B;  3HRU A;  2DYB A;  5KYY A;  3CME T;  1TTH B;  3K7A M;  5EFQ B;  1VQ9 A;  2DBM A;  1ZSZ C;  3FIF A;  1AVZ C;  2Y90 A;  3MP1 A;  5KCH A;  1Q81 R;  4HCB A;  2KRS A;  1VQ4 Q;  3NHN A;  4J5Y A;  3QWY A;  2LRQ A;  2V8J A;  4KUI A;  1WA7 A;  4KH1 B;  2CZ0 B;  1X6B A;  5GMK h;  1MNE A;  2LJ1 A;  1ENW A;  4C92 E;  4M78 G;  5DLQ E;  3MI9 B;  1W4S A;  2O2O A;  2DL4 A;  2JN0 A;  2D0Q B;  1BU2 A;  3MKD A;  1KQS P;  5CO7 A;  2J7I A;  3DOG B;  4JRK A;  2LNH B;  3CCS Q;  2EJ9 A;  2YRV A;  4RCC A;  4LNP A;  3MET A;  2XDP A;  5KYN A;  2DE0 X;  3L2Z A;  2V1Q A;  2RD1 A;  1PWT A;  2KVQ G;  2PVG B;  4LDV A;  1T0H A;  2QEX T;  1QVG P;  4ZNX A;  3E9G A;  4R56 A;  2BS4 A;  4FIB A;  3LYI A;  3EFO B;  3LH5 A;  3OYI A;  3BLH B;  2LVM A;  2R58 A;  2JUF A;  4ELL A;  1B34 A;  4N4G A;  4M7D C;  3GP8 A;  1RUW A;  3M59 A;  4J9I A;  4NL3 A;  2M02 A;  1IZ6 A;  4E7Z A;  3JB9 H;  1HXD A;  2M16 A;  2COY A;  4XQ3 A;  2BZY A;  4BCN D;  3LX7 A;  2EQJ A;  3CMA Q;  4JS4 A;  4EOM B;  3QPH A;  1TFB A;  1IGQ A;  1QKX A;  3QHR B;  3VYG A;  1D0Z A;  4XU1 A;  2B9R A;  2X3W D;  5CQX A;  1OL1 B;  3CCV A;  1BI1 A;  2ESW A;  2PZ1 A;  3TNI B;  2EGE A;  1QVF P;  4BCN B;  5LJ3 g;  4RG8 A;  2BKZ B;  4A4F A;  1M9S A;  4E7L A;  2HNI A;  2EQU A;  5AT1 B;  2ZPB B;  2LJ3 A;  2RI5 A;  4EDU A;  2YXY A;  8AT1 B;  5CKE A;  2YLB A;  4FSS A;  4B9W A;  1B3Q A;  2JTE A;  2QG9 B;  2DXB B;  2D8J A;  2IPO B;  1FX7 A;  3G71 Q;  1VQ6 Q;  3FLG A;  1VQ5 Q;  3I56 A;  1YHQ T;  1YJ9 A;  4CRL B;  3CC2 T;  2Y4X A;  2DX1 A;  1H24 B;  1Q86 R;  1RAF B;  5IHN A;  1IHW A;  2RN8 A;  1ZSZ A;  4BCK B;  2F5K A;  2I40 B;  4M77 C;  3OSS C;  1C9B A;  4BI8 B;  2PHG A;  5J26 A;  3HP9 A;  1AZG B;  2KXD A;  1PKT A;  1TOV A;  2CP0 A;  2X4X A;  3LWH A;  4OMO A;  3PVQ A;  3CCU T;  2QFZ A;  4PJM A;  3GLX A;  3QBY A;  4CFN B;  5HCK A;  2ZPG B;  1RAC B;  2HEQ A;  3OMC A;  5KE3 A;  3JB9 G;  3QWL A;  1E9H B;  1H1P B;  2DL7 A;  1VQ4 T;  5CK9 A;  4HVV A;  2JTM A;  2MK5 A;  4ESR A;  4F6W B;  2EIF A;  4F04 B;  2UZB B;  3UT1 A;  5J3B A;  1R0B G;  3JCM d;  4X9C A;  2KNB B;  1VQN A;  2BE7 D;  1NJI R;  4QKU A;  5GMK e;  2LCS A;  2ED0 A;  1NLO C;  1EIF A;  3R6O A;  1QVG S;  4DOW A;  5M9O A;  1M4Z A;  1SSH A;  4LUD A;  3G4S A;  1VQL T;  3C94 A;  1Q82 C;  4ZGE B;  4C5I A;  1HD3 A;  2W2H A;  2DXC B;  3ZFJ A;  3CCS T;  1MND A;  1G3S A;  3CCE A;  2CUD A;  1JST B;  1VYV A;  3QDF A;  3OW2 S;  4F14 A;  4M7D A;  4BY1 X;  2RHY A;  5L2W B;  2C0I A;  3U23 A;  5GAM d;  2PK9 B;  1JB0 E;  2OTJ Q;  3GNF B;  4JZ3 A;  4NL2 A;  4BY6 C;  2CS7 A;  3DL1 A;  1R77 A;  3TSZ A;  2OTL A;  2W96 A;  4EOQ B;  2M1H A;  5IXF A;  1MMD A;  2AHJ B;  2R7G A;  3CCJ A;  4M75 D;  1H64 1;  4N0A C;  1I07 A;  3V7S A;  3ULR B;  1BIB A;  2X51 A;  2PUO B;  3BDU A;  4CI0 C;  4OMM A;  1KD1 U;  4BCH B;  4M7D G;  6AT1 B;  4YTL A;  2LDM A;  4EMH A;  2E6N A;  2C5O B;  3CME A;  2E5K A;  4PNO A;  3PIP A;  5IAY A;  1W2B P;  1QVF S;  2L3Q A;  2RQU A;  1FMV A;  1H3H A;  4C8Q E;  5GAO r;  1M1K R;  4M75 B;  5I2M A;  3NDQ A;  5LJ5 g;  2LJ0 A;  1M27 C;  3DLM A;  3MPU B;  3H0H A;  1PSF A;  1YWP A;  2L89 A;  2JGZ B;  1TWB A;  2ZPI B;  3L2R A;  5LMK B;  3HSB A;  2FYK A;  2WIP B;  1K9M R;  1AWJ A;  4IKF A;  2EKO A;  1H1S B;  3GOX A;  1U06 A;  1QLB A;  4A4H A;  2A37 A;  2WMB B;  2CT4 A;  2KRO A;  3M58 A;  3OYD A;  1JJ2 P;  4P5N A;  1S72 T;  3VKI A;  4M77 A;  2QEX A;  1Q7Y R;  2A28 A;  2VXF A;  3G71 T;  2GFU A;  4BCI B;  5KE2 A;  1VQ6 T;  3JCM W;  3L2U A;  4MML A;  3VV0 A;  1Y96 B;  4PJN A;  4C8Q F;  2F5T X;  2VUB A;  2X1N B;  1KK7 A;  3JRZ A;  2K5F A;  1VQP A;  2DPP B;  3JCM V;  1Q81 U;  3KXT A;  4HL4 A;  1G3Y A;  2SEM A;  2CP7 A;  2QA4 T;  5GAN g;  2HQE A;  4EC8 B;  2RPN A;  4M77 G;  2CCH B;  1YJW Q;  4C5E A;  4DBF A;  2EJF A;  3VU3 C;  3O8V A;  1TH7 A;  4C92 B;  4DQ2 A;  2QF7 A;  3UF4 A;  2PTK A;  2F2V A;  4BI4 A;  2E65 A;  1MGQ A;  3CCQ Q;  1WXT A;  3QG1 A;  2W0Z A;  2R5M A;  2ZPE B;  1H26 B;  5FWC A;  1KQS A;  2NUT B;  3RMS A;  2E4H A;  5LQF B;  1PM3 A;  4ME7 A;  4A4G A;  1UDL A;  3SB2 A;  2EWN A;  2HL5 C;  1TU0 B;  1UB4 A;  1KC8 R;  1OU9 A;  4BUG A;  4EPC A;  4M7A E;  5GAN 8;  1EZZ B;  4AKG A;  5FW9 A;  1QP3 A;  1SF9 A;  3LLR A;  4N0A A;  3CCR Q;  5IDN B;  5GAO p;  1YHQ A;  2DTH A;  4XU3 A;  4E7H A;  3J81 E;  1NEG A;  1VQK A;  4PJO A;  1M3B A;  4EOR B;  3EGD A;  5EG2 A;  3SDZ A;  4ZGJ B;  2FB7 A;  3EGU A;  4MIM A;  1SHG A;  2KE9 A;  2YUO A;  1YIT T;  4C0G A;  5IXB A;  2WAC A;  1M90 C;  4HCC A;  2RQW A;  2C0O A;  4LD6 A;  2PU9 B;  3G7Z A;  2PVD B;  1G5V A;  3JB9 I;  3CCU A;  3QII A;  1QWF A;  2RA2 A;  3JAM E;  2L3R A;  4WTO B;  5GAN 5;  2J6K A;  4PJO G;  2GNC A;  3JCM h;  2L0A A;  1YNZ A;  1AWX A;  2GFA A;  3CQT A;  4BDZ A;  4M7A F;  2EVR A;  1VQ4 A;  3RIR A;  4E47 A;  1XNI A;  3H9N A;  4GLM A;  1BCO A;  3LGL A;  3LH0 A;  5J39 A;  5FU7 B;  4ZTJ A;  1X27 A;  4EOK B;  2DXU A;  2IW6 B;  3M4Y A;  3OYA A;  4M78 E;  2P84 A;  1VQL A;  3BLQ B;  3CD6 Q;  2RO0 A;  5EC7 A;  1W98 B;  3KHI A;  4JLI A;  2VGM A;  3CCS A;  5DY9 A;  1Q86 U;  3MY5 B;  4Z88 A;  4A54 A;  1D0X A;  3ZEH A;  4HNV A;  3BW1 A;  5FU6 B;  2DZC A;  4OR5 B;  4ELJ A;  3C12 A;  2KYB A;  3UPU A;  1BB9 A;  1O75 A;  2I2L A;  3TCJ A;  2DA9 A;  3QO3 A;  4JJD A;  2RJE A;  1VYW B;  1N9R A;  1O9S A;  5HK0 A;  4PLI A;  4FT2 A;  2KAF A;  1SKU B;  1V1C A;  2CSI A;  1OU8 A;  1WDX A;  2MF2 A;  2O4X A;  2I0N A;  1KFZ A;  3A8O B;  4R55 A;  2EW3 A;  3TSW A;  2X4W A;  2DNU A;  2DZ9 A;  2ED1 A;  2ATC B;  1OI9 B;  3CC7 T;  1Y71 A;  3I9Q A;  1NJI U;  1ZBX A;  3VS3 A;  5KYU B;  4ROE A;  4RTV A;  1ZA2 B;  2WFY B;  2J6F A;  3QJ6 A;  4IIO A;  5DQW A;  2Y4Y A;  2DD4 B;  3BG5 A;  3CBP A;  5GAN 7;  1X01 A;  1YWO A;  1HJD A;  1ZUU A;  4JS5 A;  5GMK j;  4FYV B;  2RK1 A;  1NEB A;  1GUX B;  1K4U S;  3ASK A;  5KYW A;  1VYU A;  1MMN A;  3UA6 A;  3M9Q A;  4QQD A;  1JO8 A;  1B07 A;  1N6A A;  3M55 A;  4LE9 A;  2E6Z A;  2LQ8 A;  3V8L A;  2GTJ A;  2K5L A;  3P8B B;  3I35 A;  1YJN Q;  2WHB B;  1MV3 A;  3S6W A;  2J6O A;  2JMC A;  4PFO A;  1QWE A;  3MP8 A;  4JDS A;  4MMK A;  1S72 A;  4KRT A;  4ELZ C;  2QQR A;  2E3I A;  2AIR B;  3G71 A;  1K8A R;  3HB9 A;  4BE1 A;  4C8Q D;  1LVK A;  1VQ6 A;  4ZGD B;  1VQ5 A;  4CC3 A;  4E7S A;  5EJC A;  4CFM B;  2W99 A;  2EQM A;  1ZBJ A;  2QI2 A;  5I21 A;  1D0Y A;  3R6N A;  1Q7Y C;  1VQ7 Q;  3LQ5 B;  5ECA A;  1PRL C;  1UFF A;  2AZS A;  2C6T B;  1VQO Q;  3E9F A;  1WPY A;  1BKB A;  2X3X D;  1K73 C;  2QA4 A;  1M1K U;  1WX6 A;  2K3X A;  3EGX B;  3HHT B;  4C8Q B;  5CCA A;  1YIJ T;  1W2B A;  1ZP2 A;  3DTO A;  2EPD A;  2LCL A;  3OYC A;  5DQV A;  2DYI A;  2XG8 D;  2BS2 A;  4BCG B;  3CPW S;  3SWN B;  1K9M U;  1X6O A;  2PVO B;  3EG9 B;  1WHJ A;  3GNG A;  3QKJ A;  3MO8 A;  2JS2 A;  4IMY B;  4OMF B;  1UGP B;  1T0J A;  9ATC B;  3JCM e;  2YUP A;  3BY7 A;  2YLC A;  2DJZ A;  1OQK A;  2RJF A;  4ZN3 A;  2XMF A;  1YFN A;  4EMK B;  7AT1 B;  3M0Q A;  2UZL B;  2QYZ A;  3CCJ T;  1Q7Y U;  1G3T A;  1E6G A;  2BE9 B;  3CBM A;  4OVA A;  4XK8 E;  4DEY A;  1OL2 B;  2DEQ A;  2P4T A;  4M75 C;  1H8K A;  1I1J A;  4FU6 A;  3CD6 T;  3A1P A;  4E6R A;  1JEG A;  4F7U A;  3RKX A;  5CKD A;  1HSQ A;  1GXI E;  4EIK A;  3OS2 A;  4O5V A;  1UNL D;  2PK2 A;  3I55 Q;  5LJ3 d;  2MWO A;  1W6X A;  4HCK A;  1Y07 A;  2JT4 A;  2L3S A;  3VRY A;  2DAQ A;  1CSK A;  2JM9 A;  2QQB A;  2HQH A;  2G9X B;  2BZ8 A;  1QP2 A;  3TW7 A;  1YIT A;  4LUE A;  4F7U G;  3A8H B;  1O9K B;  2W10 A;  4K11 A;  2AZV A;  1ABQ A;  4FYW B;  5IN1 A;  1PNJ A;  2DF6 A;  2KBT A;  5KYX B;  1X75 C;  4M7D E;  3HFO A;  2P0Q A;  4M7A D;  5I11 A;  2X4J A;  2QGF B;  3GF5 A;  3ER0 A;  3WXM B;  2QGS A;  2C5N B;  2H8H A;  2LNV A;  2FPE A;  3TVT A;  1DJ7 B;  2QTV A;  4IUT A;  1LJO A;  1WXB A;  2DTO A;  1KC8 U;  1VQM T;  3OW2 P;  4OF1 A;  2QQ8 A;  2DD5 A;  4M7A B;  1VQP T;  5IHK A;  1X2K A;  1KG1 A;  2RQR A;  4CC2 A;  1SEM A;  4C92 F;  1TG0 A;  3L1A A;  1N8R C;  2CJM B;  5A0L A;  1S1N A;  2JS0 A;  3JCM f;  2DVJ A;  3X25 B;  4MFE A;  2K3B A;  2M9U A;  1E6H A;  1ZHI A;  3OA6 A;  5IHY A;  2CKK A;  2K3Y A;  4BY7 X;  2BS3 A;  2L5Q A;  3HZJ A;  1UG1 A;  1JKW A;  1VQ8 T;  1NBE B;  1U5S A;  1X6G A;  1JQQ A;  2V22 B;  3BG9 A;  3IQL A;  2FZK B;  1QCN A;  3G6E Q;  3QYB A;  4ZN1 A;  2MYS A;  3CCL T;  2F1L A;  5GAM f;  2M51 A;  1VQ7 T;  3OBW A;  3AT1 B;  5GAN f;  2F2W A;  5AYF A;  2YHT A;  5BNJ B;  3JCM X;  2CT3 A;  3LW5 E;  4PFP A;  2XK0 A;  4Y91 A;  2M0O A;  1N8R U;  4M77 E;  3P8H A;  2CP3 A;  3DLL A;  1D09 B;  4AG1 C;  3CC7 A;  1ZA1 B;  4RMO A;  4A53 A;  5C0M A;  1GBQ A;  2CCI B;  4M75 A;  3EAE A;  2JOY A;  2KR3 A;  4M78 B;  1UNH D;  5CVI A;  1VQK T;  2CYZ B;  1WHH A;  3CCQ A;  2IIM A;  2V1R A;  5GAN 4;  4RTY A;  4AFS C;  3M5A A;  5D6Y A;  2F69 A;  2VV5 A;  3OSV A;  4FT4 A;  1NM7 A;  3OYH A;  4BI3 A;  1XQH A;  1E7P A;  3CC4 T;  2GBQ A;  1D3B B;  1GL5 A;  3V7R A;  5LJ5 d;  1WJQ A;  2RI2 A;  3EH1 A;  1QKW A;  3QYE A;  1R8O B;  2E41 A;  5FRO A;  3TU4 K;  1WNL A;  2KT1 A;  1B7T A;  1KHC A;  4M75 G;  4C5H A;  5FU7 C;  5D7U A;  2D8H A;  1NPP A;  2HBW A;  3RDV A;  4J9D A;  1WI7 A;  1H25 B;  4IUV A;  1PHT A;  3FB9 A;  4KUL A;  5FWB A;  2C5X B;  1MMG A;  4XU2 A;  5HQ0 B;  2WEV B;  1JBM A;  1NPR A;  1KD1 C;  4KT0 E;  4XTX A;  5FU6 C;  1KXU A;  2FZC B;  3B57 A;  1YIJ A;  3O5Z A;  2EYY A;  4LXC A;  2RF0 A;  1N9S A;  1B34 B;  2VYT A;  4RG2 A;  4F7S B;  4AKI A;  1JSU B;  4KH0 B;  3LGF A;  2KMT A;  4PJO E;  5CEI B;  2GCX A;  1TUD A;  4J9H A;  3REB B;  1P92 A;  4QSH A;  5GAN d;  2LQN A;  2UZE B;  4I3Z B;  3GPL A;  3PGG A;  2EQI A;  1NG2 A;  3OS0 A;  1VQ9 Q;  2NUT A;  2EQK A;  1WYX A;  3MP6 A;  5KCO A;  1K8A U;  3VYG B;  4J6X A;  2H3J A;  2DO3 A;  3MCA B;  3CCM Q;  1K0S A;  5LJ3 h;  3CD6 A;  1ZX6 A;  3MEW A;  2HDA A;  3F5X B;  2OAW A;  2HCK A;  4NST B;  4TTH A;  2QDL A;  1M2V B;  2XI9 A;  3VKG A;  3CMA T;  1X69 A;  2WSF E;  2CP2 A;  1UHC A;  2NUP A;  1SG5 A;  2ZPH B;  2LX9 A;  3DB3 A;  3CEY A;  3TW6 A;  1YP5 A;  2Z0W A;  3POM A;  1Q81 C;  2MMP A;  2E64 A;  2DET A;  2KY9 A;  5DLO A;  1VA7 A;  4OML A;  5D6W A;  1ARK A;  1Z9Z A;  3MJX A;  1UHF A;  1T3L A;  2PMI B;  2RB6 A;  4WCI A;  4HNT A;  1U8R A;  2EUF A;  1EFN A;  2EYX A;  4E7J A;  3VRZ A;  2EFI A;  2DM1 A;  2MIO A;  2ZPF B;  3CXC S;  2LT4 A;  2C0T A;  1QW1 A;  1VQ5 T;  4II1 A;  4AMC A;  1VQM A;  4LD9 K;  1ZLM A;  4C8Q C;  1K0X A;  3RGF B;  3Q1J A;  3BLR B;  4C92 D;  5I5Z B;  4E7K A;  4HVW A;  4J9F A;  2G3R A;  1M1G A;  1UTI A;  2K2V A;  3M0P A;  2H3E B;  4L6V 5;  1GFC A;  1ZSG A;  1BCM A;  1QVP A;  1NZ9 A;  3RER A;  5GAM j;  2JXB A;  2LCC A;  4IIM A;  3M56 A;  4L59 A;  3HPW A;  1RLP C;  5GJV B;  1PCX A;  2XID A;  4CXA B;  2HSP A;  5GMK i;  3DKM A;  5IF1 B;  1I8F A;  5GAN 2;  1VQ8 A;  4EOP B;  3ZBD A;  2VAS A;  3FJP A;  3M53 A;  3CPF A;  5GMK l;  1VIE A;  2V26 A;  4F7N B;  2J06 A;  4PK4 A;  4LOC A;  4CC7 A;  3CCL A;  4M7D B;  3VJP A;  2QXF A;  1VQ7 A;  2DIL A;  5IDP B;  3I56 Q;  4HVU A;  3H41 A;  1YJ9 Q;  3X28 B;  4BCJ B;  1YN8 A;  1QVG A;  4LDX A;  4A4K A;  2OX7 A;  2KYM A;  3FC3 A;  2JNG A;  1NYG A;  2VKN A;  2MI6 A;  1VOL A;  1Z9Q A;  2YWW A;  2EYZ A;  3PMI A;  4CFU B;  4KGX B;  2DMO A;  3OW2 A;  2QAS A;  1ZUY A;  1NLP C;  3H8Z A;  2A0F B;  5CAI A;  2BKD N;  2DIQ A;  3RKW A;  1MHN A;  1Y7X A;  2L2P A;  1MMA A;  5I2S A;  3OYJ A;  2MPX C;  1BU1 A;  2OTJ T;  5KYU A;  3VS4 A;  2C06 A;  3V7C A;  3ME9 A;  1UGQ B;  4HLQ A;  3NTI A;  4J8O A;  2ZZD B;  3EHR A;  3RKY A;  3OYF A;  4BAC A;  1WIE A;  4XTV A;  1KQ1 A;  2W9Z A;  3CC4 A;  1GUX A;  4HNU A;  1FYN A;  1RAH B;  1QCF A;  2LX7 A;  2LQW A;  1Q86 C;  4BE2 A;  2BUD A;  4OMN A;  5FRM A;  3QHS A;  4M6V A;  3CCM T;  4J9G A;  1WHG A;  4KGV B;  3RR6 A;  2WXV B;  4E2F B;  4CFX B;  4JX6 A;  1FXX A;  5LJ3 e;  5GAO m;  3A8L B;  1VQN Q;  2COW A;  3M57 A;  4II5 B;  4OGE A;  3EG3 A;  4KGZ B;  3QJY A;  4PKC C;  4M7A C;  3HRT A;  2K6D A;  5A0D A;  1N5Z A;  2HAX A;  1QVF A;  3QXE B;  1I0C A;  3TN8 B;  3G4S Q;  2QAZ A;  4RTU A;  2EGA A;  2EBP A;  2J05 A;  3CPW P;  3CCE Q;  5ICP B;  2VWF A;  1OIU B;  2FZG B;  5GAN 3;  4NC6 A;  1F1B B;  2NYS A;  1GRI A;  4M77 B;  3FEO A;  1BIA A;  5C6S A;  4N4H A;  2RQT A;  3A5Z B;  2UUE B;  4F7U E;  3WVD B;  1YI2 Q;  5GAM h;  1UEB A;  3KFV A;  4CFW B;  4C8Q A;  1HYO A;  1XOV A;  2RMO A;  1RAD B;  1WQW A;  4X9D A;  2KXC A;  2CH4 A;  5GAN h;  1NJI C;  1TS9 A;  1YBY A;  4RCB A;  2DXT A;  4IUP A;  2COZ A;  5CKH A;  2HD0 A;  4BE0 A;  3EG9 A;  3REA B;  4J6W A;  3PO3 S;  1I81 A;  1IB8 A;  1C1A A;  5GAN 6;  4RTT A;  1E7O A;  1NYF A;  4JRI A;  4ROC A;  1MV0 B;  4C8Q G;  3G33 B;  1P5E B;  2O9S A;  3TNW B;  1G2B A;  2ROL A;  3PVL A;  3CBO A;  1PSE A;  2AKK A;  1U3O A;  4M78 F;  1YJW T;  4HXJ A;  5HBJ B;  3OMG A;  2XDB A;  2QQ9 A;  4CRI A;  3D7S B;  3P8D A;  3CMA A;  5A2Q E;  3RNJ A;  3OS1 A;  3DJB A;  1XTD A;  1G8X A;  4PJO D;  3EH2 A;  5CR2 A;  4GBQ A;  1GFD A;  3CCQ T;  1FIN B;  2WJ9 A;  3THK A;  4MDX A;  4ZTF A;  4V2S A;  1KHI A;  2B8A A;  4FCY A;  5LJ3 f;  1M1K C;  2XDD A;  2QEX Q;  3EOC B;  4TVR A;  4OGC A;  4PJO B;  4HT9 A;  3EGD B;  1K9M C;  1WHL A;  2CZ1 B;  4FSX A;  4J9B A;  2E5Q A;  4BXX X;  3E2U A;  4FW1 A;  3MHX A;  2EJG A;  3CCR T;  2DVE A;  4AG2 C;  3EHQ A;  2IVX A;  2WIH B;  2BIV A;  5GAO q;  3EFO A;  2YUN A;  2R5A A;  2IW9 B;  4J7I A;  4EMG A;  3VUB A;  2RHU A;  2CGH A;  3QYG B;  1ZUK A;  2XU8 A;  2P0P A;  4M7A A;  1H27 B;  3O0G D;  1FMW A;  1URC B;  1N27 A;  1H3Z A;  4BCO B;  5CQY A;  2MWP A;  4DA4 A;  1Q82 R;  2IG0 A;  1M1F A;  2HKN A;  2IVW A;  2VGN A;  1G3N C;  2PUK B;  3GTM S;  2OAU A;  3L42 A;  4M7A G;  1V29 B;  1FVV B;  2GF7 A;  2KRM A;  3GBQ A;  1OGU B;  5GMK m;  4L5G A;  2OI3 A;  4MDW A;  4XAX B;  4F17 A;  1M8V A;  1RI0 A;  1UJ0 A;  4BCM B;  4JJC A;  1JJ2 A;  2FPF A;  2KGT A;  1YHQ Q;  3CC2 Q;  5DM7 R;  1KJW A;  1YI2 T;  2WMA B;  2ECZ A;  4MZT A;  3S3N A;  1RAA B;  3BFM A;  2HZY A;  3TEE A;  4QVC A;  5GAM e;  1C6V X;  4J9E A;  1AIS B;  4JX5 A;  4Y28 E;  2DXB A;  3RUX A;  2EYW A;  2JM8 A;  4N4I A;  5GJW B;  4JPB W;  3MEV A;  5GAN e;  1KC8 C;  1OPK A;  2M0Y A;  3NFC A;  4LDY A;  2OTJ A;  4XTU A;  1T3S A;  3I5R A;  3CCU Q;  4GY5 A;  4BCF B;  2QDJ A;  1SPK A;  3JB9 F;  3QZ5 B;  1QCO A;  1M3A A;  2RJC A;  1WGS A;  1D3B A;  2MAM A;  3BHU B;  1IXD A;  3JCM J;  1PKD B;  2X4Y A;  4J9C A;  3CCM A;  1J3T A;  4J83 A;  2O9V A;  2I53 A;  2G77 A;  1UNG D;  3UDC A;  1GBR A;  1AWO A;  5KYW B;  4J6Y A;  1M2O A;  3PFS A;  3SD4 A;  5LJ5 f;  4AFU C;  1G83 A;  4YOZ A;  1VQL Q;  2DFU A;  1GCQ C;  5HBH B;  4BCP B;  4EOS B;  2DK3 A;  2CUB A;  5IH2 A;  2DL5 A;  3AHU A;  3WVE B;  2JVV A;  4HKE A;  4JUV A;  2GTO A;  3VS7 A;  4FL6 A;  5CKF A;  4C92 C;  1M5Q 1;  1UGR B;  4XU0 A;  4UN0 A;  2KMG A;  3H6Z A;  1YJN T;  1IRX A;  4Z02 A;  1W70 A;  2DXC A;  2R57 A;  2D1X A;  2ZAE A;  2RH2 A;  5LL6 S;  3MEA A;  4MZM A;  3S3O A;  4AFQ C;  3DDQ B;  1BK2 A;  4M7D F;  4BBR M;  2E70 A;  2QK0 A;  2EKH A;  3M0R A;  1X43 A;  2DL3 A;  4XTZ A;  4Z8A A;  3JCM Q;  1UUE A;  4OGR B;  4BDY A;  2HL3 A;  3TQ7 P;  4IUU A;  1VQO T;  2KSS A;  4M78 D;  3SFM A;  2DEU A;  2A08 A;  4PJL A;  1XO2 A;  4FYY B;  4DOV A;  1JXO A;  3UA7 A;  1TUG B;  3DB4 A;  5LJ3 j;  2LZ6 B;  3M03 A;  2YT6 A;  3NMZ C;  2LTO A;  5CKB A;  3PIO A;  2K57 A;  1YJW A;  3OY9 A;  1N4M A;  1NE8 A;  5FRN A;  1M2V A;  3CPW A;  1OIY B;  4JJN K;  1Y57 A;  4NS5 A;  4Q5W A;  4ROD A;  5L8R E;  4F7U B;  3M54 A;  4FX3 B;  3OS5 A;  5KYY B;  2YDL A;  4F7J B;  4CFV B;  1S72 Q;  3L2V A;  3OB9 A;  3CXC P;  3BHV B;  2KR6 A;  3A8G B;  2IW8 B;  4OB2 B;  4NOY A;  1D1A A;  1OZ2 A;  3QZ9 B;  4AT1 B;  4A63 B;  1H4L D;  1UJY A;  1M90 R;  2PNI A;  1IRE B;  2WSE E;  2JMA A;  3PE0 A;  1OX9 A;  1ACM B;  2P4R A;  1RLQ C;  2XD0 A;  1JU5 C;  5GAO l;  3PNW C;  2ENM A;  4QVZ A;  2YRC A;  1LNX A;  2CSQ A;  2AK5 A;  4M77 F;  3G1J A;  3I55 T;  3CCR A;  2QA4 Q;  3UWN A;  1WJS A;  1AHJ B;  2O31 A;  4RTZ A;  1WLP B;  2O88 A;  4OP0 A;  3OYB A;  2JJ9 A;  2FG0 A;  2ZGW A;  4C0D B;  2W9F A;  2DRK A;  1M3C A;  3TRE A;  1Y96 A;  1OPL A;  1K8A C;  1JRI A;  4FW2 A;  4AFZ C;  4BB7 A;  5KH6 A;  2AKL A;  3DDP B;  2YSQ A;  2YUQ A;  5HKC A;  4D8K A;  1GCQ A;  1H1Q B;  1IO6 A;  3JCM P;  1KQS S;  3F70 A;  2DD5 B;  4C0Z A;  2RHZ A;  4OMP A;  3J80 E;  1YCY A;  3OBY A;  2HQX A;  2KK4 A;  4X34 A;  2L8D A;  2FEI A;  4C92 A;  2EYQ A;  1AD6 A;  4F6U B;  2F2C A;  2DLP A;  2KRN A;  2SRC A;  2E3H A;  1UE9 A;  1PKS A;  3PMT A;  2UZD B;  2L3P A;  2LMJ A;  1QQJ A;  5FGK B;  1H28 B;  2ZCF B;  2FO0 A;  2X9H A;  2LW4 A;  1OI1 A;  3C0C A;  1FMK A;  1AZE A;  3OYN A;  3I5S A;  1IGU A;  4HCZ A;  1YI2 A;  4RTW A;  2KQW A;  3HBL A;  1OZ3 A;  1PD1 A;  4C92 G;  4QW2 A;  1K9A A;  1D1B A;  1YIT Q;  2VC8 A;  2EGC A;  3MY1 B;  1TXQ A;  2K4Y A;  4QT7 A;  1SSF A;  5HK3 A;  4VUB A;  3M0T A;  4WF2 A;  2MOX A;  2RM4 A;  2CH4 W;  4DBH A;  3NTH A;  3JB9 D;  1K76 A;  1AEY A;  1H1R B;  4GLK A;  3RBB B;  4PJO C;  4PJO F;  4EOJ B;  3G6E T;  5LJ5 j;  1Q82 U;  2XKO C;  3L2Q A;  2K79 A;  2ZZD A;  3EJ1 B;  1HK9 A;  2DER A;  2QTX A;  3OQ5 A;  1SHF A;  4CC4 B;  1QMZ B;  1GH6 B;  1RAB B;  4JLG A;  2GQV A;  4BBS M;  4XTW A;  2B86 A;  2CRE A;  3HO8 A;  4ANJ A;  2CDT A;  1ZSZ B;  2P0K A;  1X2Q A;  1K1Z A;  2OJ2 A;  3VS1 A;  3OYE A;  3JB9 J;  2AT1 B;  3JCM g;  4KBM B;  3M0S A;  4EON B;  2FVU A;  2XIC A;  4Z89 A;  2DRM A;  4QQG A;  1OKV B;  4UC4 A;  1WFW A;  3SWN C;  2D0N A;  2RHI A;  1JOW A;  1MUZ A;  1PRM C;  2RNA A;  3EFR A;  1LOJ A;  3CCV Q;  1YJN A;  3VS5 A;  4KRC B;  1K73 R;  3VS6 A;  2CP5 A;  1WHK A;  4M7D D;  2PJQ A;  3VYH B;  1U1T A;  1BI3 A;  5GAN j;  1WXU A;  1I5L A;  4X1V A;  5FLX E;  3X26 B;  4EMK C;  5GAM g;  2CP6 A;  2IN3 A;  2LC4 A;  2FRY A;  3SEM A;  4XTY A;  2K9G A;  3OYL A;  3E1S A;  2LP5 A;  4JRP A;  1CKB A;  1QLY A;  4RTX A;  2DBK A;  4JZ4 A;  4OB1 B;  1TUC A;  4CFU D; 
#chains in the Genus database with same CATH homology
 2JTM A;  3P8D A;  3CMA A;  5A2Q E;  2EIF A;  5IN1 A;  3UT1 A;  5J3B A;  3OS1 A;  1XTD A;  3JCM d;  4PJO D;  3A8M B;  2D9T A;  4X9C A;  1X75 C;  5CR2 A;  1VQO A;  1VQN A;  2PQW A;  4M7D E;  3HFO A;  3X20 B;  3CCQ T;  2P0Q A;  4HT8 A;  4M7A D;  2WJ9 A;  2X4J A;  5GMK e;  3GF5 A;  4MDX A;  3ER0 A;  3WXM B;  1EIF A;  3R6O A;  4ZTF A;  4V2S A;  1QVG S;  2LNV A;  4DOW A;  1KHI A;  2B8A A;  4Z6Y A;  1M4Z A;  5M9O A;  1DJ7 B;  4HA8 A;  3G4S A;  4IUT A;  5LJ3 f;  3C94 A;  1M1K C;  1VQL T;  1LJO A;  2XDD A;  4ZGE B;  4C5I A;  1Q82 C;  3CCV A;  3V8K A;  3HKS A;  4TVR A;  2DXC B;  3ZFJ A;  3CCS T;  2QDY B;  4OGC A;  1G3S A;  3URG A;  3CCE A;  2DTO A;  2DIG A;  2E1H A;  1KC8 U;  3OW2 S;  1VQM T;  4IUQ A;  3S3M A;  4PJO B;  4OF1 A;  4M7D A;  4KUD K;  4HT9 A;  2QQ8 A;  2DD5 A;  1K9M C;  3OYY A;  4M7A B;  2RHY A;  1VQP T;  4J7F A;  5GAM d;  2CZ1 B;  2CZ7 B;  4FSX A;  1JB0 E;  2E5Q A;  3GNF B;  1KG1 A;  4NL2 A;  5LJ5 h;  4B9X A;  1ZQ1 A;  2CS7 A;  2DD4 A;  3DL1 A;  3H4C A;  3RMQ A;  4BY6 C;  4C92 F;  3EFS A;  3L1A A;  2OTL A;  1N8R C;  1FWZ A;  3MHX A;  2QQA A;  2EJG A;  5A0L A;  1VQ9 T;  4C0F A;  1OYX A;  4AI6 A;  3OYK A;  3JCM f;  2DVE A;  2M1H A;  3CCR T;  3X25 B;  4MFE A;  2AHJ B;  4O6J A;  2M9U A;  1ZHI A;  2BIV A;  3CCJ A;  3OA6 A;  2CKK A;  4M75 D;  5GAO q;  2K3Y A;  1H64 1;  3I55 T;  3OYG A;  2R5A A;  4J7I A;  4N0A C;  4EMG A;  3CC2 A;  3VUB A;  2BS3 A;  2L5Q A;  2CGH A;  3QYG B;  1BIB A;  2RHU A;  3V7S A;  3HZJ A;  2PUO B;  3BDU A;  2XU8 A;  2P0P A;  4CI0 C;  1KD1 U;  4M7D G;  2V8K A;  1VQ8 T;  4M77 D;  4M7A A;  1VQL A;  3KBG A;  3HL8 A;  3BG9 A;  4YTL A;  2LDM A;  4EMH A;  2E6N A;  1WQ7 A;  3CME A;  4PNO A;  1VIF A;  1U1S A;  3QYB A;  3I55 A;  1N27 A;  3PIP A;  3LWI A;  4ZN1 A;  5IAY A;  3QUI A;  1W2B S;  2KDS A;  3J7A F;  1QVF S;  3JCM b;  1H3Z A;  2E12 A;  3CCL T;  5CQY A;  4C8Q E;  5GAO r;  4M75 B;  5I2M A;  5GAM f;  2MWP A;  5LJ5 g;  4DA4 A;  3KUF A;  3C4S A;  4A4E A;  1VQ7 T;  2IG0 A;  3OBW A;  3DLM A;  2LQK A;  2RI3 A;  2NLU A;  1M1F A;  2IVW A;  5GAN f;  1PSF A;  2VGN A;  2L89 A;  3C95 A;  5AYF A;  2YHT A;  3RES A;  2JTF A;  5HK0 A;  3MEU A;  2O01 E;  2ZPI B;  2PUK B;  3JCM X;  3L2R A;  3LW5 E;  3HSB A;  2FYK A;  2XK0 A;  4Y91 A;  2M0O A;  1N8R U;  2OAU A;  3L42 A;  4IKF A;  1V29 B;  4M77 E;  2EKO A;  1WJR A;  4C5G A;  3P8H A;  3JCM c;  3DLL A;  2GF7 A;  3CC7 A;  2CZ6 B;  5GMK m;  3GOX A;  1I4K 1;  4L5G A;  1QLB A;  4RMO A;  4A53 A;  5C0M A;  4MDW A;  4XAX B;  4A4H A;  1M8V A;  2D6F A;  4MZP A;  1RI0 A;  4M75 A;  3EAE A;  2JOY A;  1JJ2 A;  4M78 B;  5CVI A;  1VQK T;  2E10 A;  3M58 A;  2CYZ B;  3OYD A;  3CCQ A;  3SWN A;  2RK2 A;  1JJ2 S;  3T9N A;  5GAN 4;  4M7A C;  4P5N A;  1S72 T;  3VKI A;  3M5A A;  5D6Y A;  5DM7 R;  1YI2 T;  4M77 A;  3CXC A;  3X24 B;  4MZT A;  4PL6 A;  2F69 A;  2QEX A;  2VV5 A;  3OSV A;  3S3N A;  1M90 U;  2VXF A;  3BFM A;  4FT4 A;  3G71 T;  2GFU A;  3OYH A;  4QQ6 A;  3TEE A;  1XQH A;  4BI3 A;  4RKU E;  1E7P A;  5GAM e;  4QVC A;  4FM4 B;  5KE2 A;  3CC4 T;  1VQ6 T;  1D3B B;  3JCM W;  3L2U A;  3RUX A;  4Y28 E;  4JX5 A;  4MML A;  2DXB A;  3V7R A;  3VV0 A;  3NTK A;  4N4I A;  4AKH A;  1Y96 B;  3MEV A;  5GAN e;  5LJ5 d;  4C8Q F;  1KC8 C;  1WJQ A;  2F5T X;  2RI2 A;  2VUB A;  4EMK A;  3QDR B;  2DKG A;  3JRZ A;  3NFC A;  4MFD A;  4LDY A;  3QYE A;  4XTU A;  2OTJ A;  1R8O B;  2K5F A;  1VQP A;  2E41 A;  2RHX A;  5FRO A;  1WNL A;  3TU4 K;  1FKM A;  2DPP B;  3JCM V;  1Q81 U;  1KHC A;  4M75 G;  5CIU A;  3KXT A;  4C5H A;  4HL4 A;  5FU7 C;  1G3Y A;  4GY5 A;  2QA4 T;  5GAN g;  2HQE A;  4M78 C;  3CCV T;  2QDJ A;  3JB9 F;  4M77 G;  1NPP A;  2DTI A;  4D6W A;  4F7U F;  3QZ5 B;  2XHC A;  2RJC A;  1WGS A;  2A7Y A;  4IUV A;  4C5E A;  2V8I A;  1D3B A;  2FL7 A;  2MAM A;  2EJF A;  3FB9 A;  3VU3 C;  4KUL A;  4BY6 B;  3O8V A;  3JCM J;  1TH7 A;  2X4Y A;  3CCM A;  4C92 B;  4DQ2 A;  4J83 A;  4XU2 A;  4E7I A;  2G77 A;  2QF7 A;  5GAO n;  4M7A G;  1JBM A;  3UDC A;  2RJD A;  1NPR A;  1KD1 C;  4BI4 A;  4KT0 E;  2E65 A;  1MGQ A;  3N5B B;  4XTX A;  3G6E A;  4J6Y A;  5FU6 C;  3QG1 A;  3PFS A;  3SD4 A;  1YIJ A;  2R5M A;  2ZPE B;  5LJ5 f;  2FHD A;  1KQS A;  2X35 A;  3RMS A;  1N9S A;  3I56 T;  1YJ9 T;  1G3W A;  1B34 B;  2DK3 A;  3HFN A;  3JSC A;  4A4G A;  4ME7 A;  2VYT A;  4RG2 A;  3SB2 A;  2EWN A;  4AKI A;  2WSC E;  1Q82 U;  1UB4 A;  3LGF A;  2KMT A;  3WVE B;  2JVV A;  4PLL A;  4C0D C;  3AHU A;  4PJO E;  4HKE A;  4JUV A;  4BUG A;  4EPC A;  2GCX A;  4M7A E;  4FL6 A;  2K5I A;  5CKF A;  1P92 A;  4QSH A;  4C92 C;  5GAN d;  3VKH A;  1M5Q 1;  5GAN 8;  4AKG A;  1UGR B;  4XU0 A;  3GPL A;  2KMG A;  3PGG A;  1QP3 A;  3H6Z A;  3E19 A;  1YJN T;  4LDW A;  4Z02 A;  3LLR A;  4N0A A;  2QQS A;  3OS0 A;  2DXC A;  2R57 A;  5GAO p;  1YHQ A;  2EQK A;  3MP6 A;  5KCO A;  2DTH A;  2RH2 A;  4XU3 A;  3GIB A;  5LL6 S;  4E7H A;  3J81 E;  1K8A U;  1VQK A;  3QYH B;  3MEA A;  4MZM A;  4PJO A;  3VYG B;  4J6X A;  3S3O A;  2H3J A;  2DO3 A;  3MCA B;  4M7D F;  5EG2 A;  4BBR M;  5LJ3 h;  3SDZ A;  4ZGJ B;  4JX4 A;  2E70 A;  4MIM A;  2FB7 A;  3BDL A;  5A0G A;  5LJ5 e;  3CD6 A;  3MEW A;  1BYM A;  1YIT T;  2LT1 A;  4C0G A;  3HRS A;  2WAC A;  4ATO A;  1M90 C;  3BG3 A;  4XTZ A;  4HCC A;  2XI9 A;  3VUZ A;  3JCM Q;  3VKG A;  3CMA T;  4LD6 A;  2PU9 B;  2WSF E;  3PT9 A;  4PJO C;  3G7Z A;  4BDY A;  2PVD B;  2ZPH B;  1G5V A;  3JB9 I;  5D6X A;  4IUU A;  2LX9 A;  3DB3 A;  3CCU A;  3QII A;  1VQO T;  4JRQ A;  1VQN T;  3CEY A;  2KSS A;  4M78 D;  3TW6 A;  3SFM A;  3V8J A;  4M75 E;  3QSU A;  2RA2 A;  3JAM E;  2L3R A;  2VXE A;  5GAN 5;  1Q81 C;  4DOV A;  4PJO G;  2MMP A;  3DB4 A;  5LJ3 j;  3JCM h;  2E64 A;  2GFA A;  2HBP A;  2LTO A;  5CKB A;  3PIO A;  2K57 A;  3G4S T;  4BDZ A;  3OY9 A;  1UGS B;  1YJW A;  4M7A F;  2KY9 A;  5DLO A;  1VQ4 A;  3RIR A;  4QVD A;  4OB3 B;  1NE8 A;  5D6W A;  4E47 A;  3M4G A;  5FRN A;  1XNI A;  3CCE T;  3CPW A;  3LGL A;  3LH0 A;  3INZ A;  5J39 A;  2RB6 A;  5FU7 B;  4ZTJ A;  2DXU A;  4HNT A;  4JJN K;  1U8R A;  3M4Y A;  4NS5 A;  4Q5W A;  2EAY A;  4E7J A;  5L8R E;  4F7U B;  3OYA A;  3M54 A;  3OS5 A;  3OYM A;  2JZ2 A;  2EFI A;  1RL2 A;  4M78 E;  2ZPF B;  3L2V A;  2LT4 A;  3OB9 A;  2RO0 A;  3L2W A;  3KHI A;  4JLI A;  4BD3 A;  3CXC S;  2OTL T;  2VGM A;  2KR6 A;  3A8G B;  3CCS A;  1QW1 A;  5DY9 A;  1Q86 U;  1VQ5 T;  4OB2 B;  4II1 A;  4NOY A;  4ELY C;  3PTA A;  1OZ2 A;  3QZ9 B;  4A54 A;  3ZEH A;  1VQM A;  4LD9 K;  2O4X B;  4C8Q C;  4HNV A;  3FRN A;  5IT9 E;  1IRE B;  2WSE E;  3Q1J A;  3BW1 A;  5FU6 B;  1VUB A;  1BI2 A;  2DZC A;  2A3L A;  4LDU A;  4C92 D;  4E7K A;  4ELJ A;  3C12 A;  2G3R A;  1O75 A;  5HY6 A;  3UPU A;  4M78 A;  1M1G A;  4M75 F;  2XD0 A;  1K73 U;  4IUR A;  3FDR A;  5GAO l;  2I2L A;  2K2V A;  1BI0 A;  4OB0 B;  3HRU A;  3PNW C;  3QO3 A;  4L6V 5;  3TCJ A;  4QVZ A;  3CME T;  2RJE A;  1LNX A;  4M77 F;  1N9R A;  1O9S A;  5KCH A;  3FIF A;  3MP1 A;  4PLI A;  1QVP A;  2Y90 A;  1WJS A;  4FT2 A;  1NZ9 A;  2KAF A;  3UWN A;  4HCB A;  3RER A;  1AHJ B;  5GAM j;  2LCC A;  3M56 A;  4OP0 A;  4J5Y A;  3OYB A;  2ZGW A;  4C0D B;  4L59 A;  3HPW A;  3TRE A;  1Y96 A;  2LRQ A;  2V8J A;  2MF2 A;  2O4X A;  2XID A;  4KUI A;  5GMK i;  1K8A C;  1JRI A;  2CZ0 B;  3DKM A;  1I8F A;  3A8O B;  5GAN 2;  4R55 A;  5GMK h;  1VQ8 A;  4BB7 A;  3ZBD A;  5KH6 A;  4C92 E;  2X4W A;  2DZ9 A;  4M78 G;  5DLQ E;  5HKC A;  3FJP A;  1W4S A;  3M53 A;  3CPF A;  3CC7 T;  2JN0 A;  2D0Q B;  5GMK l;  3JCM P;  1VIE A;  1Y71 A;  1KQS S;  1NJI U;  4LOC A;  1ZBX A;  3F70 A;  5CO7 A;  3CCL A;  4M7D B;  4JRK A;  3VJP A;  2QXF A;  2DD5 B;  4C0Z A;  1VQ7 A;  2RHZ A;  3J80 E;  1YCY A;  2EJ9 A;  3QJ6 A;  2YRV A;  3OBY A;  4RCC A;  2HQX A;  3MET A;  2KK4 A;  2XDP A;  3X28 B;  2Y4Y A;  4X34 A;  2DD4 B;  3BG5 A;  2L8D A;  3CBP A;  1X01 A;  4C92 A;  3L2Z A;  2EYQ A;  4CRI A;  5GAN 7;  2RD1 A;  4A4K A;  4JS5 A;  1QVG A;  4LDX A;  2KVQ G;  2PVG B;  4LDV A;  3FC3 A;  2JNG A;  5GMK j;  2QEX T;  2RK1 A;  2MI6 A;  3ASK A;  3E9G A;  4R56 A;  3PMI A;  3M9Q A;  3PMT A;  4QQD A;  1N6A A;  3M55 A;  3OW2 A;  2BS4 A;  4FIB A;  2E6Z A;  3LYI A;  2LQ8 A;  3V8L A;  2K5L A;  3H8Z A;  5CAI A;  3P8B B;  2ZCF B;  3OYI A;  2BKD N;  2DIQ A;  3RKW A;  1MHN A;  1Y7X A;  5I2S A;  3OYJ A;  2LVM A;  3CCR A;  1OI1 A;  3S6W A;  2R58 A;  2JUF A;  2OTJ T;  1B34 A;  4N4G A;  4M7D C;  3OYN A;  3MP8 A;  4JDS A;  3V7C A;  3M59 A;  4MMK A;  3GP8 A;  3ME9 A;  1UGQ B;  4HLQ A;  3NTI A;  4HCZ A;  1S72 A;  4NL3 A;  1YI2 A;  4J8O A;  2ZZD B;  1IZ6 A;  2KQW A;  3RKY A;  3HBL A;  1OZ3 A;  2QQR A;  4ELZ C;  3OYF A;  4BAC A;  4C92 G;  1VQ9 A;  2C06 A;  4QW2 A;  3G71 A;  3JB9 H;  3HB9 A;  1HXD A;  2M16 A;  4XTV A;  4BE1 A;  4C8Q D;  1VQ6 A;  4ZGD B;  1KQ1 A;  4XQ3 A;  2VC8 A;  3CC4 A;  1VQ5 A;  4HNU A;  1Q86 C;  4BE2 A;  3LX7 A;  5EJC A;  2K4Y A;  2BUD A;  1SSF A;  2EQJ A;  2EQM A;  5I21 A;  2QI2 A;  4VUB A;  4WF2 A;  5HK3 A;  4JS4 A;  2RM4 A;  3QHS A;  4M6V A;  3CCM T;  5FRM A;  1Q7Y C;  3NTH A;  3QPH A;  3JB9 D;  4JX6 A;  1FXX A;  3E9F A;  5LJ3 e;  3A8L B;  1WPY A;  4GLK A;  1BKB A;  3M57 A;  4PJO F;  3VYG A;  5GAO m;  3G6E T;  4XU1 A;  4OGE A;  2QA4 A;  1K73 C;  1M1K U;  3QJY A;  2K3X A;  4PKC C;  5CQX A;  5LJ5 j;  1BI1 A;  2XKO C;  3HHT B;  3HRT A;  2ZZD A;  4C8Q B;  5A0D A;  5CCA A;  3L2Q A;  1YIJ T;  1W2B A;  2HAX A;  1KQ2 A;  3QXE B;  1QVF A;  1HK9 A;  2QTX A;  3OYC A;  2LCL A;  2XG8 D;  5LJ3 g;  2BS2 A;  3OQ5 A;  4RG8 A;  4A4F A;  3CPW S;  4JLG A;  3SWN B;  1K9M U;  2GQV A;  1X6O A;  2PVO B;  4BBS M;  1M9S A;  5GAN 3;  4NC6 A;  4E7L A;  3GNG A;  2HNI A;  3QKJ A;  2EQU A;  4XTW A;  4M77 B;  2ZPB B;  3MO8 A;  3HO8 A;  2RI5 A;  3FEO A;  1BIA A;  4EDU A;  2P0K A;  4OMF B;  4N4H A;  5CKE A;  1UGP B;  5C6S A;  2YLB A;  3A5Z B;  3JCM e;  3BY7 A;  4B9W A;  2YLC A;  2DJZ A;  4F7U E;  3WVD B;  2RJF A;  4ZN3 A;  2DXB B;  5GAM h;  1UEB A;  4C8Q A;  1FX7 A;  1XOV A;  5CK9 A;  1WQW A;  4X9D A;  4EMK B;  3OYE A;  3JB9 J;  5GAN h;  3FLG A;  3CCJ T;  1NJI C;  3I56 A;  1YHQ T;  1YJ9 A;  1YBY A;  4RCB A;  2DXT A;  3CC2 T;  4IUP A;  1Q7Y U;  3JCM g;  4KBM B;  1G3T A;  2Y4X A;  3CBM A;  2FVU A;  4OVA A;  4XK8 E;  5CKH A;  2HD0 A;  2DEQ A;  2P4T A;  4BE0 A;  2XIC A;  4J6W A;  4M75 C;  4FU6 A;  4QQG A;  3CD6 T;  4UC4 A;  1I81 A;  3SWN C;  4F7U A;  2RHI A;  3RKX A;  5GAN 6;  5CKD A;  2F5K A;  3EFR A;  1LOJ A;  4M77 C;  3OSS C;  4BI8 B;  5J26 A;  1YJN A;  1GXI E;  4JRI A;  3HP9 A;  3OS2 A;  4O5V A;  5LJ3 d;  2MWO A;  3VYH B;  4M7D D;  1U1T A;  4C8Q G;  2X4X A;  3LWH A;  1BI3 A;  1Y07 A;  5GAN j;  1I5L A;  3CCU T;  5FLX E;  3X26 B;  2DAQ A;  2QFZ A;  4EMK C;  5GAM g;  3CBO A;  1PSE A;  2LC4 A;  2QQB A;  4XTY A;  3GLX A;  1QP2 A;  3OYL A;  3E1S A;  3QBY A;  4JRP A;  3TW7 A;  2ZPG B;  1YIT A;  4M78 F;  3OMC A;  5KE3 A;  4OB1 B;  1YJW T;  3JB9 G;  3QWL A;  3OMG A;  4F7U G;  1VQ4 T;  2XDB A;  3A8H B;  2QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...