4ZGDB

Mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 57
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgdB02
1UGRB 2PVDB 2D0QB 2DXBB 2ZZDB 2PUOB 3X26B 2ZPIB 2DD4A 2WSCE 4KT0E 2CYZB 3A8MB 3X20B 3X24B 3X25B 2CZ0B 2DXCB 3WVEB 4RKUE 4OB0B 1QP3A 3A8LB 4OB2B 2DXCA 2DD5A 3QXEB 3A8OB 2ZPFB 4ZGEB 4OB3B 4OB1B 2DPPB 3A8GB 1UGSB 2PU9B 2WSEE 1JB0E 3VYGB 2ZPGB 3QYHB 4ZGDB 1UGPB 4XK8E 2CZ1B 1DJ7B 2PVOB 2DD5B 2ZCFB 2ZPEB 1UGQB 5L8RE 1V29B 1AHJB 2CZ7B 1IREB 3QZ5B 3LW5E 3X28B 4ZGJB 1PSEA 3A8HB 3VYGA 4FM4B 2O01E 4L6V5 2ZZDA 1PSFA 2PUKB 3QZ9B 1GXIE 2PVGB 2DD4B 4Y28E 2ZPHB 3QYGB 2ZPBB 2AHJB 2CZ6B 3WVDB 2QDYB 3HHTB 1QP2A 2WSFE 3VYHB 2DXBA
chains in the Genus database with same CATH superfamily
2PVDB 4J7FA 1WPYA 2DTIA 2FHDA 4ME7A 1GCPA 1I0CA 2KXDA 4I3ZB 2H8HA 5GANh 1RAEB 4RCCA 4LDWA 4BBSM 3NGPA 4DEYA 2C4GB 4QKUA 5CVIA 4DQ2A 2GCXA 4A4FA 3CC7Q 4FSXA 2FG0A 4M75F 1I4K1 2I53A 2BZYA 3V7CA 2OTLT 2OTJA 4PL6A 4AFUC 2DLPA 3CCEQ 1NLPC 1W2BS 1UB4A 1SG5A 3H9NA 2M51A 2W9ZA 4PJOD 4Y72B 2P4TA 3HTRA 3OYIA 1GBQA 4ZGEB 3RMSA 4AMCA 3QJYA 1BYMA 1QVPA 1HD3A 2E5KA 1WHJA 2C0OA 2J6FA 3DLMA 1VQNA 2RM4A 3FDRA 4XQ3A 2HMAA 4CC4B 1JSTB 3I9QA 1WHMA 5EC7A 2XHCA 6AT1B 2VXEA 3E9FA 2G6FX 3LX7A 1H25B 2C5NB 1W2BP 3CD6A 1M2VB 4N0AA 4QW2A 1W4SA 2YRDA 2YRVA 2M0YA 2LZ6B 3OYJA 1M1FA 4RMOA 3PE0A 4M7DF 2L0AA 2WJ9A 3OYCA 2X4WA 4EOOB 1TTHB 5ICPB 3BHVB 1YJ9T 1GL5A 2O9VA 2OJ2A 1Y7XA 2EQIA 2YLBA 1VQPT 4EC8B 4C0DC 3QDFA 2KMTA 2DMEA 2MF2A 5HVYB 2LCCA 3CMAQ 3MI9B 2DL7A 4DBHA 4IUPA 4M7DE 4CC7A 3NPFA 4TVRA 1K0XA 3CCLA 3EOCB 2R5AA 2LT4A 4M7DA 3SWNA 1GCQC 5FU7B 2QK0A 2V8KA 2F69A 5LJ3j 2IVXA 3H0FA 1B3QA 1KQSA 1KK7A 2QTXA 3PNWC 5KYUA 2F2VA 4BCPB 1KC8U 3OW2P 2PTKA 1N9RA 4KGZB 2RI2A 4PFOA 1NBEB 3WVEB 2KT8A 1W2BA 1M1KR 4C8QB 4J9HA 2EPDA 3CCVA 2RN8A 1AD6A 3HFNA 1QKXA 3PIOA 1X6GA 2DXCA 1I1JA 3RDVA 3QXEB 3JB9H 2DBKA 1I81A 3OYMA 7AT1B 4HL4A 1LJOA 4AI6A 1U1SA 3RKWA 3CCUT 3O5ZA 3R6NA 4C5GA 2M9UA 5IN1A 3VS7A 3EFOA 1RL2A 2EGCA 4FYWB 4QT7A 1EIFA 5LJ3g 4TTHA 1IO6A 2RQWA 2QEXQ 1PRMC 2E1HA 5GAMd 1U3OA 1YCYA 1NE8A 4FW1A 2XMFA 2C6TB 1UHFA 2BIVA 4KULA 1MHNA 1EX4A 3FC3A 2LP5A 1M2OA 2VASA 3T9NA 3L2ZA 4LXCA 3SWNC 2O4XA 5GJVB 1KFZA 4FL6A 1FKMA 1YITA 2ECZA 2DTOA 1QVFP 4PJOC 3NTKA 3P8DA 2FRWA 3RKXA 4B9XA 3AT1B 2RHUA 1WQ7A 2LTOA 3NFCA 4FCYA 4PJJA 3MP8A 2WEVB 2CZ6B 4OMOA 3DDPB 3HHTB 2XG8D 5IT9E 4HNTA 2DYBA 2CREA 2DEUA 3B57A 3JCMJ 1YJ9A 5LJ3d 3O8VA 4JPBW 3JCMf 3CPWP 2K3BA 2A36A 5GAN2 3HRUA 3REBB 1W6XA 2DVEA 2WSCE 3PGGA 2LCLA 2JW4A 1VYVA 3G71T 4BXXX 2JT4A 5IHKA 1R0CB 3KUFA 4BY6B 3HP9A 2KYMA 3CBMA 4BE0A 1M3CA 3EH2A 3TREA 1XOVA 5FRMA 5HBEB 1E7OA 5KYXA 3CCVT 2OAUA 4LDUA 1H1PB 2KAFA 1VUBA 4PKCC 2I2LA 3JRZA 5GAN5 4KGXB 1WJSA 5KYYA 4RTXA 2Y90A 1AT1B 2X51A 4HVVA 4M7AG 2DRMA 2HD0A 4XTWA 4HT9A 1ZSGA 3EIDB 2DXTA 1PKDB 3G7ZA 5ACBA 2GTJA 4WTOB 4AFSC 2L3QA 1AWJA 3BLQB 1GCQA 1KC8C 3JV3A 2RHXA 3CCRA 1QLBA 2QEXT 2V22B 1BIAA 2X1NB 3EGDA 1UGPB 4OVAA 3N5BB 3JB9D 1V1CA 1RAAB 2ZCFB 5GMKl 2B9RA 4EOJB 4D6WA 3M4YA 2WXVB 2V26A 4HCKA 3QZ5B 1T0JA 5D6XA 2DL4A 5CKDA 1WZOA 3VYGA 1N8RU 2O01E 2GF7A 1O9KB 1KC8R 3M56A 5AT1B 2J05A 2E41A 3CCQA 3JCMP 2DILA 4VUBA 1TOVA 5A2QE 2QGFB 3G6ET 4Z8AA 4EORB 4RTYA 4F7UF 3MY1B 2JNGA 5LJ5f 2MIOA 3CCJA 2RK2A 2UUEB 1OZ3A 2QA4A 4NSTB 4AKGA 1QMZB 3EFSA 3JCMc 4OMMA 2DM1A 3EGXA 3GLXA 2YXYA 4BY1X 2JGZB 2D6FA 2H3JA 1JBMA 3D7SB 2D0QB 4E6RA 3BFMA 5KYYB 3MO8A 2LRQA 3H41A 3M57A 3TNWB 3BG9A 3TSZA 5GMKh 2YRCA 1TD6A 4BDZA 2CP0A 2OTLQ 1PRLC 3H4CA 1BI1A 1ABOA 1X43A 2CGHA 3X25B 2CZ0B 2EYZA 2R57A 4CC3A 1SEMA 5KYXB 1OL1B 1TUCA 1VQOQ 1NYGA 4GLKA 4HLQA 1AWXA 4CFXB 1KHIA 1JJ2A 1OZ2A 3QYEA 4CRLB 4C92F 3L2QA 4BD3A 1QWEA 4BY7X 5IHIA 3I56Q 1I5LA 4FYYB 1QCFA 4ORZA 4HA8A 4CFUB 3SWNB 4F04B 5GAOp 1HYOA 2AIRB 4EC9B 4ZN3A 4UC4A 2PJQA 2DVJA 2QAZA 4PK4A 5I5ZB 1M90U 2UZLB 2VGMA 2MCNA 2KBTA 2CP2A 4M7DB 2Y4YA 2WPAB 1OQKA 3SFMA 1QWFA 3LWHA 3PVQA 3OYFA 2DJQA 2JVVA 3M0RA 2NUTB 3LW5E 3X28B 5CKFA 3RESA 4M77G 3HRTA 2YT6A 3CCEA 1AISB 1HSQA 2XK0A 3HL8A 2ZZDA 1G2BA 1PSFA 1FINB 3M0TA 1H1SB 1D0ZA 1UUEA 4OMFB 1TXQA 1LOJA 1Z9ZA 1D0YA 1U06A 2I40B 2X4JA 4P5NA 3E2UA 3PMIA 3OSVA 1OIYB 1X2QA 3HPWA 1GUXA 5DY9A 4XTUA 2O4XB 5FU6B 2DMOA 2AHJB 2VWFA 3QO3A 2RQUA 4J6WA 1T3SA 1GUXB 2G9XB 1YP5A 1I8FA 2EAYA 3LH5A 4JDSA 3QWYA 2K6DA 3JCMb 2QQBA 1ENWA 4FIBA 2DFUA 2MOXA 3BHUB 1VQ4A 2ENMA 2M0OA 2SRCA 2QQSA 4E7ZA 3CCQT 2KE9A 2KK4A 1IXDA 1SPKA 3EG3A 4F14A 4E7HA 1OI9B 4MZTA 5CO7A 2NWMA 3PTAA 1C1AA 3JB9J 3CC2A 4HT8A 5FRNA 4AFZC 1E6HA 2ZPIB 2EBPA 1VQOT 2JM9A 2GFUA 3X20B 1QW1A 3X24B 1I07A 3CPWS 5GAOr 1SHFA 1TS9A 2LJ0A 3RMQA 4EOSB 4R55A 4BI4A 3VS2A 4OB0B 4BCGB 4M78F 5FWBA 5GAOl 2EIFA 2EWNA 4CFVB 4C0DB 3CC4Q 4EOIB 4J9FA 2XU8A 1ZA2B 1VQ8Q 2NUPB 2RF0A 2ZPFB 3BG3A 3PIPA 1K9MR 1VQNQ 2KSSA 4RTWA 2YWWA 4M7AD 1Q86R 1TH7A 2AKKA 3HO8A 1R0BG 5CR2A 4E7JA 1QKWA 3GOXA 1S72Q 3INZA 3FLGA 2BZXA 2VVKA 4XK8E 8AT1B 1H8KA 3DB4A 1CKBA 1YFNA 2M02A 3BG5A 1JO8A 1WQWA 3JB9I 2F5KA 4ZGJB 4M77F 3VS5A 4F7UE 2MPXC 2JMCA 4XU1A 4JRPA 1WA7A 2JS0A 4MFDA 3TVTA 5KYWB 2X3WD 3EJ1B 4UN0A 3VUBA 2V8IA 4ESRA 4CRIA 2RHYA 5GMKj 3CXCS 2COZA 3QWXX 4X1VA 1KD1C 5LJ3e 2CSQA 2X4YA 4A4KA 3GIBA 4KRTA 1VQ6A 4OGEA 1QVFA 1YJWT 2AT1B 2KY9A 4KUIA 4MFEA 3UT1A 2PUOB 2EGEA 4F6WB 2LJ3A 3E1SA 1VQLQ 1FXXA 2DE0X 2F1LA 2YUOA 3GNGA 2DA9A 3PT9A 2DD4A 3JCMX 2E6NA 3MEUA 2CUBA 1QCOA 3CCVQ 1JSUB 4D8DA 1WJRA 4PLLA 5LJ5g 1IGUA 2B8AA 3G33B 1QQJA 2A08A 4BCQD 3M55A 1OPKA 4MZPA 1OV3A 1UECA 2R58A 2XD0A 3I55T 3R6OA 1H24B 4Y92A 4Z89A 4O5VA 2X9HA 3VS6A 3OS2A 1OEBA 3JCMg 2LQWA 4CXAB 2K5IA 4IURA 3CPWA 1U8RA 4NL2A 1VQ9Q 2BZ8A 2CS7A 4NC6A 2GQIA 1PM3A 1W1FA 2JN0A 1N4MA 4F6SB 3OW2A 4IKFA 2E4HA 1VQ4Q 1WX6A 1B34A 1Q81C 2P0PA 2RJFA 5GJWB 1MMAA 3HZJA 1PNJA 1X27A 5IXFA 1PD1A 1GY3B 4CC2A 1NPRA 1T0HA 4R56A 2FL7A 4QVCA 2LCSA 2VV5A 3THKA 1WHHA 1ZSZA 2RA2A 1IREB 2E3HA 3OBYA 2A7YA 1SRMA 4ELZC 3O0GD 3ZFJA 2G3RA 4L6V5 1YI2A 3QBYA 1XO2A 4II1A 5HCKA 2GNCA 3PVLA 2ZPHB 1VQ6T 3C4SA 1M1KC 1M9SA 5CK9A 2EYWA 2F2CA 3CC4A 4RG2A 4M77E 4QQGA 4RUGA 5LQFB 1WHLA 2AZSA 3UWNA 1JXMA 5LJ3f 4AG1C 1VQ4T 5GMKm 5HNBB 1R77A 1ZUKA 3OA6A 4IIOA 1VOMA 3H8ZA 4R0KA 2I0NA 1JOWA 2NUTA 1VYWB 3QYBA 3I5SA 2RH2A 4F7UB 5GAOn 5LL6S 1BI2A 2ED0A 2NYSA 1OU8A 3OYLA 3C95A 2BE9B 3X26B 2EQJA 4F7UA 4DA4A 2UZDB 4JJDA 3J80E 3I55Q 1RABB 3QDRB 1IB8A 3CCUA 4EOLB 3EG2A 2LMJA 3G1JA 1JJ2S 2JXBA 1M2VA 3P8HA 3BY7A 5I2SA 3UPUA 4Z02A 2QA4Q 1K73C 4BE2A 2RI3A 2QDJA 2V1RA 1TFBA 4CFNB 2YUQA 2XDBA 3QUIA 5KYNA 3MEVA 4OB3B 3OW2S 2LJ1A 5I22A 1ACMB 2L2PA 2ROLA 2L89A 3VYGB 5GAMj 2D1XA 2J06A 4A53A 3TU4K 4J7IA 4JX6A 3CMEQ 1DJ7B 2C0IA 2PVOB 3HKSA 1AD5A 4JJNK 4E2FB 4BCJB 5EFQB 3RERA 3HBLA 3H6ZA 1M90R 1O75A 5KYUB 2EQMA 1VQ9T 4JZ3A 3QKJA 4WCIA 4PJOF 3JAME 1Q7YC 2DZ9A 3CCMQ 3CC2Q 1D1BA 3VUZA 2JS2A 4J5YA 1WJQA 3CC2T 1W70A 2LDMA 4BCNB 2IW6B 1EZZB 1R8OB 2HSPA 1D3BB 2IN3A 3Q1JA 3BDUA 4JRIA 1H1QB 5CYIB 4K11A 2BS2A 3PO3S 3MP6A 1YWOA 2IW8B 1S72T 1V76A 5GAMf 3CD6T 2V8JA 2VXFA 2B86A 3RBBB 1VQLT 1HJDA 1Z9QA 1OPLA 2K79A 2DO3A 4C5HA 3G4SQ 2KEAA 3ASKA 2ESWA 5HK3A 3VU3C 9ATCB 5GAOm 2C0TA 2E5QA 3OYHA 4EOPB 1B07A 2FVUA 3CCJT 2XDDA 1VQNT 4HKEA 1ZA1B 3G4ST 2J7IA 2K2MA 4PFZA 3HSBA 2RO0A 3M4GA 3TW6A 3CCET 1IGQA 4OP0A 5GAMg 3OSSC 4M7AE 1P92A 3CCLQ 2WMAB 1GFCA 4AKIA 4LN2A 3DJBA 3I5RA 2OX7A 2DXCB 3GF5A 1K76A 4YOOA 4PJNA 1ZSZB 1URCB 1JXOA 1YJNA 1VOLA 5LJ5h 1ZUUA 5CKHA 2E65A 2GQVA 3CCMT 2LC4A 1C9BA 1K8AU 2DYIA 1M3BA 3K7AM 1SSHA 3CCRT 1PKSA 4CFWB 2CH4W 2M1HA 2QASA 3SB2A 4XTZA 2MAMA 2LT1A 3TN8B 4MZMA 4ATOA 1C0MA 1A0NB 2EVRA 4BBRM 3QYHB 2KT1A 1N5ZA 3M03A 4XTYA 5KCHA 1VQ6Q 5DM7R 4BUGA 1BB9A 2HKQB 4J9DA 3RGFB 3MEAA 3GBQA 2CZ7B 4EIKA 5HBJB 3RIRA 5FROA 5CQXA 4JRQA 4KRCB 2DNUA 2JJ9A 1UGVA 3CCSA 1WNLA 1UDLA 1WXTA 2QF7A 2EJFA 2K3YA 1YIJA 3M53A 2LVMA 2QA4T 2WHBB 3OBWA 4N4HA 4Y28E 1VIFA 1D0XA 1UNHD 2NUPA 4LD6A 5FU6C 1MMGA 3META 4QQ6A 1ZLMA 4IUTA 2KI7A 2W0ZA 3CQTA 1OL2B 3ULRB 4MIMA 4F16A 2EQUA 4C92B 4F7NB 5I21A 2E10A 4OMQA 2EJ9A 2FB7A 5A0GA 1RADB 5IHYA 2C06A 3URGA 4EPCA 4M75G 4HXJA 4BCIB 1WHKA 2BS3A 4CFUD 4F7LB 1RI9A 2LQKA 5IAYA 5FU7C 1K73R 2KDSA 2AKLA 4M4ZA 1Q82C 4OGRB 2DX1A 3FB9A 1AWWA 1WGSA 1IHVA 4J9CA 4BCHB 3QIIA 5KYWA 2EYXA 3DDQB 4B9WA 4J8OA 3DTOA 1H26B 2Y4XA 3FRNA 2DD5A 1YI2Q 4E7SA 2IIMA 4MDXA 3C12A 2JTEA 2KXCA 2IVWA 2DPPB 1MNDA 3LQ5B 3OYBA 1UGSB 2UZBB 2X4XA 5GAN4 5DQWA 1X6OA 2CCIB 2COYA 1JB0E 1LVKA 2A0FB 4PJOE 1PKTA 1VQMQ 4BB7A 4C0ZA 3P8BB 4ROEA 2QG9B 1CSKA 2RD1A 1YHQA 2XI9A 3SD4A 1V29B 2PZ1A 4FT4A 4XTXA 5GANf 2PK9B 3I56T 4QVDA 4M78B 2FRYA 3DL1A 4C8QD 3I35A 5GMKe 2DL8A 1ZP2A 4J9EA 1MUZA 4BCOB 2DETA 1OU9A 1VYTA 1JU5C 3VRYA 1NJIR 4RTZA 1U5SA 3JCMe 3TW7A 2C5XB 3EHRA 1LNXA 3VKHA 1QCNA 3OYAA 2BPMB 1X69A 3QYGB 2KQWA 4OGCA 1G5VA 4JX4A 1Y71A 1W98B 4OMLA 4M78G 1TUDA 2CKKA 2VKNA 4MMLA 2WFYB 1K8AC 2LX7A 4EDUA 4JLIA 1M1KU 3JCMd 2BE7D 1KQSS 2EW3A 1VQ7A 4WF2A 3TQ7P 2A37A 1JJ2P 2DKGA 3L1AA 3L42A 1BK2A 1UJ0A 3FJPA 4EOQB 3CCJQ 5I2MA 1MV0B 2FZKB 4ZTJA 1WYXA 4M77D 5I11A 1G3TA 1OI1A 3CMEA 1FYNA 3OYGA 5GAN3 2QGGA 2DJZA 4OMNA 2YLCA 3KFVA 3FEOA 3HFOA 3F5XB 4E47A 1NPPA 3RUXA 4ELLA 1YITQ 2CUDA 5CKBA 2DIGA 3OB9A 2XICA 1H4LD 1H92A 2CP5A 3EFOB 3M0QA 2YUNA 4M7AF 5D6YA 4KUDK 1JQQA 1IHWA 1QMCA 3A8GB 1HK9A 3EG9A 2YHTA 2KRSA 2K7AA 3MP1A 3VKGA 2EGAA 4AT1B 3LYIA 4RTUA 1VQMT 1ZHIA 2P0QA 3I55A 2HAXA 1RUWA 2GGRA 1PCXA 2YDLA 3OY9A 5L23A 1KJWA 4V2SA 4KGVB 1Q86C 3VS1A 4JS5A 1Q82U 1LPLA 4HVWA 4D8KA 4PNOA 4LDXA 1B7TA 2P0KA 4M7AA 3LLRA 3OYEA 1HXDA 1UFFA 2RB6A 4NOYA 1RACB 4BCQB 2VC8A 4C8QG 1KD1U 3MY5B 4M75A 5D6WA 1TSFA 1E7PA 2HBWA 2L3SA 3CC7T 1NZ9A 4EONB 1PD0A 3VS3A 4BI8B 2EJGA 2D9TA 2FPDA 4AG2C 4PJOA 2D8JA 4M77C 5CCAA 4BACA 5CKEA 2BTTA 1JRIA 3CCRQ 2GFAA 4QQDA 3CCQQ 2MK5A 1IZ6A 3CCUQ 1KXUA 3KBGA 1XQHA 4M7DD 1N27A 1Y07A 2FPFA 1K9MU 4ANJA 2RHZA 2JZ2A 1TU0B 3MHXA 1NYFA 3V8LA 1J3TA 1KD1R 1NM7A 4FSSA 1ZUYA 4M78D 4X9DA 2EKOA 4LDYA 4KRDB 1M4ZA 3EG1A 1WXUA 3CEYA 4FX3B 2RJEA 5FWCA 4IMYB 4ELJA 2ABLA 2WACA 2JMAA 1YWPA 1UE9A 3A5ZB 4OB2B 2HQEA 5DQVA 3A8OB 2OI3A 1YIJQ 2XDPA 1ZBXA 2CT4A 2ROTA 1YN8A 2OTLA 1H27B 2CJMB 4C92D 5GAMh 3TNIB 3GTMS 4DOVA 2GBQA 3SDZA 4J9BA 1AWOA 4M75D 5CQYA 3TCJA 1U1TA 3C0CA 4JJCA 4RTVA 3CD6Q 3S6WA 1VQOA 2E70A 1K0SA 2O2OA 4C0GA 2ZPGB 4JLGA 1VQ5Q 1BI0A 2E6ZA 3UDCA 5IH2A 1UGQB 1MGQA 3PMTA 2K9GA 1MNEA 1ZQ1A 1WDXA 2RI5A 4C0FA 3REAB 4KH1B 2JOYA 2HKNA 2NLUA 2FPEA 1RI0A 4A4EA 3C94A 2HQHA 4II5B 4XAXB 4DOWA 2K3XA 2W10A 1GH6B 1S1NA 3OS5A 2ZPBB 5GMKi 2CSIA 1VQ5T 1Q82R 1RAHB 2KR3A 3L2UA 5KE3A 3HRSA 2JUFA 2DF6A 4EMGA 4B6MA 1K1ZA 2VUBA 3I56A 1KHCA 1Y96A 5GAN8 5LMKB 2DXBA 4L5GA 4C8QC 4IUUA 3BLHB 5GAOq 3J7AF 4J9GA 1RLPC 2QQ9A 8ATCB 2DXBB 2QQ8A 3CCSQ 1SF9A 1H28B 4ELYC 3L2WA 1X2KA 2SEMA 1BU2A 4QSHA 5KE2A 5A0LA 2RQRA 4LNPA 1CKAA 2LQNA 5AYFA 1YHQQ 1PG5B 3A8MB 1NJIU 1M90C 4EMKB 2L8DA 4X34A 1Y0MA 4Z88A 3EG0A 4RKUE 4M7AC 5IXBA 1KIKA 1M8VA 1UNLD 3UF4A 4JJBA 2EYYA 4IIMA 2W99A 2HQXA 2QEXA 4A4HA 3M54A 1YNZA 2PQWA 3BLRB 4BCKB 2FZGB 1XNIA 1VINA 1FWZA 2BS4A 2FYKA 1OX9A 5D7UA 2CT3A 4BCMD 4XU0A 2VB6A 4ZGDB 2K2VA 2RHIA 2BKDN 1PHTA 1D3BA 1VQ7Q 2R7GA 4LUDA 5CEIB 3M0SA 4C8QA 3MEWA 2DRKA 2PNIA 4RG8A 3S3NA 4FM4B 1K4US 1FMWA 2PUKB 4F7JB 5A0DA 1NEBA 4C92A 4YOSA 3OS0A 4J9IA 1S72A 4ZNXA 2AZVA 2DD4B 5J26A 3JCMh 3M0PA 1VQ5A 1SKUB 1BU1A 2ZGWA 2LX9A 3G71Q 3V8JA 4ZTFA 2HEQA 1G3YA 2DAQA 3EFRA 1FMVA 1JKWA 4M78A 4BI3A 3OS1A 5M9OA 1H3ZA 3OYYA 3OYNA 1QP2A 3BW1A 3CXCP 3EG9B 4JUVA 5KH6A 1BKBA 3GP8A 2LW4A 5GAMe 4M78E 1FMKA 3CBPA 2HNIA 5IHNA 2K5FA 3VRZA 2C5VB 5DLQE 2CCHB 4LE9A 1G3NC 2LNVA 2RQTA 1OGUB 3A98A 3CBOA 3DKMA 1YITT 2C5OB 2A28A 1PC0A 2K4YA 4BDYA 2KVQG 4N4GA 2V1QA 5IDPB 2K5LA 2LNHB 2OAWA 4GLMA 1Y57A 3S3OA 1YJNT 5IDNB 1F1BB 2L3PA 2W2HA 1WFWA 2CH4A 4LDVA 3EGXB 2QTVA 1VQKT 1KQ2A 4HVUA 3OYDA 4C92G 3OMCA 1VQMA 2DIQA 4OB1B 1YJWQ 1OIUB 1K73U 4DBQA 1ZX6A 2PU9B 5FLXE 1NJIC 4BCMB 1BI3A 1GRIA 4YTLA 4ROCA 1X75C 2MWOA 1JEGA 3NTHA 2XKOC 4M78C 4PFPA 1K8AR 1AOJA 1QVFS 3KHIA 1WXBA 3QHRB 1G3WA 5L8RE 3G6EQ 2W9FA 5HY6A 1K9MC 1O9SA 2Z0WA 1VQLA 1AHJB 3EGDB 4PJLA 2E64A 4M7DC 1PSEA 1E6GA 2YSQA 3FJ5A 2JTFA 2KRMA 1Y96B 4EMHA 2DK3A 3QZ9B 5HBHB 2MMPA 2X3XD 3CC7A 5FW9A 2VGNA 1KSWA 4Q5WA 5KCOA 4F7SB 3RNJA 4M75C 3V8KA 2F2WA 1MV3A 2NUZA 1VQ8A 3TEEA 2IW9B 3CCLT 1YBYA 2QFZA 3JB9G 4BE1A 4FT2A 1UEBA 1VQ9A 3WVDB 2R5MA 3BHTB 3RR6A 4EMKA 2G77A 1H641 1WIEA 1AEYA 2J6KA 4DEXA 1OKWB 2KR6A 4LD9K 4Z6YA 2ZZDB 2FEIA 1M3AA 1VQ8T 2QI2A 1RAGB 4J83A 1YI2T 1QLYA 3QJ6A 2COWA 3CMAT 2QQAA 5EJCA 4EOKB 4C92E 2D8HA 4AKHA 5FGKB 5BNJB 1G83A 1N9SA 4J6YA 1VQPQ 1TWBA 3DOGB 2PK2A 3LGLA 3DLLA 4E7IA 1Q81U 1QVGA 1FX7A 1I5OB 4C92C 2WIHB 2KYBA 4HNVA 1H3HA 2HZYA 3ER0A 4NS5A 3NTIA 4E7KA 2PHGA 3UA7A 1KQ1A 3G71A 2MI6A 4RTTA 1D1AA 2E12A 2F5TX 5GANj 2ATCB 1OULA 2L3RA 3QG1A 3JSCA 4RODA 2WSEE 4XU2A 3NHNA 2DL5A 3CMET 5DLOA 4F7UG 3RKYA 4E7LA 3CMAA 1UTIA 1KQSP 3POMA 4OMPA 1VQKA 4N4IA 2FO0A 4EOMB 1NEGA 3ME9A 2ZPEB 2P84A 1N8RC 4HCCA 3PFSA 2RK1A 1YJWA 1T3LA 1P5EB 3MKDA 4C5EA 1G8XA 3U23A 2OTJQ 1M30A 4OR5B 1UG1A 2DBMA 4KBMB 3CC4T 2BKZB 3ZBDA 3FIFA 3TNHB 4M75E 5ECAA 1AZEA 3F70A 1M5Q1 3H0HA 1MMNA 1GXIE 2PVGB 3E19A 4FYXB 1VYUA 3IQLA 2ED1A 1X01A 2O9SA 2K57A 4F70B 3OMGA 1VQ7T 5LJ5j 3QSUA 2UZEB 2MYSA 3HB9A 4DBRA 2CDTA 1OYXA 3GNFB 4A4GA 4PJMA 2HL3A 3BDLA 1ZSZC 3CXCA 1C6VX 4A54A 3H0IA 2WSFE 4M7AB 1H1RB 1N6AA 2X35A 4XU3A 1X6BA 2DZCA 5CIUA 3M9QA 4BY6C 3DB3A 3GPLA 2W96A 2QGSA 2EKHA 2RJCA 4YOZA 5EG2A 4X9CA 2HCKA 2DTHA 1VA7A 4JS4A 2EFIA 1O9KA 4GY5A 2YUPA 4CFMB 4G6LB 4IUVA 1GBRA 4Y91A 4HCZA 5IF1B 3E9GA 2JTMA 4OF1A 1YHQT 2FZCB 4XTVA 1QP3A 1WHGA 2RMOA 3UA6A 4PJOG 2QDLA 1K9AA 3M59A 4PLIA 1OOTA 3ZEHA 4JRKA 4QVZA 3ZL7C 2VYTA 4C8QF 2OTJT 3A1PA 4NL3A 2HSEB 2M16A 1M27C 2KMGA 4PJOB 1BIBA 5GANe 5GANd 4HCBA 3QHSA 1ABQA 3QWLA 2DXUA 1ARKA 4YC3B 4MDWA 1Q7YU 2LQ8A 1NLOC 2HDAA 2CZ1B 2CP6A 3MJXA 2DD5B 2D0NA 4EMKC 1GFDA 2RNAA 2CP7A 1D1CA 3MCAB 4J6XA 1YJ9Q 3V7SA 2KRNA 3LGFA 1KG1A 1TUGB 5L2WB 4F6UB 3A8HB 1VQPA 4RCBA 3BE3A 2L5QA 2H3EB 4HNUA 4F17A 2PMIB 3M0UA 4LUEA 5HKCA 4FYVB 1RAFB 1IRXA 3QHWB 2QQRA 2WMBB 3L2VA 1VIEA 1N8RR 5CAIA 1Q95G 3LWIA 2JM8A 1M8MA 4KH0B 2EUFA 3CPFA 3JB9F 1SHGA 4BCFB 2ZAEA 2KNBB 1WI7A 1F5QB 5HK0A 1BCOA 2O88A 2O31A 1AZGB 3EGUA 3CCST 4DBFA 1M1GA 2MWPA 3M58A 3VYHB 3JCMV 1RAIB 3WXMB 1UGRB 5J39A 5HQ0B 2WIPB 4N0AC 1EFNA 3SEMA 1YIJT 3UATA 4GBQA 1WLPB 4JZ4A 1VQKQ 1QVGP 4MMKA 1AVZC 1E9HB 1PWTA 2DERA 4KT0E 1RLQC 1B34B 2CYZB 4M7DG 3LH0A 3TSWA 3OYKA 3VJPA 1XJWB 3AHUA 2HL5C 4M77B 4FW2A 2RQVA 3EH1A 2DEQA 5GAN7 3QPHA 4CI0C 5GAN6 3J81E 2DL3A 3NDQA 2AK5A 3A8LB 2F2XA 4M6VA 3VS4A 5LJ3h 2HBPA 1TG0A 1UNGD 3MIAB 3L2RA 1QVGS 4IUQA 3KXTA 1BBZA 4BCND 2KROA 3V7RA 2CP3A 3VKIA 3VV0A 5GANg 4M75B 3CCMA 2RJDA 2J6OA 1SSFA 2P4RA 1BCMA 1Q86U 3SHWA 3NMZC 4FU6A 2RPNA 4LOCA 4C8QE 2EQKA 5LJ5e 1UHCA 2QXFA 4O6JA 2EYQA 5LJ5d 2A3LA 5C6SA 4A63B 1SRLA 4AFQC 1OX8A 2KGTA 4JX5A 1G3SA 5J3BA 2GTOA 2IPOB 3S3MA 1YCSB 1OKVB 3M5AA 3G4SA 3MPUB 1YJNQ 1MMDA 3EHQA 1XTDA 1ZBJA 2BUDA 4C5IA 1NG2A 3OQ5A 4L59A 3JCMQ 1FVVB 4ZN1A 1LCKA 3JCMW 2QDYB 2IG0A 1Q81R 2XIDA 4M77A 2QYZA 1Q7YR 5C0MA 3EAEA 3VS0A 3G6EA 1D09B 1UJYA 2E3IA 1D3UB
chains in the Genus database with same CATH topology
2KK4A 4M78E 2PVDB 4J7FA 4E7HA 2BS3A 1WPYA 2DTIA 2FHDA 2HNIA 2K5FA 3CBPA 4ME7A 4MZTA 5CO7A 3PTAA 3JB9J 3CC2A 4HT8A 5FRNA 5GANh 4RCCA 5DLQE 4LDWA 2LQKA 4BBSM 5FU7C 5IAYA 2KDSA 2LNVA 2ZPIB 5CVIA 4DQ2A 2GCXA 3CBOA 1VQOT 3DKMA 1YITT 1Q82C 2K4YA 4A4FA 3FB9A 1WGSA 2KVQG 4FSXA 4BDYA 2GFUA 4N4GA 3X20B 1QW1A 3X24B 4M75F 1I4K1 3CPWS 5GAOr 3RMQA 3QIIA 2K5LA 4R55A 4BI4A 3V7CA 2OTLT 4OB0B 4M78F 4PL6A 4J8OA 4B9WA 3S3OA 1YJNT 2OTJA 5GAOl 2EIFA 2EWNA 4LDVA 2Y4XA 4C0DB 3FRNA 2DD5A 4MDXA 1VQKT 2XU8A 1UB4A 1W2BS 1KQ2A 3C12A 3PIPA 2ZPFB 3BG3A 4C92G 2P4TA 3OYDA 4PJOD 3OMCA 3OYIA 1VQMA 4ZGEB 3RMSA 2DIQA 4OB1B 2IVWA 2KSSA 3QJYA 2DPPB 3OYBA 1K73U 4M7AD 1BYMA 1UGSB 2PU9B 1TH7A 2X4XA 5FLXE 1QVPA 5GAN4 3HO8A 1X6OA 1NJIC 5CR2A 1JB0E 1BI3A 4E7JA 4PJOE 3GOXA 4YTLA 2MWOA 1X75C 3DLMA 3INZA 4BB7A 2RM4A 3FLGA 3NTHA 3P8BB 4C0ZA 1VQNA 2XKOC 3FDRA 4XK8E 2RD1A 4M78C 1YHQA 2XI9A 4XQ3A 1QVFS 3KHIA 3DB4A 3SD4A 2XHCA 1G3WA 2VXEA 5L8RE 5HY6A 1V29B 4FT4A 4XTXA 1O9SA 3E9FA 5GANf 3I56T 3BG5A 1AHJB 1WQWA 3LX7A 4QVDA 1VQLA 3JB9I 3CD6A 4M78B 3DL1A 2F5KA 4C8QD 4N0AA 2E64A 4ZGJB 4M7DC 4QW2A 1W4SA 1PSEA 2YRVA 4M77F 5GMKe 4F7UE 2JTFA 1M1FA 3OYJA 4RMOA 1Y96B 4EMHA 4XU1A 4M7DF 2DK3A 2WJ9A 4JRPA 3OYCA 3QZ9B 2X4WA 2MMPA 3JCMe 3CC7A 3TW7A 4MFDA 2VGNA 1LNXA 3VKHA 3OYAA 2KQWA 4OGCA 3QYGB 4Q5WA 5KCOA 1YJ9T 1G5VA 4JX4A 1Y71A 1Y7XA 4M75C 3V8KA 4M78G 3VUBA 2V8IA 1K9MC 1VQ8A 2CKKA 3TEEA 2YLBA 4CRIA 3CCLT 1YBYA 4MMLA 2QFZA 1VQPT 3JB9G 2RHYA 5GMKj 4BE1A 4C0DC 1K8AC 4FT2A 2KMTA 2MF2A 3CXCS 2LCCA 4EDUA 4JLIA 1UEBA 1VQ9A 3WVDB 1M1KU 3JCMd 2R5MA 1KD1C 5LJ3e 1KQSS 2X4YA 4IUPA 1VQ7A 4WF2A 4EMKA 4M7DE 4A4KA 2G77A 3GIBA 1H641 1VQ6A 4OGEA 2DKGA 4TVRA 3L1AA 1QVFA 3L42A 1YJWT 2KY9A 3FJPA 2KR6A 5I2MA 3CCLA 4LD9K 4Z6YA 4KUIA 2ZZDB 4MFEA 2R5AA 3UT1A 2LT4A 2QI2A 1VQ8T 4M7DA 2PUOB 4J83A 3SWNA 1YI2T 5FU7B 3E1SA 2V8KA 4ZTJA 1FXXA 2F69A 3GNGA 3PT9A 3QJ6A 3JCMX 2DD4A 4M77D 2E6NA 3MEUA 5LJ3j 1KQSA 3CMAT 2QTXA 1G3TA 3PNWC 2QQAA 1WJRA 4PLLA 1OI1A 5EJCA 5LJ5g 4C92E 4AKHA 1N9SA 4J6YA 3OYGA 3CMEA 5GAN3 2B8AA 1KC8U 2DJZA 1N9RA 3M55A 3LGLA 3DLLA 2YLCA 4MZPA 3FEOA 2RI2A 3HFOA 4E7IA 1Q81U 1QVGA 3WVEB 1FX7A 2R58A 4E47A 1W2BA 1NPPA 2XD0A 4C92C 4C8QB 3I55T 3CCVA 3RUXA 4HNVA 3R6OA 5CKBA 2DIGA 3HFNA 3OB9A 3ER0A 3PIOA 4O5VA 4NS5A 2DXCA 3NTIA 4E7KA 2XICA 3QXEB 3JB9H 1I81A 1KQ1A 3OS2A 3OYMA 3G71A 4HL4A 1LJOA 2MI6A 4AI6A 1U1SA 3RKWA 3CCUT 3JCMg 4M7AF 4C5GA 2K5IA 2M9UA 2E12A 2F5TX 4IURA 4NL2A 5D6YA 3CPWA 5IN1A 5GANj 1U8RA 2CS7A 4KUDK 4NC6A 1RL2A 2L3RA 3A8GB 1HK9A 3QG1A 3JSCA 2YHTA 2WSEE 2JN0A 3MP1A 4XU2A 3VKGA 3OW2A 3CMET 5DLOA 4IKFA 4F7UG 3LYIA 3RKYA 4E7LA 1EIFA 5LJ3g 1VQMT 3CMAA 1B34A 1Q81C 2P0PA 2RJFA 1ZHIA 2P0QA 3I55A 2HAXA 3HZJA 2E1HA 1VQKA 5GAMd 4N4IA 3ME9A 1YCYA 1NE8A 2ZPEB 1NPRA 4R56A 1N8RC 4HCCA 2FL7A 4QVCA 2BIVA 2VV5A 3PFSA 2RK1A 4KULA 1MHNA 3OY9A 1YJWA 4C5EA 2RA2A 1IREB 4V2SA 3OBYA 1Q86C 4JS5A 2A7YA 1Q82U 3FC3A 4ELZC 3ZFJA 3T9NA 2G3RA 4KBMB 4PNOA 3L2ZA 3ZBDA 4L6V5 3FIFA 3QBYA 4M75E 3CC4T 1YI2A 3F70A 3SWNC 2O4XA 1M5Q1 2P0KA 4FL6A 4M7AA 1GXIE 1FKMA 2PVGB 3E19A 3LLRA 4II1A 1YITA 2DTOA 3OYEA 4PJOC 3NTKA 1HXDA 2ZPHB 3P8DA 1X01A 1YIJA 2RB6A 4NOYA 1VQ6T 2VC8A 3C4SA 2K57A 4C8QG 1KD1U 1M1KC 4M75A 1M9SA 3OMGA 5D6WA 3RKXA 1E7PA 4B9XA 2RHUA 1WQ7A 5CK9A 1VQ7T 3CC4A 5LJ5j 4RG2A 3QSUA 2LTOA 3NFCA 4M77E 3HB9A 3CC7T 4QQGA 1OYXA 1NZ9A 3MP8A 3GNFB 3UWNA 4BI8B 4A4GA 2CZ6B 5LJ3f 1VQ4T 2EJGA 3BDLA 5GMKm 3CXCA 2D9TA 3HHTB 4A54A 4PJOA 2WSFE 4M7AB 1N6AA 2XG8D 3OA6A 5IT9E 4HNTA 4M77C 5CCAA 2X35A 3H8ZA 4XU3A 4BACA 5CKEA 1K73C 2DZCA 1JRIA 5CIUA 2GFAA 3JCMJ 4QQDA 1YJ9A 5LJ3d 3M9QA 3O8VA 1IZ6A 3JCMf 4BY6C 3DB3A 3QYBA 5GAOn 2RH2A 4F7UB 3GPLA 3KBGA 5LL6S 5GAN2 1BI2A 3HRUA 3OYLA 1XQHA 4M7DD 1N27A 1Y07A 2RJCA 3C95A 1K9MU 3X26B 2EQJA 2RHZA 5EG2A 2JZ2A 3MHXA 4F7UA 4DA4A 4X9CA 2DVEA 2WSCE 3V8LA 3PGGA 2DTHA 3J80E 3QDRB 4M78D 4X9DA 2LCLA 4JS4A 2EFIA 2EKOA 4LDYA 4GY5A 3CCUA 1M4ZA 3G71T 4M75G 4IUVA 3KUFA 4BY6B 3HP9A 3CEYA 4Y91A 4HCZA 2RJEA 3E9GA 2JTMA 3CBMA 4BE0A 4OF1A 1YHQT 1JJ2S 3TREA 1XOVA 3P8HA 5FRMA 3BY7A 4ELJA 4XTVA 1QP3A 2WACA 4Z02A 5I2SA 3CCVT 2OAUA 4BE2A 3UPUA 4PJOG 2RI3A 4LDUA 3M59A 4PLIA 2KAFA 1VUBA 3A5ZB 4PKCC 4OB2B 2I2LA 2HQEA 3JRZA 3ZEHA 5GAN5 4JRKA 2QDJA 3A8OB 1WJSA 4QVZA 2XDBA 2Y90A 2XDPA 1ZBXA 3QUIA 3MEVA 2HD0A 4M7AG 4XTWA 2VYTA 4C8QF 2OTJT 2OTLA 4HT9A 2DXTA 4OB3B 3OW2S 3G7ZA 4NL3A 4C92D 5GAMh 4DOVA 3SDZA 4M75D 2M16A 5CQYA 1KC8C 3TCJA 2L89A 2KMGA 4PJOB 1U1TA 2RHXA 3VYGB 3CCRA 5GAMj 1BIBA 5GANe 5GANd 4HCBA 1QLBA 3QHSA 3S6WA 2QEXT 3QWLA 2DXUA 2E70A 1VQOA 1Q7YU 4MDWA 4A53A 2ZPGB 1BIAA 2LQ8A 4C0GA 4J7IA 1UGPB 4JX6A 4JLGA 3TU4K 4OVAA 2CZ1B 1DJ7B 3N5BB 3JB9D 2PVOB 2DD5B 2ZCFB 1BI0A 2E6ZA 3HKSA 3UDCA 4JJNK 4EMKC 3RERA 1UGQB 1MGQA 3PMTA 5GMKl 3HBLA 3H6ZA 4D6WA 3MCAB 4J6XA 1O75A 3M4YA 2EQMA 3V7SA 1VQ9T 1ZQ1A 3QZ5B 3QKJA 3LGFA 5D6XA 2RI5A 4PJOF 4C0FA 5CKDA 3JAME 2JOYA 2DZ9A 1Q7YC 1KG1A 3A8HB 3VYGA 2NLUA 3VUZA 4RCBA 1VQPA 1N8RU 2O01E 4J5YA 1RI0A 2GF7A 2L5QA 3C94A 1WJQA 4A4EA 3CC2T 4HNUA 4XAXB 2LDMA 3M56A 4DOWA 5HKCA 2K3XA 2E41A 2QQRA 3L2VA 3CCQA 1VIEA 3JCMP 4VUBA 5CAIA 5A2QE 3OS5A 3G6ET 1R8OB 2ZPBB 1D3BB 5GMKi 3LWIA 3Q1JA 3BDUA 4JRIA 3CPFA 4F7UF 1VQ5T 3JB9F 3L2UA 2JNGA 2BS2A 5KE3A 5LJ5f 3MP6A 3CCJA 2JUFA 2RK2A 3HRSA 4EMGA 1OZ3A 2QA4A 5GAMf 1S72T 2VUBA 4AKGA 3CD6T 3EFSA 2V8JA 2VXFA 3JCMc 1VQLT 5HK0A 3I56A 1KHCA 3CCST 1Y96A 3GLXA 2DO3A 4C5HA 5GAN8 1M1GA 2MWPA 3M58A 3VYHB 3ASKA 5HK3A 2DXBA 4L5GA 3VU3C 5GAOm 2E5QA 3JCMV 4IUUA 2FVUA 3WXMB 4C8QC 3OYHA 3CCJT 5GAOq 2D6FA 2XDDA 1UGRB 5J39A 1VQNT 2H3JA 1JBMA 4HKEA 3J7AF 2D0QB 2QQ9A 3BFMA 3G4ST 2DXBB 2LRQA 3MO8A 4N0AC 3M57A 2QQ8A 3BG9A 1YIJT 3HSBA 2RO0A 3M4GA 4MMKA 5GMKh 4ELYC 3L2WA 3TW6A 3CCET 4QSHA 5KE2A 4OP0A 5GAMg 4KT0E 4BDZA 3OSSC 5A0LA 1B34B 2CYZB 4M7DG 4M7AE 5AYFA 3H4CA 1P92A 1BI1A 3A8MB 2CGHA 3LH0A 1NJIU 4AKIA 3X25B 1M90C 3OYKA 4EMKB 3VJPA 2L8DA 2CZ0B 4X34A 2DXCB 3GF5A 2R57A 3AHUA 4M77B 4RKUE 4M7AC 2DEQA 4LDXA 5GAN7 1YJNA 3QPHA 4CI0C 5GAN6 3J81E 1M8VA 4GLKA 3A8LB 4HLQA 5LJ5h 4M6VA 1KHIA 3GP8A 5CKHA 1JJ2A 2E65A 2GQVA 5LJ3h 1OZ2A 3CCMT 3QYEA 2HBPA 2LC4A 1K8AU 4C92F 3L2QA 3L2RA 1QVGS 4BD3A 2HQXA 4IUQA 2QEXA 3KXTA 4A4HA 3M54A 3V7RA 3CCRT 2PQWA 2M1HA 3VKIA 3VV0A 1XNIA 5GANg 1I5LA 3SB2A 4XTZA 4M75B 1FWZA 2MAMA 3CCMA 2LT1A 4HA8A 3SWNB 5GAOp 2RJDA 2BS4A 2FYKA 4ZN3A 1SSFA 4MZMA 4ATOA 1Q86U 4UC4A 4FU6A 4XU0A 4LOCA 4C8QE 4BBRM 3QYHB 2EQKA 4ZGDB 2QXFA 4O6JA 2EYQA 2K2VA 2BKDN 2RHIA 2VGMA 5LJ5e 5LJ5d 1M90U 1D3BA 4XTYA 2A3LA 4M7DB 2Y4YA 5C6SA 5KCHA 3SFMA 3LWHA 5DM7R 4BUGA 3OYFA 2JVVA 3MEAA 2CZ7B 4C8QA 3MEWA 3LW5E 3X28B 4RG8A 5CKFA 3S3NA 3RESA 3RIRA 4JX5A 4M77G 5CQXA 5FROA 1G3SA 4JRQA 3HRTA 5J3BA 3CCEA 4FM4B 1WNLA 3CCSA 3S3MA 2XK0A 3HL8A 2ZZDA 1PSFA 2QF7A 2PUKB 2EJFA 2K3YA 4C92A 5A0DA 4OMFB 3M53A 3OS0A 2LVMA 3M5AA 3G4SA 2QA4T 1S72A 1LOJA 3OBWA 2DD4B 4N4HA 4P5NA 2X4JA 1VIFA 4Y28E 5J26A 3JCMh 1VQ5A 3PMIA 3OSVA 2ZGWA 1XTDA 3HPWA 2BUDA 5DY9A 4XTUA 4C5IA 4LD6A 5FU6C 2O4XB 5FU6B 2LX9A 2AHJB 3META 4QQ6A 3OQ5A 4L59A 3V8JA 3QO3A 4J6WA 3JCMQ 4ZTFA 4IUTA 4ZN1A 1G3YA 4MIMA 1I8FA 2DAQA 2EAYA 3EFRA 3JCMW 4M78A 4JDSA 4BI3A 3OS1A 5M9OA 2QDYB 1H3ZA 2IG0A 2EQUA 3OYYA 3OYNA 1QP2A 2XIDA 3BW1A 4M77A 4C92B 3JCMb 2QQBA 5I21A 4FIBA 2E10A 3EAEA 4JUVA 5C0MA 5KH6A 2EJ9A 2FB7A 5A0GA 3G6EA 2M0OA 1VQ4A 2C06A 3URGA 2QQSA 4EPCA 1BKBA 3CCQT 5GAMe
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGR B;  2PVD B;  2D0Q B;  2DXB B;  2ZZD B;  2PUO B;  3X26 B;  2ZPI B;  2DD4 A;  2WSC E;  4KT0 E;  2CYZ B;  3A8M B;  3X20 B;  3X24 B;  3X25 B;  2CZ0 B;  2DXC B;  3WVE B;  4RKU E;  4OB0 B;  1QP3 A;  3A8L B;  4OB2 B;  2DXC A;  2DD5 A;  3QXE B;  3A8O B;  2ZPF B;  4ZGE B;  4OB3 B;  4OB1 B;  2DPP B;  3A8G B;  1UGS B;  2PU9 B;  2WSE E;  1JB0 E;  3VYG B;  2ZPG B;  3QYH B;  4ZGD B;  1UGP B;  4XK8 E;  2CZ1 B;  1DJ7 B;  2PVO B;  2DD5 B;  2ZCF B;  2ZPE B;  1UGQ B;  5L8R E;  1V29 B;  1AHJ B;  2CZ7 B;  1IRE B;  3QZ5 B;  3LW5 E;  3X28 B;  4ZGJ B;  1PSE A;  3A8H B;  3VYG A;  4FM4 B;  2O01 E;  4L6V 5;  2ZZD A;  1PSF A;  2PUK B;  3QZ9 B;  1GXI E;  2PVG B;  2DD4 B;  4Y28 E;  2ZPH B;  3QYG B;  2ZPB B;  2AHJ B;  2CZ6 B;  3WVD B;  2QDY B;  3HHT B;  1QP2 A;  2WSF E;  3VYH B;  2DXB A; 
#chains in the Genus database with same CATH topology
 2PVD B;  4J7F A;  1WPY A;  2DTI A;  2FHD A;  4ME7 A;  1GCP A;  1I0C A;  2KXD A;  4I3Z B;  2H8H A;  5GAN h;  1RAE B;  4RCC A;  4LDW A;  4BBS M;  3NGP A;  4DEY A;  2C4G B;  4QKU A;  5CVI A;  4DQ2 A;  2GCX A;  4A4F A;  3CC7 Q;  4FSX A;  2FG0 A;  4M75 F;  1I4K 1;  2I53 A;  2BZY A;  3V7C A;  2OTL T;  2OTJ A;  4PL6 A;  4AFU C;  2DLP A;  3CCE Q;  1NLP C;  1W2B S;  1UB4 A;  1SG5 A;  3H9N A;  2M51 A;  2W9Z A;  4PJO D;  4Y72 B;  2P4T A;  3HTR A;  3OYI A;  1GBQ A;  4ZGE B;  3RMS A;  4AMC A;  3QJY A;  1BYM A;  1QVP A;  1HD3 A;  2E5K A;  1WHJ A;  2C0O A;  2J6F A;  3DLM A;  1VQN A;  2RM4 A;  3FDR A;  4XQ3 A;  2HMA A;  4CC4 B;  1JST B;  3I9Q A;  1WHM A;  5EC7 A;  2XHC A;  6AT1 B;  2VXE A;  3E9F A;  2G6F X;  3LX7 A;  1H25 B;  2C5N B;  1W2B P;  3CD6 A;  1M2V B;  4N0A A;  4QW2 A;  1W4S A;  2YRD A;  2YRV A;  2M0Y A;  2LZ6 B;  3OYJ A;  1M1F A;  4RMO A;  3PE0 A;  4M7D F;  2L0A A;  2WJ9 A;  3OYC A;  2X4W A;  4EOO B;  1TTH B;  5ICP B;  3BHV B;  1YJ9 T;  1GL5 A;  2O9V A;  2OJ2 A;  1Y7X A;  2EQI A;  2YLB A;  1VQP T;  4EC8 B;  4C0D C;  3QDF A;  2KMT A;  2DME A;  2MF2 A;  5HVY B;  2LCC A;  3CMA Q;  3MI9 B;  2DL7 A;  4DBH A;  4IUP A;  4M7D E;  4CC7 A;  3NPF A;  4TVR A;  1K0X A;  3CCL A;  3EOC B;  2R5A A;  2LT4 A;  4M7D A;  3SWN A;  1GCQ C;  5FU7 B;  2QK0 A;  2V8K A;  2F69 A;  5LJ3 j;  2IVX A;  3H0F A;  1B3Q A;  1KQS A;  1KK7 A;  2QTX A;  3PNW C;  5KYU A;  2F2V A;  4BCP B;  1KC8 U;  3OW2 P;  2PTK A;  1N9R A;  4KGZ B;  2RI2 A;  4PFO A;  1NBE B;  3WVE B;  2KT8 A;  1W2B A;  1M1K R;  4C8Q B;  4J9H A;  2EPD A;  3CCV A;  2RN8 A;  1AD6 A;  3HFN A;  1QKX A;  3PIO A;  1X6G A;  2DXC A;  1I1J A;  3RDV A;  3QXE B;  3JB9 H;  2DBK A;  1I81 A;  3OYM A;  7AT1 B;  4HL4 A;  1LJO A;  4AI6 A;  1U1S A;  3RKW A;  3CCU T;  3O5Z A;  3R6N A;  4C5G A;  2M9U A;  5IN1 A;  3VS7 A;  3EFO A;  1RL2 A;  2EGC A;  4FYW B;  4QT7 A;  1EIF A;  5LJ3 g;  4TTH A;  1IO6 A;  2RQW A;  2QEX Q;  1PRM C;  2E1H A;  5GAM d;  1U3O A;  1YCY A;  1NE8 A;  4FW1 A;  2XMF A;  2C6T B;  1UHF A;  2BIV A;  4KUL A;  1MHN A;  1EX4 A;  3FC3 A;  2LP5 A;  1M2O A;  2VAS A;  3T9N A;  3L2Z A;  4LXC A;  3SWN C;  2O4X A;  5GJV B;  1KFZ A;  4FL6 A;  1FKM A;  1YIT A;  2ECZ A;  2DTO A;  1QVF P;  4PJO C;  3NTK A;  3P8D A;  2FRW A;  3RKX A;  4B9X A;  3AT1 B;  2RHU A;  1WQ7 A;  2LTO A;  3NFC A;  4FCY A;  4PJJ A;  3MP8 A;  2WEV B;  2CZ6 B;  4OMO A;  3DDP B;  3HHT B;  2XG8 D;  5IT9 E;  4HNT A;  2DYB A;  2CRE A;  2DEU A;  3B57 A;  3JCM J;  1YJ9 A;  5LJ3 d;  3O8V A;  4JPB W;  3JCM f;  3CPW P;  2K3B A;  2A36 A;  5GAN 2;  3HRU A;  3REB B;  1W6X A;  2DVE A;  2WSC E;  3PGG A;  2LCL A;  2JW4 A;  1VYV A;  3G71 T;  4BXX X;  2JT4 A;  5IHK A;  1R0C B;  3KUF A;  4BY6 B;  3HP9 A;  2KYM A;  3CBM A;  4BE0 A;  1M3C A;  3EH2 A;  3TRE A;  1XOV A;  5FRM A;  5HBE B;  1E7O A;  5KYX A;  3CCV T;  2OAU A;  4LDU A;  1H1P B;  2KAF A;  1VUB A;  4PKC C;  2I2L A;  3JRZ A;  5GAN 5;  4KGX B;  1WJS A;  5KYY A;  4RTX A;  2Y90 A;  1AT1 B;  2X51 A;  4HVV A;  4M7A G;  2DRM A;  2HD0 A;  4XTW A;  4HT9 A;  1ZSG A;  3EID B;  2DXT A;  1PKD B;  3G7Z A;  5ACB A;  2GTJ A;  4WTO B;  4AFS C;  2L3Q A;  1AWJ A;  3BLQ B;  1GCQ A;  1KC8 C;  3JV3 A;  2RHX A;  3CCR A;  1QLB A;  2QEX T;  2V22 B;  1BIA A;  2X1N B;  3EGD A;  1UGP B;  4OVA A;  3N5B B;  3JB9 D;  1V1C A;  1RAA B;  2ZCF B;  5GMK l;  2B9R A;  4EOJ B;  4D6W A;  3M4Y A;  2WXV B;  2V26 A;  4HCK A;  3QZ5 B;  1T0J A;  5D6X A;  2DL4 A;  5CKD A;  1WZO A;  3VYG A;  1N8R U;  2O01 E;  2GF7 A;  1O9K B;  1KC8 R;  3M56 A;  5AT1 B;  2J05 A;  2E41 A;  3CCQ A;  3JCM P;  2DIL A;  4VUB A;  1TOV A;  5A2Q E;  2QGF B;  3G6E T;  4Z8A A;  4EOR B;  4RTY A;  4F7U F;  3MY1 B;  2JNG A;  5LJ5 f;  2MIO A;  3CCJ A;  2RK2 A;  2UUE B;  1OZ3 A;  2QA4 A;  4NST B;  4AKG A;  1QMZ B;  3EFS A;  3JCM c;  4OMM A;  2DM1 A;  3EGX A;  3GLX A;  2YXY A;  4BY1 X;  2JGZ B;  2D6F A;  2H3J A;  1JBM A;  3D7S B;  2D0Q B;  4E6R A;  3BFM A;  5KYY B;  3MO8 A;  2LRQ A;  3H41 A;  3M57 A;  3TNW B;  3BG9 A;  3TSZ A;  5GMK h;  2YRC A;  1TD6 A;  4BDZ A;  2CP0 A;  2OTL Q;  1PRL C;  3H4C A;  1BI1 A;  1ABO A;  1X43 A;  2CGH A;  3X25 B;  2CZ0 B;  2EYZ A;  2R57 A;  4CC3 A;  1SEM A;  5KYX B;  1OL1 B;  1TUC A;  1VQO Q;  1NYG A;  4GLK A;  4HLQ A;  1AWX A;  4CFX B;  1KHI A;  1JJ2 A;  1OZ2 A;  3QYE A;  4CRL B;  4C92 F;  3L2Q A;  4BD3 A;  1QWE A;  4BY7 X;  5IHI A;  3I56 Q;  1I5L A;  4FYY B;  1QCF A;  4ORZ A;  4HA8 A;  4CFU B;  3SWN B;  4F04 B;  5GAO p;  1HYO A;  2AIR B;  4EC9 B;  4ZN3 A;  4UC4 A;  2PJQ A;  2DVJ A;  2QAZ A;  4PK4 A;  5I5Z B;  1M90 U;  2UZL B;  2VGM A;  2MCN A;  2KBT A;  2CP2 A;  4M7D B;  2Y4Y A;  2WPA B;  1OQK A;  3SFM A;  1QWF A;  3LWH A;  3PVQ A;  3OYF A;  2DJQ A;  2JVV A;  3M0R A;  2NUT B;  3LW5 E;  3X28 B;  5CKF A;  3RES A;  4M77 G;  3HRT A;  2YT6 A;  3CCE A;  1AIS B;  1HSQ A;  2XK0 A;  3HL8 A;  2ZZD A;  1G2B A;  1PSF A;  1FIN B;  3M0T A;  1H1S B;  1D0Z A;  1UUE A;  4OMF B;  1TXQ A;  1LOJ A;  1Z9Z A;  1D0Y A;  1U06 A;  2I40 B;  2X4J A;  4P5N A;  3E2U A;  3PMI A;  3OSV A;  1OIY B;  1X2Q A;  3HPW A;  1GUX A;  5DY9 A;  4XTU A;  2O4X B;  5FU6 B;  2DMO A;  2AHJ B;  2VWF A;  3QO3 A;  2RQU A;  4J6W A;  1T3S A;  1GUX B;  2G9X B;  1YP5 A;  1I8F A;  2EAY A;  3LH5 A;  4JDS A;  3QWY A;  2K6D A;  3JCM b;  2QQB A;  1ENW A;  4FIB A;  2DFU A;  2MOX A;  3BHU B;  1VQ4 A;  2ENM A;  2M0O A;  2SRC A;  2QQS A;  4E7Z A;  3CCQ T;  2KE9 A;  2KK4 A;  1IXD A;  1SPK A;  3EG3 A;  4F14 A;  4E7H A;  1OI9 B;  4MZT A;  5CO7 A;  2NWM A;  3PTA A;  1C1A A;  3JB9 J;  3CC2 A;  4HT8 A;  5FRN A;  4AFZ C;  1E6H A;  2ZPI B;  2EBP A;  1VQO T;  2JM9 A;  2GFU A;  3X20 B;  1QW1 A;  3X24 B;  1I07 A;  3CPW S;  5GAO r;  1SHF A;  1TS9 A;  2LJ0 A;  3RMQ A;  4EOS B;  4R55 A;  4BI4 A;  3VS2 A;  4OB0 B;  4BCG B;  4M78 F;  5FWB A;  5GAO l;  2EIF A;  2EWN A;  4CFV B;  4C0D B;  3CC4 Q;  4EOI B;  4J9F A;  2XU8 A;  1ZA2 B;  1VQ8 Q;  2NUP B;  2RF0 A;  2ZPF B;  3BG3 A;  3PIP A;  1K9M R;  1VQN Q;  2KSS A;  4RTW A;  2YWW A;  4M7A D;  1Q86 R;  1TH7 A;  2AKK A;  3HO8 A;  1R0B G;  5CR2 A;  4E7J A;  1QKW A;  3GOX A;  1S72 Q;  3INZ A;  3FLG A;  2BZX A;  2VVK A;  4XK8 E;  8AT1 B;  1H8K A;  3DB4 A;  1CKB A;  1YFN A;  2M02 A;  3BG5 A;  1JO8 A;  1WQW A;  3JB9 I;  2F5K A;  4ZGJ B;  4M77 F;  3VS5 A;  4F7U E;  2MPX C;  2JMC A;  4XU1 A;  4JRP A;  1WA7 A;  2JS0 A;  4MFD A;  3TVT A;  5KYW B;  2X3W D;  3EJ1 B;  4UN0 A;  3VUB A;  2V8I A;  4ESR A;  4CRI A;  2RHY A;  5GMK j;  3CXC S;  2COZ A;  3QWX X;  4X1V A;  1KD1 C;  5LJ3 e;  2CSQ A;  2X4Y A;  4A4K A;  3GIB A;  4KRT A;  1VQ6 A;  4OGE A;  1QVF A;  1YJW T;  2AT1 B;  2KY9 A;  4KUI A;  4MFE A;  3UT1 A;  2PUO B;  2EGE A;  4F6W B;  2LJ3 A;  3E1S A;  1VQL Q;  1FXX A;  2DE0 X;  2F1L A;  2YUO A;  3GNG A;  2DA9 A;  3PT9 A;  2DD4 A;  3JCM X;  2E6N A;  3MEU A;  2CUB A;  1QCO A;  3CCV Q;  1JSU B;  4D8D A;  1WJR A;  4PLL A;  5LJ5 g;  1IGU A;  2B8A A;  3G33 B;  1QQJ A;  2A08 A;  4BCQ D;  3M55 A;  1OPK A;  4MZP A;  1OV3 A;  1UEC A;  2R58 A;  2XD0 A;  3I55 T;  3R6O A;  1H24 B;  4Y92 A;  4Z89 A;  4O5V A;  2X9H A;  3VS6 A;  3OS2 A;  1OEB A;  3JCM g;  2LQW A;  4CXA B;  2K5I A;  4IUR A;  3CPW A;  1U8R A;  4NL2 A;  1VQ9 Q;  2BZ8 A;  2CS7 A;  4NC6 A;  2GQI A;  1PM3 A;  1W1F A;  2JN0 A;  1N4M A;  4F6S B;  3OW2 A;  4IKF A;  2E4H A;  1VQ4 Q;  1WX6 A;  1B34 A;  1Q81 C;  2P0P A;  2RJF A;  5GJW B;  1MMA A;  3HZJ A;  1PNJ A;  1X27 A;  5IXF A;  1PD1 A;  1GY3 B;  4CC2 A;  1NPR A;  1T0H A;  4R56 A;  2FL7 A;  4QVC A;  2LCS A;  2VV5 A;  3THK A;  1WHH A;  1ZSZ A;  2RA2 A;  1IRE B;  2E3H A;  3OBY A;  2A7Y A;  1SRM A;  4ELZ C;  3O0G D;  3ZFJ A;  2G3R A;  4L6V 5;  1YI2 A;  3QBY A;  1XO2 A;  4II1 A;  5HCK A;  2GNC A;  3PVL A;  2ZPH B;  1VQ6 T;  3C4S A;  1M1K C;  1M9S A;  5CK9 A;  2EYW A;  2F2C A;  3CC4 A;  4RG2 A;  4M77 E;  4QQG A;  4RUG A;  5LQF B;  1WHL A;  2AZS A;  3UWN A;  1JXM A;  5LJ3 f;  4AG1 C;  1VQ4 T;  5GMK m;  5HNB B;  1R77 A;  1ZUK A;  3OA6 A;  4IIO A;  1VOM A;  3H8Z A;  4R0K A;  2I0N A;  1JOW A;  2NUT A;  1VYW B;  3QYB A;  3I5S A;  2RH2 A;  4F7U B;  5GAO n;  5LL6 S;  1BI2 A;  2ED0 A;  2NYS A;  1OU8 A;  3OYL A;  3C95 A;  2BE9 B;  3X26 B;  2EQJ A;  4F7U A;  4DA4 A;  2UZD B;  4JJD A;  3J80 E;  3I55 Q;  1RAB B;  3QDR B;  1IB8 A;  3CCU A;  4EOL B;  3EG2 A;  2LMJ A;  3G1J A;  1JJ2 S;  2JXB A;  1M2V A;  3P8H A;  3BY7 A;  5I2S A;  3UPU A;  4Z02 A;  2QA4 Q;  1K73 C;  4BE2 A;  2RI3 A;  2QDJ A;  2V1R A;  1TFB A;  4CFN B;  2YUQ A;  2XDB A;  3QUI A;  5KYN A;  3MEV A;  4OB3 B;  3OW2 S;  2LJ1 A;  5I22 A;  1ACM B;  2L2P A;  2ROL A;  2L89 A;  3VYG B;  5GAM j;  2D1X A;  2J06 A;  4A53 A;  3TU4 K;  4J7I A;  4JX6 A;  3CME Q;  1DJ7 B;  2C0I A;  2PVO B;  3HKS A;  1AD5 A;  4JJN K;  4E2F B;  4BCJ B;  5EFQ B;  3RER A;  3HBL A;  3H6Z A;  1M90 R;  1O75 A;  5KYU B;  2EQM A;  1VQ9 T;  4JZ3 A;  3QKJ A;  4WCI A;  4PJO F;  3JAM E;  1Q7Y C;  2DZ9 A;  3CCM Q;  3CC2 Q;  1D1B A;  3VUZ A;  2JS2 A;  4J5Y A;  1WJQ A;  3CC2 T;  1W70 A;  2LDM A;  4BCN B;  2IW6 B;  1EZZ B;  1R8O B;  2HSP A;  1D3B B;  2IN3 A;  3Q1J A;  3BDU A;  4JRI A;  1H1Q B;  5CYI B;  4K11 A;  2BS2 A;  3PO3 S;  3MP6 A;  1YWO A;  2IW8 B;  1S72 T;  1V76 A;  5GAM f;  3CD6 T;  2V8J A;  2VXF A;  2B86 A;  3RBB B;  1VQL T;  1HJD A;  1Z9Q A;  1OPL A;  2K79 A;  2DO3 A;  4C5H A;  3G4S Q;  2KEA A;  3ASK A;  2ESW A;  5HK3 A;  3VU3 C;  9ATC B;  5GAO m;  2C0T A;  2E5Q A;  3OYH A;  4EOP B;  1B07 A;  2FVU A;  3CCJ T;  2XDD A;  1VQN T;  4HKE A;  1ZA1 B;  3G4S T;  2J7I A;  2K2M A;  4PFZ A;  3HSB A;  2RO0 A;  3M4G A;  3TW6 A;  3CCE T;  1IGQ A;  4OP0 A;  5GAM g;  3OSS C;  4M7A E;  1P92 A;  3CCL Q;  2WMA B;  1GFC A;  4AKI A;  4LN2 A;  3DJB A;  3I5R A;  2OX7 A;  2DXC B;  3GF5 A;  1K76 A;  4YOO A;  4PJN A;  1ZSZ B;  1URC B;  1JXO A;  1YJN A;  1VOL A;  5LJ5 h;  1ZUU A;  5CKH A;  2E65 A;  2GQV A;  3CCM T;  2LC4 A;  1C9B A;  1K8A U;  2DYI A;  1M3B A;  3K7A M;  1SSH A;  3CCR T;  1PKS A;  4CFW B;  2CH4 W;  2M1H A;  2QAS A;  3SB2 A;  4XTZ A;  2MAM A;  2LT1 A;  3TN8 B;  4MZM A;  4ATO A;  1C0M A;  1A0N B;  2EVR A;  4BBR M;  3QYH B;  2KT1 A;  1N5Z A;  3M03 A;  4XTY A;  5KCH A;  1VQ6 Q;  5DM7 R;  4BUG A;  1BB9 A;  2HKQ B;  4J9D A;  3RGF B;  3MEA A;  3GBQ A;  2CZ7 B;  4EIK A;  5HBJ B;  3RIR A;  5FRO A;  5CQX A;  4JRQ A;  4KRC B;  2DNU A;  2JJ9 A;  1UGV A;  3CCS A;  1WNL A;  1UDL A;  1WXT A;  2QF7 A;  2EJF A;  2K3Y A;  1YIJ A;  3M53 A;  2LVM A;  2QA4 T;  2WHB B;  3OBW A;  4N4H A;  4Y28 E;  1VIF A;  1D0X A;  1UNH D;  2NUP A;  4LD6 A;  5FU6 C;  1MMG A;  3MET A;  4QQ6 A;  1ZLM A;  4IUT A;  2KI7 A;  2W0Z A;  3CQT A;  1OL2 B;  3ULR B;  4MIM A;  4F16 A;  2EQU A;  4C92 B;  4F7N B;  5I21 A;  2E10 A;  4OMQ A;  2EJ9 A;  2FB7 A;  5A0G A;  1RAD B;  5IHY A;  2C06 A;  3URG A;  4EPC A;  4M75 G;  4HXJ A;  4BCI B;  1WHK A;  2BS3 A;  4CFU D;  4F7L B;  1RI9 A;  2LQK A;  5IAY A;  5FU7 C;  1K73 R;  2KDS A;  2AKL A;  4M4Z A;  1Q82 C;  4OGR B;  2DX1 A;  3FB9 A;  1AWW A;  1WGS A;  1IHV A;  4J9C A;  4BCH B;  3QII A;  5KYW A;  2EYX A;  3DDQ B;  4B9W A;  4J8O A;  3DTO A;  1H26 B;  2Y4X A;  3FRN A;  2DD5 A;  1YI2 Q;  4E7S A;  2IIM A;  4MDX A;  3C12 A;  2JTE A;  2KXC A;  2IVW A;  2DPP B;  1MND A;  3LQ5 B;  3OYB A;  1UGS B;  2UZB B;  2X4X A;  5GAN 4;  5DQW A;  1X6O A;  2CCI B;  2COY A;  1JB0 E;  1LVK A;  2A0F B;  4PJO E;  1PKT A;  1VQM Q;  4BB7 A;  4C0Z A;  3P8B B;  4ROE A;  2QG9 B;  1CSK A;  2RD1 A;  1YHQ A;  2XI9 A;  3SD4 A;  1V29 B;  2PZ1 A;  4FT4 A;  4XTX A;  5GAN f;  2PK9 B;  3I56 T;  4QVD A;  4M78 B;  2FRY A;  3DL1 A;  4C8Q D;  3I35 A;  5GMK e;  2DL8 A;  1ZP2 A;  4J9E A;  1MUZ A;  4BCO B;  2DET A;  1OU9 A;  1VYT A;  1JU5 C;  3VRY A;  1NJI R;  4RTZ A;  1U5S A;  3JCM e;  3TW7 A;  2C5X B;  3EHR A;  1LNX A;  3VKH A;  1QCN A;  3OYA A;  2BPM B;  1X69 A;  3QYG B;  2KQW A;  4OGC A;  1G5V A;  4JX4 A;  1Y71 A;  1W98 B;  4OML A;  4M78 G;  1TUD A;  2CKK A;  2VKN A;  4MML A;  2WFY B;  1K8A C;  2LX7 A;  4EDU A;  4JLI A;  1M1K U;  3JCM d;  2BE7 D;  1KQS S;  2EW3 A;  1VQ7 A;  4WF2 A;  3TQ7 P;  2A37 A;  1JJ2 P;  2DKG A;  3L1A A;  3L42 A;  1BK2 A;  1UJ0 A;  3FJP A;  4EOQ B;  3CCJ Q;  5I2M A;  1MV0 B;  2FZK B;  4ZTJ A;  1WYX A;  4M77 D;  5I11 A;  1G3T A;  1OI1 A;  3CME A;  1FYN A;  3OYG A;  5GAN 3;  2QGG A;  2DJZ A;  4OMN A;  2YLC A;  3KFV A;  3FEO A;  3HFO A;  3F5X B;  4E47 A;  1NPP A;  3RUX A;  4ELL A;  1YIT Q;  2CUD A;  5CKB A;  2DIG A;  3OB9 A;  2XIC A;  1H4L D;  1H92 A;  2CP5 A;  3EFO B;  3M0Q A;  2YUN A;  4M7A F;  5D6Y A;  4KUD K;  1JQQ A;  1IHW A;  1QMC A;  3A8G B;  1HK9 A;  3EG9 A;  2YHT A;  2KRS A;  2K7A A;  3MP1 A;  3VKG A;  2EGA A;  4AT1 B;  3LYI A;  4RTU A;  1VQM T;  1ZHI A;  2P0Q A;  3I55 A;  2HAX A;  1RUW A;  2GGR A;  1PCX A;  2YDL A;  3OY9 A;  5L23 A;  1KJW A;  4V2S A;  4KGV B;  1Q86 C;  3VS1 A;  4JS5 A;  1Q82 U;  1LPL A;  4HVW A;  4D8K A;  4PNO A;  4LDX A;  1B7T A;  2P0K A;  4M7A A;  3LLR A;  3OYE A;  1HXD A;  1UFF A;  2RB6 A;  4NOY A;  1RAC B;  4BCQ B;  2VC8 A;  4C8Q G;  1KD1 U;  3MY5 B;  4M75 A;  5D6W A;  1TSF A;  1E7P A;  2HBW A;  2L3S A;  3CC7 T;  1NZ9 A;  4EON B;  1PD0 A;  3VS3 A;  4BI8 B;  2EJG A;  2D9T A;  2FPD A;  4AG2 C;  4PJO A;  2D8J A;  4M77 C;  5CCA A;  4BAC A;  5CKE A;  2BTT A;  1JRI A;  3CCR Q;  2GFA A;  4QQD A;  3CCQ Q;  2MK5 A;  1IZ6 A;  3CCU Q;  1KXU A;  3KBG A;  1XQH A;  4M7D D;  1N27 A;  1Y07 A;  2FPF A;  1K9M U;  4ANJ A;  2RHZ A;  2JZ2 A;  1TU0 B;  3MHX A;  1NYF A;  3V8L A;  1J3T A;  1KD1 R;  1NM7 A;  4FSS A;  1ZUY A;  4M78 D;  4X9D A;  2EKO A;  4LDY A;  4KRD B;  1M4Z A;  3EG1 A;  1WXU A;  3CEY A;  4FX3 B;  2RJE A;  5FWC A;  4IMY B;  4ELJ A;  2ABL A;  2WAC A;  2JMA A;  1YWP A;  1UE9 A;  3A5Z B;  4OB2 B;  2HQE A;  5DQV A;  3A8O B;  2OI3 A;  1YIJ Q;  2XDP A;  1ZBX A;  2CT4 A;  2ROT A;  1YN8 A;  2OTL A;  1H27 B;  2CJM B;  4C92 D;  5GAM h;  3TNI B;  3GTM S;  4DOV A;  2GBQ A;  3SDZ A;  4J9B A;  1AWO A;  4M75 D;  5CQY A;  3TCJ A;  1U1T A;  3C0C A;  4JJC A;  4RTV A;  3CD6 Q;  3S6W A;  1VQO A;  2E70 A;  1K0S A;  2O2O A;  4C0G A;  2ZPG B;  4JLG A;  1VQ5 Q;  1BI0 A;  2E6Z A;  3UDC A;  5IH2 A;  1UGQ B;  1MGQ A;  3PMT A;  2K9G A;  1MNE A;  1ZQ1 A;  1WDX A;  2RI5 A;  4C0F A;  3REA B;  4KH1 B;  2JOY A;  2HKN A;  2NLU A;  2FPE A;  1RI0 A;  4A4E A;  3C94 A;  2HQH A;  4II5 B;  4XAX B;  4DOW A;  2K3X A;  2W10 A;  1GH6 B;  1S1N A;  3OS5 A;  2ZPB B;  5GMK i;  2CSI A;  1VQ5 T;  1Q82 R;  1RAH B;  2KR3 A;  3L2U A;  5KE3 A;  3HRS A;  2JUF A;  2DF6 A;  4EMG A;  4B6M A;  1K1Z A;  2VUB A;  3I56 A;  1KHC A;  1Y96 A;  5GAN 8;  5LMK B;  2DXB A;  4L5G A;  4C8Q C;  4IUU A;  3BLH B;  5GAO q;  3J7A F;  4J9G A;  1RLP C;  2QQ9 A;  8ATC B;  2DXB B;  2QQ8 A;  3CCS Q;  1SF9 A;  1H28 B;  4ELY C;  3L2W A;  1X2K A;  2SEM A;  1BU2 A;  4QSH A;  5KE2 A;  5A0L A;  2RQR A;  4LNP A;  1CKA A;  2LQN A;  5AYF A;  1YHQ Q;  1PG5 B;  3A8M B;  1NJI U;  1M90 C;  4EMK B;  2L8D A;  4X34 A;  1Y0M A;  4Z88 A;  3EG0 A;  4RKU E;  4M7A C;  5IXB A;  1KIK A;  1M8V A;  1UNL D;  3UF4 A;  4JJB A;  2EYY A;  4IIM A;  2W99 A;  2HQX A;  2QEX A;  4A4H A;  3M54 A;  1YNZ A;  2PQW A;  3BLR B;  4BCK B;  2FZG B;  1XNI A;  1VIN A;  1FWZ A;  2BS4 A;  2FYK A;  1OX9 A;  5D7U A;  2CT3 A;  4BCM D;  4XU0 A;  2VB6 A;  4ZGD B;  2K2V A;  2RHI A;  2BKD N;  1PHT A;  1D3B A;  1VQ7 Q;  2R7G A;  4LUD A;  5CEI B;  3M0S A;  4C8Q A;  3MEW A;  2DRK A;  2PNI A;  4RG8 A;  3S3N A;  4FM4 B;  1K4U S;  1FMW A;  2PUK B;  4F7J B;  5A0D A;  1NEB A;  4C92 A;  4YOS A;  3OS0 A;  4J9I A;  1S72 A;  4ZNX A;  2AZV A;  2DD4 B;  5J26 A;  3JCM h;  3M0P A;  1VQ5 A;  1SKU B;  1BU1 A;  2ZGW A;  2LX9 A;  3G71 Q;  3V8J A;  4ZTF A;  2HEQ A;  1G3Y A;  2DAQ A;  3EFR A;  1FMV A;  1JKW A;  4M78 A;  4BI3 A;  3OS1 A;  5M9O A;  1H3Z A;  3OYY A;  3OYN A;  1QP2 A;  3BW1 A;  3CXC P;  3EG9 B;  4JUV A;  5KH6 A;  1BKB A;  3GP8 A;  2LW4 A;  5GAM e;  4M78 E;  1FMK A;  3CBP A;  2HNI A;  5IHN A;  2K5F A;  3VRZ A;  2C5V B;  5DLQ E;  2CCH B;  4LE9 A;  1G3N C;  2LNV A;  2RQT A;  1OGU B;  3A98 A;  3CBO A;  3DKM A;  1YIT T;  2C5O B;  2A28 A;  1PC0 A;  2K4Y A;  4BDY A;  2KVQ G;  4N4G A;  2V1Q A;  5IDP B;  2K5L A;  2LNH B;  2OAW A;  4GLM A;  1Y57 A;  3S3O A;  1YJN T;  5IDN B;  1F1B B;  2L3P A;  2W2H A;  1WFW A;  2CH4 A;  4LDV A;  3EGX B;  2QTV A;  1VQK T;  1KQ2 A;  4HVU A;  3OYD A;  4C92 G;  3OMC A;  1VQM A;  2DIQ A;  4OB1 B;  1YJW Q;  1OIU B;  1K73 U;  4DBQ A;  1ZX6 A;  2PU9 B;  5FLX E;  1NJI C;  4BCM B;  1BI3 A;  1GRI A;  4YTL A;  4ROC A;  1X75 C;  2MWO A;  1JEG A;  3NTH A;  2XKO C;  4M78 C;  4PFP A;  1K8A R;  1AOJ A;  1QVF S;  3KHI A;  1WXB A;  3QHR B;  1G3W A;  5L8R E;  3G6E Q;  2W9F A;  5HY6 A;  1K9M C;  1O9S A;  2Z0W A;  1VQL A;  1AHJ B;  3EGD B;  4PJL A;  2E64 A;  4M7D C;  1PSE A;  1E6G A;  2YSQ A;  3FJ5 A;  2JTF A;  2KRM A;  1Y96 B;  4EMH A;  2DK3 A;  3QZ9 B;  5HBH B;  2MMP A;  2X3X D;  3CC7 A;  5FW9 A;  2VGN A;  1KSW A;  4Q5W A;  5KCO A;  4F7S B;  3RNJ A;  4M75 C;  3V8K A;  2F2W A;  1MV3 A;  2NUZ A;  1VQ8 A;  3TEE A;  2IW9 B;  3CCL T;  1YBY A;  2QFZ A;  3JB9 G;  4BE1 A;  4FT2 A;  1UEB A;  1VQ9 A;  3WVD B;  2R5M A;  3BHT B;  3RR6 A;  4EMK A;  2G77 A;  1H64 1;  1WIE A;  1AEY A;  2J6K A;  4DEX A;  1OKW B;  2KR6 A;  4LD9 K;  4Z6Y A;  2ZZD B;  2FEI A;  1M3A A;  1VQ8 T;  2QI2 A;  1RAG B;  4J83 A;  1YI2 T;  1QLY A;  3QJ6 A;  2COW A;  3CMA T;  2QQA A;  5EJC A;  4EOK B;  4C92 E;  2D8H A;  4AKH A;  5FGK B;  5BNJ B;  1G83 A;  1N9S A;  4J6Y A;  1VQP Q;  1TWB A;  3DOG B;  2PK2 A;  3LGL A;  3DLL A;  4E7I A;  1Q81 U;  1QVG A;  1FX7 A;  1I5O B;  4C92 C;  2WIH B;  2KYB A;  4HNV A;  1H3H A;  2HZY A;  3ER0 A;  4NS5 A;  3NTI A;  4E7K A;  2PHG A;  3UA7 A;  1KQ1 A;  3G71 A;  2MI6 A;  4RTT A;  1D1A A;  2E12 A;  2F5T X;  5GAN j;  2ATC B;  1OUL A;  2L3R A;  3QG1 A;  3JSC A;  4ROD A;  2WSE E;  4XU2 A;  3NHN A;  2DL5 A;  3CME T;  5DLO A;  4F7U G;  3RKY A;  4E7L A;  3CMA A;  1UTI A;  1KQS P;  3POM A;  4OMP A;  1VQK A;  4N4I A;  2FO0 A;  4EOM B;  1NEG A;  3ME9 A;  2ZPE B;  2P84 A;  1N8R C;  4HCC A;  3PFS A;  2RK1 A;  1YJW A;  1T3L A;  1P5E B;  3MKD A;  4C5E A;  1G8X A;  3U23 A;  2OTJ Q;  1M30 A;  4OR5 B;  1UG1 A;  2DBM A;  4KBM B;  3CC4 T;  2BKZ B;  3ZBD A;  3FIF A;  3TNH B;  4M75 E;  5ECA A;  1AZE A;  3F70 A;  1M5Q 1;  3H0H A;  1MMN A;  1GXI E;  2PVG B;  3E19 A;  4FYX B;  1VYU A;  3IQL A;  2ED1 A;  1X01 A;  2O9S A;  2K57 A;  4F70 B;  3OMG A;  1VQ7 T;  5LJ5 j;  3QSU A;  2UZE B;  2MYS A;  3HB9 A;  4DBR A;  2CDT A;  1OYX A;  3GNF B;  4A4G A;  4PJM A;  2HL3 A;  3BDL A;  1ZSZ C;  3CXC A;  1C6V X;  4A54 A;  3H0I A;  2WSF E;  4M7A B;  1H1R B;  1N6A A;  2X35 A;  4XU3 A;  1X6B A;  2DZC A;  5CIU A;  3M9Q A;  4BY6 C;  3DB3 A;  3GPL A;  2W96 A;  2QGS A;  2EKH A;  2RJC A;  4YOZ A;  5EG2 A;  4X9C A;  2HCK A;  2DTH A;  1VA7 A;  4JS4 A;  2EFI A;  1O9K A;  4GY5 A;  2YUP A;  4CFM B;  4G6L B;  4IUV A;  1GBR A;  4Y91 A;  4HCZ A;  5IF1 B;  3E9G A;  2JTM A;  4OF1 A;  1YHQ T;  2FZC B;  4XTV A;  1QP3 A;  1WHG A;  2RMO A;  3UA6 A;  4PJO G;  2QDL A;  1K9A A;  3M59 A;  4PLI A;  1OOT A;  3ZEH A;  4JRK A;  4QVZ A;  3ZL7 C;  2VYT A;  4C8Q F;  2OTJ T;  3A1P A;  4NL3 A;  2HSE B;  2M16 A;  1M27 C;  2KMG A;  4PJO B;  1BIB A;  5GAN e;  5GAN d;  4HCB A;  3QHS A;  1ABQ A;  3QWL A;  2DXU A;  1ARK A;  4YC3 B;  4MDW A;  1Q7Y U;  2LQ8 A;  1NLO C;  2HDA A;  2CZ1 B;  2CP6 A;  3MJX A;  2DD5 B;  2D0N A;  4EMK C;  1GFD A;  2RNA A;  2CP7 A;  1D1C A;  3MCA B;  4J6X A;  1YJ9 Q;  3V7S A;  2KRN A;  3LGF A;  1KG1 A;  1TUG B;  5L2W B;  4F6U B;  3A8H B;  1VQP A;  4RCB A;  3BE3 A;  2L5Q A;  2H3E B;  4HNU A;  4F17 A;  2PMI B;  3M0U A;  4LUE A;  5HKC A;  4FYV B;  1RAF B;  1IRX A;  3QHW B;  2QQR A;  2WMB B;  3L2V A;  1VIE A;  1N8R R;  5CAI A;  1Q95 G;  3LWI A;  2JM8 A;  1M8M A;  4KH0 B;  2EUF A;  3CPF A;  3JB9 F;  1SHG A;  4BCF B;  2ZAE A;  2KNB B;  1WI7 A;  1F5Q B;  5HK0 A;  1BCO A;  2O88 A;  2O31 A;  1AZG B;  3EGU A;  3CCS T;  4DBF A;  1M1G A;  2MWP A;  3M58 A;  3VYH B;  3JCM V;  1RAI B;  3WXM B;  1UGR B;  5J39 A;  5HQ0 B;  2WIP B;  4N0A C;  1EFN A;  3SEM A;  1YIJ T;  3UAT A;  4GBQ A;  1WLP B;  4JZ4 A;  1VQK Q;  1QVG P;  4MMK A;  1AVZ C;  1E9H B;  1PWT A;  2DER A;  4KT0 E;  1RLQ C;  1B34 B;  2CYZ B;  4M7D G;  3LH0 A;  3TSW A;  3OYK A;  3VJP A;  1XJW B;  3AHU A;  2HL5 C;  4M77 B;  4FW2 A;  2RQV A;  3EH1 A;  2DEQ A;  5GAN 7;  3QPH A;  4CI0 C;  5GAN 6;  3J81 E;  2DL3 A;  3NDQ A;  2AK5 A;  3A8L B;  2F2X A;  4M6V A;  3VS4 A;  5LJ3 h;  2HBP A;  1TG0 A;  1UNG D;  3MIA B;  3L2R A;  1QVG S;  4IUQ A;  3KXT A;  1BBZ A;  4BCN D;  2KRO A;  3V7R A;  2CP3 A;  3VKI A;  3VV0 A;  5GAN g;  4M75 B;  3CCM A;  2RJD A;  2J6O A;  1SSF A;  2P4R A;  1BCM A;  1Q86 U;  3SHW A;  3NMZ C;  4FU6 A;  2RPN A;  4LOC A;  4C8Q E;  2EQK A;  5LJ5 e;  1UHC A;  2QXF A;  4O6J A;  2EYQ A;  5LJ5 d;  2A3L A;  5C6S A;  4A63 B;  1SRL A;  4AFQ C;  1OX8 A;  2KGT A;  4JX5 A;  1G3S A;  5J3B A;  2GTO A;  2IPO B;  3S3M A;  1YCS B;  1OKV B;  3M5A A;  3G4S A;  3MPU B;  1YJN Q;  1MMD A;  3EHQ A;  1XTD A;  1ZBJ A;  2BUD A;  4C5I A;  1NG2 A;  3OQ5 A;  4L59 A;  3JCM Q;  1FVV B;  4ZN1 A;  1LCK A;  3JCM W;  2QDY B;  2IG0 A;  1Q81 R;  2XID A;  4M77 A;  2QYZ A;  1Q7Y R;  5C0M A;  3EAE A;  3VS0 A;  3G6E A;  1D09 B;  1UJY A;  2E3I A;  1D3U B; 
#chains in the Genus database with same CATH homology
 2KK4 A;  4M78 E;  2PVD B;  4J7F A;  4E7H A;  2BS3 A;  1WPY A;  2DTI A;  2FHD A;  2HNI A;  2K5F A;  3CBP A;  4ME7 A;  4MZT A;  5CO7 A;  3PTA A;  3JB9 J;  3CC2 A;  4HT8 A;  5FRN A;  5GAN h;  4RCC A;  5DLQ E;  4LDW A;  2LQK A;  4BBS M;  5FU7 C;  5IAY A;  2KDS A;  2LNV A;  2ZPI B;  5CVI A;  4DQ2 A;  2GCX A;  3CBO A;  1VQO T;  3DKM A;  1YIT T;  1Q82 C;  2K4Y A;  4A4F A;  3FB9 A;  1WGS A;  2KVQ G;  4FSX A;  4BDY A;  2GFU A;  4N4G A;  3X20 B;  1QW1 A;  3X24 B;  4M75 F;  1I4K 1;  3CPW S;  5GAO r;  3RMQ A;  3QII A;  2K5L A;  4R55 A;  4BI4 A;  3V7C A;  2OTL T;  4OB0 B;  4M78 F;  4PL6 A;  4J8O A;  4B9W A;  3S3O A;  1YJN T;  2OTJ A;  5GAO l;  2EIF A;  2EWN A;  4LDV A;  2Y4X A;  4C0D B;  3FRN A;  2DD5 A;  4MDX A;  1VQK T;  2XU8 A;  1UB4 A;  1W2B S;  1KQ2 A;  3C12 A;  3PIP A;  2ZPF B;  3BG3 A;  4C92 G;  2P4T A;  3OYD A;  4PJO D;  3OMC A;  3OYI A;  1VQM A;  4ZGE B;  3RMS A;  2DIQ A;  4OB1 B;  2IVW A;  2KSS A;  3QJY A;  2DPP B;  3OYB A;  1K73 U;  4M7A D;  1BYM A;  1UGS B;  2PU9 B;  1TH7 A;  2X4X A;  5FLX E;  1QVP A;  5GAN 4;  3HO8 A;  1X6O A;  1NJI C;  5CR2 A;  1JB0 E;  1BI3 A;  4E7J A;  4PJO E;  3GOX A;  4YTL A;  2MWO A;  1X75 C;  3DLM A;  3INZ A;  4BB7 A;  2RM4 A;  3FLG A;  3NTH A;  3P8B B;  4C0Z A;  1VQN A;  2XKO C;  3FDR A;  4XK8 E;  2RD1 A;  4M78 C;  1YHQ A;  2XI9 A;  4XQ3 A;  1QVF S;  3KHI A;  3DB4 A;  3SD4 A;  2XHC A;  1G3W A;  2VXE A;  5L8R E;  5HY6 A;  1V29 B;  4FT4 A;  4XTX A;  1O9S A;  3E9F A;  5GAN f;  3I56 T;  3BG5 A;  1AHJ B;  1WQW A;  3LX7 A;  4QVD A;  1VQL A;  3JB9 I;  3CD6 A;  4M78 B;  3DL1 A;  2F5K A;  4C8Q D;  4N0A A;  2E64 A;  4ZGJ B;  4M7D C;  4QW2 A;  1W4S A;  1PSE A;  2YRV A;  4M77 F;  5GMK e;  4F7U E;  2JTF A;  1M1F A;  3OYJ A;  4RMO A;  1Y96 B;  4EMH A;  4XU1 A;  4M7D F;  2DK3 A;  2WJ9 A;  4JRP A;  3OYC A;  3QZ9 B;  2X4W A;  2MMP A;  3JCM e;  3CC7 A;  3TW7 A;  4MFD A;  2VGN A;  1LNX A;  3VKH A;  3OYA A;  2KQW A;  4OGC A;  3QYG B;  4Q5W A;  5KCO A;  1YJ9 T;  1G5V A;  4JX4 A;  1Y71 A;  1Y7X A;  4M75 C;  3V8K A;  4M78 G;  3VUB A;  2V8I A;  1K9M C;  1VQ8 A;  2CKK A;  3TEE A;  2YLB A;  4CRI A;  3CCL T;  1YBY A;  4MML A;  2QFZ A;  1VQP T;  3JB9 G;  2RHY A;  5GMK j;  4BE1 A;  4C0D C;  1K8A C;  4FT2 A;  2KMT A;  2MF2 A;  3CXC S;  2LCC A;  4EDU A;  4JLI A;  1UEB A;  1VQ9 A;  3WVD B;  1M1K U;  3JCM d;  2R5M A;  1KD1 C;  5LJ3 e;  1KQS S;  2X4Y A;  4IUP A;  1VQ7 A;  4WF2 A;  4EMK A;  4M7D E;  4A4K A;  2G77 A;  3GIB A;  1H64 1;  1VQ6 A;  4OGE A;  2DKG A;  4TVR A;  3L1A A;  1QVF A;  3L42 A;  1YJW T;  2KY9 A;  3FJP A;  2KR6 A;  5I2M A;  3CCL A;  4LD9 K;  4Z6Y A;  4KUI A;  2ZZD B;  4MFE A;  2R5A A;  3UT1 A;  2LT4 A;  2QI2 A;  1VQ8 T;  4M7D A;  2PUO B;  4J83 A;  3SWN A;  1YI2 T;  5FU7 B;  3E1S A;  2V8K A;  4ZTJ A;  1FXX A;  2F69 A;  3GNG A;  3PT9 A;  3QJ6 A;  3JCM X;  2DD4 A;  4M77 D;  2E6N A;  3MEU A;  5LJ3 j;  1KQS A;  3CMA T;  2QTX A;  1G3T A;  3PNW C;  2QQA A;  1WJR A;  4PLL A;  1OI1 A;  5EJC A;  5LJ5 g;  4C92 E;  4AKH A;  1N9S A;  4J6Y A;  3OYG A;  3CME A;  5GAN 3;  2B8A A;  1KC8 U;  2DJZ A;  1N9R A;  3M55 A;  3LGL A;  3DLL A;  2YLC A;  4MZP A;  3FEO A;  2RI2 A;  3HFO A;  4E7I A;  1Q81 U;  1QVG A;  3WVE B;  1FX7 A;  2R58 A;  4E47 A;  1W2B A;  1NPP A;  2XD0 A;  4C92 C;  4C8Q B;  3I55 T;  3CCV A;  3RUX A;  4HNV A;  3R6O A;  5CKB A;  2DIG A;  3HFN A;  3OB9 A;  3ER0 A;  3PIO A;  4O5V A;  4NS5 A;  2DXC A;  3NTI A;  4E7K A;  2XIC A;  3QXE B;  3JB9 H;  1I81 A;  1KQ1 A;  3OS2 A;  3OYM A;  3G71 A;  4HL4 A;  1LJO A;  2MI6 A;  4AI6 A;  1U1S A;  3RKW A;  3CCU T;  3JCM g;  4M7A F;  4C5G A;  2K5I A;  2M9U A;  2E12 A;  2F5T X;  4IUR A;  4NL2 A;  5D6Y A;  3CPW A;  5IN1 A;  5GAN j;  1U8R A;  2CS7 A;  4KUD K;  4NC6 A;  1RL2 A;  2L3R A;  3A8G B;  1HK9 A;  3QG1 A;  3JSC A;  2YHT A;  2WSE E;  2JN0 A;  3MP1 A;  4XU2 A;  3VKG A;  3OW2 A;  3CME T;  5DLO A;  4IKF A;  4F7U G;  3LYI A;  3RKY A;  4E7L A;  1EIF A;  5LJ3 g;  1VQM T;  3CMA A;  1B34 A;  1Q81 C;  2P0P A;  2RJF A;  1ZHI A;  2P0Q A;  3I55 A;  2HAX A;  3HZJ A;  2E1H A;  1VQK A;  5GAM d;  4N4I A;  3ME9 A;  1YCY A;  1NE8 A;  2ZPE B;  1NPR A;  4R56 A;  1N8R C;  4HCC A;  2FL7 A;  4QVC A;  2BIV A;  2VV5 A;  3PFS A;  2RK1 A;  4KUL A;  1MHN A;  3OY9 A;  1YJW A;  4C5E A;  2RA2 A;  1IRE B;  4V2S A;  3OBY A;  1Q86 C;  4JS5 A;  2A7Y A;  1Q82 U;  3FC3 A;  4ELZ C;  3ZFJ A;  3T9N A;  2G3R A;  4KBM B;  4PNO A;  3L2Z A;  3ZBD A;  4L6V 5;  3FIF A;  3QBY A;  4M75 E;  3CC4 T;  1YI2 A;  3F70 A;  3SWN C;  2O4X A;  1M5Q 1;  2P0K A;  4FL6 A;  4M7A A;  1GXI E;  1FKM A;  2PVG B;  3E19 A;  3LLR A;  4II1 A;  1YIT A;  2DTO A;  3OYE A;  4PJO C;  3NTK A;  1HXD A;  2ZPH B;  3P8D A;  1X01 A;  1YIJ A;  2RB6 A;  4NOY A;  1VQ6 T;  2VC8 A;  3C4S A;  2K57 A;  4C8Q G;  1KD1 U;  1M1K C;  4M75 A;  1M9S A;  3OMG A;  5D6W A;  3RKX A;  1E7P A;  4B9X A;  2RHU A;  1WQ7 A;  5CK9 A;  1VQ7 T;  3CC4 A;  5LJ5 j;  4RG2 A;  3QSU A;  2LTO A;  3NFC A;  4M77 E;  3HB9 A;  3CC7 T;  4QQG A;  1OYX A;  1NZ9 A;  3MP8 A;  3GNF B;  3UWN A;  4BI8 B;  4A4G A;  2CZ6 B;  5LJ3 f;  1VQ4 T;  2EJG A;  3BDL A;  5GMK m;  3CXC A;  2D9T A;  3HHT B;  4A54 A;  4PJO A;  2WSF E;  4M7A B;  1N6A A;  2XG8 D;  3OA6 A;  5IT9 E;  4HNT A;  4M77 C;  5CCA A;  2X35 A;  3H8Z A;  4XU3 A;  4BAC A;  5CKE A;  1K73 C;  2DZC A;  1JRI A;  5CIU A;  2GFA A;  3JCM J;  4QQD A;  1YJ9 A;  5LJ3 d;  3M9Q A;  3O8V A;  1IZ6 A;  3JCM f;  4BY6 C;  3DB3 A;  3QYB A;  5GAO n;  2RH2 A;  4F7U B;  3GPL A;  3KBG A;  5LL6 S;  5GAN 2;  1BI2 A;  3HRU A;  3OYL A;  1XQH A;  4M7D D;  1N27 A;  1Y07 A;  2RJC A;  3C95 A;  1K9M U;  3X26 B;  2EQJ A;  2RHZ A;  5EG2 A;  2JZ2 A;  3MHX A;  4F7U A;  4DA4 A;  4X9C A;  2DVE A;  2WSC E;  3V8L A;  3PGG A;  2DTH A;  3J80 E;  3QDR B;  4M78 D;  4X9D A;  2LCL A;  4JS4 A;  2EFI A;  2EKO A;  4LDY A;  4GY5 A;  3CCU A;  1M4Z A;  3G71 T;  4M75 G;  4IUV A;  3KUF A;  4BY6 B;  3HP9 A;  3CEY A;  4Y91 A;  4HCZ A;  2RJE A;  3E9G A;  2JTM A;  3CBM A;  4BE0 A;  4OF1 A;  1YHQ T;  1JJ2 S;  3TRE A;  1XOV A;  3P8H A;  5FRM A;  3BY7 A;  4ELJ A;  4XTV A;  1QP3 A;  2WAC A;  4Z02 A;  5I2S A;  3CCV T;  2OAU A;  4BE2 A;  3UPU A;  4PJO G;  2RI3 A;  4LDU A;  3M59 A;  4PLI A;  2KAF A;  1VUB A;  3A5Z B;  4PKC C;  4OB2 B;  2I2L A;  2HQE A;  3JRZ A;  3ZEH A;  5GAN 5;  4JRK A;  2QDJ A;  3A8O B;  1WJS A;  4QVZ A;  2XDB A;  2Y90 A;  2XDP A;  1ZBX A;  3QUI A;  3MEV A;  2HD0 A;  4M7A G;  4XTW A;  2VYT A;  4C8Q F;  2OTJ T;  2OTL A;  4HT9 A;  2DXT A;  4OB3 B;  3OW2 S;  3G7Z A;  4NL3 A;  4C92 D;  5GAM h;  4DOV A;  3SDZ A;  4M75 D;  2M16 A;  5CQY A;  1KC8 C;  3TCJ A;  2L89 A;  2KMG A;  4PJO B;  1U1T A;  2RHX A;  3VYG B;  3CCR A;  5GAM j;  1BIB A;  5GAN e;  5GAN d;  4HCB A;  1QLB A;  3QHS A;  3S6W A;  2QEX T;  3QWL A;  2DXU A;  2E70 A;  1VQO A;  1Q7Y U;  4MDW A;  4A53 A;  2ZPG B;  1BIA A;  2LQ8 A;  4C0G A;  4J7I A;  1UGP B;  4JX6 A;  4JLG A;  3TU4 K;  4OVA A;  2CZ1 B;  1DJ7 B;  3N5B B;  3JB9 D;  2PVO B;  2DD5 B;  2ZCF B;  1BI0 A;  2E6Z A;  3HKS A;  3UDC A;  4JJN K;  4EMK C;  3RER A;  1UGQ B;  1MGQ A;  3PMT A;  5GMK l;  3HBL A;  3H6Z A;  4D6W A;  3MCA B;  4J6X A;  1O75 A;  3M4Y A;  2EQM A;  3V7S A;  1VQ9 T;  1ZQ1 A;  3QZ5 B;  3QKJ A;  3LGF A;  5D6X A;  2RI5 A;  4PJO F;  4C0F A;  5CKD A;  3JAM E;  2JOY A;  2DZ9 A;  1Q7Y C;  1KG1 A;  3A8H B;  3VYG A;  2NLU A;  3VUZ A;  4RCB A;  1VQP A;  1N8R U;  2O01 E;  4J5Y A;  1RI0 A;  2GF7 A;  2L5Q A;  3C94 A;  1WJQ A;  4A4E A;  3CC2 T;  4HNU A;  4XAX B;  2LDM A;  3M56 A;  4DOW A;  5HKC A;  2K3X A;  2E41 A;  2QQR A;  3L2V A;  3CCQ A;  1VIE A;  3JCM P;  4VUB A;  5CAI A;  5A2Q E;  3OS5 A;  3G6E T;  1R8O B;  2ZPB B;  1D3B B;  5GMK i;  3LWI A;  3Q1J A;  3BDU A;  4JRI A;  3CPF A;  4F7U F;  1VQ5 T;  3JB9 F;  3L2U A;  2JNG A;  2BS2 A;  5KE3 A;  5LJ5 f;  3MP6 A;  3CCJ A;  2JUF A;  2RK2 A;  3HRS A;  4EMG A;  1OZ3 A;  2QA4 A;  5GAM f;  1S72 T;  2VUB A;  4AKG A;  3CD6 T;  3EFS A;  2V8J A;  2VXF A;  3JCM c;  1VQL T;  5HK0 A;  3I56 A;  1KHC A;  3CCS T;  1Y96 A;  3GLX A;  2DO3 A;  4C5H A;  5GAN 8;  1M1G A;  2MWP A;  3M58 A;  3VYH B;  3ASK A;  5HK3 A;  2DXB A;  4L5G A;  3VU3 C;  5GAO m;  2E5Q A;  3JCM V;  4IUU A;  2FVU A;  3WXM B;  4C8Q C;  3OYH A;  3CCJ T;  5GAO q;  2D6F A;  2XDD A;  1UGR B;  5J39 A;  1VQN T;  2H3J A;  1JBM A;  4HKE A;  3J7A F;  2D0Q B;  2QQ9 A;  3BFM A;  3G4S T;  2DXB B;  2LRQ A;  3MO8 A;  4N0A C;  3M57 A;  2QQ8 A;  3BG9 A;  1YIJ T;  3HSB A;  2RO0 A;  3M4G A;  4MMK A;  5GMK h;  4ELY C;  3L2W A;  3TW6 A;  3CCE T;  4QSH A;  5KE2 A;  4OP0 A;  5GAM g;  4KT0 E;  4BDZ A;  3OSS C;  5A0L A;  1B34 B;  2CYZ B;  4M7D G;  4M7A E;  5AYF A;  3H4C A;  1P92 A;  1BI1 A;  3A8M B;  2CGH A;  3LH0 A;  1NJI U;  4AKI A;  3X25 B;  1M90 C;  3OYK A;  4EMK B;  3VJP A;  2L8D A;  2CZ0 B;  4X34 A;  2DXC B;  3GF5 A;  2R57 A;  3AHU A;  4M77 B;  4RKU E;  4M7A C;  2DEQ A;  4LDX A;  5GAN 7;  1YJN A;  3QPH A;  4CI0 C;  5GAN 6;  3J81 E;  1M8V A;  4GLK A;  3A8L B;  4HLQ A;  5LJ5 h;  4M6V A;  1KHI A;  3GP8 A;  5CKH A;  1JJ2 A;  2E65 A;  2GQV A;  5LJ3 h;  1OZ2 A;  3CCM T;  3QYE A;  2HBP A;  2LC4 A;  1K8A U;  4C92 F;  3L2Q A;  3L2R A;  1QVG S;  4BD3 A;  2HQX A;  4IUQ A;  2QEX A;  3KXT A;  4A4H A;  3M54 A;  3V7R A;  3CCR T;  2PQW A;  2M1H A;  3VKI A;  3VV0 A;  1XNI A;  5GAN g;  1I5L A;  3SB2 A;  4XTZ A;  4M75 B;  1FWZ A;  2MAM A;  3CCM A;  2LT1 A;  4HA8 A;  3SWN B;  5GAO p;  2RJD A;  2BS4 A;  2FYK A;  4ZN3 A;  1SSF A;  4MZM A;  4ATO A;  1Q86 U;  4UC4 A;  4FU6 A;  4XU0 A;  4LOC A;  4C8Q E;  4BBR M;  3QYH B;  2EQK A;  4ZGD B;  2QXF A;  4O6J A;  2EYQ A;  2K2V A;  2BKD N;  2RHI A;  2VGM A;  5LJ5 e;  5LJ5 d;  1M90 U;  1D3B A;  4XTY A;  2A3L A;  4M7D B;  2Y4Y A;  5C6S A;  5KCH A;  3SFM A;  3LWH A;  5DM7 R;  4BUG A;  3OYF A;  2JVV A;  3MEA A;  2CZ7 B;  4C8Q A;  3MEW A;  3LW5 E;  3X28 B;  4RG8 A;  5CKF A;  3S3N A;  3RES A;  3RIR A;  4JX5 A;  4M77 G;  5CQX A;  5FRO A;  1G3S A;  4JRQ A;  3HRT A;  5J3B A;  3CCE A;  4FM4 B;  1WNL A;  3CCS A;  3S3M A;  2XK0 A;  3HL8 A;  2ZZD A;  1PSF A;  2QF7 A;  2PUK B;  2EJF A;  2K3Y A;  4C92 A;  5A0D A;  4OMF B;  3M53 A;  3OS0 A;  2LVM A;  3M5A A;  3G4S A;  2QA4 T;  1S72 A;  1LOJ A;  3OBW A;  2DD4 B;  4N4H A;  4P5N A;  2X4J A;  1VIF A;  4Y28 E;  5J26 A;  3JCM h;  1VQ5 A;  3PMI A;  3OSV A;  2ZGW A;  1XTD A;  3HPW A;  2BUD A;  5DY9 A;  4XTU A;  4C5I A;  4LD6 A;  5FU6 C;  2O4X B;  5FU6 B;  2LX9 A;  2AHJ B;  3MET A;  4QQ6 A;  3OQ5 A;  4L59 A;  3V8J A;  3QO3 A;  4J6W A;  3JCM Q;  4ZTF A;  4IUT A;  4ZN1 A;  1G3Y A;  4MIM A;  1I8F A;  2DAQ A;  2EAY A;  3EFR A;  3JCM W;  4M78 A;  4JDS A;  4BI3 A;  3OS1 A;  5M9O A;  2QDY B;  1H3Z A;  2IG0 A;  2EQU A;  3OYY A;  3OYN A;  1QP2 A;  2XID A;  3BW1 A;  4M77 A;  4C92 B;  3JCM b;  2QQB A;  5I21 A;  4FIB A;  2E10 A;  3EAE A;  4JUV A;  5C0M A;  5KH6 A;  2EJ9 A;  2FB7 A;  5A0G A;  3G6E A;  2M0O A;  1VQ4 A;  2C06 A;  3URG A;  2QQS A;  4EPC A;  1BKB A;  3CCQ T;  5GAM e; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...