1UNHD

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
147
structure length
147
Chain Sequence
STSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 147
sequence length 147
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF03261 CDK5_activator Cyclin-dependent kinase 5 activator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1unhD00
3BHUB 4EOQB 1VINA 3BHVB 5IDPB 3F5XB 2UUEB 4EOLB 4TTHA 1JSUB 2I53A 4EC9B 5L2WB 3LQ5B 1AD6A 2CJMB 2PK9B 2WXVB 4CFNB 3MY5B 2W9FA 1OIYB 2C5XB 3EOCB 5HBEB 1GUXB 1XO2A 4CFUB 1H24B 3DDPB 4BCGB 1H28B 4EOPB 1UNLD 3H4CA 2G9XB 3TNIB 4CFVB 1BU2A 5LMKB 2X1NB 5BNJB 1H1SB 1OL1B 4BCOB 2C4GB 3MI9B 1OL2B 4YOZA 4CFUD 1OIUB 2WHBB 1FVVB 1ZP2A 2WMAB 4ELLA 4BCKB 4F6SB 4BCQD 2W9ZA 2PK2A 3POMA 1E9HB 1UNGD 2WMBB 4KRCB 2C5VB 1OI9B 1H4LD 2EUFA 4II5B 4BCMB 5ACBA 3TNWB 1VOLA 2UZBB 4I3ZB 2WPAB 1H1PB 4BCND 4EOSB 4EOJB 4F7NB 4CRLB 4KRDB 4F6WB 4CXAB 1O9KA 4EC8B 3BLRB 1OGUB 3EJ1B 4BCMD 4BCQB 3O0GD 1OKVB 4EOIB 4RODA 3QHWB 3BLQB 1GH6B 5EFQB 1PKDB 2BPMB 5HQ0B 3DOGB 3BHTB 3MIAB 3G33B 1D3UB 4YOOA 2WIHB 1TFBA 1H27B 3EIDB 2IVXA 1G3NC 4NSTB 5HBHB 5IF1B 2C6TB 1AISB 2B9RA 3TN8B 4BCNB 1JOWA 2UZEB 2BKZB 2UZLB 4ROEA 5ICPB 4ELJA 4F7SB 1GUXA 4BCPB 2I40B 2W96A 2JGZB 1GY3B 4BCJB 4EORB 4IMYB 4F7JB 2C5OB 3TNHB 1N4MA 1FINB 4G6LB 4Y72B 4YC3B 1H25B 2CCHB 1H1QB 1UNHD 4ROCA 5HVYB 1VYWB 2WFYB 2R7GA 1OKWB 5IDNB 3QHRB 3K7AM 5I5ZB 4F7LB 2WEVB 2F2CA 4EOOB 4F6UB 2QDJA 2V22B 1JKWA 4CFWB 2C5NB 5FGKB 1P5EB 1JSTB 4F70B 2UZDB 4CFMB 4EOKB 2PHGA 2IW6B 3M03A 4CFXB 1W98B 2WIPB 4BCIB 2IW8B 4EONB 1QMZB 2PMIB 1H26B 4YOSA 1F5QB 4BCHB 4OR5B 2CCIB 1URCB 1H1RB 5CEIB 5CYIB 2W99A 3RGFB 1KXUA 4FX3B 5HNBB 5LQFB 2W2HA 4UN0A 3MY1B 4EOMB 1C9BA 4OGRB 1O9KB 3DDQB 2IW9B 4BCFB 3BLHB 5HBJB
chains in the Genus database with same CATH superfamily
4EOQB 3F5XB 3HHTB 4M6VA 3LQ5B 2PK9B 2D0QB 2C5XB 3EOCB 3QXEB 5HBEB 1GUXB 4CFUB 4BCGB 1H28B 3HBLA 2X1NB 1H1SB 2PJQA 4BCOB 4YOZA 2CZ7B 3PO3S 1E9HB 4HNVA 4HL4A 3X26B 4BCMB 4ZGEB 5ACBA 2UZBB 4BCND 5IF1B 4F6WB 4KRDB 2ZPHB 4LOCA 4HLQA 4EC8B 3NDQA 3QZ9B 2DXCB 5EJCA 3O0GD 1OKVB 3VKHA 3QHWB 5EFQB 1PKDB 3DOGB 1V29B 4YOOA 2WIHB 5HBHB 2C6TB 1AISB 1JOWA 3A8GB 2UZLB 1GUXA 4MFEA 2C5OB 4BBRM 4AKIA 1H25B 5HVYB 2R7GA 1OKWB 3K7AM 5I5ZB 5IHYA 2WEVB 2F2CA 3X28B 2QQ8A 1UGPB 2QDJA 2V22B 3DJBA 2UZDB 2DD4B 3WVDB 4OR5B 5CEIB 5CYIB 1KXUA 5LQFB 3HO8A 1C9BA 2IW9B 3BLHB 1VINA 5IDPB 4JX6A 4TTHA 2QFZA 4EC9B 5L2WB 2WXVB 4AKGA 4CFNB 4MFDA 3HZJA 4JX5A 3H4CA 3TNIB 3WVEB 1OIUB 2WHBB 1FVVB 3KHIA 4ELLA 4BCKB 2BS3A 2WMBB 3QZ5B 1OI9B 2KR6A 3TNWB 4Z6YA 4CXAB 4BBSM 1OGUB 3EJ1B 4QSHA 4EOIB 4RODA 1E7PA 2ZZDB 1TFBA 1H27B 4JX4A 3EIDB 2IVXA 1ENWA 2B9RA 2DPPB 1UGQB 4ROEA 3A8LB 5DQWA 4F7SB 4AKHA 4BCPB 2I40B 2JGZB 1GY3B 4BCJB 3TNHB 1N4MA 2ZPGB 4YC3B 1UNHD 1VYWB 2WFYB 3QHRB 3TW7A 4F7LB 4BXXX 3VKGA 3VYHB 1JSTB 4CFMB 3M03A 4CFXB 1W98B 2WIPB 3DTOA 3BG5A 4HNTA 3X25B 3RGFB 4FX3B 4UN0A 3MY1B 4OGRB 1O9KB 2ZPFB 4BCFB 4NC6A 3BHUB 4BY7X 2ZPIB 2I53A 2CJMB 3MY5B 3TW6A 1XO2A 4ZGDB 1H24B 1UNLD 2G9XB 1BU2A 5BNJB 2G77A 1OL1B 1IREB 2C4GB 3MI9B 4CFUD 1ZP2A 2WMAB 4OB0B 3A8MB 2W9ZA 2PK2A 4KRCB 4OB3B 4II5B 3QYBA 2WPAB 4EOSB 4F7NB 3QYHB 1O9KA 4BY1X 4BCMD 4BCQB 3BLQB 5HQ0B 1AHJB 3BHTB 3G33B 2CZ6B 1G3NC 3TN8B 2KMGA 2ZPEB 5ICPB 4ELJA 2W96A 4EORB 4F7JB 3BG9A 4IMYB 4MIMA 3VYGB 1FINB 1UGRB 4G6LB 1H1QB 4ROCA 5IDNB 2ZPBB 3X24B 3QYEA 4OB1B 2AHJB 2CZ1B 1JKWA 5FGKB 1P5EB 1UGSB 3HB9A 2IW6B 4BCIB 2IW8B 4EONB 1QMZB 5DQVA 2DMEA 1H26B 4YOSA 1F5QB 4BCHB 1TD6A 1H1RB 2W99A 5HNBB 2W2HA 4EOMB 2QGSA 3BHVB 2UUEB 4EOLB 1JSUB 2WJ9A 1AD6A 2W9FA 2IN3A 1OIYB 3DDPB 4EOPB 4CFVB 5LMKB 1OL2B 2DXBB 3A8HB 2BS4A 4F6SB 4BCQD 3DL1A 3GTMS 3B57A 3POMA 1UNGD 2C5VB 3BG3A 2QF7A 1H4LD 2ZCFB 2EUFA 1VOLA 4I3ZB 1H1PB 4EOJB 4CRLB 1QLBA 3BLRB 4AI6A 1GH6B 2BPMB 4HNUA 3A8OB 3MIAB 1D3UB 4NSTB 4OB2B 4BCNB 2DD5B 2UZEB 2BKZB 2CZ0B 4FM4B 4Y72B 2LW4A 2CCHB 3QWLA 2QDYB 2CYZB 4ZGJB 4EOOB 4F6UB 4CFWB 2C5NB 3QYGB 4F70B 4EOKB 2PHGA 1FKMA 2PMIB 2CCIB 1URCB 2BS2A 3X20B 3DDQB 5HBJB
chains in the Genus database with same CATH topology
3BHUB 4EOQB 1VINA 3BHVB 5IDPB 3F5XB 2UUEB 4EOLB 4TTHA 1JSUB 2I53A 4EC9B 5L2WB 3LQ5B 1AD6A 2CJMB 2PK9B 2WXVB 4CFNB 3MY5B 2W9FA 1OIYB 2C5XB 3EOCB 5HBEB 1GUXB 1XO2A 4CFUB 1H24B 3DDPB 4BCGB 1H28B 4EOPB 1UNLD 3H4CA 2G9XB 3TNIB 4CFVB 1BU2A 5LMKB 2X1NB 5BNJB 1H1SB 1OL1B 4BCOB 2C4GB 3MI9B 1OL2B 4YOZA 4CFUD 1OIUB 2WHBB 1FVVB 1ZP2A 2WMAB 4ELLA 4BCKB 4F6SB 4BCQD 2W9ZA 2PK2A 3POMA 1E9HB 1UNGD 2WMBB 4KRCB 2C5VB 1OI9B 1H4LD 2EUFA 4II5B 4BCMB 5ACBA 3TNWB 1VOLA 2UZBB 4I3ZB 2WPAB 1H1PB 4BCND 4EOSB 4EOJB 4F7NB 4CRLB 4KRDB 4F6WB 4CXAB 1O9KA 4EC8B 3BLRB 1OGUB 3EJ1B 4BCMD 4BCQB 3O0GD 1OKVB 4EOIB 4RODA 3QHWB 3BLQB 1GH6B 5EFQB 1PKDB 2BPMB 5HQ0B 3DOGB 3BHTB 3MIAB 3G33B 1D3UB 4YOOA 2WIHB 1TFBA 1H27B 3EIDB 2IVXA 1G3NC 4NSTB 5HBHB 5IF1B 2C6TB 1AISB 2B9RA 3TN8B 4BCNB 1JOWA 2UZEB 2BKZB 2UZLB 4ROEA 5ICPB 4ELJA 4F7SB 1GUXA 4BCPB 2I40B 2W96A 2JGZB 1GY3B 4BCJB 4EORB 4IMYB 4F7JB 2C5OB 3TNHB 1N4MA 1FINB 4G6LB 4Y72B 4YC3B 1H25B 2CCHB 1H1QB 1UNHD 4ROCA 5HVYB 1VYWB 2WFYB 2R7GA 1OKWB 5IDNB 3QHRB 3K7AM 5I5ZB 4F7LB 2WEVB 2F2CA 4EOOB 4F6UB 2QDJA 2V22B 1JKWA 4CFWB 2C5NB 5FGKB 1P5EB 1JSTB 4F70B 2UZDB 4CFMB 4EOKB 2PHGA 2IW6B 3M03A 4CFXB 1W98B 2WIPB 4BCIB 2IW8B 4EONB 1QMZB 2PMIB 1H26B 4YOSA 1F5QB 4BCHB 4OR5B 2CCIB 1URCB 1H1RB 5CEIB 5CYIB 2W99A 3RGFB 1KXUA 4FX3B 5HNBB 5LQFB 2W2HA 4UN0A 3MY1B 4EOMB 1C9BA 4OGRB 1O9KB 3DDQB 2IW9B 4BCFB 3BLHB 5HBJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHU B;  4EOQ B;  1VIN A;  3BHV B;  5IDP B;  3F5X B;  2UUE B;  4EOL B;  4TTH A;  1JSU B;  2I53 A;  4EC9 B;  5L2W B;  3LQ5 B;  1AD6 A;  2CJM B;  2PK9 B;  2WXV B;  4CFN B;  3MY5 B;  2W9F A;  1OIY B;  2C5X B;  3EOC B;  5HBE B;  1GUX B;  1XO2 A;  4CFU B;  1H24 B;  3DDP B;  4BCG B;  1H28 B;  4EOP B;  1UNL D;  3H4C A;  2G9X B;  3TNI B;  4CFV B;  1BU2 A;  5LMK B;  2X1N B;  5BNJ B;  1H1S B;  1OL1 B;  4BCO B;  2C4G B;  3MI9 B;  1OL2 B;  4YOZ A;  4CFU D;  1OIU B;  2WHB B;  1FVV B;  1ZP2 A;  2WMA B;  4ELL A;  4BCK B;  4F6S B;  4BCQ D;  2W9Z A;  2PK2 A;  3POM A;  1E9H B;  1UNG D;  2WMB B;  4KRC B;  2C5V B;  1OI9 B;  1H4L D;  2EUF A;  4II5 B;  4BCM B;  5ACB A;  3TNW B;  1VOL A;  2UZB B;  4I3Z B;  2WPA B;  1H1P B;  4BCN D;  4EOS B;  4EOJ B;  4F7N B;  4CRL B;  4KRD B;  4F6W B;  4CXA B;  1O9K A;  4EC8 B;  3BLR B;  1OGU B;  3EJ1 B;  4BCM D;  4BCQ B;  3O0G D;  1OKV B;  4EOI B;  4ROD A;  3QHW B;  3BLQ B;  1GH6 B;  5EFQ B;  1PKD B;  2BPM B;  5HQ0 B;  3DOG B;  3BHT B;  3MIA B;  3G33 B;  1D3U B;  4YOO A;  2WIH B;  1TFB A;  1H27 B;  3EID B;  2IVX A;  1G3N C;  4NST B;  5HBH B;  5IF1 B;  2C6T B;  1AIS B;  2B9R A;  3TN8 B;  4BCN B;  1JOW A;  2UZE B;  2BKZ B;  2UZL B;  4ROE A;  5ICP B;  4ELJ A;  4F7S B;  1GUX A;  4BCP B;  2I40 B;  2W96 A;  2JGZ B;  1GY3 B;  4BCJ B;  4EOR B;  4IMY B;  4F7J B;  2C5O B;  3TNH B;  1N4M A;  1FIN B;  4G6L B;  4Y72 B;  4YC3 B;  1H25 B;  2CCH B;  1H1Q B;  1UNH D;  4ROC A;  5HVY B;  1VYW B;  2WFY B;  2R7G A;  1OKW B;  5IDN B;  3QHR B;  3K7A M;  5I5Z B;  4F7L B;  2WEV B;  2F2C A;  4EOO B;  4F6U B;  2QDJ A;  2V22 B;  1JKW A;  4CFW B;  2C5N B;  5FGK B;  1P5E B;  1JST B;  4F70 B;  2UZD B;  4CFM B;  4EOK B;  2PHG A;  2IW6 B;  3M03 A;  4CFX B;  1W98 B;  2WIP B;  4BCI B;  2IW8 B;  4EON B;  1QMZ B;  2PMI B;  1H26 B;  4YOS A;  1F5Q B;  4BCH B;  4OR5 B;  2CCI B;  1URC B;  1H1R B;  5CEI B;  5CYI B;  2W99 A;  3RGF B;  1KXU A;  4FX3 B;  5HNB B;  5LQF B;  2W2H A;  4UN0 A;  3MY1 B;  4EOM B;  1C9B A;  4OGR B;  1O9K B;  3DDQ B;  2IW9 B;  4BCF B;  3BLH B;  5HBJ B; 
#chains in the Genus database with same CATH topology
 4EOQ B;  3F5X B;  3HHT B;  4M6V A;  3LQ5 B;  2PK9 B;  2D0Q B;  2C5X B;  3EOC B;  3QXE B;  5HBE B;  1GUX B;  4CFU B;  4BCG B;  1H28 B;  3HBL A;  2X1N B;  1H1S B;  2PJQ A;  4BCO B;  4YOZ A;  2CZ7 B;  3PO3 S;  1E9H B;  4HNV A;  4HL4 A;  3X26 B;  4BCM B;  4ZGE B;  5ACB A;  2UZB B;  4BCN D;  5IF1 B;  4F6W B;  4KRD B;  2ZPH B;  4LOC A;  4HLQ A;  4EC8 B;  3NDQ A;  3QZ9 B;  2DXC B;  5EJC A;  3O0G D;  1OKV B;  3VKH A;  3QHW B;  5EFQ B;  1PKD B;  3DOG B;  1V29 B;  4YOO A;  2WIH B;  5HBH B;  2C6T B;  1AIS B;  1JOW A;  3A8G B;  2UZL B;  1GUX A;  4MFE A;  2C5O B;  4BBR M;  4AKI A;  1H25 B;  5HVY B;  2R7G A;  1OKW B;  3K7A M;  5I5Z B;  5IHY A;  2WEV B;  2F2C A;  3X28 B;  2QQ8 A;  1UGP B;  2QDJ A;  2V22 B;  3DJB A;  2UZD B;  2DD4 B;  3WVD B;  4OR5 B;  5CEI B;  5CYI B;  1KXU A;  5LQF B;  3HO8 A;  1C9B A;  2IW9 B;  3BLH B;  1VIN A;  5IDP B;  4JX6 A;  4TTH A;  2QFZ A;  4EC9 B;  5L2W B;  2WXV B;  4AKG A;  4CFN B;  4MFD A;  3HZJ A;  4JX5 A;  3H4C A;  3TNI B;  3WVE B;  1OIU B;  2WHB B;  1FVV B;  3KHI A;  4ELL A;  4BCK B;  2BS3 A;  2WMB B;  3QZ5 B;  1OI9 B;  2KR6 A;  3TNW B;  4Z6Y A;  4CXA B;  4BBS M;  1OGU B;  3EJ1 B;  4QSH A;  4EOI B;  4ROD A;  1E7P A;  2ZZD B;  1TFB A;  1H27 B;  4JX4 A;  3EID B;  2IVX A;  1ENW A;  2B9R A;  2DPP B;  1UGQ B;  4ROE A;  3A8L B;  5DQW A;  4F7S B;  4AKH A;  4BCP B;  2I40 B;  2JGZ B;  1GY3 B;  4BCJ B;  3TNH B;  1N4M A;  2ZPG B;  4YC3 B;  1UNH D;  1VYW B;  2WFY B;  3QHR B;  3TW7 A;  4F7L B;  4BXX X;  3VKG A;  3VYH B;  1JST B;  4CFM B;  3M03 A;  4CFX B;  1W98 B;  2WIP B;  3DTO A;  3BG5 A;  4HNT A;  3X25 B;  3RGF B;  4FX3 B;  4UN0 A;  3MY1 B;  4OGR B;  1O9K B;  2ZPF B;  4BCF B;  4NC6 A;  3BHU B;  4BY7 X;  2ZPI B;  2I53 A;  2CJM B;  3MY5 B;  3TW6 A;  1XO2 A;  4ZGD B;  1H24 B;  1UNL D;  2G9X B;  1BU2 A;  5BNJ B;  2G77 A;  1OL1 B;  1IRE B;  2C4G B;  3MI9 B;  4CFU D;  1ZP2 A;  2WMA B;  4OB0 B;  3A8M B;  2W9Z A;  2PK2 A;  4KRC B;  4OB3 B;  4II5 B;  3QYB A;  2WPA B;  4EOS B;  4F7N B;  3QYH B;  1O9K A;  4BY1 X;  4BCM D;  4BCQ B;  3BLQ B;  5HQ0 B;  1AHJ B;  3BHT B;  3G33 B;  2CZ6 B;  1G3N C;  3TN8 B;  2KMG A;  2ZPE B;  5ICP B;  4ELJ A;  2W96 A;  4EOR B;  4F7J B;  3BG9 A;  4IMY B;  4MIM A;  3VYG B;  1FIN B;  1UGR B;  4G6L B;  1H1Q B;  4ROC A;  5IDN B;  2ZPB B;  3X24 B;  3QYE A;  4OB1 B;  2AHJ B;  2CZ1 B;  1JKW A;  5FGK B;  1P5E B;  1UGS B;  3HB9 A;  2IW6 B;  4BCI B;  2IW8 B;  4EON B;  1QMZ B;  5DQV A;  2DME A;  1H26 B;  4YOS A;  1F5Q B;  4BCH B;  1TD6 A;  1H1R B;  2W99 A;  5HNB B;  2W2H A;  4EOM B;  2QGS A;  3BHV B;  2UUE B;  4EOL B;  1JSU B;  2WJ9 A;  1AD6 A;  2W9F A;  2IN3 A;  1OIY B;  3DDP B;  4EOP B;  4CFV B;  5LMK B;  1OL2 B;  2DXB B;  3A8H B;  2BS4 A;  4F6S B;  4BCQ D;  3DL1 A;  3GTM S;  3B57 A;  3POM A;  1UNG D;  2C5V B;  3BG3 A;  2QF7 A;  1H4L D;  2ZCF B;  2EUF A;  1VOL A;  4I3Z B;  1H1P B;  4EOJ B;  4CRL B;  1QLB A;  3BLR B;  4AI6 A;  1GH6 B;  2BPM B;  4HNU A;  3A8O B;  3MIA B;  1D3U B;  4NST B;  4OB2 B;  4BCN B;  2DD5 B;  2UZE B;  2BKZ B;  2CZ0 B;  4FM4 B;  4Y72 B;  2LW4 A;  2CCH B;  3QWL A;  2QDY B;  2CYZ B;  4ZGJ B;  4EOO B;  4F6U B;  4CFW B;  2C5N B;  3QYG B;  4F70 B;  4EOK B;  2PHG A;  1FKM A;  2PMI B;  2CCI B;  1URC B;  2BS2 A;  3X20 B;  3DDQ B;  5HBJ B; 
#chains in the Genus database with same CATH homology
 3BHU B;  4EOQ B;  1VIN A;  3BHV B;  5IDP B;  3F5X B;  2UUE B;  4EOL B;  4TTH A;  1JSU B;  2I53 A;  4EC9 B;  5L2W B;  3LQ5 B;  1AD6 A;  2CJM B;  2PK9 B;  2WXV B;  4CFN B;  3MY5 B;  2W9F A;  1OIY B;  2C5X B;  3EOC B;  5HBE B;  1GUX B;  1XO2 A;  4CFU B;  1H24 B;  3DDP B;  4BCG B;  1H28 B;  4EOP B;  1UNL D;  3H4C A;  2G9X B;  3TNI B;  4CFV B;  1BU2 A;  5LMK B;  2X1N B;  5BNJ B;  1H1S B;  1OL1 B;  4BCO B;  2C4G B;  3MI9 B;  1OL2 B;  4YOZ A;  4CFU D;  1OIU B;  2WHB B;  1FVV B;  1ZP2 A;  2WMA B;  4ELL A;  4BCK B;  4F6S B;  4BCQ D;  2W9Z A;  2PK2 A;  3POM A;  1E9H B;  1UNG D;  2WMB B;  4KRC B;  2C5V B;  1OI9 B;  1H4L D;  2EUF A;  4II5 B;  4BCM B;  5ACB A;  3TNW B;  1VOL A;  2UZB B;  4I3Z B;  2WPA B;  1H1P B;  4BCN D;  4EOS B;  4EOJ B;  4F7N B;  4CRL B;  4KRD B;  4F6W B;  4CXA B;  1O9K A;  4EC8 B;  3BLR B;  1OGU B;  3EJ1 B;  4BCM D;  4BCQ B;  3O0G D;  1OKV B;  4EOI B;  4ROD A;  3QHW B;  3BLQ B;  1GH6 B;  5EFQ B;  1PKD B;  2BPM B;  5HQ0 B;  3DOG B;  3BHT B;  3MIA B;  3G33 B;  1D3U B;  4YOO A;  2WIH B;  1TFB A;  1H27 B;  3EID B;  2IVX A;  1G3N C;  4NST B;  5HBH B;  5IF1 B;  2C6T B;  1AIS B;  2B9R A;  3TN8 B;  4BCN B;  1JOW A;  2UZE B;  2BKZ B;  2UZL B;  4ROE A;  5ICP B;  4ELJ A;  4F7S B;  1GUX A;  4BCP B;  2I40 B;  2W96 A;  2JGZ B;  1GY3 B;  4BCJ B;  4EOR B;  4IMY B;  4F7J B;  2C5O B;  3TNH B;  1N4M A;  1FIN B;  4G6L B;  4Y72 B;  4YC3 B;  1H25 B;  2CCH B;  1H1Q B;  1UNH D;  4ROC A;  5HVY B;  1VYW B;  2WFY B;  2R7G A;  1OKW B;  5IDN B;  3QHR B;  3K7A M;  5I5Z B;  4F7L B;  2WEV B;  2F2C A;  4EOO B;  4F6U B;  2QDJ A;  2V22 B;  1JKW A;  4CFW B;  2C5N B;  5FGK B;  1P5E B;  1JST B;  4F70 B;  2UZD B;  4CFM B;  4EOK B;  2PHG A;  2IW6 B;  3M03 A;  4CFX B;  1W98 B;  2WIP B;  4BCI B;  2IW8 B;  4EON B;  1QMZ B;  2PMI B;  1H26 B;  4YOS A;  1F5Q B;  4BCH B;  4OR5 B;  2CCI B;  1URC B;  1H1R B;  5CEI B;  5CYI B;  2W99 A;  3RGF B;  1KXU A;  4FX3 B;  5HNB B;  5LQF B;  2W2H A;  4UN0 A;  3MY1 B;  4EOM B;  1C9B A;  4OGR B;  1O9K B;  3DDQ B;  2IW9 B;  4BCF B;  3BLH B;  5HBJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...