4ZGDB

Mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
total genus 57
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgdB02
2AHJB 2ZZDB 2CZ6B 2CZ0B 2ZZDA 2WSEE 1IREB 2WSFE 4ZGDB 4OB0B 3QYHB 1V29B 3VYHB 2QDYB 3QYGB 1GXIE 2ZPGB 2ZPIB 4XK8E 2PVGB 3A8OB 3QZ5B 2ZPFB 3QZ9B 4OB2B 3A8HB 3LW5E 2CZ1B 3A8GB 2CZ7B 4OB1B 1PSFA 4RKUE 2DXBB 4ZGJB 1QP2A 3QXEB 2PUKB 1DJ7B 2DXBA 3X25B 3HHTB 1UGPB 2PVOB 4FM4B 1UGSB 2DXCB 1PSEA 2ZCFB 3X26B 2DXCA 2PVDB 3X20B 4ZGEB 2O01E 4KT0E 4L6V5 1UGQB 1UGRB 2ZPEB 2ZPBB 5L8RE 2DD4B 3A8MB 1AHJB 2DPPB 2ZPHB 1QP3A 2DD4A 3X28B 1JB0E 2DD5B 4OB3B 2PUOB 2D0QB 2WSCE 2PU9B 3VYGB 4Y28E 2CYZB 2DD5A 3WVEB 3WVDB 3X24B 3A8LB 3VYGA
chains in the Genus database with same CATH superfamily
1BU2A 2FPEA 2DTIA 2CUDA 4M7AA 5GMKi 2MMPA 2MF2A 4N0AC 4HNUA 2K3YA 1U06A 5DLOA 1IGQA 1B7TA 4F70B 2WEVB 4C5HA 2PHGA 1O9KA 3P8HA 4MZPA 1UGVA 2RI5A 2RPNA 1SRLA 4DEYA 4GBQA 1WHMA 5LL6S 2J06A 5GANe 4M78B 3VKGA 2DL7A 4M77E 3CEYA 4L59A 2C5OB 2JTMA 3VUZA 3L1AA 3HTRA 2HSEB 3LW5E 2C0OA 2BTTA 2DEUA 4XU0A 4KBMB 2LX7A 3DTOA 3V8LA 1ZSZA 5FU6B 3MEUA 3VS4A 4RKUE 4HXJA 2K3XA 1G5VA 2LZ6B 2P4TA 2OTLQ 4EONB 3GIBA 5LJ5g 3G71Q 4AFSC 4F7UG 2P4RA 1E9HB 4HNTA 2L3RA 4ZNXA 2LQWA 2LQ8A 2VASA 3MP6A 3WXMB 4J7IA 1FVVB 5GAN3 5HCKA 5LJ3h 5GAOp 2EYWA 2JGZB 1ARKA 3JCMe 1CSKA 2D6FA 3M03A 4DQ2A 3X20B 2DERA 1PNJA 1K76A 2O01E 1ACMB 4XTWA 4JX5A 1TD6A 1PD1A 2X4XA 4CFUD 2W0ZA 1AISB 2HL5C 2KAFA 1G2BA 2JT4A 2DZ9A 1MV3A 4OMNA 5KYYA 4II1A 4RTTA 1IZ6A 4JJDA 1YJNT 1VQ8T 3HFNA 2COZA 2WSCE 5KYUA 4IURA 1B34B 1WIEA 4A4GA 2QDLA 3HZJA 3EOCB 2J6FA 2WACA 2V26A 1WNLA 2AHJB 3LYIA 1U5SA 2C6TB 2QDJA 2DL5A 2RI3A 3TNIB 3HRUA 3E9FA 4JRQA 1H1QB 1QWEA 1WI7A 1URCB 1UJYA 3PGGA 3THKA 2K5FA 3S6WA 1OX8A 4BCNB 4BCQB 3SDZA 3M57A 3FC3A 2JZ2A 4JLIA 1QLBA 3S3OA 2DNUA 4D6WA 1VQNA 1KQSP 1K0XA 4HA8A 4QQDA 2ZPIB 5GAMf 2EPDA 1YIJA 3PNWC 4EMKC 3A1PA 2PNIA 4FYYB 4XTUA 3OYDA 4MMLA 1W98B 1HD3A 4F17A 5LJ5h 1K73U 1VQOA 3JCMP 4M7DA 4JX6A 1QLYA 2K6DA 2X9HA 5ICPB 4J6WA 2R7GA 4DBQA 1IHWA 3G6EQ 3M59A 2LCLA 5IXBA 1SG5A 1EZZB 3NFCA 2RJFA 3HHTB 3INZA 4HNVA 1YHQT 2X4YA 2PQWA 1Y96B 2O9SA 3GBQA 1PSEA 3META 2FRWA 1YJ9T 1ZX6A 1FMKA 2F1LA 4OVAA 1GCQA 1QVGA 2JM8A 1M90U 4L6V5 5GJWB 4BE0A 4EOOB 4PJMA 2C5NB 1H3ZA 1D3BA 3GTMS 3SD4A 3GNFB 3JCMV 1VQLQ 3PFSA 3PO3S 2ZPHB 3CD6Q 1NPRA 2EYZA 2KYMA 3FRNA 1JB0E 2W99A 3QJYA 4Q5WA 2PU9B 4BCGB 3X24B 2QQSA 3V7RA 2EQKA 2RHYA 3OA6A 4JJCA 4XTZA 1UECA 1NJIC 3CMAT 1HXDA 3UWNA 2RA2A 2X3WD 2ROTA 2DK3A 1YWPA 4RTXA 1FMWA 4RUGA 2XDBA 2WSEE 3DOGB 4PLIA 1M3CA 2E41A 3CPWS 2IW6B 2CDTA 5FRNA 4DEXA 1FX7A 3DLLA 2ABLA 2KROA 1OGUB 1C0MA 4FYVB 5GAN8 1WHJA 2DXTA 5KCOA 2P84A 2JM9A 4PJOF 1TWBA 4F7LB 3JB9D 4FT4A 3P8BB 1WQWA 4BCKB 4E47A 4DBRA 1X69A 5GMKh 1KFZA 1BB9A 1NM7A 4A63B 2DVJA 3VS6A 3BLRB 4X34A 4E6RA 5A0DA 5IT9E 9ATCB 5LJ3f 4ZTFA 4BCND 1Z9QA 4BCQD 1VUBA 1LOJA 2RD1A 1PSFA 2DXBB 2BZ8A 2UZBB 3GOXA 5GAOl 1ZSGA 3PMTA 2QGSA 4HCBA 5CKHA 1OOTA 2O2OA 1ABOA 4Z02A 2KSSA 3J81E 4M75B 2E3HA 2HZYA 1FWZA 1X6GA 2YLBA 1HK9A 3OB9A 3EHQA 3LH0A 2OTJT 4PJJA 4DBFA 2FB7A 3MKDA 1K4US 3JRZA 1Q81C 5HBHB 2JS0A 3FB9A 1WHKA 4BCHB 1OI1A 2BIVA 3MY1B 2QASA 1UNHD 2P0QA 3CCLT 4ROCA 4ZN1A 5GANj 3UA6A 1KHCA 1FINB 1WDXA 5KE2A 2B8AA 3LH5A 1K9MC 2RJEA 3CCUA 2G3RA 3KXTA 4PJNA 2PUOB 1UJ0A 2V8IA 1Q82R 1VIEA 2EQUA 5CKEA 3CCST 2E4HA 3F70A 2GGRA 2QEXA 1YP5A 3CCQA 1VQ4A 2AIRB 2E64A 1VOMA 2DAQA 2NLUA 1W2BA 1Y57A 1NPPA 1JJ2S 2F2XA 4C8QB 7AT1B 1QVFA 2RNAA 3MP1A 3EGXB 4Z89A 3QDFA 2KGTA 4OB0B 3OYIA 3ER0A 4RTWA 2H8HA 4JRIA 5LJ5f 2A36A 1JSTB 1N9SA 1Y07A 3UPUA 2K57A 2MYSA 3VV0A 4BY1X 1MHNA 2K4YA 4ELYC 2M51A 1YJNQ 1VQ8Q 2ZPGB 1XTDA 2DXUA 2DTHA 2CREA 4M78G 2JMAA 3PVQA 4HL4A 2Y90A 5FWCA 2XMFA 1OYXA 5CYIB 3HRTA 2WIPB 1XQHA 4R0KA 2QQAA 1PKDB 1T0HA 3DB4A 2QGGA 1IRXA 3L2ZA 4C5IA 3TSWA 3A8GB 3CCMA 3KHIA 2WIHB 2EGAA 2NUZA 1KD1R 5CCAA 5FLXE 2YRVA 2PUKB 2LCSA 4UN0A 5KYXB 2EJ9A 2D8JA 1UGPB 5LQFB 3QYBA 2XU8A 3EAEA 1M8VA 4HT8A 4OMQA 4XTXA 2DRKA 2YUPA 4NL3A 4E7HA 4M7AF 1WZOA 2F2CA 3D7SB 2CS7A 1X2KA 1EX4A 2E1HA 4M78C 1MMGA 5D6YA 1C9BA 1BI3A 4X1VA 5GAOr 1J3TA 3ZEHA 3JCMd 4QT7A 2KEAA 2ENMA 3A98A 2DD4B 2RJDA 2KXCA 5FU6C 4M75D 4E7ZA 2AK5A 5GAMg 3EG3A 3KBGA 1BI1A 2X1NB 3QHWB 3M0RA 3M54A 2IVXA 1YHQQ 3RGFB 4FSSA 1GY3B 3EGUA 3OQ5A 3VYGA 4IUTA 1YJ9Q 3EG9B 3JB9G 2DL3A 2DLPA 1SEMA 2X3XD 4X9DA 3SWNB 4HKEA 4FYXB 1IXDA 1V1CA 4EOKB 1JO8A 2IG0A 2Z0WA 4JLGA 3PT9A 2KBTA 1TTHB 1N8RC 2JMCA 1WXUA 4CFWB 3H0IA 4C0ZA 2DMOA 2X4JA 2YUQA 5GAOq 3VKHA 2MK5A 2QQBA 1N9RA 3M55A 3I56A 2DF6A 2FYKA 4RTUA 1M1KR 2CSIA 5LJ3e 3J80E 3VYHB 4KH1B 1VQNT 3CMAA 2BUDA 2I53A 1FKMA 3QZ5B 4QVDA 3QZ9B 1RAGB 1YIJT 3I55A 2K5LA 3I5SA 4C8QD 2NUPA 4OB2B 2XG8D 1M3AA 2WMAB 3TQ7P 4YOOA 4C92F 4E7KA 2AKLA 3NTKA 4C92E 2DYIA 3DKMA 1Q7YC 4CFMB 2LNHB 3R6OA 2DMEA 4EC9B 2HDAA 3CXCS 1FMVA 4XU3A 2CKKA 1PG5B 1OKVB 1M1GA 4NL2A 4A53A 1UE9A 4FU6A 2LCCA 3BE3A 3H8ZA 1IGUA 4MDXA 3HB9A 4ME7A 1PCXA 4AKGA 2GFUA 2E12A 3T9NA 1CKBA 3OYKA 5FW9A 4OMFB 1Y7XA 1VQ9A 1QVPA 2EQIA 3TNWB 1LPLA 1BK2A 1UGQB 1D1AA 4PKCC 1KC8C 1KD1C 3CC7A 2XKOC 4JS5A 2RQWA 1BU1A 4QQGA 2CH4A 3M0UA 1YI2Q 4BCMB 4EDUA 1YITA 2WFYB 2O4XA 4PK4A 3TCJA 4WCIA 1O9SA 2LDMA 5GAN5 4YTLA 3CQTA 5CKFA 1VQ5A 2QI2A 3AT1B 1G3WA 1QWFA 4X9CA 2BS3A 3C12A 3NGPA 3O5ZA 2OTJQ 3CCLA 2LJ0A 1AWXA 4R55A 5IHNA 3RR6A 1VA7A 5LJ5e 4M7DF 3NMZC 4RCCA 2JJ9A 5DQVA 2J7IA 4BCFB 1WJSA 4BD3A 3BHUB 5D6XA 1OEBA 3VS5A 3I35A 3EFSA 4HT9A 2FVUA 1YCSB 4RCBA 1M1FA 1RUWA 2X4WA 2KNBB 4OP0A 4TVRA 1LJOA 4Z88A 3OYGA 1JEGA 1AD5A 1KSWA 4HCKA 1QKXA 3I5RA 2YUNA 2VGNA 1WHLA 3RBBB 4BI3A 3OMGA 3OYMA 1BIBA 1GFCA 3CCSQ 5HBEB 1I0CA 4BY7X 5FRMA 2EUFA 4TTHA 2G77A 1ZSZB 1VYWB 2RN8A 4LOCA 1YNZA 3V8KA 1PRMC 5AYFA 3VS3A 3EJ1B 2VYTA 4ZTJA 3QXEB 1M1KC 1H92A 1GUXA 4PL6A 3G4SA 2HBPA 2RQRA 2R58A 2E5KA 4M77F 1GRIA 1RAIB 4J9FA 4M75G 1W6XA 5GAMj 1ZBXA 1UGSB 3FIFA 3OBWA 2BZXA 4MZMA 2EGCA 1YJWQ 4J6XA 2V1RA 1X6BA 2ZPEB 1QW1A 1H24B 2AZSA 3JCMc 3PE0A 2MIOA 8AT1B 3F5XB 2DL4A 3RKWA 3A8MB 2YRCA 5KYYB 4Z8AA 2OTLA 3M0QA 3CCEA 3MEWA 5KYUB 3X28B 1K1ZA 3VRYA 2VUBA 1NYFA 4LDVA 1P92A 4OB3B 2RQUA 1PD0A 3CCUT 1D1BA 4C0GA 5ACBA 3REBB 4B9XA 2DD5A 3QBYA 4KULA 4M75C 2O9VA 2CP0A 1OZ3A 2QEXT 3CCQT 4LDUA 2BKDN 1NJIR 1VQ4T 2R5MA 4C92A 4C8QG 2FRYA 2AT1B 4BCMD 4OGRB 2GF7A 4BBRM 4NS5A 2YDLA 3L2WA 2B86A 4RMOA 3QDRB 4LDYA 4ZGDB 4FT2A 4BI4A 3GPLA 2XD0A 4OMOA 3QYHB 3QHRB 1AVZC 3JAME 5KCHA 4JRPA 4LE9A 3OMCA 4LUEA 2ZGWA 4CFNB 3PVLA 4YOZA 3BHTB 4LDWA 1GXIE 3EGDA 2VVKA 4P5NA 1G3TA 5KYWA 1UHCA 1IHVA 4XK8E 5DQWA 3OW2S 3M0SA 5I22A 1C1AA 4J9BA 4BDZA 2CUBA 2OAWA 1Y71A 4M7DB 2EGEA 2JOYA 4BB7A 3ZFJA 4OGEA 1D0XA 2C5XB 1KQSA 5IHIA 4C8QC 1B07A 4OB1B 3E1SA 1X6OA 2F69A 3CPWP 3CCMT 2HQHA 4EOQB 1WXTA 2CT4A 3CMEA 1F1BB 2LP5A 1ZQ1A 4J9IA 1X2QA 2BKZB 3DDPB 1DJ7B 3ZL7C 1SHGA 1B3QA 3MCAB 1AZGB 4YC3B 2EKHA 1Q81R 1JXMA 4AG1C 1VIFA 1ZHIA 4LNPA 4AKIA 1OZ2A 1VQNQ 2PVDB 1LVKA 4FSXA 1OIUB 3BLHB 5GAN6 1D3BB 4IUPA 5LJ3j 3OSVA 2H3EB 3OYNA 4F6SB 1OPKA 2HQXA 1Q86U 2A3LA 2KT1A 1BIAA 1VQOQ 1K9MR 1KJWA 4M78D 4IUUA 3H6ZA 1G3YA 1UEBA 6AT1B 1XNIA 1I1JA 1PKTA 2GFAA 4AMCA 3O8VA 1R0CB 2LT1A 4F7UF 1G8XA 1JBMA 4LD6A 4F7UE 1IO6A 2QAZA 1JRIA 2F2VA 4PJOC 5I11A 3V7SA 2EQJA 2BS4A 3VS7A 1NLOC 3V8JA 1UFFA 4AG2C 3VS2A 1AOJA 3MIAB 4M77A 2L0AA 4C8QE 4OMPA 1RLPC 3I56T 2YSQA 3QJ6A 4AFUC 3QIIA 4FW1A 1UG1A 1M5Q1 2JNGA 1S72A 4F14A 4ZN3A 5IH2A 2HEQA 5KH6A 1JJ2P 3I55T 4J9DA 1VQ6A 1AWJA 1OPLA 3OS0A 1RI9A 2DJQA 3SWNC 3UT1A 1TFBA 1VQKT 1MV0B 3TNHB 4MMKA 3LGFA 3ZBDA 5LJ5j 2R57A 3VJPA 3RKYA 4EPCA 5IAYA 3NHNA 3M4YA 3OY9A 2XI9A 1RL2A 2FG0A 1GH6B 2PVOB 4ELLA 1D09B 3PIPA 5IHYA 2EJGA 2C0IA 2SEMA 2WJ9A 2J6OA 2JW4A 2LX9A 2EYQA 2QFZA 4IMYB 3L2QA 5J39A 1VQ9T 1H1RB 3IQLA 4JJBA 5HK3A 3JCMh 2O88A 2DRMA 3E19A 5L8RE 3CC7T 3EG1A 2QA4T 3MY5B 3QHSA 3TU4K 4MZTA 1U1TA 1YITT 3POMA 3QPHA 1H3HA 5IDNB 4RTVA 1Q95G 1SSHA 3CC4A 1ZBJA 3SB2A 1TOVA 2JUFA 4AI6A 2KMGA 2DBMA 1VQ5T 1SKUB 3V7CA 2YWWA 3EG0A 4BE2A 2BE9B 4Y92A 4A4FA 1ZP2A 1PWTA 2UZDB 4RTZA 2YRDA 5D6WA 3TREA 1N8RR 2D0NA 3UF4A 4WF2A 1NEGA 1QVGS 2AZVA 3MEAA 1BCOA 2WXVB 2DO3A 3CC2T 1M8MA 2IIMA 1P5EB 3EFOA 3CCUQ 2HAXA 2DBKA 2EYXA 3PMIA 2GQVA 2GQIA 2QTXA 2K2MA 4HVVA 5EFQB 1RLQC 3BW1A 5GAMe 3FJ5A 1UNGD 2UUEB 3BG9A 3FJPA 2QEXQ 4M7AC 1Q7YR 2F5KA 1VQ4Q 5A0GA 1TUDA 4FL6A 3JV3A 2HKQB 2ECZA 3N5BB 2VV5A 3OSSC 5GMKj 1OKWB 2RQVA 1I8FA 4IKFA 2RF0A 1OU8A 4KUIA 2CP3A 3CCVA 3J7AF 3G4ST 2KY9A 4KH0B 2LQKA 1D1CA 4F7UA 1NZ9A 4F7SB 3EH2A 2CP2A 1GCPA 2B9RA 3DL1A 5GANd 2LJ3A 2DXCA 4KUDK 3QKJA 1T3SA 2VB6A 5GJVB 1KC8R 3O0GD 3G33B 3EHRA 1G3NC 5AT1B 1PM3A 1ZSZC 3KUFA 3CXCP 4ROEA 4BDYA 3JSCA 2QF7A 5CAIA 1H27B 2AKKA 4N4IA 1AHJB 1D0ZA 2DPPB 1X01A 2QQ9A 2OTLT 5IDPB 2QQ8A 3CCET 3G71T 4PJOB 1NLPC 4MDWA 2RK1A 4N4HA 1R77A 3VYGB 4LDXA 2DKGA 2K5IA 4Y28E 2EQMA 5C6SA 1TSFA 2DTOA 4EMKA 1K73C 5I2MA 4CC2A 1RACB 2UZLB 1WYXA 5I2SA 1VQ7A 3EG2A 4BBSM 3QSUA 2CCIB 3JCMJ 2DA9A 3BDUA 3A5ZB 3HPWA 3M4GA 1H1SB 2CZ0B 2ZZDA 3H0FA 1Q86C 1IREB 2F5TX 2W2HA 2EVRA 2OX7A 5BNJB 1NE8A 5IN1A 2OAUA 3CBMA 4HCCA 1KQ2A 1JU5C 2GTJA 2QYZA 2K7AA 2L89A 4KRCB 4F04B 1W1FA 4XAXB 3OYHA 2YUOA 1QMCA 4N4GA 2CJMB 3H0HA 2NUPB 2KE9A 1M90C 2QK0A 1AT1B 3M0TA 4J5YA 5FU7B 1VQMA 4J83A 1MGQA 3RNJA 3BLQB 2R5AA 2E5QA 2CZ1B 2W10A 4CI0C 2CZ7B 4NOYA 2D9TA 2KQWA 2RI2A 1PKSA 2L3PA 3L2VA 4BUGA 1VYTA 1W2BS 1N4MA 3QUIA 4JZ3A 3CMET 3GP8A 3JCMf 1UTIA 4JS4A 1T0JA 2QXFA 2UZEB 2PK2A 2C0TA 2KYBA 3I9QA 4KGZB 2WMBB 2HKNA 1K8AU 3C4SA 1VQKA 3CMAQ 4M78E 2GNCA 2BPMB 5HQ0B 1AEYA 4M7DC 4JX4A 2JS2A 2K2VA 4QW2A 4J9HA 2SRCA 2O4XB 2V22B 4KRDB 2HD0A 1VQPA 3OYAA 3CCRA 2EAYA 1GBQA 2KDSA 1SRMA 5FROA 2RHUA 3RKXA 5DLQE 2ROLA 2HMAA 5GAN2 4PFOA 1H641 1RADB 3C95A 2D0QB 2M02A 3QWXX 2IW8B 4EOIB 3EIDB 2NUTA 1F5QB 1HSQA 2LTOA 5C0MA 2COYA 2HCKA 1GCQC 1EFNA 2YXYA 4AKHA 4C0DB 3K7AM 2QA4A 4MFDA 4HLQA 2VC8A 1VQ9Q 4C5GA 4ESRA 1WLPB 2RO0A 1YFNA 4BCJB 4ELZC 5GAN4 1YI2A 4O6JA 4A54A 4PJOD 3CC7Q 3ME9A 2GTOA 2CP6A 2PTKA 1VQLT 4L5GA 2I2LA 2DIQA 2MOXA 2GBQA 2QGFB 1YITQ 1M2VA 1GL5A 2IN3A 3P8DA 2D1XA 3MP8A 4QKUA 4M7AB 1KQ1A 2KRMA 4EMHA 4Z6YA 1TG0A 4MFEA 4GLKA 3A8OB 2L8DA 4EORB 1VQ5Q 1E7PA 4NC6A 3FDRA 4BE1A 1S72T 2KRSA 3M56A 4GLMA 1HJDA 1O9KB 4J9GA 5HBJB 2LRQA 3CCLQ 2M9UA 5CK9A 1RAHB 1H28B 1VQ6T 3JB9F 2DM1A 2CH4W 2G6FX 3TSZA 3CC2A 3CCJA 1NJIU 4AFZC 2WPAB 5CIUA 2XDDA 4GY5A 3OS1A 1GUXB 1H26B 4ORZA 4HVWA 1TH7A 3E2UA 5A2QE 2PJQA 4BI8B 2LVMA 4PFPA 3JB9I 4D8KA 2J6KA 4YOSA 3L42A 2K79A 2J05A 5ECAA 3AHUA 4FM4B 4F7JB 3QWYA 1X43A 3OW2P 2LQNA 1MMDA 2KR6A 3ULRB 4I3ZB 1G3SA 3VS1A 3RUXA 1UGRB 4LN2A 3BFMA 5IF1B 2ZPBB 2E70A 4OMLA 4NSTB 1KIKA 3MI9B 2WHBB 3EFRA 4F6UB 2QQRA 2DD5B 4LXCA 1WA7A 4R56A 1D3UB 3E9GA 1E6GA 4F16A 3U23A 3G4SQ 3CC4T 4B9WA 1VYVA 2IW9B 1TUCA 1WFWA 1H25B 4XU2A 3VU3C 2HQEA 4C92B 5J3BA 1UB4A 3RIRA 1YJWA 1Q81U 3LX7A 2I40B 1WPYA 4FYWB 2CGHA 4D8DA 1WJQA 5GMKm 1ZA1B 2L3SA 2QG9B 2DJZA 3G71A 1W4SA 2KR3A 4OGCA 4QVCA 4FW2A 1OQKA 3JCMX 4A4HA 3M5AA 2EFIA 3EGDB 5CKBA 2VKNA 5KYWB 5GMKe 1GBRA 1K9MU 3CCEQ 3LWIA 2P0PA 2XHCA 2HNIA 4JPBW 3SHWA 2LNVA 1EIFA 2V8KA 3C0CA 1H4LD 4M78A 1OX9A 3TVTA 4XTVA 2E6ZA 3C94A 4PFZA 2F2WA 4EOMB 2E65A 2DETA 3LWHA 5GAMd 3KFVA 4CFVB 3L2RA 1KK7A 1WJRA 2BZYA 3FEOA 3R6NA 2IVWA 2FL7A 4M7AD 2XIDA 3X25B 3LLRA 2M1HA 5IXFA 5EJCA 2DZCA 2RHXA 3CCVT 4DOWA 1BCMA 2LJ1A 5FWBA 2XICA 3RDVA 3JCMb 2X35A 1LCKA 1QCOA 3OYEA 3UDCA 2C5VB 1TS9A 3CPWA 2MWOA 4BXXX 2O31A 3NPFA 1MMNA 2RB6A 2VXEA 3S3MA 2PK9B 2RQTA 1E7OA 1YCYA 1HYOA 4BY6B 2W9ZA 3MJXA 1ZUYA 5GANg 2M0YA 1XO2A 2DILA 2LT4A 5CVIA 3TW7A 2DEQA 1VOLA 1M27C 4PJOG 3CMEQ 4E2FB 1QKWA 2MI6A 5GAN7 1NEBA 1AD6A 3WVDB 1YIJQ 1GFDA 4QQ6A 4M75F 4A4KA 4UC4A 3NDQA 3VKIA 1B34A 4M75E 1IB8A 5I21A 3JCMQ 1K8AC 5HY6A 5LMKB 3G7ZA 4OF1A 2KI7A 2Y4YA 1VQ7T 4EOLB 1ENWA 1OULA 4PLLA 5HKCA 1K0SA 2CP7A 3CBPA 3G6EA 2L2PA 3L2UA 2ZAEA 1I5LA 4E7JA 2DX1A 2YT6A 4M77B 2VXFA 3JCMg 2E10A 3DDQB 2PMIB 2V8JA 1VINA 2DVEA 3JCMW 2QDYB 1OL2B 4G6LB 4C92D 1WX6A 1BBZA 5A0LA 3BG5A 4LD9K 3SEMA 5M9OA 4ELJA 3A8HB 1NYGA 1PHTA 2MPXC 2DYBA 4CRIA 3MEVA 3RMQA 3HKSA 1VQLA 4IUQA 4BCOB 1VQMT 4RODA 1ZUKA 2FZKB 5CQYA 5EC7A 4C8QF 3CD6A 4FX3B 1QVGP 1KHIA 3NTIA 4C5EA 3CPFA 4J8OA 4V2SA 2XDPA 2QTVA 2X51A 1N8RU 4F6WB 1OIYB 1WGSA 2YHTA 4PNOA 3G1JA 1JJ2A 1TXQA 5LJ3d 3H4CA 2P0KA 1Q82U 3HBLA 4CC3A 2ZCFB 3X26B 5GANh 1Y96A 2MCNA 1M3BA 1H1PB 3H9NA 3HFOA 1U3OA 1S72Q 3LQ5B 1JSUB 1SSFA 1H8KA 3MPUB 5FU7C 3CBOA 2LC4A 2MWPA 1VQ6Q 1QMZB 1BYMA 4M6VA 2FPDA 1E6HA 1Q7YU 4J9CA 4CC7A 1VQPT 1UUEA 3CCRT 4JJNK 2VWFA 3SFMA 3UATA 3UA7A 2CCHB 4M7DD 3GNGA 5J26A 4EMGA 1YN8A 4HVUA 1KQSS 1I5OB 1D0YA 2CYZB 2A7YA 2JTEA 2CT3A 3TN8B 1K73R 2ESWA 1TUGB 1A0NB 1N6AA 4N0AA 4AFQC 1K9AA 4IIMA 3QO3A 4PJOE 2OI3A 1FYNA 2RM4A 1Q86R 1MMAA 1AZEA 3BHVB 2COWA 1WXBA 2A08A 1W70A 2EIFA 1KC8U 1KD1U 1AWOA 1YI2T 3QWLA 3OYFA 4EOPB 2ED1A 1ZA2B 2EBPA 3EFOB 4B6MA 1TU0B 4M7AG 3QYGB 2L5QA 1M90R 5I5ZB 2YLCA 5IHKA 3BDLA 2E6NA 2PVGB 3CC4Q 4BCIB 4RG8A 4OR5B 3M58A 4F7NB 3H41A 1SHFA 4XQ3A 4FIBA 5LJ5d 1X27A 1M2OA 5D7UA 4FCYA 4M4ZA 4M77D 4C0DC 2K9GA 2M0OA 4XTYA 2Y4XA 4E7SA 3CCJT 4KGXB 1Z9ZA 1QP2A 2E3IA 1U8RA 1XJWB 3LGLA 1R0BG 2DXBA 4F7UB 4Y72B 1I07A 2K3BA 1WHGA 1R8OB 2RK2A 3OYLA 2RHZA 1FXXA 4K11A 4EIKA 2G9XB 2DXCB 4DBHA 3NTHA 4M75A 1BI2A 3CCQQ 2JVVA 2EW3A 2XK0A 1PC0A 3HP9A 1Y0MA 2H3JA 4KT0E 4BCPB 5CKDA 5GAOn 1S1NA 2ED0A 2VGMA 3DJBA 1PRLC 4EOJB 3DB3A 2RH2A 1W2BP 3HRSA 3TW6A 3OYYA 1YJNA 1VQ8A 1BKBA 3HO8A 4CRLB 2KT8A 1QVFP 1M1KU 3ASKA 4OMMA 1LNXA 3MO8A 4EMKB 3OBYA 3BG3A 2JN0A 3PIOA 2EYYA 4JRKA 3CCVQ 1OU9A 3CXCA 1SPKA 4C92G 1QQJA 4II5B 1U1SA 2NYSA 2BS2A 1N27A 2ZZDB 2FO0A 1YJWT 4QSHA 4J7FA 2CZ6B 5CEIB 3CCMQ 4C8QA 2WSFE 3EGXA 4JUVA 3M9QA 1ZLMA 4RG2A 2IPOB 2KK4A 3QYEA 2HSPA 4ATOA 4DOVA 3M0PA 2A28A 3OYJA 3HSBA 1V29B 1JXOA 1RAEB 1RI0A 2C06A 1ABQA 1XOVA 5HK0A 1QCNA 1I81A 3RERA 5L2WB 2NWMA 4C92C 2FHDA 1KXUA 2GCXA 4MIMA 4M7AE 3HL8A 4HCZA 2A0FB 1VQ7Q 4Y91A 2OJ2A 5GANf 5HNBB 1O75A 4ANJA 1MUZA 2ATCB 5DY9A 1YHQA 2CSQA 3OS2A 3JB9J 5DM7R 1JOWA 1CKAA 1YJ9A 3M53A 2RMOA 5KYXA 1KG1A 4AT1B 4M7DG 3RESA 3B57A 1M30A 2HL3A 2L3QA 5GMKl 2KXDA 4VUBA 1AWWA 4PJOA 3Q1JA 4ZGEB 1JQQA 1NBEB 2DE0X 1QCFA 3MHXA 4CC4B 5CO7A 1VQMQ 1I4K1 5HVYB 1SF9A 1QVFS 1OI9B 1BI0A 1MNEA 1QP3A 2DD4A 3I56Q 5EG2A 5FGKB 2DFUA 5GAOm 4BACA 2NUTB 4CXAB 5CQXA 2I0NA 4M78F 3VS0A 3WVEB 1OL1B 1Q82C 4JDSA 2KMTA 3I55Q 1C6VX 8ATCB 3URGA 2EKOA 4XU1A 2EWNA 2C4GB 3EG9A 2JXBA 4LUDA 1VQKQ 4RTYA 3SWNA 2DL8A 3EH1A 2M16A 4EC8B 3G6ET 4M77G 3QG1A 4A4EA 4BY6C 1M2VB 2CP5A 1VQOT 4DA4A 5CR2A 1VQPQ 1VYUA 1N5ZA 3CCRQ 2MAMA 3GLXA 5L23A 1OV3A 2D8HA 2FZCB 5KE3A 2ZPFB 1WHHA 5KYNA 2W96A 4IUVA 1MNDA 1UHFA 1RAAB 3OS5A 4CFXB 3PTAA 2RJCA 2FEIA 4JZ4A 1YWOA 4C0FA 3RMSA 1WQ7A 1NG2A 3REAB 2W9FA 2V1QA 4EOSB 2QA4Q 5GAMh 1G83A 1RABB 3DLMA 1YBYA 3GF5A 4ZGJB 4CFUB 3CD6T 4WTOB 2PZ1A 4O5VA 3VRZA 2KVQG 1T3LA 4M77C 2OTJA 2JTFA 2HBWA 1V76A 1UDLA 4IIOA 3VUBA 1M4ZA 4J9EA 1M9SA 2FPFA 2LW4A 2RHIA 3BY7A 1RAFB 3OYCA 3S3NA 1UNLD 4KRTA 3OYBA 5LJ3g 3TEEA 4M7DE 1ZUUA 3OW2A 3JB9H 4QVZA 2EJFA 3CC2Q 3CCJQ 4PJLA 2A37A 3CCSA 4KGVB 1JKWA 1X75C 2KRNA 2FZGB 4E7IA 2LMJA 2BE7D 3FLGA 4J6YA 3A8LB 2DIGA 1K8AR 4E7LA
chains in the Genus database with same CATH topology
2DTIA 5HY6A 3G7ZA 4OF1A 4A4FA 3JB9G 4X9DA 3SWNB 4M7AA 5GMKi 2MMPA 4HKEA 2MF2A 2Y4YA 4N0AC 1VQ7T 2IG0A 5HKCA 4HNUA 4JLGA 4PLLA 2K3YA 5D6WA 3TREA 3PT9A 3CBPA 3G6EA 5DLOA 3L2UA 1N8RC 4C5HA 4WF2A 4E7JA 1I5LA 4M77B 3P8HA 2VXFA 4MZPA 3JCMg 4C0ZA 2X4JA 1QVGS 2RI5A 2E10A 5GAOq 3VKHA 3MEAA 2QQBA 2V8JA 1N9RA 3M55A 3I56A 2DO3A 2FYKA 3CC2T 4PJOB 5LL6S 5LJ3e 3J80E 2DVEA 3JCMW 3VYHB 2QDYB 4C92D 5GANe 2HAXA 1VQNT 3CMAA 3PMIA 2BUDA 2GQVA 4M78B 1FKMA 2QTXA 5A0LA 3BG5A 3VKGA 3QZ5B 4M77E 3CEYA 4QVDA 3QZ9B 1YIJT 4LD9K 3I55A 2K5LA 4C8QD 4L59A 2JTMA 4OB2B 3A8HB 4ELJA 2XG8D 3BW1A 3VUZA 5GAMe 3L1AA 5M9OA 3BG9A 4CRIA 3FJPA 3MEVA 3LW5E 4C92F 4E7KA 4M7AC 2F5KA 3NTKA 3RMQA 5A0GA 4XU0A 3HKSA 1VQLA 4KBMB 4IUQA 4C92E 1VQMT 3DKMA 1Q7YC 4FL6A 3V8LA 3N5BB 3R6OA 5CQYA 4C8QF 2VV5A 3OSSC 5FU6B 5GMKj 3MEUA 3CD6A 1YJNT 3CXCS 4RKUE 2K3XA 1KHIA 3NTIA 2P4TA 4XU3A 3CPFA 4J8OA 4C5EA 1G5VA 4V2SA 2XDPA 1I8FA 2CKKA 4IKFA 1M1GA 4NL2A 4A53A 5LJ5g 1N8RU 3GIBA 4KUIA 1WGSA 2YHTA 4FU6A 4PNOA 2LCCA 3H8ZA 4F7UG 3CCVA 1JJ2A 3J7AF 4HNTA 2L3RA 3G4ST 2LQ8A 4MDXA 2KY9A 3MP6A 3WXMB 4J7IA 3HB9A 2LQKA 4ME7A 5GAN3 4F7UA 4AKGA 2GFUA 1NZ9A 5LJ3d 5LJ3h 5GAOp 3H4CA 2E12A 2P0KA 3T9NA 1Q82U 3HBLA 2ZCFB 3JCMe 3X26B 3DL1A 5GANh 5GANd 3OYKA 4KUDK 2DXCA 1Y96A 1Y7XA 3QKJA 1QVPA 4OMFB 4DQ2A 1VQ9A 2D6FA 3X20B 2O01E 3HFOA 1UGQB 4XTWA 1SSFA 4JX5A 4PKCC 5FU7C 2X4XA 1KC8C 1KD1C 3CBOA 3CC7A 2XKOC 2LC4A 4JS5A 3KUFA 2MWPA 4QQGA 4BDYA 3JSCA 2QF7A 5CAIA 1BYMA 4M6VA 4N4IA 2KAFA 4EDUA 1Q7YU 1YITA 1AHJB 2O4XA 2DPPB 1X01A 3TCJA 2DZ9A 1VQPT 2QQ9A 3CCRT 4JJNK 2OTLT 3SFMA 2QQ8A 3CCET 4II1A 1IZ6A 1O9SA 2LDMA 5GAN5 3GNGA 3HFNA 4YTLA 3G71T 5J26A 4MDWA 2RK1A 4N4HA 5CKFA 4EMGA 1VQ5A 2QI2A 2WSCE 3OY9A 3VYGB 1G3WA 4IURA 2K5IA 1B34B 2DKGA 2CYZB 2BS3A 2A7YA 2EQMA 3C12A 4X9CA 4Y28E 4A4GA 5C6SA 2DTOA 3HZJA 4EMKA 3CCLA 1K73C 5I2MA 4R55A 1N6AA 4N0AA 5LJ5e 4M7DF 2WACA 1WNLA 4RCCA 2AHJB 5I2SA 3LYIA 3QO3A 1KQSS 1VQ7A 4BBSM 2QDJA 3QSUA 1WJSA 4BD3A 4PJOE 3JCMJ 2RI3A 3BDUA 3HRUA 3A5ZB 3E9FA 2RM4A 5D6XA 3HPWA 4JRQA 3M4GA 2CZ0B 2ZZDA 3EFSA 1Q86C 1IREB 3PGGA 4HT9A 2FVUA 2F5TX 2K5FA 3S6WA 1NE8A 4RCBA 2OAUA 1M1FA 2EIFA 3CBMA 5IN1A 1KC8U 1YI2T 1KD1U 4HCCA 1KQ2A 3QWLA 2X4WA 3SDZA 3M57A 3OYFA 3FC3A 4OP0A 4TVRA 1LJOA 2L89A 2JZ2A 3OYGA 4JLIA 1QLBA 3S3OA 4D6WA 4XAXB 1VQNA 4M7AG 3QYGB 4HA8A 3OYHA 4QQDA 2ZPIB 2L5QA 4N4GA 5GAMf 2VGNA 1YIJA 2YLCA 4BI3A 3BDLA 3OYMA 3OMGA 2E6NA 2PVGB 1BIBA 1M90C 3PNWC 4RG8A 4EMKC 4XTUA 3M58A 3OYDA 4MMLA 5FRMA 4J5YA 5FU7B 4XQ3A 4FIBA 2G77A 5LJ5h 4J83A 5LJ5d 1VQMA 1MGQA 1K73U 1VQOA 3JCMP 4M7DA 2R5AA 2E5QA 2CZ1B 4JX6A 4M77D 4CI0C 4C0DC 2CZ7B 2M0OA 4NOYA 4LOCA 2D9TA 4XTYA 2Y4XA 3V8KA 2KQWA 2RI2A 5AYFA 3CCJT 4J6WA 3L2VA 1QP2A 2VYTA 4ZTJA 3QXEB 1U8RA 1M1KC 4BUGA 3M59A 1W2BS 2LCLA 3QUIA 3LGLA 3NFCA 2DXBA 2HBPA 2RJFA 2R58A 4M77F 3HHTB 4PL6A 3INZA 3CMET 4F7UB 4HNVA 3GP8A 1YHQT 1R8OB 4M75G 3JCMf 2X4YA 2PQWA 2RK2A 3OYLA 2RHZA 1FXXA 5GAMj 4JS4A 1ZBXA 2QXFA 1UGSB 2DXCB 1Y96B 3NTHA 1PSEA 3FIFA 4M75A 3META 3OBWA 1YJ9T 1BI2A 2JVVA 2XK0A 4MZMA 1K8AU 3C4SA 3HP9A 4OVAA 1QVGA 1VQKA 2H3JA 4KT0E 5CKDA 4J6XA 5GAOn 1M90U 4L6V5 4M78E 4BE0A 1H3ZA 2ZPEB 1QW1A 3JCMc 2VGMA 4M7DC 4JX4A 2K2VA 1D3BA 4QW2A 2O4XB 3SD4A 3GNFB 3JCMV 2HD0A 1VQPA 3RKWA 3OYAA 3CCRA 3A8MB 2EAYA 3DB3A 2KDSA 2RH2A 5FROA 2OTLA 3PFSA 3HRSA 2RHUA 3CCEA 3TW6A 3OYYA 2ZPHB 3RKXA 1BKBA 3HO8A 1YJNA 1VQ8A 1NPRA 3MEWA 5DLQE 3X28B 5GAN2 3FRNA 2VUBA 4LDVA 1H641 1JB0E 1P92A 3QJYA 4OB3B 3C95A 1M1KU 3ASKA 4Q5WA 3CCUT 2D0QB 1LNXA 4C0GA 3MO8A 2PU9B 4EMKB 3OBYA 4B9XA 3BG3A 2JN0A 2DD5A 3X24B 3QBYA 4JRKA 4KULA 3PIOA 5C0MA 2LTOA 2QQSA 4M75C 3V7RA 3CXCA 4C92G 2EQKA 1OZ3A 2RHYA 1U1SA 3OA6A 2QEXT 3CCQT 4LDUA 2BKDN 2BS2A 1VQ4T 1N27A 4AKHA 4C0DB 2ZZDB 2R5MA 4XTZA 4C8QG 4C92A 4MFDA 4HLQA 2VC8A 1HXDA 3UWNA 2QA4A 2RA2A 1YJWT 4C5GA 1NJIC 3CMAT 4QSHA 2GF7A 4J7FA 2DK3A 4BBRM 2RO0A 4NS5A 2CZ6B 3L2WA 5GAN4 4ELZC 2XDBA 2WSEE 4C8QA 4PLIA 1YI2A 2WSFE 4RMOA 3QDRB 4LDYA 4ZGDB 4FT2A 4JUVA 4BI4A 3GPLA 2XD0A 3M9QA 2E41A 3QYHB 3CPWS 4RG2A 4O6JA 4A54A 4PJOD 2KK4A 3ME9A 3QYEA 5FRNA 1VQLT 4L5GA 1FX7A 2I2LA 4DOVA 5KCHA 3JAME 2DIQA 3DLLA 4JRPA 5GAN8 3OYJA 3HSBA 2DXTA 3OMCA 2ZGWA 1V29B 3P8DA 3MP8A 5KCOA 4LDWA 1RI0A 1KQ1A 4M7AB 1GXIE 4P5NA 1G3TA 4EMHA 4Z6YA 4PJOF 3G4SA 4MFEA 2C06A 4GLKA 4XK8E 3JB9D 3A8OB 1XOVA 2L8DA 4FT4A 3P8BB 5HK0A 3OW2S 1WQWA 4E47A 4BDZA 1E7PA 1I81A 5GMKh 4NC6A 1Y71A 3FDRA 4BE1A 1S72T 3RERA 4ATOA 3M56A 4M7DB 2JOYA 4X34A 5A0DA 2LRQA 4BB7A 4C92C 2FHDA 2M9UA 2GCXA 3ZFJA 4MIMA 5CK9A 5IT9E 4M7AE 1VQ6T 3HL8A 3JB9F 5LJ3f 4ZTFA 4OGEA 4HCZA 3CC2A 1KQSA 4Y91A 3CCJA 1VUBA 4C8QC 4OB1B 1LOJA 5GANf 5CIUA 2XDDA 1PSFA 1O75A 1X6OA 2F69A 2RD1A 3E1SA 2DXBB 4GY5A 3OS1A 3GOXA 3CCMT 1TH7A 5A2QE 3CMEA 5GAOl 4BI8B 1ZQ1A 3PMTA 2LVMA 5DY9A 3JB9I 1YHQA 5CKHA 1DJ7B 4HCBA 3OS2A 3JB9J 3MCAB 1NJIU 3L42A 4Z02A 2KSSA 3J81E 4M75B 5DM7R 1FWZA 3AHUA 2YLBA 4FM4B 1HK9A 3OB9A 1YJ9A 3M53A 3LH0A 2OTJT 1KG1A 2FB7A 4M7DG 3RESA 1VIFA 1ZHIA 3JRZA 1Q81C 2KR6A 3FB9A 4AKIA 1OZ2A 5GMKl 2PVDB 4FSXA 4BE2A 4VUBA 4PJOA 1G3SA 3Q1JA 4ZGEB 5GAN6 1D3BB 4IUPA 1OI1A 2BIVA 3MHXA 3OSVA 3RUXA 1UGRB 5LJ3j 3OYNA 3BFMA 5CO7A 2P0QA 3CCLT 2HQXA 2ZPBB 4ZN1A 5GANj 1Q86U 2A3LA 1BIAA 2E70A 1KHCA 1I4K1 4M78D 4IUUA 5KE2A 1QVFS 4M7DD 3H6ZA 2B8AA 1BI0A 1K9MC 1QP3A 2RJEA 2DD4A 3EFRA 1G3YA 1UEBA 2QQRA 3CCUA 1K8AC 5EG2A 2G3RA 1XNIA 2DD5B 5GAOm 3KXTA 4BACA 4LDXA 2GFAA 2PUOB 4R56A 3O8VA 3E9GA 2V8IA 5CQXA 2LT1A 4F7UF 3CC4T 2EQUA 1VIEA 4M78F 3WVEB 5CKEA 4B9WA 3CCST 1JBMA 3F70A 4LD6A 4F7UE 4JDSA 2QEXA 1Q82C 3CCQA 2KMTA 4XU2A 3VU3C 2HQEA 2E64A 4C92B 1VQ4A 1JRIA 5J3BA 2DAQA 2NLUA 1UB4A 3RIRA 4PJOC 3URGA 1W2BA 1YJWA 1Q81U 3LX7A 1NPPA 2EKOA 4XU1A 1WPYA 2EQJA 2CGHA 3V7SA 1WJQA 5GMKm 1JJ2S 2EWNA 2BS4A 4C8QB 1QVFA 3MP1A 3SWNA 2DJZA 3G71A 2M16A 3V8JA 1W4SA 3G6ET 3OYIA 4OB0B 3ER0A 3QG1A 4M77G 4OGCA 4A4EA 4BY6C 4QVCA 4JRIA 1VQOT 5LJ5f 3JCMX 4A4HA 4DA4A 3M5AA 5CR2A 2EFIA 1N9SA 1Y07A 4M77A 5CKBA 4C8QE 3UPUA 5GMKe 2K57A 2MAMA 3VV0A 1MHNA 2K4YA 3GLXA 4ELYC 3I56T 3LWIA 1K9MU 3QJ6A 3QIIA 2P0PA 2ZPGB 1XTDA 2DXUA 2DTHA 4M78G 2XHCA 1M5Q1 2JNGA 2HNIA 1S72A 4HL4A 4ZN3A 2ZPFB 2Y90A 5KE3A 1OYXA 2LNVA 1EIFA 2V8KA 3HRTA 4IUVA 4M78A 1XQHA 3OS5A 5KH6A 3I55T 2QQAA 3PTAA 2RJCA 4XTVA 1VQ6A 2E6ZA 3C94A 4C0FA 3DB4A 4C5IA 3L2ZA 3RMSA 3OS0A 1WQ7A 3A8GB 2E65A 3SWNC 3UT1A 3CCMA 3KHIA 3LWHA 1VQKT 1VQ8T 5GAMd 5GAMh 5CCAA 4MMKA 3L2RA 1WJRA 3DLMA 1YBYA 3GF5A 4ZGJB 2YRVA 3LGFA 3ZBDA 5FLXE 5LJ5j 3CD6T 2PUKB 2R57A 3FEOA 2IVWA 2FL7A 4O5VA 3RKYA 2KVQG 2XIDA 3VJPA 3X25B 4EPCA 3M4YA 5IAYA 2EJ9A 2XI9A 3LLRA 1RL2A 4M77C 3EAEA 1UGPB 2XU8A 3QYBA 2M1HA 1M8VA 2OTJA 5EJCA 2JTFA 2DZCA 2PVOB 2RHXA 3CCVT 4XTXA 4DOWA 4HT8A 2XICA 3JCMb 3VUBA 4NL3A 3PIPA 2X35A 2EJGA 4E7HA 1M4ZA 4M7AF 1M9SA 3OYEA 3UDCA 2WJ9A 2MWOA 3CPWA 2CS7A 2RHIA 2E1HA 2LX9A 2RB6A 2VXEA 4M78C 2EYQA 2QFZA 3S3MA 3BY7A 3L2QA 1VQ9T 5D6YA 5J39A 3OYCA 1BI3A 5GAOr 1YCYA 3S3NA 3OYBA 3ZEHA 5HK3A 3JCMh 5LJ3g 3TEEA 3JCMd 4M7DE 4BY6B 3E19A 5L8RE 5GANg 3CC7T 2DD4B 3JB9H 2LT4A 3OW2A 4QVZA 5CVIA 2QA4T 2RJDA 5FU6C 3QHSA 3TU4K 2EJFA 4M75D 1U1TA 4MZTA 1YITT 3TW7A 2DEQA 3QPHA 5GAMg 4PJOG 3CC4A 3KBGA 1BI1A 3CCSA 3SB2A 3M54A 2MI6A 5GAN7 1X75C 4E7LA 2JUFA 4AI6A 2KMGA 3WVDB 4E7IA 4QQ6A 4M75F 4A4KA 4UC4A 3V7CA 3VKIA 1VQ5T 4M7AD 4J6YA 3FLGA 3OQ5A 3A8LB 2DIGA 3VYGA 1B34A 4M75E 4IUTA 5I21A 3JCMQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AHJ B;  2ZZD B;  2CZ6 B;  2CZ0 B;  2ZZD A;  2WSE E;  1IRE B;  2WSF E;  4ZGD B;  4OB0 B;  3QYH B;  1V29 B;  3VYH B;  2QDY B;  3QYG B;  1GXI E;  2ZPG B;  2ZPI B;  4XK8 E;  2PVG B;  3A8O B;  3QZ5 B;  2ZPF B;  3QZ9 B;  4OB2 B;  3A8H B;  3LW5 E;  2CZ1 B;  3A8G B;  2CZ7 B;  4OB1 B;  1PSF A;  4RKU E;  2DXB B;  4ZGJ B;  1QP2 A;  3QXE B;  2PUK B;  1DJ7 B;  2DXB A;  3X25 B;  3HHT B;  1UGP B;  2PVO B;  4FM4 B;  1UGS B;  2DXC B;  1PSE A;  2ZCF B;  3X26 B;  2DXC A;  2PVD B;  3X20 B;  4ZGE B;  2O01 E;  4KT0 E;  4L6V 5;  1UGQ B;  1UGR B;  2ZPE B;  2ZPB B;  5L8R E;  2DD4 B;  3A8M B;  1AHJ B;  2DPP B;  2ZPH B;  1QP3 A;  2DD4 A;  3X28 B;  1JB0 E;  2DD5 B;  4OB3 B;  2PUO B;  2D0Q B;  2WSC E;  2PU9 B;  3VYG B;  4Y28 E;  2CYZ B;  2DD5 A;  3WVE B;  3WVD B;  3X24 B;  3A8L B;  3VYG A; 
#chains in the Genus database with same CATH topology
 1BU2 A;  2FPE A;  2DTI A;  2CUD A;  4M7A A;  5GMK i;  2MMP A;  2MF2 A;  4N0A C;  4HNU A;  2K3Y A;  1U06 A;  5DLO A;  1IGQ A;  1B7T A;  4F70 B;  2WEV B;  4C5H A;  2PHG A;  1O9K A;  3P8H A;  4MZP A;  1UGV A;  2RI5 A;  2RPN A;  1SRL A;  4DEY A;  4GBQ A;  1WHM A;  5LL6 S;  2J06 A;  5GAN e;  4M78 B;  3VKG A;  2DL7 A;  4M77 E;  3CEY A;  4L59 A;  2C5O B;  2JTM A;  3VUZ A;  3L1A A;  3HTR A;  2HSE B;  3LW5 E;  2C0O A;  2BTT A;  2DEU A;  4XU0 A;  4KBM B;  2LX7 A;  3DTO A;  3V8L A;  1ZSZ A;  5FU6 B;  3MEU A;  3VS4 A;  4RKU E;  4HXJ A;  2K3X A;  1G5V A;  2LZ6 B;  2P4T A;  2OTL Q;  4EON B;  3GIB A;  5LJ5 g;  3G71 Q;  4AFS C;  4F7U G;  2P4R A;  1E9H B;  4HNT A;  2L3R A;  4ZNX A;  2LQW A;  2LQ8 A;  2VAS A;  3MP6 A;  3WXM B;  4J7I A;  1FVV B;  5GAN 3;  5HCK A;  5LJ3 h;  5GAO p;  2EYW A;  2JGZ B;  1ARK A;  3JCM e;  1CSK A;  2D6F A;  3M03 A;  4DQ2 A;  3X20 B;  2DER A;  1PNJ A;  1K76 A;  2O01 E;  1ACM B;  4XTW A;  4JX5 A;  1TD6 A;  1PD1 A;  2X4X A;  4CFU D;  2W0Z A;  1AIS B;  2HL5 C;  2KAF A;  1G2B A;  2JT4 A;  2DZ9 A;  1MV3 A;  4OMN A;  5KYY A;  4II1 A;  4RTT A;  1IZ6 A;  4JJD A;  1YJN T;  1VQ8 T;  3HFN A;  2COZ A;  2WSC E;  5KYU A;  4IUR A;  1B34 B;  1WIE A;  4A4G A;  2QDL A;  3HZJ A;  3EOC B;  2J6F A;  2WAC A;  2V26 A;  1WNL A;  2AHJ B;  3LYI A;  1U5S A;  2C6T B;  2QDJ A;  2DL5 A;  2RI3 A;  3TNI B;  3HRU A;  3E9F A;  4JRQ A;  1H1Q B;  1QWE A;  1WI7 A;  1URC B;  1UJY A;  3PGG A;  3THK A;  2K5F A;  3S6W A;  1OX8 A;  4BCN B;  4BCQ B;  3SDZ A;  3M57 A;  3FC3 A;  2JZ2 A;  4JLI A;  1QLB A;  3S3O A;  2DNU A;  4D6W A;  1VQN A;  1KQS P;  1K0X A;  4HA8 A;  4QQD A;  2ZPI B;  5GAM f;  2EPD A;  1YIJ A;  3PNW C;  4EMK C;  3A1P A;  2PNI A;  4FYY B;  4XTU A;  3OYD A;  4MML A;  1W98 B;  1HD3 A;  4F17 A;  5LJ5 h;  1K73 U;  1VQO A;  3JCM P;  4M7D A;  4JX6 A;  1QLY A;  2K6D A;  2X9H A;  5ICP B;  4J6W A;  2R7G A;  4DBQ A;  1IHW A;  3G6E Q;  3M59 A;  2LCL A;  5IXB A;  1SG5 A;  1EZZ B;  3NFC A;  2RJF A;  3HHT B;  3INZ A;  4HNV A;  1YHQ T;  2X4Y A;  2PQW A;  1Y96 B;  2O9S A;  3GBQ A;  1PSE A;  3MET A;  2FRW A;  1YJ9 T;  1ZX6 A;  1FMK A;  2F1L A;  4OVA A;  1GCQ A;  1QVG A;  2JM8 A;  1M90 U;  4L6V 5;  5GJW B;  4BE0 A;  4EOO B;  4PJM A;  2C5N B;  1H3Z A;  1D3B A;  3GTM S;  3SD4 A;  3GNF B;  3JCM V;  1VQL Q;  3PFS A;  3PO3 S;  2ZPH B;  3CD6 Q;  1NPR A;  2EYZ A;  2KYM A;  3FRN A;  1JB0 E;  2W99 A;  3QJY A;  4Q5W A;  2PU9 B;  4BCG B;  3X24 B;  2QQS A;  3V7R A;  2EQK A;  2RHY A;  3OA6 A;  4JJC A;  4XTZ A;  1UEC A;  1NJI C;  3CMA T;  1HXD A;  3UWN A;  2RA2 A;  2X3W D;  2ROT A;  2DK3 A;  1YWP A;  4RTX A;  1FMW A;  4RUG A;  2XDB A;  2WSE E;  3DOG B;  4PLI A;  1M3C A;  2E41 A;  3CPW S;  2IW6 B;  2CDT A;  5FRN A;  4DEX A;  1FX7 A;  3DLL A;  2ABL A;  2KRO A;  1OGU B;  1C0M A;  4FYV B;  5GAN 8;  1WHJ A;  2DXT A;  5KCO A;  2P84 A;  2JM9 A;  4PJO F;  1TWB A;  4F7L B;  3JB9 D;  4FT4 A;  3P8B B;  1WQW A;  4BCK B;  4E47 A;  4DBR A;  1X69 A;  5GMK h;  1KFZ A;  1BB9 A;  1NM7 A;  4A63 B;  2DVJ A;  3VS6 A;  3BLR B;  4X34 A;  4E6R A;  5A0D A;  5IT9 E;  9ATC B;  5LJ3 f;  4ZTF A;  4BCN D;  1Z9Q A;  4BCQ D;  1VUB A;  1LOJ A;  2RD1 A;  1PSF A;  2DXB B;  2BZ8 A;  2UZB B;  3GOX A;  5GAO l;  1ZSG A;  3PMT A;  2QGS A;  4HCB A;  5CKH A;  1OOT A;  2O2O A;  1ABO A;  4Z02 A;  2KSS A;  3J81 E;  4M75 B;  2E3H A;  2HZY A;  1FWZ A;  1X6G A;  2YLB A;  1HK9 A;  3OB9 A;  3EHQ A;  3LH0 A;  2OTJ T;  4PJJ A;  4DBF A;  2FB7 A;  3MKD A;  1K4U S;  3JRZ A;  1Q81 C;  5HBH B;  2JS0 A;  3FB9 A;  1WHK A;  4BCH B;  1OI1 A;  2BIV A;  3MY1 B;  2QAS A;  1UNH D;  2P0Q A;  3CCL T;  4ROC A;  4ZN1 A;  5GAN j;  3UA6 A;  1KHC A;  1FIN B;  1WDX A;  5KE2 A;  2B8A A;  3LH5 A;  1K9M C;  2RJE A;  3CCU A;  2G3R A;  3KXT A;  4PJN A;  2PUO B;  1UJ0 A;  2V8I A;  1Q82 R;  1VIE A;  2EQU A;  5CKE A;  3CCS T;  2E4H A;  3F70 A;  2GGR A;  2QEX A;  1YP5 A;  3CCQ A;  1VQ4 A;  2AIR B;  2E64 A;  1VOM A;  2DAQ A;  2NLU A;  1W2B A;  1Y57 A;  1NPP A;  1JJ2 S;  2F2X A;  4C8Q B;  7AT1 B;  1QVF A;  2RNA A;  3MP1 A;  3EGX B;  4Z89 A;  3QDF A;  2KGT A;  4OB0 B;  3OYI A;  3ER0 A;  4RTW A;  2H8H A;  4JRI A;  5LJ5 f;  2A36 A;  1JST B;  1N9S A;  1Y07 A;  3UPU A;  2K57 A;  2MYS A;  3VV0 A;  4BY1 X;  1MHN A;  2K4Y A;  4ELY C;  2M51 A;  1YJN Q;  1VQ8 Q;  2ZPG B;  1XTD A;  2DXU A;  2DTH A;  2CRE A;  4M78 G;  2JMA A;  3PVQ A;  4HL4 A;  2Y90 A;  5FWC A;  2XMF A;  1OYX A;  5CYI B;  3HRT A;  2WIP B;  1XQH A;  4R0K A;  2QQA A;  1PKD B;  1T0H A;  3DB4 A;  2QGG A;  1IRX A;  3L2Z A;  4C5I A;  3TSW A;  3A8G B;  3CCM A;  3KHI A;  2WIH B;  2EGA A;  2NUZ A;  1KD1 R;  5CCA A;  5FLX E;  2YRV A;  2PUK B;  2LCS A;  4UN0 A;  5KYX B;  2EJ9 A;  2D8J A;  1UGP B;  5LQF B;  3QYB A;  2XU8 A;  3EAE A;  1M8V A;  4HT8 A;  4OMQ A;  4XTX A;  2DRK A;  2YUP A;  4NL3 A;  4E7H A;  4M7A F;  1WZO A;  2F2C A;  3D7S B;  2CS7 A;  1X2K A;  1EX4 A;  2E1H A;  4M78 C;  1MMG A;  5D6Y A;  1C9B A;  1BI3 A;  4X1V A;  5GAO r;  1J3T A;  3ZEH A;  3JCM d;  4QT7 A;  2KEA A;  2ENM A;  3A98 A;  2DD4 B;  2RJD A;  2KXC A;  5FU6 C;  4M75 D;  4E7Z A;  2AK5 A;  5GAM g;  3EG3 A;  3KBG A;  1BI1 A;  2X1N B;  3QHW B;  3M0R A;  3M54 A;  2IVX A;  1YHQ Q;  3RGF B;  4FSS A;  1GY3 B;  3EGU A;  3OQ5 A;  3VYG A;  4IUT A;  1YJ9 Q;  3EG9 B;  3JB9 G;  2DL3 A;  2DLP A;  1SEM A;  2X3X D;  4X9D A;  3SWN B;  4HKE A;  4FYX B;  1IXD A;  1V1C A;  4EOK B;  1JO8 A;  2IG0 A;  2Z0W A;  4JLG A;  3PT9 A;  2KBT A;  1TTH B;  1N8R C;  2JMC A;  1WXU A;  4CFW B;  3H0I A;  4C0Z A;  2DMO A;  2X4J A;  2YUQ A;  5GAO q;  3VKH A;  2MK5 A;  2QQB A;  1N9R A;  3M55 A;  3I56 A;  2DF6 A;  2FYK A;  4RTU A;  1M1K R;  2CSI A;  5LJ3 e;  3J80 E;  3VYH B;  4KH1 B;  1VQN T;  3CMA A;  2BUD A;  2I53 A;  1FKM A;  3QZ5 B;  4QVD A;  3QZ9 B;  1RAG B;  1YIJ T;  3I55 A;  2K5L A;  3I5S A;  4C8Q D;  2NUP A;  4OB2 B;  2XG8 D;  1M3A A;  2WMA B;  3TQ7 P;  4YOO A;  4C92 F;  4E7K A;  2AKL A;  3NTK A;  4C92 E;  2DYI A;  3DKM A;  1Q7Y C;  4CFM B;  2LNH B;  3R6O A;  2DME A;  4EC9 B;  2HDA A;  3CXC S;  1FMV A;  4XU3 A;  2CKK A;  1PG5 B;  1OKV B;  1M1G A;  4NL2 A;  4A53 A;  1UE9 A;  4FU6 A;  2LCC A;  3BE3 A;  3H8Z A;  1IGU A;  4MDX A;  3HB9 A;  4ME7 A;  1PCX A;  4AKG A;  2GFU A;  2E12 A;  3T9N A;  1CKB A;  3OYK A;  5FW9 A;  4OMF B;  1Y7X A;  1VQ9 A;  1QVP A;  2EQI A;  3TNW B;  1LPL A;  1BK2 A;  1UGQ B;  1D1A A;  4PKC C;  1KC8 C;  1KD1 C;  3CC7 A;  2XKO C;  4JS5 A;  2RQW A;  1BU1 A;  4QQG A;  2CH4 A;  3M0U A;  1YI2 Q;  4BCM B;  4EDU A;  1YIT A;  2WFY B;  2O4X A;  4PK4 A;  3TCJ A;  4WCI A;  1O9S A;  2LDM A;  5GAN 5;  4YTL A;  3CQT A;  5CKF A;  1VQ5 A;  2QI2 A;  3AT1 B;  1G3W A;  1QWF A;  4X9C A;  2BS3 A;  3C12 A;  3NGP A;  3O5Z A;  2OTJ Q;  3CCL A;  2LJ0 A;  1AWX A;  4R55 A;  5IHN A;  3RR6 A;  1VA7 A;  5LJ5 e;  4M7D F;  3NMZ C;  4RCC A;  2JJ9 A;  5DQV A;  2J7I A;  4BCF B;  1WJS A;  4BD3 A;  3BHU B;  5D6X A;  1OEB A;  3VS5 A;  3I35 A;  3EFS A;  4HT9 A;  2FVU A;  1YCS B;  4RCB A;  1M1F A;  1RUW A;  2X4W A;  2KNB B;  4OP0 A;  4TVR A;  1LJO A;  4Z88 A;  3OYG A;  1JEG A;  1AD5 A;  1KSW A;  4HCK A;  1QKX A;  3I5R A;  2YUN A;  2VGN A;  1WHL A;  3RBB B;  4BI3 A;  3OMG A;  3OYM A;  1BIB A;  1GFC A;  3CCS Q;  5HBE B;  1I0C A;  4BY7 X;  5FRM A;  2EUF A;  4TTH A;  2G77 A;  1ZSZ B;  1VYW B;  2RN8 A;  4LOC A;  1YNZ A;  3V8K A;  1PRM C;  5AYF A;  3VS3 A;  3EJ1 B;  2VYT A;  4ZTJ A;  3QXE B;  1M1K C;  1H92 A;  1GUX A;  4PL6 A;  3G4S A;  2HBP A;  2RQR A;  2R58 A;  2E5K A;  4M77 F;  1GRI A;  1RAI B;  4J9F A;  4M75 G;  1W6X A;  5GAM j;  1ZBX A;  1UGS B;  3FIF A;  3OBW A;  2BZX A;  4MZM A;  2EGC A;  1YJW Q;  4J6X A;  2V1R A;  1X6B A;  2ZPE B;  1QW1 A;  1H24 B;  2AZS A;  3JCM c;  3PE0 A;  2MIO A;  8AT1 B;  3F5X B;  2DL4 A;  3RKW A;  3A8M B;  2YRC A;  5KYY B;  4Z8A A;  2OTL A;  3M0Q A;  3CCE A;  3MEW A;  5KYU B;  3X28 B;  1K1Z A;  3VRY A;  2VUB A;  1NYF A;  4LDV A;  1P92 A;  4OB3 B;  2RQU A;  1PD0 A;  3CCU T;  1D1B A;  4C0G A;  5ACB A;  3REB B;  4B9X A;  2DD5 A;  3QBY A;  4KUL A;  4M75 C;  2O9V A;  2CP0 A;  1OZ3 A;  2QEX T;  3CCQ T;  4LDU A;  2BKD N;  1NJI R;  1VQ4 T;  2R5M A;  4C92 A;  4C8Q G;  2FRY A;  2AT1 B;  4BCM D;  4OGR B;  2GF7 A;  4BBR M;  4NS5 A;  2YDL A;  3L2W A;  2B86 A;  4RMO A;  3QDR B;  4LDY A;  4ZGD B;  4FT2 A;  4BI4 A;  3GPL A;  2XD0 A;  4OMO A;  3QYH B;  3QHR B;  1AVZ C;  3JAM E;  5KCH A;  4JRP A;  4LE9 A;  3OMC A;  4LUE A;  2ZGW A;  4CFN B;  3PVL A;  4YOZ A;  3BHT B;  4LDW A;  1GXI E;  3EGD A;  2VVK A;  4P5N A;  1G3T A;  5KYW A;  1UHC A;  1IHV A;  4XK8 E;  5DQW A;  3OW2 S;  3M0S A;  5I22 A;  1C1A A;  4J9B A;  4BDZ A;  2CUB A;  2OAW A;  1Y71 A;  4M7D B;  2EGE A;  2JOY A;  4BB7 A;  3ZFJ A;  4OGE A;  1D0X A;  2C5X B;  1KQS A;  5IHI A;  4C8Q C;  1B07 A;  4OB1 B;  3E1S A;  1X6O A;  2F69 A;  3CPW P;  3CCM T;  2HQH A;  4EOQ B;  1WXT A;  2CT4 A;  3CME A;  1F1B B;  2LP5 A;  1ZQ1 A;  4J9I A;  1X2Q A;  2BKZ B;  3DDP B;  1DJ7 B;  3ZL7 C;  1SHG A;  1B3Q A;  3MCA B;  1AZG B;  4YC3 B;  2EKH A;  1Q81 R;  1JXM A;  4AG1 C;  1VIF A;  1ZHI A;  4LNP A;  4AKI A;  1OZ2 A;  1VQN Q;  2PVD B;  1LVK A;  4FSX A;  1OIU B;  3BLH B;  5GAN 6;  1D3B B;  4IUP A;  5LJ3 j;  3OSV A;  2H3E B;  3OYN A;  4F6S B;  1OPK A;  2HQX A;  1Q86 U;  2A3L A;  2KT1 A;  1BIA A;  1VQO Q;  1K9M R;  1KJW A;  4M78 D;  4IUU A;  3H6Z A;  1G3Y A;  1UEB A;  6AT1 B;  1XNI A;  1I1J A;  1PKT A;  2GFA A;  4AMC A;  3O8V A;  1R0C B;  2LT1 A;  4F7U F;  1G8X A;  1JBM A;  4LD6 A;  4F7U E;  1IO6 A;  2QAZ A;  1JRI A;  2F2V A;  4PJO C;  5I11 A;  3V7S A;  2EQJ A;  2BS4 A;  3VS7 A;  1NLO C;  3V8J A;  1UFF A;  4AG2 C;  3VS2 A;  1AOJ A;  3MIA B;  4M77 A;  2L0A A;  4C8Q E;  4OMP A;  1RLP C;  3I56 T;  2YSQ A;  3QJ6 A;  4AFU C;  3QII A;  4FW1 A;  1UG1 A;  1M5Q 1;  2JNG A;  1S72 A;  4F14 A;  4ZN3 A;  5IH2 A;  2HEQ A;  5KH6 A;  1JJ2 P;  3I55 T;  4J9D A;  1VQ6 A;  1AWJ A;  1OPL A;  3OS0 A;  1RI9 A;  2DJQ A;  3SWN C;  3UT1 A;  1TFB A;  1VQK T;  1MV0 B;  3TNH B;  4MMK A;  3LGF A;  3ZBD A;  5LJ5 j;  2R57 A;  3VJP A;  3RKY A;  4EPC A;  5IAY A;  3NHN A;  3M4Y A;  3OY9 A;  2XI9 A;  1RL2 A;  2FG0 A;  1GH6 B;  2PVO B;  4ELL A;  1D09 B;  3PIP A;  5IHY A;  2EJG A;  2C0I A;  2SEM A;  2WJ9 A;  2J6O A;  2JW4 A;  2LX9 A;  2EYQ A;  2QFZ A;  4IMY B;  3L2Q A;  5J39 A;  1VQ9 T;  1H1R B;  3IQL A;  4JJB A;  5HK3 A;  3JCM h;  2O88 A;  2DRM A;  3E19 A;  5L8R E;  3CC7 T;  3EG1 A;  2QA4 T;  3MY5 B;  3QHS A;  3TU4 K;  4MZT A;  1U1T A;  1YIT T;  3POM A;  3QPH A;  1H3H A;  5IDN B;  4RTV A;  1Q95 G;  1SSH A;  3CC4 A;  1ZBJ A;  3SB2 A;  1TOV A;  2JUF A;  4AI6 A;  2KMG A;  2DBM A;  1VQ5 T;  1SKU B;  3V7C A;  2YWW A;  3EG0 A;  4BE2 A;  2BE9 B;  4Y92 A;  4A4F A;  1ZP2 A;  1PWT A;  2UZD B;  4RTZ A;  2YRD A;  5D6W A;  3TRE A;  1N8R R;  2D0N A;  3UF4 A;  4WF2 A;  1NEG A;  1QVG S;  2AZV A;  3MEA A;  1BCO A;  2WXV B;  2DO3 A;  3CC2 T;  1M8M A;  2IIM A;  1P5E B;  3EFO A;  3CCU Q;  2HAX A;  2DBK A;  2EYX A;  3PMI A;  2GQV A;  2GQI A;  2QTX A;  2K2M A;  4HVV A;  5EFQ B;  1RLQ C;  3BW1 A;  5GAM e;  3FJ5 A;  1UNG D;  2UUE B;  3BG9 A;  3FJP A;  2QEX Q;  4M7A C;  1Q7Y R;  2F5K A;  1VQ4 Q;  5A0G A;  1TUD A;  4FL6 A;  3JV3 A;  2HKQ B;  2ECZ A;  3N5B B;  2VV5 A;  3OSS C;  5GMK j;  1OKW B;  2RQV A;  1I8F A;  4IKF A;  2RF0 A;  1OU8 A;  4KUI A;  2CP3 A;  3CCV A;  3J7A F;  3G4S T;  2KY9 A;  4KH0 B;  2LQK A;  1D1C A;  4F7U A;  1NZ9 A;  4F7S B;  3EH2 A;  2CP2 A;  1GCP A;  2B9R A;  3DL1 A;  5GAN d;  2LJ3 A;  2DXC A;  4KUD K;  3QKJ A;  1T3S A;  2VB6 A;  5GJV B;  1KC8 R;  3O0G D;  3G33 B;  3EHR A;  1G3N C;  5AT1 B;  1PM3 A;  1ZSZ C;  3KUF A;  3CXC P;  4ROE A;  4BDY A;  3JSC A;  2QF7 A;  5CAI A;  1H27 B;  2AKK A;  4N4I A;  1AHJ B;  1D0Z A;  2DPP B;  1X01 A;  2QQ9 A;  2OTL T;  5IDP B;  2QQ8 A;  3CCE T;  3G71 T;  4PJO B;  1NLP C;  4MDW A;  2RK1 A;  4N4H A;  1R77 A;  3VYG B;  4LDX A;  2DKG A;  2K5I A;  4Y28 E;  2EQM A;  5C6S A;  1TSF A;  2DTO A;  4EMK A;  1K73 C;  5I2M A;  4CC2 A;  1RAC B;  2UZL B;  1WYX A;  5I2S A;  1VQ7 A;  3EG2 A;  4BBS M;  3QSU A;  2CCI B;  3JCM J;  2DA9 A;  3BDU A;  3A5Z B;  3HPW A;  3M4G A;  1H1S B;  2CZ0 B;  2ZZD A;  3H0F A;  1Q86 C;  1IRE B;  2F5T X;  2W2H A;  2EVR A;  2OX7 A;  5BNJ B;  1NE8 A;  5IN1 A;  2OAU A;  3CBM A;  4HCC A;  1KQ2 A;  1JU5 C;  2GTJ A;  2QYZ A;  2K7A A;  2L89 A;  4KRC B;  4F04 B;  1W1F A;  4XAX B;  3OYH A;  2YUO A;  1QMC A;  4N4G A;  2CJM B;  3H0H A;  2NUP B;  2KE9 A;  1M90 C;  2QK0 A;  1AT1 B;  3M0T A;  4J5Y A;  5FU7 B;  1VQM A;  4J83 A;  1MGQ A;  3RNJ A;  3BLQ B;  2R5A A;  2E5Q A;  2CZ1 B;  2W10 A;  4CI0 C;  2CZ7 B;  4NOY A;  2D9T A;  2KQW A;  2RI2 A;  1PKS A;  2L3P A;  3L2V A;  4BUG A;  1VYT A;  1W2B S;  1N4M A;  3QUI A;  4JZ3 A;  3CME T;  3GP8 A;  3JCM f;  1UTI A;  4JS4 A;  1T0J A;  2QXF A;  2UZE B;  2PK2 A;  2C0T A;  2KYB A;  3I9Q A;  4KGZ B;  2WMB B;  2HKN A;  1K8A U;  3C4S A;  1VQK A;  3CMA Q;  4M78 E;  2GNC A;  2BPM B;  5HQ0 B;  1AEY A;  4M7D C;  4JX4 A;  2JS2 A;  2K2V A;  4QW2 A;  4J9H A;  2SRC A;  2O4X B;  2V22 B;  4KRD B;  2HD0 A;  1VQP A;  3OYA A;  3CCR A;  2EAY A;  1GBQ A;  2KDS A;  1SRM A;  5FRO A;  2RHU A;  3RKX A;  5DLQ E;  2ROL A;  2HMA A;  5GAN 2;  4PFO A;  1H64 1;  1RAD B;  3C95 A;  2D0Q B;  2M02 A;  3QWX X;  2IW8 B;  4EOI B;  3EID B;  2NUT A;  1F5Q B;  1HSQ A;  2LTO A;  5C0M A;  2COY A;  2HCK A;  1GCQ C;  1EFN A;  2YXY A;  4AKH A;  4C0D B;  3K7A M;  2QA4 A;  4MFD A;  4HLQ A;  2VC8 A;  1VQ9 Q;  4C5G A;  4ESR A;  1WLP B;  2RO0 A;  1YFN A;  4BCJ B;  4ELZ C;  5GAN 4;  1YI2 A;  4O6J A;  4A54 A;  4PJO D;  3CC7 Q;  3ME9 A;  2GTO A;  2CP6 A;  2PTK A;  1VQL T;  4L5G A;  2I2L A;  2DIQ A;  2MOX A;  2GBQ A;  2QGF B;  1YIT Q;  1M2V A;  1GL5 A;  2IN3 A;  3P8D A;  2D1X A;  3MP8 A;  4QKU A;  4M7A B;  1KQ1 A;  2KRM A;  4EMH A;  4Z6Y A;  1TG0 A;  4MFE A;  4GLK A;  3A8O B;  2L8D A;  4EOR B;  1VQ5 Q;  1E7P A;  4NC6 A;  3FDR A;  4BE1 A;  1S72 T;  2KRS A;  3M56 A;  4GLM A;  1HJD A;  1O9K B;  4J9G A;  5HBJ B;  2LRQ A;  3CCL Q;  2M9U A;  5CK9 A;  1RAH B;  1H28 B;  1VQ6 T;  3JB9 F;  2DM1 A;  2CH4 W;  2G6F X;  3TSZ A;  3CC2 A;  3CCJ A;  1NJI U;  4AFZ C;  2WPA B;  5CIU A;  2XDD A;  4GY5 A;  3OS1 A;  1GUX B;  1H26 B;  4ORZ A;  4HVW A;  1TH7 A;  3E2U A;  5A2Q E;  2PJQ A;  4BI8 B;  2LVM A;  4PFP A;  3JB9 I;  4D8K A;  2J6K A;  4YOS A;  3L42 A;  2K79 A;  2J05 A;  5ECA A;  3AHU A;  4FM4 B;  4F7J B;  3QWY A;  1X43 A;  3OW2 P;  2LQN A;  1MMD A;  2KR6 A;  3ULR B;  4I3Z B;  1G3S A;  3VS1 A;  3RUX A;  1UGR B;  4LN2 A;  3BFM A;  5IF1 B;  2ZPB B;  2E70 A;  4OML A;  4NST B;  1KIK A;  3MI9 B;  2WHB B;  3EFR A;  4F6U B;  2QQR A;  2DD5 B;  4LXC A;  1WA7 A;  4R56 A;  1D3U B;  3E9G A;  1E6G A;  4F16 A;  3U23 A;  3G4S Q;  3CC4 T;  4B9W A;  1VYV A;  2IW9 B;  1TUC A;  1WFW A;  1H25 B;  4XU2 A;  3VU3 C;  2HQE A;  4C92 B;  5J3B A;  1UB4 A;  3RIR A;  1YJW A;  1Q81 U;  3LX7 A;  2I40 B;  1WPY A;  4FYW B;  2CGH A;  4D8D A;  1WJQ A;  5GMK m;  1ZA1 B;  2L3S A;  2QG9 B;  2DJZ A;  3G71 A;  1W4S A;  2KR3 A;  4OGC A;  4QVC A;  4FW2 A;  1OQK A;  3JCM X;  4A4H A;  3M5A A;  2EFI A;  3EGD B;  5CKB A;  2VKN A;  5KYW B;  5GMK e;  1GBR A;  1K9M U;  3CCE Q;  3LWI A;  2P0P A;  2XHC A;  2HNI A;  4JPB W;  3SHW A;  2LNV A;  1EIF A;  2V8K A;  3C0C A;  1H4L D;  4M78 A;  1OX9 A;  3TVT A;  4XTV A;  2E6Z A;  3C94 A;  4PFZ A;  2F2W A;  4EOM B;  2E65 A;  2DET A;  3LWH A;  5GAM d;  3KFV A;  4CFV B;  3L2R A;  1KK7 A;  1WJR A;  2BZY A;  3FEO A;  3R6N A;  2IVW A;  2FL7 A;  4M7A D;  2XID A;  3X25 B;  3LLR A;  2M1H A;  5IXF A;  5EJC A;  2DZC A;  2RHX A;  3CCV T;  4DOW A;  1BCM A;  2LJ1 A;  5FWB A;  2XIC A;  3RDV A;  3JCM b;  2X35 A;  1LCK A;  1QCO A;  3OYE A;  3UDC A;  2C5V B;  1TS9 A;  3CPW A;  2MWO A;  4BXX X;  2O31 A;  3NPF A;  1MMN A;  2RB6 A;  2VXE A;  3S3M A;  2PK9 B;  2RQT A;  1E7O A;  1YCY A;  1HYO A;  4BY6 B;  2W9Z A;  3MJX A;  1ZUY A;  5GAN g;  2M0Y A;  1XO2 A;  2DIL A;  2LT4 A;  5CVI A;  3TW7 A;  2DEQ A;  1VOL A;  1M27 C;  4PJO G;  3CME Q;  4E2F B;  1QKW A;  2MI6 A;  5GAN 7;  1NEB A;  1AD6 A;  3WVD B;  1YIJ Q;  1GFD A;  4QQ6 A;  4M75 F;  4A4K A;  4UC4 A;  3NDQ A;  3VKI A;  1B34 A;  4M75 E;  1IB8 A;  5I21 A;  3JCM Q;  1K8A C;  5HY6 A;  5LMK B;  3G7Z A;  4OF1 A;  2KI7 A;  2Y4Y A;  1VQ7 T;  4EOL B;  1ENW A;  1OUL A;  4PLL A;  5HKC A;  1K0S A;  2CP7 A;  3CBP A;  3G6E A;  2L2P A;  3L2U A;  2ZAE A;  1I5L A;  4E7J A;  2DX1 A;  2YT6 A;  4M77 B;  2VXF A;  3JCM g;  2E10 A;  3DDQ B;  2PMI B;  2V8J A;  1VIN A;  2DVE A;  3JCM W;  2QDY B;  1OL2 B;  4G6L B;  4C92 D;  1WX6 A;  1BBZ A;  5A0L A;  3BG5 A;  4LD9 K;  3SEM A;  5M9O A;  4ELJ A;  3A8H B;  1NYG A;  1PHT A;  2MPX C;  2DYB A;  4CRI A;  3MEV A;  3RMQ A;  3HKS A;  1VQL A;  4IUQ A;  4BCO B;  1VQM T;  4ROD A;  1ZUK A;  2FZK B;  5CQY A;  5EC7 A;  4C8Q F;  3CD6 A;  4FX3 B;  1QVG P;  1KHI A;  3NTI A;  4C5E A;  3CPF A;  4J8O A;  4V2S A;  2XDP A;  2QTV A;  2X51 A;  1N8R U;  4F6W B;  1OIY B;  1WGS A;  2YHT A;  4PNO A;  3G1J A;  1JJ2 A;  1TXQ A;  5LJ3 d;  3H4C A;  2P0K A;  1Q82 U;  3HBL A;  4CC3 A;  2ZCF B;  3X26 B;  5GAN h;  1Y96 A;  2MCN A;  1M3B A;  1H1P B;  3H9N A;  3HFO A;  1U3O A;  1S72 Q;  3LQ5 B;  1JSU B;  1SSF A;  1H8K A;  3MPU B;  5FU7 C;  3CBO A;  2LC4 A;  2MWP A;  1VQ6 Q;  1QMZ B;  1BYM A;  4M6V A;  2FPD A;  1E6H A;  1Q7Y U;  4J9C A;  4CC7 A;  1VQP T;  1UUE A;  3CCR T;  4JJN K;  2VWF A;  3SFM A;  3UAT A;  3UA7 A;  2CCH B;  4M7D D;  3GNG A;  5J26 A;  4EMG A;  1YN8 A;  4HVU A;  1KQS S;  1I5O B;  1D0Y A;  2CYZ B;  2A7Y A;  2JTE A;  2CT3 A;  3TN8 B;  1K73 R;  2ESW A;  1TUG B;  1A0N B;  1N6A A;  4N0A A;  4AFQ C;  1K9A A;  4IIM A;  3QO3 A;  4PJO E;  2OI3 A;  1FYN A;  2RM4 A;  1Q86 R;  1MMA A;  1AZE A;  3BHV B;  2COW A;  1WXB A;  2A08 A;  1W70 A;  2EIF A;  1KC8 U;  1KD1 U;  1AWO A;  1YI2 T;  3QWL A;  3OYF A;  4EOP B;  2ED1 A;  1ZA2 B;  2EBP A;  3EFO B;  4B6M A;  1TU0 B;  4M7A G;  3QYG B;  2L5Q A;  1M90 R;  5I5Z B;  2YLC A;  5IHK A;  3BDL A;  2E6N A;  2PVG B;  3CC4 Q;  4BCI B;  4RG8 A;  4OR5 B;  3M58 A;  4F7N B;  3H41 A;  1SHF A;  4XQ3 A;  4FIB A;  5LJ5 d;  1X27 A;  1M2O A;  5D7U A;  4FCY A;  4M4Z A;  4M77 D;  4C0D C;  2K9G A;  2M0O A;  4XTY A;  2Y4X A;  4E7S A;  3CCJ T;  4KGX B;  1Z9Z A;  1QP2 A;  2E3I A;  1U8R A;  1XJW B;  3LGL A;  1R0B G;  2DXB A;  4F7U B;  4Y72 B;  1I07 A;  2K3B A;  1WHG A;  1R8O B;  2RK2 A;  3OYL A;  2RHZ A;  1FXX A;  4K11 A;  4EIK A;  2G9X B;  2DXC B;  4DBH A;  3NTH A;  4M75 A;  1BI2 A;  3CCQ Q;  2JVV A;  2EW3 A;  2XK0 A;  1PC0 A;  3HP9 A;  1Y0M A;  2H3J A;  4KT0 E;  4BCP B;  5CKD A;  5GAO n;  1S1N A;  2ED0 A;  2VGM A;  3DJB A;  1PRL C;  4EOJ B;  3DB3 A;  2RH2 A;  1W2B P;  3HRS A;  3TW6 A;  3OYY A;  1YJN A;  1VQ8 A;  1BKB A;  3HO8 A;  4CRL B;  2KT8 A;  1QVF P;  1M1K U;  3ASK A;  4OMM A;  1LNX A;  3MO8 A;  4EMK B;  3OBY A;  3BG3 A;  2JN0 A;  3PIO A;  2EYY A;  4JRK A;  3CCV Q;  1OU9 A;  3CXC A;  1SPK A;  4C92 G;  1QQJ A;  4II5 B;  1U1S A;  2NYS A;  2BS2 A;  1N27 A;  2ZZD B;  2FO0 A;  1YJW T;  4QSH A;  4J7F A;  2CZ6 B;  5CEI B;  3CCM Q;  4C8Q A;  2WSF E;  3EGX A;  4JUV A;  3M9Q A;  1ZLM A;  4RG2 A;  2IPO B;  2KK4 A;  3QYE A;  2HSP A;  4ATO A;  4DOV A;  3M0P A;  2A28 A;  3OYJ A;  3HSB A;  1V29 B;  1JXO A;  1RAE B;  1RI0 A;  2C06 A;  1ABQ A;  1XOV A;  5HK0 A;  1QCN A;  1I81 A;  3RER A;  5L2W B;  2NWM A;  4C92 C;  2FHD A;  1KXU A;  2GCX A;  4MIM A;  4M7A E;  3HL8 A;  4HCZ A;  2A0F B;  1VQ7 Q;  4Y91 A;  2OJ2 A;  5GAN f;  5HNB B;  1O75 A;  4ANJ A;  1MUZ A;  2ATC B;  5DY9 A;  1YHQ A;  2CSQ A;  3OS2 A;  3JB9 J;  5DM7 R;  1JOW A;  1CKA A;  1YJ9 A;  3M53 A;  2RMO A;  5KYX A;  1KG1 A;  4AT1 B;  4M7D G;  3RES A;  3B57 A;  1M30 A;  2HL3 A;  2L3Q A;  5GMK l;  2KXD A;  4VUB A;  1AWW A;  4PJO A;  3Q1J A;  4ZGE B;  1JQQ A;  1NBE B;  2DE0 X;  1QCF A;  3MHX A;  4CC4 B;  5CO7 A;  1VQM Q;  1I4K 1;  5HVY B;  1SF9 A;  1QVF S;  1OI9 B;  1BI0 A;  1MNE A;  1QP3 A;  2DD4 A;  3I56 Q;  5EG2 A;  5FGK B;  2DFU A;  5GAO m;  4BAC A;  2NUT B;  4CXA B;  5CQX A;  2I0N A;  4M78 F;  3VS0 A;  3WVE B;  1OL1 B;  1Q82 C;  4JDS A;  2KMT A;  3I55 Q;  1C6V X;  8ATC B;  3URG A;  2EKO A;  4XU1 A;  2EWN A;  2C4G B;  3EG9 A;  2JXB A;  4LUD A;  1VQK Q;  4RTY A;  3SWN A;  2DL8 A;  3EH1 A;  2M16 A;  4EC8 B;  3G6E T;  4M77 G;  3QG1 A;  4A4E A;  4BY6 C;  1M2V B;  2CP5 A;  1VQO T;  4DA4 A;  5CR2 A;  1VQP Q;  1VYU A;  1N5Z A;  3CCR Q;  2MAM A;  3GLX A;  5L23 A;  1OV3 A;  2D8H A;  2FZC B;  5KE3 A;  2ZPF B;  1WHH A;  5KYN A;  2W96 A;  4IUV A;  1MND A;  1UHF A;  1RAA B;  3OS5 A;  4CFX B;  3PTA A;  2RJC A;  2FEI A;  4JZ4 A;  1YWO A;  4C0F A;  3RMS A;  1WQ7 A;  1NG2 A;  3REA B;  2W9F A;  2V1Q A;  4EOS B;  2QA4 Q;  5GAM h;  1G83 A;  1RAB B;  3DLM A;  1YBY A;  3GF5 A;  4ZGJ B;  4CFU B;  3CD6 T;  4WTO B;  2PZ1 A;  4O5V A;  3VRZ A;  2KVQ G;  1T3L A;  4M77 C;  2OTJ A;  2JTF A;  2HBW A;  1V76 A;  1UDL A;  4IIO A;  3VUB A;  1M4Z A;  4J9E A;  1M9S A;  2FPF A;  2LW4 A;  2RHI A;  3BY7 A;  1RAF B;  3OYC A;  3S3N A;  1UNL D;  4KRT A;  3OYB A;  5LJ3 g;  3TEE A;  4M7D E;  1ZUU A;  3OW2 A;  3JB9 H;  4QVZ A;  2EJF A;  3CC2 Q;  3CCJ Q;  4PJL A;  2A37 A;  3CCS A;  4KGV B;  1JKW A;  1X75 C;  2KRN A;  2FZG B;  4E7I A;  2LMJ A;  2BE7 D;  3FLG A;  4J6Y A;  3A8L B;  2DIG A;  1K8A R;  4E7L A; 
#chains in the Genus database with same CATH homology
 2DTI A;  5HY6 A;  3G7Z A;  4OF1 A;  4A4F A;  3JB9 G;  4X9D A;  3SWN B;  4M7A A;  5GMK i;  2MMP A;  4HKE A;  2MF2 A;  2Y4Y A;  4N0A C;  1VQ7 T;  2IG0 A;  5HKC A;  4HNU A;  4JLG A;  4PLL A;  2K3Y A;  5D6W A;  3TRE A;  3PT9 A;  3CBP A;  3G6E A;  5DLO A;  3L2U A;  1N8R C;  4C5H A;  4WF2 A;  4E7J A;  1I5L A;  4M77 B;  3P8H A;  2VXF A;  4MZP A;  3JCM g;  4C0Z A;  2X4J A;  1QVG S;  2RI5 A;  2E10 A;  5GAO q;  3VKH A;  3MEA A;  2QQB A;  2V8J A;  1N9R A;  3M55 A;  3I56 A;  2DO3 A;  2FYK A;  3CC2 T;  4PJO B;  5LL6 S;  5LJ3 e;  3J80 E;  2DVE A;  3JCM W;  3VYH B;  2QDY B;  4C92 D;  5GAN e;  2HAX A;  1VQN T;  3CMA A;  3PMI A;  2BUD A;  2GQV A;  4M78 B;  1FKM A;  2QTX A;  5A0L A;  3BG5 A;  3VKG A;  3QZ5 B;  4M77 E;  3CEY A;  4QVD A;  3QZ9 B;  1YIJ T;  4LD9 K;  3I55 A;  2K5L A;  4C8Q D;  4L59 A;  2JTM A;  4OB2 B;  3A8H B;  4ELJ A;  2XG8 D;  3BW1 A;  3VUZ A;  5GAM e;  3L1A A;  5M9O A;  3BG9 A;  4CRI A;  3FJP A;  3MEV A;  3LW5 E;  4C92 F;  4E7K A;  4M7A C;  2F5K A;  3NTK A;  3RMQ A;  5A0G A;  4XU0 A;  3HKS A;  1VQL A;  4KBM B;  4IUQ A;  4C92 E;  1VQM T;  3DKM A;  1Q7Y C;  4FL6 A;  3V8L A;  3N5B B;  3R6O A;  5CQY A;  4C8Q F;  2VV5 A;  3OSS C;  5FU6 B;  5GMK j;  3MEU A;  3CD6 A;  1YJN T;  3CXC S;  4RKU E;  2K3X A;  1KHI A;  3NTI A;  2P4T A;  4XU3 A;  3CPF A;  4J8O A;  4C5E A;  1G5V A;  4V2S A;  2XDP A;  1I8F A;  2CKK A;  4IKF A;  1M1G A;  4NL2 A;  4A53 A;  5LJ5 g;  1N8R U;  3GIB A;  4KUI A;  1WGS A;  2YHT A;  4FU6 A;  4PNO A;  2LCC A;  3H8Z A;  4F7U G;  3CCV A;  1JJ2 A;  3J7A F;  4HNT A;  2L3R A;  3G4S T;  2LQ8 A;  4MDX A;  2KY9 A;  3MP6 A;  3WXM B;  4J7I A;  3HB9 A;  2LQK A;  4ME7 A;  5GAN 3;  4F7U A;  4AKG A;  2GFU A;  1NZ9 A;  5LJ3 d;  5LJ3 h;  5GAO p;  3H4C A;  2E12 A;  2P0K A;  3T9N A;  1Q82 U;  3HBL A;  2ZCF B;  3JCM e;  3X26 B;  3DL1 A;  5GAN h;  5GAN d;  3OYK A;  4KUD K;  2DXC A;  1Y96 A;  1Y7X A;  3QKJ A;  1QVP A;  4OMF B;  4DQ2 A;  1VQ9 A;  2D6F A;  3X20 B;  2O01 E;  3HFO A;  1UGQ B;  4XTW A;  1SSF A;  4JX5 A;  4PKC C;  5FU7 C;  2X4X A;  1KC8 C;  1KD1 C;  3CBO A;  3CC7 A;  2XKO C;  2LC4 A;  4JS5 A;  3KUF A;  2MWP A;  4QQG A;  4BDY A;  3JSC A;  2QF7 A;  5CAI A;  1BYM A;  4M6V A;  4N4I A;  2KAF A;  4EDU A;  1Q7Y U;  1YIT A;  1AHJ B;  2O4X A;  2DPP B;  1X01 A;  3TCJ A;  2DZ9 A;  1VQP T;  2QQ9 A;  3CCR T;  4JJN K;  2OTL T;  3SFM A;  2QQ8 A;  3CCE T;  4II1 A;  1IZ6 A;  1O9S A;  2LDM A;  5GAN 5;  3GNG A;  3HFN A;  4YTL A;  3G71 T;  5J26 A;  4MDW A;  2RK1 A;  4N4H A;  5CKF A;  4EMG A;  1VQ5 A;  2QI2 A;  2WSC E;  3OY9 A;  3VYG B;  1G3W A;  4IUR A;  2K5I A;  1B34 B;  2DKG A;  2CYZ B;  2BS3 A;  2A7Y A;  2EQM A;  3C12 A;  4X9C A;  4Y28 E;  4A4G A;  5C6S A;  2DTO A;  3HZJ A;  4EMK A;  3CCL A;  1K73 C;  5I2M A;  4R55 A;  1N6A A;  4N0A A;  5LJ5 e;  4M7D F;  2WAC A;  1WNL A;  4RCC A;  2AHJ B;  5I2S A;  3LYI A;  3QO3 A;  1KQS S;  1VQ7 A;  4BBS M;  2QDJ A;  3QSU A;  1WJS A;  4BD3 A;  4PJO E;  3JCM J;  2RI3 A;  3BDU A;  3HRU A;  3A5Z B;  3E9F A;  2RM4 A;  5D6X A;  3HPW A;  4JRQ A;  3M4G A;  2CZ0 B;  2ZZD A;  3EFS A;  1Q86 C;  1IRE B;  3PGG A;  4HT9 A;  2FVU A;  2F5T X;  2K5F A;  3S6W A;  1NE8 A;  4RCB A;  2OAU A;  1M1F A;  2EIF A;  3CBM A;  5IN1 A;  1KC8 U;  1YI2 T;  1KD1 U;  4HCC A;  1KQ2 A;  3QWL A;  2X4W A;  3SDZ A;  3M57 A;  3OYF A;  3FC3 A;  4OP0 A;  4TVR A;  1LJO A;  2L89 A;  2JZ2 A;  3OYG A;  4JLI A;  1QLB A;  3S3O A;  4D6W A;  4XAX B;  1VQN A;  4M7A G;  3QYG B;  4HA8 A;  3OYH A;  4QQD A;  2ZPI B;  2L5Q A;  4N4G A;  5GAM f;  2VGN A;  1YIJ A;  2YLC A;  4BI3 A;  3BDL A;  3OYM A;  3OMG A;  2E6N A;  2PVG B;  1BIB A;  1M90 C;  3PNW C;  4RG8 A;  4EMK C;  4XTU A;  3M58 A;  3OYD A;  4MML A;  5FRM A;  4J5Y A;  5FU7 B;  4XQ3 A;  4FIB A;  2G77 A;  5LJ5 h;  4J83 A;  5LJ5 d;  1VQM A;  1MGQ A;  1K73 U;  1VQO A;  3JCM P;  4M7D A;  2R5A A;  2E5Q A;  2CZ1 B;  4JX6 A;  4M77 D;  4CI0 C;  4C0D C;  2CZ7 B;  2M0O A;  4NOY A;  4LOC A;  2D9T A;  4XTY A;  2Y4X A;  3V8K A;  2KQW A;  2RI2 A;  5AYF A;  3CCJ T;  4J6W A;  3L2V A;  1QP2 A;  2VYT A;  4ZTJ A;  3QXE B;  1U8R A;  1M1K C;  4BUG A;  3M59 A;  1W2B S;  2LCL A;  3QUI A;  3LGL A;  3NFC A;  2DXB A;  2HBP A;  2RJF A;  2R58 A;  4M77 F;  3HHT B;  4PL6 A;  3INZ A;  3CME T;  4F7U B;  4HNV A;  3GP8 A;  1YHQ T;  1R8O B;  4M75 G;  3JCM f;  2X4Y A;  2PQW A;  2RK2 A;  3OYL A;  2RHZ A;  1FXX A;  5GAM j;  4JS4 A;  1ZBX A;  2QXF A;  1UGS B;  2DXC B;  1Y96 B;  3NTH A;  1PSE A;  3FIF A;  4M75 A;  3MET A;  3OBW A;  1YJ9 T;  1BI2 A;  2JVV A;  2XK0 A;  4MZM A;  1K8A U;  3C4S A;  3HP9 A;  4OVA A;  1QVG A;  1VQK A;  2H3J A;  4KT0 E;  5CKD A;  4J6X A;  5GAO n;  1M90 U;  4L6V 5;  4M78 E;  4BE0 A;  1H3Z A;  2ZPE B;  1QW1 A;  3JCM c;  2VGM A;  4M7D C;  4JX4 A;  2K2V A;  1D3B A;  4QW2 A;  2O4X B;  3SD4 A;  3GNF B;  3JCM V;  2HD0 A;  1VQP A;  3RKW A;  3OYA A;  3CCR A;  3A8M B;  2EAY A;  3DB3 A;  2KDS A;  2RH2 A;  5FRO A;  2OTL A;  3PFS A;  3HRS A;  2RHU A;  3CCE A;  3TW6 A;  3OYY A;  2ZPH B;  3RKX A;  1BKB A;  3HO8 A;  1YJN A;  1VQ8 A;  1NPR A;  3MEW A;  5DLQ E;  3X28 B;  5GAN 2;  3FRN A;  2VUB A;  4LDV A;  1H64 1;  1JB0 E;  1P92 A;  3QJY A;  4OB3 B;  3C95 A;  1M1K U;  3ASK A;  4Q5W A;  3CCU T;  2D0Q B;  1LNX A;  4C0G A;  3MO8 A;  2PU9 B;  4EMK B;  3OBY A;  4B9X A;  3BG3 A;  2JN0 A;  2DD5 A;  3X24 B;  3QBY A;  4JRK A;  4KUL A;  3PIO A;  5C0M A;  2LTO A;  2QQS A;  4M75 C;  3V7R A;  3CXC A;  4C92 G;  2EQK A;  1OZ3 A;  2RHY A;  1U1S A;  3OA6 A;  2QEX T;  3CCQ T;  4LDU A;  2BKD N;  2BS2 A;  1VQ4 T;  1N27 A;  4AKH A;  4C0D B;  2ZZD B;  2R5M A;  4XTZ A;  4C8Q G;  4C92 A;  4MFD A;  4HLQ A;  2VC8 A;  1HXD A;  3UWN A;  2QA4 A;  2RA2 A;  1YJW T;  4C5G A;  1NJI C;  3CMA T;  4QSH A;  2GF7 A;  4J7F A;  2DK3 A;  4BBR M;  2RO0 A;  4NS5 A;  2CZ6 B;  3L2W A;  5GAN 4;  4ELZ C;  2XDB A;  2WSE E;  4C8Q A;  4PLI A;  1YI2 A;  2WSF E;  4RMO A;  3QDR B;  4LDY A;  4ZGD B;  4FT2 A;  4JUV A;  4BI4 A;  3GPL A;  2XD0 A;  3M9Q A;  2E41 A;  3QYH B;  3CPW S;  4RG2 A;  4O6J A;  4A54 A;  4PJO D;  2KK4 A;  3ME9 A;  3QYE A;  5FRN A;  1VQL T;  4L5G A;  1FX7 A;  2I2L A;  4DOV A;  5KCH A;  3JAM E;  2DIQ A;  3DLL A;  4JRP A;  5GAN 8;  3OYJ A;  3HSB A;  2DXT A;  3OMC A;  2ZGW A;  1V29 B;  3P8D A;  3MP8 A;  5KCO A;  4LDW A;  1RI0 A;  1KQ1 A;  4M7A B;  1GXI E;  4P5N A;  1G3T A;  4EMH A;  4Z6Y A;  4PJO F;  3G4S A;  4MFE A;  2C06 A;  4GLK A;  4XK8 E;  3JB9 D;  3A8O B;  1XOV A;  2L8D A;  4FT4 A;  3P8B B;  5HK0 A;  3OW2 S;  1WQW A;  4E47 A;  4BDZ A;  1E7P A;  1I81 A;  5GMK h;  4NC6 A;  1Y71 A;  3FDR A;  4BE1 A;  1S72 T;  3RER A;  4ATO A;  3M56 A;  4M7D B;  2JOY A;  4X34 A;  5A0D A;  2LRQ A;  4BB7 A;  4C92 C;  2FHD A;  2M9U A;  2GCX A;  3ZFJ A;  4MIM A;  5CK9 A;  5IT9 E;  4M7A E;  1VQ6 T;  3HL8 A;  3JB9 F;  5LJ3 f;  4ZTF A;  4OGE A;  4HCZ A;  3CC2 A;  1KQS A;  4Y91 A;  3CCJ A;  1VUB A;  4C8Q C;  4OB1 B;  1LOJ A;  5GAN f;  5CIU A;  2XDD A;  1PSF A;  1O75 A;  1X6O A;  2F69 A;  2RD1 A;  3E1S A;  2DXB B;  4GY5 A;  3OS1 A;  3GOX A;  3CCM T;  1TH7 A;  5A2Q E;  3CME A;  5GAO l;  4BI8 B;  1ZQ1 A;  3PMT A;  2LVM A;  5DY9 A;  3JB9 I;  1YHQ A;  5CKH A;  1DJ7 B;  4HCB A;  3OS2 A;  3JB9 J;  3MCA B;  1NJI U;  3L42 A;  4Z02 A;  2KSS A;  3J81 E;  4M75 B;  5DM7 R;  1FWZ A;  3AHU A;  2YLB A;  4FM4 B;  1HK9 A;  3OB9 A;  1YJ9 A;  3M53 A;  3LH0 A;  2OTJ T;  1KG1 A;  2FB7 A;  4M7D G;  3RES A;  1VIF A;  1ZHI A;  3JRZ A;  1Q81 C;  2KR6 A;  3FB9 A;  4AKI A;  1OZ2 A;  5GMK l;  2PVD B;  4FSX A;  4BE2 A;  4VUB A;  4PJO A;  1G3S A;  3Q1J A;  4ZGE B;  5GAN 6;  1D3B B;  4IUP A;  1OI1 A;  2BIV A;  3MHX A;  3OSV A;  3RUX A;  1UGR B;  5LJ3 j;  3OYN A;  3BFM A;  5CO7 A;  2P0Q A;  3CCL T;  2HQX A;  2ZPB B;  4ZN1 A;  5GAN j;  1Q86 U;  2A3L A;  1BIA A;  2E70 A;  1KHC A;  1I4K 1;  4M78 D;  4IUU A;  5KE2 A;  1QVF S;  4M7D D;  3H6Z A;  2B8A A;  1BI0 A;  1K9M C;  1QP3 A;  2RJE A;  2DD4 A;  3EFR A;  1G3Y A;  1UEB A;  2QQR A;  3CCU A;  1K8A C;  5EG2 A;  2G3R A;  1XNI A;  2DD5 B;  5GAO m;  3KXT A;  4BAC A;  4LDX A;  2GFA A;  2PUO B;  4R56 A;  3O8V A;  3E9G A;  2V8I A;  5CQX A;  2LT1 A;  4F7U F;  3CC4 T;  2EQU A;  1VIE A;  4M78 F;  3WVE B;  5CKE A;  4B9W A;  3CCS T;  1JBM A;  3F70 A;  4LD6 A;  4F7U E;  4JDS A;  2QEX A;  1Q82 C;  3CCQ A;  2KMT A;  4XU2 A;  3VU3 C;  2HQE A;  2E64 A;  4C92 B;  1VQ4 A;  1JRI A;  5J3B A;  2DAQ A;  2NLU A;  1UB4 A;  3RIR A;  4PJO C;  3URG A;  1W2B A;  1YJW A;  1Q81 U;  3LX7 A;  1NPP A;  2EKO A;  4XU1 A;  1WPY A;  2EQJ A;  2CGH A;  3V7S A;  1WJQ A;  5GMK m;  1JJ2 S;  2EWN A;  2BS4 A;  4C8Q B;  1QVF A;  3MP1 A;  3SWN A;  2DJZ A;  3G71 A;  2M16 A;  3V8J A;  1W4S A;  3G6E T;  3OYI A;  4OB0 B;  3ER0 A;  3QG1 A;  4M77 G;  4OGC A;  4A4E A;  4BY6 C;  4QVC A;  4JRI A;  1VQO T;  5LJ5 f;  3JCM X;  4A4H A;  4DA4 A;  3M5A A;  5CR2 A;  2EFI A;  1N9S A;  1Y07 A;  4M77 A;  5CKB A;  4C8Q E;  3UPU A;  5GMK e;  2K57 A;  2MAM A;  3VV0 A;  1MHN A;  2K4Y A;  3GLX A;  4ELY C;  3I56 T;  3LWI A;  1K9M U;  3QJ6 A;  3QII A;  2P0P A;  2ZPG B;  1XTD A;  2DXU A;  2DTH A;  4M78 G;  2XHC A;  1M5Q 1;  2JNG A;  2HNI A;  1S72 A;  4HL4 A;  4ZN3 A;  2ZPF B;  2Y90 A;  5KE3 A;  1OYX A;  2LNV A;  1EIF A;  2V8K A;  3HRT A;  4IUV A;  4M78 A;  1XQH A;  3OS5 A;  5KH6 A;  3I55 T;  2QQA A;  3PTA A;  2RJC A;  4XTV A;  1VQ6 A;  2E6Z A;  3C94 A;  4C0F A;  3DB4 A;  4C5I A;  3L2Z A;  3RMS A;  3OS0 A;  1WQ7 A;  3A8G B;  2E65 A;  3SWN C;  3UT1 A;  3CCM A;  3KHI A;  3LWH A;  1VQK T;  1VQ8 T;  5GAM d;  5GAM h;  5CCA A;  4MMK A;  3L2R A;  1WJR A;  3DLM A;  1YBY A;  3GF5 A;  4ZGJ B;  2YRV A;  3LGF A;  3ZBD A;  5FLX E;  5LJ5 j;  3CD6 T;  2PUK B;  2R57 A;  3FEO A;  2IVW A;  2FL7 A;  4O5V A;  3RKY A;  2KVQ G;  2XID A;  3VJP A;  3X25 B;  4EPC A;  3M4Y A;  5IAY A;  2EJ9 A;  2XI9 A;  3LLR A;  1RL2 A;  4M77 C;  3EAE A;  1UGP B;  2XU8 A;  3QYB A;  2M1H A;  1M8V A;  2OTJ A;  5EJC A;  2JTF A;  2DZC A;  2PVO B;  2RHX A;  3CCV T;  4XTX A;  4DOW A;  4HT8 A;  2XIC A;  3JCM b;  3VUB A;  4NL3 A;  3PIP A;  2X35 A;  2EJG A;  4E7H A;  1M4Z A;  4M7A F;  1M9S A;  3OYE A;  3UDC A;  2WJ9 A;  2MWO A;  3CPW A;  2CS7 A;  2RHI A;  2E1H A;  2LX9 A;  2RB6 A;  2VXE A;  4M78 C;  2EYQ A;  2QFZ A;  3S3M A;  3BY7 A;  3L2Q A;  1VQ9 T;  5D6Y A;  5J39 A;  3OYC A;  1BI3 A;  5GAO r;  1YCY A;  3S3N A;  3OYB A;  3ZEH A;  5HK3 A;  3JCM h;  5LJ3 g;  3TEE A;  3JCM d;  4M7D E;  4BY6 B;  3E19 A;  5L8R E;  5GAN g;  3CC7 T;  2DD4 B;  3JB9 H;  2LT4 A;  3OW2 A;  4QVZ A;  5CVI A;  2QA4 T;  2RJD A;  5FU6 C;  3QHS A;  3TU4 K;  2EJF A;  4M75 D;  1U1T A;  4MZT A;  1YIT T;  3TW7 A;  2DEQ A;  3QPH A;  5GAM g;  4PJO G;  3CC4 A;  3KBG A;  1BI1 A;  3CCS A;  3SB2 A;  3M54 A;  2MI6 A;  5GAN 7;  1X75 C;  4E7L A;  2JUF A;  4AI6 A;  2KMG A;  3WVD B;  4E7I A;  4QQ6 A;  4M75 F;  4A4K A;  4UC4 A;  3V7C A;  3VKI A;  1VQ5 T;  4M7A D;  4J6Y A;  3FLG A;  3OQ5 A;  3A8L B;  2DIG A;  3VYG A;  1B34 A;  4M75 E;  4IUT A;  5I21 A;  3JCM Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...