2ZCFB

Mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zcfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zcfB02
5L8RE 4RKUE 3X24B 3X25B 1V29B 3WVDB 3VYGA 3VYHB 1QP3A 4OB2B 4ZGEB 4OB1B 2PVDB 2D0QB 2O01E 1IREB 2DD5A 2ZPHB 3WVEB 2PUOB 2CZ0B 4OB3B 2PVGB 3QYGB 2ZZDB 2DXCA 1UGQB 3QYHB 2DD4B 4L6V5 2DXCB 2ZZDA 3VYGB 1PSEA 2DXBA 1PSFA 4Y28E 2ZPFB 3X20B 2DD4A 3A8OB 2WSCE 1UGPB 2CZ1B 2DXBB 2ZPEB 2DD5B 2CZ6B 2PU9B 2CZ7B 2ZPIB 1AHJB 3X28B 3QZ5B 2PUKB 4ZGJB 2QDYB 1UGSB 1QP2A 2PVOB 3A8MB 3HHTB 1JB0E 2ZPBB 3A8HB 2ZCFB 1DJ7B 3LW5E 4OB0B 3A8LB 4XK8E 2CYZB 1GXIE 2AHJB 4FM4B 1UGRB 3A8GB 3X26B 3QZ9B 4ZGDB 3QXEB 2DPPB 2WSEE 4KT0E 2WSFE 2ZPGB
chains in the Genus database with same CATH superfamily
1M1FA 3NTKA 2B86A 3EG9A 1GCQA 1I5OB 4OF1A 3MPUB 1BI0A 2COYA 4J6YA 4Z02A 1SRMA 2RK1A 5I22A 3JB9D 1F5QB 2W9ZA 2YUPA 4F04B 2JN0A 1O9KB 2VVKA 3REAB 3CMAQ 1KG1A 3MIAB 1B34A 1QWFA 2P4TA 1TG0A 2RN8A 1K73R 5KH6A 1UUEA 1X27A 1BK2A 3CCRA 2J05A 4IUPA 2FHDA 1VIEA 4BCOB 1PD0A 2OTJQ 2XG8D 4HVUA 1Z9QA 3TW6A 3MEAA 3M4YA 3RKXA 2EQUA 1H25B 1VQMT 1H1QB 3RDVA 3OS5A 4A53A 2CUBA 1VQ7Q 4FSSA 2HSEB 4M77B 3BLQB 3OW2P 1VQ9A 4LOCA 3NPFA 1ZUYA 2RQTA 2E3HA 3TNHB 1UB4A 2WFYB 2WSCE 1VQ7T 2QQ8A 5IHIA 3OBYA 2JOYA 3R6NA 2CP5A 4CFNB 1H3HA 1YJNT 4TVRA 1VQ8T 1QMCA 3I9QA 2M51A 5GMKj 3MI9B 1VQPA 4F70B 2VASA 4N0AA 1GUXB 3BHTB 3QZ5B 5CKBA 3CC2A 1YJWA 4Y72B 1HK9A 2BS4A 4KGZB 1K76A 1Q82C 2DNUA 1VQLQ 3DOGB 2E70A 4C5GA 4F7UE 5GAOq 4ROCA 1PKSA 2CH4A 2DEUA 2HBPA 1TU0B 1X6BA 4F6SB 2K3BA 1N8RU 4C8QC 4IIOA 2KBTA 4RG8A 4C92D 1KQ1A 4BCQB 1UG1A 4M78D 2KY9A 3VKGA 1SF9A 3OA6A 4HXJA 2WACA 1M8MA 2HD0A 3CC4A 2MI6A 5CKDA 1WHMA 4AFZC 2J7IA 4C5HA 3G4ST 1K9MR 1SSFA 1C9BA 5KYWA 3ER0A 2QEXQ 3DDQB 1JRIA 1WX6A 3FB9A 1QLYA 1YHQA 4NSTB 2ESWA 2D6FA 4PK4A 2YLBA 3O8VA 3VS4A 1QMZB 4A4EA 4M75D 1WHKA 1BU1A 1VIFA 2IG0A 3RR6A 2K5FA 4XAXB 5LJ3e 3GLXA 4HL4A 4GBQA 4JRPA 4LDWA 4BD3A 1VQ6T 1M3AA 4IMYB 1Y71A 4HCCA 5CK9A 1D3UB 3JCMJ 3LLRA 3VS7A 2DXCB 1VQ4T 2PZ1A 4QW2A 3CCMT 4FW1A 5IAYA 4HNUA 2K5IA 1S1NA 2W2HA 1V76A 4IUTA 3V7SA 1O9SA 1B07A 3V7CA 1YJNA 2E1HA 4JUVA 1G3YA 4M75A 3CCUT 4BDZA 1KD1U 2DD5B 2C4GB 3V7RA 4OGRB 2RJFA 2HMAA 3G6EA 1AHJB 1VOMA 2RHZA 4HCZA 6AT1B 3GTMS 1B7TA 4HLQA 2M16A 4MZTA 4F17A 1YJ9Q 5KYXA 1R0BG 2LCCA 1YCYA 5ICPB 5A0DA 2MAMA 1QCOA 2EFIA 1WGSA 4PJOC 5LJ5e 2KYBA 2OTLA 2DL7A 1IB8A 1JB0E 2RJCA 5IHKA 2ZPBB 2WPAB 3L2WA 2XMFA 3CCJT 2DIGA 3SEMA 3TN8B 4HT9A 1RACB 2K5LA 3V8KA 3C94A 4BCFB 1GCQC 5FU6C 3EGDB 5D6WA 4A54A 4F7JB 4Y91A 3OYHA 2E5QA 4A4KA 5I2SA 1WNLA 2K7AA 2WMBB 2A28A 1TSFA 4F16A 1JQQA 1I81A 1PNJA 1VQMQ 4J9EA 2NUZA 5DM7R 2GBQA 1D1BA 2RI2A 2CH4W 2MWOA 1TXQA 2NUPA 5KE2A 2QFZA 4C8QG 3UA7A 1I5LA 3M57A 1GBQA 2DETA 5GAMe 2KYMA 4C92C 2KDSA 3FRNA 2O4XB 3M0PA 5GANg 2YWWA 2KI7A 4LUDA 2X4YA 1G5VA 2FEIA 5CIUA 2HSPA 1URCB 5FRNA 1ZX6A 1TD6A 2DL3A 4O5VA 4FYWB 2FG0A 2MCNA 1CSKA 1MV0B 3CCVQ 3M59A 2FPEA 2E3IA 5LJ3j 1W98B 2GGRA 5C0MA 3HSBA 4E7IA 1I07A 1UGPB 1ZQ1A 4M7AG 5GAOp 2L3RA 4AG2C 4OGCA 1QVGS 3FIFA 4X9CA 1K8AU 1PHTA 1YWPA 2IIMA 3M58A 4JJBA 2KMTA 5IT9E 3VJPA 1FINB 3OYJA 1C0MA 1UHFA 2OX7A 4PJOA 4MFEA 3ZEHA 1X75C 1AISB 3THKA 2RHIA 5EC7A 2Y90A 4KH0B 2BTTA 2LP5A 2HL3A 4DOVA 1VQ6Q 3SWNA 3M4GA 4KGVB 1GXIE 2C6TB 3BLHB 1FX7A 2EJFA 1FMWA 1X2QA 3NFCA 3DTOA 3QXEB 2H3JA 1WIEA 5GAN6 5GAMj 2EBPA 4EONB 4KT0E 3UF4A 2DL4A 1Q81U 4BI3A 1ZBXA 1M2VA 2DYBA 4JX5A 4PFPA 2L0AA 2DXTA 4K11A 1BCOA 3ZFJA 4DBRA 4F7UB 4OB2B 1D0XA 3EIDB 1OU9A 1KIKA 1RLQC 4B6MA 2MWPA 1OGUB 1ZLMA 1IREB 4NOYA 3OYGA 1OYXA 4XTZA 3ZL7C 2DMEA 2JW4A 4EORB 4OP0A 3CXCS 4O6JA 3MP8A 5HBHB 2M0YA 3UWNA 4M7DD 4QKUA 4BCMD 2RI3A 2C5XB 3EAEA 3CBOA 2QXFA 4BCKB 4C0DC 4BCHB 4C5EA 4J9HA 2JJ9A 1YBYA 3MP6A 5GMKl 1NLPC 3CCQA 5C6SA 5GAMg 4CFUB 4BBSM 5EG2A 1K8AR 3GP8A 3JCMP 3ZBDA 1JKWA 1W2BA 4BY1X 2NYSA 5IF1B 4X9DA 5ACBA 2KRSA 4JS4A 3T9NA 2LX9A 1A0NB 2DVEA 4RTXA 2VC8A 1PKTA 1QKXA 2K4YA 4BCJB 2QTVA 5LJ5f 2KR3A 4AKGA 2CCIB 1HXDA 3OS1A 3JCMW 1KC8C 4CC2A 1P92A 3HHTB 4E47A 4M77C 1OKVB 2KEAA 3J81E 1FVVB 3BDUA 2CYZB 2W99A 1BIBA 3NMZC 1YP5A 4FCYA 4M7AC 1JXOA 3BFMA 4PJOF 1VINA 4RCBA 3BHUB 1FKMA 3EGUA 4Z88A 2KXDA 4IUVA 1YIJA 4PFZA 1AWWA 3OSSC 2JS2A 2ZAEA 2AZVA 4E7ZA 1H4LD 3H0HA 3RIRA 2BIVA 2Y4YA 1WDXA 2DEQA 3FC3A 1OPKA 1Q81C 2BZXA 3UATA 3CPFA 5IHNA 3QJYA 5AT1B 1M3BA 1JOWA 2LNVA 1K8AC 2KRNA 4OB1B 1H28B 3TREA 4ZNXA 2EGCA 4NL2A 5IDPB 3OYMA 2CCHB 5GMKh 2VB6A 1FWZA 2EW3A 2QTXA 4ZTJA 4M7DB 1NBEB 1Y96B 1MMDA 1Q86U 1N6AA 2OTJA 4M78A 5GJVB 4CFWB 2WXVB 3M0QA 1SSHA 4AFUC 1OI9B 4M7AD 1LJOA 1ZSZB 2C0OA 4BCIB 2JMCA 4L59A 4FT4A 3MEUA 4RG2A 2KXCA 1H92A 4PJMA 4I3ZB 3TSWA 1MNDA 1ZUKA 3V8LA 2RJDA 1VQPQ 1BI3A 2VGNA 2NUPB 5GJWB 5LJ3f 1PCXA 2G3RA 2C5VB 3A1PA 3FJ5A 1I0CA 3JCMh 3OSVA 3H4CA 2JZ2A 2RMOA 3RESA 2LZ6B 4EMHA 3U23A 4JX4A 2LNHB 3RUXA 4AKHA 4WCIA 4HT8A 1NE8A 2AZSA 4M77F 4BBRM 1YI2Q 2P0KA 4GY5A 2GFUA 4J9FA 3JB9H 1C6VX 2DF6A 1LVKA 4R56A 2BE7D 4IUUA 1VQ6A 4D8DA 3OYYA 3A8GB 1IGQA 1R77A 1E6GA 1YIJQ 3EG2A 5I5ZB 3BW1A 2EQIA 1R0CB 1YJ9T 4EMKC 1WQ7A 1NG2A 4II5B 1AD5A 3TU4K 4XU1A 2BPMB 2DL5A 2DRKA 1S72Q 1N5ZA 1D0YA 4M7DG 2PNIA 3LQ5B 1G8XA 2WIHB 1FMKA 1AEYA 3P8BB 4J9BA 4AKIA 3JB9G 3RBBB 3I55T 2ROLA 2V8KA 4QVZA 3G6ET 2O2OA 2EKOA 2I2LA 1YHQQ 4BXXX 2DTHA 3TCJA 4JZ4A 3B57A 4DOWA 3HRTA 1KSWA 4J7IA 4BY6B 4M78E 1TWBA 2VV5A 4A4GA 1RAFB 1TUCA 2JGZB 1Q86R 4QT7A 3DL1A 3M9QA 1UJYA 1OEBA 3RKWA 3HB9A 4EOMB 3GPLA 2QYZA 5CCAA 1JEGA 1PSEA 2X3WD 3M03A 4DBHA 3DB3A 4OMMA 2DD4A 4XTVA 4P5NA 4YOSA 3CC2T 2X4JA 5CQYA 2DM1A 1XO2A 1VQPT 4F7NB 2HL5C 2VGMA 1QVPA 3OW2S 1G3TA 3A98A 3G7ZA 2LVMA 2LDMA 4M75C 5HQ0B 4XU3A 2MOXA 2PUKB 1WXBA 4E7SA 5HK0A 2NWMA 3VRYA 4UC4A 3OYKA 2KT1A 5DLQE 3TSZA 2F2VA 4XQ3A 3JCMg 1M3CA 1W6XA 3VUBA 3OMGA 3CPWA 1X2KA 4MMKA 2M02A 1NM7A 4C92A 3CQTA 1IHVA 1XQHA 1HJDA 3SB2A 3PFSA 2IPOB 5IHYA 1M1KU 2QGFB 3CD6Q 3GBQA 2C5NB 1F1BB 2EKHA 3CCJQ 1YCSB 2E41A 2KT8A 2QASA 1U3OA 2COWA 2YUNA 5CKEA 3X24B 3VUZA 2HNIA 5A0GA 4PJOG 5D6XA 3FEOA 1PRMC 2ZGWA 3HZJA 3E19A 1AWOA 1MNEA 2RK2A 2JT4A 1VYTA 4YC3B 3C0CA 2BUDA 2EJGA 2K3YA 2OJ2A 2O9SA 1KD1C 5CKFA 4BCPB 2MK5A 4WTOB 3GOXA 2DFUA 3OYAA 5ECAA 2QQBA 1M1GA 3G1JA 4BCMB 4F7UG 3OYFA 2DJQA 5FU7C 1VQ4A 2WIPB 4OMFB 2IW9B 1K73U 4CRLB 1IXDA 4KUDK 3VS3A 3L2RA 5LJ3d 4ELJA 1YI2T 4GLMA 3LX7A 1EFNA 4M78C 4D8KA 5GAN5 2M9UA 3CMAT 3C4SA 3TNWB 4AT1B 2KRMA 3CCRT 4QVDA 4JLGA 3H0IA 5CVIA 1S72T 2LX7A 1W70A 3QYEA 1AT1B 2QQ9A 1WHJA 3NDQA 3LH5A 4DEXA 1H8KA 5FRMA 1GCPA 4CFXB 4M77A 4OVAA 1WA7A 2YT6A 3RMQA 2B9RA 3CC4T 1UGSB 1KQSA 1QVGP 5IXFA 2JTFA 1PD1A 3CMEQ 4M78B 1KK7A 2K3XA 4RTUA 1K9MC 1Y96A 3OYDA 3CMEA 3PIOA 4IKFA 2V8JA 1XJWB 3I35A 3M0SA 4DBQA 3I55Q 2HKNA 4FM4B 2CKKA 3CC7Q 1H1SB 5GAN4 3OBWA 3PTAA 4ZGDB 1K9AA 4B9XA 1U8RA 3UPUA 3JSCA 3OS2A 4J7FA 3CD6A 4M7DE 1T3LA 2A7YA 3VS2A 4IIMA 1S72A 2DLPA 3DKMA 4EPCA 1X69A 2LJ0A 4X1VA 4F14A 2HZYA 4M75F 3OW2A 3H0FA 1U06A 2KSSA 2EVRA 2QG9B 2PVDB 1K1ZA 4F7SB 2XU8A 2CP7A 2O01E 5KYYA 3S3MA 4C8QB 2K2MA 2QGSA 2G6FX 2NUTA 2E12A 1VUBA 2YRDA 4RTYA 3CCEQ 4CXAB 1UJ0A 5LL6S 2DXUA 3QYGB 5FLXE 4XTWA 3G4SA 2ZZDB 2HBWA 2RD1A 3GNFB 2EQJA 2JVVA 1NPRA 2UZBB 3VYGB 1ZBJA 2QDLA 4TTHA 1BB9A 3QG1A 3EHQA 5CO7A 4MMLA 4LDUA 4NC6A 4F6WB 3MJXA 2PJQA 4ANJA 4HVWA 3A8OB 4HVVA 1YIJT 5GAOn 3BDLA 2V1QA 4OR5B 3KHIA 2ROTA 5A0LA 4PJNA 1KQSP 2FRWA 2CSIA 2W0ZA 4RTZA 2LT1A 1UHCA 3PO3S 2BS3A 3PMTA 3CMET 4PKCC 1QVFS 3ULRB 1YJ9A 2PVOB 3OYLA 1W2BP 4LUEA 2RF0A 1B3QA 3CBPA 1FXXA 3MKDA 3I55A 2MYSA 3CCQT 2BKZB 1M8VA 2WJ9A 3QKJA 4FW2A 3JCMf 1AOJA 3VKHA 4HNTA 5I21A 5KE3A 1IO6A 4M4ZA 1PG5B 1M1KC 4BY6C 3DLMA 1ZHIA 4C0FA 4EOIB 1D0ZA 4J9IA 5GAN2 3CCJA 1HSQA 1CKAA 4C5IA 1ABQA 3SD4A 5GAN8 4M78F 1M30A 4C8QE 2LQKA 1GL5A 3NTHA 4G6LB 2QA4A 2F69A 2L3SA 2V22B 4LN2A 2EUFA 4E7HA 4KH1B 2QEXA 3M56A 3QJ6A 2A37A 4DEYA 1BKBA 1KHCA 1UEBA 2W96A 2UZLB 3E2UA 5DQVA 2O4XA 1ABOA 2YRCA 3M54A 1M90U 3HPWA 2KAFA 5GAOm 1ZSGA 2KMGA 3N5BB 2HCKA 4L5GA 3QYHB 1Y07A 4ESRA 4CC7A 4XTUA 2L3QA 2DVJA 4HKEA 1WYXA 5FGKB 4PL6A 2EQKA 3F70A 2I40B 1RI9A 2QQAA 3GIBA 3C12A 3X20B 2RHXA 3UA6A 1TFBA 1ACMB 4FYYB 1TS9A 5GANf 2MIOA 2F5KA 2UZDB 2YDLA 1MHNA 2KE9A 2M0OA 1CKBA 1R8OB 3EG9B 3JRZA 2HQXA 1K9MU 2RJEA 3JB9I 2XKOC 2FPDA 2F2XA 2R7GA 3LWIA 1G3WA 2K79A 2LJ3A 3H6ZA 4LDVA 3O5ZA 4JJDA 1Y0MA 1YJWQ 4Z89A 3PNWC 1KJWA 4JRIA 4RUGA 2C5OB 1IGUA 3CCLT 1G3NC 1ZSZA 5GAOr 2LCLA 3A8LB 2P0QA 2AHJB 1NZ9A 4E7JA 4C0DB 2L2PA 2GTOA 2CP2A 3QYBA 5L23A 1UNLD 4DBFA 2DPPB 3REBB 4LDXA 1VQ5A 3DDPB 3HTRA 1KHIA 5FU7B 1EX4A 3MO8A 3Q1JA 5LJ3g 3EH2A 2LQNA 1VQ5Q 2C06A 3CCSQ 1YITT 1G3SA 3M5AA 3K7AM 1G83A 2ABLA 1JU5C 3WVDB 2XDDA 4A63B 2DRMA 3MHXA 2RQUA 3E9GA 1UDLA 2PMIB 1MMGA 2A0FB 1BU2A 1U5SA 3TEEA 3HFNA 2DX1A 3CCVT 1RAHB 2JXBA 3CEYA 3CCEA 2EGEA 2EJ9A 1SKUB 1UTIA 2FL7A 1QW1A 3L42A 2NLUA 3QHSA 3LWHA 1H27B 5CKHA 2CUDA 1AZGB 1WHGA 1N8RR 3L2UA 2DZCA 3HKSA 2DD4B 1QLBA 1ENWA 2FO0A 1NJIC 4ZTFA 1VQ9T 4BE1A 4BY7X 4ATOA 5FU6B 1WPYA 2YUQA 2RA2A 4Q5WA 1VQ7A 2K6DA 2M1HA 2HEQA 2XIDA 3JV3A 4BCNB 4JLIA 2DERA 7AT1B 3O0GD 1GY3B 2PK2A 1KXUA 3JCMc 4GLKA 4JDSA 3V8JA 1GBRA 2DXBB 2QF7A 4OMOA 1X43A 4M77E 3PGGA 3PIPA 2QK0A 2D8JA 4PLLA 1W1FA 3VS1A 3QBYA 2RQVA 2ZPIB 4LD6A 2HKQB 4HA8A 3X28B 3UDCA 3G6EQ 3HP9A 3QIIA 4AMCA 3EFSA 2DK3A 2BS2A 2DO3A 1HYOA 1T0JA 3CC2Q 2XD0A 5GANd 4BCGB 2RHYA 4PJJA 3GF5A 4RTTA 2LT4A 2EYQA 3JB9F 2LTOA 4DA4A 1DJ7B 2CT4A 1VQNA 2QAZA 4J6XA 4E7LA 4AI6A 2UZEB 4J8OA 1X6GA 4FU6A 1BBZA 1U1TA 2YUOA 3I5RA 1WJRA 2LCSA 4M7DA 5HCKA 5CQXA 2DAQA 2IVWA 3OS0A 1X01A 5CEIB 2K9GA 1WLPB 3L2QA 2VXFA 4CC4B 1UFFA 1IRXA 1FMVA 5IN1A 3X25B 3KBGA 5GMKi 2RNAA 3VRZA 2DL8A 2J06A 2J6FA 1QVGA 2CREA 2DA9A 3P8DA 2ED1A 2CDTA 5D7UA 1NJIU 3E1SA 2GCXA 3POMA 1TUDA 2K2VA 4NS5A 5KYYB 4E2FB 4FX3B 4QQ6A 2E65A 4JJCA 1YITA 2FYKA 3EFOA 4BCND 4F7UF 3JCMQ 3INZA 1LOJA 2FB7A 2PUOB 4BI4A 1GFDA 2WMAB 1Q82R 4M7AF 1H26B 4EOPB 5GANj 2FRYA 2DBMA 1OPLA 1K0XA 1IHWA 4OMPA 4EOJB 5HKCA 4M6VA 1N4MA 3G71A 5GMKm 3CCLA 3GNGA 3I5SA 1E7PA 2A3LA 4Y92A 1PSFA 4LE9A 3CCUQ 3META 1PWTA 3JB9J 3J7AF 2J6OA 4MZMA 4OMNA 5GMKe 3TW7A 2EYZA 4EOSB 2R5MA 2KVQG 1VQOT 1GFCA 1WJQA 1B34B 3VU3C 2QI2A 1TTHB 4CI0C 2KGTA 2DMOA 2PU9B 2PQWA 3VS5A 3H41A 2YLCA 1K73C 3LGLA 4FSXA 2QQRA 3OY9A 3EG0A 4KRDB 4OGEA 1EIFA 1LNXA 1TOVA 5CAIA 4Z8AA 3JAME 2L89A 4C92B 1JJ2A 4BE2A 4C0GA 1VQNQ 1OU8A 1I1JA 2COZA 4N4HA 2G77A 3EGXA 1ZSZC 1RL2A 2R57A 1P5EB 1M90C 2BZYA 4J83A 1VQ8A 2MPXC 4IUQA 1VQNT 1UGVA 1QCFA 5KYWB 3ME9A 4E7KA 5GAMf 3CC4Q 3M0RA 1Y7XA 4M75G 2E10A 3MCAB 3H8ZA 4RKUE 1FYNA 2HQEA 4ROEA 4N4IA 1OULA 1WZOA 2JS0A 2H3EB 2PTKA 1V29B 1OX9A 3VYGA 3CCSA 1T3SA 3CCST 1YITQ 3EFRA 1MV3A 2R58A 3PE0A 4ZGEB 2YXYA 2QA4Q 2O9VA 4LXCA 4JJNK 1M2VB 3JCMd 4M78G 2Z0WA 4A4HA 3RGFB 3KFVA 2DKGA 2DE0X 3CCRQ 4JZ3A 3OYBA 2EYXA 2V1RA 2LW4A 5HBEB 1D3BB 4E6RA 2DXCA 4KULA 1UGQB 3RNJA 2DBKA 1OIYB 1JJ2P 3QPHA 1K4US 2LC4A 2X35A 1RAEB 1SHFA 3CXCP 3CCUA 2DTOA 2EQMA 4RTVA 2JTEA 3A5ZB 1PKDB 2A36A 3CCET 1WQWA 4II1A 3CCVA 4J5YA 4QQGA 2BE9B 3DB4A 4PNOA 2KK4A 2DILA 4BI8B 1EZZB 5D6YA 1PM3A 2XK0A 2CZ6B 5IDNB 5GAN3 3AT1B 2XHCA 3HBLA 1VQOA 1M9SA 1OQKA 1OI1A 1MUZA 4HCBA 1OZ3A 4ZGJB 4F7UA 1M1KR 3WXMB 2VWFA 2OTLQ 1Q7YU 1KQSS 2ENMA 4MIMA 3FDRA 3S3NA 1XNIA 4F6UB 2CP3A 2PK9B 2E6NA 1RLPC 2DYIA 2LQWA 5HK3A 1VYVA 2DIQA 1ARKA 4CFMB 3A8HB 3BG9A 3QO3A 1MGQA 3LW5E 4CRIA 1QVFP 1D3BA 2DJZA 2OAWA 1WI7A 4MDXA 3SDZA 3M0TA 4UN0A 4CC3A 3HO8A 1AVZC 1N9SA 2LJ1A 3URGA 1IZ6A 1Q82U 3HL8A 3I56Q 4XTYA 4PJOE 4ELZC 5GAMd 2ZPGB 2RI5A 1G2BA 3BE3A 2L5QA 5EFQB 4KGXB 3ASKA 3D7SB 1OL1B 2JM8A 1WHHA 1K0SA 4AG1C 1KD1R 2X1NB 1D1CA 3VYHB 4QSHA 2P4RA 2X3XD 4CFUD 4EDUA 3BY7A 4PJOD 1WHLA 2D0QB 1JSUB 2RQWA 5IXBA 3CCMA 2ZPHB 5I2MA 3CD6T 4ORZA 1BI2A 2BZ8A 4VUBA 1OX8A 1Q86C 1D09B 2HAXA 1RABB 1X6OA 2XDBA 2K57A 3MY5B 4L6V5 4YTLA 1UECA 2R5AA 1Q7YR 4EMGA 3MP1A 1BYMA 1VA7A 1H3ZA 3OMCA 2MF2A 4Y28E 2P84A 4C8QD 2E4HA 3OQ5A 4QQDA 1OIUB 2ZPFB 3DLLA 1JJ2S 5HNBB 5FW9A 1LPLA 3JCMe 3G33B 4EC8B 4BACA 2QEXT 3PT9A 2VKNA 3OYIA 1VQKT 4QVCA 1RAIB 1ZUUA 4OMLA 2KNBB 4R0KA 4J9CA 2A08A 3QSUA 1ZA2B 4M7AE 1VQKQ 4BB7A 3BHVB 1QVFA 1YI2A 2YRVA 4BCQD 4AFSC 3F5XB 2QDJA 1YNZA 2EWNA 2I53A 3IQLA 1XOVA 2SEMA 4C8QA 4DQ2A 1OKWB 2SRCA 2JMAA 2EYYA 4M75E 3CPWS 5L2WB 1QQJA 4XTXA 1YJWT 1UGRB 2EIFA 4ME7A 1O75A 4EOOB 2RO0A 2J6KA 3VS0A 4XU0A 3S3OA 2WSEE 1D1AA 1SRLA 2WSFE 4M7DF 2IVXA 2IN3A 3I56A 2GTJA 5L8RE 2YHTA 5LJ5d 3M55A 3JCMX 3NTIA 1NPPA 1WFWA 4D6WA 2JM9A 2IW8B 2X9HA 2FZGB 5HBJB 1NLOC 1WXUA 3AHUA 1KQ2A 1H24B 3HFOA 4JS5A 2F2WA 3CCMQ 1VOLA 3P8HA 2F2CA 3OYEA 4M7AB 4ELLA 4J9DA 2DD5A 4M77D 4ELYC 2RPNA 1RAGB 4FL6A 4B9WA 2QGGA 5LJ5j 1KC8U 2FZKB 4KRTA 3MY1B 2CS7A 3LH0A 2CZ0B 4HNVA 1VYUA 3OYNA 2GF7A 2VYTA 5J26A 5A2QE 3CCLQ 1I8FA 2XDPA 4MZPA 5KYNA 2IW6B 2ZZDA 2L8DA 1RI0A 1Z9ZA 2AKLA 2O31A 3G71Q 2JTMA 1BIAA 5LQFB 1UE9A 5KYXB 4YOOA 4R55A 5GAN7 2PHGA 5IH2A 1UNHD 1Q95G 1VQ9Q 4RMOA 1SHGA 3VS6A 3R6OA 2GQVA 4FT2A 3L2ZA 2CZ1B 2AIRB 4LNPA 5GAOl 3CC7T 2RM4A 1VYWB 5FWBA 3M0UA 3RMSA 5LMKB 2D1XA 2C0TA 2Y4XA 5DQWA 2H8HA 2AKKA 4PFOA 4J6WA 2CZ7B 1BCMA 2RQRA 5KYUA 2JUFA 1RAAB 2BKDN 3LYIA 4JRKA 1M4ZA 3VKIA 3BLRB 1VQLA 2CT3A 3L2VA 2OTJT 4N4GA 3J80E 4AFQC 5LJ5g 2E6ZA 3BG5A 2V8IA 2LRQA 4LD9K 2HQHA 3LGFA 4EC9B 4PJLA 9ATCB 2HDAA 4FYVB 3CBMA 2OI3A 4OMQA 3MEWA 4XK8E 3SWNB 1M90R 1AWJA 1AZEA 1E6HA 1TUGB 2CP6A 2DTIA 3M53A 1AWXA 3CC7A 3X26B 2W9FA 5KCOA 3EJ1B 5KCHA 1YHQT 1M5Q1 1E7OA 2FZCB 3CPWP 2CGHA 1O9KA 4KUIA 1M2OA 1NEGA 2ED0A 2X51A 4C92E 4KRCB 1T0HA 2ECZA 1QCNA 5GANh 1WXTA 2D9TA 5HY6A 4MDWA 1VQMA 2AK5A 3PMIA 4NL3A 2D8HA 4JX6A 4A4FA 3UT1A 3CMAA 1Q81R 5J39A 4N0AC 4YOZA 1C1AA 1PRLC 1PC0A 2EAYA 4J9GA 4Z6YA 2WEVB 2L3PA 1VQ4Q 1Y57A 2PVGB 2ATCB 3OB9A 4BE0A 3RERA 2GNCA 2B8AA 1MMAA 2RH2A 4RTWA 2EYWA 1H1PB 2UUEB 4M75B 2DXBA 1ZP2A 3QDFA 4FIBA 2XI9A 1NYFA 1H1RB 3EGXB 2WHBB 3SWNC 1OZ2A 3KXTA 1H641 3I56T 4ZN3A 1Q7YC 1LCKA 2CJMB 1N8RC 4FYXB 3CCQQ 4F7LB 1YJNQ 2KROA 3MEVA 5CYIB 4X34A 1BI1A 2G9XB 2E64A 1I4K1 1SG5A 3HRSA 1M27C 2F5TX 1J3TA 1QWEA 2JNGA 2C0IA 1VQOQ 3EGDA 2W10A 2F1LA 1N9RA 3JCMb 1QP2A 3KUFA 8AT1B 3E9FA 2KR6A 1RUWA 3PVQA 1VQKA 1JBMA 1GRIA 3L1AA 3JCMV 3A8MB 2RHUA 4ZN1A 3HRUA 1OOTA 2AT1B 5HVYB 3EOCB 2D0NA 4C92F 2OTLT 3EG1A 1ZA1B 4JPBW 1W4SA 1W2BS 3DJBA 5I11A 1JO8A 1N27A 2YSQA 1KFZA 4BDYA 1VQ8Q 1HD3A 3QWXX 3VV0A 1E9HB 1JSTB 4BUGA 5GAMh 3EH1A 5KYUB 4RCCA 4WF2A 4JRQA 2MMPA 2QQSA 1NJIR 4PLIA 4M77G 1RADB 1NYGA 1QP3A 3QUIA 3EG3A 4C0ZA 3H9NA 3FLGA 3EFOB 2V26A 3FJPA 1YN8A 2GQIA 4XU2A 3QDRB 4CFVB 1OL2B 2CP0A 2OAUA 1OV3A 3WVEB 2VXEA 4HCKA 2O88A 4EMKB 5AYFA 1VQLT 2FVUA 3PVLA 2X4XA 4OB3B 1GH6B 2X4WA 8ATCB 3TQ7P 5BNJB 2EPDA 3TVTA 4KBMB 1GUXA 4V2SA 1VQ5T 1AD6A 1YWOA 2LMJA 3OYCA 3G4SQ 4LDYA 1YFNA 5DLOA 3QHRB 4EIKA 4M7AA 1V1CA 3BG3A 1JXMA 5LJ5h 3G71T 1U1SA 2I0NA 4PJOB 4RODA 4EOQB 5GANe 1SPKA 5M9OA 5FROA 5FWCA 2CSQA 2XICA 2ZPEB 3CXCA 3TNIB 2EGAA 1WJSA 2QA4T 3QHWB 1SEMA 3RKYA 4IURA 3QWLA 3NGPA 5CR2A 2QDYB 5J3BA 4MFDA 1UNGD 1QKWA 3C95A 3NHNA 5DY9A 5EJCA 4M7DC 2RB6A 4EOLB 3QWYA 2ZCFB 2LQ8A 1XTDA 3SFMA 2P0PA 4OB0B 1NEBA 2KQWA 4EMKA 4C8QF 4EOKB 3S6WA 1KC8R 2NUTB 2E5KA 3EHRA 4C92G 5LJ3h 2DZ9A 2FPFA 3QZ9B 1TH7A 2VUBA 1MMNA 2GFAA 3SHWA
chains in the Genus database with same CATH topology
3OSSC 2L5QA 1M1FA 3ASKA 3NTKA 5GAN2 3CCJA 4C5IA 3SD4A 3RIRA 2BIVA 2Y4YA 5GAN8 4M78F 2DEQA 2LQKA 4C8QE 3FC3A 3NTHA 2QA4A 1Q81C 2F69A 3CPFA 4OF1A 3VYHB 3QJYA 4QSHA 4E7HA 1BI0A 4J6YA 4Z02A 2QEXA 3M56A 2LNVA 3QJ6A 1K8AC 4EDUA 4OB1B 3BY7A 3TREA 4PJOD 1BKBA 2D0QB 1KHCA 2RK1A 3JB9D 1UEBA 4NL2A 3CCMA 3OYMA 2JN0A 2ZPHB 5I2MA 1KG1A 3CD6T 5GMKh 1B34A 1FWZA 1BI2A 2P4TA 2O4XA 2QTXA 5KH6A 3M54A 1M90U 4VUBA 3CCRA 4ZTJA 3HPWA 2KAFA 5GAOm 4IUPA 2KMGA 2FHDA 1VIEA 4M7DB 3N5BB 2XG8D 4L5GA 3QYHB 1Y07A 1Q86C 1Y96B 3TW6A 2HAXA 3MEAA 1Q86U 1N6AA 4XTUA 1X6OA 3M4YA 3RKXA 2XDBA 4M78A 2EQUA 4HKEA 1VQMT 2K57A 4L6V5 4YTLA 2R5AA 3OS5A 4A53A 4EMGA 4PL6A 3MP1A 1BYMA 1H3ZA 2EQKA 2MF2A 3F70A 3OMCA 2QQAA 4M77B 4Y28E 4C8QD 1VQ9A 3OQ5A 4LOCA 4QQDA 3GIBA 3C12A 2ZPFB 3X20B 1LJOA 2RHXA 3DLLA 1JJ2S 4M7AD 4L59A 4FT4A 1UB4A 3MEUA 4RG2A 2WSCE 1VQ7T 2QQ8A 3JCMe 3OBYA 2JOYA 5GANf 2F5KA 4BACA 1MHNA 3V8LA 2QEXT 2M0OA 3PT9A 3OYIA 1VQKT 2RJDA 1YJNT 1R8OB 4QVCA 1BI3A 4TVRA 1VQ8T 2VGNA 3JRZA 2HQXA 1K9MU 5LJ3f 5GMKj 2G3RA 2RJEA 3JB9I 2XKOC 1VQPA 3QSUA 3JCMh 3OSVA 3H4CA 4N0AA 2JZ2A 3QZ5B 3RESA 3LWIA 1G3WA 4M7AE 5CKBA 4BB7A 4EMHA 3CC2A 1YJWA 4JX4A 3RUXA 1QVFA 4AKHA 1HK9A 1YI2A 3H6ZA 4LDVA 2BS4A 1NE8A 2YRVA 4HT8A 1Q82C 4M77F 2QDJA 3PNWC 2E70A 4BBRM 4C5GA 2P0KA 4F7UE 5GAOq 4JRIA 2EWNA 4GY5A 1XOVA 4C8QA 4DQ2A 2GFUA 3CCLT 3JB9H 2HBPA 5GAOr 2LCLA 4M75E 3A8LB 3CPWS 4R56A 4HCBA 2P0QA 2AHJB 1N8RU 4IUUA 4C8QC 5KE3A 4XTXA 1VQ6A 1NZ9A 4E7JA 4RG8A 4C0DB 3OYYA 4C92D 1UGRB 1KQ1A 2EIFA 4M78D 3A8GB 4ME7A 1O75A 2RO0A 1YJWT 3QYBA 2KY9A 3BW1A 4XU0A 3S3OA 2DPPB 3VKGA 2WSEE 2WSFE 3OA6A 4M7DF 3I56A 4EMKC 4LDXA 1WQ7A 2WACA 5L8RE 1VQ5A 2YHTA 2HD0A 5LJ5d 3CC4A 2MI6A 3M55A 1KHIA 5FU7B 5CKDA 3JCMX 3NTIA 4C5HA 3TU4K 1NPPA 4XU1A 3G4ST 3MO8A 3Q1JA 5LJ3g 4D6WA 2C06A 1YITT 1G3SA 3M5AA 1SSFA 3ER0A 3WVDB 4M7DG 1JRIA 3AHUA 1KQ2A 2XDDA 3FB9A 3HFOA 3MHXA 4JS5A 3E9GA 3P8BB 1YHQA 4AKIA 3P8HA 3JB9G 3OYEA 3I55T 3TEEA 3HFNA 3CCVT 2V8KA 4QVZA 3G6ET 2D6FA 2EKOA 2I2LA 3CEYA 4M7AB 2DTHA 2YLBA 2DD5A 3O8VA 2EJ9A 4M77D 4FL6A 2FL7A 3TCJA 4B9WA 1QW1A 3L42A 4A4EA 4ELYC 4M75D 5LJ5j 2NLUA 3QHSA 3LWHA 1VIFA 1KC8U 2CS7A 2IG0A 5CKHA 4DOWA 2K5FA 3HRTA 3LH0A 2CZ0B 4HNVA 4XAXB 5LJ3e 3OYNA 4J7IA 4BY6B 4M78E 2GF7A 3GLXA 4HL4A 2VV5A 4A4GA 2VYTA 5J26A 3L2UA 2DZCA 3HKSA 5A2QE 2DD4B 4LDWA 4BD3A 1I8FA 4JRPA 1VQ6T 1QLBA 3DL1A 2XDPA 3M9QA 1Y71A 4MZPA 4HCCA 5CK9A 3JCMJ 4ZTFA 3LLRA 3RKWA 3HB9A 4BE1A 1VQ9T 1NJIC 2DXCB 2ZZDA 3GPLA 1VQ4T 2L8DA 1RI0A 4QW2A 4ATOA 5CCAA 3CCMT 5FU6B 5IAYA 4HNUA 2JTMA 2K5IA 1PSEA 1BIAA 1WPYA 4R55A 2RA2A 5GAN7 4Q5WA 1VQ7A 3V7SA 4IUTA 3DB3A 2DD4A 2M1HA 1O9SA 2XIDA 4XTVA 4JLIA 4P5NA 3V7CA 1YJNA 3CC2T 2E1HA 4RMOA 2X4JA 5CQYA 4JUVA 3JCMc 3R6OA 2GQVA 4FT2A 4GLKA 1G3YA 4JDSA 3V8JA 3L2ZA 2CZ1B 5GAOl 1VQPT 2DXBB 2QF7A 2VGMA 1QVPA 3OW2S 3CC7T 1G3TA 4M75A 3CCUT 2RM4A 4BDZA 3RMSA 4M77E 1KD1U 3PGGA 3PIPA 2DD5B 2Y4XA 3V7RA 3G7ZA 4PLLA 2LVMA 3QBYA 2RJFA 4J6WA 2LDMA 2CZ7B 2ZPIB 4LD6A 1AHJB 2RHZA 4M75C 4HCZA 3G6EA 4XU3A 4HA8A 3X28B 4HLQA 2M16A 2JUFA 4MZTA 2BKDN 3LYIA 4JRKA 1M4ZA 3UDCA 3VKIA 2PUKB 3HP9A 2LCCA 1YCYA 3QIIA 3EFSA 1VQLA 5HK0A 5A0DA 2DK3A 3L2VA 2BS2A 2MAMA 2EFIA 2DO3A 1WGSA 4UC4A 2OTJT 4N4GA 2XD0A 4PJOC 5LJ5e 3OYKA 5GANd 3J80E 2RHYA 5LJ5g 2E6ZA 5DLQE 3BG5A 3GF5A 2OTLA 2V8IA 2LT4A 2LRQA 4LD9K 2EYQA 1JB0E 2RJCA 4XQ3A 3JCMg 2LTOA 2ZPBB 3LGFA 4DA4A 3L2WA 3JB9F 1DJ7B 3VUBA 3OMGA 3CBMA 3CPWA 3CCJT 1VQNA 4J6XA 2DIGA 4AI6A 3MEWA 4E7LA 4MMKA 4XK8E 4J8OA 4FU6A 3SWNB 4C92A 1U1TA 4HT9A 1XQHA 2DTIA 1WJRA 3M53A 3SB2A 2K5LA 3PFSA 4M7DA 3V8KA 3C94A 5CQXA 2DAQA 2IVWA 5FU6C 3OS0A 3CC7A 1M1KU 1X01A 3X26B 5D6WA 4A54A 4Y91A 3OYHA 2E5QA 4A4KA 5KCHA 5KCOA 1YHQT 5I2SA 1M5Q1 3L2QA 2CGHA 1WNLA 2E41A 2VXFA 4KUIA 5CKEA 3X24B 3VUZA 4C92E 2HNIA 5A0GA 5IN1A 1I81A 3X25B 3KBGA 5GMKi 4PJOG 5GANh 5D6XA 1QVGA 3P8DA 1NJIU 2D9TA 3FEOA 3E1SA 2GCXA 2ZGWA 3HZJA 5HY6A 3E19A 4MDWA 5DM7R 2K2VA 4NS5A 2RK2A 1VQMA 3PMIA 4NL3A 4QQ6A 2E65A 1YITA 2FYKA 2RI2A 2BUDA 2MWOA 2EJGA 2K3YA 4JX6A 4F7UF 3JCMQ 4A4FA 3UT1A 5KE2A 3CMAA 5J39A 1KD1C 2QFZA 4N0AC 5CKFA 4C8QG 1I5LA 3M57A 3INZA 1LOJA 3GOXA 5GAMe 4C92C 2FB7A 2KDSA 3FRNA 3OYAA 2PUOB 4BI4A 2EAYA 2QQBA 2O4XB 1M1GA 4M7AF 4Z6YA 5GANj 5GANg 4F7UG 2PVGB 3OYFA 3OB9A 2X4YA 1G5VA 4BE0A 5FU7C 3RERA 1VQ4A 5HKCA 4OMFB 5CIUA 4M6VA 1K73U 5I21A 3G71A 2B8AA 5GMKm 5FRNA 3CCLA 4KUDK 2RH2A 3GNGA 5LJ3d 3L2RA 1E7PA 4M75B 4O5VA 2A3LA 2DXBA 4FIBA 4ELJA 1PSFA 2XI9A 3META 3J7AF 3JB9J 1YI2T 3SWNC 1OZ2A 3LX7A 3M59A 4M78C 3KXTA 4MZMA 1H641 5GAN5 3I56T 4ZN3A 5LJ3j 5GMKe 1Q7YC 3TW7A 2M9UA 3CMAT 5C0MA 1N8RC 3C4SA 4E7IA 3HSBA 2R5MA 3CCRT 2KVQG 4QVDA 1UGPB 4JLGA 1VQOT 1WJQA 1B34B 1ZQ1A 2QI2A 3VU3C 5GAOp 5CVIA 2L3RA 3MEVA 1S72T 4M7AG 3QYEA 4OGCA 4CI0C 4X34A 1QVGS 1BI1A 2PU9B 2PQWA 3FIFA 4X9CA 1K8AU 3M58A 2QQ9A 2YLCA 2E64A 3LGLA 1I4K1 1K73C 2KMTA 4FSXA 5FRMA 3HRSA 2QQRA 2F5TX 5IT9E 3VJPA 4M77A 3OY9A 3OYJA 4OVAA 2JNGA 3RMQA 4OGEA 1EIFA 3CC4T 1LNXA 4PJOA 1UGSB 1N9RA 1KQSA 4MFEA 3JCMb 1QP2A 3ZEHA 1X75C 2JTFA 3E9FA 3KUFA 2KR6A 5CAIA 3JAME 2L89A 1VQKA 4M78B 1JBMA 2RHIA 3L1AA 2Y90A 2K3XA 3A8MB 2RHUA 3JCMV 4C0GA 4C92B 4ZN1A 4BE2A 1JJ2A 3HRUA 1Y96A 1K9MC 3OYDA 4DOVA 3CMEA 3PIOA 4IKFA 2V8JA 4N4HA 4C92F 2G77A 2OTLT 3SWNA 1W4SA 1RL2A 2R57A 3M4GA 1GXIE 1M90C 4FM4B 2CKKA 1FX7A 4J83A 1W2BS 1VQ8A 2EJFA 4IUQA 1VQNT 1N27A 5GAN4 3NFCA 3OBWA 4BDYA 3PTAA 4ZGDB 3VV0A 3ME9A 4B9XA 1U8RA 3QXEB 2H3JA 4E7KA 5GAMf 3UPUA 5GAN6 5GAMj 1Y7XA 3JSCA 4M75G 3OS2A 4BUGA 2E10A 4J7FA 4KT0E 3CD6A 4M7DE 3MCAB 5GAMh 2A7YA 3H8ZA 4RKUE 1Q81U 4BI3A 2HQEA 1ZBXA 1S72A 4JX5A 3DKMA 4N4IA 4EPCA 2DXTA 4RCCA 4WF2A 4JRQA 2MMPA 2QQSA 1V29B 4PLIA 3ZFJA 4M77G 4F7UB 3VYGA 3CCSA 3CCST 4M75F 3OW2A 3EFRA 1QP3A 3QUIA 2KSSA 2R58A 4OB2B 4ZGEB 4C0ZA 3FLGA 3FJPA 4JJNK 3JCMd 4XU2A 2PVDB 3QDRB 4M78G 2MWPA 2XU8A 2O01E 3S3MA 4A4HA 4C8QB 1IREB 2OAUA 2DKGA 3WVEB 2VXEA 2E12A 4NOYA 1VUBA 3OYGA 3OYBA 4EMKB 1OYXA 4XTZA 5AYFA 2FVUA 1VQLT 2X4XA 4OB3B 3CXCS 4OP0A 1D3BB 2X4WA 4O6JA 5LL6S 2DXUA 3QYGB 3MP8A 4XTWA 5FLXE 3G4SA 2ZZDB 2DXCA 1UGQB 4KULA 4KBMB 4V2SA 2RD1A 3GNFB 2EQJA 1VQ5T 3OYCA 2JVVA 4LDYA 3UWNA 4M7DD 3QPHA 2LC4A 2X35A 2RI3A 1NPRA 3EAEA 3CBOA 5DLOA 3VYGB 2QXFA 3CCUA 2DTOA 2EQMA 4M7AA 3BG3A 3QG1A 4C0DC 5LJ5h 5CO7A 4MMLA 4C5EA 4LDUA 4NC6A 3G71T 1YBYA 3MP6A 5GMKl 1U1SA 4PJOB 3A5ZB 3A8OB 5C6SA 5GAMg 3CCQA 1YIJT 4BBSM 1WQWA 5GANe 3BDLA 5EG2A 4II1A 5GAOn 3CCET 3GP8A 5M9OA 3CCVA 4J5YA 4QQGA 3JCMP 3DB4A 5FROA 4PNOA 3ZBDA 2KK4A 2XICA 1W2BA 4BI8B 5D6YA 2ZPEB 3KHIA 3CXCA 2XK0A 4X9DA 5A0LA 2CZ6B 5GAN3 4JS4A 1WJSA 3T9NA 2QA4T 2LX9A 2DVEA 2XHCA 3HBLA 2LT1A 1VQOA 1M9SA 2BS3A 1OI1A 3PMTA 2VC8A 3RKYA 2K4YA 4IURA 3CMET 3QWLA 4ZGJB 1OZ3A 4PKCC 2QDYB 4F7UA 5J3BA 5CR2A 1QVFS 3WXMB 5LJ5f 1YJ9A 4MFDA 2PVOB 4AKGA 1Q7YU 1KQSS 4MIMA 3C95A 3FDRA 3OYLA 3S3NA 1XNIA 1HXDA 3OS1A 3JCMW 1KC8C 5DY9A 2E6NA 1P92A 3HHTB 4E47A 5EJCA 5HK3A 4M77C 2RB6A 2DIQA 4M7DC 3CBPA 3A8HB 3BG9A 1FXXA 3QO3A 2ZCFB 3J81E 3I55A 1MGQA 2LQ8A 1XTDA 3LW5E 2P0PA 4OB0B 3SFMA 4CRIA 3BDUA 1D3BA 2DJZA 3CCQT 1M8VA 4MDXA 2WJ9A 3CCEA 2CYZB 3QKJA 2KQWA 1BIBA 4EMKA 3SDZA 4C8QF 3S6WA 3JCMf 4M7AC 3BFMA 3HO8A 1N9SA 3VKHA 4C92G 5LJ3h 4HNTA 2DZ9A 1IZ6A 4RCBA 4PJOF 3QZ9B 1TH7A 2VUBA 3HL8A 3URGA 2GFAA 4XTYA 1Q82U 1M1KC 4ELZC 1FKMA 4BY6C 4PJOE 3DLMA 5GAMd 2OTJA 1ZHIA 4C0FA 4IUVA 1YIJA 2ZPGB 1YJ9T 2RI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L8R E;  4RKU E;  3X24 B;  3X25 B;  1V29 B;  3WVD B;  3VYG A;  3VYH B;  1QP3 A;  4OB2 B;  4ZGE B;  4OB1 B;  2PVD B;  2D0Q B;  2O01 E;  1IRE B;  2DD5 A;  2ZPH B;  3WVE B;  2PUO B;  2CZ0 B;  4OB3 B;  2PVG B;  3QYG B;  2ZZD B;  2DXC A;  1UGQ B;  3QYH B;  2DD4 B;  4L6V 5;  2DXC B;  2ZZD A;  3VYG B;  1PSE A;  2DXB A;  1PSF A;  4Y28 E;  2ZPF B;  3X20 B;  2DD4 A;  3A8O B;  2WSC E;  1UGP B;  2CZ1 B;  2DXB B;  2ZPE B;  2DD5 B;  2CZ6 B;  2PU9 B;  2CZ7 B;  2ZPI B;  1AHJ B;  3X28 B;  3QZ5 B;  2PUK B;  4ZGJ B;  2QDY B;  1UGS B;  1QP2 A;  2PVO B;  3A8M B;  3HHT B;  1JB0 E;  2ZPB B;  3A8H B;  2ZCF B;  1DJ7 B;  3LW5 E;  4OB0 B;  3A8L B;  4XK8 E;  2CYZ B;  1GXI E;  2AHJ B;  4FM4 B;  1UGR B;  3A8G B;  3X26 B;  3QZ9 B;  4ZGD B;  3QXE B;  2DPP B;  2WSE E;  4KT0 E;  2WSF E;  2ZPG B; 
#chains in the Genus database with same CATH topology
 1M1F A;  3NTK A;  2B86 A;  3EG9 A;  1GCQ A;  1I5O B;  4OF1 A;  3MPU B;  1BI0 A;  2COY A;  4J6Y A;  4Z02 A;  1SRM A;  2RK1 A;  5I22 A;  3JB9 D;  1F5Q B;  2W9Z A;  2YUP A;  4F04 B;  2JN0 A;  1O9K B;  2VVK A;  3REA B;  3CMA Q;  1KG1 A;  3MIA B;  1B34 A;  1QWF A;  2P4T A;  1TG0 A;  2RN8 A;  1K73 R;  5KH6 A;  1UUE A;  1X27 A;  1BK2 A;  3CCR A;  2J05 A;  4IUP A;  2FHD A;  1VIE A;  4BCO B;  1PD0 A;  2OTJ Q;  2XG8 D;  4HVU A;  1Z9Q A;  3TW6 A;  3MEA A;  3M4Y A;  3RKX A;  2EQU A;  1H25 B;  1VQM T;  1H1Q B;  3RDV A;  3OS5 A;  4A53 A;  2CUB A;  1VQ7 Q;  4FSS A;  2HSE B;  4M77 B;  3BLQ B;  3OW2 P;  1VQ9 A;  4LOC A;  3NPF A;  1ZUY A;  2RQT A;  2E3H A;  3TNH B;  1UB4 A;  2WFY B;  2WSC E;  1VQ7 T;  2QQ8 A;  5IHI A;  3OBY A;  2JOY A;  3R6N A;  2CP5 A;  4CFN B;  1H3H A;  1YJN T;  4TVR A;  1VQ8 T;  1QMC A;  3I9Q A;  2M51 A;  5GMK j;  3MI9 B;  1VQP A;  4F70 B;  2VAS A;  4N0A A;  1GUX B;  3BHT B;  3QZ5 B;  5CKB A;  3CC2 A;  1YJW A;  4Y72 B;  1HK9 A;  2BS4 A;  4KGZ B;  1K76 A;  1Q82 C;  2DNU A;  1VQL Q;  3DOG B;  2E70 A;  4C5G A;  4F7U E;  5GAO q;  4ROC A;  1PKS A;  2CH4 A;  2DEU A;  2HBP A;  1TU0 B;  1X6B A;  4F6S B;  2K3B A;  1N8R U;  4C8Q C;  4IIO A;  2KBT A;  4RG8 A;  4C92 D;  1KQ1 A;  4BCQ B;  1UG1 A;  4M78 D;  2KY9 A;  3VKG A;  1SF9 A;  3OA6 A;  4HXJ A;  2WAC A;  1M8M A;  2HD0 A;  3CC4 A;  2MI6 A;  5CKD A;  1WHM A;  4AFZ C;  2J7I A;  4C5H A;  3G4S T;  1K9M R;  1SSF A;  1C9B A;  5KYW A;  3ER0 A;  2QEX Q;  3DDQ B;  1JRI A;  1WX6 A;  3FB9 A;  1QLY A;  1YHQ A;  4NST B;  2ESW A;  2D6F A;  4PK4 A;  2YLB A;  3O8V A;  3VS4 A;  1QMZ B;  4A4E A;  4M75 D;  1WHK A;  1BU1 A;  1VIF A;  2IG0 A;  3RR6 A;  2K5F A;  4XAX B;  5LJ3 e;  3GLX A;  4HL4 A;  4GBQ A;  4JRP A;  4LDW A;  4BD3 A;  1VQ6 T;  1M3A A;  4IMY B;  1Y71 A;  4HCC A;  5CK9 A;  1D3U B;  3JCM J;  3LLR A;  3VS7 A;  2DXC B;  1VQ4 T;  2PZ1 A;  4QW2 A;  3CCM T;  4FW1 A;  5IAY A;  4HNU A;  2K5I A;  1S1N A;  2W2H A;  1V76 A;  4IUT A;  3V7S A;  1O9S A;  1B07 A;  3V7C A;  1YJN A;  2E1H A;  4JUV A;  1G3Y A;  4M75 A;  3CCU T;  4BDZ A;  1KD1 U;  2DD5 B;  2C4G B;  3V7R A;  4OGR B;  2RJF A;  2HMA A;  3G6E A;  1AHJ B;  1VOM A;  2RHZ A;  4HCZ A;  6AT1 B;  3GTM S;  1B7T A;  4HLQ A;  2M16 A;  4MZT A;  4F17 A;  1YJ9 Q;  5KYX A;  1R0B G;  2LCC A;  1YCY A;  5ICP B;  5A0D A;  2MAM A;  1QCO A;  2EFI A;  1WGS A;  4PJO C;  5LJ5 e;  2KYB A;  2OTL A;  2DL7 A;  1IB8 A;  1JB0 E;  2RJC A;  5IHK A;  2ZPB B;  2WPA B;  3L2W A;  2XMF A;  3CCJ T;  2DIG A;  3SEM A;  3TN8 B;  4HT9 A;  1RAC B;  2K5L A;  3V8K A;  3C94 A;  4BCF B;  1GCQ C;  5FU6 C;  3EGD B;  5D6W A;  4A54 A;  4F7J B;  4Y91 A;  3OYH A;  2E5Q A;  4A4K A;  5I2S A;  1WNL A;  2K7A A;  2WMB B;  2A28 A;  1TSF A;  4F16 A;  1JQQ A;  1I81 A;  1PNJ A;  1VQM Q;  4J9E A;  2NUZ A;  5DM7 R;  2GBQ A;  1D1B A;  2RI2 A;  2CH4 W;  2MWO A;  1TXQ A;  2NUP A;  5KE2 A;  2QFZ A;  4C8Q G;  3UA7 A;  1I5L A;  3M57 A;  1GBQ A;  2DET A;  5GAM e;  2KYM A;  4C92 C;  2KDS A;  3FRN A;  2O4X B;  3M0P A;  5GAN g;  2YWW A;  2KI7 A;  4LUD A;  2X4Y A;  1G5V A;  2FEI A;  5CIU A;  2HSP A;  1URC B;  5FRN A;  1ZX6 A;  1TD6 A;  2DL3 A;  4O5V A;  4FYW B;  2FG0 A;  2MCN A;  1CSK A;  1MV0 B;  3CCV Q;  3M59 A;  2FPE A;  2E3I A;  5LJ3 j;  1W98 B;  2GGR A;  5C0M A;  3HSB A;  4E7I A;  1I07 A;  1UGP B;  1ZQ1 A;  4M7A G;  5GAO p;  2L3R A;  4AG2 C;  4OGC A;  1QVG S;  3FIF A;  4X9C A;  1K8A U;  1PHT A;  1YWP A;  2IIM A;  3M58 A;  4JJB A;  2KMT A;  5IT9 E;  3VJP A;  1FIN B;  3OYJ A;  1C0M A;  1UHF A;  2OX7 A;  4PJO A;  4MFE A;  3ZEH A;  1X75 C;  1AIS B;  3THK A;  2RHI A;  5EC7 A;  2Y90 A;  4KH0 B;  2BTT A;  2LP5 A;  2HL3 A;  4DOV A;  1VQ6 Q;  3SWN A;  3M4G A;  4KGV B;  1GXI E;  2C6T B;  3BLH B;  1FX7 A;  2EJF A;  1FMW A;  1X2Q A;  3NFC A;  3DTO A;  3QXE B;  2H3J A;  1WIE A;  5GAN 6;  5GAM j;  2EBP A;  4EON B;  4KT0 E;  3UF4 A;  2DL4 A;  1Q81 U;  4BI3 A;  1ZBX A;  1M2V A;  2DYB A;  4JX5 A;  4PFP A;  2L0A A;  2DXT A;  4K11 A;  1BCO A;  3ZFJ A;  4DBR A;  4F7U B;  4OB2 B;  1D0X A;  3EID B;  1OU9 A;  1KIK A;  1RLQ C;  4B6M A;  2MWP A;  1OGU B;  1ZLM A;  1IRE B;  4NOY A;  3OYG A;  1OYX A;  4XTZ A;  3ZL7 C;  2DME A;  2JW4 A;  4EOR B;  4OP0 A;  3CXC S;  4O6J A;  3MP8 A;  5HBH B;  2M0Y A;  3UWN A;  4M7D D;  4QKU A;  4BCM D;  2RI3 A;  2C5X B;  3EAE A;  3CBO A;  2QXF A;  4BCK B;  4C0D C;  4BCH B;  4C5E A;  4J9H A;  2JJ9 A;  1YBY A;  3MP6 A;  5GMK l;  1NLP C;  3CCQ A;  5C6S A;  5GAM g;  4CFU B;  4BBS M;  5EG2 A;  1K8A R;  3GP8 A;  3JCM P;  3ZBD A;  1JKW A;  1W2B A;  4BY1 X;  2NYS A;  5IF1 B;  4X9D A;  5ACB A;  2KRS A;  4JS4 A;  3T9N A;  2LX9 A;  1A0N B;  2DVE A;  4RTX A;  2VC8 A;  1PKT A;  1QKX A;  2K4Y A;  4BCJ B;  2QTV A;  5LJ5 f;  2KR3 A;  4AKG A;  2CCI B;  1HXD A;  3OS1 A;  3JCM W;  1KC8 C;  4CC2 A;  1P92 A;  3HHT B;  4E47 A;  4M77 C;  1OKV B;  2KEA A;  3J81 E;  1FVV B;  3BDU A;  2CYZ B;  2W99 A;  1BIB A;  3NMZ C;  1YP5 A;  4FCY A;  4M7A C;  1JXO A;  3BFM A;  4PJO F;  1VIN A;  4RCB A;  3BHU B;  1FKM A;  3EGU A;  4Z88 A;  2KXD A;  4IUV A;  1YIJ A;  4PFZ A;  1AWW A;  3OSS C;  2JS2 A;  2ZAE A;  2AZV A;  4E7Z A;  1H4L D;  3H0H A;  3RIR A;  2BIV A;  2Y4Y A;  1WDX A;  2DEQ A;  3FC3 A;  1OPK A;  1Q81 C;  2BZX A;  3UAT A;  3CPF A;  5IHN A;  3QJY A;  5AT1 B;  1M3B A;  1JOW A;  2LNV A;  1K8A C;  2KRN A;  4OB1 B;  1H28 B;  3TRE A;  4ZNX A;  2EGC A;  4NL2 A;  5IDP B;  3OYM A;  2CCH B;  5GMK h;  2VB6 A;  1FWZ A;  2EW3 A;  2QTX A;  4ZTJ A;  4M7D B;  1NBE B;  1Y96 B;  1MMD A;  1Q86 U;  1N6A A;  2OTJ A;  4M78 A;  5GJV B;  4CFW B;  2WXV B;  3M0Q A;  1SSH A;  4AFU C;  1OI9 B;  4M7A D;  1LJO A;  1ZSZ B;  2C0O A;  4BCI B;  2JMC A;  4L59 A;  4FT4 A;  3MEU A;  4RG2 A;  2KXC A;  1H92 A;  4PJM A;  4I3Z B;  3TSW A;  1MND A;  1ZUK A;  3V8L A;  2RJD A;  1VQP Q;  1BI3 A;  2VGN A;  2NUP B;  5GJW B;  5LJ3 f;  1PCX A;  2G3R A;  2C5V B;  3A1P A;  3FJ5 A;  1I0C A;  3JCM h;  3OSV A;  3H4C A;  2JZ2 A;  2RMO A;  3RES A;  2LZ6 B;  4EMH A;  3U23 A;  4JX4 A;  2LNH B;  3RUX A;  4AKH A;  4WCI A;  4HT8 A;  1NE8 A;  2AZS A;  4M77 F;  4BBR M;  1YI2 Q;  2P0K A;  4GY5 A;  2GFU A;  4J9F A;  3JB9 H;  1C6V X;  2DF6 A;  1LVK A;  4R56 A;  2BE7 D;  4IUU A;  1VQ6 A;  4D8D A;  3OYY A;  3A8G B;  1IGQ A;  1R77 A;  1E6G A;  1YIJ Q;  3EG2 A;  5I5Z B;  3BW1 A;  2EQI A;  1R0C B;  1YJ9 T;  4EMK C;  1WQ7 A;  1NG2 A;  4II5 B;  1AD5 A;  3TU4 K;  4XU1 A;  2BPM B;  2DL5 A;  2DRK A;  1S72 Q;  1N5Z A;  1D0Y A;  4M7D G;  2PNI A;  3LQ5 B;  1G8X A;  2WIH B;  1FMK A;  1AEY A;  3P8B B;  4J9B A;  4AKI A;  3JB9 G;  3RBB B;  3I55 T;  2ROL A;  2V8K A;  4QVZ A;  3G6E T;  2O2O A;  2EKO A;  2I2L A;  1YHQ Q;  4BXX X;  2DTH A;  3TCJ A;  4JZ4 A;  3B57 A;  4DOW A;  3HRT A;  1KSW A;  4J7I A;  4BY6 B;  4M78 E;  1TWB A;  2VV5 A;  4A4G A;  1RAF B;  1TUC A;  2JGZ B;  1Q86 R;  4QT7 A;  3DL1 A;  3M9Q A;  1UJY A;  1OEB A;  3RKW A;  3HB9 A;  4EOM B;  3GPL A;  2QYZ A;  5CCA A;  1JEG A;  1PSE A;  2X3W D;  3M03 A;  4DBH A;  3DB3 A;  4OMM A;  2DD4 A;  4XTV A;  4P5N A;  4YOS A;  3CC2 T;  2X4J A;  5CQY A;  2DM1 A;  1XO2 A;  1VQP T;  4F7N B;  2HL5 C;  2VGM A;  1QVP A;  3OW2 S;  1G3T A;  3A98 A;  3G7Z A;  2LVM A;  2LDM A;  4M75 C;  5HQ0 B;  4XU3 A;  2MOX A;  2PUK B;  1WXB A;  4E7S A;  5HK0 A;  2NWM A;  3VRY A;  4UC4 A;  3OYK A;  2KT1 A;  5DLQ E;  3TSZ A;  2F2V A;  4XQ3 A;  3JCM g;  1M3C A;  1W6X A;  3VUB A;  3OMG A;  3CPW A;  1X2K A;  4MMK A;  2M02 A;  1NM7 A;  4C92 A;  3CQT A;  1IHV A;  1XQH A;  1HJD A;  3SB2 A;  3PFS A;  2IPO B;  5IHY A;  1M1K U;  2QGF B;  3CD6 Q;  3GBQ A;  2C5N B;  1F1B B;  2EKH A;  3CCJ Q;  1YCS B;  2E41 A;  2KT8 A;  2QAS A;  1U3O A;  2COW A;  2YUN A;  5CKE A;  3X24 B;  3VUZ A;  2HNI A;  5A0G A;  4PJO G;  5D6X A;  3FEO A;  1PRM C;  2ZGW A;  3HZJ A;  3E19 A;  1AWO A;  1MNE A;  2RK2 A;  2JT4 A;  1VYT A;  4YC3 B;  3C0C A;  2BUD A;  2EJG A;  2K3Y A;  2OJ2 A;  2O9S A;  1KD1 C;  5CKF A;  4BCP B;  2MK5 A;  4WTO B;  3GOX A;  2DFU A;  3OYA A;  5ECA A;  2QQB A;  1M1G A;  3G1J A;  4BCM B;  4F7U G;  3OYF A;  2DJQ A;  5FU7 C;  1VQ4 A;  2WIP B;  4OMF B;  2IW9 B;  1K73 U;  4CRL B;  1IXD A;  4KUD K;  3VS3 A;  3L2R A;  5LJ3 d;  4ELJ A;  1YI2 T;  4GLM A;  3LX7 A;  1EFN A;  4M78 C;  4D8K A;  5GAN 5;  2M9U A;  3CMA T;  3C4S A;  3TNW B;  4AT1 B;  2KRM A;  3CCR T;  4QVD A;  4JLG A;  3H0I A;  5CVI A;  1S72 T;  2LX7 A;  1W70 A;  3QYE A;  1AT1 B;  2QQ9 A;  1WHJ A;  3NDQ A;  3LH5 A;  4DEX A;  1H8K A;  5FRM A;  1GCP A;  4CFX B;  4M77 A;  4OVA A;  1WA7 A;  2YT6 A;  3RMQ A;  2B9R A;  3CC4 T;  1UGS B;  1KQS A;  1QVG P;  5IXF A;  2JTF A;  1PD1 A;  3CME Q;  4M78 B;  1KK7 A;  2K3X A;  4RTU A;  1K9M C;  1Y96 A;  3OYD A;  3CME A;  3PIO A;  4IKF A;  2V8J A;  1XJW B;  3I35 A;  3M0S A;  4DBQ A;  3I55 Q;  2HKN A;  4FM4 B;  2CKK A;  3CC7 Q;  1H1S B;  5GAN 4;  3OBW A;  3PTA A;  4ZGD B;  1K9A A;  4B9X A;  1U8R A;  3UPU A;  3JSC A;  3OS2 A;  4J7F A;  3CD6 A;  4M7D E;  1T3L A;  2A7Y A;  3VS2 A;  4IIM A;  1S72 A;  2DLP A;  3DKM A;  4EPC A;  1X69 A;  2LJ0 A;  4X1V A;  4F14 A;  2HZY A;  4M75 F;  3OW2 A;  3H0F A;  1U06 A;  2KSS A;  2EVR A;  2QG9 B;  2PVD B;  1K1Z A;  4F7S B;  2XU8 A;  2CP7 A;  2O01 E;  5KYY A;  3S3M A;  4C8Q B;  2K2M A;  2QGS A;  2G6F X;  2NUT A;  2E12 A;  1VUB A;  2YRD A;  4RTY A;  3CCE Q;  4CXA B;  1UJ0 A;  5LL6 S;  2DXU A;  3QYG B;  5FLX E;  4XTW A;  3G4S A;  2ZZD B;  2HBW A;  2RD1 A;  3GNF B;  2EQJ A;  2JVV A;  1NPR A;  2UZB B;  3VYG B;  1ZBJ A;  2QDL A;  4TTH A;  1BB9 A;  3QG1 A;  3EHQ A;  5CO7 A;  4MML A;  4LDU A;  4NC6 A;  4F6W B;  3MJX A;  2PJQ A;  4ANJ A;  4HVW A;  3A8O B;  4HVV A;  1YIJ T;  5GAO n;  3BDL A;  2V1Q A;  4OR5 B;  3KHI A;  2ROT A;  5A0L A;  4PJN A;  1KQS P;  2FRW A;  2CSI A;  2W0Z A;  4RTZ A;  2LT1 A;  1UHC A;  3PO3 S;  2BS3 A;  3PMT A;  3CME T;  4PKC C;  1QVF S;  3ULR B;  1YJ9 A;  2PVO B;  3OYL A;  1W2B P;  4LUE A;  2RF0 A;  1B3Q A;  3CBP A;  1FXX A;  3MKD A;  3I55 A;  2MYS A;  3CCQ T;  2BKZ B;  1M8V A;  2WJ9 A;  3QKJ A;  4FW2 A;  3JCM f;  1AOJ A;  3VKH A;  4HNT A;  5I21 A;  5KE3 A;  1IO6 A;  4M4Z A;  1PG5 B;  1M1K C;  4BY6 C;  3DLM A;  1ZHI A;  4C0F A;  4EOI B;  1D0Z A;  4J9I A;  5GAN 2;  3CCJ A;  1HSQ A;  1CKA A;  4C5I A;  1ABQ A;  3SD4 A;  5GAN 8;  4M78 F;  1M30 A;  4C8Q E;  2LQK A;  1GL5 A;  3NTH A;  4G6L B;  2QA4 A;  2F69 A;  2L3S A;  2V22 B;  4LN2 A;  2EUF A;  4E7H A;  4KH1 B;  2QEX A;  3M56 A;  3QJ6 A;  2A37 A;  4DEY A;  1BKB A;  1KHC A;  1UEB A;  2W96 A;  2UZL B;  3E2U A;  5DQV A;  2O4X A;  1ABO A;  2YRC A;  3M54 A;  1M90 U;  3HPW A;  2KAF A;  5GAO m;  1ZSG A;  2KMG A;  3N5B B;  2HCK A;  4L5G A;  3QYH B;  1Y07 A;  4ESR A;  4CC7 A;  4XTU A;  2L3Q A;  2DVJ A;  4HKE A;  1WYX A;  5FGK B;  4PL6 A;  2EQK A;  3F70 A;  2I40 B;  1RI9 A;  2QQA A;  3GIB A;  3C12 A;  3X20 B;  2RHX A;  3UA6 A;  1TFB A;  1ACM B;  4FYY B;  1TS9 A;  5GAN f;  2MIO A;  2F5K A;  2UZD B;  2YDL A;  1MHN A;  2KE9 A;  2M0O A;  1CKB A;  1R8O B;  3EG9 B;  3JRZ A;  2HQX A;  1K9M U;  2RJE A;  3JB9 I;  2XKO C;  2FPD A;  2F2X A;  2R7G A;  3LWI A;  1G3W A;  2K79 A;  2LJ3 A;  3H6Z A;  4LDV A;  3O5Z A;  4JJD A;  1Y0M A;  1YJW Q;  4Z89 A;  3PNW C;  1KJW A;  4JRI A;  4RUG A;  2C5O B;  1IGU A;  3CCL T;  1G3N C;  1ZSZ A;  5GAO r;  2LCL A;  3A8L B;  2P0Q A;  2AHJ B;  1NZ9 A;  4E7J A;  4C0D B;  2L2P A;  2GTO A;  2CP2 A;  3QYB A;  5L23 A;  1UNL D;  4DBF A;  2DPP B;  3REB B;  4LDX A;  1VQ5 A;  3DDP B;  3HTR A;  1KHI A;  5FU7 B;  1EX4 A;  3MO8 A;  3Q1J A;  5LJ3 g;  3EH2 A;  2LQN A;  1VQ5 Q;  2C06 A;  3CCS Q;  1YIT T;  1G3S A;  3M5A A;  3K7A M;  1G83 A;  2ABL A;  1JU5 C;  3WVD B;  2XDD A;  4A63 B;  2DRM A;  3MHX A;  2RQU A;  3E9G A;  1UDL A;  2PMI B;  1MMG A;  2A0F B;  1BU2 A;  1U5S A;  3TEE A;  3HFN A;  2DX1 A;  3CCV T;  1RAH B;  2JXB A;  3CEY A;  3CCE A;  2EGE A;  2EJ9 A;  1SKU B;  1UTI A;  2FL7 A;  1QW1 A;  3L42 A;  2NLU A;  3QHS A;  3LWH A;  1H27 B;  5CKH A;  2CUD A;  1AZG B;  1WHG A;  1N8R R;  3L2U A;  2DZC A;  3HKS A;  2DD4 B;  1QLB A;  1ENW A;  2FO0 A;  1NJI C;  4ZTF A;  1VQ9 T;  4BE1 A;  4BY7 X;  4ATO A;  5FU6 B;  1WPY A;  2YUQ A;  2RA2 A;  4Q5W A;  1VQ7 A;  2K6D A;  2M1H A;  2HEQ A;  2XID A;  3JV3 A;  4BCN B;  4JLI A;  2DER A;  7AT1 B;  3O0G D;  1GY3 B;  2PK2 A;  1KXU A;  3JCM c;  4GLK A;  4JDS A;  3V8J A;  1GBR A;  2DXB B;  2QF7 A;  4OMO A;  1X43 A;  4M77 E;  3PGG A;  3PIP A;  2QK0 A;  2D8J A;  4PLL A;  1W1F A;  3VS1 A;  3QBY A;  2RQV A;  2ZPI B;  4LD6 A;  2HKQ B;  4HA8 A;  3X28 B;  3UDC A;  3G6E Q;  3HP9 A;  3QII A;  4AMC A;  3EFS A;  2DK3 A;  2BS2 A;  2DO3 A;  1HYO A;  1T0J A;  3CC2 Q;  2XD0 A;  5GAN d;  4BCG B;  2RHY A;  4PJJ A;  3GF5 A;  4RTT A;  2LT4 A;  2EYQ A;  3JB9 F;  2LTO A;  4DA4 A;  1DJ7 B;  2CT4 A;  1VQN A;  2QAZ A;  4J6X A;  4E7L A;  4AI6 A;  2UZE B;  4J8O A;  1X6G A;  4FU6 A;  1BBZ A;  1U1T A;  2YUO A;  3I5R A;  1WJR A;  2LCS A;  4M7D A;  5HCK A;  5CQX A;  2DAQ A;  2IVW A;  3OS0 A;  1X01 A;  5CEI B;  2K9G A;  1WLP B;  3L2Q A;  2VXF A;  4CC4 B;  1UFF A;  1IRX A;  1FMV A;  5IN1 A;  3X25 B;  3KBG A;  5GMK i;  2RNA A;  3VRZ A;  2DL8 A;  2J06 A;  2J6F A;  1QVG A;  2CRE A;  2DA9 A;  3P8D A;  2ED1 A;  2CDT A;  5D7U A;  1NJI U;  3E1S A;  2GCX A;  3POM A;  1TUD A;  2K2V A;  4NS5 A;  5KYY B;  4E2F B;  4FX3 B;  4QQ6 A;  2E65 A;  4JJC A;  1YIT A;  2FYK A;  3EFO A;  4BCN D;  4F7U F;  3JCM Q;  3INZ A;  1LOJ A;  2FB7 A;  2PUO B;  4BI4 A;  1GFD A;  2WMA B;  1Q82 R;  4M7A F;  1H26 B;  4EOP B;  5GAN j;  2FRY A;  2DBM A;  1OPL A;  1K0X A;  1IHW A;  4OMP A;  4EOJ B;  5HKC A;  4M6V A;  1N4M A;  3G71 A;  5GMK m;  3CCL A;  3GNG A;  3I5S A;  1E7P A;  2A3L A;  4Y92 A;  1PSF A;  4LE9 A;  3CCU Q;  3MET A;  1PWT A;  3JB9 J;  3J7A F;  2J6O A;  4MZM A;  4OMN A;  5GMK e;  3TW7 A;  2EYZ A;  4EOS B;  2R5M A;  2KVQ G;  1VQO T;  1GFC A;  1WJQ A;  1B34 B;  3VU3 C;  2QI2 A;  1TTH B;  4CI0 C;  2KGT A;  2DMO A;  2PU9 B;  2PQW A;  3VS5 A;  3H41 A;  2YLC A;  1K73 C;  3LGL A;  4FSX A;  2QQR A;  3OY9 A;  3EG0 A;  4KRD B;  4OGE A;  1EIF A;  1LNX A;  1TOV A;  5CAI A;  4Z8A A;  3JAM E;  2L89 A;  4C92 B;  1JJ2 A;  4BE2 A;  4C0G A;  1VQN Q;  1OU8 A;  1I1J A;  2COZ A;  4N4H A;  2G77 A;  3EGX A;  1ZSZ C;  1RL2 A;  2R57 A;  1P5E B;  1M90 C;  2BZY A;  4J83 A;  1VQ8 A;  2MPX C;  4IUQ A;  1VQN T;  1UGV A;  1QCF A;  5KYW B;  3ME9 A;  4E7K A;  5GAM f;  3CC4 Q;  3M0R A;  1Y7X A;  4M75 G;  2E10 A;  3MCA B;  3H8Z A;  4RKU E;  1FYN A;  2HQE A;  4ROE A;  4N4I A;  1OUL A;  1WZO A;  2JS0 A;  2H3E B;  2PTK A;  1V29 B;  1OX9 A;  3VYG A;  3CCS A;  1T3S A;  3CCS T;  1YIT Q;  3EFR A;  1MV3 A;  2R58 A;  3PE0 A;  4ZGE B;  2YXY A;  2QA4 Q;  2O9V A;  4LXC A;  4JJN K;  1M2V B;  3JCM d;  4M78 G;  2Z0W A;  4A4H A;  3RGF B;  3KFV A;  2DKG A;  2DE0 X;  3CCR Q;  4JZ3 A;  3OYB A;  2EYX A;  2V1R A;  2LW4 A;  5HBE B;  1D3B B;  4E6R A;  2DXC A;  4KUL A;  1UGQ B;  3RNJ A;  2DBK A;  1OIY B;  1JJ2 P;  3QPH A;  1K4U S;  2LC4 A;  2X35 A;  1RAE B;  1SHF A;  3CXC P;  3CCU A;  2DTO A;  2EQM A;  4RTV A;  2JTE A;  3A5Z B;  1PKD B;  2A36 A;  3CCE T;  1WQW A;  4II1 A;  3CCV A;  4J5Y A;  4QQG A;  2BE9 B;  3DB4 A;  4PNO A;  2KK4 A;  2DIL A;  4BI8 B;  1EZZ B;  5D6Y A;  1PM3 A;  2XK0 A;  2CZ6 B;  5IDN B;  5GAN 3;  3AT1 B;  2XHC A;  3HBL A;  1VQO A;  1M9S A;  1OQK A;  1OI1 A;  1MUZ A;  4HCB A;  1OZ3 A;  4ZGJ B;  4F7U A;  1M1K R;  3WXM B;  2VWF A;  2OTL Q;  1Q7Y U;  1KQS S;  2ENM A;  4MIM A;  3FDR A;  3S3N A;  1XNI A;  4F6U B;  2CP3 A;  2PK9 B;  2E6N A;  1RLP C;  2DYI A;  2LQW A;  5HK3 A;  1VYV A;  2DIQ A;  1ARK A;  4CFM B;  3A8H B;  3BG9 A;  3QO3 A;  1MGQ A;  3LW5 E;  4CRI A;  1QVF P;  1D3B A;  2DJZ A;  2OAW A;  1WI7 A;  4MDX A;  3SDZ A;  3M0T A;  4UN0 A;  4CC3 A;  3HO8 A;  1AVZ C;  1N9S A;  2LJ1 A;  3URG A;  1IZ6 A;  1Q82 U;  3HL8 A;  3I56 Q;  4XTY A;  4PJO E;  4ELZ C;  5GAM d;  2ZPG B;  2RI5 A;  1G2B A;  3BE3 A;  2L5Q A;  5EFQ B;  4KGX B;  3ASK A;  3D7S B;  1OL1 B;  2JM8 A;  1WHH A;  1K0S A;  4AG1 C;  1KD1 R;  2X1N B;  1D1C A;  3VYH B;  4QSH A;  2P4R A;  2X3X D;  4CFU D;  4EDU A;  3BY7 A;  4PJO D;  1WHL A;  2D0Q B;  1JSU B;  2RQW A;  5IXB A;  3CCM A;  2ZPH B;  5I2M A;  3CD6 T;  4ORZ A;  1BI2 A;  2BZ8 A;  4VUB A;  1OX8 A;  1Q86 C;  1D09 B;  2HAX A;  1RAB B;  1X6O A;  2XDB A;  2K57 A;  3MY5 B;  4L6V 5;  4YTL A;  1UEC A;  2R5A A;  1Q7Y R;  4EMG A;  3MP1 A;  1BYM A;  1VA7 A;  1H3Z A;  3OMC A;  2MF2 A;  4Y28 E;  2P84 A;  4C8Q D;  2E4H A;  3OQ5 A;  4QQD A;  1OIU B;  2ZPF B;  3DLL A;  1JJ2 S;  5HNB B;  5FW9 A;  1LPL A;  3JCM e;  3G33 B;  4EC8 B;  4BAC A;  2QEX T;  3PT9 A;  2VKN A;  3OYI A;  1VQK T;  4QVC A;  1RAI B;  1ZUU A;  4OML A;  2KNB B;  4R0K A;  4J9C A;  2A08 A;  3QSU A;  1ZA2 B;  4M7A E;  1VQK Q;  4BB7 A;  3BHV B;  1QVF A;  1YI2 A;  2YRV A;  4BCQ D;  4AFS C;  3F5X B;  2QDJ A;  1YNZ A;  2EWN A;  2I53 A;  3IQL A;  1XOV A;  2SEM A;  4C8Q A;  4DQ2 A;  1OKW B;  2SRC A;  2JMA A;  2EYY A;  4M75 E;  3CPW S;  5L2W B;  1QQJ A;  4XTX A;  1YJW T;  1UGR B;  2EIF A;  4ME7 A;  1O75 A;  4EOO B;  2RO0 A;  2J6K A;  3VS0 A;  4XU0 A;  3S3O A;  2WSE E;  1D1A A;  1SRL A;  2WSF E;  4M7D F;  2IVX A;  2IN3 A;  3I56 A;  2GTJ A;  5L8R E;  2YHT A;  5LJ5 d;  3M55 A;  3JCM X;  3NTI A;  1NPP A;  1WFW A;  4D6W A;  2JM9 A;  2IW8 B;  2X9H A;  2FZG B;  5HBJ B;  1NLO C;  1WXU A;  3AHU A;  1KQ2 A;  1H24 B;  3HFO A;  4JS5 A;  2F2W A;  3CCM Q;  1VOL A;  3P8H A;  2F2C A;  3OYE A;  4M7A B;  4ELL A;  4J9D A;  2DD5 A;  4M77 D;  4ELY C;  2RPN A;  1RAG B;  4FL6 A;  4B9W A;  2QGG A;  5LJ5 j;  1KC8 U;  2FZK B;  4KRT A;  3MY1 B;  2CS7 A;  3LH0 A;  2CZ0 B;  4HNV A;  1VYU A;  3OYN A;  2GF7 A;  2VYT A;  5J26 A;  5A2Q E;  3CCL Q;  1I8F A;  2XDP A;  4MZP A;  5KYN A;  2IW6 B;  2ZZD A;  2L8D A;  1RI0 A;  1Z9Z A;  2AKL A;  2O31 A;  3G71 Q;  2JTM A;  1BIA A;  5LQF B;  1UE9 A;  5KYX B;  4YOO A;  4R55 A;  5GAN 7;  2PHG A;  5IH2 A;  1UNH D;  1Q95 G;  1VQ9 Q;  4RMO A;  1SHG A;  3VS6 A;  3R6O A;  2GQV A;  4FT2 A;  3L2Z A;  2CZ1 B;  2AIR B;  4LNP A;  5GAO l;  3CC7 T;  2RM4 A;  1VYW B;  5FWB A;  3M0U A;  3RMS A;  5LMK B;  2D1X A;  2C0T A;  2Y4X A;  5DQW A;  2H8H A;  2AKK A;  4PFO A;  4J6W A;  2CZ7 B;  1BCM A;  2RQR A;  5KYU A;  2JUF A;  1RAA B;  2BKD N;  3LYI A;  4JRK A;  1M4Z A;  3VKI A;  3BLR B;  1VQL A;  2CT3 A;  3L2V A;  2OTJ T;  4N4G A;  3J80 E;  4AFQ C;  5LJ5 g;  2E6Z A;  3BG5 A;  2V8I A;  2LRQ A;  4LD9 K;  2HQH A;  3LGF A;  4EC9 B;  4PJL A;  9ATC B;  2HDA A;  4FYV B;  3CBM A;  2OI3 A;  4OMQ A;  3MEW A;  4XK8 E;  3SWN B;  1M90 R;  1AWJ A;  1AZE A;  1E6H A;  1TUG B;  2CP6 A;  2DTI A;  3M53 A;  1AWX A;  3CC7 A;  3X26 B;  2W9F A;  5KCO A;  3EJ1 B;  5KCH A;  1YHQ T;  1M5Q 1;  1E7O A;  2FZC B;  3CPW P;  2CGH A;  1O9K A;  4KUI A;  1M2O A;  1NEG A;  2ED0 A;  2X51 A;  4C92 E;  4KRC B;  1T0H A;  2ECZ A;  1QCN A;  5GAN h;  1WXT A;  2D9T A;  5HY6 A;  4MDW A;  1VQM A;  2AK5 A;  3PMI A;  4NL3 A;  2D8H A;  4JX6 A;  4A4F A;  3UT1 A;  3CMA A;  1Q81 R;  5J39 A;  4N0A C;  4YOZ A;  1C1A A;  1PRL C;  1PC0 A;  2EAY A;  4J9G A;  4Z6Y A;  2WEV B;  2L3P A;  1VQ4 Q;  1Y57 A;  2PVG B;  2ATC B;  3OB9 A;  4BE0 A;  3RER A;  2GNC A;  2B8A A;  1MMA A;  2RH2 A;  4RTW A;  2EYW A;  1H1P B;  2UUE B;  4M75 B;  2DXB A;  1ZP2 A;  3QDF A;  4FIB A;  2XI9 A;  1NYF A;  1H1R B;  3EGX B;  2WHB B;  3SWN C;  1OZ2 A;  3KXT A;  1H64 1;  3I56 T;  4ZN3 A;  1Q7Y C;  1LCK A;  2CJM B;  1N8R C;  4FYX B;  3CCQ Q;  4F7L B;  1YJN Q;  2KRO A;  3MEV A;  5CYI B;  4X34 A;  1BI1 A;  2G9X B;  2E64 A;  1I4K 1;  1SG5 A;  3HRS A;  1M27 C;  2F5T X;  1J3T A;  1QWE A;  2JNG A;  2C0I A;  1VQO Q;  3EGD A;  2W10 A;  2F1L A;  1N9R A;  3JCM b;  1QP2 A;  3KUF A;  8AT1 B;  3E9F A;  2KR6 A;  1RUW A;  3PVQ A;  1VQK A;  1JBM A;  1GRI A;  3L1A A;  3JCM V;  3A8M B;  2RHU A;  4ZN1 A;  3HRU A;  1OOT A;  2AT1 B;  5HVY B;  3EOC B;  2D0N A;  4C92 F;  2OTL T;  3EG1 A;  1ZA1 B;  4JPB W;  1W4S A;  1W2B S;  3DJB A;  5I11 A;  1JO8 A;  1N27 A;  2YSQ A;  1KFZ A;  4BDY A;  1VQ8 Q;  1HD3 A;  3QWX X;  3VV0 A;  1E9H B;  1JST B;  4BUG A;  5GAM h;  3EH1 A;  5KYU B;  4RCC A;  4WF2 A;  4JRQ A;  2MMP A;  2QQS A;  1NJI R;  4PLI A;  4M77 G;  1RAD B;  1NYG A;  1QP3 A;  3QUI A;  3EG3 A;  4C0Z A;  3H9N A;  3FLG A;  3EFO B;  2V26 A;  3FJP A;  1YN8 A;  2GQI A;  4XU2 A;  3QDR B;  4CFV B;  1OL2 B;  2CP0 A;  2OAU A;  1OV3 A;  3WVE B;  2VXE A;  4HCK A;  2O88 A;  4EMK B;  5AYF A;  1VQL T;  2FVU A;  3PVL A;  2X4X A;  4OB3 B;  1GH6 B;  2X4W A;  8ATC B;  3TQ7 P;  5BNJ B;  2EPD A;  3TVT A;  4KBM B;  1GUX A;  4V2S A;  1VQ5 T;  1AD6 A;  1YWO A;  2LMJ A;  3OYC A;  3G4S Q;  4LDY A;  1YFN A;  5DLO A;  3QHR B;  4EIK A;  4M7A A;  1V1C A;  3BG3 A;  1JXM A;  5LJ5 h;  3G71 T;  1U1S A;  2I0N A;  4PJO B;  4ROD A;  4EOQ B;  5GAN e;  1SPK A;  5M9O A;  5FRO A;  5FWC A;  2CSQ A;  2XIC A;  2ZPE B;  3CXC A;  3TNI B;  2EGA A;  1WJS A;  2QA4 T;  3QHW B;  1SEM A;  3RKY A;  4IUR A;  3QWL A;  3NGP A;  5CR2 A;  2QDY B;  5J3B A;  4MFD A;  1UNG D;  1QKW A;  3C95 A;  3NHN A;  5DY9 A;  5EJC A;  4M7D C;  2RB6 A;  4EOL B;  3QWY A;  2ZCF B;  2LQ8 A;  1XTD A;  3SFM A;  2P0P A;  4OB0 B;  1NEB A;  2KQW A;  4EMK A;  4C8Q F;  4EOK B;  3S6W A;  1KC8 R;  2NUT B;  2E5K A;  3EHR A;  4C92 G;  5LJ3 h;  2DZ9 A;  2FPF A;  3QZ9 B;  1TH7 A;  2VUB A;  1MMN A;  2GFA A;  3SHW A; 
#chains in the Genus database with same CATH homology
 3OSS C;  2L5Q A;  1M1F A;  3ASK A;  3NTK A;  5GAN 2;  3CCJ A;  4C5I A;  3SD4 A;  3RIR A;  2BIV A;  2Y4Y A;  5GAN 8;  4M78 F;  2DEQ A;  2LQK A;  4C8Q E;  3FC3 A;  3NTH A;  2QA4 A;  1Q81 C;  2F69 A;  3CPF A;  4OF1 A;  3VYH B;  3QJY A;  4QSH A;  4E7H A;  1BI0 A;  4J6Y A;  4Z02 A;  2QEX A;  3M56 A;  2LNV A;  3QJ6 A;  1K8A C;  4EDU A;  4OB1 B;  3BY7 A;  3TRE A;  4PJO D;  1BKB A;  2D0Q B;  1KHC A;  2RK1 A;  3JB9 D;  1UEB A;  4NL2 A;  3CCM A;  3OYM A;  2JN0 A;  2ZPH B;  5I2M A;  1KG1 A;  3CD6 T;  5GMK h;  1B34 A;  1FWZ A;  1BI2 A;  2P4T A;  2O4X A;  2QTX A;  5KH6 A;  3M54 A;  1M90 U;  4VUB A;  3CCR A;  4ZTJ A;  3HPW A;  2KAF A;  5GAO m;  4IUP A;  2KMG A;  2FHD A;  1VIE A;  4M7D B;  3N5B B;  2XG8 D;  4L5G A;  3QYH B;  1Y07 A;  1Q86 C;  1Y96 B;  3TW6 A;  2HAX A;  3MEA A;  1Q86 U;  1N6A A;  4XTU A;  1X6O A;  3M4Y A;  3RKX A;  2XDB A;  4M78 A;  2EQU A;  4HKE A;  1VQM T;  2K57 A;  4L6V 5;  4YTL A;  2R5A A;  3OS5 A;  4A53 A;  4EMG A;  4PL6 A;  3MP1 A;  1BYM A;  1H3Z A;  2EQK A;  2MF2 A;  3F70 A;  3OMC A;  2QQA A;  4M77 B;  4Y28 E;  4C8Q D;  1VQ9 A;  3OQ5 A;  4LOC A;  4QQD A;  3GIB A;  3C12 A;  2ZPF B;  3X20 B;  1LJO A;  2RHX A;  3DLL A;  1JJ2 S;  4M7A D;  4L59 A;  4FT4 A;  1UB4 A;  3MEU A;  4RG2 A;  2WSC E;  1VQ7 T;  2QQ8 A;  3JCM e;  3OBY A;  2JOY A;  5GAN f;  2F5K A;  4BAC A;  1MHN A;  3V8L A;  2QEX T;  2M0O A;  3PT9 A;  3OYI A;  1VQK T;  2RJD A;  1YJN T;  1R8O B;  4QVC A;  1BI3 A;  4TVR A;  1VQ8 T;  2VGN A;  3JRZ A;  2HQX A;  1K9M U;  5LJ3 f;  5GMK j;  2G3R A;  2RJE A;  3JB9 I;  2XKO C;  1VQP A;  3QSU A;  3JCM h;  3OSV A;  3H4C A;  4N0A A;  2JZ2 A;  3QZ5 B;  3RES A;  3LWI A;  1G3W A;  4M7A E;  5CKB A;  4BB7 A;  4EMH A;  3CC2 A;  1YJW A;  4JX4 A;  3RUX A;  1QVF A;  4AKH A;  1HK9 A;  1YI2 A;  3H6Z A;  4LDV A;  2BS4 A;  1NE8 A;  2YRV A;  4HT8 A;  1Q82 C;  4M77 F;  2QDJ A;  3PNW C;  2E70 A;  4BBR M;  4C5G A;  2P0K A;  4F7U E;  5GAO q;  4JRI A;  2EWN A;  4GY5 A;  1XOV A;  4C8Q A;  4DQ2 A;  2GFU A;  3CCL T;  3JB9 H;  2HBP A;  5GAO r;  2LCL A;  4M75 E;  3A8L B;  3CPW S;  4R56 A;  4HCB A;  2P0Q A;  2AHJ B;  1N8R U;  4IUU A;  4C8Q C;  5KE3 A;  4XTX A;  1VQ6 A;  1NZ9 A;  4E7J A;  4RG8 A;  4C0D B;  3OYY A;  4C92 D;  1UGR B;  1KQ1 A;  2EIF A;  4M78 D;  3A8G B;  4ME7 A;  1O75 A;  2RO0 A;  1YJW T;  3QYB A;  2KY9 A;  3BW1 A;  4XU0 A;  3S3O A;  2DPP B;  3VKG A;  2WSE E;  2WSF E;  3OA6 A;  4M7D F;  3I56 A;  4EMK C;  4LDX A;  1WQ7 A;  2WAC A;  5L8R E;  1VQ5 A;  2YHT A;  2HD0 A;  5LJ5 d;  3CC4 A;  2MI6 A;  3M55 A;  1KHI A;  5FU7 B;  5CKD A;  3JCM X;  3NTI A;  4C5H A;  3TU4 K;  1NPP A;  4XU1 A;  3G4S T;  3MO8 A;  3Q1J A;  5LJ3 g;  4D6W A;  2C06 A;  1YIT T;  1G3S A;  3M5A A;  1SSF A;  3ER0 A;  3WVD B;  4M7D G;  1JRI A;  3AHU A;  1KQ2 A;  2XDD A;  3FB9 A;  3HFO A;  3MHX A;  4JS5 A;  3E9G A;  3P8B B;  1YHQ A;  4AKI A;  3P8H A;  3JB9 G;  3OYE A;  3I55 T;  3TEE A;  3HFN A;  3CCV T;  2V8K A;  4QVZ A;  3G6E T;  2D6F A;  2EKO A;  2I2L A;  3CEY A;  4M7A B;  2DTH A;  2YLB A;  2DD5 A;  3O8V A;  2EJ9 A;  4M77 D;  4FL6 A;  2FL7 A;  3TCJ A;  4B9W A;  1QW1 A;  3L42 A;  4A4E A;  4ELY C;  4M75 D;  5LJ5 j;  2NLU A;  3QHS A;  3LWH A;  1VIF A;  1KC8 U;  2CS7 A;  2IG0 A;  5CKH A;  4DOW A;  2K5F A;  3HRT A;  3LH0 A;  2CZ0 B;  4HNV A;  4XAX B;  5LJ3 e;  3OYN A;  4J7I A;  4BY6 B;  4M78 E;  2GF7 A;  3GLX A;  4HL4 A;  2VV5 A;  4A4G A;  2VYT A;  5J26 A;  3L2U A;  2DZC A;  3HKS A;  5A2Q E;  2DD4 B;  4LDW A;  4BD3 A;  1I8F A;  4JRP A;  1VQ6 T;  1QLB A;  3DL1 A;  2XDP A;  3M9Q A;  1Y71 A;  4MZP A;  4HCC A;  5CK9 A;  3JCM J;  4ZTF A;  3LLR A;  3RKW A;  3HB9 A;  4BE1 A;  1VQ9 T;  1NJI C;  2DXC B;  2ZZD A;  3GPL A;  1VQ4 T;  2L8D A;  1RI0 A;  4QW2 A;  4ATO A;  5CCA A;  3CCM T;  5FU6 B;  5IAY A;  4HNU A;  2JTM A;  2K5I A;  1PSE A;  1BIA A;  1WPY A;  4R55 A;  2RA2 A;  5GAN 7;  4Q5W A;  1VQ7 A;  3V7S A;  4IUT A;  3DB3 A;  2DD4 A;  2M1H A;  1O9S A;  2XID A;  4XTV A;  4JLI A;  4P5N A;  3V7C A;  1YJN A;  3CC2 T;  2E1H A;  4RMO A;  2X4J A;  5CQY A;  4JUV A;  3JCM c;  3R6O A;  2GQV A;  4FT2 A;  4GLK A;  1G3Y A;  4JDS A;  3V8J A;  3L2Z A;  2CZ1 B;  5GAO l;  1VQP T;  2DXB B;  2QF7 A;  2VGM A;  1QVP A;  3OW2 S;  3CC7 T;  1G3T A;  4M75 A;  3CCU T;  2RM4 A;  4BDZ A;  3RMS A;  4M77 E;  1KD1 U;  3PGG A;  3PIP A;  2DD5 B;  2Y4X A;  3V7R A;  3G7Z A;  4PLL A;  2LVM A;  3QBY A;  2RJF A;  4J6W A;  2LDM A;  2CZ7 B;  2ZPI B;  4LD6 A;  1AHJ B;  2RHZ A;  4M75 C;  4HCZ A;  3G6E A;  4XU3 A;  4HA8 A;  3X28 B;  4HLQ A;  2M16 A;  2JUF A;  4MZT A;  2BKD N;  3LYI A;  4JRK A;  1M4Z A;  3UDC A;  3VKI A;  2PUK B;  3HP9 A;  2LCC A;  1YCY A;  3QII A;  3EFS A;  1VQL A;  5HK0 A;  5A0D A;  2DK3 A;  3L2V A;  2BS2 A;  2MAM A;  2EFI A;  2DO3 A;  1WGS A;  4UC4 A;  2OTJ T;  4N4G A;  2XD0 A;  4PJO C;  5LJ5 e;  3OYK A;  5GAN d;  3J80 E;  2RHY A;  5LJ5 g;  2E6Z A;  5DLQ E;  3BG5 A;  3GF5 A;  2OTL A;  2V8I A;  2LT4 A;  2LRQ A;  4LD9 K;  2EYQ A;  1JB0 E;  2RJC A;  4XQ3 A;  3JCM g;  2LTO A;  2ZPB B;  3LGF A;  4DA4 A;  3L2W A;  3JB9 F;  1DJ7 B;  3VUB A;  3OMG A;  3CBM A;  3CPW A;  3CCJ T;  1VQN A;  4J6X A;  2DIG A;  4AI6 A;  3MEW A;  4E7L A;  4MMK A;  4XK8 E;  4J8O A;  4FU6 A;  3SWN B;  4C92 A;  1U1T A;  4HT9 A;  1XQH A;  2DTI A;  1WJR A;  3M53 A;  3SB2 A;  2K5L A;  3PFS A;  4M7D A;  3V8K A;  3C94 A;  5CQX A;  2DAQ A;  2IVW A;  5FU6 C;  3OS0 A;  3CC7 A;  1M1K U;  1X01 A;  3X26 B;  5D6W A;  4A54 A;  4Y91 A;  3OYH A;  2E5Q A;  4A4K A;  5KCH A;  5KCO A;  1YHQ T;  5I2S A;  1M5Q 1;  3L2Q A;  2CGH A;  1WNL A;  2E41 A;  2VXF A;  4KUI A;  5CKE A;  3X24 B;  3VUZ A;  4C92 E;  2HNI A;  5A0G A;  5IN1 A;  1I81 A;  3X25 B;  3KBG A;  5GMK i;  4PJO G;  5GAN h;  5D6X A;  1QVG A;  3P8D A;  1NJI U;  2D9T A;  3FEO A;  3E1S A;  2GCX A;  2ZGW A;  3HZJ A;  5HY6 A;  3E19 A;  4MDW A;  5DM7 R;  2K2V A;  4NS5 A;  2RK2 A;  1VQM A;  3PMI A;  4NL3 A;  4QQ6 A;  2E65 A;  1YIT A;  2FYK A;  2RI2 A;  2BUD A;  2MWO A;  2EJG A;  2K3Y A;  4JX6 A;  4F7U F;  3JCM Q;  4A4F A;  3UT1 A;  5KE2 A;  3CMA A;  5J39 A;  1KD1 C;  2QFZ A;  4N0A C;  5CKF A;  4C8Q G;  1I5L A;  3M57 A;  3INZ A;  1LOJ A;  3GOX A;  5GAM e;  4C92 C;  2FB7 A;  2KDS A;  3FRN A;  3OYA A;  2PUO B;  4BI4 A;  2EAY A;  2QQB A;  2O4X B;  1M1G A;  4M7A F;  4Z6Y A;  5GAN j;  5GAN g;  4F7U G;  2PVG B;  3OYF A;  3OB9 A;  2X4Y A;  1G5V A;  4BE0 A;  5FU7 C;  3RER A;  1VQ4 A;  5HKC A;  4OMF B;  5CIU A;  4M6V A;  1K73 U;  5I21 A;  3G71 A;  2B8A A;  5GMK m;  5FRN A;  3CCL A;  4KUD K;  2RH2 A;  3GNG A;  5LJ3 d;  3L2R A;  1E7P A;  4M75 B;  4O5V A;  2A3L A;  2DXB A;  4FIB A;  4ELJ A;  1PSF A;  2XI9 A;  3MET A;  3J7A F;  3JB9 J;  1YI2 T;  3SWN C;  1OZ2 A;  3LX7 A;  3M59 A;  4M78 C;  3KXT A;  4MZM A;  1H64 1;  5GAN 5;  3I56 T;  4ZN3 A;  5LJ3 j;  5GMK e;  1Q7Y C;  3TW7 A;  2M9U A;  3CMA T;  5C0M A;  1N8R C;  3C4S A;  4E7I A;  3HSB A;  2R5M A;  3CCR T;  2KVQ G;  4QVD A;  1UGP B;  4JLG A;  1VQO T;  1WJQ A;  1B34 B;  1ZQ1 A;  2QI2 A;  3VU3 C;  5GAO p;  5CVI A;  2L3R A;  3MEV A;  1S72 T;  4M7A G;  3QYE A;  4OGC A;  4CI0 C;  4X34 A;  1QVG S;  1BI1 A;  2PU9 B;  2PQW A;  3FIF A;  4X9C A;  1K8A U;  3M58 A;  2QQ9 A;  2YLC A;  2E64 A;  3LGL A;  1I4K 1;  1K73 C;  2KMT A;  4FSX A;  5FRM A;  3HRS A;  2QQR A;  2F5T X;  5IT9 E;  3VJP A;  4M77 A;  3OY9 A;  3OYJ A;  4OVA A;  2JNG A;  3RMQ A;  4OGE A;  1EIF A;  3CC4 T;  1LNX A;  4PJO A;  1UGS B;  1N9R A;  1KQS A;  4MFE A;  3JCM b;  1QP2 A;  3ZEH A;  1X75 C;  2JTF A;  3E9F A;  3KUF A;  2KR6 A;  5CAI A;  3JAM E;  2L89 A;  1VQK A;  4M78 B;  1JBM A;  2RHI A;  3L1A A;  2Y90 A;  2K3X A;  3A8M B;  2RHU A;  3JCM V;  4C0G A;  4C92 B;  4ZN1 A;  4BE2 A;  1JJ2 A;  3HRU A;  1Y96 A;  1K9M C;  3OYD A;  4DOV A;  3CME A;  3PIO A;  4IKF A;  2V8J A;  4N4H A;  4C92 F;  2G77 A;  2OTL T;  3SWN A;  1W4S A;  1RL2 A;  2R57 A;  3M4G A;  1GXI E;  1M90 C;  4FM4 B;  2CKK A;  1FX7 A;  4J83 A;  1W2B S;  1VQ8 A;  2EJF A;  4IUQ A;  1VQN T;  1N27 A;  5GAN 4;  3NFC A;  3OBW A;  4BDY A;  3PTA A;  4ZGD B;  3VV0 A;  3ME9 A;  4B9X A;  1U8R A;  3QXE B;  2H3J A;  4E7K A;  5GAM f;  3UPU A;  5GAN 6;  5GAM j;  1Y7X A;  3JSC A;  4M75 G;  3OS2 A;  4BUG A;  2E10 A;  4J7F A;  4KT0 E;  3CD6 A;  4M7D E;  3MCA B;  5GAM h;  2A7Y A;  3H8Z A;  4RKU E;  1Q81 U;  4BI3 A;  2HQE A;  1ZBX A;  1S72 A;  4JX5 A;  3DKM A;  4N4I A;  4EPC A;  2DXT A;  4RCC A;  4WF2 A;  4JRQ A;  2MMP A;  2QQS A;  1V29 B;  4PLI A;  3ZFJ A;  4M77 G;  4F7U B;  3VYG A;  3CCS A;  3CCS T;  4M75 F;  3OW2 A;  3EFR A;  1QP3 A;  3QUI A;  2KSS A;  2R58 A;  4OB2 B;  4ZGE B;  4C0Z A;  3FLG A;  3FJP A;  4JJN K;  3JCM d;  4XU2 A;  2PVD B;  3QDR B;  4M78 G;  2MWP A;  2XU8 A;  2O01 E;  3S3M A;  4A4H A;  4C8Q B;  1IRE B;  2OAU A;  2DKG A;  3WVE B;  2VXE A;  2E12 A;  4NOY A;  1VUB A;  3OYG A;  3OYB A;  4EMK B;  1OYX A;  4XTZ A;  5AYF A;  2FVU A;  1VQL T;  2X4X A;  4OB3 B;  3CXC S;  4OP0 A;  1D3B B;  2X4W A;  4O6J A;  5LL6 S;  2DXU A;  3QYG B;  3MP8 A;  4XTW A;  5FLX E;  3G4S A;  2ZZD B;  2DXC A;  1UGQ B;  4KUL A;  4KBM B;  4V2S A;  2RD1 A;  3GNF B;  2EQJ A;  1VQ5 T;  3OYC A;  2JVV A;  4LDY A;  3UWN A;  4M7D D;  3QPH A;  2LC4 A;  2X35 A;  2RI3 A;  1NPR A;  3EAE A;  3CBO A;  5DLO A;  3VYG B;  2QXF A;  3CCU A;  2DTO A;  2EQM A;  4M7A A;  3BG3 A;  3QG1 A;  4C0D C;  5LJ5 h;  5CO7 A;  4MML A;  4C5E A;  4LDU A;  4NC6 A;  3G71 T;  1YBY A;  3MP6 A;  5GMK l;  1U1S A;  4PJO B;  3A5Z B;  3A8O B;  5C6S A;  5GAM g;  3CCQ A;  1YIJ T;  4BBS M;  1WQW A;  5GAN e;  3BDL A;  5EG2 A;  4II1 A;  5GAO n;  3CCE T;  3GP8 A;  5M9O A;  3CCV A;  4J5Y A;  4QQG A;  3JCM P;  3DB4 A;  5FRO A;  4PNO A;  3ZBD A;  2KK4 A;  2XIC A;  1W2B A;  4BI8 B;  5D6Y A;  2ZPE B;  3KHI A;  3CXC A;  2XK0 A;  4X9D A;  5A0L A;  2CZ6 B;  5GAN 3;  4JS4 A;  1WJS A;  3T9N A;  2QA4 T;  2LX9 A;  2DVE A;  2XHC A;  3HBL A;  2LT1 A;  1VQO A;  1M9S A;  2BS3 A;  1OI1 A;  3PMT A;  2VC8 A;  3RKY A;  2K4Y A;  4IUR A;  3CME T;  3QWL A;  4ZGJ B;  1OZ3 A;  4PKC C;  2QDY B;  4F7U A;  5J3B A;  5CR2 A;  1QVF S;  3WXM B;  5LJ5 f;  1YJ9 A;  4MFD A;  2PVO B;  4AKG A;  1Q7Y U;  1KQS S;  4MIM A;  3C95 A;  3FDR A;  3OYL A;  3S3N A;  1XNI A;  1HXD A;  3OS1 A;  3JCM W;  1KC8 C;  5DY9 A;  2E6N A;  1P92 A;  3HHT B;  4E47 A;  5EJC A;  5HK3 A;  4M77 C;  2RB6 A;  2DIQ A;  4M7D C;  3CBP A;  3A8H B;  3BG9 A;  1FXX A;  3QO3 A;  2ZCF B;  3J81 E;  3I55 A;  1MGQ A;  2LQ8 A;  1XTD A;  3LW5 E;  2P0P A;  4OB0 B;  3SFM A;  4CRI A;  3BDU A;  1D3B A;  2DJZ A;  3CCQ T;  1M8V A;  4MDX A;  2WJ9 A;  3CCE A;  2CYZ B;  3QKJ A;  2KQW A;  1BIB A;  4EMK A;  3SDZ A;  4C8Q F;  3S6W A;  3JCM f;  4M7A C;  3BFM A;  3HO8 A;  1N9S A;  3VKH A;  4C92 G;  5LJ3 h;  4HNT A;  2DZ9 A;  1IZ6 A;  4RCB A;  4PJO F;  3QZ9 B;  1TH7 A;  2VUB A;  3HL8 A;  3URG A;  2GFA A;  4XTY A;  1Q82 U;  1M1K C;  4ELZ C;  1FKM A;  4BY6 C;  4PJO E;  3DLM A;  5GAM d;  2OTJ A;  1ZHI A;  4C0F A;  4IUV A;  1YIJ A;  2ZPG B;  1YJ9 T;  2RI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...