4ZGDB

Mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 57
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgdB02
1PSEA 2DXBB 1DJ7B 2CZ6B 2PUKB 2ZPFB 2WSEE 3X28B 2DXCA 2DPPB 2PUOB 2CZ1B 2ZPHB 2O01E 2DD5B 1UGQB 2ZPEB 2PVDB 1UGSB 2ZCFB 2DD4B 3QYHB 2ZZDA 2WSFE 3QZ5B 3A8MB 3X25B 4ZGEB 2ZZDB 3QZ9B 2DD5A 3LW5E 2PVGB 4XK8E 2DD4A 3X20B 4OB1B 4OB3B 3WVDB 2PU9B 1JB0E 2ZPGB 1QP3A 2ZPBB 3QYGB 2AHJB 1UGRB 3X26B 4FM4B 1IREB 2WSCE 1UGPB 4OB0B 3A8GB 3VYHB 5L8RE 3WVEB 3VYGB 2ZPIB 2CZ7B 3A8HB 4Y28E 2QDYB 2D0QB 3HHTB 3A8LB 2CZ0B 1V29B 1PSFA 4KT0E 4L6V5 1GXIE 4RKUE 2PVOB 1QP2A 3VYGA 4OB2B 3X24B 2DXBA 3QXEB 2DXCB 4ZGJB 2CYZB 1AHJB 4ZGDB 3A8OB
chains in the Genus database with same CATH superfamily
2E41A 2DXBB 1W4SA 2L8DA 3KHIA 1JBMA 2EJGA 1KC8U 1M8VA 1CKBA 1VQ9Q 4PFPA 4FSXA 1UB4A 2HKQB 4ESRA 5KYYB 4FYVB 1FINB 1Y7XA 3J81E 3M5AA 4II1A 3EFOA 4MMLA 1RAFB 2ZPEB 1ZUKA 2DIGA 4AG2C 2JZ2A 2K6DA 2KRMA 2NUPA 3JCMV 2M0YA 5LJ3h 4XU3A 3A98A 5EG2A 2LC4A 1WHGA 1Y96B 2LX9A 1M90R 2RPNA 3BW1A 3H0HA 2CT4A 4RODA 3X25B 4EMKB 3FJPA 1QMZB 2QEXA 4JUVA 3NTHA 2EJFA 1NE8A 4CFUD 2IN3A 1KQSP 3JB9D 4OMOA 5LJ5f 4Q5WA 2QI2A 3VS1A 2JNGA 1KSWA 1P5EB 3M0SA 2E3IA 2PU9B 5GANg 3SWNB 3RDVA 1PWTA 2HQEA 2RHZA 2YDLA 4C92C 1VOMA 1B7TA 4IUTA 4J7IA 3QYGB 2CKKA 2CP0A 4M75C 4ORZA 5IAYA 4J7FA 3CPWS 2LCLA 2XI9A 5D6WA 3ER0A 3RR6A 3I56A 4A4HA 2KAFA 4F7LB 2JVVA 2LQWA 2UZEB 5CK9A 4PJOA 5KYUB 4C0DC 2AIRB 4E47A 1I07A 4O5VA 2M1HA 4XQ3A 3G71T 1YI2Q 1FYNA 1OIUB 1PRLC 5I2SA 2FZCB 3QDFA 1RLPC 3EG3A 1RABB 4PFZA 2XDDA 3EGDA 4ZTJA 2HD0A 1Q86R 4RTUA 1TXQA 3NDQA 2OAUA 3EGXA 1UECA 2KEAA 2QGSA 4XTWA 2ROTA 2BE7D 2EQKA 3UPUA 1H1SB 2LZ6B 3CXCA 1QWFA 1YBYA 2KYBA 2RI5A 2DNUA 2PTKA 1M5Q1 2W0ZA 5CKFA 1JQQA 3HKSA 4NSTB 1KQSS 4M7DA 3GNGA 4ZTFA 1M2VA 4N0AC 1M90U 3L2UA 4RG2A 3BHTB 3NMZC 3PNWC 1UGQB 1YJNA 3GNFB 2RN8A 3JB9G 4RCBA 2IW9B 2JMAA 1JXMA 2RQVA 2KNBB 2L3SA 1WXTA 1D09B 3K7AM 3BHUB 2F1LA 2JM9A 1VQ4Q 2RQUA 3H6ZA 1S72A 1HK9A 2J7IA 5EC7A 1TOVA 2QQ9A 2V26A 1SHGA 4XTVA 3QHSA 1VQPQ 1B3QA 1BB9A 1WJRA 2B9RA 5CAIA 1MMDA 5I11A 3CCST 1VQLA 2E10A 1LJOA 2DIQA 5FROA 2HBWA 2MWPA 2Y4YA 1JRIA 4M78A 4AKIA 2CUDA 3C12A 4JJDA 4LDYA 2XK0A 1WX6A 4EORB 5DLOA 5GANj 5GAMh 3MY1B 3CC4A 1G3NC 1H28B 1T0JA 2OJ2A 4HT9A 4C92E 2CCIB 5CKHA 4M7AC 2QF7A 1NLPC 3GP8A 2ROLA 1QCOA 4CFWB 4M75E 1UNLD 3HHTB 5LJ3f 2RHYA 3VUZA 4KRCB 2CGHA 2IPOB 1IHVA 3MP8A 4HNUA 1QWEA 1Q86U 4KT0E 3OW2S 4L6V5 3CD6Q 4DBQA 2PVOB 2VGMA 2VXFA 4CRIA 1AWJA 3CBOA 3ZL7C 3PVLA 4C0FA 3VS3A 1U3OA 2ED0A 2OAWA 2FRYA 4E2FB 4J6XA 3QHWB 4EIKA 1AZGB 4OMMA 3MJXA 4BCOB 2EFIA 4JS4A 1X69A 5FRNA 4C92G 3NPFA 3PO3S 4M75G 2V22B 3M59A 1GBRA 2DERA 1PHTA 2ZAEA 3R6OA 4HL4A 2E4HA 4JDSA 2X9HA 2X4WA 1K4US 4OGCA 2EWNA 4UN0A 1Q7YC 2HSPA 5LMKB 2JM8A 2W96A 2RJDA 3QUIA 4JZ4A 4ELZC 3JB9I 1Q81C 2CH4A 3FRNA 4XTXA 4HCKA 3CCQT 3T9NA 1I4K1 2M51A 5LL6S 1OPKA 1GBQA 1UG1A 3GTMS 4C92B 3JCMh 4M7DD 1KD1R 4LUDA 3LW5E 4M75B 5IHNA 4LUEA 3OS0A 4D8DA 1KXUA 2X1NB 3UF4A 2R5MA 2WMBB 2VUBA 4BI3A 1AWWA 4PKCC 1ZHIA 1E6GA 2CS7A 3HP9A 2KMTA 2FB7A 3H4CA 1YJ9T 1AVZC 4C0DB 4BCMB 2D1XA 4BY6C 2KE9A 1WZOA 1IREB 4JJNK 1M27C 1OL2B 2EGEA 1Z9ZA 3CCMA 3LH5A 2QDLA 3OYCA 1NEBA 2O31A 4Y72B 1N9RA 1YJNQ 3TNWB 2EKHA 3MP6A 2RHIA 2RNAA 4XTUA 3R6NA 4M78D 5CVIA 4OMLA 2VYTA 3QYEA 1SRLA 3OS2A 2GQVA 2DXTA 2EUFA 1KJWA 1GXIE 1NBEB 2CREA 3M4GA 4M77C 2QA4T 1ZUUA 4BCPB 2PHGA 4X9DA 2DXBA 3PTAA 4M7AE 2PJQA 2YLBA 4QQGA 2DXCB 1YCSB 3MY5B 5FWCA 3BG5A 4ZGDB 1VQLQ 3PVQA 4IIOA 2AK5A 1QVFS 4IUQA 4RG8A 4HXJA 2EYWA 4R55A 1OKWB 1MMNA 3L2RA 4BCJB 2W9FA 2DL8A 2VB6A 2FPDA 5IN1A 2MK5A 3X28B 2BTTA 2WSEE 3G4SA 2A7YA 5GAMf 1PKTA 3CC4Q 4PL6A 1NJIC 1Y96A 3THKA 3CEYA 5GAN2 1PKSA 2LT4A 3FDRA 1KD1U 1UGSB 2MF2A 2HMAA 4M7AG 2RA2A 1W70A 3G71A 4OMNA 4DBFA 2E64A 1D3UB 2QQSA 1AD6A 1G3TA 5CEIB 5AYFA 4RCCA 4C8QD 1UFFA 3CPWA 1Y07A 5KH6A 3SWNA 1XOVA 5ECAA 1YITT 4PLIA 2O2OA 1ZSZC 4J9HA 3CCRT 3KFVA 4N4HA 1VQ6A 1IXDA 2YUOA 4M7AB 3WXMB 3TSWA 3UATA 1B07A 3RMSA 1QVGS 4GLMA 4NL3A 2HCKA 5CKBA 1ZBXA 2JMCA 1K0XA 2EJ9A 5KYUA 1VQOT 2J05A 3VU3C 5IXBA 1K8AR 5HK3A 2AZVA 2C4GB 1MNEA 2R7GA 2JS2A 3TNIB 1VQKT 3G6ET 2AZSA 4Y91A 3POMA 3H9NA 1EX4A 2DO3A 2K57A 1VQ9A 3HBLA 1V29B 2X4YA 1SRMA 3EH2A 1R0BG 2WIPB 3I55T 2H3EB 6AT1B 2OTLT 1U06A 4A53A 3QJYA 2XICA 1TH7A 3O5ZA 1XTDA 1G5VA 1AHJB 2MPXC 2VASA 1GFDA 1W2BP 3OBYA 4YOZA 1GCQC 3EG9B 1ENWA 3VKHA 2DBMA 3OY9A 3JCMW 4M77E 3QIIA 1PG5B 4M6VA 4CC3A 1N5ZA 4J9GA 2DPPB 1WHHA 3EAEA 2F2VA 4OF1A 3SHWA 3RKWA 3CC7T 1UEBA 2DD4B 1AD5A 1JKWA 2HDAA 3D7SB 3OYFA 4HNVA 1X6OA 2IVXA 2ZZDB 2A0FB 3GIBA 1ZX6A 3QZ9B 5L23A 4BCKB 1HYOA 1QW1A 1FMWA 4M77G 2J6OA 4EC8B 4BY6B 4PJLA 4DEYA 2W99A 3TVTA 4OB3B 1C0MA 2P0QA 4GBQA 4EOSB 4NL2A 4J9BA 4KUIA 1K8AU 4VUBA 5I21A 4ZN3A 4MZPA 1UTIA 5LJ5d 3TU4K 1YWPA 3L2QA 1W6XA 2DF6A 3OYHA 3GLXA 3EHQA 2X3XD 2DE0X 1OYXA 2YRCA 2QYZA 4M77B 3V8JA 5FW9A 1Y71A 3VYGB 1URCB 3OYJA 3JB9J 1W2BS 2D6FA 2M02A 2XHCA 2L2PA 3G71Q 1PCXA 3MO8A 1KHIA 5HCKA 5LJ5g 3M0RA 3QYBA 3SDZA 1Q82C 3RBBB 2RI2A 3CCET 4Z6YA 2PZ1A 1RI9A 1XJWB 1S1NA 4J6WA 2CP5A 1T0HA 3CPFA 2HKNA 2ATCB 4FYWB 2LJ1A 3META 3P8HA 3PE0A 2YT6A 1OU8A 2RJEA 4J8OA 1VQ4A 1IO6A 4CC4B 3E1SA 2ENMA 2CDTA 4JJCA 2LMJA 3TCJA 4EC9B 3OYNA 1G83A 3L42A 3BLRB 1VQPA 4DBHA 2OTJA 2MOXA 1VQ7T 3V7RA 5KYXA 4TTHA 5CCAA 3OS5A 5GAOn 5GMKj 3VV0A 2UZDB 1ZSZB 2COYA 1SSFA 1YCYA 1H26B 2K5IA 2LJ0A 2QA4A 1OI1A 2X4XA 4EPCA 1D3BA 1PKDB 4EOKB 2LRQA 5CKDA 4AKHA 5CYIB 4EOMB 4FT4A 1KC8C 2QASA 4D8KA 3S6WA 2FL7A 1M3AA 2DL7A 5CO7A 2HNIA 4CFXB 3OQ5A 5GANd 1JJ2P 2K3XA 2VGNA 3ME9A 1N9SA 1JSTB 1QLYA 2WHBB 4C5EA 4HT8A 4AKGA 3CD6A 5HBHB 4RTVA 2DLPA 4D6WA 1H1PB 3FB9A 1WJSA 2BE9B 1JU5C 1VQMT 2QXFA 2BZ8A 2EQIA 4QVZA 4OGRB 2ED1A 3PMTA 3QBYA 1K0SA 4MIMA 2LJ3A 3M0PA 2I0NA 4IKFA 2HL3A 3J7AF 2CZ0B 2M16A 4NC6A 4WCIA 2E65A 2ECZA 4AFSC 3N5BB 1C1AA 1YITA 3CCLA 4KH1B 1BBZA 2EBPA 4F7UA 1F5QB 1VQ5T 3QSUA 4BI8B 1LVKA 3CCRA 4CRLB 2YHTA 4B9XA 2J6KA 2DRKA 2V1RA 1JXOA 5LJ5j 4ANJA 1JSUB 4LNPA 2QQAA 2D9TA 2VVKA 3MKDA 2V8IA 2J06A 2KBTA 5DQWA 1PM3A 4NS5A 3DB3A 4LXCA 1K9MC 3DLMA 2RH2A 1WGSA 3S3OA 3UA7A 1NYGA 5I5ZB 3EFRA 3HFOA 2YXYA 2B86A 2DD5B 3G6EA 5LJ3g 1IHWA 2ZGWA 1TUDA 3I55A 2JGZB 5KCOA 4DA4A 4JLIA 2K3BA 4XU0A 2JT4A 5GAN7 4BE1A 1QVGA 1VYTA 3EH1A 2QQBA 1X6BA 3QWYA 1HD3A 4OMFB 5GAOr 4EDUA 5ICPB 1ZUYA 2NUTA 3X20B 3MIAB 2LCSA 2L3QA 4M7AA 3SD4A 1WFWA 1YJ9Q 4C92D 4AT1B 2DA9A 2LQ8A 4M75D 2DL4A 5LJ5e 3CCJT 1UDLA 3E19A 5KYWA 3Q1JA 1RUWA 2AHJB 3F5XB 4KH0B 1PNJA 1X6GA 1AWOA 4LD9K 3NFCA 4QT7A 3DLLA 4DBRA 1Q7YR 1G8XA 1WA7A 2C5VB 4F16A 2OTJQ 4J9IA 2FEIA 3JCMQ 2GNCA 2DMEA 4PJOC 3M03A 4BCMD 2RD1A 5J26A 1Q81R 1O9KB 4QQ6A 4LN2A 4J5YA 2Y90A 1HXDA 3DOGB 3RKYA 3P8BB 3OBWA 1GFCA 4P5NA 4AFQC 2KYMA 4JZ3A 1T3LA 2QA4Q 3RMQA 4RKUE 1N8RC 4E7IA 2PQWA 3QG1A 2V1QA 3L2WA 1VINA 2RK2A 4LDVA 1BI3A 1YHQT 1PC0A 2DEUA 4BXXX 1WHLA 3A8OB 1GUXB 1FMKA 5L2WB 2KGTA 2K79A 2I2LA 1DJ7B 3JCMb 3JB9F 4HNTA 1V76A 1H3HA 1ARKA 2WEVB 4RTXA 1C9BA 4JLGA 1OIYB 2R5AA 3LQ5B 1M4ZA 1BU2A 3KXTA 5HBEB 5I2MA 2XG8D 3GPLA 4K11A 1G3SA 2QTXA 2KRNA 2E70A 3RESA 2FO0A 3CMET 3LWIA 2KR6A 2ZZDA 2BZYA 4BCQB 2VKNA 3A8MB 4CI0C 1YJWT 4IUVA 4ZGEB 2XMFA 1GRIA 3CBMA 4O6JA 5LJ3j 3PMIA 2SEMA 2Y4XA 3CCLQ 1YITQ 2X4JA 1D1CA 1GH6B 4FSSA 2M0OA 3IQLA 4C8QA 2E5QA 3ULRB 4HVVA 4YTLA 3CCRQ 1IGUA 5GANe 2KDSA 3F70A 2LNHB 3M55A 1KG1A 1G3YA 1I0CA 2HZYA 2C5NB 3RNJA 2IIMA 1M3BA 5D7UA 3CCVT 2X51A 1Q7YU 1ZBJA 4BCIB 1NG2A 1UGRB 3OYLA 2ESWA 5D6XA 2LNVA 5GAMg 1VQOQ 4OMPA 2DM1A 2E12A 4R56A 3ASKA 4M77A 3VKGA 1UGPB 1VQ7A 1SG5A 1E7PA 3LLRA 4A4KA 1VQKQ 4F6WB 5IDPB 4M7AD 3G6EQ 1YWOA 1NJIR 1ZLMA 3HL8A 3JRZA 2YUNA 3G7ZA 4A63B 3I55Q 2E5KA 2OTLQ 1N6AA 2G9XB 7AT1B 2KY9A 1BI0A 2RB6A 4BE0A 1Y57A 4OP0A 1MNDA 4KGZB 1Y0MA 3CMAT 4PJOE 4E7LA 3HRTA 5GMKi 2O9VA 5FGKB 3I9QA 3REAB 3EFOB 2KSSA 2CP3A 5CKEA 2PMIB 3OYMA 4JX6A 1H3ZA 1XO2A 4AI6A 2NUPB 3OYIA 3HFNA 1Z9QA 2K4YA 3DB4A 2DKGA 1VQMA 1XQHA 3BY7A 2WIHB 2QFZA 4AMCA 1M2OA 2XIDA 3VS2A 4DOVA 5I22A 4ROCA 3CC7Q 3SFMA 4C5GA 4X9CA 3VUBA 1KFZA 1MUZA 2PVDB 5CIUA 4DEXA 2A36A 2JXBA 5DLQE 2RI3A 2DVJA 2WSFE 3L2VA 5KYYA 1PD0A 4BE2A 4QW2A 3BG9A 3GBQA 3LX7A 3CXCP 2LDMA 4LD6A 2R58A 2DAQA 3QHRB 4EOIB 3EG1A 3VS0A 2DZCA 2L3RA 5BNJB 1TWBA 1F1BB 5GJWB 2M9UA 3QKJA 4BCNB 2GFUA 2G77A 2L0AA 3QPHA 1EFNA 3WVDB 2D0NA 4CC2A 4AG1C 4EMKA 4E7SA 3TEEA 1OQKA 4F7UF 1QP3A 1OU9A 4PJOB 4C5HA 2FZKB 1NJIU 2PK2A 1I81A 3MCAB 3JV3A 2A3LA 4XU2A 2FG0A 4PJOF 1AEYA 4EMHA 3C94A 4KULA 2P0KA 3A8GB 2QEXT 2LW4A 3CC2T 2BKZB 4CC7A 2JTMA 2DFUA 1RAEB 5GAMj 5ACBA 1GCQA 1WXUA 4Y28E 2F69A 2KQWA 1D1BA 1N27A 3EGXB 1M8MA 2C0IA 4M77D 3CCEQ 3DDPB 3PFSA 2RQRA 4KGXB 4E7ZA 5A0LA 2C0OA 2LQNA 3H41A 1WYXA 4ME7A 2O9SA 4XU1A 5KE3A 3CCJA 3MI9B 2BS4A 3I56T 2NUZA 1BU1A 1QCNA 4M7DF 2P0PA 1PSEA 2CP2A 4IURA 2HL5C 3CXCS 3M54A 1H1QB 2E6NA 2CZ6B 3JB9H 2JW4A 5HNBB 2PNIA 2JUFA 2CP7A 3MEUA 3JCMf 1KQSA 4MDXA 2KRSA 1JOWA 1VQ7Q 3CCSA 1RAAB 2EPDA 2MI6A 3BDUA 3GF5A 2BKDN 4J9FA 4LDUA 5CQYA 5GAOl 1OGUB 2EQMA 1QLBA 3EOCB 4BY1X 4AFUC 3I35A 1TG0A 5CR2A 2NYSA 4BBSM 4I3ZB 1R77A 3HPWA 9ATCB 5GAOq 3REBB 4B6MA 2HBPA 5GJVB 1MMAA 2JTFA 1NEGA 2O4XB 4N4IA 1Q82R 2WJ9A 4M78F 4OB1B 3M0TA 2C6TB 2EAYA 1JB0E 3CQTA 4LE9A 2JTEA 1R8OB 4EOQB 3ZFJA 1W1FA 2KT1A 4Z02A 2ZPBB 1YIJT 4FM4B 3FLGA 1B34B 3EGUA 2WSCE 1VQMQ 2X3WD 3VS6A 1H25B 1SKUB 3CBPA 1H8KA 4BB7A 3CMEA 1O9KA 1S72T 2DYBA 2EYXA 1FMVA 2C5OB 1U1SA 1UHFA 4QKUA 1VA7A 2IW8B 2XU8A 1E9HB 1ABOA 2D8JA 4OR5B 2ZPIB 4MDWA 1YJWA 2EIFA 3E2UA 1O9SA 2BS2A 1WQWA 2CCHB 3TSZA 4J9CA 3VS5A 2EYQA 1VQ5Q 4NOYA 1D0ZA 1BCMA 4LOCA 5FU6C 3OW2A 3VRZA 1YNZA 5GAN6 4HVUA 1TUGB 4FCYA 2ABLA 5GAN4 1LOJA 4IMYB 1OL1B 4Z89A 3PT9A 3CCQA 5IHYA 2DEQA 2GTOA 5IHIA 2R57A 4F17A 1K73C 4PFOA 2L5QA 4XAXB 4C8QF 4HCCA 1Q95G 4Y92A 2WFYB 3V8LA 5A0DA 3MP1A 3UT1A 3SB2A 5IT9E 1OULA 2E3HA 2I53A 1VUBA 4GLKA 5A0GA 2RJCA 2GTJA 3JAME 2QG9B 5GAN5 4CFNB 2ZPHB 2DILA 3FJ5A 2RK1A 3VKIA 3FIFA 2ZCFB 1YJ9A 1NM7A 3QDRB 1M1KC 1OZ3A 4FL6A 2YUPA 1I5OB 1ZP2A 3P8DA 3VS4A 2IG0A 3CCUT 2XDBA 3CMAA 4QQDA 2K5LA 2RM4A 3NTKA 5GMKl 4XTYA 4QVCA 1U5SA 1X75C 1K76A 1BCOA 1MMGA 5GAN3 2LP5A 3CCJQ 1IB8A 3PGGA 2K9GA 3GOXA 1BIBA 4C92A 1OI9B 5GANh 4M75A 1PD1A 2GFAA 3MHXA 2DL3A 1TUCA 4A4EA 3FEOA 2L89A 3M58A 1OKVB 1K9MR 2LQKA 3CPWP 3M0UA 3OMGA 3CCSQ 2WACA 2BUDA 1RI0A 4FW1A 1MV0B 4ZNXA 5IDNB 2E6ZA 2PK9B 1ZA2B 1QKWA 2DTHA 2VXEA 3JCMJ 1FXXA 4BCFB 4QSHA 2FPFA 4HVWA 3A8LB 1YHQQ 3TN8B 4J83A 3SEMA 4OB2B 4II5B 4F70B 4RTZA 5IHKA 1H24B 2DRMA 3X24B 1RAHB 2LVMA 4C0ZA 2CYZB 3CCMT 1M3CA 4JRKA 1BYMA 2AKKA 2EQUA 2FPEA 4J9EA 4JRPA 2QDJA 3TW6A 3HRUA 3UA6A 5FRMA 1QVFA 4KBMB 5GMKe 2IW6B 1H4LD 2BPMB 2PUKB 4MFDA 3NTIA 3CC2A 1X43A 2ZPFB 4WTOB 1E6HA 4N0AA 2DXCA 4BUGA 1OEBA 2CZ1B 3TNHB 3BE3A 1H27B 4BI4A 5IXFA 3CMEQ 1W98B 5GAOp 2FVUA 1VQ8T 2FYKA 2COZA 3QJ6A 5LJ3d 4EMGA 2G3RA 2NWMA 1K1ZA 3H8ZA 1YJWQ 3PIPA 2LTOA 4L5GA 3HZJA 4RTWA 2GGRA 1QVPA 4HLQA 1VQOA 2B8AA 4ELYC 2UZBB 1TD6A 5D6YA 1BK2A 1N8RR 4MZTA 4A54A 2COWA 1SPKA 3EHRA 4BCQD 3G4ST 1GCPA 1VQKA 2W10A 3CCVQ 1J3TA 3CCQQ 1WPYA 1JJ2S 2CUBA 2ZPGB 2EW3A 1NPRA 1K9MU 1PRMC 2YSQA 2DXUA 5GAOm 4RTTA 1WNLA 4KGVB 2DTOA 1NLOC 3X26B 5HKCA 2OTLA 2D8HA 1VQNT 2V8JA 3OYEA 4EONB 1OOTA 2IVWA 4KRDB 4IUPA 3G1JA 2HQXA 5FU6B 3V7SA 2FHDA 1D0XA 3A5ZB 2DVEA 2KXDA 1RLQC 2KR3A 4CXAB 4Z8AA 3V8KA 3EJ1B 2QAZA 2GBQA 4MFEA 1M90C 1TSFA 5HBJB 2CH4W 4JS5A 1VQ6T 3OS1A 3OYKA 4CFVB 2X35A 3CMAQ 1AISB 4J9DA 1BKBA 3OW2P 1H1RB 5HQ0B 2H3JA 4RMOA 4JJBA 3RGFB 4F6SB 1VIEA 4M4ZA 4E7HA 3CC7A 3QXEB 4FYXB 1NZ9A 5A2QE 4E7KA 2K3YA 1RACB 1WXBA 1YIJA 1D0YA 5C6SA 2LX7A 5HY6A 5C0MA 5GANf 2AKLA 1BI2A 3AHUA 2XKOC 2MCNA 2CP6A 1G3WA 3O8VA 1VQ9T 2PUOB 2A37A 4RTYA 2O88A 2XD0A 1ZQ1A 4HA8A 4HKEA 2O01E 4EOLB 4RUGA 2QQ8A 3C4SA 3RKXA 3EG0A 3L2ZA 3EG9A 5DQVA 3H0IA 2DMOA 4CFUB 5AT1B 1RADB 1N8RU 1ACMB 1ZA1B 4BACA 1OX9A 3M57A 3MEAA 1LNXA 1GL5A 2RMOA 2WMAB 4AFZC 2MYSA 2O4XA 3OA6A 2DJQA 2CJMB 4M7DC 1VIFA 3ZBDA 3DTOA 1AT1B 3QWXX 2DD4A 2GQIA 3U23A 1Q86C 3O0GD 4N4GA 2H8HA 3JCMP 1B34A 3TREA 2KVQG 1X2KA 2DX1A 3BG3A 4C0GA 3EIDB 4BCGB 2QTVA 4F6UB 5FWBA 3BDLA 4BCND 1AWXA 1I1JA 5GAMd 2QEXQ 2WXVB 3BFMA 1M30A 3CC2Q 3CCEA 3FC3A 3INZA 3RERA 1SHFA 1V1CA 3M9QA 5GMKm 4C5IA 4WF2A 2A08A 4J6YA 4PJOD 5DM7R 4L59A 3C0CA 1M1FA 1UJYA 1RAGB 2CT3A 3CCUA 1W2BA 1FKMA 2QDYB 4CFMB 1GY3B 1UNHD 4ROEA 3PIOA 3HTRA 3LH0A 5LQFB 4M78C 2LCCA 4PNOA 1M9SA 1PSFA 1VOLA 1JEGA 4YOOA 1Q81U 3DL1A 1OPLA 3VYGA 2HAXA 2EGCA 3I56Q 1YI2T 3M0QA 2VC8A 1BIAA 3HSBA 4EOPB 2GCXA 3I5SA 3HB9A 3MEWA 3M56A 2EKOA 5KYXB 2RO0A 1QVFP 2MMPA 2F5KA 1O75A 2F2WA 3RUXA 4F7UE 3S3NA 4BD3A 1CKAA 4C92F 4BY7X 2LT1A 5LJ3e 4PJMA 4M75F 1VYUA 1D3BB 2YWWA 2KXCA 8AT1B 4R0KA 4Z88A 2EVRA 2SRCA 1YFNA 1AOJA 3ZEHA 1P92A 3JCMd 2EQJA 2K2VA 1FX7A 3VJPA 1WJQA 3URGA 4X34A 3A1PA 2NLUA 2QK0A 1VQ4T 2XDPA 1EZZB 1UE9A 2MWOA 4F7UG 4C8QC 2FZGB 4XK8E 4EOOB 1ZSZA 1TTHB 1HJDA 4HCBA 4XTZA 1VQPT 1YIJQ 2OTJT 4PJNA 4PJOG 4PK4A 2V8KA 1QCFA 3JCMg 1VQ5A 3JCMc 4M7DE 1SF9A 1S72Q 1QVGP 1VQ8A 2KMGA 3M53A 4OB0B 3LGFA 2RQTA 4F14A 3LYIA 4E7JA 1H641 5FU7C 4F7UB 2F2CA 5KCHA 3HO8A 1JO8A 4GY5A 3V7CA 1VYVA 2JS0A 2D0QB 1T3SA 1I5LA 3G33B 4FYYB 1KIKA 4BDYA 1KD1C 3EG2A 4LDWA 2CSIA 3L1AA 3OMCA 1QP2A 4M7DG 4EOJB 3CD6T 2YUQA 3BLHB 2YLCA 1FVVB 5IF1B 5J39A 1YP5A 2HEQA 5DY9A 2KROA 2DZ9A 2RQWA 1VYWB 3OYBA 1VQNA 2MAMA 4M78E 2KT8A 4B9WA 2BS3A 3EGDB 2EYZA 4PJJA 1H92A 5HK0A 3OYYA 4PLLA 1IZ6A 1KK7A 1CSKA 2RJFA 2VWFA 2YRDA 2F2XA 2P4TA 5GMKh 4YOSA 2A28A 3CCLT 3QO3A 4M7DB 2C06A 4FX3B 1NPPA 1M2VB 3HRSA 1MV3A 3EFSA 1WQ7A 2NUTB 2OI3A 5J3BA 1JJ2A 3CCUQ 1N4MA 3E9FA 3QYHB 4UC4A 3DJBA 1IRXA 3KUFA 2G6FX 2AT1B 3MPUB 2C5XB 1BI1A 4IIMA 4KRTA 4M78G 1MGQA 4M7AF 2FRWA 4ATOA 1R0CB 1WLPB 2DD5A 5KYWB 1X2QA 3I5RA 2EGAA 3DKMA 1WIEA 2JN0A 3MEVA 4A4GA 1U8RA 2C0TA 1YN8A 1QMCA 4EMKC 3AT1B 5GAMe 5HVYB 1K73R 2P4RA 2RHUA 1UGVA 2HQHA 4FW2A 4JRQA 3OYDA 3S3MA 1WDXA 4C8QE 1YHQA 3TW7A 4IUUA 4M78B 4TVRA 4F7SB 1E7OA 2K7AA 1MHNA 1XNIA 5L8RE 4DQ2A 4FU6A 3SWNC 5FLXE 2KK4A 2UUEB 1TFBA 2CZ7B 1IGQA 4MZMA 1YJNT 4JX4A 2W9ZA 1M1KR 8ATCB 3NHNA 2DTIA 2P84A 4BBRM 1RAIB 4BDZA 1A0NB 4E6RA 2F5TX 2BIVA 5LJ5h 1QKXA 3CCMQ 4C8QG 1LPLA 5KYNA 1TU0B 3OYGA 1RL2A 1KQ1A 2BZXA 1U1TA 2I40B 3J80E 1UJ0A 3OB9A 5IH2A 1VQLT 1UHCA 3LWHA 2E1HA 4F7NB 2DETA 2WPAB 1ABQA 4JPBW 1SEMA 2RHXA 1VQ8Q 2QQRA 1K8AC 4F04B 5KE2A 3LGLA 1GUXA 1KC8R 2GF7A 4ELLA 4ELJA 3QWLA 3CCVA 4C8QB 4QVDA 3JCMe 3CC4T 1TS9A 1I8FA 1UNGD 3QZ5B 1NYFA 5EFQB 4F7JB 1OZ2A 4KUDK 1YI2A 4YC3B 4FIBA 3H0FA 4JRIA 2DYIA 5M9OA 3G4SQ 3DDQB 3OYAA 4OVAA 3OSSC 1K73U 2W2HA 2PVGB 3NGPA 1ZSGA 2DJZA 4FT2A 4V2SA 1OV3A 3BHVB 2QGFB 4A4FA 2JOYA 2JJ9A 3OSVA 2UZLB 4JX5A 1G2BA 1KHCA 2YRVA 1FWZA 4M77F 5FU7B 3KBGA 1VQNQ 4BCHB 1AZEA 1Q82U 2KI7A 1WHMA 4X1VA 4DOWA 1SSHA 3UWNA 3B57A 3E9GA 4HCZA 2CSQA 2RF0A 2K5FA 1M1KU 1EIFA 3BLQB 3UDCA 2DK3A 1C6VX 3VRYA 3VS7A 4ZN1A 3VYHB 4G6LB 2VV5A 1HSQA 1WHJA 1QQJA 3WVEB 3JSCA 1K9AA 5GAN8 1OX8A 3A8HB 4LDXA 3TQ7P 1VQ6Q 2MIOA 2J6FA 2QGGA 1M1GA 1X01A 4OGEA 2DL5A 1WHKA 3RIRA 1WI7A 5EJCA 1X27A 2OX7A 2EYYA 2L3PA 3JCMX 4MMKA 2HSEB 3M4YA 4OMQA 1D1AA 2K2MA 2DBKA 1KQ2A 1LCKA 5CQXA 3C95A 2Z0WA 4ZGJB 1UUEA
chains in the Genus database with same CATH topology
1YIJA 2E41A 2KSSA 2DXBB 1W4SA 5CKEA 3OBYA 3OYMA 5C6SA 2L8DA 5HY6A 3VKHA 3KHIA 1JBMA 4JX6A 2EJGA 1KC8U 5C0MA 4AI6A 5GANf 1BI2A 3OY9A 3JCMW 1M8VA 1H3ZA 3OYIA 3AHUA 2XKOC 3HFNA 4M77E 4FSXA 1UB4A 3QIIA 2K4YA 3DB4A 2DKGA 1VQMA 1G3WA 4M6VA 1XQHA 3O8VA 1VQ9T 3BY7A 2DPPB 2PUOB 1Y7XA 2QFZA 2XD0A 1ZQ1A 2XIDA 3J81E 3M5AA 4DOVA 3EAEA 4HA8A 2O01E 4HKEA 4II1A 4MMLA 2QQ8A 3SFMA 4C5GA 5GAN2 3C4SA 2ZPEB 4X9CA 2DIGA 3VUBA 2PVDB 3RKXA 3L2ZA 2JZ2A 5CIUA 4OF1A 3RKWA 3JCMV 3CC7T 1N8RU 1UEBA 2DD4B 5DLQE 4BACA 5LJ3h 3M57A 2RI3A 4XU3A 2WSFE 5EG2A 2LC4A 3MEAA 1Y96B 2LX9A 3L2VA 4BE2A 1LNXA 3BW1A 4QW2A 3OYFA 3BG9A 3X25B 3LX7A 4HNVA 4EMKB 2LDMA 3FJPA 1X6OA 2DAQA 2O4XA 2R58A 4LD6A 2QEXA 2ZZDB 4JUVA 3GIBA 3NTHA 3QZ9B 2EJFA 3OA6A 4M7DC 1NE8A 1QW1A 1VIFA 2DZCA 2L3RA 3ZBDA 4M77G 3JB9D 5LJ5f 4BY6B 4Q5WA 2QI2A 2DD4A 2M9UA 3QKJA 2GFUA 2G77A 2JNGA 3QPHA 1Q86C 4OB3B 3WVDB 4N4GA 2P0QA 2PU9B 5GANg 3JCMP 4EMKA 1B34A 3SWNB 3TREA 2HQEA 2KVQG 2RHZA 3TEEA 4NL2A 4F7UF 4C92C 1QP3A 3BG3A 4C0GA 4KUIA 1K8AU 4PJOB 4C5HA 4IUTA 4J7IA 3QYGB 2CKKA 4M75C 4VUBA 4MZPA 4ZN3A 5I21A 1NJIU 3BDLA 3MCAB 1I81A 5LJ5d 3TU4K 5GAMd 3L2QA 3BFMA 5IAYA 2A3LA 4XU2A 4J7FA 3CCEA 3CPWS 4PJOF 3OYHA 3GLXA 4EMHA 2LCLA 3FC3A 3C94A 3INZA 4KULA 3RERA 2P0KA 3A8GB 2XI9A 3M9QA 5D6WA 5GMKm 2QEXT 4C5IA 3ER0A 4WF2A 3I56A 1OYXA 3CC2T 4J6YA 4PJOD 2JTMA 4M77B 3V8JA 4A4HA 2KAFA 5DM7R 1Y71A 3VYGB 4L59A 3OYJA 2JVVA 3JB9J 5CK9A 5GAMj 1W2BS 1M1FA 2D6FA 4PJOA 3CCUA 2XHCA 4C0DC 1W2BA 4Y28E 4E47A 1FKMA 2QDYB 2F69A 2KQWA 4O5VA 3MO8A 3PIOA 2M1HA 1N27A 3LH0A 4M78C 2LCCA 1KHIA 4PNOA 4XQ3A 1M9SA 1PSFA 4M77D 5LJ5g 3G71T 5I2SA 1Q81U 3PFSA 3DL1A 3QYBA 3VYGA 3SDZA 2HAXA 1Q82C 2RI2A 5A0LA 1YI2T 3CCET 2VC8A 4ME7A 4Z6YA 1BIAA 4XU1A 3HSBA 5KE3A 2XDDA 3CCJA 4ZTJA 2HD0A 2GCXA 1VQLA 3HB9A 3MEWA 2BS4A 4J6WA 3M56A 3I56T 2OAUA 3CPFA 4M7DF 2P0PA 1PSEA 2EKOA 4IURA 4XTWA 3CXCS 2EQKA 3UPUA 3M54A 3CXCA 3META 3P8HA 2RO0A 2MMPA 2F5KA 2E6NA 2CZ6B 1YBYA 3JB9H 1O75A 2RI5A 2RJEA 4J8OA 1VQ4A 1M5Q1 5CKFA 3HKSA 3E1SA 3RUXA 3CCVA 2JUFA 3MEUA 4F7UE 4BD3A 3GNGA 3S3NA 1KQSS 4ZTFA 3JCMf 4M7DA 1KQSA 4MDXA 3TCJA 4N0AC 1M90U 4C92F 3OYNA 3L2UA 2LT1A 4RG2A 3L42A 5LJ3e 3CCSA 2MI6A 3BDUA 3GF5A 3PNWC 4M75F 2BKDN 1VQPA 1D3BB 1UGQB 1YJNA 3GNFB 4LDUA 2OTJA 1VQ7T 5CQYA 3JB9G 3V7RA 4RCBA 5CCAA 3OS5A 5GAOl 5GAOn 5GMKj 3VV0A 2EQMA 1QLBA 3ZEHA 1P92A 3JCMd 2EQJA 1SSFA 1YCYA 2K2VA 1FX7A 5CR2A 3VJPA 2K5IA 1WJQA 4BBSM 3URGA 2QA4A 3H6ZA 1OI1A 2X4XA 4EPCA 4X34A 1S72A 1D3BA 3HPWA 1HK9A 2LRQA 2NLUA 5GAOq 5CKDA 1VQ4T 4AKHA 2XDPA 2HBPA 4FT4A 2MWOA 2QQ9A 1KC8C 4F7UG 4XTVA 3QHSA 4C8QC 2JTFA 4N4IA 2O4XB 4XK8E 3S6WA 2WJ9A 4M78F 1WJRA 2FL7A 4OB1B 5CAIA 5CO7A 2HNIA 3CCST 4HCBA 2EAYA 2E10A 1JB0E 1LJOA 3OQ5A 4XTZA 5GANd 2DIQA 5FROA 1VQPT 2OTJT 4PJOG 2K3XA 1R8OB 2MWPA 2V8KA 2VGNA 2Y4YA 1N9SA 3ME9A 3ZFJA 1JRIA 4M78A 3JCMg 4Z02A 5FRMA 2ZPBB 4C5EA 4AKIA 3C12A 1YIJT 4FM4B 4LDYA 2XK0A 1B34B 3FLGA 3JCMc 1VQ5A 4M7DE 4HT8A 4AKGA 2WSCE 3CD6A 5DLOA 5GANj 1VQ8A 2KMGA 3M53A 5GAMh 4D6WA 4OB0B 3FB9A 3CBPA 1WJSA 4BB7A 3CC4A 3LGFA 3CMEA 1S72T 1VQMT 3LYIA 4E7JA 2QXFA 1U1SA 1H641 5FU7C 4F7UB 4QVZA 4HT9A 2XU8A 4MDWA 4C92E 5KCHA 2ZPIB 3PMTA 3HO8A 3QBYA 5CKHA 2QF7A 4MIMA 3GP8A 1YJWA 4M7AC 4GY5A 2EIFA 3V7CA 1O9SA 4M75E 2BS2A 2D0QB 3HHTB 5LJ3f 1I5LA 1WQWA 2RHYA 3VUZA 2CGHA 4IKFA 3MP8A 3J7AF 4HNUA 2EYQA 2CZ0B 2M16A 1Q86U 4NC6A 4BDYA 4NOYA 4KT0E 2E65A 5FU6C 4LOCA 3OW2S 4L6V5 1KD1C 3N5BB 1YITA 4LDWA 3OW2A 2PVOB 2VGMA 3CCLA 2VXFA 4CRIA 3CBOA 3L1AA 1QP2A 3OMCA 4F7UA 1VQ5T 1VQ8T 3QSUA 4BI8B 4M7DG 5GAN6 3CCRA 2YHTA 4C0FA 5GAN4 3CD6T 1LOJA 4B9XA 2YLCA 5J39A 5DY9A 3PT9A 3CCQA 4J6XA 5LJ5j 2DEQA 2DZ9A 2QQAA 2D9TA 2R57A 3OYBA 2EFIA 1K73C 1VQNA 2MAMA 4M78E 2L5QA 2V8IA 4XAXB 4JS4A 4B9WA 2BS3A 4C92G 4C8QF 5FRNA 4HCCA 4M75G 3V8LA 5A0DA 3MP1A 5HK0A 3UT1A 3M59A 4NS5A 3DB3A 3OYYA 3SB2A 5IT9E 4PLLA 1IZ6A 1VUBA 4GLKA 3R6OA 5A0GA 1K9MC 2RJCA 4HL4A 2RJFA 3DLMA 4JDSA 2RH2A 1WGSA 3JAME 3S3OA 2X4WA 3EFRA 5GAN5 4OGCA 2EWNA 2P4TA 5GMKh 3HFOA 1Q7YC 3CCLT 2ZPHB 2RJDA 3QO3A 2DD5B 3QUIA 3G6EA 4M7DB 2C06A 5LJ3g 4ELZC 1NPPA 2RK1A 3VKIA 3JB9I 3FIFA 3HRSA 1Q81C 2ZCFB 1YJ9A 3EFSA 1WQ7A 5J3BA 1JJ2A 3FRNA 3QDRB 3E9FA 2ZGWA 3QYHB 1M1KC 4XTXA 1OZ3A 4UC4A 3CCQT 4FL6A 3T9NA 3I55A 3KUFA 5KCOA 1I4K1 4DA4A 4JLIA 5LL6S 3P8DA 2IG0A 1BI1A 4XU0A 3CCUT 2XDBA 5GAN7 4C92B 4M78G 4QQDA 3JCMh 1MGQA 3CMAA 4BE1A 1QVGA 4M7DD 4M7AF 2K5LA 2QQBA 2DD5A 2RM4A 3LW5E 3NTKA 4M75B 5GMKl 4ATOA 4XTYA 4OMFB 5GAOr 4EDUA 3OS0A 4QVCA 1X75C 2R5MA 2VUBA 4BI3A 3DKMA 3X20B 4PKCC 2JN0A 5GAN3 3MEVA 1ZHIA 4A4GA 4M7AA 1U8RA 3SD4A 2CS7A 3PGGA 4C92D 3GOXA 1BIBA 2LQ8A 3HP9A 4C92A 4EMKC 4M75D 2KMTA 2FB7A 5LJ5e 3CCJT 5GAMe 3H4CA 3E19A 5GANh 4M75A 1YJ9T 4C0DB 2GFAA 3MHXA 3Q1JA 2RHUA 2AHJB 4A4EA 3FEOA 4JRQA 3OYDA 3S3MA 4BY6C 2L89A 1IREB 4C8QE 4JJNK 3M58A 1YHQA 3TW7A 4IUUA 4M78B 4LD9K 4TVRA 2LQKA 3NFCA 3OMGA 3CCMA 2WACA 2BUDA 3DLLA 1MHNA 1XNIA 5L8RE 4DQ2A 3OYCA 4FU6A 3SWNC 5FLXE 1N9RA 1RI0A 2KK4A 3JCMQ 2CZ7B 3MP6A 4PJOC 2E6ZA 2RD1A 4MZMA 2RHIA 5J26A 4QQ6A 2DTHA 2VXEA 1YJNT 4JX4A 4XTUA 3JCMJ 4J5YA 2Y90A 1FXXA 1HXDA 4M78D 5CVIA 4QSHA 3RKYA 2VYTA 3QYEA 3P8BB 3OBWA 2DTIA 4P5NA 3A8LB 4BBRM 4BDZA 3OS2A 2GQVA 2DXTA 2F5TX 1GXIE 3RMQA 2BIVA 4RKUE 1N8RC 4J83A 4E7IA 2PQWA 3M4GA 4M77C 4OB2B 5LJ5h 3QG1A 2QA4T 3L2WA 2RK2A 3X24B 4LDVA 1BI3A 2DXBA 4X9DA 4C8QG 3PTAA 2YLBA 4QQGA 1YHQT 2LVMA 4C0ZA 4M7AE 2DXCB 2CYZB 3CCMT 3BG5A 4ZGDB 3OYGA 1RL2A 3A8OB 4JRKA 1BYMA 1KQ1A 1U1TA 2EQUA 1QVFS 3J80E 4IUQA 4RG8A 2QDJA 3TW6A 2I2LA 3HRUA 3OB9A 4R55A 4KBMB 5GMKe 1DJ7B 4JRPA 1VQLT 1QVFA 3JCMb 3JB9F 3LWHA 3L2RA 2E1HA 2PUKB 4HNTA 4MFDA 3NTIA 3CC2A 2ZPFB 4JLGA 2RHXA 4N0AA 2WSEE 3X28B 2DXCA 2R5AA 5IN1A 3G4SA 2A7YA 4BUGA 2QQRA 1K8AC 5GAMf 1M4ZA 2CZ1B 5KE2A 3KXTA 3LGLA 4BI4A 4PL6A 1NJIC 5I2MA 1Y96A 2GF7A 2FVUA 2XG8D 5GAOp 3CEYA 4ELJA 1G3SA 2FYKA 3QJ6A 2LT4A 2QTXA 3QWLA 3FDRA 5LJ3d 2G3RA 1UGSB 2MF2A 4C8QB 2E70A 4EMGA 4QVDA 3H8ZA 3RESA 3JCMe 3CMET 3GPLA 3CC4T 4M7AG 3PIPA 2RA2A 2LTOA 3LWIA 2KR6A 2ZZDA 4L5GA 3G71A 1I8FA 3QZ5B 2E64A 3A8MB 3HZJA 2QQSA 4CI0C 1YJWT 1QVPA 4ZGEB 4IUVA 3CBMA 4O6JA 4HLQA 1G3TA 1OZ2A 1VQOA 5AYFA 4FIBA 5LJ3j 3PMIA 2B8AA 1YI2A 4KUDK 4ELYC 2Y4XA 4JRIA 4RCCA 5M9OA 3OYAA 4C8QD 3CPWA 4OVAA 2X4JA 3OSSC 5D6YA 1Y07A 4MZTA 2M0OA 4A54A 1K73U 4C8QA 2PVGB 2E5QA 5KH6A 4FT2A 4YTLA 2DJZA 1XOVA 3SWNA 5GANe 3G4ST 1YITT 4V2SA 4PLIA 1VQKA 2KDSA 3F70A 4A4FA 2JOYA 3M55A 1KG1A 1G3YA 3OSVA 3CCRT 4JX5A 1WPYA 1JJ2S 2ZPGB 1KHCA 2YRVA 1FWZA 1NPRA 4M77F 1K9MU 4N4HA 3KBGA 5FU7B 1VQ6A 3CCVT 2DXUA 5GAOm 1Q7YU 1WNLA 4M7AB 3WXMB 1Q82U 2DTOA 3X26B 1UGRB 4DOWA 5HKCA 3OYLA 5D6XA 3RMSA 2LNVA 5GAMg 1QVGS 2OTLA 3UWNA 1VQNT 2V8JA 2E12A 3E9GA 3ASKA 4HCZA 4M77A 4R56A 4NL3A 3OYEA 2IVWA 5CKBA 3VKGA 1UGPB 1VQ7A 1ZBXA 3LLRA 1E7PA 2EJ9A 2K5FA 4IUPA 1EIFA 2HQXA 5FU6B 3UDCA 2DK3A 1VQOT 1M1KU 3VU3C 3V7SA 2FHDA 4ZN1A 4A4KA 5HK3A 3VYHB 3A5ZB 2DVEA 4M7AD 2VV5A 3JSCA 3WVEB 5GAN8 3V8KA 3HL8A 3JRZA 3A8HB 1KD1U 4MFEA 1VQKT 1M90C 4LDXA 3G6ET 3G7ZA 4Y91A 1M1GA 1X01A 2K57A 2DO3A 4OGEA 3RIRA 1VQ9A 4JS5A 1VQ6T 3HBLA 1N6AA 3OS1A 5EJCA 1V29B 3OYKA 2X4YA 2X35A 3JCMX 3I55T 1BKBA 3M4YA 4MMKA 2KY9A 1BI0A 2H3JA 2RB6A 4RMOA 4BE0A 2OTLT 4OP0A 1KQ2A 3CMAT 5CQXA 3C95A 1VIEA 4E7HA 4A53A 3CC7A 3QJYA 4PJOE 3QXEB 1TH7A 2XICA 4E7LA 1XTDA 4ZGJB 1NZ9A 3HRTA 5GMKi 1G5VA 5A2QE 4E7KA 1AHJB 2K3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSE A;  2DXB B;  1DJ7 B;  2CZ6 B;  2PUK B;  2ZPF B;  2WSE E;  3X28 B;  2DXC A;  2DPP B;  2PUO B;  2CZ1 B;  2ZPH B;  2O01 E;  2DD5 B;  1UGQ B;  2ZPE B;  2PVD B;  1UGS B;  2ZCF B;  2DD4 B;  3QYH B;  2ZZD A;  2WSF E;  3QZ5 B;  3A8M B;  3X25 B;  4ZGE B;  2ZZD B;  3QZ9 B;  2DD5 A;  3LW5 E;  2PVG B;  4XK8 E;  2DD4 A;  3X20 B;  4OB1 B;  4OB3 B;  3WVD B;  2PU9 B;  1JB0 E;  2ZPG B;  1QP3 A;  2ZPB B;  3QYG B;  2AHJ B;  1UGR B;  3X26 B;  4FM4 B;  1IRE B;  2WSC E;  1UGP B;  4OB0 B;  3A8G B;  3VYH B;  5L8R E;  3WVE B;  3VYG B;  2ZPI B;  2CZ7 B;  3A8H B;  4Y28 E;  2QDY B;  2D0Q B;  3HHT B;  3A8L B;  2CZ0 B;  1V29 B;  1PSF A;  4KT0 E;  4L6V 5;  1GXI E;  4RKU E;  2PVO B;  1QP2 A;  3VYG A;  4OB2 B;  3X24 B;  2DXB A;  3QXE B;  2DXC B;  4ZGJ B;  2CYZ B;  1AHJ B;  4ZGD B;  3A8O B; 
#chains in the Genus database with same CATH topology
 2E41 A;  2DXB B;  1W4S A;  2L8D A;  3KHI A;  1JBM A;  2EJG A;  1KC8 U;  1M8V A;  1CKB A;  1VQ9 Q;  4PFP A;  4FSX A;  1UB4 A;  2HKQ B;  4ESR A;  5KYY B;  4FYV B;  1FIN B;  1Y7X A;  3J81 E;  3M5A A;  4II1 A;  3EFO A;  4MML A;  1RAF B;  2ZPE B;  1ZUK A;  2DIG A;  4AG2 C;  2JZ2 A;  2K6D A;  2KRM A;  2NUP A;  3JCM V;  2M0Y A;  5LJ3 h;  4XU3 A;  3A98 A;  5EG2 A;  2LC4 A;  1WHG A;  1Y96 B;  2LX9 A;  1M90 R;  2RPN A;  3BW1 A;  3H0H A;  2CT4 A;  4ROD A;  3X25 B;  4EMK B;  3FJP A;  1QMZ B;  2QEX A;  4JUV A;  3NTH A;  2EJF A;  1NE8 A;  4CFU D;  2IN3 A;  1KQS P;  3JB9 D;  4OMO A;  5LJ5 f;  4Q5W A;  2QI2 A;  3VS1 A;  2JNG A;  1KSW A;  1P5E B;  3M0S A;  2E3I A;  2PU9 B;  5GAN g;  3SWN B;  3RDV A;  1PWT A;  2HQE A;  2RHZ A;  2YDL A;  4C92 C;  1VOM A;  1B7T A;  4IUT A;  4J7I A;  3QYG B;  2CKK A;  2CP0 A;  4M75 C;  4ORZ A;  5IAY A;  4J7F A;  3CPW S;  2LCL A;  2XI9 A;  5D6W A;  3ER0 A;  3RR6 A;  3I56 A;  4A4H A;  2KAF A;  4F7L B;  2JVV A;  2LQW A;  2UZE B;  5CK9 A;  4PJO A;  5KYU B;  4C0D C;  2AIR B;  4E47 A;  1I07 A;  4O5V A;  2M1H A;  4XQ3 A;  3G71 T;  1YI2 Q;  1FYN A;  1OIU B;  1PRL C;  5I2S A;  2FZC B;  3QDF A;  1RLP C;  3EG3 A;  1RAB B;  4PFZ A;  2XDD A;  3EGD A;  4ZTJ A;  2HD0 A;  1Q86 R;  4RTU A;  1TXQ A;  3NDQ A;  2OAU A;  3EGX A;  1UEC A;  2KEA A;  2QGS A;  4XTW A;  2ROT A;  2BE7 D;  2EQK A;  3UPU A;  1H1S B;  2LZ6 B;  3CXC A;  1QWF A;  1YBY A;  2KYB A;  2RI5 A;  2DNU A;  2PTK A;  1M5Q 1;  2W0Z A;  5CKF A;  1JQQ A;  3HKS A;  4NST B;  1KQS S;  4M7D A;  3GNG A;  4ZTF A;  1M2V A;  4N0A C;  1M90 U;  3L2U A;  4RG2 A;  3BHT B;  3NMZ C;  3PNW C;  1UGQ B;  1YJN A;  3GNF B;  2RN8 A;  3JB9 G;  4RCB A;  2IW9 B;  2JMA A;  1JXM A;  2RQV A;  2KNB B;  2L3S A;  1WXT A;  1D09 B;  3K7A M;  3BHU B;  2F1L A;  2JM9 A;  1VQ4 Q;  2RQU A;  3H6Z A;  1S72 A;  1HK9 A;  2J7I A;  5EC7 A;  1TOV A;  2QQ9 A;  2V26 A;  1SHG A;  4XTV A;  3QHS A;  1VQP Q;  1B3Q A;  1BB9 A;  1WJR A;  2B9R A;  5CAI A;  1MMD A;  5I11 A;  3CCS T;  1VQL A;  2E10 A;  1LJO A;  2DIQ A;  5FRO A;  2HBW A;  2MWP A;  2Y4Y A;  1JRI A;  4M78 A;  4AKI A;  2CUD A;  3C12 A;  4JJD A;  4LDY A;  2XK0 A;  1WX6 A;  4EOR B;  5DLO A;  5GAN j;  5GAM h;  3MY1 B;  3CC4 A;  1G3N C;  1H28 B;  1T0J A;  2OJ2 A;  4HT9 A;  4C92 E;  2CCI B;  5CKH A;  4M7A C;  2QF7 A;  1NLP C;  3GP8 A;  2ROL A;  1QCO A;  4CFW B;  4M75 E;  1UNL D;  3HHT B;  5LJ3 f;  2RHY A;  3VUZ A;  4KRC B;  2CGH A;  2IPO B;  1IHV A;  3MP8 A;  4HNU A;  1QWE A;  1Q86 U;  4KT0 E;  3OW2 S;  4L6V 5;  3CD6 Q;  4DBQ A;  2PVO B;  2VGM A;  2VXF A;  4CRI A;  1AWJ A;  3CBO A;  3ZL7 C;  3PVL A;  4C0F A;  3VS3 A;  1U3O A;  2ED0 A;  2OAW A;  2FRY A;  4E2F B;  4J6X A;  3QHW B;  4EIK A;  1AZG B;  4OMM A;  3MJX A;  4BCO B;  2EFI A;  4JS4 A;  1X69 A;  5FRN A;  4C92 G;  3NPF A;  3PO3 S;  4M75 G;  2V22 B;  3M59 A;  1GBR A;  2DER A;  1PHT A;  2ZAE A;  3R6O A;  4HL4 A;  2E4H A;  4JDS A;  2X9H A;  2X4W A;  1K4U S;  4OGC A;  2EWN A;  4UN0 A;  1Q7Y C;  2HSP A;  5LMK B;  2JM8 A;  2W96 A;  2RJD A;  3QUI A;  4JZ4 A;  4ELZ C;  3JB9 I;  1Q81 C;  2CH4 A;  3FRN A;  4XTX A;  4HCK A;  3CCQ T;  3T9N A;  1I4K 1;  2M51 A;  5LL6 S;  1OPK A;  1GBQ A;  1UG1 A;  3GTM S;  4C92 B;  3JCM h;  4M7D D;  1KD1 R;  4LUD A;  3LW5 E;  4M75 B;  5IHN A;  4LUE A;  3OS0 A;  4D8D A;  1KXU A;  2X1N B;  3UF4 A;  2R5M A;  2WMB B;  2VUB A;  4BI3 A;  1AWW A;  4PKC C;  1ZHI A;  1E6G A;  2CS7 A;  3HP9 A;  2KMT A;  2FB7 A;  3H4C A;  1YJ9 T;  1AVZ C;  4C0D B;  4BCM B;  2D1X A;  4BY6 C;  2KE9 A;  1WZO A;  1IRE B;  4JJN K;  1M27 C;  1OL2 B;  2EGE A;  1Z9Z A;  3CCM A;  3LH5 A;  2QDL A;  3OYC A;  1NEB A;  2O31 A;  4Y72 B;  1N9R A;  1YJN Q;  3TNW B;  2EKH A;  3MP6 A;  2RHI A;  2RNA A;  4XTU A;  3R6N A;  4M78 D;  5CVI A;  4OML A;  2VYT A;  3QYE A;  1SRL A;  3OS2 A;  2GQV A;  2DXT A;  2EUF A;  1KJW A;  1GXI E;  1NBE B;  2CRE A;  3M4G A;  4M77 C;  2QA4 T;  1ZUU A;  4BCP B;  2PHG A;  4X9D A;  2DXB A;  3PTA A;  4M7A E;  2PJQ A;  2YLB A;  4QQG A;  2DXC B;  1YCS B;  3MY5 B;  5FWC A;  3BG5 A;  4ZGD B;  1VQL Q;  3PVQ A;  4IIO A;  2AK5 A;  1QVF S;  4IUQ A;  4RG8 A;  4HXJ A;  2EYW A;  4R55 A;  1OKW B;  1MMN A;  3L2R A;  4BCJ B;  2W9F A;  2DL8 A;  2VB6 A;  2FPD A;  5IN1 A;  2MK5 A;  3X28 B;  2BTT A;  2WSE E;  3G4S A;  2A7Y A;  5GAM f;  1PKT A;  3CC4 Q;  4PL6 A;  1NJI C;  1Y96 A;  3THK A;  3CEY A;  5GAN 2;  1PKS A;  2LT4 A;  3FDR A;  1KD1 U;  1UGS B;  2MF2 A;  2HMA A;  4M7A G;  2RA2 A;  1W70 A;  3G71 A;  4OMN A;  4DBF A;  2E64 A;  1D3U B;  2QQS A;  1AD6 A;  1G3T A;  5CEI B;  5AYF A;  4RCC A;  4C8Q D;  1UFF A;  3CPW A;  1Y07 A;  5KH6 A;  3SWN A;  1XOV A;  5ECA A;  1YIT T;  4PLI A;  2O2O A;  1ZSZ C;  4J9H A;  3CCR T;  3KFV A;  4N4H A;  1VQ6 A;  1IXD A;  2YUO A;  4M7A B;  3WXM B;  3TSW A;  3UAT A;  1B07 A;  3RMS A;  1QVG S;  4GLM A;  4NL3 A;  2HCK A;  5CKB A;  1ZBX A;  2JMC A;  1K0X A;  2EJ9 A;  5KYU A;  1VQO T;  2J05 A;  3VU3 C;  5IXB A;  1K8A R;  5HK3 A;  2AZV A;  2C4G B;  1MNE A;  2R7G A;  2JS2 A;  3TNI B;  1VQK T;  3G6E T;  2AZS A;  4Y91 A;  3POM A;  3H9N A;  1EX4 A;  2DO3 A;  2K57 A;  1VQ9 A;  3HBL A;  1V29 B;  2X4Y A;  1SRM A;  3EH2 A;  1R0B G;  2WIP B;  3I55 T;  2H3E B;  6AT1 B;  2OTL T;  1U06 A;  4A53 A;  3QJY A;  2XIC A;  1TH7 A;  3O5Z A;  1XTD A;  1G5V A;  1AHJ B;  2MPX C;  2VAS A;  1GFD A;  1W2B P;  3OBY A;  4YOZ A;  1GCQ C;  3EG9 B;  1ENW A;  3VKH A;  2DBM A;  3OY9 A;  3JCM W;  4M77 E;  3QII A;  1PG5 B;  4M6V A;  4CC3 A;  1N5Z A;  4J9G A;  2DPP B;  1WHH A;  3EAE A;  2F2V A;  4OF1 A;  3SHW A;  3RKW A;  3CC7 T;  1UEB A;  2DD4 B;  1AD5 A;  1JKW A;  2HDA A;  3D7S B;  3OYF A;  4HNV A;  1X6O A;  2IVX A;  2ZZD B;  2A0F B;  3GIB A;  1ZX6 A;  3QZ9 B;  5L23 A;  4BCK B;  1HYO A;  1QW1 A;  1FMW A;  4M77 G;  2J6O A;  4EC8 B;  4BY6 B;  4PJL A;  4DEY A;  2W99 A;  3TVT A;  4OB3 B;  1C0M A;  2P0Q A;  4GBQ A;  4EOS B;  4NL2 A;  4J9B A;  4KUI A;  1K8A U;  4VUB A;  5I21 A;  4ZN3 A;  4MZP A;  1UTI A;  5LJ5 d;  3TU4 K;  1YWP A;  3L2Q A;  1W6X A;  2DF6 A;  3OYH A;  3GLX A;  3EHQ A;  2X3X D;  2DE0 X;  1OYX A;  2YRC A;  2QYZ A;  4M77 B;  3V8J A;  5FW9 A;  1Y71 A;  3VYG B;  1URC B;  3OYJ A;  3JB9 J;  1W2B S;  2D6F A;  2M02 A;  2XHC A;  2L2P A;  3G71 Q;  1PCX A;  3MO8 A;  1KHI A;  5HCK A;  5LJ5 g;  3M0R A;  3QYB A;  3SDZ A;  1Q82 C;  3RBB B;  2RI2 A;  3CCE T;  4Z6Y A;  2PZ1 A;  1RI9 A;  1XJW B;  1S1N A;  4J6W A;  2CP5 A;  1T0H A;  3CPF A;  2HKN A;  2ATC B;  4FYW B;  2LJ1 A;  3MET A;  3P8H A;  3PE0 A;  2YT6 A;  1OU8 A;  2RJE A;  4J8O A;  1VQ4 A;  1IO6 A;  4CC4 B;  3E1S A;  2ENM A;  2CDT A;  4JJC A;  2LMJ A;  3TCJ A;  4EC9 B;  3OYN A;  1G83 A;  3L42 A;  3BLR B;  1VQP A;  4DBH A;  2OTJ A;  2MOX A;  1VQ7 T;  3V7R A;  5KYX A;  4TTH A;  5CCA A;  3OS5 A;  5GAO n;  5GMK j;  3VV0 A;  2UZD B;  1ZSZ B;  2COY A;  1SSF A;  1YCY A;  1H26 B;  2K5I A;  2LJ0 A;  2QA4 A;  1OI1 A;  2X4X A;  4EPC A;  1D3B A;  1PKD B;  4EOK B;  2LRQ A;  5CKD A;  4AKH A;  5CYI B;  4EOM B;  4FT4 A;  1KC8 C;  2QAS A;  4D8K A;  3S6W A;  2FL7 A;  1M3A A;  2DL7 A;  5CO7 A;  2HNI A;  4CFX B;  3OQ5 A;  5GAN d;  1JJ2 P;  2K3X A;  2VGN A;  3ME9 A;  1N9S A;  1JST B;  1QLY A;  2WHB B;  4C5E A;  4HT8 A;  4AKG A;  3CD6 A;  5HBH B;  4RTV A;  2DLP A;  4D6W A;  1H1P B;  3FB9 A;  1WJS A;  2BE9 B;  1JU5 C;  1VQM T;  2QXF A;  2BZ8 A;  2EQI A;  4QVZ A;  4OGR B;  2ED1 A;  3PMT A;  3QBY A;  1K0S A;  4MIM A;  2LJ3 A;  3M0P A;  2I0N A;  4IKF A;  2HL3 A;  3J7A F;  2CZ0 B;  2M16 A;  4NC6 A;  4WCI A;  2E65 A;  2ECZ A;  4AFS C;  3N5B B;  1C1A A;  1YIT A;  3CCL A;  4KH1 B;  1BBZ A;  2EBP A;  4F7U A;  1F5Q B;  1VQ5 T;  3QSU A;  4BI8 B;  1LVK A;  3CCR A;  4CRL B;  2YHT A;  4B9X A;  2J6K A;  2DRK A;  2V1R A;  1JXO A;  5LJ5 j;  4ANJ A;  1JSU B;  4LNP A;  2QQA A;  2D9T A;  2VVK A;  3MKD A;  2V8I A;  2J06 A;  2KBT A;  5DQW A;  1PM3 A;  4NS5 A;  3DB3 A;  4LXC A;  1K9M C;  3DLM A;  2RH2 A;  1WGS A;  3S3O A;  3UA7 A;  1NYG A;  5I5Z B;  3EFR A;  3HFO A;  2YXY A;  2B86 A;  2DD5 B;  3G6E A;  5LJ3 g;  1IHW A;  2ZGW A;  1TUD A;  3I55 A;  2JGZ B;  5KCO A;  4DA4 A;  4JLI A;  2K3B A;  4XU0 A;  2JT4 A;  5GAN 7;  4BE1 A;  1QVG A;  1VYT A;  3EH1 A;  2QQB A;  1X6B A;  3QWY A;  1HD3 A;  4OMF B;  5GAO r;  4EDU A;  5ICP B;  1ZUY A;  2NUT A;  3X20 B;  3MIA B;  2LCS A;  2L3Q A;  4M7A A;  3SD4 A;  1WFW A;  1YJ9 Q;  4C92 D;  4AT1 B;  2DA9 A;  2LQ8 A;  4M75 D;  2DL4 A;  5LJ5 e;  3CCJ T;  1UDL A;  3E19 A;  5KYW A;  3Q1J A;  1RUW A;  2AHJ B;  3F5X B;  4KH0 B;  1PNJ A;  1X6G A;  1AWO A;  4LD9 K;  3NFC A;  4QT7 A;  3DLL A;  4DBR A;  1Q7Y R;  1G8X A;  1WA7 A;  2C5V B;  4F16 A;  2OTJ Q;  4J9I A;  2FEI A;  3JCM Q;  2GNC A;  2DME A;  4PJO C;  3M03 A;  4BCM D;  2RD1 A;  5J26 A;  1Q81 R;  1O9K B;  4QQ6 A;  4LN2 A;  4J5Y A;  2Y90 A;  1HXD A;  3DOG B;  3RKY A;  3P8B B;  3OBW A;  1GFC A;  4P5N A;  4AFQ C;  2KYM A;  4JZ3 A;  1T3L A;  2QA4 Q;  3RMQ A;  4RKU E;  1N8R C;  4E7I A;  2PQW A;  3QG1 A;  2V1Q A;  3L2W A;  1VIN A;  2RK2 A;  4LDV A;  1BI3 A;  1YHQ T;  1PC0 A;  2DEU A;  4BXX X;  1WHL A;  3A8O B;  1GUX B;  1FMK A;  5L2W B;  2KGT A;  2K79 A;  2I2L A;  1DJ7 B;  3JCM b;  3JB9 F;  4HNT A;  1V76 A;  1H3H A;  1ARK A;  2WEV B;  4RTX A;  1C9B A;  4JLG A;  1OIY B;  2R5A A;  3LQ5 B;  1M4Z A;  1BU2 A;  3KXT A;  5HBE B;  5I2M A;  2XG8 D;  3GPL A;  4K11 A;  1G3S A;  2QTX A;  2KRN A;  2E70 A;  3RES A;  2FO0 A;  3CME T;  3LWI A;  2KR6 A;  2ZZD A;  2BZY A;  4BCQ B;  2VKN A;  3A8M B;  4CI0 C;  1YJW T;  4IUV A;  4ZGE B;  2XMF A;  1GRI A;  3CBM A;  4O6J A;  5LJ3 j;  3PMI A;  2SEM A;  2Y4X A;  3CCL Q;  1YIT Q;  2X4J A;  1D1C A;  1GH6 B;  4FSS A;  2M0O A;  3IQL A;  4C8Q A;  2E5Q A;  3ULR B;  4HVV A;  4YTL A;  3CCR Q;  1IGU A;  5GAN e;  2KDS A;  3F70 A;  2LNH B;  3M55 A;  1KG1 A;  1G3Y A;  1I0C A;  2HZY A;  2C5N B;  3RNJ A;  2IIM A;  1M3B A;  5D7U A;  3CCV T;  2X51 A;  1Q7Y U;  1ZBJ A;  4BCI B;  1NG2 A;  1UGR B;  3OYL A;  2ESW A;  5D6X A;  2LNV A;  5GAM g;  1VQO Q;  4OMP A;  2DM1 A;  2E12 A;  4R56 A;  3ASK A;  4M77 A;  3VKG A;  1UGP B;  1VQ7 A;  1SG5 A;  1E7P A;  3LLR A;  4A4K A;  1VQK Q;  4F6W B;  5IDP B;  4M7A D;  3G6E Q;  1YWO A;  1NJI R;  1ZLM A;  3HL8 A;  3JRZ A;  2YUN A;  3G7Z A;  4A63 B;  3I55 Q;  2E5K A;  2OTL Q;  1N6A A;  2G9X B;  7AT1 B;  2KY9 A;  1BI0 A;  2RB6 A;  4BE0 A;  1Y57 A;  4OP0 A;  1MND A;  4KGZ B;  1Y0M A;  3CMA T;  4PJO E;  4E7L A;  3HRT A;  5GMK i;  2O9V A;  5FGK B;  3I9Q A;  3REA B;  3EFO B;  2KSS A;  2CP3 A;  5CKE A;  2PMI B;  3OYM A;  4JX6 A;  1H3Z A;  1XO2 A;  4AI6 A;  2NUP B;  3OYI A;  3HFN A;  1Z9Q A;  2K4Y A;  3DB4 A;  2DKG A;  1VQM A;  1XQH A;  3BY7 A;  2WIH B;  2QFZ A;  4AMC A;  1M2O A;  2XID A;  3VS2 A;  4DOV A;  5I22 A;  4ROC A;  3CC7 Q;  3SFM A;  4C5G A;  4X9C A;  3VUB A;  1KFZ A;  1MUZ A;  2PVD B;  5CIU A;  4DEX A;  2A36 A;  2JXB A;  5DLQ E;  2RI3 A;  2DVJ A;  2WSF E;  3L2V A;  5KYY A;  1PD0 A;  4BE2 A;  4QW2 A;  3BG9 A;  3GBQ A;  3LX7 A;  3CXC P;  2LDM A;  4LD6 A;  2R58 A;  2DAQ A;  3QHR B;  4EOI B;  3EG1 A;  3VS0 A;  2DZC A;  2L3R A;  5BNJ B;  1TWB A;  1F1B B;  5GJW B;  2M9U A;  3QKJ A;  4BCN B;  2GFU A;  2G77 A;  2L0A A;  3QPH A;  1EFN A;  3WVD B;  2D0N A;  4CC2 A;  4AG1 C;  4EMK A;  4E7S A;  3TEE A;  1OQK A;  4F7U F;  1QP3 A;  1OU9 A;  4PJO B;  4C5H A;  2FZK B;  1NJI U;  2PK2 A;  1I81 A;  3MCA B;  3JV3 A;  2A3L A;  4XU2 A;  2FG0 A;  4PJO F;  1AEY A;  4EMH A;  3C94 A;  4KUL A;  2P0K A;  3A8G B;  2QEX T;  2LW4 A;  3CC2 T;  2BKZ B;  4CC7 A;  2JTM A;  2DFU A;  1RAE B;  5GAM j;  5ACB A;  1GCQ A;  1WXU A;  4Y28 E;  2F69 A;  2KQW A;  1D1B A;  1N27 A;  3EGX B;  1M8M A;  2C0I A;  4M77 D;  3CCE Q;  3DDP B;  3PFS A;  2RQR A;  4KGX B;  4E7Z A;  5A0L A;  2C0O A;  2LQN A;  3H41 A;  1WYX A;  4ME7 A;  2O9S A;  4XU1 A;  5KE3 A;  3CCJ A;  3MI9 B;  2BS4 A;  3I56 T;  2NUZ A;  1BU1 A;  1QCN A;  4M7D F;  2P0P A;  1PSE A;  2CP2 A;  4IUR A;  2HL5 C;  3CXC S;  3M54 A;  1H1Q B;  2E6N A;  2CZ6 B;  3JB9 H;  2JW4 A;  5HNB B;  2PNI A;  2JUF A;  2CP7 A;  3MEU A;  3JCM f;  1KQS A;  4MDX A;  2KRS A;  1JOW A;  1VQ7 Q;  3CCS A;  1RAA B;  2EPD A;  2MI6 A;  3BDU A;  3GF5 A;  2BKD N;  4J9F A;  4LDU A;  5CQY A;  5GAO l;  1OGU B;  2EQM A;  1QLB A;  3EOC B;  4BY1 X;  4AFU C;  3I35 A;  1TG0 A;  5CR2 A;  2NYS A;  4BBS M;  4I3Z B;  1R77 A;  3HPW A;  9ATC B;  5GAO q;  3REB B;  4B6M A;  2HBP A;  5GJV B;  1MMA A;  2JTF A;  1NEG A;  2O4X B;  4N4I A;  1Q82 R;  2WJ9 A;  4M78 F;  4OB1 B;  3M0T A;  2C6T B;  2EAY A;  1JB0 E;  3CQT A;  4LE9 A;  2JTE A;  1R8O B;  4EOQ B;  3ZFJ A;  1W1F A;  2KT1 A;  4Z02 A;  2ZPB B;  1YIJ T;  4FM4 B;  3FLG A;  1B34 B;  3EGU A;  2WSC E;  1VQM Q;  2X3W D;  3VS6 A;  1H25 B;  1SKU B;  3CBP A;  1H8K A;  4BB7 A;  3CME A;  1O9K A;  1S72 T;  2DYB A;  2EYX A;  1FMV A;  2C5O B;  1U1S A;  1UHF A;  4QKU A;  1VA7 A;  2IW8 B;  2XU8 A;  1E9H B;  1ABO A;  2D8J A;  4OR5 B;  2ZPI B;  4MDW A;  1YJW A;  2EIF A;  3E2U A;  1O9S A;  2BS2 A;  1WQW A;  2CCH B;  3TSZ A;  4J9C A;  3VS5 A;  2EYQ A;  1VQ5 Q;  4NOY A;  1D0Z A;  1BCM A;  4LOC A;  5FU6 C;  3OW2 A;  3VRZ A;  1YNZ A;  5GAN 6;  4HVU A;  1TUG B;  4FCY A;  2ABL A;  5GAN 4;  1LOJ A;  4IMY B;  1OL1 B;  4Z89 A;  3PT9 A;  3CCQ A;  5IHY A;  2DEQ A;  2GTO A;  5IHI A;  2R57 A;  4F17 A;  1K73 C;  4PFO A;  2L5Q A;  4XAX B;  4C8Q F;  4HCC A;  1Q95 G;  4Y92 A;  2WFY B;  3V8L A;  5A0D A;  3MP1 A;  3UT1 A;  3SB2 A;  5IT9 E;  1OUL A;  2E3H A;  2I53 A;  1VUB A;  4GLK A;  5A0G A;  2RJC A;  2GTJ A;  3JAM E;  2QG9 B;  5GAN 5;  4CFN B;  2ZPH B;  2DIL A;  3FJ5 A;  2RK1 A;  3VKI A;  3FIF A;  2ZCF B;  1YJ9 A;  1NM7 A;  3QDR B;  1M1K C;  1OZ3 A;  4FL6 A;  2YUP A;  1I5O B;  1ZP2 A;  3P8D A;  3VS4 A;  2IG0 A;  3CCU T;  2XDB A;  3CMA A;  4QQD A;  2K5L A;  2RM4 A;  3NTK A;  5GMK l;  4XTY A;  4QVC A;  1U5S A;  1X75 C;  1K76 A;  1BCO A;  1MMG A;  5GAN 3;  2LP5 A;  3CCJ Q;  1IB8 A;  3PGG A;  2K9G A;  3GOX A;  1BIB A;  4C92 A;  1OI9 B;  5GAN h;  4M75 A;  1PD1 A;  2GFA A;  3MHX A;  2DL3 A;  1TUC A;  4A4E A;  3FEO A;  2L89 A;  3M58 A;  1OKV B;  1K9M R;  2LQK A;  3CPW P;  3M0U A;  3OMG A;  3CCS Q;  2WAC A;  2BUD A;  1RI0 A;  4FW1 A;  1MV0 B;  4ZNX A;  5IDN B;  2E6Z A;  2PK9 B;  1ZA2 B;  1QKW A;  2DTH A;  2VXE A;  3JCM J;  1FXX A;  4BCF B;  4QSH A;  2FPF A;  4HVW A;  3A8L B;  1YHQ Q;  3TN8 B;  4J83 A;  3SEM A;  4OB2 B;  4II5 B;  4F70 B;  4RTZ A;  5IHK A;  1H24 B;  2DRM A;  3X24 B;  1RAH B;  2LVM A;  4C0Z A;  2CYZ B;  3CCM T;  1M3C A;  4JRK A;  1BYM A;  2AKK A;  2EQU A;  2FPE A;  4J9E A;  4JRP A;  2QDJ A;  3TW6 A;  3HRU A;  3UA6 A;  5FRM A;  1QVF A;  4KBM B;  5GMK e;  2IW6 B;  1H4L D;  2BPM B;  2PUK B;  4MFD A;  3NTI A;  3CC2 A;  1X43 A;  2ZPF B;  4WTO B;  1E6H A;  4N0A A;  2DXC A;  4BUG A;  1OEB A;  2CZ1 B;  3TNH B;  3BE3 A;  1H27 B;  4BI4 A;  5IXF A;  3CME Q;  1W98 B;  5GAO p;  2FVU A;  1VQ8 T;  2FYK A;  2COZ A;  3QJ6 A;  5LJ3 d;  4EMG A;  2G3R A;  2NWM A;  1K1Z A;  3H8Z A;  1YJW Q;  3PIP A;  2LTO A;  4L5G A;  3HZJ A;  4RTW A;  2GGR A;  1QVP A;  4HLQ A;  1VQO A;  2B8A A;  4ELY C;  2UZB B;  1TD6 A;  5D6Y A;  1BK2 A;  1N8R R;  4MZT A;  4A54 A;  2COW A;  1SPK A;  3EHR A;  4BCQ D;  3G4S T;  1GCP A;  1VQK A;  2W10 A;  3CCV Q;  1J3T A;  3CCQ Q;  1WPY A;  1JJ2 S;  2CUB A;  2ZPG B;  2EW3 A;  1NPR A;  1K9M U;  1PRM C;  2YSQ A;  2DXU A;  5GAO m;  4RTT A;  1WNL A;  4KGV B;  2DTO A;  1NLO C;  3X26 B;  5HKC A;  2OTL A;  2D8H A;  1VQN T;  2V8J A;  3OYE A;  4EON B;  1OOT A;  2IVW A;  4KRD B;  4IUP A;  3G1J A;  2HQX A;  5FU6 B;  3V7S A;  2FHD A;  1D0X A;  3A5Z B;  2DVE A;  2KXD A;  1RLQ C;  2KR3 A;  4CXA B;  4Z8A A;  3V8K A;  3EJ1 B;  2QAZ A;  2GBQ A;  4MFE A;  1M90 C;  1TSF A;  5HBJ B;  2CH4 W;  4JS5 A;  1VQ6 T;  3OS1 A;  3OYK A;  4CFV B;  2X35 A;  3CMA Q;  1AIS B;  4J9D A;  1BKB A;  3OW2 P;  1H1R B;  5HQ0 B;  2H3J A;  4RMO A;  4JJB A;  3RGF B;  4F6S B;  1VIE A;  4M4Z A;  4E7H A;  3CC7 A;  3QXE B;  4FYX B;  1NZ9 A;  5A2Q E;  4E7K A;  2K3Y A;  1RAC B;  1WXB A;  1YIJ A;  1D0Y A;  5C6S A;  2LX7 A;  5HY6 A;  5C0M A;  5GAN f;  2AKL A;  1BI2 A;  3AHU A;  2XKO C;  2MCN A;  2CP6 A;  1G3W A;  3O8V A;  1VQ9 T;  2PUO B;  2A37 A;  4RTY A;  2O88 A;  2XD0 A;  1ZQ1 A;  4HA8 A;  4HKE A;  2O01 E;  4EOL B;  4RUG A;  2QQ8 A;  3C4S A;  3RKX A;  3EG0 A;  3L2Z A;  3EG9 A;  5DQV A;  3H0I A;  2DMO A;  4CFU B;  5AT1 B;  1RAD B;  1N8R U;  1ACM B;  1ZA1 B;  4BAC A;  1OX9 A;  3M57 A;  3MEA A;  1LNX A;  1GL5 A;  2RMO A;  2WMA B;  4AFZ C;  2MYS A;  2O4X A;  3OA6 A;  2DJQ A;  2CJM B;  4M7D C;  1VIF A;  3ZBD A;  3DTO A;  1AT1 B;  3QWX X;  2DD4 A;  2GQI A;  3U23 A;  1Q86 C;  3O0G D;  4N4G A;  2H8H A;  3JCM P;  1B34 A;  3TRE A;  2KVQ G;  1X2K A;  2DX1 A;  3BG3 A;  4C0G A;  3EID B;  4BCG B;  2QTV A;  4F6U B;  5FWB A;  3BDL A;  4BCN D;  1AWX A;  1I1J A;  5GAM d;  2QEX Q;  2WXV B;  3BFM A;  1M30 A;  3CC2 Q;  3CCE A;  3FC3 A;  3INZ A;  3RER A;  1SHF A;  1V1C A;  3M9Q A;  5GMK m;  4C5I A;  4WF2 A;  2A08 A;  4J6Y A;  4PJO D;  5DM7 R;  4L59 A;  3C0C A;  1M1F A;  1UJY A;  1RAG B;  2CT3 A;  3CCU A;  1W2B A;  1FKM A;  2QDY B;  4CFM B;  1GY3 B;  1UNH D;  4ROE A;  3PIO A;  3HTR A;  3LH0 A;  5LQF B;  4M78 C;  2LCC A;  4PNO A;  1M9S A;  1PSF A;  1VOL A;  1JEG A;  4YOO A;  1Q81 U;  3DL1 A;  1OPL A;  3VYG A;  2HAX A;  2EGC A;  3I56 Q;  1YI2 T;  3M0Q A;  2VC8 A;  1BIA A;  3HSB A;  4EOP B;  2GCX A;  3I5S A;  3HB9 A;  3MEW A;  3M56 A;  2EKO A;  5KYX B;  2RO0 A;  1QVF P;  2MMP A;  2F5K A;  1O75 A;  2F2W A;  3RUX A;  4F7U E;  3S3N A;  4BD3 A;  1CKA A;  4C92 F;  4BY7 X;  2LT1 A;  5LJ3 e;  4PJM A;  4M75 F;  1VYU A;  1D3B B;  2YWW A;  2KXC A;  8AT1 B;  4R0K A;  4Z88 A;  2EVR A;  2SRC A;  1YFN A;  1AOJ A;  3ZEH A;  1P92 A;  3JCM d;  2EQJ A;  2K2V A;  1FX7 A;  3VJP A;  1WJQ A;  3URG A;  4X34 A;  3A1P A;  2NLU A;  2QK0 A;  1VQ4 T;  2XDP A;  1EZZ B;  1UE9 A;  2MWO A;  4F7U G;  4C8Q C;  2FZG B;  4XK8 E;  4EOO B;  1ZSZ A;  1TTH B;  1HJD A;  4HCB A;  4XTZ A;  1VQP T;  1YIJ Q;  2OTJ T;  4PJN A;  4PJO G;  4PK4 A;  2V8K A;  1QCF A;  3JCM g;  1VQ5 A;  3JCM c;  4M7D E;  1SF9 A;  1S72 Q;  1QVG P;  1VQ8 A;  2KMG A;  3M53 A;  4OB0 B;  3LGF A;  2RQT A;  4F14 A;  3LYI A;  4E7J A;  1H64 1;  5FU7 C;  4F7U B;  2F2C A;  5KCH A;  3HO8 A;  1JO8 A;  4GY5 A;  3V7C A;  1VYV A;  2JS0 A;  2D0Q B;  1T3S A;  1I5L A;  3G33 B;  4FYY B;  1KIK A;  4BDY A;  1KD1 C;  3EG2 A;  4LDW A;  2CSI A;  3L1A A;  3OMC A;  1QP2 A;  4M7D G;  4EOJ B;  3CD6 T;  2YUQ A;  3BLH B;  2YLC A;  1FVV B;  5IF1 B;  5J39 A;  1YP5 A;  2HEQ A;  5DY9 A;  2KRO A;  2DZ9 A;  2RQW A;  1VYW B;  3OYB A;  1VQN A;  2MAM A;  4M78 E;  2KT8 A;  4B9W A;  2BS3 A;  3EGD B;  2EYZ A;  4PJJ A;  1H92 A;  5HK0 A;  3OYY A;  4PLL A;  1IZ6 A;  1KK7 A;  1CSK A;  2RJF A;  2VWF A;  2YRD A;  2F2X A;  2P4T A;  5GMK h;  4YOS A;  2A28 A;  3CCL T;  3QO3 A;  4M7D B;  2C06 A;  4FX3 B;  1NPP A;  1M2V B;  3HRS A;  1MV3 A;  3EFS A;  1WQ7 A;  2NUT B;  2OI3 A;  5J3B A;  1JJ2 A;  3CCU Q;  1N4M A;  3E9F A;  3QYH B;  4UC4 A;  3DJB A;  1IRX A;  3KUF A;  2G6F X;  2AT1 B;  3MPU B;  2C5X B;  1BI1 A;  4IIM A;  4KRT A;  4M78 G;  1MGQ A;  4M7A F;  2FRW A;  4ATO A;  1R0C B;  1WLP B;  2DD5 A;  5KYW B;  1X2Q A;  3I5R A;  2EGA A;  3DKM A;  1WIE A;  2JN0 A;  3MEV A;  4A4G A;  1U8R A;  2C0T A;  1YN8 A;  1QMC A;  4EMK C;  3AT1 B;  5GAM e;  5HVY B;  1K73 R;  2P4R A;  2RHU A;  1UGV A;  2HQH A;  4FW2 A;  4JRQ A;  3OYD A;  3S3M A;  1WDX A;  4C8Q E;  1YHQ A;  3TW7 A;  4IUU A;  4M78 B;  4TVR A;  4F7S B;  1E7O A;  2K7A A;  1MHN A;  1XNI A;  5L8R E;  4DQ2 A;  4FU6 A;  3SWN C;  5FLX E;  2KK4 A;  2UUE B;  1TFB A;  2CZ7 B;  1IGQ A;  4MZM A;  1YJN T;  4JX4 A;  2W9Z A;  1M1K R;  8ATC B;  3NHN A;  2DTI A;  2P84 A;  4BBR M;  1RAI B;  4BDZ A;  1A0N B;  4E6R A;  2F5T X;  2BIV A;  5LJ5 h;  1QKX A;  3CCM Q;  4C8Q G;  1LPL A;  5KYN A;  1TU0 B;  3OYG A;  1RL2 A;  1KQ1 A;  2BZX A;  1U1T A;  2I40 B;  3J80 E;  1UJ0 A;  3OB9 A;  5IH2 A;  1VQL T;  1UHC A;  3LWH A;  2E1H A;  4F7N B;  2DET A;  2WPA B;  1ABQ A;  4JPB W;  1SEM A;  2RHX A;  1VQ8 Q;  2QQR A;  1K8A C;  4F04 B;  5KE2 A;  3LGL A;  1GUX A;  1KC8 R;  2GF7 A;  4ELL A;  4ELJ A;  3QWL A;  3CCV A;  4C8Q B;  4QVD A;  3JCM e;  3CC4 T;  1TS9 A;  1I8F A;  1UNG D;  3QZ5 B;  1NYF A;  5EFQ B;  4F7J B;  1OZ2 A;  4KUD K;  1YI2 A;  4YC3 B;  4FIB A;  3H0F A;  4JRI A;  2DYI A;  5M9O A;  3G4S Q;  3DDQ B;  3OYA A;  4OVA A;  3OSS C;  1K73 U;  2W2H A;  2PVG B;  3NGP A;  1ZSG A;  2DJZ A;  4FT2 A;  4V2S A;  1OV3 A;  3BHV B;  2QGF B;  4A4F A;  2JOY A;  2JJ9 A;  3OSV A;  2UZL B;  4JX5 A;  1G2B A;  1KHC A;  2YRV A;  1FWZ A;  4M77 F;  5FU7 B;  3KBG A;  1VQN Q;  4BCH B;  1AZE A;  1Q82 U;  2KI7 A;  1WHM A;  4X1V A;  4DOW A;  1SSH A;  3UWN A;  3B57 A;  3E9G A;  4HCZ A;  2CSQ A;  2RF0 A;  2K5F A;  1M1K U;  1EIF A;  3BLQ B;  3UDC A;  2DK3 A;  1C6V X;  3VRY A;  3VS7 A;  4ZN1 A;  3VYH B;  4G6L B;  2VV5 A;  1HSQ A;  1WHJ A;  1QQJ A;  3WVE B;  3JSC A;  1K9A A;  5GAN 8;  1OX8 A;  3A8H B;  4LDX A;  3TQ7 P;  1VQ6 Q;  2MIO A;  2J6F A;  2QGG A;  1M1G A;  1X01 A;  4OGE A;  2DL5 A;  1WHK A;  3RIR A;  1WI7 A;  5EJC A;  1X27 A;  2OX7 A;  2EYY A;  2L3P A;  3JCM X;  4MMK A;  2HSE B;  3M4Y A;  4OMQ A;  1D1A A;  2K2M A;  2DBK A;  1KQ2 A;  1LCK A;  5CQX A;  3C95 A;  2Z0W A;  4ZGJ B;  1UUE A; 
#chains in the Genus database with same CATH homology
 1YIJ A;  2E41 A;  2KSS A;  2DXB B;  1W4S A;  5CKE A;  3OBY A;  3OYM A;  5C6S A;  2L8D A;  5HY6 A;  3VKH A;  3KHI A;  1JBM A;  4JX6 A;  2EJG A;  1KC8 U;  5C0M A;  4AI6 A;  5GAN f;  1BI2 A;  3OY9 A;  3JCM W;  1M8V A;  1H3Z A;  3OYI A;  3AHU A;  2XKO C;  3HFN A;  4M77 E;  4FSX A;  1UB4 A;  3QII A;  2K4Y A;  3DB4 A;  2DKG A;  1VQM A;  1G3W A;  4M6V A;  1XQH A;  3O8V A;  1VQ9 T;  3BY7 A;  2DPP B;  2PUO B;  1Y7X A;  2QFZ A;  2XD0 A;  1ZQ1 A;  2XID A;  3J81 E;  3M5A A;  4DOV A;  3EAE A;  4HA8 A;  2O01 E;  4HKE A;  4II1 A;  4MML A;  2QQ8 A;  3SFM A;  4C5G A;  5GAN 2;  3C4S A;  2ZPE B;  4X9C A;  2DIG A;  3VUB A;  2PVD B;  3RKX A;  3L2Z A;  2JZ2 A;  5CIU A;  4OF1 A;  3RKW A;  3JCM V;  3CC7 T;  1N8R U;  1UEB A;  2DD4 B;  5DLQ E;  4BAC A;  5LJ3 h;  3M57 A;  2RI3 A;  4XU3 A;  2WSF E;  5EG2 A;  2LC4 A;  3MEA A;  1Y96 B;  2LX9 A;  3L2V A;  4BE2 A;  1LNX A;  3BW1 A;  4QW2 A;  3OYF A;  3BG9 A;  3X25 B;  3LX7 A;  4HNV A;  4EMK B;  2LDM A;  3FJP A;  1X6O A;  2DAQ A;  2O4X A;  2R58 A;  4LD6 A;  2QEX A;  2ZZD B;  4JUV A;  3GIB A;  3NTH A;  3QZ9 B;  2EJF A;  3OA6 A;  4M7D C;  1NE8 A;  1QW1 A;  1VIF A;  2DZC A;  2L3R A;  3ZBD A;  4M77 G;  3JB9 D;  5LJ5 f;  4BY6 B;  4Q5W A;  2QI2 A;  2DD4 A;  2M9U A;  3QKJ A;  2GFU A;  2G77 A;  2JNG A;  3QPH A;  1Q86 C;  4OB3 B;  3WVD B;  4N4G A;  2P0Q A;  2PU9 B;  5GAN g;  3JCM P;  4EMK A;  1B34 A;  3SWN B;  3TRE A;  2HQE A;  2KVQ G;  2RHZ A;  3TEE A;  4NL2 A;  4F7U F;  4C92 C;  1QP3 A;  3BG3 A;  4C0G A;  4KUI A;  1K8A U;  4PJO B;  4C5H A;  4IUT A;  4J7I A;  3QYG B;  2CKK A;  4M75 C;  4VUB A;  4MZP A;  4ZN3 A;  5I21 A;  1NJI U;  3BDL A;  3MCA B;  1I81 A;  5LJ5 d;  3TU4 K;  5GAM d;  3L2Q A;  3BFM A;  5IAY A;  2A3L A;  4XU2 A;  4J7F A;  3CCE A;  3CPW S;  4PJO F;  3OYH A;  3GLX A;  4EMH A;  2LCL A;  3FC3 A;  3C94 A;  3INZ A;  4KUL A;  3RER A;  2P0K A;  3A8G B;  2XI9 A;  3M9Q A;  5D6W A;  5GMK m;  2QEX T;  4C5I A;  3ER0 A;  4WF2 A;  3I56 A;  1OYX A;  3CC2 T;  4J6Y A;  4PJO D;  2JTM A;  4M77 B;  3V8J A;  4A4H A;  2KAF A;  5DM7 R;  1Y71 A;  3VYG B;  4L59 A;  3OYJ A;  2JVV A;  3JB9 J;  5CK9 A;  5GAM j;  1W2B S;  1M1F A;  2D6F A;  4PJO A;  3CCU A;  2XHC A;  4C0D C;  1W2B A;  4Y28 E;  4E47 A;  1FKM A;  2QDY B;  2F69 A;  2KQW A;  4O5V A;  3MO8 A;  3PIO A;  2M1H A;  1N27 A;  3LH0 A;  4M78 C;  2LCC A;  1KHI A;  4PNO A;  4XQ3 A;  1M9S A;  1PSF A;  4M77 D;  5LJ5 g;  3G71 T;  5I2S A;  1Q81 U;  3PFS A;  3DL1 A;  3QYB A;  3VYG A;  3SDZ A;  2HAX A;  1Q82 C;  2RI2 A;  5A0L A;  1YI2 T;  3CCE T;  2VC8 A;  4ME7 A;  4Z6Y A;  1BIA A;  4XU1 A;  3HSB A;  5KE3 A;  2XDD A;  3CCJ A;  4ZTJ A;  2HD0 A;  2GCX A;  1VQL A;  3HB9 A;  3MEW A;  2BS4 A;  4J6W A;  3M56 A;  3I56 T;  2OAU A;  3CPF A;  4M7D F;  2P0P A;  1PSE A;  2EKO A;  4IUR A;  4XTW A;  3CXC S;  2EQK A;  3UPU A;  3M54 A;  3CXC A;  3MET A;  3P8H A;  2RO0 A;  2MMP A;  2F5K A;  2E6N A;  2CZ6 B;  1YBY A;  3JB9 H;  1O75 A;  2RI5 A;  2RJE A;  4J8O A;  1VQ4 A;  1M5Q 1;  5CKF A;  3HKS A;  3E1S A;  3RUX A;  3CCV A;  2JUF A;  3MEU A;  4F7U E;  4BD3 A;  3GNG A;  3S3N A;  1KQS S;  4ZTF A;  3JCM f;  4M7D A;  1KQS A;  4MDX A;  3TCJ A;  4N0A C;  1M90 U;  4C92 F;  3OYN A;  3L2U A;  2LT1 A;  4RG2 A;  3L42 A;  5LJ3 e;  3CCS A;  2MI6 A;  3BDU A;  3GF5 A;  3PNW C;  4M75 F;  2BKD N;  1VQP A;  1D3B B;  1UGQ B;  1YJN A;  3GNF B;  4LDU A;  2OTJ A;  1VQ7 T;  5CQY A;  3JB9 G;  3V7R A;  4RCB A;  5CCA A;  3OS5 A;  5GAO l;  5GAO n;  5GMK j;  3VV0 A;  2EQM A;  1QLB A;  3ZEH A;  1P92 A;  3JCM d;  2EQJ A;  1SSF A;  1YCY A;  2K2V A;  1FX7 A;  5CR2 A;  3VJP A;  2K5I A;  1WJQ A;  4BBS M;  3URG A;  2QA4 A;  3H6Z A;  1OI1 A;  2X4X A;  4EPC A;  4X34 A;  1S72 A;  1D3B A;  3HPW A;  1HK9 A;  2LRQ A;  2NLU A;  5GAO q;  5CKD A;  1VQ4 T;  4AKH A;  2XDP A;  2HBP A;  4FT4 A;  2MWO A;  2QQ9 A;  1KC8 C;  4F7U G;  4XTV A;  3QHS A;  4C8Q C;  2JTF A;  4N4I A;  2O4X B;  4XK8 E;  3S6W A;  2WJ9 A;  4M78 F;  1WJR A;  2FL7 A;  4OB1 B;  5CAI A;  5CO7 A;  2HNI A;  3CCS T;  4HCB A;  2EAY A;  2E10 A;  1JB0 E;  1LJO A;  3OQ5 A;  4XTZ A;  5GAN d;  2DIQ A;  5FRO A;  1VQP T;  2OTJ T;  4PJO G;  2K3X A;  1R8O B;  2MWP A;  2V8K A;  2VGN A;  2Y4Y A;  1N9S A;  3ME9 A;  3ZFJ A;  1JRI A;  4M78 A;  3JCM g;  4Z02 A;  5FRM A;  2ZPB B;  4C5E A;  4AKI A;  3C12 A;  1YIJ T;  4FM4 B;  4LDY A;  2XK0 A;  1B34 B;  3FLG A;  3JCM c;  1VQ5 A;  4M7D E;  4HT8 A;  4AKG A;  2WSC E;  3CD6 A;  5DLO A;  5GAN j;  1VQ8 A;  2KMG A;  3M53 A;  5GAM h;  4D6W A;  4OB0 B;  3FB9 A;  3CBP A;  1WJS A;  4BB7 A;  3CC4 A;  3LGF A;  3CME A;  1S72 T;  1VQM T;  3LYI A;  4E7J A;  2QXF A;  1U1S A;  1H64 1;  5FU7 C;  4F7U B;  4QVZ A;  4HT9 A;  2XU8 A;  4MDW A;  4C92 E;  5KCH A;  2ZPI B;  3PMT A;  3HO8 A;  3QBY A;  5CKH A;  2QF7 A;  4MIM A;  3GP8 A;  1YJW A;  4M7A C;  4GY5 A;  2EIF A;  3V7C A;  1O9S A;  4M75 E;  2BS2 A;  2D0Q B;  3HHT B;  5LJ3 f;  1I5L A;  1WQW A;  2RHY A;  3VUZ A;  2CGH A;  4IKF A;  3MP8 A;  3J7A F;  4HNU A;  2EYQ A;  2CZ0 B;  2M16 A;  1Q86 U;  4NC6 A;  4BDY A;  4NOY A;  4KT0 E;  2E65 A;  5FU6 C;  4LOC A;  3OW2 S;  4L6V 5;  1KD1 C;  3N5B B;  1YIT A;  4LDW A;  3OW2 A;  2PVO B;  2VGM A;  3CCL A;  2VXF A;  4CRI A;  3CBO A;  3L1A A;  1QP2 A;  3OMC A;  4F7U A;  1VQ5 T;  1VQ8 T;  3QSU A;  4BI8 B;  4M7D G;  5GAN 6;  3CCR A;  2YHT A;  4C0F A;  5GAN 4;  3CD6 T;  1LOJ A;  4B9X A;  2YLC A;  5J39 A;  5DY9 A;  3PT9 A;  3CCQ A;  4J6X A;  5LJ5 j;  2DEQ A;  2DZ9 A;  2QQA A;  2D9T A;  2R57 A;  3OYB A;  2EFI A;  1K73 C;  1VQN A;  2MAM A;  4M78 E;  2L5Q A;  2V8I A;  4XAX B;  4JS4 A;  4B9W A;  2BS3 A;  4C92 G;  4C8Q F;  5FRN A;  4HCC A;  4M75 G;  3V8L A;  5A0D A;  3MP1 A;  5HK0 A;  3UT1 A;  3M59 A;  4NS5 A;  3DB3 A;  3OYY A;  3SB2 A;  5IT9 E;  4PLL A;  1IZ6 A;  1VUB A;  4GLK A;  3R6O A;  5A0G A;  1K9M C;  2RJC A;  4HL4 A;  2RJF A;  3DLM A;  4JDS A;  2RH2 A;  1WGS A;  3JAM E;  3S3O A;  2X4W A;  3EFR A;  5GAN 5;  4OGC A;  2EWN A;  2P4T A;  5GMK h;  3HFO A;  1Q7Y C;  3CCL T;  2ZPH B;  2RJD A;  3QO3 A;  2DD5 B;  3QUI A;  3G6E A;  4M7D B;  2C06 A;  5LJ3 g;  4ELZ C;  1NPP A;  2RK1 A;  3VKI A;  3JB9 I;  3FIF A;  3HRS A;  1Q81 C;  2ZCF B;  1YJ9 A;  3EFS A;  1WQ7 A;  5J3B A;  1JJ2 A;  3FRN A;  3QDR B;  3E9F A;  2ZGW A;  3QYH B;  1M1K C;  4XTX A;  1OZ3 A;  4UC4 A;  3CCQ T;  4FL6 A;  3T9N A;  3I55 A;  3KUF A;  5KCO A;  1I4K 1;  4DA4 A;  4JLI A;  5LL6 S;  3P8D A;  2IG0 A;  1BI1 A;  4XU0 A;  3CCU T;  2XDB A;  5GAN 7;  4C92 B;  4M78 G;  4QQD A;  3JCM h;  1MGQ A;  3CMA A;  4BE1 A;  1QVG A;  4M7D D;  4M7A F;  2K5L A;  2QQB A;  2DD5 A;  2RM4 A;  3LW5 E;  3NTK A;  4M75 B;  5GMK l;  4ATO A;  4XTY A;  4OMF B;  5GAO r;  4EDU A;  3OS0 A;  4QVC A;  1X75 C;  2R5M A;  2VUB A;  4BI3 A;  3DKM A;  3X20 B;  4PKC C;  2JN0 A;  5GAN 3;  3MEV A;  1ZHI A;  4A4G A;  4M7A A;  1U8R A;  3SD4 A;  2CS7 A;  3PGG A;  4C92 D;  3GOX A;  1BIB A;  2LQ8 A;  3HP9 A;  4C92 A;  4EMK C;  4M75 D;  2KMT A;  2FB7 A;  5LJ5 e;  3CCJ T;  5GAM e;  3H4C A;  3E19 A;  5GAN h;  4M75 A;  1YJ9 T;  4C0D B;  2GFA A;  3MHX A;  3Q1J A;  2RHU A;  2AHJ B;  4A4E A;  3FEO A;  4JRQ A;  3OYD A;  3S3M A;  4BY6 C;  2L89 A;  1IRE B;  4C8Q E;  4JJN K;  3M58 A;  1YHQ A;  3TW7 A;  4IUU A;  4M78 B;  4LD9 K;  4TVR A;  2LQK A;  3NFC A;  3OMG A;  3CCM A;  2WAC A;  2BUD A;  3DLL A;  1MHN A;  1XNI A;  5L8R E;  4DQ2 A;  3OYC A;  4FU6 A;  3SWN C;  5FLX E;  1N9R A;  1RI0 A;  2KK4 A;  3JCM Q;  2CZ7 B;  3MP6 A;  4PJO C;  2E6Z A;  2RD1 A;  4MZM A;  2RHI A;  5J26 A;  4QQ6 A;  2DTH A;  2VXE A;  1YJN T;  4JX4 A;  4XTU A;  3JCM J;  4J5Y A;  2Y90 A;  1FXX A;  1HXD A;  4M78 D;  5CVI A;  4QSH A;  3RKY A;  2VYT A;  3QYE A;  3P8B B;  3OBW A;  2DTI A;  4P5N A;  3A8L B;  4BBR M;  4BDZ A;  3OS2 A;  2GQV A;  2DXT A;  2F5T X;  1GXI E;  3RMQ A;  2BIV A;  4RKU E;  1N8R C;  4J83 A;  4E7I A;  2PQW A;  3M4G A;  4M77 C;  4OB2 B;  5LJ5 h;  3QG1 A;  2QA4 T;  3L2W A;  2RK2 A;  3X24 B;  4LDV A;  1BI3 A;  2DXB A;  4X9D A;  4C8Q G;  3PTA A;  2YLB A;  4QQG A;  1YHQ T;  2LVM A;  4C0Z A;  4M7A E;  2DXC B;  2CYZ B;  3CCM T;  3BG5 A;  4ZGD B;  3OYG A;  1RL2 A;  3A8O B;  4JRK A;  1BYM A;  1KQ1 A;  1U1T A;  2EQU A;  1QVF S;  3J80 E;  4IUQ A;  4RG8 A;  2QDJ A;  3TW6 A;  2I2L A;  3HRU A;  3OB9 A;  4R55 A;  4KBM B;  5GMK e;  1DJ7 B;  4JRP A;  1VQL T;  1QVF A;  3JCM b;  3JB9 F;  3LWH A;  3L2R A;  2E1H A;  2PUK B;  4HNT A;  4MFD A;  3NTI A;  3CC2 A;  2ZPF B;  4JLG A;  2RHX A;  4N0A A;  2WSE E;  3X28 B;  2DXC A;  2R5A A;  5IN1 A;  3G4S A;  2A7Y A;  4BUG A;  2QQR A;  1K8A C;  5GAM f;  1M4Z A;  2CZ1 B;  5KE2 A;  3KXT A;  3LGL A;  4BI4 A;  4PL6 A;  1NJI C;  5I2M A;  1Y96 A;  2GF7 A;  2FVU A;  2XG8 D;  5GAO p;  3CEY A;  4ELJ A;  1G3S A;  2FYK A;  3QJ6 A;  2LT4 A;  2QTX A;  3QWL A;  3FDR A;  5LJ3 d;  2G3R A;  1UGS B;  2MF2 A;  4C8Q B;  2E70 A;  4EMG A;  4QVD A;  3H8Z A;  3RES A;  3JCM e;  3CME T;  3GPL A;  3CC4 T;  4M7A G;  3PIP A;  2RA2 A;  2LTO A;  3LWI A;  2KR6 A;  2ZZD A;  4L5G A;  3G71 A;  1I8F A;  3QZ5 B;  2E64 A;  3A8M B;  3HZJ A;  2QQS A;  4CI0 C;  1YJW T;  1QVP A;  4ZGE B;  4IUV A;  3CBM A;  4O6J A;  4HLQ A;  1G3T A;  1OZ2 A;  1VQO A;  5AYF A;  4FIB A;  5LJ3 j;  3PMI A;  2B8A A;  1YI2 A;  4KUD K;  4ELY C;  2Y4X A;  4JRI A;  4RCC A;  5M9O A;  3OYA A;  4C8Q D;  3CPW A;  4OVA A;  2X4J A;  3OSS C;  5D6Y A;  1Y07 A;  4MZT A;  2M0O A;  4A54 A;  1K73 U;  4C8Q A;  2PVG B;  2E5Q A;  5KH6 A;  4FT2 A;  4YTL A;  2DJZ A;  1XOV A;  3SWN A;  5GAN e;  3G4S T;  1YIT T;  4V2S A;  4PLI A;  1VQK A;  2KDS A;  3F70 A;  4A4F A;  2JOY A;  3M55 A;  1KG1 A;  1G3Y A;  3OSV A;  3CCR T;  4JX5 A;  1WPY A;  1JJ2 S;  2ZPG B;  1KHC A;  2YRV A;  1FWZ A;  1NPR A;  4M77 F;  1K9M U;  4N4H A;  3KBG A;  5FU7 B;  1VQ6 A;  3CCV T;  2DXU A;  5GAO m;  1Q7Y U;  1WNL A;  4M7A B;  3WXM B;  1Q82 U;  2DTO A;  3X26 B;  1UGR B;  4DOW A;  5HKC A;  3OYL A;  5D6X A;  3RMS A;  2LNV A;  5GAM g;  1QVG S;  2OTL A;  3UWN A;  1VQN T;  2V8J A;  2E12 A;  3E9G A;  3ASK A;  4HCZ A;  4M77 A;  4R56 A;  4NL3 A;  3OYE A;  2IVW A;  5CKB A;  3VKG A;  1UGP B;  1VQ7 A;  1ZBX A;  3LLR A;  1E7P A;  2EJ9 A;  2K5F A;  4IUP A;  1EIF A;  2HQX A;  5FU6 B;  3UDC A;  2DK3 A;  1VQO T;  1M1K U;  3VU3 C;  3V7S A;  2FHD A;  4ZN1 A;  4A4K A;  5HK3 A;  3VYH B;  3A5Z B;  2DVE A;  4M7A D;  2VV5 A;  3JSC A;  3WVE B;  5GAN 8;  3V8K A;  3HL8 A;  3JRZ A;  3A8H B;  1KD1 U;  4MFE A;  1VQK T;  1M90 C;  4LDX A;  3G6E T;  3G7Z A;  4Y91 A;  1M1G A;  1X01 A;  2K57 A;  2DO3 A;  4OGE A;  3RIR A;  1VQ9 A;  4JS5 A;  1VQ6 T;  3HBL A;  1N6A A;  3OS1 A;  5EJC A;  1V29 B;  3OYK A;  2X4Y A;  2X35 A;  3JCM X;  3I55 T;  1BKB A;  3M4Y A;  4MMK A;  2KY9 A;  1BI0 A;  2H3J A;  2RB6 A;  4RMO A;  4BE0 A;  2OTL T;  4OP0 A;  1KQ2 A;  3CMA T;  5CQX A;  3C95 A;  1VIE A;  4E7H A;  4A53 A;  3CC7 A;  3QJY A;  4PJO E;  3QXE B;  1TH7 A;  2XIC A;  4E7L A;  1XTD A;  4ZGJ B;  1NZ9 A;  3HRT A;  5GMK i;  1G5V A;  5A2Q E;  4E7K A;  1AHJ B;  2K3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...