4ZGDB

Mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 57
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgdB02
2ZPIB 1IREB 2O01E 3QZ9B 1PSFA 2ZPFB 4FM4B 4OB0B 3A8GB 1UGRB 3A8OB 3QXEB 2PVDB 3A8MB 4OB2B 2DXCA 2DXBB 3VYGB 1GXIE 3QYGB 1QP2A 3QYHB 2ZPEB 4OB3B 2AHJB 4OB1B 1UGQB 2CYZB 3HHTB 4RKUE 1AHJB 3X20B 2CZ1B 4ZGEB 2ZPBB 4ZGDB 5L8RE 2DPPB 3X26B 1JB0E 2DD5A 2DXCB 1V29B 2PUKB 2PU9B 2DD4A 1UGPB 4L6V5 2CZ6B 1QP3A 2CZ7B 2QDYB 3X24B 3WVEB 3A8LB 3LW5E 4KT0E 2WSCE 4XK8E 4ZGJB 2ZCFB 3X25B 2DD5B 1UGSB 2ZPHB 3WVDB 2CZ0B 2ZZDA 3X28B 4Y28E 2D0QB 2DD4B 2WSFE 1PSEA 2WSEE 3VYHB 2PVGB 2PVOB 2PUOB 1DJ7B 2ZZDB 2DXBA 3VYGA 3QZ5B 2ZPGB 3A8HB
chains in the Genus database with same CATH superfamily
2E5QA 3PTAA 1LJOA 3C4SA 3QJYA 1IZ6A 4FM4B 3C95A 1G83A 4TTHA 2RN8A 3I55Q 3CCQA 4FW1A 4M75C 3RERA 2F1LA 3CC2Q 2KK4A 1QCOA 4MMLA 3CMET 1YI2Q 4EOOB 3CPFA 2I40B 4F16A 4HT9A 1URCB 2RPNA 1YIJA 4C8QD 2FRYA 1WHHA 4ELLA 5LMKB 5M9OA 1M90U 4M7DF 2P84A 4LDXA 4GLMA 2F5TX 1UGVA 2PTKA 3CCRA 4ZGEB 4BCMD 2LX7A 5A0DA 1M30A 3V7SA 1B34B 2QTVA 1NLOC 1OX9A 3SHWA 3VKIA 2YHTA 3Q1JA 1UGPB 3MO8A 4KULA 4M75E 1K73R 3MJXA 3L2ZA 1W98B 3BDLA 2VASA 4QT7A 3BHUB 1D1AA 3QWXX 4ATOA 3A5ZB 5AYFA 2DL5A 4KT0E 2WSCE 3NPFA 2QQSA 1N8RR 1GY3B 3OS0A 5CO7A 4GY5A 2VUBA 4M77F 1W4SA 2M51A 4L5GA 1OEBA 1K0SA 2DD4B 2DTHA 3O5ZA 1G3TA 1TU0B 1Q82U 4I3ZB 2WSFE 2X35A 1I81A 1LCKA 4JZ4A 2L3QA 3RUXA 4DBHA 1PSEA 3OYLA 3WXMB 2EQJA 4LUDA 2M0OA 3HRSA 2JOYA 4QKUA 5KE3A 5GMKm 1WZOA 1VQPT 2KXDA 4E2FB 3JB9G 4E7LA 5GMKj 1GCQA 4HT8A 1R0BG 3LWIA 2V26A 3JV3A 3MP8A 4FT2A 2QEXA 4RTVA 1U1SA 2VB6A 3OYAA 1WYXA 1NJIR 2FPEA 1VQNQ 1XO2A 3C0CA 3QZ9B 3G71A 4F7LB 2P0KA 1XOVA 3TCJA 2P4TA 1VQ4Q 4M78D 1BYMA 4J9FA 4J9GA 1JSUB 3CMAQ 1PD1A 4LUEA 4RCCA 2DXCA 1VQ6A 2QXFA 4E7ZA 4JJCA 5GAMg 1QCNA 1T3LA 2NUPB 2WEVB 4C8QF 3NTKA 3D7SB 5GAN2 3CC7T 3MEAA 2Y4YA 3LYIA 3CD6A 2AHJB 1Q81C 2DKGA 3VUZA 5IHKA 1SHGA 3EG3A 3TNWB 2BPMB 1W1FA 5I5ZB 4LN2A 2J6OA 3M03A 4C0GA 3OYKA 1K4US 2RJDA 3DTOA 3H4CA 1G5VA 2MOXA 1VQ5A 1N27A 2YUQA 5IF1B 3QYEA 1TG0A 1H3HA 1O9KA 2J05A 4BE2A 2WHBB 4MDWA 4BE1A 2BKZB 5KCHA 2GGRA 1IGUA 2O31A 1WQWA 3CXCS 1ZSZC 2FZCB 4HNTA 2RF0A 1W2BA 3CCRQ 1TUDA 4BCND 2F2VA 5GANf 1AVZC 4PJOC 1D3BB 1JBMA 1M1FA 4KRCB 3M4GA 3QSUA 4IUPA 5ICPB 4JPBW 4NC6A 5GAN6 4M4ZA 3K7AM 1RADB 4EMKC 1K8AR 2RNAA 3CCVQ 3TVTA 3M0TA 3PMTA 1UUEA 2BS3A 2LQ8A 2RQWA 1S72A 1AEYA 4JRQA 5J26A 3VU3C 4A4FA 4YC3B 1C1AA 5CVIA 4Y72B 3G1JA 3CCEA 1N6AA 1RAEB 3DDPB 1BI2A 4BCFB 2IN3A 2ED1A 1VQ8T 3EAEA 3EG9A 3M9QA 3TQ7P 1WNLA 4TVRA 4C0DC 2RK2A 2XDPA 3VUBA 4M78F 3BLRB 3DDQB 4BI8B 4E7KA 1QVFA 2BE7D 3QXEB 4R55A 1AWXA 3M0UA 1MMNA 3UDCA 2JS0A 1FKMA 5GJWB 2DXBB 2J06A 2GF7A 2JUFA 1QP2A 4F7NB 5GAOm 2K5LA 4CFNB 2CJMB 2G9XB 3G71Q 5GAOq 1Y71A 4EC8B 3EFSA 5GAN4 4XTXA 4DEYA 1OKVB 3DJBA 3O0GD 1VQ6Q 5GANh 1GRIA 5GAN3 2RJCA 5KE2A 4QVCA 3FC3A 4C5HA 4N4HA 4L6V5 1W2BP 3CCMA 4Y91A 1I5LA 3CD6Q 2ZAEA 3OYJA 2WIHB 2JM8A 2W0ZA 2HSPA 4YOOA 2G77A 4ZNXA 3OYHA 3L42A 3X24B 2JT4A 2DL3A 2IPOB 1GCPA 2KY9A 4BY7X 4HCKA 3VS7A 2DL7A 2IW9B 1VYTA 1D1BA 5FRMA 3META 1HXDA 3GPLA 4LD6A 3V8JA 3FLGA 4M7DC 4RTXA 3G4SA 1JJ2A 3BDUA 1YJ9T 1UNHD 2CP0A 4FL6A 5LJ5g 2E3HA 2I53A 2B8AA 1GBRA 1FMKA 1OYXA 1AT1B 3NFCA 1PWTA 1JEGA 3MEWA 5DQWA 1VQKT 3OYYA 2CS7A 2QGSA 4EOQB 2EGCA 5DLOA 4C92C 2VYTA 1E9HB 2NUTB 3ZEHA 3H0FA 4XTWA 3TEEA 3CCUT 2A37A 2ZPGB 1UB4A 4EDUA 1LOJA 1G3WA 3DL1A 2QQAA 3CC4Q 4MIMA 4JJNK 4ZTJA 1BIBA 2ENMA 4Z8AA 4JRPA 1G3YA 2EQKA 2L0AA 1HSQA 2EKHA 4M77C 4C5IA 2HDAA 4M7DE 1SG5A 2O4XA 2EQIA 2QA4A 1WXTA 1T0HA 4FT4A 5I2SA 1OIYB 3CCEQ 1VINA 5CKHA 4ZN3A 3UA6A 4OB2B 1QLYA 4BBRM 2AZSA 3HRTA 8AT1B 3HPWA 1KQ1A 1NEGA 1EZZB 4Z02A 3I35A 2DILA 1TOVA 5ACBA 2VV5A 5FU6B 4MZPA 4MFEA 1OGUB 5HK0A 1TH7A 5C0MA 1FWZA 1H4LD 2AKKA 3FIFA 3HHTB 1AHJB 1NPPA 2A3LA 2QFZA 2CZ1B 4JZ3A 2GTOA 2H3EB 3VS3A 2LCCA 4M77E 1NEBA 1OOTA 4C5EA 4XU2A 1MMAA 4FU6A 3JB9D 3MCAB 4A4GA 3R6OA 5CCAA 1JJ2P 2MWPA 3GLXA 4C8QC 3N5BB 4CC2A 3OW2A 3URGA 1G3NC 1R8OB 3E2UA 1YJWA 1QCFA 2SRCA 3CCMQ 2DO3A 4BCKB 4Y28E 1VQMQ 2EAYA 2PK2A 2XDDA 2CT3A 1RAGB 5HBJB 3C94A 3EGXA 3MKDA 2J6FA 1B07A 3RMSA 2CT4A 4QW2A 1K73U 5D6YA 3E1SA 3CCQT 3MPUB 1YHQA 4XTZA 1BU2A 1K1ZA 4BY6B 4M7AB 2QGGA 1N8RU 3UT1A 1KC8C 4KRDB 1RI0A 3JCMf 2IVWA 1YIJT 4C8QE 1IREB 4CRIA 3QWYA 2K6DA 2O01E 1PSFA 3JCMP 3MEVA 1NBEB 2JN0A 4OB0B 1PRLC 4HVWA 1D0YA 3M58A 4BDZA 2K5FA 2EW3A 5IHNA 3I56Q 3A8GB 3CCRT 5GAOp 3EH1A 3I55A 2CP7A 1B34A 4KBMB 2RMOA 5LJ3f 2FVUA 3VS1A 5IDNB 1YI2A 5L2WB 3RDVA 3LGLA 3BHVB 1KG1A 2JZ2A 2CP2A 3HFOA 3JCMe 1NJIU 4CFUD 2O2OA 1B3QA 4J9IA 3RGFB 2KMTA 3DB4A 3L2WA 4HVUA 2LW4A 3VJPA 4O5VA 1QKWA 3CXCA 2DD4A 2H3JA 4PJMA 2V1QA 5HQ0B 4JRIA 4M78C 4BCIB 3MEUA 2C5XB 3G7ZA 3OW2P 3MI9B 5LJ3e 1X6OA 4M7DD 1MGQA 4QVZA 1K9MC 3A8LB 4DOWA 2DRMA 3CCST 1M8MA 2DX1A 1H1QB 1B7TA 1NZ9A 4N0AA 3WVDB 4LOCA 1M1KC 4IURA 4BCHB 2YLCA 3REAB 4UN0A 2QEXT 5KYWB 2KAFA 1TXQA 3DOGB 1MHNA 3VYHB 2Y4XA 1JO8A 4A54A 2LT4A 3J7AF 2LC4A 2RHUA 4M78E 3OYCA 4BCPB 3RKYA 2HEQA 4HL4A 4OMNA 2DE0X 3S3MA 2CDTA 1VQ6T 1I0CA 2NUPA 3DLMA 5GAOl 1TD6A 2R58A 2EQMA 3BE3A 9ATCB 2HBPA 4F7SB 1K76A 3RMQA 3HO8A 2W96A 1ZHIA 5I2MA 5DY9A 4BCQB 3MY5B 1Q86C 1A0NB 1C6VX 1U5SA 1VQNA 5D6XA 4AFSC 1R0CB 4A4KA 1K8AU 2UUEB 4MMKA 5LJ5d 5GAN8 1OULA 2LP5A 1VQ4A 1UGRB 3A8OB 2XG8D 3UF4A 5IXBA 3JAME 1S1NA 4F7UA 3T9NA 5DQVA 1M2OA 3CMAA 1TS9A 1VQ5T 3PE0A 2JVVA 2C4GB 3GF5A 2VGNA 3EGXB 5IHYA 1M27C 1VOMA 4IIMA 3S3NA 3SWNB 2GNCA 4OGEA 4LDUA 1D09B 2O9SA 1ENWA 1BK2A 4A4HA 2NWMA 3O8VA 1QVGS 3CPWA 2COWA 2MCNA 3G6EQ 4HA8A 1D3BA 5FW9A 2KR6A 4RTZA 4F7UG 5GAMf 2W9ZA 1BI0A 3QYBA 5ECAA 3OQ5A 4PFOA 3M4YA 1H27B 3QDRB 2K3YA 1ZUYA 2HZYA 3TNHB 3KXTA 2QAZA 3BLHB 4VUBA 3LW5E 1S72T 1E6HA 2K2VA 3JB9H 2W99A 3FEOA 2K79A 3CCLQ 1D0XA 4XTUA 3SD4A 1VQ7T 1UGSB 2OJ2A 3CCET 2DTIA 1KFZA 2D0QB 1WQ7A 1OI9B 3FB9A 5LJ5j 4OVAA 2X51A 2E12A 5FGKB 1K9MR 2XK0A 1D1CA 2IW8B 2CSQA 4LDVA 3CCVA 5DLQE 4EMHA 3POMA 1XJWB 5IN1A 2PVOB 5KYUA 5CQXA 2D8JA 3DKMA 3KUFA 2D0NA 2FYKA 2DXBA 3LGFA 3M57A 1MUZA 2AT1B 1V76A 2DZCA 2CCIB 5KYXA 1MNEA 4BE0A 3PIPA 4M75B 2LMJA 4PK4A 1AZEA 1QVPA 2R5MA 2LQWA 3CCJA 3S3OA 1KQSA 5IDPB 2AKLA 2CH4A 2EYXA 3TU4K 5BNJB 1WJQA 3HSBA 2XMFA 3EFRA 4XQ3A 1X6GA 1X27A 1E7PA 4X1VA 3BG9A 3CCMT 1PRMC 2KT1A 4KH0B 5GAMh 1KD1R 3RKWA 4XU1A 3CPWP 2DBMA 4BI4A 4PJOG 1BCMA 3OBYA 4J7IA 4M7AF 2G6FX 3KFVA 3RIRA 3GNGA 5L8RE 2NUZA 4BB7A 3TN8B 1M1GA 2KVQG 1V29B 2PUKB 3G4ST 1YN8A 3MP6A 2CZ6B 4RG2A 3INZA 4M6VA 2EIFA 1QP3A 1M90C 3I9QA 4RODA 1I1JA 1VQLQ 5I22A 2QQBA 2EGEA 1VQOQ 2L3PA 1WI7A 3JCMX 2F2CA 4RCBA 2RQTA 2A0FB 2FPDA 2WXVB 2NUTA 1HJDA 4FYYB 4F7UB 2R7GA 1WHMA 3SDZA 2ABLA 2L3RA 4B9WA 4F6UB 1FX7A 1U3OA 1VOLA 2WFYB 1OL1B 1PM3A 1RLQC 1KHIA 2F69A 1PCXA 5GAOr 2UZBB 2RB6A 4AG2C 2E3IA 2QA4T 2ESWA 1CKBA 2PVGB 4CI0C 2KNBB 1PHTA 5L23A 1X2KA 2A08A 3OA6A 2ZZDB 4RUGA 4MZTA 5CQYA 4F70B 1AWOA 3OYEA 1Q82C 5A0GA 4HXJA 1KQSP 3QUIA 2ZPIB 3OY9A 2K4YA 1Q7YC 5CR2A 3CC4A 3VKGA 2EBPA 4NOYA 1WFWA 5CKFA 2V8KA 2RM4A 1GUXB 2OAUA 3HRUA 4EOLB 1OZ2A 2WMBB 1GXIE 1VUBA 1Y7XA 2XI9A 5GANe 3RBBB 1GCQC 3V8LA 2K5IA 1KSWA 3CCJQ 3HP9A 2DVJA 2OTJQ 2DAQA 2X9HA 5HK3A 1UG1A 4PFZA 4E7IA 1YITT 3F5XB 3H41A 2V8JA 5KYUB 4II5B 2DM1A 1YJWT 3L2RA 4FSSA 2EGAA 3OBWA 3PFSA 1ZSZB 1VQ9Q 1VIEA 5KYXB 1HK9A 2OI3A 2RI3A 4ESRA 3THKA 2KSSA 4PJOB 3JCMd 4Z6YA 4J6XA 4QVDA 2YUOA 2NYSA 3M59A 1X69A 2DMOA 2MK5A 4XK8E 3CEYA 1MNDA 1YJNQ 4J7FA 2DD5B 1YHQT 3E9FA 5FU7C 1TTHB 4EMKB 4M7AA 3UATA 2EUFA 2BZYA 4RTYA 2L89A 3EGDB 2RK1A 3LX7A 3VS0A 4ORZA 4JX6A 5LJ3d 1Q81R 1VQMA 1OV3A 2D9TA 4FCYA 3HL8A 2W9FA 2DLPA 2EPDA 1VQPA 4ME7A 4J9BA 2KR3A 2X4WA 2LJ1A 5J39A 1ACMB 4PLLA 3I55T 3JB9I 3BLQB 1N5ZA 4YOZA 2M16A 3L2UA 3EFOB 2KMGA 3CC2T 1G3SA 4X9CA 3QZ5B 2QQ9A 2MF2A 4MFDA 4M7AG 1GL5A 3A8HB 1YI2T 4C0DB 3M0SA 4J83A 2PHGA 2BS2A 1ZA1B 2GTJA 4HLQA 4NS5A 2PZ1A 5GAN7 2OX7A 1SRMA 4J9HA 2RJFA 1H28B 2K3BA 1Y07A 5CKDA 1JXMA 2EYYA 2DVEA 4F6SB 1PC0A 4RTWA 3I56A 2RA2A 5IAYA 3VYGB 2QTXA 5EC7A 2HL3A 2DRKA 5GMKh 1EFNA 4C5GA 2OTLA 3U23A 2BKDN 1QVGA 1BKBA 1QVFP 3RNJA 2DXUA 1C9BA 3OYDA 2C6TB 3ZBDA 3JCMJ 3CMEQ 5LJ3j 2EFIA 3MHXA 2DPPB 1IHWA 3EG0A 2MIOA 2CP6A 3MIAB 3ASKA 1H24B 1RUWA 4ANJA 5KYWA 1I07A 1C0MA 1WXUA 3SFMA 4PLIA 4PJLA 4C0ZA 4B6MA 2BTTA 2FRWA 3NMZC 4D8DA 2C5VB 3OS5A 2MWOA 2G3RA 4R56A 2K3XA 2YRVA 4Q5WA 2PK9B 4BBSM 3CBMA 2FZKB 1SHFA 3UPUA 4Y92A 2AIRB 3LWHA 2R57A 5GAN5 2V1RA 4CC4B 3VV0A 4C92B 1SSHA 4EOJB 1CKAA 2RQVA 1Y96B 4AG1C 1OPKA 4DBFA 1AWJA 1VQNT 1O75A 2P0PA 1MV3A 3S6WA 1VQ4T 4D6WA 2PUOB 4EOSB 4QQ6A 1BU1A 4X9DA 3BY7A 3CMAT 4M77B 2SEMA 1RAFB 2E65A 2IG0A 3PVLA 1K9AA 4F7JB 5FRNA 3VS2A 1JKWA 1VQPQ 2WPAB 3SWNA 1VA7A 1WGSA 3I5RA 3TSZA 1K9MU 3J81E 1X75C 4F7UF 4M7AE 4CC3A 3OMCA 1FINB 4BACA 1CSKA 4MDXA 1OL2B 2IVXA 2C06A 4IMYB 4JX5A 4BCJB 3EHQA 1ARKA 2EKOA 1LNXA 2DYBA 1M9SA 5EJCA 3EG1A 4JRKA 1E7OA 1UDLA 4AKHA 4WTOB 3TNIB 1X2QA 2LTOA 4JJBA 4KGZB 2O88A 4OB1B 2E4HA 1KJWA 2KE9A 2EJ9A 5CKEA 2KYMA 3AT1B 5GAOn 4XAXB 1FYNA 3TSWA 1W2BS 1X01A 3OSSC 4OMLA 1GBQA 2CSIA 2OTLQ 3G6EA 1JRIA 2KEAA 4E6RA 3H0HA 1RLPC 4AI6A 3QWLA 3QIIA 4PJNA 4C8QB 4KGXB 1QLBA 4FYVB 2JS2A 4JDSA 1E6GA 4BXXX 1O9SA 4HCZA 3CCVT 1KD1U 4AMCA 3EOCB 1UTIA 1WJRA 5LQFB 1SKUB 2OAWA 1LPLA 2VKNA 1JXOA 2HQHA 1NG2A 2ZCFB 1K0XA 3X25B 2K9GA 4BCMB 4LXCA 3CCLA 4EOIB 2K57A 4GBQA 3VRYA 2KYBA 2CCHB 5D7UA 1VYWB 3A98A 2KROA 4OMQA 4PFPA 1RAIB 4M75A 2JXBA 4OR5B 3NTHA 1MV0B 4HVVA 2A28A 4BCGB 4HNVA 4IUTA 3CCJT 4HKEA 1QKXA 2E64A 5I11A 3KHIA 3V8KA 2RJEA 1ZX6A 2JM9A 1RABB 1HD3A 2DTOA 2FG0A 2EYZA 2RI5A 2RI2A 2COYA 1YWPA 2DETA 4PJOF 3OYNA 2D1XA 3M5AA 2E41A 5KYYB 1U06A 3V7CA 2DFUA 1WA7A 2V22B 1JSTB 4JLIA 1H92A 1RAAB 1R77A 5FLXE 1K73C 3G71T 2M1HA 4M75G 2KI7A 2F2XA 4HCBA 2UZEB 2DBKA 4PKCC 4X34A 1IB8A 3QG1A 4YOSA 2X3XD 4EIKA 3A8MB 1VQ8Q 1N8RC 2NLUA 4EOMB 2JGZB 1TWBA 2IIMA 2CP5A 1NM7A 2AK5A 4OMPA 4XU0A 2RH2A 4QSHA 1XQHA 4C0FA 1WX6A 1WHLA 3CD6T 1BB9A 5IXFA 4CFXB 1G8XA 3L1AA 1AWWA 4ZGDB 2FHDA 4M78B 1KC8R 2DEQA 5GANd 3JCMg 2MPXC 2GQVA 1H1RB 1OU8A 1QWEA 2L8DA 2JTMA 3JCMW 1JJ2S 1TFBA 3DB3A 3WVEB 3H6ZA 1VQLA 1ABOA 3OSVA 4LDYA 4MZMA 3GOXA 1VQOA 3CXCP 3PMIA 2DERA 2HSEB 4M7AD 4PL6A 3MY1B 1VYVA 4AFZC 3P8DA 1SSFA 4FW2A 5LJ3g 2QI2A 1H641 2ZZDA 2O9VA 4KH1B 2QQ8A 4OMMA 4NSTB 2LNHB 1IRXA 3QDFA 2MYSA 4OMOA 2VXEA 4XU3A 1ZUKA 3IQLA 1XTDA 1KHCA 3CC4T 2JTEA 1N9RA 2HCKA 4BCNB 1HYOA 1YJ9Q 4RMOA 4QQDA 1GUXA 1EX4A 1ZQ1A 1YWOA 2DYIA 2I0NA 5CIUA 1BI1A 3RKXA 2H8HA 3VRZA 4BDYA 4N0AC 3JB9J 1PD0A 3VS5A 1GFDA 2QF7A 3PIOA 1VQKQ 1G2BA 5GANj 3EHRA 5GAMe 4O6JA 4IKFA 1Q81U 3M53A 4EONB 2RHZA 3UWNA 3CCUQ 4ZTFA 4BCOB 1M1KR 1QMCA 1UECA 1N9SA 3ME9A 1D0ZA 2RHYA 1ZSZA 4C92F 2KRMA 5HVYB 1GFCA 4OB3B 4PJOA 1M8VA 4OGCA 1PKSA 1JQQA 3TW7A 1YBYA 2CUBA 1K8AC 3M0PA 1Z9QA 4OF1A 2YXYA 1PG5B 2DIGA 2DL4A 3X20B 4FSXA 3UA7A 2OTJA 2ZPBB 1VIFA 2EWNA 2DD5A 3HFNA 4EMKA 4II1A 5HBEB 1WXBA 3VS4A 3OW2S 1WDXA 3EGDA 2DF6A 1OX8A 1Q86R 2HD0A 5IT9E 1RAHB 1VQ9A 2LDMA 1VQMT 3HZJA 4FYWB 2QDYB 1Q7YU 2AZVA 3CCSA 3OB9A 4E7SA 1Z9ZA 2P0QA 2E6NA 2LQNA 3QHRB 4FYXB 1AOJA 1YJNA 3EFOA 4N4GA 4DBRA 5HKCA 5AT1B 2YRDA 3GBQA 2KDSA 1YP5A 2PJQA 4YTLA 4BCQD 2DJQA 4J8OA 4ELJA 1H26B 4NL2A 3ULRB 2YT6A 1U8RA 4F7UE 2W10A 3V7RA 5J3BA 4AT1B 1DJ7B 2LZ6B 2W2HA 1F1BB 4A4EA 4LD9K 3I56T 3VYGA 1M2VB 2E6ZA 1UEBA 2OTLT 2D8HA 3VKHA 1QW1A 3CCQQ 2ZPFB 2COZA 2FZGB 3P8HA 5KYNA 3OYIA 2PNIA 2D6FA 1YNZA 2BZXA 2E1HA 2MI6A 3DLLA 1QMZB 2RHIA 1YIJQ 4JX4A 2QDLA 2WJ9A 2A36A 1RI9A 2L3SA 4EORB 1WIEA 3ER0A 4J6YA 5LJ5f 3EGUA 3BG5A 2L2PA 1TUGB 2UZLB 5HY6A 4CFWB 2EVRA 4RKUE 4M7DA 4D8KA 3CMEA 1AZGB 1BBZA 2HQXA 1Y0MA 1I4K1 2CUDA 3FDRA 2JMAA 1MMGA 3CBOA 3M0RA 2B86A 4KUDK 4JJDA 3HBLA 5CK9A 4F6WB 4C92A 3RESA 2YUNA 1YFNA 4B9XA 1Y96A 3I5SA 4HNUA 4LE9A 1GH6B 2J6KA 4IIOA 3QO3A 2F2WA 2BUDA 3EH2A 2RD1A 4LNPA 4ZGJB 3E19A 4M7DG 4V2SA 5LJ5e 1VQ7A 2J7IA 3BHTB 4AKGA 3QKJA 2LCSA 1N4MA 5IHIA 2CP3A 2KXCA 2ZPHB 1OKWB 2XICA 5CKBA 2E70A 1NE8A 4JS5A 1MMDA 4M77A 1FMVA 2VGMA 1NPRA 1UHCA 4M75D 1JU5C 4PJOE 2LJ0A 2GFAA 5GMKi 3LH5A 1QQJA 1SRLA 4F04B 4QQGA 3CCSQ 4UC4A 4XTYA 2YUPA 4C92G 4AKIA 5A2QE 2LQKA 2KGTA 3PVQA 7AT1B 5GJVB 1H1SB 1SEMA 3QJ6A 2QEXQ 1SF9A 4EC9B 5KH6A 1M90R 4JS4A 2KQWA 4J5YA 2HMAA 2CKKA 3M54A 3EJ1B 2X4JA 4M77G 5I21A 2JJ9A 5A0LA 2K2MA 4AFUC 5GMKe 4DEXA 2B9RA 5LJ5h 3OYGA 3GNFB 2QYZA 3G33B 1RACB 2PVDB 1Q95G 2XD0A 4J9EA 2X3WD 2GQIA 3RR6A 2YWWA 3QYGB 1BIAA 3G6ET 3CPWS 2GCXA 2BE9B 2WIPB 2EYQA 4K11A 1ZLMA 1UJYA 3OYFA 4C8QA 3PO3S 2UZDB 3JRZA 4EPCA 3KBGA 2HL5C 2M02A 5FWBA 4HCCA 3FJPA 1UGQB 5FU6C 2CYZB 5GANg 2BS4A 4JUVA 1V1CA 3B57A 4RTTA 2DMEA 1VQ5Q 1Q82R 4CXAB 3X26B 2HQEA 2DXCB 1NLPC 1OPLA 5EG2A 2CH4W 2P4RA 4PNOA 3BFMA 2IW6B 2ZGWA 2KBTA 3CCLT 5IH2A 2C5OB 1H3ZA 1Q7YR 3CC7A 3H9NA 2CZ7B 1P5EB 1EIFA 4C8QG 4P5NA 5FU7B 4KUIA 2GBQA 1BCOA 1U1TA 1TUCA 4DBQA 1JOWA 4CFUB 1KXUA 2VWFA 3EG2A 3QBYA 1OZ3A 3PNWC 3H8ZA 2YDLA 1F5QB 2JNGA 2XHCA 1NYGA 2EJGA 1O9KB 4M75F 2LRQA 2RHXA 4FIBA 4ROEA 2MAMA 2DK3A 1KC8U 5KYYA 1VYUA 2LVMA 3CBPA 2K7AA 2QDJA 1S72Q 2WACA 1UNLD 2HKNA 5KCOA 2QGFB 4R0KA 1QWFA 2ATCB 4M7DB 1VQ7Q 1T0JA 4EOKB 3PT9A 1M3CA 2Y90A 3F70A 5CYIB 3FJ5A 3TW6A 1FVVB 1ZUUA 3QPHA 1KQSS 4RTUA 1ZSGA 4G6LB 4GLKA 3QHWB 2LT1A 1OI1A 2C0IA 4C92E 2RO0A 4IUVA 4BY6C 1PKDB 1AD5A 2F5KA 2RQUA 4M7AC 2HNIA 1I8FA 1IGQA 2X4XA 3JCMc 2R5AA 1UJ0A 3MP1A 3OS2A 2YLBA 1LVKA 4CC7A 4EOPB 4M78A 3OMGA 4XTVA 2XU8A 1KQ2A 2Z0WA 3CQTA 5CEIB 3A1PA 2VXFA 4KRTA 5DM7R 1VQ8A 5EFQB 1PKTA 1H25B 2DXTA 3LLRA 4PJOD 3EG9B 3QYHB 3M0QA 2ZPEB 2PMIB 1WHJA 5GAMd 4FX3B 3JCMb 5GMKl 5HNBB 1PNJA 2RQRA 1VQLT 1YITA 1VQOT 2PQWA 4WCIA 3M56A 2HAXA 1UNGD 2FB7A 2X1NB 2LNVA 1UFFA 3GTMS 1QVGP 4M78G 2YRCA 3BW1A 3H0IA 4N4IA 1M1KU 1RL2A 1BI3A 4CRLB 2MMPA 1P92A 3SB2A 2CREA 4F17A 3AHUA 4A53A 5C6SA 4LDWA 4PJJA 3P8BB 4OMFB 1ZA2B 2YSQA 3TREA 1M5Q1 4Z89A 3EIDB 2GFUA 4BY1X 3R6NA 2ROLA 2KT8A 3G4SQ 4IUQA 1M4ZA 1X43A 4BD3A 3L2VA 3X28B 4JLGA 4RG8A 2FL7A 3CC7Q 3GIBA 2XDBA 6AT1B 1WLPB 4F14A 2BZ8A 3HKSA 1ABQA 2EQUA 2WSEE 4BUGA 8ATCB 1ZBJA 4KGVB 1UE9A 1Q86U 2JTFA 4CFVB 4DA4A 1M3AA 2V8IA 3L2QA 4CFMB 3M55A 2E10A 3NDQA 2XKOC 5GAMj 3REBB 3PGGA 3CC2A 1YJ9A 5FWCA 2A7YA 1M3BA 2WMAB 2QK0A 1H8KA 2BIVA 2HBWA 1IXDA 2DIQA 2DNUA 2ED0A 5D6WA 3JCMV 3NGPA 2C0TA 2QA4Q 3BG3A 2FO0A 2VC8A 2C5NB 1Y57A 1NYFA 1ZP2A 1VQKA 1WHKA 4DOVA 2E5KA 3JCMQ 4J6WA 1OU9A 1W70A 5LL6S 2OTJT 4ROCA 1OQKA 3JSCA 4L59A 1WHGA 2QG9B 3E9GA 1AISB 2CGHA 3CCUA 3OS1A 3FRNA 3QHSA 2FEIA 1QVFS 3ZL7C 3JB9F 1VQ9T 4OGRB 1SPKA 3HTRA 3NHNA 3OYBA 4BI3A 2EYWA 2DA9A 1XNIA 4ELYC 2O4XB 2HKQB 2C0OA 3LQ5B 2JW4A 5FROA 1W6XA 2XIDA 2M0YA 1FXXA 3C12A 1X6BA 2FPFA 3SWNC 1JB0E 1WPYA 1ZBXA 4E7JA 4IUUA 1UHFA 1YJNT 2PU9B 5HBHB 3NTIA 4ELZC 4A63B 4C92D 3SEMA 2VVKA 3JCMh 4ZN1A 4WF2A 1H1PB 5CAIA 4AFQC 1YITQ 3GP8A 1I5OB 5HCKA 1T3SA 4Z88A 1YJWQ 2KRSA 4E47A 4NL3A 3VS6A 1IHVA 4M77D 2CZ0B 4J9DA 1IO6A 1FMWA 4EMGA 2DZ9A 2QQRA 5LJ3h 4DQ2A 4OP0A 3LH0A 2M9UA 2LX9A 1M2VA 1D3UB 2ECZA 2I2LA 3ZFJA 4E7HA 4J9CA 2ROTA 1KD1C 1NJIC 1J3TA 1YHQQ 2X4YA 1YCYA 2DL8A 1KK7A 3OYMA 3J80E 2L5QA 2QASA 1AD6A 1TSFA 2EJFA 2KRNA 2DJZA 2DEUA 2JMCA 1OIUB 3HB9A 2LJ3A 1YCSB 1WJSA 1KIKA 2LCLA
chains in the Genus database with same CATH topology
2IVWA 1YI2T 2E5QA 2E6ZA 4C0DB 4C8QE 1IREB 4J83A 1UEBA 4CRIA 2BS2A 2OTLT 2O01E 3PTAA 4HLQA 4NS5A 1LJOA 1PSFA 3C4SA 3QJYA 5GAN7 3VKHA 1QW1A 3JCMP 3MEVA 2ZPFB 1IZ6A 4FM4B 3C95A 3P8HA 2JN0A 2RJFA 3OYIA 1Y07A 4OB0B 5CKDA 3CCQA 4BDZA 3M58A 2K5FA 4M75C 3RERA 2D6FA 3A8GB 3CCRT 2E1HA 2KK4A 2DVEA 2MI6A 5GAOp 4MMLA 3I55A 3DLLA 3CMET 2RHIA 1B34A 3I56A 4KBMB 2RA2A 3A8HB 5LJ3f 4JX4A 3CPFA 5IAYA 3VYGB 2QTXA 2FVUA 2WJ9A 4HT9A 1YIJA 1YI2A 4C8QD 5GMKh 4C5GA 2OTLA 2BKDN 5M9OA 1QVGA 3ER0A 1BKBA 4J6YA 5LJ5f 3LGLA 1M90U 4M7DF 1KG1A 2DXUA 3BG5A 2JZ2A 3OYDA 3HFOA 3ZBDA 3JCMe 3JCMJ 1NJIU 5HY6A 4LDXA 3L2WA 4RKUE 3DB4A 2KMTA 4M7DA 2F5TX 3CCRA 5LJ3j 4ZGEB 2EFIA 3MHXA 3VJPA 3CMEA 5A0DA 2DPPB 3V7SA 2HQXA 1B34B 1I4K1 3ASKA 4O5VA 3FDRA 3VKIA 3CBOA 3CXCA 2YHTA 3Q1JA 1UGPB 2DD4A 2H3JA 3MO8A 4KULA 4KUDK 4JRIA 4M78C 4M75E 3HBLA 3MEUA 5CK9A 3L2ZA 3BDLA 3G7ZA 3SFMA 4C92A 3RESA 4PLIA 5LJ3e 4C0ZA 4B9XA 1Y96A 1X6OA 4ATOA 3A5ZB 1MGQA 4HNUA 5AYFA 4M7DD 4QVZA 1K9MC 3A8LB 4DOWA 4KT0E 2WSCE 3CCST 3QO3A 2BUDA 2QQSA 2RD1A 3OS5A 2MWOA 4ZGJB 2G3RA 3E19A 4R56A 4M7DG 2K3XA 5LJ5e 3OS0A 4V2SA 1VQ7A 5CO7A 4AKGA 2YRVA 1NZ9A 3QKJA 4GY5A 4N0AA 4BBSM 2VUBA 3CBMA 3WVDB 2ZPHB 1W4SA 2XICA 4L5GA 4M77F 3UPUA 4LOCA 3LWHA 5CKBA 2E70A 1NE8A 4JS5A 1M1KC 4IURA 2DD4B 2R57A 2YLCA 2DTHA 4M77A 2VGMA 5GAN5 1G3TA 1NPRA 1Q82U 4M75D 2QEXT 4PJOE 2WSFE 2X35A 2GFAA 1I81A 5GMKi 2KAFA 3VV0A 3RUXA 1PSEA 4C92B 4QQGA 3OYLA 3WXMB 2EQJA 1Y96B 1MHNA 4UC4A 4XTYA 3VYHB 1VQNT 4C92G 2Y4XA 4AKIA 1O75A 2M0OA 2JOYA 2P0PA 3HRSA 4A54A 2LT4A 5KE3A 5GMKm 5A2QE 3JB9G 1VQPT 2LC4A 3J7AF 2RHUA 2LQKA 4M78E 3OYCA 3RKYA 4E7LA 5GMKj 4HL4A 3S6WA 1VQ4T 4HT8A 4D6WA 2PUOB 3LWIA 3QJ6A 4QQ6A 4X9DA 3S3MA 1VQ6T 3BY7A 3CMAT 3MP8A 5KH6A 4JS4A 3DLMA 2KQWA 4FT2A 4J5YA 4M77B 5GAOl 2R58A 2QEXA 2CKKA 2EQMA 3M54A 1U1SA 3OYAA 2E65A 2IG0A 2X4JA 2HBPA 4M77G 3RMQA 3HO8A 1ZHIA 5I2MA 5I21A 3QZ9B 5FRNA 5A0LA 5DY9A 1Q86C 3G71A 2P0KA 1XOVA 5GMKe 3SWNA 1VQNA 3TCJA 5D6XA 2P4TA 4A4KA 5LJ5h 3OYGA 3GNFB 1WGSA 1K9MU 1K8AU 4M78D 4MMKA 1BYMA 3J81E 1X75C 4F7UF 5LJ5d 5GAN8 4M7AE 3OMCA 1VQ4A 1UGRB 3A8OB 2PVDB 2XG8D 4BACA 2C06A 4MDXA 2XD0A 3JAME 4F7UA 4RCCA 3T9NA 2DXCA 1VQ6A 2QXFA 4JX5A 3CMAA 5GAMg 1VQ5T 2EKOA 3QYGB 1LNXA 1M9SA 1BIAA 2JVVA 5EJCA 4C8QF 3G6ET 3CPWS 4JRKA 2GCXA 3NTKA 3GF5A 5GAN2 2EYQA 2VGNA 4AKHA 3CC7T 3OYFA 2LTOA 4C8QA 3MEAA 2Y4YA 3LYIA 3CD6A 3JRZA 4EPCA 2AHJB 3KBGA 4OB1B 3S3NA 3SWNB 2DKGA 1Q81C 4HCCA 3FJPA 1UGQB 3VUZA 4OGEA 4LDUA 5CKEA 2CYZB 2EJ9A 5FU6C 5GANg 4A4HA 5GAOn 2BS4A 4XAXB 3O8VA 4JUVA 1QVGS 3CPWA 3X26B 2HQEA 1X01A 3OSSC 4HA8A 4C0GA 3OYKA 1D3BA 2DXCB 1W2BS 2RJDA 3H4CA 1G5VA 5EG2A 2KR6A 4PNOA 1VQ5A 1N27A 3BFMA 3QYEA 2ZGWA 4F7UG 5GAMf 3G6EA 1BI0A 3CCLT 3QYBA 1JRIA 3OQ5A 3M4YA 1H3ZA 4BE2A 4AI6A 3QDRB 4MDWA 4BE1A 3QWLA 2K3YA 3QIIA 5KCHA 3CC7A 4C8QB 2CZ7B 1WQWA 1QLBA 3KXTA 3CXCS 1EIFA 4HNTA 4JDSA 4P5NA 5FU7B 4C8QG 4KUIA 1O9SA 1W2BA 1U1TA 4HCZA 3CCVT 4VUBA 3LW5E 1S72T 2K2VA 1KD1U 3JB9H 5GANf 1WJRA 3FEOA 1YIJT 4PJOC 3QBYA 2ZCFB 3X25B 1OZ3A 3PNWC 4XTUA 3H8ZA 1D3BB 1JBMA 3SD4A 1UGSB 1VQ7T 2JNGA 1M1FA 3CCET 2XHCA 2DTIA 3M4GA 3QSUA 3CCLA 2K57A 2D0QB 1WQ7A 4IUPA 2EJGA 4M75F 4NC6A 3FB9A 4OVAA 2LRQA 2RHXA 4FIBA 5GAN6 2MAMA 2DK3A 5LJ5j 1KC8U 2E12A 2LVMA 3CBPA 4EMKC 2XK0A 2QDJA 4M75A 3NTHA 2WACA 3PMTA 5KCOA 4HNVA 2BS3A 2LQ8A 4IUTA 4LDVA 3CCJT 3CCVA 1S72A 4HKEA 5DLQE 4EMHA 4JRQA 4M7DB 2E64A 5IN1A 5J26A 3VU3C 3PT9A 2PVOB 4A4FA 2Y90A 3F70A 3KHIA 3V8KA 3TW6A 5CQXA 5CVIA 3QPHA 1KQSS 2RJEA 3CCEA 3DKMA 2DTOA 3KUFA 1N6AA 2RI5A 2FYKA 2DXBA 3LGFA 1BI2A 2RI2A 4GLKA 2LT1A 3M57A 1OI1A 4PJOF 1VQ8T 3OYNA 4C92E 2DZCA 2RO0A 3M5AA 4IUVA 2E41A 3EAEA 4BE0A 4BY6C 3M9QA 2F5KA 3V7CA 4M7AC 3PIPA 4M75B 1WNLA 4JLIA 2HNIA 1QVPA 2R5MA 5FLXE 1I8FA 3G71T 2M1HA 4M75G 4TVRA 3CCJA 1K73C 3S3OA 4C0DC 1KQSA 2RK2A 2X4XA 2XDPA 3JCMc 4HCBA 3VUBA 2R5AA 4M78F 4PKCC 3TU4K 3MP1A 4X34A 4BI8B 3OS2A 4E7KA 4Q5WA 2YLBA 1WJQA 3QG1A 1QVFA 3QXEB 4R55A 4M78A 3A8MB 3HSBA 3OMGA 4XTVA 2NLUA 2XU8A 1N8RC 1KQ2A 3UDCA 3EFRA 4XQ3A 1FKMA 2DXBB 2VXFA 5DM7R 2GF7A 2JUFA 1VQ8A 1E7PA 1QP2A 2DXTA 3LLRA 3BG9A 5GAOm 2K5LA 3CCMT 4PJOD 4XU0A 3QYHB 5GAMh 2RH2A 3RKWA 5GAOq 1Y71A 3EFSA 4QSHA 2ZPEB 4XU1A 1XQHA 4C0FA 5GAMd 5GAN4 4XTXA 4BI4A 4PJOG 3JCMb 3CD6T 5GMKl 3OBYA 4J7IA 1VQLT 1YITA 4M7AF 1VQOT 2PQWA 3L1AA 4ZGDB 2FHDA 3M56A 3RIRA 4M78B 3GNGA 5L8RE 5GANh 4BB7A 5GAN3 2DEQA 2RJCA 2HAXA 2FB7A 5KE2A 2LNVA 1M1GA 2KVQG 4QVCA 3FC3A 1V29B 2PUKB 4C5HA 4M78G 5GANd 3G4ST 3JCMg 4N4HA 2GQVA 3BW1A 4L6V5 3MP6A 2CZ6B 4N4IA 4RG2A 3CCMA 1M1KU 1RL2A 1BI3A 2L8DA 3INZA 4M6VA 2MMPA 2EIFA 4Y91A 1P92A 3SB2A 1I5LA 1QP3A 2JTMA 3OYJA 1M90C 3JCMW 3AHUA 1KC8C 4A53A 5C6SA 1JJ2S 4LDWA 2G77A 3P8BB 3OYHA 2QQBA 4OMFB 3L42A 3DB3A 3JCMf 3JCMX 3TREA 3X24B 1M5Q1 3WVEB 3H6ZA 2KY9A 1VQLA 4RCBA 3OSVA 4LDYA 4MZMA 3GOXA 1VQOA 2GFUA 3PMIA 4M7AD 4PL6A 4IUQA 3META 1HXDA 5FRMA 3GPLA 3P8DA 1SSFA 4LD6A 5LJ3g 1M4ZA 2QI2A 1H641 2ZZDA 3FLGA 3V8JA 4BD3A 4F7UB 3G4SA 4M7DC 3L2VA 1JJ2A 3BDUA 2QQ8A 3X28B 4JLGA 2L3RA 4RG8A 3SDZA 1YJ9T 2FL7A 4B9WA 3GIBA 1FX7A 2XDBA 2VXEA 4FL6A 3HKSA 5LJ5g 2F69A 4XU3A 1KHIA 2B8AA 5GAOr 2EQUA 2WSEE 1XTDA 2RB6A 4BUGA 1OYXA 3NFCA 1Q86U 2JTFA 1KHCA 3CC4T 3MEWA 4DA4A 1N9RA 1VQKT 2QA4T 3OYYA 2CS7A 2PVGB 2V8IA 4CI0C 5DLOA 3L2QA 4C92C 3M55A 2VYTA 3ZEHA 4RMOA 2E10A 4QQDA 2XKOC 5GAMj 3OA6A 2ZZDB 1ZQ1A 3PGGA 3CC2A 4MZTA 4XTWA 5CQYA 3TEEA 3CCUT 1YJ9A 3OYEA 2A7YA 5CIUA 1Q82C 5A0GA 2ZPGB 1BI1A 3RKXA 1UB4A 4EDUA 4BDYA 3QUIA 2ZPIB 1LOJA 2BIVA 1G3WA 4N0AC 3OY9A 3JB9J 2DIQA 3DL1A 2QQAA 5D6WA 2QF7A 4MIMA 3JCMV 4JJNK 4ZTJA 1BIBA 2K4YA 3PIOA 4JRPA 1G3YA 2EQKA 3BG3A 1Q7YC 2VC8A 5GANj 4M7DE 4M77C 4C5IA 5CR2A 3CC4A 5GAMe 3VKGA 4O6JA 2O4XA 1Q81U 4IKFA 4NOYA 3M53A 2QA4A 1VQKA 4DOVA 3JCMQ 5CKFA 4J6WA 2V8KA 2RHZA 4FT4A 3UWNA 5LL6S 5I2SA 4ZTFA 2OTJT 5CKHA 4ZN3A 2RM4A 2OAUA 3JSCA 4L59A 3E9GA 3HRUA 4OB2B 1N9SA 1OZ2A 2CGHA 3CCUA 3ME9A 3OS1A 4BBRM 3FRNA 1GXIE 2RHYA 3QHSA 1VUBA 1Y7XA 3HRTA 2XI9A 3HPWA 1KQ1A 4C92F 4Z02A 5GANe 3V8LA 1QVFS 2VV5A 5FU6B 3JB9F 4MZPA 2K5IA 4MFEA 4OB3B 5HK0A 1VQ9T 1TH7A 4PJOA 1M8VA 3HP9A 4OGCA 3OYBA 5C0MA 1FWZA 4BI3A 3TW7A 1YBYA 1XNIA 3FIFA 2DAQA 4ELYC 1K8AC 2O4XB 4OF1A 5HK3A 3HHTB 1AHJB 5FROA 2DIGA 4FSXA 3X20B 1NPPA 2XIDA 2A3LA 1FXXA 2OTJA 2QFZA 3C12A 4E7IA 2CZ1B 1YITT 2ZPBB 2V8JA 1VIFA 2EWNA 3SWNC 2DD5A 1JB0E 1WPYA 3HFNA 1YJWT 2LCCA 1ZBXA 4EMKA 4M77E 3L2RA 4E7JA 4IUUA 4II1A 1YJNT 2PU9B 4C5EA 3OBWA 3PFSA 3NTIA 4ELZC 3OW2S 4XU2A 1VIEA 2HD0A 4C92D 5IT9E 3JCMh 1HK9A 4ZN1A 4FU6A 2RI3A 4WF2A 3JB9D 2LDMA 1VQMT 1VQ9A 3HZJA 2KSSA 4PJOB 3JCMd 4Z6YA 2QDYB 5CAIA 3MCAB 1Q7YU 4A4GA 3R6OA 4J6XA 4QVDA 3GP8A 5CCAA 3CCSA 3M59A 2MWPA 3OB9A 3GLXA 4C8QC 4XK8E 3CEYA 4E47A 3N5BB 3OW2A 4NL3A 3URGA 1R8OB 4J7FA 2DD5B 1YHQT 3E9FA 5FU7C 1YJWA 2P0QA 2E6NA 4M77D 4EMKB 2CZ0B 4M7AA 1YJNA 4N4GA 5HKCA 2DO3A 4Y28E 4EMGA 2DZ9A 2L89A 2EAYA 2QQRA 2KDSA 5LJ3h 4DQ2A 2RK1A 4OP0A 3LH0A 2XDDA 2M9UA 2LX9A 4YTLA 3LX7A 4J8OA 4JX6A 3C94A 5LJ3d 1VQMA 4ELJA 2D9TA 3HL8A 2I2LA 3ZFJA 4E7HA 3RMSA 1KD1C 4NL2A 1NJIC 4QW2A 1VQPA 4ME7A 1K73U 2X4YA 1YCYA 3E1SA 5D6YA 3CCQT 3OYMA 3J80E 1U8RA 2L5QA 4F7UE 2X4WA 3V7RA 5J3BA 5J39A 2EJFA 1YHQA 2DJZA 4XTZA 4PLLA 3I55T 3JB9I 4BY6B 1DJ7B 4M7AB 2M16A 3L2UA 4A4EA 4LD9K 3I56T 2KMGA 3UT1A 1N8RU 3CC2T 1G3SA 4X9CA 3HB9A 3QZ5B 2QQ9A 2MF2A 4MFDA 3VYGA 4M7AG 1WJSA 1RI0A 2LCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPI B;  1IRE B;  2O01 E;  3QZ9 B;  1PSF A;  2ZPF B;  4FM4 B;  4OB0 B;  3A8G B;  1UGR B;  3A8O B;  3QXE B;  2PVD B;  3A8M B;  4OB2 B;  2DXC A;  2DXB B;  3VYG B;  1GXI E;  3QYG B;  1QP2 A;  3QYH B;  2ZPE B;  4OB3 B;  2AHJ B;  4OB1 B;  1UGQ B;  2CYZ B;  3HHT B;  4RKU E;  1AHJ B;  3X20 B;  2CZ1 B;  4ZGE B;  2ZPB B;  4ZGD B;  5L8R E;  2DPP B;  3X26 B;  1JB0 E;  2DD5 A;  2DXC B;  1V29 B;  2PUK B;  2PU9 B;  2DD4 A;  1UGP B;  4L6V 5;  2CZ6 B;  1QP3 A;  2CZ7 B;  2QDY B;  3X24 B;  3WVE B;  3A8L B;  3LW5 E;  4KT0 E;  2WSC E;  4XK8 E;  4ZGJ B;  2ZCF B;  3X25 B;  2DD5 B;  1UGS B;  2ZPH B;  3WVD B;  2CZ0 B;  2ZZD A;  3X28 B;  4Y28 E;  2D0Q B;  2DD4 B;  2WSF E;  1PSE A;  2WSE E;  3VYH B;  2PVG B;  2PVO B;  2PUO B;  1DJ7 B;  2ZZD B;  2DXB A;  3VYG A;  3QZ5 B;  2ZPG B;  3A8H B; 
#chains in the Genus database with same CATH topology
 2E5Q A;  3PTA A;  1LJO A;  3C4S A;  3QJY A;  1IZ6 A;  4FM4 B;  3C95 A;  1G83 A;  4TTH A;  2RN8 A;  3I55 Q;  3CCQ A;  4FW1 A;  4M75 C;  3RER A;  2F1L A;  3CC2 Q;  2KK4 A;  1QCO A;  4MML A;  3CME T;  1YI2 Q;  4EOO B;  3CPF A;  2I40 B;  4F16 A;  4HT9 A;  1URC B;  2RPN A;  1YIJ A;  4C8Q D;  2FRY A;  1WHH A;  4ELL A;  5LMK B;  5M9O A;  1M90 U;  4M7D F;  2P84 A;  4LDX A;  4GLM A;  2F5T X;  1UGV A;  2PTK A;  3CCR A;  4ZGE B;  4BCM D;  2LX7 A;  5A0D A;  1M30 A;  3V7S A;  1B34 B;  2QTV A;  1NLO C;  1OX9 A;  3SHW A;  3VKI A;  2YHT A;  3Q1J A;  1UGP B;  3MO8 A;  4KUL A;  4M75 E;  1K73 R;  3MJX A;  3L2Z A;  1W98 B;  3BDL A;  2VAS A;  4QT7 A;  3BHU B;  1D1A A;  3QWX X;  4ATO A;  3A5Z B;  5AYF A;  2DL5 A;  4KT0 E;  2WSC E;  3NPF A;  2QQS A;  1N8R R;  1GY3 B;  3OS0 A;  5CO7 A;  4GY5 A;  2VUB A;  4M77 F;  1W4S A;  2M51 A;  4L5G A;  1OEB A;  1K0S A;  2DD4 B;  2DTH A;  3O5Z A;  1G3T A;  1TU0 B;  1Q82 U;  4I3Z B;  2WSF E;  2X35 A;  1I81 A;  1LCK A;  4JZ4 A;  2L3Q A;  3RUX A;  4DBH A;  1PSE A;  3OYL A;  3WXM B;  2EQJ A;  4LUD A;  2M0O A;  3HRS A;  2JOY A;  4QKU A;  5KE3 A;  5GMK m;  1WZO A;  1VQP T;  2KXD A;  4E2F B;  3JB9 G;  4E7L A;  5GMK j;  1GCQ A;  4HT8 A;  1R0B G;  3LWI A;  2V26 A;  3JV3 A;  3MP8 A;  4FT2 A;  2QEX A;  4RTV A;  1U1S A;  2VB6 A;  3OYA A;  1WYX A;  1NJI R;  2FPE A;  1VQN Q;  1XO2 A;  3C0C A;  3QZ9 B;  3G71 A;  4F7L B;  2P0K A;  1XOV A;  3TCJ A;  2P4T A;  1VQ4 Q;  4M78 D;  1BYM A;  4J9F A;  4J9G A;  1JSU B;  3CMA Q;  1PD1 A;  4LUE A;  4RCC A;  2DXC A;  1VQ6 A;  2QXF A;  4E7Z A;  4JJC A;  5GAM g;  1QCN A;  1T3L A;  2NUP B;  2WEV B;  4C8Q F;  3NTK A;  3D7S B;  5GAN 2;  3CC7 T;  3MEA A;  2Y4Y A;  3LYI A;  3CD6 A;  2AHJ B;  1Q81 C;  2DKG A;  3VUZ A;  5IHK A;  1SHG A;  3EG3 A;  3TNW B;  2BPM B;  1W1F A;  5I5Z B;  4LN2 A;  2J6O A;  3M03 A;  4C0G A;  3OYK A;  1K4U S;  2RJD A;  3DTO A;  3H4C A;  1G5V A;  2MOX A;  1VQ5 A;  1N27 A;  2YUQ A;  5IF1 B;  3QYE A;  1TG0 A;  1H3H A;  1O9K A;  2J05 A;  4BE2 A;  2WHB B;  4MDW A;  4BE1 A;  2BKZ B;  5KCH A;  2GGR A;  1IGU A;  2O31 A;  1WQW A;  3CXC S;  1ZSZ C;  2FZC B;  4HNT A;  2RF0 A;  1W2B A;  3CCR Q;  1TUD A;  4BCN D;  2F2V A;  5GAN f;  1AVZ C;  4PJO C;  1D3B B;  1JBM A;  1M1F A;  4KRC B;  3M4G A;  3QSU A;  4IUP A;  5ICP B;  4JPB W;  4NC6 A;  5GAN 6;  4M4Z A;  3K7A M;  1RAD B;  4EMK C;  1K8A R;  2RNA A;  3CCV Q;  3TVT A;  3M0T A;  3PMT A;  1UUE A;  2BS3 A;  2LQ8 A;  2RQW A;  1S72 A;  1AEY A;  4JRQ A;  5J26 A;  3VU3 C;  4A4F A;  4YC3 B;  1C1A A;  5CVI A;  4Y72 B;  3G1J A;  3CCE A;  1N6A A;  1RAE B;  3DDP B;  1BI2 A;  4BCF B;  2IN3 A;  2ED1 A;  1VQ8 T;  3EAE A;  3EG9 A;  3M9Q A;  3TQ7 P;  1WNL A;  4TVR A;  4C0D C;  2RK2 A;  2XDP A;  3VUB A;  4M78 F;  3BLR B;  3DDQ B;  4BI8 B;  4E7K A;  1QVF A;  2BE7 D;  3QXE B;  4R55 A;  1AWX A;  3M0U A;  1MMN A;  3UDC A;  2JS0 A;  1FKM A;  5GJW B;  2DXB B;  2J06 A;  2GF7 A;  2JUF A;  1QP2 A;  4F7N B;  5GAO m;  2K5L A;  4CFN B;  2CJM B;  2G9X B;  3G71 Q;  5GAO q;  1Y71 A;  4EC8 B;  3EFS A;  5GAN 4;  4XTX A;  4DEY A;  1OKV B;  3DJB A;  3O0G D;  1VQ6 Q;  5GAN h;  1GRI A;  5GAN 3;  2RJC A;  5KE2 A;  4QVC A;  3FC3 A;  4C5H A;  4N4H A;  4L6V 5;  1W2B P;  3CCM A;  4Y91 A;  1I5L A;  3CD6 Q;  2ZAE A;  3OYJ A;  2WIH B;  2JM8 A;  2W0Z A;  2HSP A;  4YOO A;  2G77 A;  4ZNX A;  3OYH A;  3L42 A;  3X24 B;  2JT4 A;  2DL3 A;  2IPO B;  1GCP A;  2KY9 A;  4BY7 X;  4HCK A;  3VS7 A;  2DL7 A;  2IW9 B;  1VYT A;  1D1B A;  5FRM A;  3MET A;  1HXD A;  3GPL A;  4LD6 A;  3V8J A;  3FLG A;  4M7D C;  4RTX A;  3G4S A;  1JJ2 A;  3BDU A;  1YJ9 T;  1UNH D;  2CP0 A;  4FL6 A;  5LJ5 g;  2E3H A;  2I53 A;  2B8A A;  1GBR A;  1FMK A;  1OYX A;  1AT1 B;  3NFC A;  1PWT A;  1JEG A;  3MEW A;  5DQW A;  1VQK T;  3OYY A;  2CS7 A;  2QGS A;  4EOQ B;  2EGC A;  5DLO A;  4C92 C;  2VYT A;  1E9H B;  2NUT B;  3ZEH A;  3H0F A;  4XTW A;  3TEE A;  3CCU T;  2A37 A;  2ZPG B;  1UB4 A;  4EDU A;  1LOJ A;  1G3W A;  3DL1 A;  2QQA A;  3CC4 Q;  4MIM A;  4JJN K;  4ZTJ A;  1BIB A;  2ENM A;  4Z8A A;  4JRP A;  1G3Y A;  2EQK A;  2L0A A;  1HSQ A;  2EKH A;  4M77 C;  4C5I A;  2HDA A;  4M7D E;  1SG5 A;  2O4X A;  2EQI A;  2QA4 A;  1WXT A;  1T0H A;  4FT4 A;  5I2S A;  1OIY B;  3CCE Q;  1VIN A;  5CKH A;  4ZN3 A;  3UA6 A;  4OB2 B;  1QLY A;  4BBR M;  2AZS A;  3HRT A;  8AT1 B;  3HPW A;  1KQ1 A;  1NEG A;  1EZZ B;  4Z02 A;  3I35 A;  2DIL A;  1TOV A;  5ACB A;  2VV5 A;  5FU6 B;  4MZP A;  4MFE A;  1OGU B;  5HK0 A;  1TH7 A;  5C0M A;  1FWZ A;  1H4L D;  2AKK A;  3FIF A;  3HHT B;  1AHJ B;  1NPP A;  2A3L A;  2QFZ A;  2CZ1 B;  4JZ3 A;  2GTO A;  2H3E B;  3VS3 A;  2LCC A;  4M77 E;  1NEB A;  1OOT A;  4C5E A;  4XU2 A;  1MMA A;  4FU6 A;  3JB9 D;  3MCA B;  4A4G A;  3R6O A;  5CCA A;  1JJ2 P;  2MWP A;  3GLX A;  4C8Q C;  3N5B B;  4CC2 A;  3OW2 A;  3URG A;  1G3N C;  1R8O B;  3E2U A;  1YJW A;  1QCF A;  2SRC A;  3CCM Q;  2DO3 A;  4BCK B;  4Y28 E;  1VQM Q;  2EAY A;  2PK2 A;  2XDD A;  2CT3 A;  1RAG B;  5HBJ B;  3C94 A;  3EGX A;  3MKD A;  2J6F A;  1B07 A;  3RMS A;  2CT4 A;  4QW2 A;  1K73 U;  5D6Y A;  3E1S A;  3CCQ T;  3MPU B;  1YHQ A;  4XTZ A;  1BU2 A;  1K1Z A;  4BY6 B;  4M7A B;  2QGG A;  1N8R U;  3UT1 A;  1KC8 C;  4KRD B;  1RI0 A;  3JCM f;  2IVW A;  1YIJ T;  4C8Q E;  1IRE B;  4CRI A;  3QWY A;  2K6D A;  2O01 E;  1PSF A;  3JCM P;  3MEV A;  1NBE B;  2JN0 A;  4OB0 B;  1PRL C;  4HVW A;  1D0Y A;  3M58 A;  4BDZ A;  2K5F A;  2EW3 A;  5IHN A;  3I56 Q;  3A8G B;  3CCR T;  5GAO p;  3EH1 A;  3I55 A;  2CP7 A;  1B34 A;  4KBM B;  2RMO A;  5LJ3 f;  2FVU A;  3VS1 A;  5IDN B;  1YI2 A;  5L2W B;  3RDV A;  3LGL A;  3BHV B;  1KG1 A;  2JZ2 A;  2CP2 A;  3HFO A;  3JCM e;  1NJI U;  4CFU D;  2O2O A;  1B3Q A;  4J9I A;  3RGF B;  2KMT A;  3DB4 A;  3L2W A;  4HVU A;  2LW4 A;  3VJP A;  4O5V A;  1QKW A;  3CXC A;  2DD4 A;  2H3J A;  4PJM A;  2V1Q A;  5HQ0 B;  4JRI A;  4M78 C;  4BCI B;  3MEU A;  2C5X B;  3G7Z A;  3OW2 P;  3MI9 B;  5LJ3 e;  1X6O A;  4M7D D;  1MGQ A;  4QVZ A;  1K9M C;  3A8L B;  4DOW A;  2DRM A;  3CCS T;  1M8M A;  2DX1 A;  1H1Q B;  1B7T A;  1NZ9 A;  4N0A A;  3WVD B;  4LOC A;  1M1K C;  4IUR A;  4BCH B;  2YLC A;  3REA B;  4UN0 A;  2QEX T;  5KYW B;  2KAF A;  1TXQ A;  3DOG B;  1MHN A;  3VYH B;  2Y4X A;  1JO8 A;  4A54 A;  2LT4 A;  3J7A F;  2LC4 A;  2RHU A;  4M78 E;  3OYC A;  4BCP B;  3RKY A;  2HEQ A;  4HL4 A;  4OMN A;  2DE0 X;  3S3M A;  2CDT A;  1VQ6 T;  1I0C A;  2NUP A;  3DLM A;  5GAO l;  1TD6 A;  2R58 A;  2EQM A;  3BE3 A;  9ATC B;  2HBP A;  4F7S B;  1K76 A;  3RMQ A;  3HO8 A;  2W96 A;  1ZHI A;  5I2M A;  5DY9 A;  4BCQ B;  3MY5 B;  1Q86 C;  1A0N B;  1C6V X;  1U5S A;  1VQN A;  5D6X A;  4AFS C;  1R0C B;  4A4K A;  1K8A U;  2UUE B;  4MMK A;  5LJ5 d;  5GAN 8;  1OUL A;  2LP5 A;  1VQ4 A;  1UGR B;  3A8O B;  2XG8 D;  3UF4 A;  5IXB A;  3JAM E;  1S1N A;  4F7U A;  3T9N A;  5DQV A;  1M2O A;  3CMA A;  1TS9 A;  1VQ5 T;  3PE0 A;  2JVV A;  2C4G B;  3GF5 A;  2VGN A;  3EGX B;  5IHY A;  1M27 C;  1VOM A;  4IIM A;  3S3N A;  3SWN B;  2GNC A;  4OGE A;  4LDU A;  1D09 B;  2O9S A;  1ENW A;  1BK2 A;  4A4H A;  2NWM A;  3O8V A;  1QVG S;  3CPW A;  2COW A;  2MCN A;  3G6E Q;  4HA8 A;  1D3B A;  5FW9 A;  2KR6 A;  4RTZ A;  4F7U G;  5GAM f;  2W9Z A;  1BI0 A;  3QYB A;  5ECA A;  3OQ5 A;  4PFO A;  3M4Y A;  1H27 B;  3QDR B;  2K3Y A;  1ZUY A;  2HZY A;  3TNH B;  3KXT A;  2QAZ A;  3BLH B;  4VUB A;  3LW5 E;  1S72 T;  1E6H A;  2K2V A;  3JB9 H;  2W99 A;  3FEO A;  2K79 A;  3CCL Q;  1D0X A;  4XTU A;  3SD4 A;  1VQ7 T;  1UGS B;  2OJ2 A;  3CCE T;  2DTI A;  1KFZ A;  2D0Q B;  1WQ7 A;  1OI9 B;  3FB9 A;  5LJ5 j;  4OVA A;  2X51 A;  2E12 A;  5FGK B;  1K9M R;  2XK0 A;  1D1C A;  2IW8 B;  2CSQ A;  4LDV A;  3CCV A;  5DLQ E;  4EMH A;  3POM A;  1XJW B;  5IN1 A;  2PVO B;  5KYU A;  5CQX A;  2D8J A;  3DKM A;  3KUF A;  2D0N A;  2FYK A;  2DXB A;  3LGF A;  3M57 A;  1MUZ A;  2AT1 B;  1V76 A;  2DZC A;  2CCI B;  5KYX A;  1MNE A;  4BE0 A;  3PIP A;  4M75 B;  2LMJ A;  4PK4 A;  1AZE A;  1QVP A;  2R5M A;  2LQW A;  3CCJ A;  3S3O A;  1KQS A;  5IDP B;  2AKL A;  2CH4 A;  2EYX A;  3TU4 K;  5BNJ B;  1WJQ A;  3HSB A;  2XMF A;  3EFR A;  4XQ3 A;  1X6G A;  1X27 A;  1E7P A;  4X1V A;  3BG9 A;  3CCM T;  1PRM C;  2KT1 A;  4KH0 B;  5GAM h;  1KD1 R;  3RKW A;  4XU1 A;  3CPW P;  2DBM A;  4BI4 A;  4PJO G;  1BCM A;  3OBY A;  4J7I A;  4M7A F;  2G6F X;  3KFV A;  3RIR A;  3GNG A;  5L8R E;  2NUZ A;  4BB7 A;  3TN8 B;  1M1G A;  2KVQ G;  1V29 B;  2PUK B;  3G4S T;  1YN8 A;  3MP6 A;  2CZ6 B;  4RG2 A;  3INZ A;  4M6V A;  2EIF A;  1QP3 A;  1M90 C;  3I9Q A;  4ROD A;  1I1J A;  1VQL Q;  5I22 A;  2QQB A;  2EGE A;  1VQO Q;  2L3P A;  1WI7 A;  3JCM X;  2F2C A;  4RCB A;  2RQT A;  2A0F B;  2FPD A;  2WXV B;  2NUT A;  1HJD A;  4FYY B;  4F7U B;  2R7G A;  1WHM A;  3SDZ A;  2ABL A;  2L3R A;  4B9W A;  4F6U B;  1FX7 A;  1U3O A;  1VOL A;  2WFY B;  1OL1 B;  1PM3 A;  1RLQ C;  1KHI A;  2F69 A;  1PCX A;  5GAO r;  2UZB B;  2RB6 A;  4AG2 C;  2E3I A;  2QA4 T;  2ESW A;  1CKB A;  2PVG B;  4CI0 C;  2KNB B;  1PHT A;  5L23 A;  1X2K A;  2A08 A;  3OA6 A;  2ZZD B;  4RUG A;  4MZT A;  5CQY A;  4F70 B;  1AWO A;  3OYE A;  1Q82 C;  5A0G A;  4HXJ A;  1KQS P;  3QUI A;  2ZPI B;  3OY9 A;  2K4Y A;  1Q7Y C;  5CR2 A;  3CC4 A;  3VKG A;  2EBP A;  4NOY A;  1WFW A;  5CKF A;  2V8K A;  2RM4 A;  1GUX B;  2OAU A;  3HRU A;  4EOL B;  1OZ2 A;  2WMB B;  1GXI E;  1VUB A;  1Y7X A;  2XI9 A;  5GAN e;  3RBB B;  1GCQ C;  3V8L A;  2K5I A;  1KSW A;  3CCJ Q;  3HP9 A;  2DVJ A;  2OTJ Q;  2DAQ A;  2X9H A;  5HK3 A;  1UG1 A;  4PFZ A;  4E7I A;  1YIT T;  3F5X B;  3H41 A;  2V8J A;  5KYU B;  4II5 B;  2DM1 A;  1YJW T;  3L2R A;  4FSS A;  2EGA A;  3OBW A;  3PFS A;  1ZSZ B;  1VQ9 Q;  1VIE A;  5KYX B;  1HK9 A;  2OI3 A;  2RI3 A;  4ESR A;  3THK A;  2KSS A;  4PJO B;  3JCM d;  4Z6Y A;  4J6X A;  4QVD A;  2YUO A;  2NYS A;  3M59 A;  1X69 A;  2DMO A;  2MK5 A;  4XK8 E;  3CEY A;  1MND A;  1YJN Q;  4J7F A;  2DD5 B;  1YHQ T;  3E9F A;  5FU7 C;  1TTH B;  4EMK B;  4M7A A;  3UAT A;  2EUF A;  2BZY A;  4RTY A;  2L89 A;  3EGD B;  2RK1 A;  3LX7 A;  3VS0 A;  4ORZ A;  4JX6 A;  5LJ3 d;  1Q81 R;  1VQM A;  1OV3 A;  2D9T A;  4FCY A;  3HL8 A;  2W9F A;  2DLP A;  2EPD A;  1VQP A;  4ME7 A;  4J9B A;  2KR3 A;  2X4W A;  2LJ1 A;  5J39 A;  1ACM B;  4PLL A;  3I55 T;  3JB9 I;  3BLQ B;  1N5Z A;  4YOZ A;  2M16 A;  3L2U A;  3EFO B;  2KMG A;  3CC2 T;  1G3S A;  4X9C A;  3QZ5 B;  2QQ9 A;  2MF2 A;  4MFD A;  4M7A G;  1GL5 A;  3A8H B;  1YI2 T;  4C0D B;  3M0S A;  4J83 A;  2PHG A;  2BS2 A;  1ZA1 B;  2GTJ A;  4HLQ A;  4NS5 A;  2PZ1 A;  5GAN 7;  2OX7 A;  1SRM A;  4J9H A;  2RJF A;  1H28 B;  2K3B A;  1Y07 A;  5CKD A;  1JXM A;  2EYY A;  2DVE A;  4F6S B;  1PC0 A;  4RTW A;  3I56 A;  2RA2 A;  5IAY A;  3VYG B;  2QTX A;  5EC7 A;  2HL3 A;  2DRK A;  5GMK h;  1EFN A;  4C5G A;  2OTL A;  3U23 A;  2BKD N;  1QVG A;  1BKB A;  1QVF P;  3RNJ A;  2DXU A;  1C9B A;  3OYD A;  2C6T B;  3ZBD A;  3JCM J;  3CME Q;  5LJ3 j;  2EFI A;  3MHX A;  2DPP B;  1IHW A;  3EG0 A;  2MIO A;  2CP6 A;  3MIA B;  3ASK A;  1H24 B;  1RUW A;  4ANJ A;  5KYW A;  1I07 A;  1C0M A;  1WXU A;  3SFM A;  4PLI A;  4PJL A;  4C0Z A;  4B6M A;  2BTT A;  2FRW A;  3NMZ C;  4D8D A;  2C5V B;  3OS5 A;  2MWO A;  2G3R A;  4R56 A;  2K3X A;  2YRV A;  4Q5W A;  2PK9 B;  4BBS M;  3CBM A;  2FZK B;  1SHF A;  3UPU A;  4Y92 A;  2AIR B;  3LWH A;  2R57 A;  5GAN 5;  2V1R A;  4CC4 B;  3VV0 A;  4C92 B;  1SSH A;  4EOJ B;  1CKA A;  2RQV A;  1Y96 B;  4AG1 C;  1OPK A;  4DBF A;  1AWJ A;  1VQN T;  1O75 A;  2P0P A;  1MV3 A;  3S6W A;  1VQ4 T;  4D6W A;  2PUO B;  4EOS B;  4QQ6 A;  1BU1 A;  4X9D A;  3BY7 A;  3CMA T;  4M77 B;  2SEM A;  1RAF B;  2E65 A;  2IG0 A;  3PVL A;  1K9A A;  4F7J B;  5FRN A;  3VS2 A;  1JKW A;  1VQP Q;  2WPA B;  3SWN A;  1VA7 A;  1WGS A;  3I5R A;  3TSZ A;  1K9M U;  3J81 E;  1X75 C;  4F7U F;  4M7A E;  4CC3 A;  3OMC A;  1FIN B;  4BAC A;  1CSK A;  4MDX A;  1OL2 B;  2IVX A;  2C06 A;  4IMY B;  4JX5 A;  4BCJ B;  3EHQ A;  1ARK A;  2EKO A;  1LNX A;  2DYB A;  1M9S A;  5EJC A;  3EG1 A;  4JRK A;  1E7O A;  1UDL A;  4AKH A;  4WTO B;  3TNI B;  1X2Q A;  2LTO A;  4JJB A;  4KGZ B;  2O88 A;  4OB1 B;  2E4H A;  1KJW A;  2KE9 A;  2EJ9 A;  5CKE A;  2KYM A;  3AT1 B;  5GAO n;  4XAX B;  1FYN A;  3TSW A;  1W2B S;  1X01 A;  3OSS C;  4OML A;  1GBQ A;  2CSI A;  2OTL Q;  3G6E A;  1JRI A;  2KEA A;  4E6R A;  3H0H A;  1RLP C;  4AI6 A;  3QWL A;  3QII A;  4PJN A;  4C8Q B;  4KGX B;  1QLB A;  4FYV B;  2JS2 A;  4JDS A;  1E6G A;  4BXX X;  1O9S A;  4HCZ A;  3CCV T;  1KD1 U;  4AMC A;  3EOC B;  1UTI A;  1WJR A;  5LQF B;  1SKU B;  2OAW A;  1LPL A;  2VKN A;  1JXO A;  2HQH A;  1NG2 A;  2ZCF B;  1K0X A;  3X25 B;  2K9G A;  4BCM B;  4LXC A;  3CCL A;  4EOI B;  2K57 A;  4GBQ A;  3VRY A;  2KYB A;  2CCH B;  5D7U A;  1VYW B;  3A98 A;  2KRO A;  4OMQ A;  4PFP A;  1RAI B;  4M75 A;  2JXB A;  4OR5 B;  3NTH A;  1MV0 B;  4HVV A;  2A28 A;  4BCG B;  4HNV A;  4IUT A;  3CCJ T;  4HKE A;  1QKX A;  2E64 A;  5I11 A;  3KHI A;  3V8K A;  2RJE A;  1ZX6 A;  2JM9 A;  1RAB B;  1HD3 A;  2DTO A;  2FG0 A;  2EYZ A;  2RI5 A;  2RI2 A;  2COY A;  1YWP A;  2DET A;  4PJO F;  3OYN A;  2D1X A;  3M5A A;  2E41 A;  5KYY B;  1U06 A;  3V7C A;  2DFU A;  1WA7 A;  2V22 B;  1JST B;  4JLI A;  1H92 A;  1RAA B;  1R77 A;  5FLX E;  1K73 C;  3G71 T;  2M1H A;  4M75 G;  2KI7 A;  2F2X A;  4HCB A;  2UZE B;  2DBK A;  4PKC C;  4X34 A;  1IB8 A;  3QG1 A;  4YOS A;  2X3X D;  4EIK A;  3A8M B;  1VQ8 Q;  1N8R C;  2NLU A;  4EOM B;  2JGZ B;  1TWB A;  2IIM A;  2CP5 A;  1NM7 A;  2AK5 A;  4OMP A;  4XU0 A;  2RH2 A;  4QSH A;  1XQH A;  4C0F A;  1WX6 A;  1WHL A;  3CD6 T;  1BB9 A;  5IXF A;  4CFX B;  1G8X A;  3L1A A;  1AWW A;  4ZGD B;  2FHD A;  4M78 B;  1KC8 R;  2DEQ A;  5GAN d;  3JCM g;  2MPX C;  2GQV A;  1H1R B;  1OU8 A;  1QWE A;  2L8D A;  2JTM A;  3JCM W;  1JJ2 S;  1TFB A;  3DB3 A;  3WVE B;  3H6Z A;  1VQL A;  1ABO A;  3OSV A;  4LDY A;  4MZM A;  3GOX A;  1VQO A;  3CXC P;  3PMI A;  2DER A;  2HSE B;  4M7A D;  4PL6 A;  3MY1 B;  1VYV A;  4AFZ C;  3P8D A;  1SSF A;  4FW2 A;  5LJ3 g;  2QI2 A;  1H64 1;  2ZZD A;  2O9V A;  4KH1 B;  2QQ8 A;  4OMM A;  4NST B;  2LNH B;  1IRX A;  3QDF A;  2MYS A;  4OMO A;  2VXE A;  4XU3 A;  1ZUK A;  3IQL A;  1XTD A;  1KHC A;  3CC4 T;  2JTE A;  1N9R A;  2HCK A;  4BCN B;  1HYO A;  1YJ9 Q;  4RMO A;  4QQD A;  1GUX A;  1EX4 A;  1ZQ1 A;  1YWO A;  2DYI A;  2I0N A;  5CIU A;  1BI1 A;  3RKX A;  2H8H A;  3VRZ A;  4BDY A;  4N0A C;  3JB9 J;  1PD0 A;  3VS5 A;  1GFD A;  2QF7 A;  3PIO A;  1VQK Q;  1G2B A;  5GAN j;  3EHR A;  5GAM e;  4O6J A;  4IKF A;  1Q81 U;  3M53 A;  4EON B;  2RHZ A;  3UWN A;  3CCU Q;  4ZTF A;  4BCO B;  1M1K R;  1QMC A;  1UEC A;  1N9S A;  3ME9 A;  1D0Z A;  2RHY A;  1ZSZ A;  4C92 F;  2KRM A;  5HVY B;  1GFC A;  4OB3 B;  4PJO A;  1M8V A;  4OGC A;  1PKS A;  1JQQ A;  3TW7 A;  1YBY A;  2CUB A;  1K8A C;  3M0P A;  1Z9Q A;  4OF1 A;  2YXY A;  1PG5 B;  2DIG A;  2DL4 A;  3X20 B;  4FSX A;  3UA7 A;  2OTJ A;  2ZPB B;  1VIF A;  2EWN A;  2DD5 A;  3HFN A;  4EMK A;  4II1 A;  5HBE B;  1WXB A;  3VS4 A;  3OW2 S;  1WDX A;  3EGD A;  2DF6 A;  1OX8 A;  1Q86 R;  2HD0 A;  5IT9 E;  1RAH B;  1VQ9 A;  2LDM A;  1VQM T;  3HZJ A;  4FYW B;  2QDY B;  1Q7Y U;  2AZV A;  3CCS A;  3OB9 A;  4E7S A;  1Z9Z A;  2P0Q A;  2E6N A;  2LQN A;  3QHR B;  4FYX B;  1AOJ A;  1YJN A;  3EFO A;  4N4G A;  4DBR A;  5HKC A;  5AT1 B;  2YRD A;  3GBQ A;  2KDS A;  1YP5 A;  2PJQ A;  4YTL A;  4BCQ D;  2DJQ A;  4J8O A;  4ELJ A;  1H26 B;  4NL2 A;  3ULR B;  2YT6 A;  1U8R A;  4F7U E;  2W10 A;  3V7R A;  5J3B A;  4AT1 B;  1DJ7 B;  2LZ6 B;  2W2H A;  1F1B B;  4A4E A;  4LD9 K;  3I56 T;  3VYG A;  1M2V B;  2E6Z A;  1UEB A;  2OTL T;  2D8H A;  3VKH A;  1QW1 A;  3CCQ Q;  2ZPF B;  2COZ A;  2FZG B;  3P8H A;  5KYN A;  3OYI A;  2PNI A;  2D6F A;  1YNZ A;  2BZX A;  2E1H A;  2MI6 A;  3DLL A;  1QMZ B;  2RHI A;  1YIJ Q;  4JX4 A;  2QDL A;  2WJ9 A;  2A36 A;  1RI9 A;  2L3S A;  4EOR B;  1WIE A;  3ER0 A;  4J6Y A;  5LJ5 f;  3EGU A;  3BG5 A;  2L2P A;  1TUG B;  2UZL B;  5HY6 A;  4CFW B;  2EVR A;  4RKU E;  4M7D A;  4D8K A;  3CME A;  1AZG B;  1BBZ A;  2HQX A;  1Y0M A;  1I4K 1;  2CUD A;  3FDR A;  2JMA A;  1MMG A;  3CBO A;  3M0R A;  2B86 A;  4KUD K;  4JJD A;  3HBL A;  5CK9 A;  4F6W B;  4C92 A;  3RES A;  2YUN A;  1YFN A;  4B9X A;  1Y96 A;  3I5S A;  4HNU A;  4LE9 A;  1GH6 B;  2J6K A;  4IIO A;  3QO3 A;  2F2W A;  2BUD A;  3EH2 A;  2RD1 A;  4LNP A;  4ZGJ B;  3E19 A;  4M7D G;  4V2S A;  5LJ5 e;  1VQ7 A;  2J7I A;  3BHT B;  4AKG A;  3QKJ A;  2LCS A;  1N4M A;  5IHI A;  2CP3 A;  2KXC A;  2ZPH B;  1OKW B;  2XIC A;  5CKB A;  2E70 A;  1NE8 A;  4JS5 A;  1MMD A;  4M77 A;  1FMV A;  2VGM A;  1NPR A;  1UHC A;  4M75 D;  1JU5 C;  4PJO E;  2LJ0 A;  2GFA A;  5GMK i;  3LH5 A;  1QQJ A;  1SRL A;  4F04 B;  4QQG A;  3CCS Q;  4UC4 A;  4XTY A;  2YUP A;  4C92 G;  4AKI A;  5A2Q E;  2LQK A;  2KGT A;  3PVQ A;  7AT1 B;  5GJV B;  1H1S B;  1SEM A;  3QJ6 A;  2QEX Q;  1SF9 A;  4EC9 B;  5KH6 A;  1M90 R;  4JS4 A;  2KQW A;  4J5Y A;  2HMA A;  2CKK A;  3M54 A;  3EJ1 B;  2X4J A;  4M77 G;  5I21 A;  2JJ9 A;  5A0L A;  2K2M A;  4AFU C;  5GMK e;  4DEX A;  2B9R A;  5LJ5 h;  3OYG A;  3GNF B;  2QYZ A;  3G33 B;  1RAC B;  2PVD B;  1Q95 G;  2XD0 A;  4J9E A;  2X3W D;  2GQI A;  3RR6 A;  2YWW A;  3QYG B;  1BIA A;  3G6E T;  3CPW S;  2GCX A;  2BE9 B;  2WIP B;  2EYQ A;  4K11 A;  1ZLM A;  1UJY A;  3OYF A;  4C8Q A;  3PO3 S;  2UZD B;  3JRZ A;  4EPC A;  3KBG A;  2HL5 C;  2M02 A;  5FWB A;  4HCC A;  3FJP A;  1UGQ B;  5FU6 C;  2CYZ B;  5GAN g;  2BS4 A;  4JUV A;  1V1C A;  3B57 A;  4RTT A;  2DME A;  1VQ5 Q;  1Q82 R;  4CXA B;  3X26 B;  2HQE A;  2DXC B;  1NLP C;  1OPL A;  5EG2 A;  2CH4 W;  2P4R A;  4PNO A;  3BFM A;  2IW6 B;  2ZGW A;  2KBT A;  3CCL T;  5IH2 A;  2C5O B;  1H3Z A;  1Q7Y R;  3CC7 A;  3H9N A;  2CZ7 B;  1P5E B;  1EIF A;  4C8Q G;  4P5N A;  5FU7 B;  4KUI A;  2GBQ A;  1BCO A;  1U1T A;  1TUC A;  4DBQ A;  1JOW A;  4CFU B;  1KXU A;  2VWF A;  3EG2 A;  3QBY A;  1OZ3 A;  3PNW C;  3H8Z A;  2YDL A;  1F5Q B;  2JNG A;  2XHC A;  1NYG A;  2EJG A;  1O9K B;  4M75 F;  2LRQ A;  2RHX A;  4FIB A;  4ROE A;  2MAM A;  2DK3 A;  1KC8 U;  5KYY A;  1VYU A;  2LVM A;  3CBP A;  2K7A A;  2QDJ A;  1S72 Q;  2WAC A;  1UNL D;  2HKN A;  5KCO A;  2QGF B;  4R0K A;  1QWF A;  2ATC B;  4M7D B;  1VQ7 Q;  1T0J A;  4EOK B;  3PT9 A;  1M3C A;  2Y90 A;  3F70 A;  5CYI B;  3FJ5 A;  3TW6 A;  1FVV B;  1ZUU A;  3QPH A;  1KQS S;  4RTU A;  1ZSG A;  4G6L B;  4GLK A;  3QHW B;  2LT1 A;  1OI1 A;  2C0I A;  4C92 E;  2RO0 A;  4IUV A;  4BY6 C;  1PKD B;  1AD5 A;  2F5K A;  2RQU A;  4M7A C;  2HNI A;  1I8F A;  1IGQ A;  2X4X A;  3JCM c;  2R5A A;  1UJ0 A;  3MP1 A;  3OS2 A;  2YLB A;  1LVK A;  4CC7 A;  4EOP B;  4M78 A;  3OMG A;  4XTV A;  2XU8 A;  1KQ2 A;  2Z0W A;  3CQT A;  5CEI B;  3A1P A;  2VXF A;  4KRT A;  5DM7 R;  1VQ8 A;  5EFQ B;  1PKT A;  1H25 B;  2DXT A;  3LLR A;  4PJO D;  3EG9 B;  3QYH B;  3M0Q A;  2ZPE B;  2PMI B;  1WHJ A;  5GAM d;  4FX3 B;  3JCM b;  5GMK l;  5HNB B;  1PNJ A;  2RQR A;  1VQL T;  1YIT A;  1VQO T;  2PQW A;  4WCI A;  3M56 A;  2HAX A;  1UNG D;  2FB7 A;  2X1N B;  2LNV A;  1UFF A;  3GTM S;  1QVG P;  4M78 G;  2YRC A;  3BW1 A;  3H0I A;  4N4I A;  1M1K U;  1RL2 A;  1BI3 A;  4CRL B;  2MMP A;  1P92 A;  3SB2 A;  2CRE A;  4F17 A;  3AHU A;  4A53 A;  5C6S A;  4LDW A;  4PJJ A;  3P8B B;  4OMF B;  1ZA2 B;  2YSQ A;  3TRE A;  1M5Q 1;  4Z89 A;  3EID B;  2GFU A;  4BY1 X;  3R6N A;  2ROL A;  2KT8 A;  3G4S Q;  4IUQ A;  1M4Z A;  1X43 A;  4BD3 A;  3L2V A;  3X28 B;  4JLG A;  4RG8 A;  2FL7 A;  3CC7 Q;  3GIB A;  2XDB A;  6AT1 B;  1WLP B;  4F14 A;  2BZ8 A;  3HKS A;  1ABQ A;  2EQU A;  2WSE E;  4BUG A;  8ATC B;  1ZBJ A;  4KGV B;  1UE9 A;  1Q86 U;  2JTF A;  4CFV B;  4DA4 A;  1M3A A;  2V8I A;  3L2Q A;  4CFM B;  3M55 A;  2E10 A;  3NDQ A;  2XKO C;  5GAM j;  3REB B;  3PGG A;  3CC2 A;  1YJ9 A;  5FWC A;  2A7Y A;  1M3B A;  2WMA B;  2QK0 A;  1H8K A;  2BIV A;  2HBW A;  1IXD A;  2DIQ A;  2DNU A;  2ED0 A;  5D6W A;  3JCM V;  3NGP A;  2C0T A;  2QA4 Q;  3BG3 A;  2FO0 A;  2VC8 A;  2C5N B;  1Y57 A;  1NYF A;  1ZP2 A;  1VQK A;  1WHK A;  4DOV A;  2E5K A;  3JCM Q;  4J6W A;  1OU9 A;  1W70 A;  5LL6 S;  2OTJ T;  4ROC A;  1OQK A;  3JSC A;  4L59 A;  1WHG A;  2QG9 B;  3E9G A;  1AIS B;  2CGH A;  3CCU A;  3OS1 A;  3FRN A;  3QHS A;  2FEI A;  1QVF S;  3ZL7 C;  3JB9 F;  1VQ9 T;  4OGR B;  1SPK A;  3HTR A;  3NHN A;  3OYB A;  4BI3 A;  2EYW A;  2DA9 A;  1XNI A;  4ELY C;  2O4X B;  2HKQ B;  2C0O A;  3LQ5 B;  2JW4 A;  5FRO A;  1W6X A;  2XID A;  2M0Y A;  1FXX A;  3C12 A;  1X6B A;  2FPF A;  3SWN C;  1JB0 E;  1WPY A;  1ZBX A;  4E7J A;  4IUU A;  1UHF A;  1YJN T;  2PU9 B;  5HBH B;  3NTI A;  4ELZ C;  4A63 B;  4C92 D;  3SEM A;  2VVK A;  3JCM h;  4ZN1 A;  4WF2 A;  1H1P B;  5CAI A;  4AFQ C;  1YIT Q;  3GP8 A;  1I5O B;  5HCK A;  1T3S A;  4Z88 A;  1YJW Q;  2KRS A;  4E47 A;  4NL3 A;  3VS6 A;  1IHV A;  4M77 D;  2CZ0 B;  4J9D A;  1IO6 A;  1FMW A;  4EMG A;  2DZ9 A;  2QQR A;  5LJ3 h;  4DQ2 A;  4OP0 A;  3LH0 A;  2M9U A;  2LX9 A;  1M2V A;  1D3U B;  2ECZ A;  2I2L A;  3ZFJ A;  4E7H A;  4J9C A;  2ROT A;  1KD1 C;  1NJI C;  1J3T A;  1YHQ Q;  2X4Y A;  1YCY A;  2DL8 A;  1KK7 A;  3OYM A;  3J80 E;  2L5Q A;  2QAS A;  1AD6 A;  1TSF A;  2EJF A;  2KRN A;  2DJZ A;  2DEU A;  2JMC A;  1OIU B;  3HB9 A;  2LJ3 A;  1YCS B;  1WJS A;  1KIK A;  2LCL A; 
#chains in the Genus database with same CATH homology
 2IVW A;  1YI2 T;  2E5Q A;  2E6Z A;  4C0D B;  4C8Q E;  1IRE B;  4J83 A;  1UEB A;  4CRI A;  2BS2 A;  2OTL T;  2O01 E;  3PTA A;  4HLQ A;  4NS5 A;  1LJO A;  1PSF A;  3C4S A;  3QJY A;  5GAN 7;  3VKH A;  1QW1 A;  3JCM P;  3MEV A;  2ZPF B;  1IZ6 A;  4FM4 B;  3C95 A;  3P8H A;  2JN0 A;  2RJF A;  3OYI A;  1Y07 A;  4OB0 B;  5CKD A;  3CCQ A;  4BDZ A;  3M58 A;  2K5F A;  4M75 C;  3RER A;  2D6F A;  3A8G B;  3CCR T;  2E1H A;  2KK4 A;  2DVE A;  2MI6 A;  5GAO p;  4MML A;  3I55 A;  3DLL A;  3CME T;  2RHI A;  1B34 A;  3I56 A;  4KBM B;  2RA2 A;  3A8H B;  5LJ3 f;  4JX4 A;  3CPF A;  5IAY A;  3VYG B;  2QTX A;  2FVU A;  2WJ9 A;  4HT9 A;  1YIJ A;  1YI2 A;  4C8Q D;  5GMK h;  4C5G A;  2OTL A;  2BKD N;  5M9O A;  1QVG A;  3ER0 A;  1BKB A;  4J6Y A;  5LJ5 f;  3LGL A;  1M90 U;  4M7D F;  1KG1 A;  2DXU A;  3BG5 A;  2JZ2 A;  3OYD A;  3HFO A;  3ZBD A;  3JCM e;  3JCM J;  1NJI U;  5HY6 A;  4LDX A;  3L2W A;  4RKU E;  3DB4 A;  2KMT A;  4M7D A;  2F5T X;  3CCR A;  5LJ3 j;  4ZGE B;  2EFI A;  3MHX A;  3VJP A;  3CME A;  5A0D A;  2DPP B;  3V7S A;  2HQX A;  1B34 B;  1I4K 1;  3ASK A;  4O5V A;  3FDR A;  3VKI A;  3CBO A;  3CXC A;  2YHT A;  3Q1J A;  1UGP B;  2DD4 A;  2H3J A;  3MO8 A;  4KUL A;  4KUD K;  4JRI A;  4M78 C;  4M75 E;  3HBL A;  3MEU A;  5CK9 A;  3L2Z A;  3BDL A;  3G7Z A;  3SFM A;  4C92 A;  3RES A;  4PLI A;  5LJ3 e;  4C0Z A;  4B9X A;  1Y96 A;  1X6O A;  4ATO A;  3A5Z B;  1MGQ A;  4HNU A;  5AYF A;  4M7D D;  4QVZ A;  1K9M C;  3A8L B;  4DOW A;  4KT0 E;  2WSC E;  3CCS T;  3QO3 A;  2BUD A;  2QQS A;  2RD1 A;  3OS5 A;  2MWO A;  4ZGJ B;  2G3R A;  3E19 A;  4R56 A;  4M7D G;  2K3X A;  5LJ5 e;  3OS0 A;  4V2S A;  1VQ7 A;  5CO7 A;  4AKG A;  2YRV A;  1NZ9 A;  3QKJ A;  4GY5 A;  4N0A A;  4BBS M;  2VUB A;  3CBM A;  3WVD B;  2ZPH B;  1W4S A;  2XIC A;  4L5G A;  4M77 F;  3UPU A;  4LOC A;  3LWH A;  5CKB A;  2E70 A;  1NE8 A;  4JS5 A;  1M1K C;  4IUR A;  2DD4 B;  2R57 A;  2YLC A;  2DTH A;  4M77 A;  2VGM A;  5GAN 5;  1G3T A;  1NPR A;  1Q82 U;  4M75 D;  2QEX T;  4PJO E;  2WSF E;  2X35 A;  2GFA A;  1I81 A;  5GMK i;  2KAF A;  3VV0 A;  3RUX A;  1PSE A;  4C92 B;  4QQG A;  3OYL A;  3WXM B;  2EQJ A;  1Y96 B;  1MHN A;  4UC4 A;  4XTY A;  3VYH B;  1VQN T;  4C92 G;  2Y4X A;  4AKI A;  1O75 A;  2M0O A;  2JOY A;  2P0P A;  3HRS A;  4A54 A;  2LT4 A;  5KE3 A;  5GMK m;  5A2Q E;  3JB9 G;  1VQP T;  2LC4 A;  3J7A F;  2RHU A;  2LQK A;  4M78 E;  3OYC A;  3RKY A;  4E7L A;  5GMK j;  4HL4 A;  3S6W A;  1VQ4 T;  4HT8 A;  4D6W A;  2PUO B;  3LWI A;  3QJ6 A;  4QQ6 A;  4X9D A;  3S3M A;  1VQ6 T;  3BY7 A;  3CMA T;  3MP8 A;  5KH6 A;  4JS4 A;  3DLM A;  2KQW A;  4FT2 A;  4J5Y A;  4M77 B;  5GAO l;  2R58 A;  2QEX A;  2CKK A;  2EQM A;  3M54 A;  1U1S A;  3OYA A;  2E65 A;  2IG0 A;  2X4J A;  2HBP A;  4M77 G;  3RMQ A;  3HO8 A;  1ZHI A;  5I2M A;  5I21 A;  3QZ9 B;  5FRN A;  5A0L A;  5DY9 A;  1Q86 C;  3G71 A;  2P0K A;  1XOV A;  5GMK e;  3SWN A;  1VQN A;  3TCJ A;  5D6X A;  2P4T A;  4A4K A;  5LJ5 h;  3OYG A;  3GNF B;  1WGS A;  1K9M U;  1K8A U;  4M78 D;  4MMK A;  1BYM A;  3J81 E;  1X75 C;  4F7U F;  5LJ5 d;  5GAN 8;  4M7A E;  3OMC A;  1VQ4 A;  1UGR B;  3A8O B;  2PVD B;  2XG8 D;  4BAC A;  2C06 A;  4MDX A;  2XD0 A;  3JAM E;  4F7U A;  4RCC A;  3T9N A;  2DXC A;  1VQ6 A;  2QXF A;  4JX5 A;  3CMA A;  5GAM g;  1VQ5 T;  2EKO A;  3QYG B;  1LNX A;  1M9S A;  1BIA A;  2JVV A;  5EJC A;  4C8Q F;  3G6E T;  3CPW S;  4JRK A;  2GCX A;  3NTK A;  3GF5 A;  5GAN 2;  2EYQ A;  2VGN A;  4AKH A;  3CC7 T;  3OYF A;  2LTO A;  4C8Q A;  3MEA A;  2Y4Y A;  3LYI A;  3CD6 A;  3JRZ A;  4EPC A;  2AHJ B;  3KBG A;  4OB1 B;  3S3N A;  3SWN B;  2DKG A;  1Q81 C;  4HCC A;  3FJP A;  1UGQ B;  3VUZ A;  4OGE A;  4LDU A;  5CKE A;  2CYZ B;  2EJ9 A;  5FU6 C;  5GAN g;  4A4H A;  5GAO n;  2BS4 A;  4XAX B;  3O8V A;  4JUV A;  1QVG S;  3CPW A;  3X26 B;  2HQE A;  1X01 A;  3OSS C;  4HA8 A;  4C0G A;  3OYK A;  1D3B A;  2DXC B;  1W2B S;  2RJD A;  3H4C A;  1G5V A;  5EG2 A;  2KR6 A;  4PNO A;  1VQ5 A;  1N27 A;  3BFM A;  3QYE A;  2ZGW A;  4F7U G;  5GAM f;  3G6E A;  1BI0 A;  3CCL T;  3QYB A;  1JRI A;  3OQ5 A;  3M4Y A;  1H3Z A;  4BE2 A;  4AI6 A;  3QDR B;  4MDW A;  4BE1 A;  3QWL A;  2K3Y A;  3QII A;  5KCH A;  3CC7 A;  4C8Q B;  2CZ7 B;  1WQW A;  1QLB A;  3KXT A;  3CXC S;  1EIF A;  4HNT A;  4JDS A;  4P5N A;  5FU7 B;  4C8Q G;  4KUI A;  1O9S A;  1W2B A;  1U1T A;  4HCZ A;  3CCV T;  4VUB A;  3LW5 E;  1S72 T;  2K2V A;  1KD1 U;  3JB9 H;  5GAN f;  1WJR A;  3FEO A;  1YIJ T;  4PJO C;  3QBY A;  2ZCF B;  3X25 B;  1OZ3 A;  3PNW C;  4XTU A;  3H8Z A;  1D3B B;  1JBM A;  3SD4 A;  1UGS B;  1VQ7 T;  2JNG A;  1M1F A;  3CCE T;  2XHC A;  2DTI A;  3M4G A;  3QSU A;  3CCL A;  2K57 A;  2D0Q B;  1WQ7 A;  4IUP A;  2EJG A;  4M75 F;  4NC6 A;  3FB9 A;  4OVA A;  2LRQ A;  2RHX A;  4FIB A;  5GAN 6;  2MAM A;  2DK3 A;  5LJ5 j;  1KC8 U;  2E12 A;  2LVM A;  3CBP A;  4EMK C;  2XK0 A;  2QDJ A;  4M75 A;  3NTH A;  2WAC A;  3PMT A;  5KCO A;  4HNV A;  2BS3 A;  2LQ8 A;  4IUT A;  4LDV A;  3CCJ T;  3CCV A;  1S72 A;  4HKE A;  5DLQ E;  4EMH A;  4JRQ A;  4M7D B;  2E64 A;  5IN1 A;  5J26 A;  3VU3 C;  3PT9 A;  2PVO B;  4A4F A;  2Y90 A;  3F70 A;  3KHI A;  3V8K A;  3TW6 A;  5CQX A;  5CVI A;  3QPH A;  1KQS S;  2RJE A;  3CCE A;  3DKM A;  2DTO A;  3KUF A;  1N6A A;  2RI5 A;  2FYK A;  2DXB A;  3LGF A;  1BI2 A;  2RI2 A;  4GLK A;  2LT1 A;  3M57 A;  1OI1 A;  4PJO F;  1VQ8 T;  3OYN A;  4C92 E;  2DZC A;  2RO0 A;  3M5A A;  4IUV A;  2E41 A;  3EAE A;  4BE0 A;  4BY6 C;  3M9Q A;  2F5K A;  3V7C A;  4M7A C;  3PIP A;  4M75 B;  1WNL A;  4JLI A;  2HNI A;  1QVP A;  2R5M A;  5FLX E;  1I8F A;  3G71 T;  2M1H A;  4M75 G;  4TVR A;  3CCJ A;  1K73 C;  3S3O A;  4C0D C;  1KQS A;  2RK2 A;  2X4X A;  2XDP A;  3JCM c;  4HCB A;  3VUB A;  2R5A A;  4M78 F;  4PKC C;  3TU4 K;  3MP1 A;  4X34 A;  4BI8 B;  3OS2 A;  4E7K A;  4Q5W A;  2YLB A;  1WJQ A;  3QG1 A;  1QVF A;  3QXE B;  4R55 A;  4M78 A;  3A8M B;  3HSB A;  3OMG A;  4XTV A;  2NLU A;  2XU8 A;  1N8R C;  1KQ2 A;  3UDC A;  3EFR A;  4XQ3 A;  1FKM A;  2DXB B;  2VXF A;  5DM7 R;  2GF7 A;  2JUF A;  1VQ8 A;  1E7P A;  1QP2 A;  2DXT A;  3LLR A;  3BG9 A;  5GAO m;  2K5L A;  3CCM T;  4PJO D;  4XU0 A;  3QYH B;  5GAM h;  2RH2 A;  3RKW A;  5GAO q;  1Y71 A;  3EFS A;  4QSH A;  2ZPE B;  4XU1 A;  1XQH A;  4C0F A;  5GAM d;  5GAN 4;  4XTX A;  4BI4 A;  4PJO G;  3JCM b;  3CD6 T;  5GMK l;  3OBY A;  4J7I A;  1VQL T;  1YIT A;  4M7A F;  1VQO T;  2PQW A;  3L1A A;  4ZGD B;  2FHD A;  3M56 A;  3RIR A;  4M78 B;  3GNG A;  5L8R E;  5GAN h;  4BB7 A;  5GAN 3;  2DEQ A;  2RJC A;  2HAX A;  2FB7 A;  5KE2 A;  2LNV A;  1M1G A;  2KVQ G;  4QVC A;  3FC3 A;  1V29 B;  2PUK B;  4C5H A;  4M78 G;  5GAN d;  3G4S T;  3JCM g;  4N4H A;  2GQV A;  3BW1 A;  4L6V 5;  3MP6 A;  2CZ6 B;  4N4I A;  4RG2 A;  3CCM A;  1M1K U;  1RL2 A;  1BI3 A;  2L8D A;  3INZ A;  4M6V A;  2MMP A;  2EIF A;  4Y91 A;  1P92 A;  3SB2 A;  1I5L A;  1QP3 A;  2JTM A;  3OYJ A;  1M90 C;  3JCM W;  3AHU A;  1KC8 C;  4A53 A;  5C6S A;  1JJ2 S;  4LDW A;  2G77 A;  3P8B B;  3OYH A;  2QQB A;  4OMF B;  3L42 A;  3DB3 A;  3JCM f;  3JCM X;  3TRE A;  3X24 B;  1M5Q 1;  3WVE B;  3H6Z A;  2KY9 A;  1VQL A;  4RCB A;  3OSV A;  4LDY A;  4MZM A;  3GOX A;  1VQO A;  2GFU A;  3PMI A;  4M7A D;  4PL6 A;  4IUQ A;  3MET A;  1HXD A;  5FRM A;  3GPL A;  3P8D A;  1SSF A;  4LD6 A;  5LJ3 g;  1M4Z A;  2QI2 A;  1H64 1;  2ZZD A;  3FLG A;  3V8J A;  4BD3 A;  4F7U B;  3G4S A;  4M7D C;  3L2V A;  1JJ2 A;  3BDU A;  2QQ8 A;  3X28 B;  4JLG A;  2L3R A;  4RG8 A;  3SDZ A;  1YJ9 T;  2FL7 A;  4B9W A;  3GIB A;  1FX7 A;  2XDB A;  2VXE A;  4FL6 A;  3HKS A;  5LJ5 g;  2F69 A;  4XU3 A;  1KHI A;  2B8A A;  5GAO r;  2EQU A;  2WSE E;  1XTD A;  2RB6 A;  4BUG A;  1OYX A;  3NFC A;  1Q86 U;  2JTF A;  1KHC A;  3CC4 T;  3MEW A;  4DA4 A;  1N9R A;  1VQK T;  2QA4 T;  3OYY A;  2CS7 A;  2PVG B;  2V8I A;  4CI0 C;  5DLO A;  3L2Q A;  4C92 C;  3M55 A;  2VYT A;  3ZEH A;  4RMO A;  2E10 A;  4QQD A;  2XKO C;  5GAM j;  3OA6 A;  2ZZD B;  1ZQ1 A;  3PGG A;  3CC2 A;  4MZT A;  4XTW A;  5CQY A;  3TEE A;  3CCU T;  1YJ9 A;  3OYE A;  2A7Y A;  5CIU A;  1Q82 C;  5A0G A;  2ZPG B;  1BI1 A;  3RKX A;  1UB4 A;  4EDU A;  4BDY A;  3QUI A;  2ZPI B;  1LOJ A;  2BIV A;  1G3W A;  4N0A C;  3OY9 A;  3JB9 J;  2DIQ A;  3DL1 A;  2QQA A;  5D6W A;  2QF7 A;  4MIM A;  3JCM V;  4JJN K;  4ZTJ A;  1BIB A;  2K4Y A;  3PIO A;  4JRP A;  1G3Y A;  2EQK A;  3BG3 A;  1Q7Y C;  2VC8 A;  5GAN j;  4M7D E;  4M77 C;  4C5I A;  5CR2 A;  3CC4 A;  5GAM e;  3VKG A;  4O6J A;  2O4X A;  1Q81 U;  4IKF A;  4NOY A;  3M53 A;  2QA4 A;  1VQK A;  4DOV A;  3JCM Q;  5CKF A;  4J6W A;  2V8K A;  2RHZ A;  4FT4 A;  3UWN A;  5LL6 S;  5I2S A;  4ZTF A;  2OTJ T;  5CKH A;  4ZN3 A;  2RM4 A;  2OAU A;  3JSC A;  4L59 A;  3E9G A;  3HRU A;  4OB2 B;  1N9S A;  1OZ2 A;  2CGH A;  3CCU A;  3ME9 A;  3OS1 A;  4BBR M;  3FRN A;  1GXI E;  2RHY A;  3QHS A;  1VUB A;  1Y7X A;  3HRT A;  2XI9 A;  3HPW A;  1KQ1 A;  4C92 F;  4Z02 A;  5GAN e;  3V8L A;  1QVF S;  2VV5 A;  5FU6 B;  3JB9 F;  4MZP A;  2K5I A;  4MFE A;  4OB3 B;  5HK0 A;  1VQ9 T;  1TH7 A;  4PJO A;  1M8V A;  3HP9 A;  4OGC A;  3OYB A;  5C0M A;  1FWZ A;  4BI3 A;  3TW7 A;  1YBY A;  1XNI A;  3FIF A;  2DAQ A;  4ELY C;  1K8A C;  2O4X B;  4OF1 A;  5HK3 A;  3HHT B;  1AHJ B;  5FRO A;  2DIG A;  4FSX A;  3X20 B;  1NPP A;  2XID A;  2A3L A;  1FXX A;  2OTJ A;  2QFZ A;  3C12 A;  4E7I A;  2CZ1 B;  1YIT T;  2ZPB B;  2V8J A;  1VIF A;  2EWN A;  3SWN C;  2DD5 A;  1JB0 E;  1WPY A;  3HFN A;  1YJW T;  2LCC A;  1ZBX A;  4EMK A;  4M77 E;  3L2R A;  4E7J A;  4IUU A;  4II1 A;  1YJN T;  2PU9 B;  4C5E A;  3OBW A;  3PFS A;  3NTI A;  4ELZ C;  3OW2 S;  4XU2 A;  1VIE A;  2HD0 A;  4C92 D;  5IT9 E;  3JCM h;  1HK9 A;  4ZN1 A;  4FU6 A;  2RI3 A;  4WF2 A;  3JB9 D;  2LDM A;  1VQM T;  1VQ9 A;  3HZJ A;  2KSS A;  4PJO B;  3JCM d;  4Z6Y A;  2QDY B;  5CAI A;  3MCA B;  1Q7Y U;  4A4G A;  3R6O A;  4J6X A;  4QVD A;  3GP8 A;  5CCA A;  3CCS A;  3M59 A;  2MWP A;  3OB9 A;  3GLX A;  4C8Q C;  4XK8 E;  3CEY A;  4E47 A;  3N5B B;  3OW2 A;  4NL3 A;  3URG A;  1R8O B;  4J7F A;  2DD5 B;  1YHQ T;  3E9F A;  5FU7 C;  1YJW A;  2P0Q A;  2E6N A;  4M77 D;  4EMK B;  2CZ0 B;  4M7A A;  1YJN A;  4N4G A;  5HKC A;  2DO3 A;  4Y28 E;  4EMG A;  2DZ9 A;  2L89 A;  2EAY A;  2QQR A;  2KDS A;  5LJ3 h;  4DQ2 A;  2RK1 A;  4OP0 A;  3LH0 A;  2XDD A;  2M9U A;  2LX9 A;  4YTL A;  3LX7 A;  4J8O A;  4JX6 A;  3C94 A;  5LJ3 d;  1VQM A;  4ELJ A;  2D9T A;  3HL8 A;  2I2L A;  3ZFJ A;  4E7H A;  3RMS A;  1KD1 C;  4NL2 A;  1NJI C;  4QW2 A;  1VQP A;  4ME7 A;  1K73 U;  2X4Y A;  1YCY A;  3E1S A;  5D6Y A;  3CCQ T;  3OYM A;  3J80 E;  1U8R A;  2L5Q A;  4F7U E;  2X4W A;  3V7R A;  5J3B A;  5J39 A;  2EJF A;  1YHQ A;  2DJZ A;  4XTZ A;  4PLL A;  3I55 T;  3JB9 I;  4BY6 B;  1DJ7 B;  4M7A B;  2M16 A;  3L2U A;  4A4E A;  4LD9 K;  3I56 T;  2KMG A;  3UT1 A;  1N8R U;  3CC2 T;  1G3S A;  4X9C A;  3HB9 A;  3QZ5 B;  2QQ9 A;  2MF2 A;  4MFD A;  3VYG A;  4M7A G;  1WJS A;  1RI0 A;  2LCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...