2ZCFB

Mutational study on alpha-gln90 of fe-type nitrile hydratase from rhodococcus sp. n771
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutational study on alphaGln90 of Fe-type nitrile hydratase from Rhodococcus sp. N771
pubmed doi rcsb
source organism Rhodococcus erythropolis
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
total genus 56
structure length 212
sequence length 212
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zcfB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zcfB02
1PSEA 3VYGA 2PUKB 2DD5B 4L6V5 3LW5E 1UGSB 4Y28E 4KT0E 3A8OB 3HHTB 2DD5A 1GXIE 2ZPGB 3X25B 2DD4B 3A8LB 4OB1B 3QXEB 2CZ6B 1V29B 3X28B 1QP3A 3WVEB 4XK8E 1QP2A 2ZZDA 2CZ7B 3VYHB 3A8GB 2O01E 2WSCE 2CZ1B 2WSFE 2CZ0B 1JB0E 4ZGJB 4OB3B 3A8MB 1UGRB 2PVGB 2PU9B 2WSEE 2ZPEB 4ZGEB 3VYGB 1AHJB 2DXCA 2ZPBB 2AHJB 4ZGDB 2CYZB 1IREB 1DJ7B 2DXBA 2QDYB 4OB0B 2D0QB 3QYGB 4OB2B 2ZZDB 2DXCB 3QZ9B 3QYHB 1UGPB 2ZCFB 2ZPHB 2DD4A 4FM4B 2PVDB 3QZ5B 3X24B 1UGQB 3X20B 2PVOB 2DXBB 4RKUE 2DPPB 2ZPIB 3X26B 2ZPFB 5L8RE 1PSFA 3WVDB 3A8HB 2PUOB
chains in the Genus database with same CATH superfamily
1K9AA 3MEVA 3CC7T 1Q86U 2ROLA 2KMGA 3DDPB 4XU2A 3V8KA 1M1KU 1RAIB 2VC8A 4M78D 1W98B 2DIQA 1JU5C 1N5ZA 2R7GA 2QASA 5GAN4 1UB4A 2E70A 1Y57A 1HK9A 4HL4A 3EGUA 1W2BA 1VQ7T 3L2UA 3DJBA 1RL2A 4M75D 5KYYA 1WYXA 4LD6A 4CC2A 3CCMQ 2K2MA 2HEQA 3VUZA 1AWOA 3X28B 1BK2A 2E64A 2IW9B 4XK8E 2EYXA 1QP2A 3CC7A 3DLMA 4C92E 2CUDA 4JJNK 1WI7A 3G7ZA 2COZA 2HBPA 4M7DG 4A4EA 3J7AF 1RAHB 1M90U 1K8AU 4ELLA 3C94A 1OI9B 3RUXA 1OX9A 5GMKe 2DRKA 3URGA 4WF2A 3HBLA 4JLGA 4N4IA 3QG1A 4R0KA 2EYZA 1I0CA 2COYA 2D1XA 9ATCB 2OJ2A 3DB3A 3RKYA 1VQNQ 2V26A 1WHLA 4EPCA 1MMAA 2QGGA 2AKKA 1X69A 3IQLA 4C8QE 2C5NB 1LVKA 1Z9ZA 4FYVB 1KQSA 5D7UA 4M7AC 2YUOA 3CBMA 2MK5A 1VQ8T 2FG0A 1P92A 4HCZA 3PIOA 4WCIA 3META 3CPWP 3NTHA 2ZCFB 4FT4A 2B86A 1UTIA 4UN0A 1RACB 2KY9A 5CQYA 2PJQA 1RAGB 2R5AA 5FU7C 2K57A 3KBGA 2CP5A 2KNBB 4PJOA 3QDFA 4HCCA 2WEVB 4NSTB 3OSVA 4K11A 3R6NA 3J80E 1TTHB 4F7SB 2D6FA 1E6GA 4BY1X 4J9BA 3OS0A 3SDZA 5C6SA 4BE2A 2FB7A 1E9HB 3RDVA 2C0IA 4C8QG 3V8LA 3CMEA 2SEMA 1H1SB 4OGRB 1WA7A 1PNJA 2K5LA 5CKFA 3EHRA 5HNBB 2PUOB 3I56T 2K4YA 4A4HA 1U1SA 4M7AB 4GY5A 4C5IA 4X9DA 4BCOB 7AT1B 4C0DC 3CCUT 2CT4A 3J81E 2RH2A 2BS3A 3CEYA 3HRTA 3NGPA 1QWFA 4EC8B 2DTIA 5CIUA 1V76A 2CCIB 2QEXT 1EX4A 3M0PA 4BCMB 1WZOA 4DEYA 1IRXA 2FPEA 4JZ4A 3QWXX 3DL1A 4PKCC 5LJ3d 1YHQT 1FMKA 1GCPA 4J9EA 1ZA1B 3BHVB 4N4GA 4LXCA 4DBFA 3OBWA 1VQ4T 3QYBA 2CZ7B 2JMCA 3A8GB 4BCKB 2O01E 3H0HA 1QVFP 5CKEA 4GBQA 3EH2A 1AZGB 1VINA 1Q82C 2CZ1B 5GMKj 1QCOA 5HBJB 1YP5A 4AFQC 1V1CA 2EGEA 5DLQE 2RA2A 1YJ9T 1NLPC 2QGSA 2LNVA 2RQVA 5KE3A 1PKTA 1JO8A 1Q95G 3CCEA 3EHQA 1GUXB 4BBRM 4BCNB 2P0QA 4OMLA 4C0FA 2DL3A 4M7DC 4EDUA 2ZGWA 2LCSA 8ATCB 4BBSM 2NLUA 3CXCA 4JX4A 2GF7A 1RABB 4CRIA 2DXUA 4M7AF 3EFOA 2WJ9A 2LX7A 3S3OA 5LJ5e 5CAIA 3JB9J 2ENMA 2IVXA 4XU1A 2PHGA 1KXUA 1FMVA 4ELZC 5CK9A 4MZPA 4QW2A 3CCMT 3MJXA 1KC8U 1ZUUA 2IW6B 4M78C 3KXTA 5LJ5j 1ZSGA 3GP8A 2F5KA 2KK4A 3INZA 1G3TA 3X24B 2FL7A 2C6TB 3CD6Q 2RJFA 3ER0A 4M75C 3G71T 3MP8A 2L3QA 5GAOp 2JT4A 2XI9A 1FWZA 4IMYB 1NJIR 4E7LA 2M9UA 1TUGB 4EMGA 1QKXA 5GMKi 1MMDA 4MFEA 1IB8A 4BCGB 2HSPA 4J9DA 5GAMf 1UG1A 3V7SA 1SG5A 3G6EA 4C8QD 4JRKA 2QGFB 1G2BA 3QIIA 2LT1A 4LDVA 2EQJA 2KAFA 2W99A 5KH6A 2DEUA 1IO6A 4HNTA 2MPXC 4L59A 1H8KA 1ZSZC 2W10A 3OYIA 4NS5A 5FLXE 3CCRT 5GANj 3VYHB 4OMNA 5D6YA 1AWXA 5HY6A 1M90R 1VQKA 1TUDA 2EJFA 4ELJA 1M4ZA 1OI1A 1TD6A 1CSKA 2KT1A 4ROCA 3A1PA 2QF7A 3MY1B 1P5EB 1UJYA 1G5VA 3A8MB 1OULA 5FROA 1M1KR 2DBMA 4AG1C 2VGMA 2GNCA 3CCSA 3CCMA 2LJ1A 4C0DB 5LJ5g 1M8MA 3SD4A 3RKWA 5LL6S 3QJYA 3PTAA 3FEOA 1U3OA 1WJSA 5LMKB 4OF1A 1H27B 5LJ5f 4BY7X 4J6XA 1E7PA 4IURA 4PJOB 4N4HA 3OYFA 1O9KA 3RR6A 4MDXA 1TOVA 3L2ZA 2E3HA 1LPLA 4QQGA 2JUFA 1BCOA 4RTXA 3TQ7P 1E6HA 4KUDK 1WFWA 2PVDB 3MEWA 1H92A 5EC7A 4KRDB 1BKBA 3FB9A 3ZEHA 4FYYB 2X4YA 3M0RA 3VS4A 1Y96A 2DPPB 2XG8D 3GNFB 4X34A 2DVJA 5LJ5d 1PSFA 1OGUB 2E12A 4FL6A 4EORB 1M2VB 2YLBA 4PLLA 4II5B 1D3BA 2RK2A 1YIJT 3SHWA 4F7JB 2ED1A 3JB9I 1BIBA 4IIOA 1NEGA 1QLYA 3FJPA 2KDSA 5A0LA 1KFZA 2KE9A 5LJ3h 2JNGA 3VS1A 3HHTB 1GXIE 3X25B 3PVLA 3MPUB 2V22B 2XDPA 4IUPA 1WNLA 2OTLQ 3NTIA 3TCJA 3RMQA 1T3LA 2DO3A 4QT7A 3G71A 4BACA 2QEXQ 2LVMA 1CKBA 1TU0B 4ME7A 4JDSA 5IF1B 4TTHA 3RKXA 4EONB 3TW6A 4RTUA 2G6FX 3BG5A 5FWBA 2JS2A 3EFSA 4OMMA 3OW2S 5HQ0B 2JXBA 3BHUB 3NHNA 4LDYA 3GIBA 4ATOA 3KFVA 1XOVA 4FX3B 3UWNA 1ZA2B 1XNIA 2L0AA 3CQTA 3H6ZA 2ESWA 4BCIB 2OX7A 4HVUA 4M7AD 1NJIU 1D3UB 1VQKT 1OZ3A 4ZGDB 5EFQB 1FXXA 5I22A 1HD3A 2I40B 3I55T 1Y96B 1CKAA 1AD5A 5GAOn 1VQ5Q 1YJ9A 1PRMC 3EAEA 3O8VA 3CCVA 2D8HA 1BBZA 1B3QA 1B7TA 3OYJA 2W9FA 4JRIA 3QZ9B 2W2HA 1MUZA 1JJ2S 5CVIA 4AG2C 3CCQT 4EMKC 1KC8R 1ZHIA 2EPDA 3OS1A 4ZTJA 4ANJA 4CFVB 1FX7A 1SHGA 1WQ7A 4ORZA 1H25B 5M9OA 4RTTA 3TSWA 2EKHA 3S3NA 3C4SA 3RBBB 1IGUA 1UE9A 3M58A 1QVFS 3CC2Q 4KGVB 1MGQA 4BCJB 2CS7A 2PTKA 2CUBA 2F1LA 1YI2Q 1U06A 3M56A 1YJNA 1NBEB 1WHMA 4EOKB 2MF2A 3EJ1B 1JRIA 4LE9A 3H4CA 2CSQA 2X51A 1ZX6A 4F7NB 1F1BB 1W1FA 3TSZA 1H4LD 4NC6A 4BCFB 3CMET 3GF5A 2WPAB 1QVGP 4EIKA 3OA6A 3HO8A 1N8RC 3P8BB 1RI0A 1W6XA 3I9QA 3VS7A 2IW8B 3L2QA 2R57A 3ZBDA 1ZBJA 3JAME 2QQRA 2KYMA 2O9SA 4XTZA 3EFRA 1UHCA 2LCCA 2CP2A 4E7SA 2JGZB 4F17A 5EJCA 1RAEB 2K6DA 2BZ8A 4OGEA 3D7SB 1H28B 3OYMA 3OW2P 2W0ZA 2F2CA 1VQPT 5GAOl 2LJ0A 3B57A 3OYDA 4OGCA 1UUEA 1KD1C 2E65A 2XKOC 3CCQA 1OIYB 4F6SB 3JB9D 2CYZB 3CD6T 1PD0A 2LW4A 2NUPA 3PMTA 3BLRB 2KVQG 4CRLB 2FZKB 4LDXA 1VIEA 2G9XB 1JBMA 2XICA 1WLPB 2VVKA 1H26B 3QYGB 2FRWA 1H641 2BPMB 2ZZDB 1A0NB 3OMGA 2QA4T 3CCJT 2WIHB 1B34A 3CBPA 1RAFB 2MIOA 2QTVA 3GPLA 3I5SA 3OYKA 4JS4A 4B6MA 2LJ3A 1UGQB 1HJDA 5DQVA 1PRLC 3JV3A 2PVOB 2BUDA 2CT3A 2NUZA 1BU1A 4QKUA 3CC2T 4MZTA 1PKSA 2EW3A 5L8RE 3G4SQ 3L2WA 1JQQA 1WXTA 4JX5A 3EG9A 1GBRA 1Q81R 2LTOA 1LJOA 4JZ3A 2KR6A 3DOGB 1M30A 2KMTA 1QMCA 2UZLB 2EYYA 3JCMV 2UUEB 1NZ9A 2HKQB 2DERA 4XTWA 4GLKA 1K8AR 2BZXA 2J6FA 2O4XB 1YCSB 2DF6A 4X9CA 3BW1A 4XTYA 5GMKm 2HL3A 2XHCA 1Q81C 4LUEA 2DD4B 4J9FA 5CO7A 3QPHA 2RD1A 1VQPA 2MMPA 1B34B 1QCNA 4M7DE 4BI3A 4PL6A 2FYKA 5HCKA 4J7IA 3CCLQ 4Z89A 3RGFB 1VIFA 1PC0A 2VYTA 1GRIA 2A36A 2CZ0B 1SF9A 4BD3A 1BCMA 1D0ZA 3CC4A 4OB3B 3HL8A 3JCMd 2J7IA 1YI2A 1YJNT 2EYWA 1UHFA 2PU9B 2XK0A 2J6OA 5I2MA 1Q7YC 4M7DF 2RHIA 1EIFA 1FMWA 4RTVA 3PO3S 1JSTB 1FYNA 2MCNA 1SKUB 6AT1B 4ZN1A 2B8AA 2CJMB 1HSQA 2DL8A 2KXCA 1M1KC 3VKHA 3CCST 2JW4A 2DAQA 5IHKA 4M77A 4KRCB 3HRSA 1M1FA 2QK0A 3ME9A 2QXFA 2DL4A 2MWPA 4MMKA 5IDPB 3HRUA 3R6OA 1IGQA 5IHNA 1BI0A 3EG9B 3VJPA 5HK0A 1G3WA 4J8OA 1ZBXA 1KQSP 1VQ5T 4RUGA 1C1AA 4M75A 3X20B 3OS5A 1OV3A 4WTOB 1PM3A 5KCOA 2FO0A 2VWFA 2ZPFB 2L3SA 2LC4A 4AI6A 1YITT 4XTVA 1N8RR 4ZNXA 1WHHA 4ESRA 4PJMA 2O31A 2YHTA 2ABLA 1M3AA 2QQAA 4JUVA 4CI0C 1ZUYA 1BYMA 2K2VA 2YRCA 1JOWA 1TXQA 4LOCA 1VYWB 2DRMA 3CMAA 2O88A 2P0PA 4CC3A 2RHZA 1TFBA 4M7DB 2DL7A 3QHSA 4PNOA 4E47A 1KIKA 1AWJA 3OSSC 2FVUA 4QVZA 4Y28E 1NG2A 5GMKl 3M0SA 2ZPGB 3TEEA 3S3MA 1E7OA 4OMQA 3VS6A 1GY3B 2EVRA 4RTZA 4M7AG 4II1A 1VQLQ 2DA9A 2EGAA 4CFMB 4C8QB 3VRZA 2UZEB 4CFUD 3G4ST 2XDBA 3RNJA 2X4XA 1YJWQ 2DLPA 2P0KA 1M3CA 3RIRA 1OU8A 2FPDA 2RK1A 2RMOA 2E4HA 8AT1B 1IHVA 1OPLA 3GNGA 1HYOA 2CP0A 3LH0A 1D09B 2CREA 3CC4Q 1QVFA 1T0JA 2KXDA 2DNUA 1N6AA 3ASKA 1YCYA 3QYEA 5CCAA 2JS0A 4Z02A 3BG3A 1UDLA 4E7HA 4Y72B 4GLMA 1YITA 2KI7A 3BE3A 3QYHB 1UGPB 1X2KA 5GANg 3SWNB 5GAOm 3EG0A 3JB9G 3QZ5B 1VQOT 3UPUA 1JJ2A 2H3JA 1K0SA 4J6WA 4RKUE 1KSWA 2ZPIB 1X6GA 1Q82R 3I35A 3LWHA 1X75C 1YHQQ 2Y4XA 3RMSA 4C8QF 2A28A 3QWYA 1MNEA 5HK3A 4YOSA 4M6VA 5IDNB 1O75A 4JJCA 2RJDA 1KJWA 2SRCA 2J06A 3CCSQ 4ZN3A 1VYUA 2LX9A 1D0XA 3TNWB 4RCCA 2IG0A 1GFCA 2LNHB 2K3YA 4MMLA 5IAYA 4Q5WA 1PCXA 4BY6C 1X6BA 4HT8A 5I2SA 4HCBA 3MI9B 3OW2A 2BZYA 3JCMf 1ABOA 1TUCA 4EC9B 4CC7A 2QDJA 2I53A 1OPKA 5LQFB 2HQEA 3OYCA 3G6EQ 5GAN3 5KYUB 1ARKA 1ZP2A 3HTRA 4ZGJB 4DQ2A 1OL1B 2ATCB 2I2LA 1X6OA 4DBQA 4JS5A 1UNLD 1GUXA 4M75G 3MCAB 2EBPA 4VUBA 1VQLA 1X01A 2K3XA 1D3BB 1Y07A 1UFFA 4FW2A 3M55A 5GAN5 1YJNQ 1AZEA 4DOVA 1F5QB 4M78E 2DJZA 3QJ6A 5KYWA 3ULRB 1G3NC 5LJ3g 1K76A 4XU3A 4BCHB 2D0QB 2L2PA 3G33B 4C0ZA 2OAUA 1VQ4Q 1RLQC 1K73U 4YOZA 4KRTA 4IKFA 1S72T 4EMKA 2FPFA 3MHXA 4JRPA 4M77D 3V8JA 3QHWB 1XTDA 3OYHA 2ZPHB 5CR2A 2Z0WA 4PJOC 1VQ8A 5I5ZB 3JCMJ 2KBTA 2PK9B 1W2BP 4JJBA 2VGNA 3MO8A 2PK2A 3EGXA 4OP0A 1GBQA 3M57A 1LOJA 2KRMA 1FVVB 4DA4A 2K79A 2DFUA 2EAYA 3M0QA 2XMFA 2WHBB 5CQXA 4D8DA 1S1NA 2QQBA 5GANd 1C0MA 2ECZA 4M4ZA 2QQ9A 4PJOE 3L2RA 1I07A 5KYUA 2VXFA 1VQMA 1AD6A 1I4K1 1GFDA 2HBWA 2EQMA 2OTJT 2VB6A 4AMCA 2JM8A 1BI3A 4B9WA 1BIAA 3NTKA 5LJ5h 5DY9A 1UNGD 2CH4W 3PE0A 3SWNC 1M2VA 3CD6A 2F69A 4KUIA 2WXVB 5KCHA 1AEYA 5CEIB 2HZYA 4F7UG 2DMEA 2MYSA 2RJCA 2AKLA 1NM7A 1GCQA 2QA4A 1VA7A 5LJ3j 1I5OB 3MEAA 2WSEE 2DL5A 3G71Q 1ZQ1A 2HQHA 5ACBA 4EMKB 3FJ5A 2DXCA 2A7YA 2CP7A 2AHJB 2GFUA 4RODA 2DIGA 1C6VX 4EOLB 3L1AA 1IREB 3TVTA 2G77A 2UZDB 4YC3B 1WDXA 2J6KA 1KD1R 3I5RA 2E1HA 1EZZB 2NUTB 3VU3C 3C0CA 4F70B 4M78A 4PLIA 1FKMA 1ZSZA 3KHIA 1YJWA 1LNXA 2DE0X 5KYXB 2YT6A 3HFOA 4PJLA 5FU6C 1N27A 4FM4B 5EG2A 1KK7A 4IUVA 4MDWA 3V7CA 1K9MC 3G6ET 1BU2A 2EJGA 4ZTFA 4EOMB 2KYBA 3CCEQ 4M75B 4HKEA 3CCJA 3JCMQ 2W9ZA 4R56A 4IIMA 1WJRA 2EKOA 1H1QB 4LDUA 1M2OA 2QQ8A 1R0BG 2Y4YA 3PFSA 5DQWA 1NLOC 1PSEA 2OTLT 1M9SA 4Z6YA 1ENWA 2W96A 2EUFA 2DZ9A 3CXCS 3VV0A 1WIEA 1UNHD 4EOOB 1H1PB 5FWCA 4F7UF 4F16A 1OQKA 1NE8A 4LN2A 1VQLT 4J5YA 1I5LA 4M77B 4J7FA 3A5ZB 2VKNA 3MY5B 1M8VA 2C4GB 1B07A 4DBRA 3VUBA 2YLCA 5J26A 4BXXX 2E3IA 1VOMA 3A8LB 3CCJQ 4F7LB 4C92G 1PG5B 1SHFA 1NEBA 1HXDA 1U5SA 5KYXA 5KE2A 4CC4B 4FT2A 4PFOA 2H3EB 4A4GA 1VQKQ 1WHGA 3EG2A 1WGSA 2CCHB 3OYNA 3PVQA 4OMPA 2L5QA 2KSSA 2YUPA 2FZGB 4XU0A 3DLLA 2QDLA 3RERA 3JCMW 3TNHB 4AKIA 3VRYA 3H8ZA 2MOXA 3JCMc 1UGRB 3QSUA 1VQMQ 4PJOD 3VYGB 4NOYA 1OL2B 2QFZA 1N9RA 3Q1JA 1Q86R 4OR5B 2LQNA 3CCQQ 2DKGA 4M75F 4Y92A 1Q7YR 1VQNA 1Y7XA 2LZ6B 3OY9A 1Y71A 4XQ3A 3CCVQ 1RLPC 3JCMb 2DXBA 2NWMA 3CMAQ 1WHJA 2CDTA 4G6LB 1GH6B 4F6WB 4QQ6A 4AFZC 1M27C 2C0TA 3BY7A 4F7UB 1VQOA 5GAOq 2P84A 3SFMA 5J3BA 5LJ3e 4QVDA 2D9TA 2LDMA 3EIDB 1N8RU 3CCLT 3TW7A 5IT9E 2PMIB 3OYLA 2O2OA 3M53A 4HNUA 1UECA 1KG1A 2YUNA 3CCRA 1VQ6A 2JJ9A 3CPFA 3DDQB 4O5VA 2DM1A 2AT1B 1KQSS 1QWEA 3T9NA 3M0UA 1G3YA 2M02A 3VYGA 4HA8A 3HKSA 4NL2A 2X1NB 1ZSZB 2M16A 5GJVB 4XTUA 2DD5B 2NUTA 4RG8A 2WACA 3VS3A 1KD1U 3CCLA 1X27A 5FRMA 2X3XD 2JOYA 1XQHA 4C0GA 5KYWB 2A3LA 4FYWB 3O5ZA 2AK5A 3A8OB 1SSHA 1YN8A 1IHWA 4CXAB 2EIFA 3F70A 3M4YA 1V29B 2WFYB 2ED0A 3HP9A 2DK3A 2RPNA 1R0CB 4HVVA 5D6WA 3QWLA 1QMZB 1TS9A 3NDQA 4CFUB 2QG9B 1SPKA 5IH2A 3M9QA 1JXMA 2O4XA 1JB0E 2M1HA 2X9HA 3CCET 1YFNA 3UDCA 4C5GA 3CCUQ 2C5XB 1VYVA 1VQ9T 2BTTA 1W2BS 1Q86C 2HQXA 3LH5A 1SEMA 3CMAT 1OU9A 2K9GA 2V8KA 1AOJA 3I55A 1YHQA 2DILA 5D6XA 1AVZC 3VKGA 1M5Q1 2Y90A 5AYFA 3EG3A 1NYFA 4M77C 2CP3A 2BS2A 4CFXB 1O9SA 4OB0B 4KH0B 2NUPB 2EQUA 2HMAA 1YI2T 4C92B 3QUIA 3TU4K 2CH4A 2RQTA 2DXCB 4M77E 1Q81U 4LNPA 4QQDA 3THKA 2KROA 1YNZA 1VYTA 2HKNA 2DTHA 1K73R 2R5MA 3CMEQ 1M90C 1JJ2P 1K8AC 4BCQB 2E10A 1WQWA 3REAB 4BCPB 4HT9A 2XU8A 1FINB 2EQIA 3UA7A 5FRNA 1TWBA 1RADB 4A54A 2HD0A 2X35A 1XJWB 3LYIA 4FYXB 2RN8A 1KQ2A 5CKHA 5KYYB 5A2QE 2AZVA 3OYYA 1VQ6Q 1OYXA 1YJ9Q 1X2QA 3MKDA 2P4RA 3EGDB 4BI8B 3CC4T 4QSHA 1K9MR 4OMOA 1VQPQ 2E6ZA 1OOTA 3EOCB 5IXFA 5CYIB 1KHCA 3PMIA 4M7AE 5HVYB 2CZ6B 1KQ1A 1RUWA 2RF0A 3I56A 2RHUA 2C0OA 1H1RB 2RHXA 3WVEB 4DOWA 3PIPA 2HAXA 2HCKA 5IN1A 2FRYA 2O9VA 4C92F 2J05A 2DYIA 1D1BA 2C5VB 1YIJA 1EFNA 1H3HA 3H0IA 1R8OB 5I11A 3FRNA 4JJDA 2XIDA 3O0GD 1MNDA 4J6YA 1H24B 2KT8A 4MFDA 4EOIB 3JB9F 3HFNA 1AHJB 4JX6A 1K0XA 3BLQB 1KHIA 1SRLA 1NYGA 1VQ7A 2LRQA 3OS2A 1OKWB 1YWOA 3EGXB 4J9HA 2K5FA 2CGHA 2B9RA 4C92C 3SB2A 1QVGS 4V2SA 2KRNA 3QDRB 4PJJA 3U23A 3CCUA 2A08A 2L89A 4L5GA 3OYAA 4RTYA 3E19A 1YITQ 4OB2B 2A0FB 4HVWA 4YTLA 2P4TA 2QTXA 2E5QA 4IUUA 2QEXA 4O6JA 4BE1A 1Q82U 3AHUA 5GAMg 2LP5A 2GTOA 3L2VA 1W70A 5ICPB 4J9CA 4DEXA 1UJ0A 2DZCA 3LX7A 1PD1A 5GANe 2OTLA 3H41A 2UZBB 2HSEB 4HNVA 4EOSB 1D1CA 3POMA 1XO2A 5AT1B 4EOPB 2HL5C 4B9XA 1G83A 2PUKB 5GAMd 4MZMA 3NFCA 4KGZB 4BDZA 1M3BA 4KGXB 1T0HA 3BG9A 3EH1A 4EOQB 3SEMA 3TNIB 1JKWA 3EGDA 4FCYA 2DEQA 2GQVA 4KT0E 1KC8C 1AT1B 2BS4A 4OB1B 3ZFJA 1U1TA 4LD9K 5DM7R 3FC3A 1W4SA 2QI2A 3UT1A 2GBQA 2WSCE 4UC4A 2K7AA 2DXTA 4R55A 4NL3A 2XDDA 3S6WA 3EFOB 2M51A 4A4FA 2C06A 3A98A 1GCQC 4P5NA 3OYGA 4M78F 4EMHA 2PVGB 4KULA 3I56Q 2CKKA 4RMOA 1J3TA 2DMOA 5GAMh 1Z9QA 2EFIA 2LMJA 2FHDA 2GGRA 2ZPBB 4M78G 3JCMX 2R58A 2OTJA 5A0GA 1WXBA 2VASA 4E7ZA 1VQ9Q 1YIJQ 4D8KA 3LLRA 2D0NA 2QDYB 4I3ZB 2OTJQ 2YUQA 3CC2A 5J39A 1D1AA 2DVEA 3M5AA 2VUBA 1VQ5A 3JCMe 1WX6A 1OEBA 4C5HA 3SWNA 2X4WA 2L3RA 2M0OA 2VXEA 3BDUA 2KQWA 4F14A 3HB9A 4HXJA 2EGCA 3GBQA 2L3PA 2V1QA 2DD4A 3CPWA 2LCLA 5GAN8 2RB6A 5I21A 4CFNB 2V1RA 2RNAA 4IUTA 1PKDB 1R77A 3JCMh 3UA6A 3QO3A 4J9IA 4OVAA 2C5OB 2BE7D 1NPPA 3VS0A 1M1GA 3K7AM 2JTEA 3REBB 1YBYA 2M0YA 4TVRA 4HLQA 3OBYA 2RI5A 3UATA 4M78B 2QAZA 2F5TX 2DETA 2RM4A 4AKHA 1K4US 1K1ZA 3LW5E 5CKBA 4AFUC 2NYSA 4PJOF 3WXMB 4QVCA 4M7DA 3M0TA 4Z88A 2LQWA 4FIBA 1X43A 3VS5A 2DD5A 4EOJB 3OYBA 1RAAB 1N4MA 4ROEA 2IVWA 3C12A 1SSFA 1VQ6T 1Y0MA 2F2XA 4LDWA 1K73C 5FGKB 3UF4A 2CP6A 3OYEA 3OB9A 1JSUB 5IHIA 2ZZDA 2F2WA 3RESA 3M54A 1WHKA 2AIRB 1OX8A 2GFAA 4BI4A 4AKGA 2WSFE 3BLHB 3QBYA 1VQOQ 3NPFA 4FU6A 2ZPEB 3LGFA 1MV0B 5GANf 3LQ5B 1N9SA 5FU6B 4JRQA 2I0NA 2L8DA 2OAWA 3G4SA 4A53A 5CKDA 4PK4A 5LJ3f 3LWIA 2RI3A 1GL5A 2D8JA 1U8RA 4C92A 3JCMg 1VQ4A 2PQWA 4CFWB 1I8FA 1D0YA 3CXCP 1URCB 3P8DA 1JEGA 4FSSA 3QHRB 3PT9A 1QLBA 3JSCA 5ECAA 5HKCA 4BY6B 1YWPA 3CBOA 2YWWA 1MMNA 4BDYA 2XD0A 3H9NA 2ZAEA 4F7UA 3GOXA 4YOOA 2VV5A 4PJNA 4F04B 3JCMP 3CCRQ 2HDAA 3CPWS 1UEBA 1TG0A 3I55Q 2WMAB 4E7KA 3DTOA 2OI3A 5KYNA 2DXBB 1ZUKA 4C8QA 2BE9B 2DJQA 4XAXB 3JB9H 3TREA 2KEAA 3GLXA 4Z8AA 3A8HB 1JXOA 1AISB 4BE0A 4ELYC 1NJIC 4HCKA 2DTOA 1BB9A 3V7RA 1VQ7Q 2YRDA 2RI2A 4BUGA 1QCFA 2QYZA 3CCVT 3E9GA 4L6V5 4MIMA 1UGSB 4N0AC 2DBKA 5GAN7 3M59A 3F5XB 1OKVB 2IN3A 5GAN2 4BCQD 2V8JA 3E1SA 1VUBA 2JVVA 4BB7A 2PNIA 1O9KB 3BHTB 4A4KA 3JRZA 2QA4Q 2YXYA 5IXBA 2COWA 1S72Q 5DLOA 2FEIA 4AFSC 1K9MU 4M7DD 2JZ2A 1C9BA 2RO0A 2E41A 3FIFA 5GAOr 4C92D 5GMKh 2E5KA 2G3RA 3MP6A 2IIMA 4ZGEB 2H8HA 3FLGA 4E6RA 2MWOA 4M75E 1ZLMA 1WJQA 5HBEB 1MMGA 2RHYA 1S72A 3E9FA 4FW1A 1SRMA 2F2VA 2RQUA 4J83A 4M77F 2RQRA 5HBHB 2GCXA 2LQ8A 1T3SA 2AZSA 3N5BB 2ROTA 3QKJA 2RQWA 5C0MA 3NMZC 4E7JA 3VKIA 3HPWA 2EWNA 4RG2A 1WPYA 2GQIA 1MV3A 3PGGA 3BFMA 3HSBA 2A37A 4JLIA 3FDRA 1ACMB 1IXDA 4E2FB 2JN0A 2JTFA 3OQ5A 1UGVA 3M03A 3X26B 4C5EA 4Y91A 3G1JA 1QVGA 2KRSA 3HZJA 4LUDA 3ZL7C 1H3ZA 3P8HA 4FSXA 4M77G 1LCKA 1VQ9A 4J9GA 2YDLA 2IPOB 3L42A 2EQKA 5GANh 2JMAA 3GTMS 3CC7Q 2WIPB 5L23A 3DKMA 2V8IA 3BDLA 1MHNA 3VS2A 3PNWC 2YSQA 4PJOG 1QW1A 3LGLA 4KH1B 4BCMD 5FU7B 4BCND 3QXEB 1VQ8Q 3MEUA 1VQMT 5IHYA 2CSIA 2BIVA 1QP3A 4KBMB 5BNJB 4PFZA 4M7AA 4C8QC 4IUQA 3M4GA 1ABQA 2MAMA 3H0FA 2K5IA 2PZ1A 1I1JA 3MP1A 3TN8B 4RTWA 4JPBW 3OMCA 4AT1B 2BKDN 1OIUB 2BKZB 2K3BA 3DB4A 2WMBB 1WXUA 1G3SA 3MIAB 4PFPA 4F7UE 2FZCB 4OMFB 1NPRA 1QKWA 3KUFA 1AWWA 2RJEA 4XTXA 2KGTA 1TH7A 3C95A 1PWTA 1PHTA 4A63B 1BI1A 2DYBA 1BI2A 1DJ7B 3AT1B 1TSFA 5FW9A 2EJ9A 2LT4A 5L2WB 2KR3A 1OZ2A 4DBHA 1QQJA 2LQKA 2EYQA 1VQNT 2X4JA 5GAMe 5GAMj 3E2UA 4N0AA 1QVPA 1G8XA 5GJWB 1I81A 4D6WA 2JTMA 1IZ6A 4RCBA 1YJWT 4F6UB 1VOLA 2DX1A 5GAN6 2YRVA 3EG1A 2MI6A 2HNIA 1RI9A 2GTJA 4E7IA 1Q7YU 2X3WD 3WVDB 2QQSA 2E6NA 5A0DA 2JM9A 4X1VA
chains in the Genus database with same CATH topology
4DA4A 3M58A 3MEVA 1QVFS 3CC7T 1Q86U 2EAYA 2KMGA 1MGQA 2CS7A 2PUKB 4XU2A 3V8KA 1M1KU 5CQXA 2VC8A 3M56A 4M78D 2QQBA 1YJNA 5GANd 5GAMd 4MZMA 3NFCA 2DIQA 2QQ9A 2MF2A 5GAN4 1UB4A 2E70A 4BDZA 4PJOE 1JRIA 3L2RA 1VQMA 2VXFA 3H4CA 1I4K1 3BG9A 1HK9A 4HL4A 2DEQA 2EQMA 2GQVA 4KT0E 2OTJT 1W2BA 1KC8C 1VQ7T 3L2UA 2BS4A 1BI3A 1RL2A 4NC6A 4M75D 4OB1B 4LD6A 4B9WA 1BIAA 3GF5A 3CMET 3ZFJA 1U1TA 4LD9K 3NTKA 3VUZA 3OA6A 3HO8A 5LJ5h 3X28B 1RI0A 3P8BB 5DY9A 5DM7R 1N8RC 2E64A 4XK8E 3FC3A 1QP2A 3CC7A 1W4SA 3DLMA 4B9XA 3SWNC 3CD6A 2QI2A 4C92E 2F69A 2R57A 3UT1A 3L2QA 3ZBDA 4KUIA 3JAME 2QQRA 2WSCE 4UC4A 4JJNK 5KCHA 3G7ZA 2DXTA 4XTZA 2HBPA 3EFRA 4M7DG 4A4EA 4R55A 4NL3A 2XDDA 3S6WA 3J7AF 2LCCA 4A4FA 4F7UG 2C06A 4P5NA 1M90U 2RJCA 1K8AU 3OYGA 3C94A 4M78F 2QA4A 3RUXA 5GMKe 4EMHA 5EJCA 5LJ3j 3URGA 4WF2A 2PVGB 3MEAA 2WSEE 3HBLA 4JLGA 4KULA 4OGEA 3OYMA 4N4IA 2CKKA 1ZQ1A 4RMOA 3QG1A 4EMKB 5GAMh 2EFIA 2FHDA 2DXCA 2A7YA 2ZPBB 2AHJB 4M78G 2GFUA 3JCMX 2R58A 5GAOl 1VQPT 2DIGA 3DB3A 4OGCA 3RKYA 3OYDA 1KD1C 2OTJA 5A0GA 2E65A 2XKOC 3L1AA 3CCQA 4EPCA 3JB9D 2CYZB 3CD6T 1IREB 3LLRA 3PMTA 4C8QE 2QDYB 2G77A 2KVQG 4LDXA 1VIEA 1JBMA 2E1HA 2XICA 1KQSA 3CC2A 3VU3C 3QYGB 4M78A 5J39A 4M7AC 2DVEA 1H641 2VUBA 3CBMA 3M5AA 1FKMA 2ZZDB 4PLIA 3KHIA 3OMGA 1P92A 3JCMe 1YJWA 1LNXA 4HCZA 3SWNA 4C5HA 3CCJT 3PIOA 2QA4T 1B34A 3META 2X4WA 3CBPA 2L3RA 2M0OA 2VXEA 3BDUA 3NTHA 2KQWA 3HFOA 3HB9A 3GPLA 5FU6C 3OYKA 1N27A 2ZCFB 4JS4A 4FT4A 2DD4A 5CQYA 3CPWA 2KY9A 4FM4B 5EG2A 2LCLA 4IUVA 5GAN8 2R5AA 5FU7C 2RB6A 2K57A 3KBGA 4MDWA 3V7CA 5I21A 1UGQB 3G6ET 1K9MC 4PJOA 4HCCA 4IUTA 3OSVA 3J80E 3CC2T 2PVOB 2BUDA 2EJGA 4ZTFA 2D6FA 3JCMh 3OS0A 3SDZA 3QO3A 4MZTA 4OVAA 5C6SA 4BE2A 2FB7A 5L8RE 4M75B 4C8QG 4HKEA 3CMEA 3CCJA 3L2WA 3JCMQ 1NPPA 2K5LA 5CKFA 4R56A 1WJRA 2EKOA 2PUOB 4JX5A 2K4YA 1M1GA 4LDUA 3I56T 1VQ4A 4A4HA 1U1SA 4M7AB 2QQ8A 1VQ5A 4GY5A 4C5IA 2Y4YA 3PFSA 1PSEA 2LTOA 2OTLT 1LJOA 4Z6YA 1M9SA 4X9DA 1YBYA 2DZ9A 2KR6A 4TVRA 3CXCS 4HLQA 3OBYA 2RI5A 3VV0A 2KMTA 4C0DC 3CCUT 4M78B 3JCMV 3J81E 4F7UF 1NZ9A 2F5TX 2RH2A 2BS3A 4AKHA 2RM4A 3CEYA 3HRTA 4XTWA 1NE8A 3LW5E 5CKBA 1VQLT 4GLKA 4J5YA 4PJOF 3WXMB 2DTIA 5CIUA 1I5LA 4M77B 2O4XB 4J7FA 4QVCA 3A5ZB 4M7DA 2QEXT 1M8VA 4FIBA 4X9CA 3BW1A 2DD5A 2YLCA 4XTYA 5J26A 3VUBA 5GMKm 3OYBA 2XHCA 3DL1A 1Q81C 2IVWA 3C12A 4PKCC 2DD4B 5CO7A 1SSFA 3A8LB 3QPHA 5LJ3d 1VQ6T 1YHQT 1M1KC 2RD1A 4C92G 1VQPA 4LDWA 1K73C 1HXDA 2MMPA 1B34B 3OYEA 3OB9A 4N4GA 5KE2A 4M7DE 4BI3A 1VQ4T 2ZZDA 3OBWA 4FT2A 2FYKA 4PL6A 3RESA 3QYBA 4A4GA 2CZ7B 3A8GB 2O01E 3M54A 4J7IA 5CKEA 1VIFA 2GFAA 1WGSA 4BI4A 1Q82C 4AKGA 3OYNA 2CZ1B 2VYTA 2WSFE 2L5QA 2CZ0B 2KSSA 4BD3A 5GMKj 4XU0A 3DLLA 3CC4A 3QBYA 3RERA 3JCMW 4OB3B 3HL8A 4AKIA 3JCMd 5DLQE 1YI2A 3H8ZA 4FU6A 3JCMc 1UGRB 2RA2A 2PU9B 1YJNT 3QSUA 2ZPEB 2XK0A 3LGFA 5I2MA 1YJ9T 1Q7YC 4M7DF 3VYGB 2RHIA 4NOYA 5GANf 2LNVA 5KE3A 4JRQA 1N9SA 5FU6B 2QFZA 1EIFA 2L8DA 1N9RA 3Q1JA 3G4SA 3CCEA 4A53A 5CKDA 4BBRM 2P0QA 4C0FA 5LJ3f 3LWIA 2RI3A 2DKGA 4M7DC 4M75F 4EDUA 2B8AA 2ZGWA 4ZN1A 1U8RA 4C92A 3JCMg 1VQNA 4BBSM 1Y7XA 2PQWA 3OY9A 1Y71A 2NLUA 3VKHA 4JX4A 1I8FA 2GF7A 4XQ3A 4CRIA 3JCMb 3CXCA 3CCST 2DXBA 2DAQA 2DXUA 4M7AF 2WJ9A 4M77A 3HRSA 1M1FA 3P8DA 3S3OA 5LJ5e 5CAIA 3JB9J 4QQ6A 4XU1A 3ME9A 2QXFA 2MWPA 3PT9A 4ELZC 1QLBA 5CK9A 3BY7A 3JSCA 4MMKA 4MZPA 4QW2A 4F7UB 3CCMT 1VQOA 1KC8U 5HKCA 4M78C 5GAOq 3KXTA 3SFMA 3HRUA 4BY6B 5J3BA 5LJ3e 4QVDA 3R6OA 3CBOA 5LJ5j 3GP8A 4BDYA 1BI0A 2XD0A 2F5KA 2D9TA 2KK4A 3INZA 3VJPA 4F7UA 5HK0A 2LDMA 1G3WA 4J8OA 3GOXA 1ZBXA 2VV5A 3CCLT 3JCMP 1G3TA 1N8RU 1VQ5T 3CPWS 1UEBA 3TW7A 4M75A 3X24B 2FL7A 5IT9E 3X20B 2RJFA 3ER0A 3OS5A 3OYLA 4M75C 4E7KA 3M53A 4HNUA 3G71T 1KG1A 2DXBB 4C8QA 3MP8A 5KCOA 3CCRA 1VQ6A 2ZPFB 4XAXB 3JB9H 2LC4A 3TREA 4AI6A 3CPFA 3GLXA 4XTVA 5GAOp 1YITT 3A8HB 2XI9A 4O5VA 1FWZA 1KQSS 4BE0A 3T9NA 4ELYC 4E7LA 1NJIC 1G3YA 2M9UA 2YHTA 2DTOA 4EMGA 3V7RA 3VYGA 5GMKi 2QQAA 4HA8A 3HKSA 4JUVA 2RI2A 4NL2A 4CI0C 4MFEA 4BUGA 1BYMA 2M16A 3CCVT 2K2VA 2DD5B 4XTUA 3E9GA 4L6V5 4LOCA 4RG8A 2WACA 3CMAA 4MIMA 2P0PA 1KD1U 3CCLA 5FRMA 1UGSB 2RHZA 2JOYA 1XQHA 4M7DB 5GAMf 3QHSA 4PNOA 3V7SA 2A3LA 4C0GA 4E47A 3G6EA 3OSSC 4C8QD 2FVUA 4JRKA 4N0AC 4QVZA 4Y28E 3A8OB 5GAN7 3M59A 3QIIA 5GMKl 2ZPGB 2LT1A 4LDVA 3TEEA 2EQJA 2KAFA 5KH6A 3S3MA 2EIFA 3F70A 3M4YA 1V29B 5GAN2 4HNTA 2V8JA 3E1SA 1VUBA 2JVVA 3HP9A 4L59A 4BB7A 2DK3A 3OYIA 4NS5A 5D6WA 5FLXE 3CCRT 5GANj 4M7AG 3VYHB 5D6YA 4II1A 3QWLA 3JRZA 4A4KA 5HY6A 1VQKA 2EJFA 4ELJA 1M4ZA 1OI1A 3M9QA 4C8QB 5DLOA 2O4XA 1K9MU 1JB0E 2M1HA 4M7DD 2QF7A 2JZ2A 2RO0A 3G4ST 3CCET 1G5VA 3UDCA 2XDBA 2E41A 2X4XA 3FIFA 4C5GA 3A8MB 5GAOr 2P0KA 4C92D 5GMKh 1Q86C 1VQ9T 1W2BS 2G3RA 2HQXA 5FROA 3MP6A 3RIRA 4ZGEB 2VGMA 3CMAT 2V8KA 3CCSA 3FLGA 3CCMA 3I55A 2RK1A 1YHQA 5D6XA 2MWOA 4C0DB 5LJ5g 3SD4A 3RKWA 5LL6S 3VKGA 1M5Q1 2Y90A 3GNGA 3QJYA 4M75E 1WJQA 5AYFA 3PTAA 3LH0A 4M77C 3FEOA 1WJSA 2BS2A 2RHYA 1O9SA 4OF1A 4OB0B 5LJ5f 1S72A 1QVFA 2EQUA 3E9FA 4J6XA 1YI2T 1E7PA 4IURA 4PJOB 4J83A 4M77F 4C92B 3QUIA 1VQ8T 4N4HA 1N6AA 3OYFA 3ASKA 1YCYA 2LQ8A 3QYEA 2GCXA 5CCAA 4Z02A 3TU4K 3BG3A 4E7HA 4MDXA 3L2ZA 2DXCB 3N5BB 3QKJA 4M77E 1YITA 1Q81U 3QYHB 4QQGA 5C0MA 1UGPB 2JUFA 4E7JA 5GANg 3SWNB 4QQDA 3VKIA 3HPWA 2EWNA 4KUDK 4RG2A 1WPYA 2PVDB 5GAOm 2DTHA 3QZ5B 3MEWA 3JB9G 3PGGA 1VQOT 2R5MA 1BKBA 3BFMA 3FB9A 3ZEHA 1M90C 3HSBA 2X4YA 4JLIA 3FDRA 2E10A 3UPUA 1K8AC 1WQWA 2H3JA 1JJ2A 4J6WA 4HT9A 1Y96A 2JN0A 2JTFA 4RKUE 3OQ5A 4M7AE 2DPPB 2XG8D 2XU8A 2ZPIB 3GNFB 4X34A 3X26B 5A0DA 5LJ5d 1PSFA 5FRNA 2E12A 4A54A 4FL6A 4C5EA 2HD0A 2X35A 4Y91A 3LWHA 2YLBA 1X75C 4PLLA 1D3BA 2RK2A 1QVGA 2Y4XA 3RMSA 1YIJT 3LYIA 3HZJA 4C8QF 3JB9I 1H3ZA 1BIBA 3P8HA 4FSXA 4M77G 5CKHA 5HK3A 1KQ2A 1O75A 4M6VA 2RJDA 1VQ9A 5A2QE 3OYYA 1OYXA 3FJPA 2KDSA 4ZN3A 4BI8B 2LX9A 2EQKA 3L42A 5A0LA 4QSHA 5GANh 3CC4T 3DKMA 4RCCA 2IG0A 2E6ZA 5LJ3h 2V8IA 2JNGA 3BDLA 3HHTB 1MHNA 3PNWC 5IAYA 2K3YA 4MMLA 1GXIE 3X25B 4Q5WA 1QW1A 4PJOG 3LGLA 5FU7B 1KHCA 4BY6C 4HT8A 3QXEB 2XDPA 3PMIA 3MEUA 5I2SA 3OW2A 4IUPA 2CZ6B 1VQMT 1WNLA 4HCBA 1KQ1A 3NTIA 3I56A 3JCMf 2RHUA 3TCJA 3RMQA 2BIVA 2DO3A 3G71A 1QP3A 2RHXA 4KBMB 3WVEB 4DOWA 3PIPA 2HAXA 4BACA 4M7AA 5IN1A 2LVMA 4C8QC 4ME7A 4IUQA 4JDSA 2QDJA 3M4GA 2MAMA 4C92F 2K5IA 2HQEA 3RKXA 3OYCA 3TW6A 3BG5A 5GAN3 3MP1A 1YIJA 3EFSA 3OW2S 4ZGJB 1R8OB 3FRNA 3OMCA 4DQ2A 2BKDN 4LDYA 3GIBA 4ATOA 2I2LA 1X6OA 1XOVA 3DB4A 3UWNA 2XIDA 4JS5A 4F7UE 1G3SA 1XNIA 3H6ZA 4J6YA 4OMFB 4M75G 3MCAB 4VUBA 4MFDA 1VQLA 1NPRA 3KUFA 2RJEA 4XTXA 3JB9F 1X01A 3HFNA 1AHJB 1TH7A 4JX6A 2K3XA 3C95A 4M7AD 1D3BB 1NJIU 1VQKT 1KHIA 1Y07A 1OZ3A 1VQ7A 2LRQA 4ZGDB 3OS2A 1FXXA 1BI1A 3M55A 5GAN5 2K5FA 1BI2A 2CGHA 4DOVA 1DJ7B 4M78E 4C92C 2DJZA 3QJ6A 1Y96B 3SB2A 3I55T 2EJ9A 5LJ3g 2LT4A 1QVGS 4V2SA 4XU3A 1OZ2A 2D0QB 3QDRB 5GAOn 4C0ZA 3CCUA 2L89A 2LQKA 4L5GA 3OYAA 1YJ9A 2OAUA 3EAEA 3O8VA 3CCVA 2EYQA 1K73U 1VQNT 3E19A 4OB2B 2X4JA 4IKFA 5GAMe 5GAMj 3OYJA 4N0AA 4JRIA 1S72T 3QZ9B 4YTLA 2P4TA 2QTXA 4EMKA 3MHXA 2E5QA 1QVPA 4IUUA 4M77D 3V8JA 5CVIA 2QEXA 4JRPA 1JJ2S 3CCQT 4PJOD 1XTDA 4EMKC 3OYHA 1I81A 2ZPHB 4O6JA 4D6WA 5CR2A 2JTMA 1ZHIA 4BE1A 1Q82U 3OS1A 4PJOC 1IZ6A 4RCBA 4ZTJA 1YJWT 1VQ8A 3AHUA 5GAMg 3JCMJ 3L2VA 5GAN6 2YRVA 1FX7A 2MI6A 2HNIA 2VGNA 2DZCA 3LX7A 3MO8A 1WQ7A 5GANe 2OTLA 4OP0A 5M9OA 4E7IA 1Q7YU 3M57A 4HNVA 3WVDB 2QQSA 1LOJA 2E6NA 3S3NA 3C4SA 3V8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSE A;  3VYG A;  2PUK B;  2DD5 B;  4L6V 5;  3LW5 E;  1UGS B;  4Y28 E;  4KT0 E;  3A8O B;  3HHT B;  2DD5 A;  1GXI E;  2ZPG B;  3X25 B;  2DD4 B;  3A8L B;  4OB1 B;  3QXE B;  2CZ6 B;  1V29 B;  3X28 B;  1QP3 A;  3WVE B;  4XK8 E;  1QP2 A;  2ZZD A;  2CZ7 B;  3VYH B;  3A8G B;  2O01 E;  2WSC E;  2CZ1 B;  2WSF E;  2CZ0 B;  1JB0 E;  4ZGJ B;  4OB3 B;  3A8M B;  1UGR B;  2PVG B;  2PU9 B;  2WSE E;  2ZPE B;  4ZGE B;  3VYG B;  1AHJ B;  2DXC A;  2ZPB B;  2AHJ B;  4ZGD B;  2CYZ B;  1IRE B;  1DJ7 B;  2DXB A;  2QDY B;  4OB0 B;  2D0Q B;  3QYG B;  4OB2 B;  2ZZD B;  2DXC B;  3QZ9 B;  3QYH B;  1UGP B;  2ZCF B;  2ZPH B;  2DD4 A;  4FM4 B;  2PVD B;  3QZ5 B;  3X24 B;  1UGQ B;  3X20 B;  2PVO B;  2DXB B;  4RKU E;  2DPP B;  2ZPI B;  3X26 B;  2ZPF B;  5L8R E;  1PSF A;  3WVD B;  3A8H B;  2PUO B; 
#chains in the Genus database with same CATH topology
 1K9A A;  3MEV A;  3CC7 T;  1Q86 U;  2ROL A;  2KMG A;  3DDP B;  4XU2 A;  3V8K A;  1M1K U;  1RAI B;  2VC8 A;  4M78 D;  1W98 B;  2DIQ A;  1JU5 C;  1N5Z A;  2R7G A;  2QAS A;  5GAN 4;  1UB4 A;  2E70 A;  1Y57 A;  1HK9 A;  4HL4 A;  3EGU A;  1W2B A;  1VQ7 T;  3L2U A;  3DJB A;  1RL2 A;  4M75 D;  5KYY A;  1WYX A;  4LD6 A;  4CC2 A;  3CCM Q;  2K2M A;  2HEQ A;  3VUZ A;  1AWO A;  3X28 B;  1BK2 A;  2E64 A;  2IW9 B;  4XK8 E;  2EYX A;  1QP2 A;  3CC7 A;  3DLM A;  4C92 E;  2CUD A;  4JJN K;  1WI7 A;  3G7Z A;  2COZ A;  2HBP A;  4M7D G;  4A4E A;  3J7A F;  1RAH B;  1M90 U;  1K8A U;  4ELL A;  3C94 A;  1OI9 B;  3RUX A;  1OX9 A;  5GMK e;  2DRK A;  3URG A;  4WF2 A;  3HBL A;  4JLG A;  4N4I A;  3QG1 A;  4R0K A;  2EYZ A;  1I0C A;  2COY A;  2D1X A;  9ATC B;  2OJ2 A;  3DB3 A;  3RKY A;  1VQN Q;  2V26 A;  1WHL A;  4EPC A;  1MMA A;  2QGG A;  2AKK A;  1X69 A;  3IQL A;  4C8Q E;  2C5N B;  1LVK A;  1Z9Z A;  4FYV B;  1KQS A;  5D7U A;  4M7A C;  2YUO A;  3CBM A;  2MK5 A;  1VQ8 T;  2FG0 A;  1P92 A;  4HCZ A;  3PIO A;  4WCI A;  3MET A;  3CPW P;  3NTH A;  2ZCF B;  4FT4 A;  2B86 A;  1UTI A;  4UN0 A;  1RAC B;  2KY9 A;  5CQY A;  2PJQ A;  1RAG B;  2R5A A;  5FU7 C;  2K57 A;  3KBG A;  2CP5 A;  2KNB B;  4PJO A;  3QDF A;  4HCC A;  2WEV B;  4NST B;  3OSV A;  4K11 A;  3R6N A;  3J80 E;  1TTH B;  4F7S B;  2D6F A;  1E6G A;  4BY1 X;  4J9B A;  3OS0 A;  3SDZ A;  5C6S A;  4BE2 A;  2FB7 A;  1E9H B;  3RDV A;  2C0I A;  4C8Q G;  3V8L A;  3CME A;  2SEM A;  1H1S B;  4OGR B;  1WA7 A;  1PNJ A;  2K5L A;  5CKF A;  3EHR A;  5HNB B;  2PUO B;  3I56 T;  2K4Y A;  4A4H A;  1U1S A;  4M7A B;  4GY5 A;  4C5I A;  4X9D A;  4BCO B;  7AT1 B;  4C0D C;  3CCU T;  2CT4 A;  3J81 E;  2RH2 A;  2BS3 A;  3CEY A;  3HRT A;  3NGP A;  1QWF A;  4EC8 B;  2DTI A;  5CIU A;  1V76 A;  2CCI B;  2QEX T;  1EX4 A;  3M0P A;  4BCM B;  1WZO A;  4DEY A;  1IRX A;  2FPE A;  4JZ4 A;  3QWX X;  3DL1 A;  4PKC C;  5LJ3 d;  1YHQ T;  1FMK A;  1GCP A;  4J9E A;  1ZA1 B;  3BHV B;  4N4G A;  4LXC A;  4DBF A;  3OBW A;  1VQ4 T;  3QYB A;  2CZ7 B;  2JMC A;  3A8G B;  4BCK B;  2O01 E;  3H0H A;  1QVF P;  5CKE A;  4GBQ A;  3EH2 A;  1AZG B;  1VIN A;  1Q82 C;  2CZ1 B;  5GMK j;  1QCO A;  5HBJ B;  1YP5 A;  4AFQ C;  1V1C A;  2EGE A;  5DLQ E;  2RA2 A;  1YJ9 T;  1NLP C;  2QGS A;  2LNV A;  2RQV A;  5KE3 A;  1PKT A;  1JO8 A;  1Q95 G;  3CCE A;  3EHQ A;  1GUX B;  4BBR M;  4BCN B;  2P0Q A;  4OML A;  4C0F A;  2DL3 A;  4M7D C;  4EDU A;  2ZGW A;  2LCS A;  8ATC B;  4BBS M;  2NLU A;  3CXC A;  4JX4 A;  2GF7 A;  1RAB B;  4CRI A;  2DXU A;  4M7A F;  3EFO A;  2WJ9 A;  2LX7 A;  3S3O A;  5LJ5 e;  5CAI A;  3JB9 J;  2ENM A;  2IVX A;  4XU1 A;  2PHG A;  1KXU A;  1FMV A;  4ELZ C;  5CK9 A;  4MZP A;  4QW2 A;  3CCM T;  3MJX A;  1KC8 U;  1ZUU A;  2IW6 B;  4M78 C;  3KXT A;  5LJ5 j;  1ZSG A;  3GP8 A;  2F5K A;  2KK4 A;  3INZ A;  1G3T A;  3X24 B;  2FL7 A;  2C6T B;  3CD6 Q;  2RJF A;  3ER0 A;  4M75 C;  3G71 T;  3MP8 A;  2L3Q A;  5GAO p;  2JT4 A;  2XI9 A;  1FWZ A;  4IMY B;  1NJI R;  4E7L A;  2M9U A;  1TUG B;  4EMG A;  1QKX A;  5GMK i;  1MMD A;  4MFE A;  1IB8 A;  4BCG B;  2HSP A;  4J9D A;  5GAM f;  1UG1 A;  3V7S A;  1SG5 A;  3G6E A;  4C8Q D;  4JRK A;  2QGF B;  1G2B A;  3QII A;  2LT1 A;  4LDV A;  2EQJ A;  2KAF A;  2W99 A;  5KH6 A;  2DEU A;  1IO6 A;  4HNT A;  2MPX C;  4L59 A;  1H8K A;  1ZSZ C;  2W10 A;  3OYI A;  4NS5 A;  5FLX E;  3CCR T;  5GAN j;  3VYH B;  4OMN A;  5D6Y A;  1AWX A;  5HY6 A;  1M90 R;  1VQK A;  1TUD A;  2EJF A;  4ELJ A;  1M4Z A;  1OI1 A;  1TD6 A;  1CSK A;  2KT1 A;  4ROC A;  3A1P A;  2QF7 A;  3MY1 B;  1P5E B;  1UJY A;  1G5V A;  3A8M B;  1OUL A;  5FRO A;  1M1K R;  2DBM A;  4AG1 C;  2VGM A;  2GNC A;  3CCS A;  3CCM A;  2LJ1 A;  4C0D B;  5LJ5 g;  1M8M A;  3SD4 A;  3RKW A;  5LL6 S;  3QJY A;  3PTA A;  3FEO A;  1U3O A;  1WJS A;  5LMK B;  4OF1 A;  1H27 B;  5LJ5 f;  4BY7 X;  4J6X A;  1E7P A;  4IUR A;  4PJO B;  4N4H A;  3OYF A;  1O9K A;  3RR6 A;  4MDX A;  1TOV A;  3L2Z A;  2E3H A;  1LPL A;  4QQG A;  2JUF A;  1BCO A;  4RTX A;  3TQ7 P;  1E6H A;  4KUD K;  1WFW A;  2PVD B;  3MEW A;  1H92 A;  5EC7 A;  4KRD B;  1BKB A;  3FB9 A;  3ZEH A;  4FYY B;  2X4Y A;  3M0R A;  3VS4 A;  1Y96 A;  2DPP B;  2XG8 D;  3GNF B;  4X34 A;  2DVJ A;  5LJ5 d;  1PSF A;  1OGU B;  2E12 A;  4FL6 A;  4EOR B;  1M2V B;  2YLB A;  4PLL A;  4II5 B;  1D3B A;  2RK2 A;  1YIJ T;  3SHW A;  4F7J B;  2ED1 A;  3JB9 I;  1BIB A;  4IIO A;  1NEG A;  1QLY A;  3FJP A;  2KDS A;  5A0L A;  1KFZ A;  2KE9 A;  5LJ3 h;  2JNG A;  3VS1 A;  3HHT B;  1GXI E;  3X25 B;  3PVL A;  3MPU B;  2V22 B;  2XDP A;  4IUP A;  1WNL A;  2OTL Q;  3NTI A;  3TCJ A;  3RMQ A;  1T3L A;  2DO3 A;  4QT7 A;  3G71 A;  4BAC A;  2QEX Q;  2LVM A;  1CKB A;  1TU0 B;  4ME7 A;  4JDS A;  5IF1 B;  4TTH A;  3RKX A;  4EON B;  3TW6 A;  4RTU A;  2G6F X;  3BG5 A;  5FWB A;  2JS2 A;  3EFS A;  4OMM A;  3OW2 S;  5HQ0 B;  2JXB A;  3BHU B;  3NHN A;  4LDY A;  3GIB A;  4ATO A;  3KFV A;  1XOV A;  4FX3 B;  3UWN A;  1ZA2 B;  1XNI A;  2L0A A;  3CQT A;  3H6Z A;  2ESW A;  4BCI B;  2OX7 A;  4HVU A;  4M7A D;  1NJI U;  1D3U B;  1VQK T;  1OZ3 A;  4ZGD B;  5EFQ B;  1FXX A;  5I22 A;  1HD3 A;  2I40 B;  3I55 T;  1Y96 B;  1CKA A;  1AD5 A;  5GAO n;  1VQ5 Q;  1YJ9 A;  1PRM C;  3EAE A;  3O8V A;  3CCV A;  2D8H A;  1BBZ A;  1B3Q A;  1B7T A;  3OYJ A;  2W9F A;  4JRI A;  3QZ9 B;  2W2H A;  1MUZ A;  1JJ2 S;  5CVI A;  4AG2 C;  3CCQ T;  4EMK C;  1KC8 R;  1ZHI A;  2EPD A;  3OS1 A;  4ZTJ A;  4ANJ A;  4CFV B;  1FX7 A;  1SHG A;  1WQ7 A;  4ORZ A;  1H25 B;  5M9O A;  4RTT A;  3TSW A;  2EKH A;  3S3N A;  3C4S A;  3RBB B;  1IGU A;  1UE9 A;  3M58 A;  1QVF S;  3CC2 Q;  4KGV B;  1MGQ A;  4BCJ B;  2CS7 A;  2PTK A;  2CUB A;  2F1L A;  1YI2 Q;  1U06 A;  3M56 A;  1YJN A;  1NBE B;  1WHM A;  4EOK B;  2MF2 A;  3EJ1 B;  1JRI A;  4LE9 A;  3H4C A;  2CSQ A;  2X51 A;  1ZX6 A;  4F7N B;  1F1B B;  1W1F A;  3TSZ A;  1H4L D;  4NC6 A;  4BCF B;  3CME T;  3GF5 A;  2WPA B;  1QVG P;  4EIK A;  3OA6 A;  3HO8 A;  1N8R C;  3P8B B;  1RI0 A;  1W6X A;  3I9Q A;  3VS7 A;  2IW8 B;  3L2Q A;  2R57 A;  3ZBD A;  1ZBJ A;  3JAM E;  2QQR A;  2KYM A;  2O9S A;  4XTZ A;  3EFR A;  1UHC A;  2LCC A;  2CP2 A;  4E7S A;  2JGZ B;  4F17 A;  5EJC A;  1RAE B;  2K6D A;  2BZ8 A;  4OGE A;  3D7S B;  1H28 B;  3OYM A;  3OW2 P;  2W0Z A;  2F2C A;  1VQP T;  5GAO l;  2LJ0 A;  3B57 A;  3OYD A;  4OGC A;  1UUE A;  1KD1 C;  2E65 A;  2XKO C;  3CCQ A;  1OIY B;  4F6S B;  3JB9 D;  2CYZ B;  3CD6 T;  1PD0 A;  2LW4 A;  2NUP A;  3PMT A;  3BLR B;  2KVQ G;  4CRL B;  2FZK B;  4LDX A;  1VIE A;  2G9X B;  1JBM A;  2XIC A;  1WLP B;  2VVK A;  1H26 B;  3QYG B;  2FRW A;  1H64 1;  2BPM B;  2ZZD B;  1A0N B;  3OMG A;  2QA4 T;  3CCJ T;  2WIH B;  1B34 A;  3CBP A;  1RAF B;  2MIO A;  2QTV A;  3GPL A;  3I5S A;  3OYK A;  4JS4 A;  4B6M A;  2LJ3 A;  1UGQ B;  1HJD A;  5DQV A;  1PRL C;  3JV3 A;  2PVO B;  2BUD A;  2CT3 A;  2NUZ A;  1BU1 A;  4QKU A;  3CC2 T;  4MZT A;  1PKS A;  2EW3 A;  5L8R E;  3G4S Q;  3L2W A;  1JQQ A;  1WXT A;  4JX5 A;  3EG9 A;  1GBR A;  1Q81 R;  2LTO A;  1LJO A;  4JZ3 A;  2KR6 A;  3DOG B;  1M30 A;  2KMT A;  1QMC A;  2UZL B;  2EYY A;  3JCM V;  2UUE B;  1NZ9 A;  2HKQ B;  2DER A;  4XTW A;  4GLK A;  1K8A R;  2BZX A;  2J6F A;  2O4X B;  1YCS B;  2DF6 A;  4X9C A;  3BW1 A;  4XTY A;  5GMK m;  2HL3 A;  2XHC A;  1Q81 C;  4LUE A;  2DD4 B;  4J9F A;  5CO7 A;  3QPH A;  2RD1 A;  1VQP A;  2MMP A;  1B34 B;  1QCN A;  4M7D E;  4BI3 A;  4PL6 A;  2FYK A;  5HCK A;  4J7I A;  3CCL Q;  4Z89 A;  3RGF B;  1VIF A;  1PC0 A;  2VYT A;  1GRI A;  2A36 A;  2CZ0 B;  1SF9 A;  4BD3 A;  1BCM A;  1D0Z A;  3CC4 A;  4OB3 B;  3HL8 A;  3JCM d;  2J7I A;  1YI2 A;  1YJN T;  2EYW A;  1UHF A;  2PU9 B;  2XK0 A;  2J6O A;  5I2M A;  1Q7Y C;  4M7D F;  2RHI A;  1EIF A;  1FMW A;  4RTV A;  3PO3 S;  1JST B;  1FYN A;  2MCN A;  1SKU B;  6AT1 B;  4ZN1 A;  2B8A A;  2CJM B;  1HSQ A;  2DL8 A;  2KXC A;  1M1K C;  3VKH A;  3CCS T;  2JW4 A;  2DAQ A;  5IHK A;  4M77 A;  4KRC B;  3HRS A;  1M1F A;  2QK0 A;  3ME9 A;  2QXF A;  2DL4 A;  2MWP A;  4MMK A;  5IDP B;  3HRU A;  3R6O A;  1IGQ A;  5IHN A;  1BI0 A;  3EG9 B;  3VJP A;  5HK0 A;  1G3W A;  4J8O A;  1ZBX A;  1KQS P;  1VQ5 T;  4RUG A;  1C1A A;  4M75 A;  3X20 B;  3OS5 A;  1OV3 A;  4WTO B;  1PM3 A;  5KCO A;  2FO0 A;  2VWF A;  2ZPF B;  2L3S A;  2LC4 A;  4AI6 A;  1YIT T;  4XTV A;  1N8R R;  4ZNX A;  1WHH A;  4ESR A;  4PJM A;  2O31 A;  2YHT A;  2ABL A;  1M3A A;  2QQA A;  4JUV A;  4CI0 C;  1ZUY A;  1BYM A;  2K2V A;  2YRC A;  1JOW A;  1TXQ A;  4LOC A;  1VYW B;  2DRM A;  3CMA A;  2O88 A;  2P0P A;  4CC3 A;  2RHZ A;  1TFB A;  4M7D B;  2DL7 A;  3QHS A;  4PNO A;  4E47 A;  1KIK A;  1AWJ A;  3OSS C;  2FVU A;  4QVZ A;  4Y28 E;  1NG2 A;  5GMK l;  3M0S A;  2ZPG B;  3TEE A;  3S3M A;  1E7O A;  4OMQ A;  3VS6 A;  1GY3 B;  2EVR A;  4RTZ A;  4M7A G;  4II1 A;  1VQL Q;  2DA9 A;  2EGA A;  4CFM B;  4C8Q B;  3VRZ A;  2UZE B;  4CFU D;  3G4S T;  2XDB A;  3RNJ A;  2X4X A;  1YJW Q;  2DLP A;  2P0K A;  1M3C A;  3RIR A;  1OU8 A;  2FPD A;  2RK1 A;  2RMO A;  2E4H A;  8AT1 B;  1IHV A;  1OPL A;  3GNG A;  1HYO A;  2CP0 A;  3LH0 A;  1D09 B;  2CRE A;  3CC4 Q;  1QVF A;  1T0J A;  2KXD A;  2DNU A;  1N6A A;  3ASK A;  1YCY A;  3QYE A;  5CCA A;  2JS0 A;  4Z02 A;  3BG3 A;  1UDL A;  4E7H A;  4Y72 B;  4GLM A;  1YIT A;  2KI7 A;  3BE3 A;  3QYH B;  1UGP B;  1X2K A;  5GAN g;  3SWN B;  5GAO m;  3EG0 A;  3JB9 G;  3QZ5 B;  1VQO T;  3UPU A;  1JJ2 A;  2H3J A;  1K0S A;  4J6W A;  4RKU E;  1KSW A;  2ZPI B;  1X6G A;  1Q82 R;  3I35 A;  3LWH A;  1X75 C;  1YHQ Q;  2Y4X A;  3RMS A;  4C8Q F;  2A28 A;  3QWY A;  1MNE A;  5HK3 A;  4YOS A;  4M6V A;  5IDN B;  1O75 A;  4JJC A;  2RJD A;  1KJW A;  2SRC A;  2J06 A;  3CCS Q;  4ZN3 A;  1VYU A;  2LX9 A;  1D0X A;  3TNW B;  4RCC A;  2IG0 A;  1GFC A;  2LNH B;  2K3Y A;  4MML A;  5IAY A;  4Q5W A;  1PCX A;  4BY6 C;  1X6B A;  4HT8 A;  5I2S A;  4HCB A;  3MI9 B;  3OW2 A;  2BZY A;  3JCM f;  1ABO A;  1TUC A;  4EC9 B;  4CC7 A;  2QDJ A;  2I53 A;  1OPK A;  5LQF B;  2HQE A;  3OYC A;  3G6E Q;  5GAN 3;  5KYU B;  1ARK A;  1ZP2 A;  3HTR A;  4ZGJ B;  4DQ2 A;  1OL1 B;  2ATC B;  2I2L A;  1X6O A;  4DBQ A;  4JS5 A;  1UNL D;  1GUX A;  4M75 G;  3MCA B;  2EBP A;  4VUB A;  1VQL A;  1X01 A;  2K3X A;  1D3B B;  1Y07 A;  1UFF A;  4FW2 A;  3M55 A;  5GAN 5;  1YJN Q;  1AZE A;  4DOV A;  1F5Q B;  4M78 E;  2DJZ A;  3QJ6 A;  5KYW A;  3ULR B;  1G3N C;  5LJ3 g;  1K76 A;  4XU3 A;  4BCH B;  2D0Q B;  2L2P A;  3G33 B;  4C0Z A;  2OAU A;  1VQ4 Q;  1RLQ C;  1K73 U;  4YOZ A;  4KRT A;  4IKF A;  1S72 T;  4EMK A;  2FPF A;  3MHX A;  4JRP A;  4M77 D;  3V8J A;  3QHW B;  1XTD A;  3OYH A;  2ZPH B;  5CR2 A;  2Z0W A;  4PJO C;  1VQ8 A;  5I5Z B;  3JCM J;  2KBT A;  2PK9 B;  1W2B P;  4JJB A;  2VGN A;  3MO8 A;  2PK2 A;  3EGX A;  4OP0 A;  1GBQ A;  3M57 A;  1LOJ A;  2KRM A;  1FVV B;  4DA4 A;  2K79 A;  2DFU A;  2EAY A;  3M0Q A;  2XMF A;  2WHB B;  5CQX A;  4D8D A;  1S1N A;  2QQB A;  5GAN d;  1C0M A;  2ECZ A;  4M4Z A;  2QQ9 A;  4PJO E;  3L2R A;  1I07 A;  5KYU A;  2VXF A;  1VQM A;  1AD6 A;  1I4K 1;  1GFD A;  2HBW A;  2EQM A;  2OTJ T;  2VB6 A;  4AMC A;  2JM8 A;  1BI3 A;  4B9W A;  1BIA A;  3NTK A;  5LJ5 h;  5DY9 A;  1UNG D;  2CH4 W;  3PE0 A;  3SWN C;  1M2V A;  3CD6 A;  2F69 A;  4KUI A;  2WXV B;  5KCH A;  1AEY A;  5CEI B;  2HZY A;  4F7U G;  2DME A;  2MYS A;  2RJC A;  2AKL A;  1NM7 A;  1GCQ A;  2QA4 A;  1VA7 A;  5LJ3 j;  1I5O B;  3MEA A;  2WSE E;  2DL5 A;  3G71 Q;  1ZQ1 A;  2HQH A;  5ACB A;  4EMK B;  3FJ5 A;  2DXC A;  2A7Y A;  2CP7 A;  2AHJ B;  2GFU A;  4ROD A;  2DIG A;  1C6V X;  4EOL B;  3L1A A;  1IRE B;  3TVT A;  2G77 A;  2UZD B;  4YC3 B;  1WDX A;  2J6K A;  1KD1 R;  3I5R A;  2E1H A;  1EZZ B;  2NUT B;  3VU3 C;  3C0C A;  4F70 B;  4M78 A;  4PLI A;  1FKM A;  1ZSZ A;  3KHI A;  1YJW A;  1LNX A;  2DE0 X;  5KYX B;  2YT6 A;  3HFO A;  4PJL A;  5FU6 C;  1N27 A;  4FM4 B;  5EG2 A;  1KK7 A;  4IUV A;  4MDW A;  3V7C A;  1K9M C;  3G6E T;  1BU2 A;  2EJG A;  4ZTF A;  4EOM B;  2KYB A;  3CCE Q;  4M75 B;  4HKE A;  3CCJ A;  3JCM Q;  2W9Z A;  4R56 A;  4IIM A;  1WJR A;  2EKO A;  1H1Q B;  4LDU A;  1M2O A;  2QQ8 A;  1R0B G;  2Y4Y A;  3PFS A;  5DQW A;  1NLO C;  1PSE A;  2OTL T;  1M9S A;  4Z6Y A;  1ENW A;  2W96 A;  2EUF A;  2DZ9 A;  3CXC S;  3VV0 A;  1WIE A;  1UNH D;  4EOO B;  1H1P B;  5FWC A;  4F7U F;  4F16 A;  1OQK A;  1NE8 A;  4LN2 A;  1VQL T;  4J5Y A;  1I5L A;  4M77 B;  4J7F A;  3A5Z B;  2VKN A;  3MY5 B;  1M8V A;  2C4G B;  1B07 A;  4DBR A;  3VUB A;  2YLC A;  5J26 A;  4BXX X;  2E3I A;  1VOM A;  3A8L B;  3CCJ Q;  4F7L B;  4C92 G;  1PG5 B;  1SHF A;  1NEB A;  1HXD A;  1U5S A;  5KYX A;  5KE2 A;  4CC4 B;  4FT2 A;  4PFO A;  2H3E B;  4A4G A;  1VQK Q;  1WHG A;  3EG2 A;  1WGS A;  2CCH B;  3OYN A;  3PVQ A;  4OMP A;  2L5Q A;  2KSS A;  2YUP A;  2FZG B;  4XU0 A;  3DLL A;  2QDL A;  3RER A;  3JCM W;  3TNH B;  4AKI A;  3VRY A;  3H8Z A;  2MOX A;  3JCM c;  1UGR B;  3QSU A;  1VQM Q;  4PJO D;  3VYG B;  4NOY A;  1OL2 B;  2QFZ A;  1N9R A;  3Q1J A;  1Q86 R;  4OR5 B;  2LQN A;  3CCQ Q;  2DKG A;  4M75 F;  4Y92 A;  1Q7Y R;  1VQN A;  1Y7X A;  2LZ6 B;  3OY9 A;  1Y71 A;  4XQ3 A;  3CCV Q;  1RLP C;  3JCM b;  2DXB A;  2NWM A;  3CMA Q;  1WHJ A;  2CDT A;  4G6L B;  1GH6 B;  4F6W B;  4QQ6 A;  4AFZ C;  1M27 C;  2C0T A;  3BY7 A;  4F7U B;  1VQO A;  5GAO q;  2P84 A;  3SFM A;  5J3B A;  5LJ3 e;  4QVD A;  2D9T A;  2LDM A;  3EID B;  1N8R U;  3CCL T;  3TW7 A;  5IT9 E;  2PMI B;  3OYL A;  2O2O A;  3M53 A;  4HNU A;  1UEC A;  1KG1 A;  2YUN A;  3CCR A;  1VQ6 A;  2JJ9 A;  3CPF A;  3DDQ B;  4O5V A;  2DM1 A;  2AT1 B;  1KQS S;  1QWE A;  3T9N A;  3M0U A;  1G3Y A;  2M02 A;  3VYG A;  4HA8 A;  3HKS A;  4NL2 A;  2X1N B;  1ZSZ B;  2M16 A;  5GJV B;  4XTU A;  2DD5 B;  2NUT A;  4RG8 A;  2WAC A;  3VS3 A;  1KD1 U;  3CCL A;  1X27 A;  5FRM A;  2X3X D;  2JOY A;  1XQH A;  4C0G A;  5KYW B;  2A3L A;  4FYW B;  3O5Z A;  2AK5 A;  3A8O B;  1SSH A;  1YN8 A;  1IHW A;  4CXA B;  2EIF A;  3F70 A;  3M4Y A;  1V29 B;  2WFY B;  2ED0 A;  3HP9 A;  2DK3 A;  2RPN A;  1R0C B;  4HVV A;  5D6W A;  3QWL A;  1QMZ B;  1TS9 A;  3NDQ A;  4CFU B;  2QG9 B;  1SPK A;  5IH2 A;  3M9Q A;  1JXM A;  2O4X A;  1JB0 E;  2M1H A;  2X9H A;  3CCE T;  1YFN A;  3UDC A;  4C5G A;  3CCU Q;  2C5X B;  1VYV A;  1VQ9 T;  2BTT A;  1W2B S;  1Q86 C;  2HQX A;  3LH5 A;  1SEM A;  3CMA T;  1OU9 A;  2K9G A;  2V8K A;  1AOJ A;  3I55 A;  1YHQ A;  2DIL A;  5D6X A;  1AVZ C;  3VKG A;  1M5Q 1;  2Y90 A;  5AYF A;  3EG3 A;  1NYF A;  4M77 C;  2CP3 A;  2BS2 A;  4CFX B;  1O9S A;  4OB0 B;  4KH0 B;  2NUP B;  2EQU A;  2HMA A;  1YI2 T;  4C92 B;  3QUI A;  3TU4 K;  2CH4 A;  2RQT A;  2DXC B;  4M77 E;  1Q81 U;  4LNP A;  4QQD A;  3THK A;  2KRO A;  1YNZ A;  1VYT A;  2HKN A;  2DTH A;  1K73 R;  2R5M A;  3CME Q;  1M90 C;  1JJ2 P;  1K8A C;  4BCQ B;  2E10 A;  1WQW A;  3REA B;  4BCP B;  4HT9 A;  2XU8 A;  1FIN B;  2EQI A;  3UA7 A;  5FRN A;  1TWB A;  1RAD B;  4A54 A;  2HD0 A;  2X35 A;  1XJW B;  3LYI A;  4FYX B;  2RN8 A;  1KQ2 A;  5CKH A;  5KYY B;  5A2Q E;  2AZV A;  3OYY A;  1VQ6 Q;  1OYX A;  1YJ9 Q;  1X2Q A;  3MKD A;  2P4R A;  3EGD B;  4BI8 B;  3CC4 T;  4QSH A;  1K9M R;  4OMO A;  1VQP Q;  2E6Z A;  1OOT A;  3EOC B;  5IXF A;  5CYI B;  1KHC A;  3PMI A;  4M7A E;  5HVY B;  2CZ6 B;  1KQ1 A;  1RUW A;  2RF0 A;  3I56 A;  2RHU A;  2C0O A;  1H1R B;  2RHX A;  3WVE B;  4DOW A;  3PIP A;  2HAX A;  2HCK A;  5IN1 A;  2FRY A;  2O9V A;  4C92 F;  2J05 A;  2DYI A;  1D1B A;  2C5V B;  1YIJ A;  1EFN A;  1H3H A;  3H0I A;  1R8O B;  5I11 A;  3FRN A;  4JJD A;  2XID A;  3O0G D;  1MND A;  4J6Y A;  1H24 B;  2KT8 A;  4MFD A;  4EOI B;  3JB9 F;  3HFN A;  1AHJ B;  4JX6 A;  1K0X A;  3BLQ B;  1KHI A;  1SRL A;  1NYG A;  1VQ7 A;  2LRQ A;  3OS2 A;  1OKW B;  1YWO A;  3EGX B;  4J9H A;  2K5F A;  2CGH A;  2B9R A;  4C92 C;  3SB2 A;  1QVG S;  4V2S A;  2KRN A;  3QDR B;  4PJJ A;  3U23 A;  3CCU A;  2A08 A;  2L89 A;  4L5G A;  3OYA A;  4RTY A;  3E19 A;  1YIT Q;  4OB2 B;  2A0F B;  4HVW A;  4YTL A;  2P4T A;  2QTX A;  2E5Q A;  4IUU A;  2QEX A;  4O6J A;  4BE1 A;  1Q82 U;  3AHU A;  5GAM g;  2LP5 A;  2GTO A;  3L2V A;  1W70 A;  5ICP B;  4J9C A;  4DEX A;  1UJ0 A;  2DZC A;  3LX7 A;  1PD1 A;  5GAN e;  2OTL A;  3H41 A;  2UZB B;  2HSE B;  4HNV A;  4EOS B;  1D1C A;  3POM A;  1XO2 A;  5AT1 B;  4EOP B;  2HL5 C;  4B9X A;  1G83 A;  2PUK B;  5GAM d;  4MZM A;  3NFC A;  4KGZ B;  4BDZ A;  1M3B A;  4KGX B;  1T0H A;  3BG9 A;  3EH1 A;  4EOQ B;  3SEM A;  3TNI B;  1JKW A;  3EGD A;  4FCY A;  2DEQ A;  2GQV A;  4KT0 E;  1KC8 C;  1AT1 B;  2BS4 A;  4OB1 B;  3ZFJ A;  1U1T A;  4LD9 K;  5DM7 R;  3FC3 A;  1W4S A;  2QI2 A;  3UT1 A;  2GBQ A;  2WSC E;  4UC4 A;  2K7A A;  2DXT A;  4R55 A;  4NL3 A;  2XDD A;  3S6W A;  3EFO B;  2M51 A;  4A4F A;  2C06 A;  3A98 A;  1GCQ C;  4P5N A;  3OYG A;  4M78 F;  4EMH A;  2PVG B;  4KUL A;  3I56 Q;  2CKK A;  4RMO A;  1J3T A;  2DMO A;  5GAM h;  1Z9Q A;  2EFI A;  2LMJ A;  2FHD A;  2GGR A;  2ZPB B;  4M78 G;  3JCM X;  2R58 A;  2OTJ A;  5A0G A;  1WXB A;  2VAS A;  4E7Z A;  1VQ9 Q;  1YIJ Q;  4D8K A;  3LLR A;  2D0N A;  2QDY B;  4I3Z B;  2OTJ Q;  2YUQ A;  3CC2 A;  5J39 A;  1D1A A;  2DVE A;  3M5A A;  2VUB A;  1VQ5 A;  3JCM e;  1WX6 A;  1OEB A;  4C5H A;  3SWN A;  2X4W A;  2L3R A;  2M0O A;  2VXE A;  3BDU A;  2KQW A;  4F14 A;  3HB9 A;  4HXJ A;  2EGC A;  3GBQ A;  2L3P A;  2V1Q A;  2DD4 A;  3CPW A;  2LCL A;  5GAN 8;  2RB6 A;  5I21 A;  4CFN B;  2V1R A;  2RNA A;  4IUT A;  1PKD B;  1R77 A;  3JCM h;  3UA6 A;  3QO3 A;  4J9I A;  4OVA A;  2C5O B;  2BE7 D;  1NPP A;  3VS0 A;  1M1G A;  3K7A M;  2JTE A;  3REB B;  1YBY A;  2M0Y A;  4TVR A;  4HLQ A;  3OBY A;  2RI5 A;  3UAT A;  4M78 B;  2QAZ A;  2F5T X;  2DET A;  2RM4 A;  4AKH A;  1K4U S;  1K1Z A;  3LW5 E;  5CKB A;  4AFU C;  2NYS A;  4PJO F;  3WXM B;  4QVC A;  4M7D A;  3M0T A;  4Z88 A;  2LQW A;  4FIB A;  1X43 A;  3VS5 A;  2DD5 A;  4EOJ B;  3OYB A;  1RAA B;  1N4M A;  4ROE A;  2IVW A;  3C12 A;  1SSF A;  1VQ6 T;  1Y0M A;  2F2X A;  4LDW A;  1K73 C;  5FGK B;  3UF4 A;  2CP6 A;  3OYE A;  3OB9 A;  1JSU B;  5IHI A;  2ZZD A;  2F2W A;  3RES A;  3M54 A;  1WHK A;  2AIR B;  1OX8 A;  2GFA A;  4BI4 A;  4AKG A;  2WSF E;  3BLH B;  3QBY A;  1VQO Q;  3NPF A;  4FU6 A;  2ZPE B;  3LGF A;  1MV0 B;  5GAN f;  3LQ5 B;  1N9S A;  5FU6 B;  4JRQ A;  2I0N A;  2L8D A;  2OAW A;  3G4S A;  4A53 A;  5CKD A;  4PK4 A;  5LJ3 f;  3LWI A;  2RI3 A;  1GL5 A;  2D8J A;  1U8R A;  4C92 A;  3JCM g;  1VQ4 A;  2PQW A;  4CFW B;  1I8F A;  1D0Y A;  3CXC P;  1URC B;  3P8D A;  1JEG A;  4FSS A;  3QHR B;  3PT9 A;  1QLB A;  3JSC A;  5ECA A;  5HKC A;  4BY6 B;  1YWP A;  3CBO A;  2YWW A;  1MMN A;  4BDY A;  2XD0 A;  3H9N A;  2ZAE A;  4F7U A;  3GOX A;  4YOO A;  2VV5 A;  4PJN A;  4F04 B;  3JCM P;  3CCR Q;  2HDA A;  3CPW S;  1UEB A;  1TG0 A;  3I55 Q;  2WMA B;  4E7K A;  3DTO A;  2OI3 A;  5KYN A;  2DXB B;  1ZUK A;  4C8Q A;  2BE9 B;  2DJQ A;  4XAX B;  3JB9 H;  3TRE A;  2KEA A;  3GLX A;  4Z8A A;  3A8H B;  1JXO A;  1AIS B;  4BE0 A;  4ELY C;  1NJI C;  4HCK A;  2DTO A;  1BB9 A;  3V7R A;  1VQ7 Q;  2YRD A;  2RI2 A;  4BUG A;  1QCF A;  2QYZ A;  3CCV T;  3E9G A;  4L6V 5;  4MIM A;  1UGS B;  4N0A C;  2DBK A;  5GAN 7;  3M59 A;  3F5X B;  1OKV B;  2IN3 A;  5GAN 2;  4BCQ D;  2V8J A;  3E1S A;  1VUB A;  2JVV A;  4BB7 A;  2PNI A;  1O9K B;  3BHT B;  4A4K A;  3JRZ A;  2QA4 Q;  2YXY A;  5IXB A;  2COW A;  1S72 Q;  5DLO A;  2FEI A;  4AFS C;  1K9M U;  4M7D D;  2JZ2 A;  1C9B A;  2RO0 A;  2E41 A;  3FIF A;  5GAO r;  4C92 D;  5GMK h;  2E5K A;  2G3R A;  3MP6 A;  2IIM A;  4ZGE B;  2H8H A;  3FLG A;  4E6R A;  2MWO A;  4M75 E;  1ZLM A;  1WJQ A;  5HBE B;  1MMG A;  2RHY A;  1S72 A;  3E9F A;  4FW1 A;  1SRM A;  2F2V A;  2RQU A;  4J83 A;  4M77 F;  2RQR A;  5HBH B;  2GCX A;  2LQ8 A;  1T3S A;  2AZS A;  3N5B B;  2ROT A;  3QKJ A;  2RQW A;  5C0M A;  3NMZ C;  4E7J A;  3VKI A;  3HPW A;  2EWN A;  4RG2 A;  1WPY A;  2GQI A;  1MV3 A;  3PGG A;  3BFM A;  3HSB A;  2A37 A;  4JLI A;  3FDR A;  1ACM B;  1IXD A;  4E2F B;  2JN0 A;  2JTF A;  3OQ5 A;  1UGV A;  3M03 A;  3X26 B;  4C5E A;  4Y91 A;  3G1J A;  1QVG A;  2KRS A;  3HZJ A;  4LUD A;  3ZL7 C;  1H3Z A;  3P8H A;  4FSX A;  4M77 G;  1LCK A;  1VQ9 A;  4J9G A;  2YDL A;  2IPO B;  3L42 A;  2EQK A;  5GAN h;  2JMA A;  3GTM S;  3CC7 Q;  2WIP B;  5L23 A;  3DKM A;  2V8I A;  3BDL A;  1MHN A;  3VS2 A;  3PNW C;  2YSQ A;  4PJO G;  1QW1 A;  3LGL A;  4KH1 B;  4BCM D;  5FU7 B;  4BCN D;  3QXE B;  1VQ8 Q;  3MEU A;  1VQM T;  5IHY A;  2CSI A;  2BIV A;  1QP3 A;  4KBM B;  5BNJ B;  4PFZ A;  4M7A A;  4C8Q C;  4IUQ A;  3M4G A;  1ABQ A;  2MAM A;  3H0F A;  2K5I A;  2PZ1 A;  1I1J A;  3MP1 A;  3TN8 B;  4RTW A;  4JPB W;  3OMC A;  4AT1 B;  2BKD N;  1OIU B;  2BKZ B;  2K3B A;  3DB4 A;  2WMB B;  1WXU A;  1G3S A;  3MIA B;  4PFP A;  4F7U E;  2FZC B;  4OMF B;  1NPR A;  1QKW A;  3KUF A;  1AWW A;  2RJE A;  4XTX A;  2KGT A;  1TH7 A;  3C95 A;  1PWT A;  1PHT A;  4A63 B;  1BI1 A;  2DYB A;  1BI2 A;  1DJ7 B;  3AT1 B;  1TSF A;  5FW9 A;  2EJ9 A;  2LT4 A;  5L2W B;  2KR3 A;  1OZ2 A;  4DBH A;  1QQJ A;  2LQK A;  2EYQ A;  1VQN T;  2X4J A;  5GAM e;  5GAM j;  3E2U A;  4N0A A;  1QVP A;  1G8X A;  5GJW B;  1I81 A;  4D6W A;  2JTM A;  1IZ6 A;  4RCB A;  1YJW T;  4F6U B;  1VOL A;  2DX1 A;  5GAN 6;  2YRV A;  3EG1 A;  2MI6 A;  2HNI A;  1RI9 A;  2GTJ A;  4E7I A;  1Q7Y U;  2X3W D;  3WVD B;  2QQS A;  2E6N A;  5A0D A;  2JM9 A;  4X1V A; 
#chains in the Genus database with same CATH homology
 4DA4 A;  3M58 A;  3MEV A;  1QVF S;  3CC7 T;  1Q86 U;  2EAY A;  2KMG A;  1MGQ A;  2CS7 A;  2PUK B;  4XU2 A;  3V8K A;  1M1K U;  5CQX A;  2VC8 A;  3M56 A;  4M78 D;  2QQB A;  1YJN A;  5GAN d;  5GAM d;  4MZM A;  3NFC A;  2DIQ A;  2QQ9 A;  2MF2 A;  5GAN 4;  1UB4 A;  2E70 A;  4BDZ A;  4PJO E;  1JRI A;  3L2R A;  1VQM A;  2VXF A;  3H4C A;  1I4K 1;  3BG9 A;  1HK9 A;  4HL4 A;  2DEQ A;  2EQM A;  2GQV A;  4KT0 E;  2OTJ T;  1W2B A;  1KC8 C;  1VQ7 T;  3L2U A;  2BS4 A;  1BI3 A;  1RL2 A;  4NC6 A;  4M75 D;  4OB1 B;  4LD6 A;  4B9W A;  1BIA A;  3GF5 A;  3CME T;  3ZFJ A;  1U1T A;  4LD9 K;  3NTK A;  3VUZ A;  3OA6 A;  3HO8 A;  5LJ5 h;  3X28 B;  1RI0 A;  3P8B B;  5DY9 A;  5DM7 R;  1N8R C;  2E64 A;  4XK8 E;  3FC3 A;  1QP2 A;  3CC7 A;  1W4S A;  3DLM A;  4B9X A;  3SWN C;  3CD6 A;  2QI2 A;  4C92 E;  2F69 A;  2R57 A;  3UT1 A;  3L2Q A;  3ZBD A;  4KUI A;  3JAM E;  2QQR A;  2WSC E;  4UC4 A;  4JJN K;  5KCH A;  3G7Z A;  2DXT A;  4XTZ A;  2HBP A;  3EFR A;  4M7D G;  4A4E A;  4R55 A;  4NL3 A;  2XDD A;  3S6W A;  3J7A F;  2LCC A;  4A4F A;  4F7U G;  2C06 A;  4P5N A;  1M90 U;  2RJC A;  1K8A U;  3OYG A;  3C94 A;  4M78 F;  2QA4 A;  3RUX A;  5GMK e;  4EMH A;  5EJC A;  5LJ3 j;  3URG A;  4WF2 A;  2PVG B;  3MEA A;  2WSE E;  3HBL A;  4JLG A;  4KUL A;  4OGE A;  3OYM A;  4N4I A;  2CKK A;  1ZQ1 A;  4RMO A;  3QG1 A;  4EMK B;  5GAM h;  2EFI A;  2FHD A;  2DXC A;  2A7Y A;  2ZPB B;  2AHJ B;  4M78 G;  2GFU A;  3JCM X;  2R58 A;  5GAO l;  1VQP T;  2DIG A;  3DB3 A;  4OGC A;  3RKY A;  3OYD A;  1KD1 C;  2OTJ A;  5A0G A;  2E65 A;  2XKO C;  3L1A A;  3CCQ A;  4EPC A;  3JB9 D;  2CYZ B;  3CD6 T;  1IRE B;  3LLR A;  3PMT A;  4C8Q E;  2QDY B;  2G77 A;  2KVQ G;  4LDX A;  1VIE A;  1JBM A;  2E1H A;  2XIC A;  1KQS A;  3CC2 A;  3VU3 C;  3QYG B;  4M78 A;  5J39 A;  4M7A C;  2DVE A;  1H64 1;  2VUB A;  3CBM A;  3M5A A;  1FKM A;  2ZZD B;  4PLI A;  3KHI A;  3OMG A;  1P92 A;  3JCM e;  1YJW A;  1LNX A;  4HCZ A;  3SWN A;  4C5H A;  3CCJ T;  3PIO A;  2QA4 T;  1B34 A;  3MET A;  2X4W A;  3CBP A;  2L3R A;  2M0O A;  2VXE A;  3BDU A;  3NTH A;  2KQW A;  3HFO A;  3HB9 A;  3GPL A;  5FU6 C;  3OYK A;  1N27 A;  2ZCF B;  4JS4 A;  4FT4 A;  2DD4 A;  5CQY A;  3CPW A;  2KY9 A;  4FM4 B;  5EG2 A;  2LCL A;  4IUV A;  5GAN 8;  2R5A A;  5FU7 C;  2RB6 A;  2K57 A;  3KBG A;  4MDW A;  3V7C A;  5I21 A;  1UGQ B;  3G6E T;  1K9M C;  4PJO A;  4HCC A;  4IUT A;  3OSV A;  3J80 E;  3CC2 T;  2PVO B;  2BUD A;  2EJG A;  4ZTF A;  2D6F A;  3JCM h;  3OS0 A;  3SDZ A;  3QO3 A;  4MZT A;  4OVA A;  5C6S A;  4BE2 A;  2FB7 A;  5L8R E;  4M75 B;  4C8Q G;  4HKE A;  3CME A;  3CCJ A;  3L2W A;  3JCM Q;  1NPP A;  2K5L A;  5CKF A;  4R56 A;  1WJR A;  2EKO A;  2PUO B;  4JX5 A;  2K4Y A;  1M1G A;  4LDU A;  3I56 T;  1VQ4 A;  4A4H A;  1U1S A;  4M7A B;  2QQ8 A;  1VQ5 A;  4GY5 A;  4C5I A;  2Y4Y A;  3PFS A;  1PSE A;  2LTO A;  2OTL T;  1LJO A;  4Z6Y A;  1M9S A;  4X9D A;  1YBY A;  2DZ9 A;  2KR6 A;  4TVR A;  3CXC S;  4HLQ A;  3OBY A;  2RI5 A;  3VV0 A;  2KMT A;  4C0D C;  3CCU T;  4M78 B;  3JCM V;  3J81 E;  4F7U F;  1NZ9 A;  2F5T X;  2RH2 A;  2BS3 A;  4AKH A;  2RM4 A;  3CEY A;  3HRT A;  4XTW A;  1NE8 A;  3LW5 E;  5CKB A;  1VQL T;  4GLK A;  4J5Y A;  4PJO F;  3WXM B;  2DTI A;  5CIU A;  1I5L A;  4M77 B;  2O4X B;  4J7F A;  4QVC A;  3A5Z B;  4M7D A;  2QEX T;  1M8V A;  4FIB A;  4X9C A;  3BW1 A;  2DD5 A;  2YLC A;  4XTY A;  5J26 A;  3VUB A;  5GMK m;  3OYB A;  2XHC A;  3DL1 A;  1Q81 C;  2IVW A;  3C12 A;  4PKC C;  2DD4 B;  5CO7 A;  1SSF A;  3A8L B;  3QPH A;  5LJ3 d;  1VQ6 T;  1YHQ T;  1M1K C;  2RD1 A;  4C92 G;  1VQP A;  4LDW A;  1K73 C;  1HXD A;  2MMP A;  1B34 B;  3OYE A;  3OB9 A;  4N4G A;  5KE2 A;  4M7D E;  4BI3 A;  1VQ4 T;  2ZZD A;  3OBW A;  4FT2 A;  2FYK A;  4PL6 A;  3RES A;  3QYB A;  4A4G A;  2CZ7 B;  3A8G B;  2O01 E;  3M54 A;  4J7I A;  5CKE A;  1VIF A;  2GFA A;  1WGS A;  4BI4 A;  1Q82 C;  4AKG A;  3OYN A;  2CZ1 B;  2VYT A;  2WSF E;  2L5Q A;  2CZ0 B;  2KSS A;  4BD3 A;  5GMK j;  4XU0 A;  3DLL A;  3CC4 A;  3QBY A;  3RER A;  3JCM W;  4OB3 B;  3HL8 A;  4AKI A;  3JCM d;  5DLQ E;  1YI2 A;  3H8Z A;  4FU6 A;  3JCM c;  1UGR B;  2RA2 A;  2PU9 B;  1YJN T;  3QSU A;  2ZPE B;  2XK0 A;  3LGF A;  5I2M A;  1YJ9 T;  1Q7Y C;  4M7D F;  3VYG B;  2RHI A;  4NOY A;  5GAN f;  2LNV A;  5KE3 A;  4JRQ A;  1N9S A;  5FU6 B;  2QFZ A;  1EIF A;  2L8D A;  1N9R A;  3Q1J A;  3G4S A;  3CCE A;  4A53 A;  5CKD A;  4BBR M;  2P0Q A;  4C0F A;  5LJ3 f;  3LWI A;  2RI3 A;  2DKG A;  4M7D C;  4M75 F;  4EDU A;  2B8A A;  2ZGW A;  4ZN1 A;  1U8R A;  4C92 A;  3JCM g;  1VQN A;  4BBS M;  1Y7X A;  2PQW A;  3OY9 A;  1Y71 A;  2NLU A;  3VKH A;  4JX4 A;  1I8F A;  2GF7 A;  4XQ3 A;  4CRI A;  3JCM b;  3CXC A;  3CCS T;  2DXB A;  2DAQ A;  2DXU A;  4M7A F;  2WJ9 A;  4M77 A;  3HRS A;  1M1F A;  3P8D A;  3S3O A;  5LJ5 e;  5CAI A;  3JB9 J;  4QQ6 A;  4XU1 A;  3ME9 A;  2QXF A;  2MWP A;  3PT9 A;  4ELZ C;  1QLB A;  5CK9 A;  3BY7 A;  3JSC A;  4MMK A;  4MZP A;  4QW2 A;  4F7U B;  3CCM T;  1VQO A;  1KC8 U;  5HKC A;  4M78 C;  5GAO q;  3KXT A;  3SFM A;  3HRU A;  4BY6 B;  5J3B A;  5LJ3 e;  4QVD A;  3R6O A;  3CBO A;  5LJ5 j;  3GP8 A;  4BDY A;  1BI0 A;  2XD0 A;  2F5K A;  2D9T A;  2KK4 A;  3INZ A;  3VJP A;  4F7U A;  5HK0 A;  2LDM A;  1G3W A;  4J8O A;  3GOX A;  1ZBX A;  2VV5 A;  3CCL T;  3JCM P;  1G3T A;  1N8R U;  1VQ5 T;  3CPW S;  1UEB A;  3TW7 A;  4M75 A;  3X24 B;  2FL7 A;  5IT9 E;  3X20 B;  2RJF A;  3ER0 A;  3OS5 A;  3OYL A;  4M75 C;  4E7K A;  3M53 A;  4HNU A;  3G71 T;  1KG1 A;  2DXB B;  4C8Q A;  3MP8 A;  5KCO A;  3CCR A;  1VQ6 A;  2ZPF B;  4XAX B;  3JB9 H;  2LC4 A;  3TRE A;  4AI6 A;  3CPF A;  3GLX A;  4XTV A;  5GAO p;  1YIT T;  3A8H B;  2XI9 A;  4O5V A;  1FWZ A;  1KQS S;  4BE0 A;  3T9N A;  4ELY C;  4E7L A;  1NJI C;  1G3Y A;  2M9U A;  2YHT A;  2DTO A;  4EMG A;  3V7R A;  3VYG A;  5GMK i;  2QQA A;  4HA8 A;  3HKS A;  4JUV A;  2RI2 A;  4NL2 A;  4CI0 C;  4MFE A;  4BUG A;  1BYM A;  2M16 A;  3CCV T;  2K2V A;  2DD5 B;  4XTU A;  3E9G A;  4L6V 5;  4LOC A;  4RG8 A;  2WAC A;  3CMA A;  4MIM A;  2P0P A;  1KD1 U;  3CCL A;  5FRM A;  1UGS B;  2RHZ A;  2JOY A;  1XQH A;  4M7D B;  5GAM f;  3QHS A;  4PNO A;  3V7S A;  2A3L A;  4C0G A;  4E47 A;  3G6E A;  3OSS C;  4C8Q D;  2FVU A;  4JRK A;  4N0A C;  4QVZ A;  4Y28 E;  3A8O B;  5GAN 7;  3M59 A;  3QII A;  5GMK l;  2ZPG B;  2LT1 A;  4LDV A;  3TEE A;  2EQJ A;  2KAF A;  5KH6 A;  3S3M A;  2EIF A;  3F70 A;  3M4Y A;  1V29 B;  5GAN 2;  4HNT A;  2V8J A;  3E1S A;  1VUB A;  2JVV A;  3HP9 A;  4L59 A;  4BB7 A;  2DK3 A;  3OYI A;  4NS5 A;  5D6W A;  5FLX E;  3CCR T;  5GAN j;  4M7A G;  3VYH B;  5D6Y A;  4II1 A;  3QWL A;  3JRZ A;  4A4K A;  5HY6 A;  1VQK A;  2EJF A;  4ELJ A;  1M4Z A;  1OI1 A;  3M9Q A;  4C8Q B;  5DLO A;  2O4X A;  1K9M U;  1JB0 E;  2M1H A;  4M7D D;  2QF7 A;  2JZ2 A;  2RO0 A;  3G4S T;  3CCE T;  1G5V A;  3UDC A;  2XDB A;  2E41 A;  2X4X A;  3FIF A;  4C5G A;  3A8M B;  5GAO r;  2P0K A;  4C92 D;  5GMK h;  1Q86 C;  1VQ9 T;  1W2B S;  2G3R A;  2HQX A;  5FRO A;  3MP6 A;  3RIR A;  4ZGE B;  2VGM A;  3CMA T;  2V8K A;  3CCS A;  3FLG A;  3CCM A;  3I55 A;  2RK1 A;  1YHQ A;  5D6X A;  2MWO A;  4C0D B;  5LJ5 g;  3SD4 A;  3RKW A;  5LL6 S;  3VKG A;  1M5Q 1;  2Y90 A;  3GNG A;  3QJY A;  4M75 E;  1WJQ A;  5AYF A;  3PTA A;  3LH0 A;  4M77 C;  3FEO A;  1WJS A;  2BS2 A;  2RHY A;  1O9S A;  4OF1 A;  4OB0 B;  5LJ5 f;  1S72 A;  1QVF A;  2EQU A;  3E9F A;  4J6X A;  1YI2 T;  1E7P A;  4IUR A;  4PJO B;  4J83 A;  4M77 F;  4C92 B;  3QUI A;  1VQ8 T;  4N4H A;  1N6A A;  3OYF A;  3ASK A;  1YCY A;  2LQ8 A;  3QYE A;  2GCX A;  5CCA A;  4Z02 A;  3TU4 K;  3BG3 A;  4E7H A;  4MDX A;  3L2Z A;  2DXC B;  3N5B B;  3QKJ A;  4M77 E;  1YIT A;  1Q81 U;  3QYH B;  4QQG A;  5C0M A;  1UGP B;  2JUF A;  4E7J A;  5GAN g;  3SWN B;  4QQD A;  3VKI A;  3HPW A;  2EWN A;  4KUD K;  4RG2 A;  1WPY A;  2PVD B;  5GAO m;  2DTH A;  3QZ5 B;  3MEW A;  3JB9 G;  3PGG A;  1VQO T;  2R5M A;  1BKB A;  3BFM A;  3FB9 A;  3ZEH A;  1M90 C;  3HSB A;  2X4Y A;  4JLI A;  3FDR A;  2E10 A;  3UPU A;  1K8A C;  1WQW A;  2H3J A;  1JJ2 A;  4J6W A;  4HT9 A;  1Y96 A;  2JN0 A;  2JTF A;  4RKU E;  3OQ5 A;  4M7A E;  2DPP B;  2XG8 D;  2XU8 A;  2ZPI B;  3GNF B;  4X34 A;  3X26 B;  5A0D A;  5LJ5 d;  1PSF A;  5FRN A;  2E12 A;  4A54 A;  4FL6 A;  4C5E A;  2HD0 A;  2X35 A;  4Y91 A;  3LWH A;  2YLB A;  1X75 C;  4PLL A;  1D3B A;  2RK2 A;  1QVG A;  2Y4X A;  3RMS A;  1YIJ T;  3LYI A;  3HZJ A;  4C8Q F;  3JB9 I;  1H3Z A;  1BIB A;  3P8H A;  4FSX A;  4M77 G;  5CKH A;  5HK3 A;  1KQ2 A;  1O75 A;  4M6V A;  2RJD A;  1VQ9 A;  5A2Q E;  3OYY A;  1OYX A;  3FJP A;  2KDS A;  4ZN3 A;  4BI8 B;  2LX9 A;  2EQK A;  3L42 A;  5A0L A;  4QSH A;  5GAN h;  3CC4 T;  3DKM A;  4RCC A;  2IG0 A;  2E6Z A;  5LJ3 h;  2V8I A;  2JNG A;  3BDL A;  3HHT B;  1MHN A;  3PNW C;  5IAY A;  2K3Y A;  4MML A;  1GXI E;  3X25 B;  4Q5W A;  1QW1 A;  4PJO G;  3LGL A;  5FU7 B;  1KHC A;  4BY6 C;  4HT8 A;  3QXE B;  2XDP A;  3PMI A;  3MEU A;  5I2S A;  3OW2 A;  4IUP A;  2CZ6 B;  1VQM T;  1WNL A;  4HCB A;  1KQ1 A;  3NTI A;  3I56 A;  3JCM f;  2RHU A;  3TCJ A;  3RMQ A;  2BIV A;  2DO3 A;  3G71 A;  1QP3 A;  2RHX A;  4KBM B;  3WVE B;  4DOW A;  3PIP A;  2HAX A;  4BAC A;  4M7A A;  5IN1 A;  2LVM A;  4C8Q C;  4ME7 A;  4IUQ A;  4JDS A;  2QDJ A;  3M4G A;  2MAM A;  4C92 F;  2K5I A;  2HQE A;  3RKX A;  3OYC A;  3TW6 A;  3BG5 A;  5GAN 3;  3MP1 A;  1YIJ A;  3EFS A;  3OW2 S;  4ZGJ B;  1R8O B;  3FRN A;  3OMC A;  4DQ2 A;  2BKD N;  4LDY A;  3GIB A;  4ATO A;  2I2L A;  1X6O A;  1XOV A;  3DB4 A;  3UWN A;  2XID A;  4JS5 A;  4F7U E;  1G3S A;  1XNI A;  3H6Z A;  4J6Y A;  4OMF B;  4M75 G;  3MCA B;  4VUB A;  4MFD A;  1VQL A;  1NPR A;  3KUF A;  2RJE A;  4XTX A;  3JB9 F;  1X01 A;  3HFN A;  1AHJ B;  1TH7 A;  4JX6 A;  2K3X A;  3C95 A;  4M7A D;  1D3B B;  1NJI U;  1VQK T;  1KHI A;  1Y07 A;  1OZ3 A;  1VQ7 A;  2LRQ A;  4ZGD B;  3OS2 A;  1FXX A;  1BI1 A;  3M55 A;  5GAN 5;  2K5F A;  1BI2 A;  2CGH A;  4DOV A;  1DJ7 B;  4M78 E;  4C92 C;  2DJZ A;  3QJ6 A;  1Y96 B;  3SB2 A;  3I55 T;  2EJ9 A;  5LJ3 g;  2LT4 A;  1QVG S;  4V2S A;  4XU3 A;  1OZ2 A;  2D0Q B;  3QDR B;  5GAO n;  4C0Z A;  3CCU A;  2L89 A;  2LQK A;  4L5G A;  3OYA A;  1YJ9 A;  2OAU A;  3EAE A;  3O8V A;  3CCV A;  2EYQ A;  1K73 U;  1VQN T;  3E19 A;  4OB2 B;  2X4J A;  4IKF A;  5GAM e;  5GAM j;  3OYJ A;  4N0A A;  4JRI A;  1S72 T;  3QZ9 B;  4YTL A;  2P4T A;  2QTX A;  4EMK A;  3MHX A;  2E5Q A;  1QVP A;  4IUU A;  4M77 D;  3V8J A;  5CVI A;  2QEX A;  4JRP A;  1JJ2 S;  3CCQ T;  4PJO D;  1XTD A;  4EMK C;  3OYH A;  1I81 A;  2ZPH B;  4O6J A;  4D6W A;  5CR2 A;  2JTM A;  1ZHI A;  4BE1 A;  1Q82 U;  3OS1 A;  4PJO C;  1IZ6 A;  4RCB A;  4ZTJ A;  1YJW T;  1VQ8 A;  3AHU A;  5GAM g;  3JCM J;  3L2V A;  5GAN 6;  2YRV A;  1FX7 A;  2MI6 A;  2HNI A;  2VGN A;  2DZC A;  3LX7 A;  3MO8 A;  1WQ7 A;  5GAN e;  2OTL A;  4OP0 A;  5M9O A;  4E7I A;  1Q7Y U;  3M57 A;  4HNV A;  3WVD B;  2QQS A;  1LOJ A;  2E6N A;  3S3N A;  3C4S A;  3V8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...