4ZGDB

Mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
206
structure length
206
Chain Sequence
MDGMHDLGGKQGFGPVIKTHNAKAFHEEWEVKMNAISGALVSKGIYNMDEYRHGIERMEPRHYLTASYFERVFTTAVTLCIEKGVFTAAELEAKLGTSVPLSLPSSPGRQPPKGPEGGFKLGQRVHVKNEFVPGHTRFPAYIRGKAGVVVGISPAYPYPDAAAHGEYGFSEPTYDVCFKSKDLWPDGCEAADVHVGVFQSYLLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyzing the catalytic role of active site residues in the Fe-type nitrile hydratase from Comamonas testosteroni Ni1.
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Lyase
molecule keywords Nitrile hydratase alpha subunit
total genus 57
structure length 206
sequence length 206
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2015-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 4zgdB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4zgdB02
1UGQB 2CZ6B 2ZPFB 2DD4B 3VYGB 4OB3B 2DXCB 3QYGB 2PVGB 3QZ5B 2CZ1B 2ZCFB 1AHJB 1PSEA 2DPPB 1UGSB 2PVOB 3X26B 2CZ0B 2CYZB 2ZZDA 4OB0B 2DXBA 5L8RE 2DD5B 1GXIE 3A8HB 2ZZDB 2DD4A 4RKUE 2PVDB 2ZPIB 2ZPGB 2ZPBB 1JB0E 2AHJB 3A8MB 2O01E 1UGPB 2ZPEB 3QXEB 4ZGDB 4OB2B 1DJ7B 4ZGJB 3VYHB 1QP2A 3WVEB 1IREB 2PUOB 1PSFA 3A8OB 2PU9B 2D0QB 4KT0E 2DD5A 3HHTB 2DXBB 2WSFE 2WSCE 3A8GB 4ZGEB 4FM4B 3A8LB 4L6V5 3X20B 4OB1B 3X28B 1QP3A 3QYHB 4XK8E 2DXCA 3X25B 3LW5E 4Y28E 2ZPHB 2PUKB 3X24B 3QZ9B 3VYGA 2QDYB 2CZ7B 3WVDB 1UGRB 1V29B 2WSEE
chains in the Genus database with same CATH superfamily
1BIBA 1VUBA 3HZJA 2LNVA 1JXMA 2Y90A 3I5SA 1WHGA 3HO8A 4J6WA 2QXFA 4EC9B 2CZ1B 4BI3A 5LMKB 2JJ9A 2HZYA 3CCET 2CZ0B 4M7DD 2NUTA 1Q86U 2X3XD 2CP6A 5J3BA 2KQWA 2MAMA 4LDVA 2PZ1A 2MWPA 3EH1A 1NM7A 3UDCA 3KBGA 3BG3A 1TUGB 4ZNXA 4HL4A 4E6RA 2O9VA 1VQ7Q 1Y7XA 2ZPIB 5DLQE 1XTDA 2EQJA 2DVEA 1W70A 3LGLA 1YJ9T 1U1TA 2L3SA 1QVFP 4GBQA 1NEBA 1QQJA 4ZGDB 1PD0A 5A2QE 1RAFB 3HFNA 4GLMA 3TN8B 1PWTA 2DBMA 2BZ8A 5EG2A 5J26A 4M75D 2E64A 4J9DA 1YITA 2K3YA 1YJWT 1EIFA 4BCMB 3OS5A 1FMVA 3CPWS 3OYHA 1H1SB 1OULA 3FB9A 4BY6B 1M8VA 2NWMA 5D7UA 1RABB 1AISB 3PE0A 1JQQA 1LCKA 3JB9G 1N9SA 2OTJT 4PJOF 1PNJA 1WJSA 3MP8A 4FYWB 1HYOA 1MMAA 2CP7A 4C8QB 4E7IA 3PFSA 1QCNA 1UHFA 3EHRA 4AKHA 5IDNB 1WHMA 3O5ZA 2PNIA 2DXCA 1YJ9Q 1TD6A 4FCYA 4M7AA 4CFUB 2KSSA 3HPWA 4KBMB 4BCNB 4XU1A 4RMOA 4OMLA 3BLRB 1YJNA 1K8AU 2YHTA 2V8KA 4BCFB 1R0BG 4N4GA 1GBRA 2YUQA 2DTOA 3O8VA 1VQMQ 3PIOA 4LOCA 2BUDA 3BHVB 2DL5A 5IH2A 1X43A 1VQOT 3BG5A 2XU8A 3CCJT 4DQ2A 4AMCA 2DRKA 5GAN8 4Y92A 4B9XA 2MWOA 5LJ3h 1C1AA 1PRLC 5LJ3f 1JJ2S 3EJ1B 2DPPB 1H8KA 5FROA 1UGSB 3DB3A 3CD6A 2OAWA 3OYEA 3CQTA 3VS0A 2C6TB 1VQ7A 4L5GA 1TUCA 1K4US 1VQOQ 4M78E 2BKDN 4N4IA 1U3OA 4LD6A 1VQ6A 3RR6A 5CQYA 4F7UA 4HVVA 2B9RA 3CCMQ 1VINA 4RG2A 3RMQA 1TG0A 3MHXA 1Q82C 2PVDB 3OYLA 5A0GA 4M78F 2DA9A 4HCBA 5KCOA 1YCSB 3RESA 2F69A 1UGPB 4BCND 1I4K1 3SHWA 3OSVA 3GNGA 2LRQA 2L89A 4E7ZA 1WHKA 3S3NA 5ACBA 2DJZA 5HBJB 3OBWA 2DZ9A 3HRUA 4C92D 2RO0A 4NL2A 3E9FA 2RK1A 5GAOl 5GAMg 4MMKA 4QQ6A 4A53A 3THKA 3EOCB 4CFNB 4PJOD 4EOLB 4EMGA 1QWEA 4CC4B 3F5XB 2QG9B 2KYMA 1D3BB 2HBPA 2LP5A 8AT1B 1TH7A 4YOZA 4Z89A 5GJVB 3OS1A 1N5ZA 1SRMA 3NTKA 2FPEA 2EAYA 2QYZA 3CCMT 3GF5A 1W2BA 2K5IA 5DQVA 1M90C 3CC7Q 1X2KA 2WACA 4DOVA 5J39A 2X4YA 2A7YA 2M02A 3X24B 1JSTB 2E10A 5GMKj 4JRQA 1M90R 3CC7A 1G3WA 2VUBA 1FKMA 1I0CA 2IIMA 2LT4A 3QO3A 3OW2A 2HD0A 4MZPA 4ATOA 1K8AR 1G83A 1GFCA 4BCQB 4M75A 4QVZA 2C06A 2MK5A 3CMAQ 4PJNA 4BY6C 2Y4YA 4MFDA 2EVRA 4BCGB 2LCCA 4ZN3A 3JCMc 2C5VB 1SF9A 4IIMA 2RF0A 4EOQB 1D09B 4DBQA 1H1PB 4DBHA 3EHQA 3NGPA 4BB7A 1V76A 5CQXA 2DXBA 1W2BS 5IT9E 1S72A 1QVPA 3CC4A 2QK0A 3MEWA 5LJ5f 1PKSA 1UG1A 3SWNC 1QMZB 2XHCA 2JN0A 4JRIA 4HT9A 2NUPB 4CFMB 5FGKB 1IHVA 3A1PA 2J05A 3M9QA 2R58A 4XAXB 2ZPEB 3HRTA 2VVKA 1YI2T 1XOVA 3C0CA 5EJCA 4BCOB 5C0MA 4OMQA 3M4YA 2D8JA 3M54A 1VQLQ 5IDPB 1M5Q1 3CCRA 2ED1A 1Y57A 2RJCA 1T3SA 3CC2Q 2K3BA 2X9HA 3A8OB 1QVFA 1JO8A 1H3ZA 1Q81R 3CCSQ 3EG9B 1M3CA 4CC3A 3CD6Q 3OYJA 1OX8A 1GL5A 3SD4A 1PHTA 4PLIA 4C0ZA 2RHZA 1O9KB 2KBTA 2QQ9A 1NLPC 5FU7C 3LQ5B 2HSPA 3DKMA 3X28B 1B34B 4MDWA 5HVYB 4BCKB 1Q82R 5GANf 4JZ3A 4M77C 4C5EA 2HQHA 1TSFA 2FHDA 5FWBA 1MMGA 4M7DF 4F6UB 2HSEB 4FW2A 1H641 1YJNQ 1TXQA 2NUZA 3REAB 3VRYA 4RTZA 4LDWA 1KQSS 4PJOB 1VQ4T 4PJOA 2MCNA 1A0NB 1FXXA 2LQ8A 2X1NB 4OR5B 1ZSZC 2KE9A 1RI0A 1VQ4Q 3EFOB 4M7AC 1UFFA 1OL2B 1ZBXA 2JTEA 2QGSA 1KC8C 4KRTA 2KEAA 3CCJA 2BKZB 1UNGD 1VQ5A 2K2MA 2KY9A 3VS1A 4E7SA 3NTIA 4OF1A 4L59A 4JS5A 1ZUUA 3ZBDA 1CSKA 2FEIA 4FT4A 1JJ2P 1OX9A 2E65A 4NL3A 4DA4A 2VV5A 1WQ7A 3CCMA 2UZBB 2YWWA 5GAN3 4K11A 2DFUA 3I56A 4M7DE 2DL7A 2LJ0A 4BACA 2WIPB 2MYSA 3UPUA 2DD4A 3GOXA 4J9FA 2BE9B 1AT1B 2ZPBB 4EORB 1VIFA 4N4HA 1YHQT 2I53A 5GAN4 1Q95G 4AFUC 2LQWA 3Q1JA 1M8MA 1OOTA 4C5IA 2QQAA 1VQ9Q 3TNIB 4J9IA 1E7OA 3V7CA 3OSSC 1H24B 2SRCA 1TTHB 2YRCA 1BI2A 1R0CB 3OY9A 3QDFA 3E2UA 2WSFE 2KGTA 2K7AA 3A8GB 1EZZB 2L0AA 4PFZA 1YJ9A 2NUTB 4Z02A 2PTKA 3A8LB 3X20B 2RA2A 4LDYA 3L2WA 3FIFA 2J06A 4AFQC 2PMIB 3JCMf 4M77B 2JGZB 3LW5E 5IHNA 4M7DA 2XICA 3JCMb 2DXUA 3OW2S 5FW9A 4EDUA 1QVGA 1H1RB 1RI9A 5LJ3e 4RTXA 4FL6A 1V29B 3HSBA 1VQPQ 2P0KA 5IXBA 3VJPA 2JTMA 2O88A 4AKIA 4QVDA 3OMCA 3A5ZB 1VQ7T 3C4SA 1VA7A 4OP0A 2CZ6B 2VYTA 3RERA 4BE2A 5LJ5j 3QUIA 3KFVA 1OV3A 1GY3B 2E5QA 4EOIB 1JU5C 1VQNQ 2QQ8A 3J80E 1X6GA 2YUOA 1OQKA 1SEMA 5HBHB 3JCMP 4ZTFA 2XKOC 8ATCB 5IHIA 1Z9ZA 1YI2A 1N8RC 2QGFB 1D3BA 2A3LA 4BY1X 3OYMA 3CMET 4XTUA 1BCMA 3HFOA 3TVTA 5GAMe 1RLPC 4J9BA 4JPBW 4PFOA 1KC8U 3CCQA 3ASKA 5IHYA 1YJWA 3C95A 1YNZA 1G3NC 3H0IA 3L2ZA 1QVFS 3OYKA 3R6NA 4JX5A 4J7FA 1R77A 1ZA2B 2PUOB 2PJQA 3M4GA 4AI6A 4A4HA 4ANJA 3VKGA 2WJ9A 5FU6B 2EUFA 2RHUA 3UWNA 1SSHA 2K3XA 4CXAB 3LLRA 4X9CA 3CMEQ 4GY5A 3HBLA 1UB4A 2ENMA 1WLPB 2M0YA 3L2RA 1M90U 4ELLA 2EQUA 4CC2A 1VQ8Q 2QEXA 1TFBA 1W1FA 2EYWA 3OYAA 2FZCB 1BI3A 1KD1C 1AZGB 5LL6S 4HVUA 3M58A 1G3TA 1Q7YC 1MMNA 1NYFA 4RUGA 2AIRB 4OGEA 4J6YA 1HXDA 3JCMg 2BS4A 1V1CA 5HY6A 2CZ7B 2J6FA 2KRMA 1GCQC 2R7GA 3EGXB 1UTIA 2CUBA 4RCBA 4E47A 4EPCA 2MOXA 1VQ6T 4KH1B 3QYBA 4BD3A 1ABOA 2JM8A 1RAHB 3SB2A 3BG9A 2RH2A 2JOYA 1M2VB 1YBYA 1D0XA 1QWFA 3RKXA 1K73C 1IXDA 1NPRA 2YSQA 3PNWC 4R0KA 2YDLA 1KQSP 1M3BA 2DK3A 3E9GA 2OX7A 2IPOB 1VQKT 1I07A 4JJCA 1KK7A 2GTOA 2E3HA 1YI2Q 3MKDA 5IXFA 4BXXX 3I5RA 2K2VA 4ESRA 3CPWA 3G4SQ 2ECZA 2XK0A 4J6XA 1BI0A 3DTOA 1VQNA 3BHUB 4E7LA 4P5NA 3I35A 4QVCA 1LOJA 3CD6T 2DJQA 3CCST 2DIGA 3R6OA 4II5B 5ECAA 3TNHB 2I0NA 1ZHIA 4AFZC 3PTAA 1ZLMA 4DBFA 2P4TA 3L2UA 5CIUA 2UUEB 1KQ1A 2FB7A 3KXTA 5CKHA 1IZ6A 3CCLA 4QQDA 2K5LA 3EAEA 3E19A 2EYZA 5I21A 4F6SB 4KH0B 2W0ZA 2L8DA 4BI8B 3G6ET 1J3TA 2BTTA 2RJDA 4E7HA 1RAAB 3SFMA 3ZL7C 2X51A 1SRLA 5EC7A 2DXBB 3CCEQ 5I2SA 2RHXA 2JZ2A 2K5FA 3H8ZA 2KI7A 3MI9B 4CFUD 1M4ZA 1ZUKA 2J6KA 4BDYA 4PKCC 4XQ3A 4DOWA 3JCMV 1E6HA 1G8XA 1GUXB 3GIBA 4ME7A 3UATA 4LE9A 5DY9A 1VQ4A 3AT1B 3M55A 2JMAA 1ZSGA 3VS7A 3HKSA 2WFYB 1Y96B 4BDZA 3G71T 3C12A 3PMTA 1OKWB 1WHLA 5GAN7 4OGCA 1H4LD 4JLIA 3POMA 1VQ9A 1AZEA 5CK9A 3CBPA 1VIEA 2HCKA 4LUEA 2QDLA 3GBQA 4M77E 4BCMD 2G6FX 3VYGB 5IF1B 2JT4A 2DXCB 5CCAA 4FYYB 3CCEA 3VS6A 2YRDA 4ROCA 1R8OB 3S3MA 3C94A 1IO6A 4F7LB 1W6XA 5ICPB 2VWFA 3SWNA 1S1NA 4HNUA 3CCRT 2WMAB 2SEMA 4IUUA 1LNXA 3CXCA 3CCLQ 1KQ2A 1H3HA 1JBMA 2G3RA 2JW4A 3M0UA 3GLXA 1W4SA 2LTOA 2PQWA 1E7PA 2MI6A 2ZPGB 4YOSA 1MMDA 1Q81U 4FX3B 3PVLA 2VGNA 4HA8A 9ATCB 1G5VA 5GANh 2A0FB 2GNCA 5IHKA 1YP5A 4IIOA 1WXTA 3QSUA 1C6VX 4IKFA 3TU4K 1K8AC 2YUNA 3KHIA 2RI5A 4A4GA 3EG0A 2RQTA 2G9XB 3DL1A 2J6OA 4X1VA 3G71A 2F1LA 3CCVA 3V8LA 4ZN1A 4M7AF 3INZA 2QAZA 3M57A 2FPFA 4R55A 1NE8A 3S3OA 1UNHD 2FZGB 3JB9J 4L6V5 1KXUA 2XDBA 2IW6B 3PGGA 1VQMT 2LVMA 2VC8A 1QLYA 4F17A 4F14A 5GMKi 3JB9D 3JCMe 5IAYA 3QYHB 2R5AA 3CCUQ 1ABQA 1OZ3A 3NTHA 3MO8A 1PCXA 3NMZC 3CC7T 4M4ZA 2M16A 4OMPA 2ZPHB 2FYKA 2GF7A 2ROLA 4EOMB 4O5VA 2AZSA 3JCMh 4C92F 1H25B 2FG0A 1P5EB 1VYWB 3CC2A 1YWOA 3OYNA 2VXFA 3CCLT 2C5XB 5GAOn 2DD4B 1UNLD 2DF6A 2PVGB 3EGDB 1GCPA 5CKEA 3QYEA 1RAIB 1RUWA 5KYNA 2AK5A 3I55Q 5CO7A 1SKUB 4D6WA 4F7UE 2AZVA 2EYYA 1PKDB 1AD5A 1FMWA 2LX9A 3LWHA 3GPLA 3RDVA 2DO3A 4J9GA 1B7TA 3U23A 1UE9A 2DZCA 2FZKB 4C5HA 3JAME 2E41A 1M27C 4EOOB 2GCXA 2K9GA 2QA4Q 1H28B 2XI9A 3LWIA 1NJIC 4E7JA 1HK9A 2CS7A 2HAXA 5C6SA 4CC7A 4M6VA 1X69A 2R57A 3RKYA 1PD1A 2EQMA 2EJFA 2COZA 4BBRM 4FYVB 5A0DA 1VQOA 2BIVA 2D0QB 2QTXA 2ED0A 3VUZA 1M1KC 4JZ4A 4OGRB 2X4WA 3P8DA 4MZMA 4Y91A 4YOOA 1BU1A 5LJ5e 1AWXA 1QP3A 4CFWB 3B57A 2MPXC 3OW2P 2VASA 3UA6A 3EGXA 1KHIA 1GBQA 1VQMA 2ROTA 1OPLA 3DDQB 3EFSA 3EG3A 1BK2A 1X6OA 2UZLB 3EG2A 3NFCA 2PUKB 5KYUA 4E7KA 5L2WB 1G3YA 4AG2C 5GAOr 5HCKA 4PJOG 4ELYC 4FU6A 2E5KA 1W2BP 4M75F 2EJ9A 1UGVA 2JTFA 2DM1A 1O9KA 5GMKe 4HKEA 1CKAA 2WHBB 4Y72B 2OTLA 3BHTB 4IUQA 3DOGB 4C8QA 1M3AA 3CBOA 3J81E 1UDLA 3ULRB 2X4XA 3HTRA 3CPWP 1QKXA 2E70A 4YTLA 5AYFA 4PNOA 1C0MA 2EQIA 2F2CA 1WDXA 2DX1A 2EW3A 2MMPA 1W98B 1IGQA 4OMMA 4EC8B 3TEEA 4C92E 4OMFB 5GANd 2DD5B 1VQ6Q 1YWPA 2W99A 1UECA 1X27A 4HXJA 3MP1A 1BYMA 4CFXB 4A4FA 4A4KA 1JB0E 4X34A 2O01E 5CKBA 2IVWA 3QXEB 1ARKA 2K79A 4J83A 1FYNA 3OYBA 3SWNB 3OS0A 1NYGA 1KC8R 3JB9F 3I56Q 4OMOA 4D8KA 1SPKA 2QI2A 1VQPA 3LGFA 4OVAA 2DYIA 4KT0E 4KGVB 3LX7A 4M75E 2V26A 2KXDA 3CCUT 2RN8A 2EBPA 1QW1A 2CSQA 1ZA1B 2K4YA 4FIBA 4IUPA 1JOWA 2YXYA 1FX7A 2HBWA 4KRCB 5GJWB 1VQ9T 2D6FA 2F2VA 1BKBA 3ZEHA 2V8IA 1WHJA 2M9UA 1KQSA 5I22A 1Q86C 1MV0B 4MZTA 3VS5A 5CKDA 5FU7B 1D3UB 3E1SA 2KXCA 2A37A 2RJFA 1OZ2A 3TQ7P 1Q86R 3V7RA 1YHQQ 3VYGA 2QDYB 4BI4A 1WIEA 4LNPA 4AG1C 2Z0WA 2FPDA 1YITQ 2RK2A 3TSWA 4M7DC 4RTYA 1U1SA 2D8HA 3HL8A 4AKGA 2RHIA 4C8QF 1GRIA 4G6LB 4RTTA 4C0FA 3RMSA 2FVUA 1AHJB 3OB9A 3DDPB 3PO3S 5KYXA 1X01A 5GAOp 1M1GA 4F7SB 3CCSA 4M7AD 2KRNA 4CFVB 2O4XA 2O9SA 4OB0B 4NOYA 4IUTA 5KCHA 4JUVA 1FWZA 3CCRQ 2IVXA 2YLCA 1ZQ1A 2F5TX 5FU6C 3IQLA 4PK4A 4BCIB 5FWCA 1FMKA 2ZZDB 3RUXA 4M77D 3MEVA 4RCCA 1X6BA 4F7UB 1SSFA 4WCIA 4X9DA 2RI3A 2AHJB 4OMNA 4XU0A 1URCB 1WA7A 3TREA 1T0HA 3TW6A 1VOMA 4HNVA 4XTYA 3QWLA 5GAN2 1VQ5Q 2AKLA 4Z8AA 3CCVT 4M7AE 3EFRA 2DIQA 3PT9A 2XD0A 3CC4Q 1U06A 1S72Q 3QHWB 4HCCA 1HSQA 1N8RU 2JNGA 1IB8A 1VOLA 1OIUB 2C0OA 1VQ5T 4ELJA 2LNHB 4JX4A 4EOJB 1D1CA 2E6ZA 3QDRB 1OGUB 1D1BA 4OB1B 2D0NA 1WX6A 1QVGP 1EX4A 2QGGA 4JDSA 3M0RA 2QQSA 4M7AB 3JB9H 4C5GA 1PKTA 3X25B 2Y4XA 4Z88A 3VS3A 1Q7YU 4DEXA 2NLUA 3CPFA 4QKUA 3MIAB 5EFQB 5KYXB 4EOPB 5HBEB 4PJOE 2B8AA 1O9SA 1K0SA 2V1RA 4J9HA 3QHSA 3WVDB 1PM3A 3CCUA 1UJ0A 3VKIA 2QDJA 1F1BB 4C8QD 1OU9A 1VQLA 1TUDA 3OYGA 4WF2A 1OEBA 1JJ2A 5GANg 1K76A 3QKJA 4A4EA 4LN2A 2KVQG 3JRZA 3CC2T 2E12A 2ZPFB 1N4MA 1WJRA 3GTMS 3HP9A 3I55T 1VQLT 4JLGA 3H0FA 1WI7A 1KIKA 2D9TA 3MY1B 4BCQD 3M59A 4LD9K 1IHWA 3MY5B 4IUVA 3N5BB 4VUBA 1BI1A 2DTHA 1YN8A 2CYZB 4C92G 2YT6A 4M78B 3O0GD 4F6WB 2ESWA 2CREA 3OYDA 2EQKA 2CGHA 2XIDA 1Q7YR 3ZFJA 4F04B 1N8RR 3DB4A 1SHFA 2KDSA 1BBZA 1JKWA 2LW4A 2W9FA 4AFSC 4KRDB 5DLOA 4LXCA 3CMAA 2H3JA 1YIJA 3P8BB 5GAMj 4N0AA 2COYA 4PJOC 3CMAT 3SEMA 2VKNA 3EGDA 1XO2A 3CCQT 2R5MA 1WFWA 1WQWA 1HD3A 3P8HA 4C92C 1T3LA 1B34A 2DMEA 2LQNA 5GAOq 4XTZA 1MUZA 3RIRA 4JRPA 2HL5C 2EGEA 3CXCS 2CT4A 5HNBB 2WPAB 1TWBA 1LJOA 1ZBJA 1GFDA 4XU2A 3G7ZA 1M1FA 1VYTA 2RM4A 1MNEA 1NLOC 3BLQB 3V7SA 2JMCA 5LQFB 1MV3A 4C0GA 1VQKA 2X3WD 3CCVQ 2VGMA 4EOSB 1Q82U 5GANj 5GMKl 2OJ2A 2EKHA 4UN0A 2DYBA 2E6NA 2WMBB 3META 2QASA 5A0LA 1Z9QA 3GNFB 2V8JA 1KFZA 2KT1A 2X35A 5LJ5g 4RTWA 2W9ZA 1I8FA 2OI3A 3RKWA 1RACB 2JVVA 1P92A 2EGCA 2L5QA 2LT1A 2EYQA 3A98A 6AT1B 4JJDA 3JCMQ 3M03A 4J5YA 1XJWB 2QQRA 2KRSA 4R56A 4KGZB 2EJGA 1BU2A 4M78C 1MGQA 3VS4A 1ZSZB 2JXBA 1K73U 5HK0A 3URGA 2KK4A 1XQHA 5FRNA 3M0SA 4EONB 1QKWA 3A8HB 2L3PA 3OYYA 3RBBB 4BCPB 3PMIA 2HKQB 1H1QB 1WNLA 1F5QB 2H3EB 3JSCA 5LJ3g 2A28A 2IW8B 3OA6A 2CJMB 1C9BA 1ACMB 2A36A 1N9RA 2FO0A 1RLQC 1RL2A 4LUDA 5HK3A 1HJDA 2DBKA 2JUFA 1UEBA 3FJ5A 4ELZC 3VYHB 1B07A 1NZ9A 1WPYA 5KH6A 2CT3A 1VQPT 3L2VA 2VB6A 3FC3A 3OYFA 5LJ5h 4IMYB 4M75G 2C5OB 3VKHA 3FDRA 1KD1U 4CRLB 1NEGA 3JV3A 4NC6A 3BY7A 1YHQA 4M78G 4GLKA 2DNUA 3I9QA 4M77G 3G6EQ 3EH2A 3HHTB 4M75C 1KG1A 2JS2A 1G2BA 3CBMA 4EMKC 4BCHB 3AHUA 5DM7R 2OTLQ 4C92A 4MFEA 4EMHA 3GP8A 1TS9A 2CSIA 3K7AM 2CCIB 2CDTA 4BCJB 5LJ5d 3BFMA 1RAEB 1LVKA 2VXEA 5I11A 4A54A 5GAMf 2DMOA 2MF2A 4QW2A 5GAMh 2C0IA 2YRVA 4ORZA 3D7SB 2DEUA 2AT1B 3VUBA 2GQVA 2RPNA 2COWA 4QSHA 2RNAA 3OQ5A 1UGQB 5DQWA 5KE3A 2EFIA 4FYXB 2NUPA 2PK9B 3VRZA 2P4RA 3L1AA 2HNIA 4OB3B 2GFAA 2LQKA 2EWNA 2P0QA 1Y96A 1K0XA 1OI1A 2PVOB 2KYBA 2C0TA 3TW7A 4EIKA 2I40B 3BDUA 4NS5A 1N27A 2HQXA 2P84A 2EIFA 3LYIA 4PJLA 1QMCA 2YLBA 2CUDA 3ER0A 4DBRA 3G4SA 1IGUA 2QEXT 1K1ZA 4FSXA 3M0QA 5KYYB 1PC0A 3CC4T 1S72T 1O75A 4EMKB 1FINB 2C5NB 4PLLA 3RGFB 1SG5A 3M0TA 3EG9A 2EPDA 4RG8A 4M7AG 4N0AC 2O2OA 5CR2A 1OIYB 1BCOA 4FW1A 2KNBB 4B9WA 1YCYA 4C0DB 1D0ZA 2GBQA 1I5OB 4WTOB 3OYCA 1WZOA 4MDXA 2PU9B 2DKGA 2KR3A 1U8RA 3I55A 3HRSA 2KT8A 4J7IA 2W96A 4M77F 3DLLA 2E3IA 4M75B 2ABLA 2CP2A 2M51A 1JSUB 4XTWA 1H92A 2XMFA 2QEXQ 2W10A 2RQUA 2BE7D 4C92B 2O4XB 4XK8E 4ROEA 2DERA 4BUGA 3VU3C 2QTVA 1VYVA 3CMEA 2RQWA 1KJWA 4JX6A 4D8DA 3RNJA 2HQEA 4JRKA 2OTJQ 2EGAA 4F7UG 2QA4T 3NPFA 2OTLT 2FL7A 1UHCA 3UA7A 4PJMA 1YJWQ 2RQRA 2WXVB 1UUEA 1B3QA 2GTJA 3QZ5B 2BZXA 4F16A 3CCQQ 1M1KR 2HL3A 4FT2A 4C8QG 2QA4A 2AKKA 3X26B 3G6EA 4KUDK 3M56A 3PIPA 1H26B 1KHCA 4J9EA 3G71Q 2FRWA 2H8HA 3UT1A 3BLHB 3MJXA 1BB9A 3HB9A 3PVQA 1M1KU 1EFNA 1OI9B 2CH4W 5FLXE 1ZSZA 2LMJA 2PK2A 1GH6B 1JEGA 4RKUE 5KYWB 5CEIB 4FSSA 3JCMJ 1OL1B 2JS0A 1IRXA 1MNDA 2LDMA 3S6WA 2LX7A 2G77A 2PHGA 4DEYA 1NJIR 5HKCA 3JCMW 1PRMC 2CP0A 2RHYA 2E4HA 3QJ6A 1AWOA 4XTVA 2K6DA 1RAGB 3QHRB 1NBEB 5IN1A 1AEYA 3EGUA 3QWYA 1AD6A 1QP2A 4MIMA 1ZUYA 2LCSA 2GQIA 2BS2A 1NJIU 1PSFA 3OYIA 2DE0X 3MCAB 2LZ6B 2LJ1A 2EYXA 3T9NA 3JCMd 4M7DG 2HMAA 2L3RA 4FM4B 3L2QA 2WIHB 5GMKh 5M9OA 1NG2A 2K57A 3QWXX 5LJ3d 3OBYA 2DL8A 4B6MA 2OAUA 1D0YA 5LJ3j 3FLGA 4RODA 1JRIA 1M9SA 1ENWA 2HDAA 1VQKQ 2RB6A 2V22B 2E1HA 2XDDA 2EKOA 4M78D 3M53A 5FRMA 1WGSA 1K9MR 1FVVB 2B86A 3VV0A 3ME9A 1XNIA 1QCFA 1VYUA 2NYSA 4Q5WA 2CP3A 4F7UF 4XTXA 4EMKA 3DLMA 3QYGB 5I2MA 2D1XA 2DXTA 2ZCFB 1T0JA 1PSEA 3OS2A 2RMOA 1GUXA 2KAFA 3REBB 2XDPA 3MPUB 4M7DB 2F2WA 1KSWA 4HNTA 1K9AA 3F70A 3MEAA 7AT1B 2L3QA 5D6XA 1I81A 3FEOA 2F2XA 5KYWA 2RD1A 3TCJA 4YC3B 3M0PA 2BS3A 4F7NB 4O6JA 1Y71A 3UF4A 1WYXA 3QPHA 2CCHB 3V8KA 2KR6A 2IG0A 1YIJT 1OYXA 5CKFA 1GXIE 4HT8A 3VS2A 3V8JA 4XU3A 1VQ8T 2KMTA 2LC4A 2HEQA 4F70B 3G33B 1N6AA 3H0HA 4BE0A 5KYYA 1M30A 3TSZA 1K9MU 2WEVB 1PG5B 3MP6A 4OB2B 4PFPA 4LDXA 3KUFA 3CCJQ 4V2SA 2DL3A 4PL6A 3MEUA 1DJ7B 2KMGA 4ZGJB 2QFZA 3DJBA 1M2OA 4KGXB 1ZP2A 2DAQA 3OMGA 3BW1A 3WVEB 1IREB 4IURA 2O31A 5KE2A 2RJEA 4KUIA 4M78A 1QCOA 1GCQA 3G1JA 1U5SA 3CXCP 3EG1A 2DRMA 2DVJA 3H41A 1Q81C 4RTVA 5CVIA 2UZEB 1WHHA 2WSCE 2W2HA 2HKNA 5AT1B 2J7IA 1AWWA 2IN3A 3FRNA 3JB9I 4HCKA 2UZDB 2LCLA 1D1AA 2DLPA 3BDLA 5CAIA 3G4ST 2M1HA 1WJQA 1M2VA 4KULA 1OKVB 4TVRA 4UC4A 3EIDB 3H9NA 4Y28E 1X75C 1VQNT 2ATCB 2DL4A 2P0PA 4BBSM 3QIIA 2GGRA 4JJBA 2WSEE 1RADB 5KYUB 4NSTB 1YIJQ 3EFOA 4HCZA 2IW9B 1I5LA 4RTUA 2RI2A 1QLBA 4C8QE 1AVZC 2ZGWA 1G3SA 3H4CA 2MIOA 2I2LA 1X2QA 4QT7A 1I1JA 1WXBA 4CRIA 5GAMd 2DETA 1BIAA 4C8QC 2A08A 1LPLA 5D6WA 1K73R 2ZZDA 2QF7A 1AWJA 4EOKB 2RQVA 3TNWB 5L8RE 2F5KA 1AOJA 4HLQA 2KROA 2YUPA 1JXOA 2CH4A 4JS4A 5I5ZB 5GANe 2FRYA 1WXUA 4ZTJA 1YJNT 3NDQA 2DILA 1KD1R 1SHGA 3QG1A 3A8MB 2QQBA 5HQ0B 1K9MC 4A63B 4C0DC 1OU8A 5L23A 4M77A 3LH5A 4JJNK 1QVGS 1Y0MA 3I56T 1OPKA 4QQGA 4AT1B 3NHNA 2JM9A 1Y07A 2DTIA 4E2FB 5CYIB 1YFNA 4TTHA 5GAN5 2DEQA 3WXMB 4PJJA 4CI0C 2OTJA 2V1QA 2CKKA 5GAN6 1NPPA 4F7JB 3CEYA 5GMKm 2DD5A 5GAOm 3JCMX 3J7AF 4J8OA 3M5AA 2ZAEA 4II1A 2C4GB 4ZGEB 4MMLA 1YITT 1E6GA 3FJPA 4HVWA 1ZX6A 2GFUA 1TOVA 3SDZA 1VQ8A 3BE3A 2LJ3A 4J9CA 1MHNA 2XG8D 5BNJB 4BE1A 1UJYA 1E9HB 2BZYA 3QJYA 3L42A 3H6ZA 3LH0A 4LDUA 1CKBA 2CP5A 4BY7X 2BPMB 4Z6YA 5D6YA 1TU0B 4I3ZB 3QZ9B 3QBYA 1UGRB 2M0OA 2X4JA 1H27B 2L2PA
chains in the Genus database with same CATH topology
1BIBA 2JTMA 1VUBA 3OQ5A 3HZJA 1UGQB 4AKIA 2LNVA 3OMCA 4QVDA 5KE3A 4HKEA 2EFIA 5GMKe 3A5ZB 2Y90A 1VQ7T 3C4SA 3HO8A 4J6WA 4OP0A 2CZ6B 2VYTA 2QXFA 2OTLA 3RERA 3L1AA 4IUQA 2HNIA 4OB3B 4C8QA 2GFAA 4BE2A 2LQKA 3CBOA 3J81E 2EWNA 2P0QA 2CZ1B 5LJ5j 1Y96A 3QUIA 4BI3A 2X4XA 1OI1A 2E70A 2PVOB 4YTLA 5AYFA 3TW7A 2E5QA 4PNOA 3CCET 3BDUA 2CZ0B 4NS5A 4M7DD 2QQ8A 3J80E 2MMPA 1N27A 1Q86U 2HQXA 5J3BA 2EIFA 2KQWA 2MAMA 3LYIA 4LDVA 4OMFB 2XKOC 3TEEA 2YLBA 4C92E 3ER0A 3G4SA 2QEXT 5GANd 4FSXA 2MWPA 2DD5B 1YI2A 3UDCA 1N8RC 1D3BA 2A3LA 3KBGA 3BG3A 4HL4A 3CC4T 1S72T 1O75A 3MP1A 3OYMA 3CMET 1Y7XA 2ZPIB 5DLQE 1XTDA 4EMKB 1BYMA 2EQJA 4XTUA 4A4FA 2DVEA 3LGLA 4PLLA 4A4KA 1JB0E 1YJ9T 3HFOA 4X34A 5GAMe 2O01E 4RG8A 1U1TA 4M7AG 1KC8U 5CKBA 3CC4A 4N0AC 3CCQA 2IVWA 5CR2A 3QXEB 4ZGDB 3ASKA 5A2QE 4J83A 4B9WA 1YCYA 3HFNA 3OYBA 4C0DB 3SWNB 1YJWA 3C95A 3OS0A 5EG2A 3JB9F 5J26A 4M75D 3L2ZA 1QVFS 3OYKA 2E64A 4JX5A 4J7FA 1YITA 2K3YA 1YJWT 1EIFA 2PUOB 2QI2A 3OS5A 3OYCA 1VQPA 3LGFA 4OVAA 2PU9B 3M4GA 4AI6A 4MDXA 4A4HA 3CPWS 3OYHA 2DKGA 3VKGA 4KT0E 4M75E 3LX7A 3FB9A 2WJ9A 4BY6B 1M8VA 5FU6B 2RHUA 3UWNA 1U8RA 2K3XA 3LLRA 4X9CA 3HRSA 3I55A 3CCUT 4GY5A 3JB9G 3HBLA 1N9SA 1UB4A 4J7IA 2OTJT 4PJOF 4M77F 3DLLA 1WJSA 4M75B 3MP8A 1QW1A 4C8QB 4XTWA 4E7IA 3PFSA 4FIBA 2K4YA 3L2RA 1M90U 4IUPA 2EQUA 1FX7A 1VQ9T 2QEXA 4AKHA 4C92B 2D6FA 3OYAA 1BKBA 1BI3A 2O4XB 4XK8E 1KD1C 3ZEHA 2V8IA 3JCMP 2M9UA 1KQSA 5LL6S 2DXCA 4BUGA 3VU3C 4BDZA 4MZTA 1Q86C 3M58A 1G3TA 5CKDA 5FU7B 1Q7YC 3E1SA 4M7AA 2RJFA 2KSSA 3HPWA 4OGEA 3CMEA 4J6YA 1OZ2A 1HXDA 4KBMB 4XU1A 3V7RA 3JCMg 4RMOA 4JX6A 2BS4A 1YJNA 2HQEA 1K8AU 2YHTA 4JRKA 2V8KA 5HY6A 4N4GA 2QDYB 2CZ7B 3VYGA 4BI4A 3O8VA 2DTOA 4F7UG 3PIOA 4LOCA 2QA4T 2BUDA 2RK2A 4RCBA 2OTLT 2FL7A 1U1SA 4E47A 4M7DC 3HL8A 4EPCA 1VQOT 3BG5A 4AKGA 2XU8A 4DQ2A 3CCJT 1VQ6T 2RHIA 3QYBA 4C8QF 5GAN8 4BD3A 4B9XA 2MWOA 5LJ3h 3SB2A 3BG9A 4C0FA 3RMSA 3QZ5B 2FVUA 2RH2A 5LJ3f 1JJ2S 1AHJB 2JOYA 2DPPB 3OB9A 1YBYA 4FT2A 4C8QG 2QA4A 5FROA 1X01A 1UGSB 3RKXA 3X26B 3G6EA 1K73C 3DB3A 3M56A 1NPRA 4KUDK 3PIPA 1KHCA 3PNWC 5GAOp 3CD6A 1M1GA 3OYEA 2DK3A 3E9GA 3CCSA 4M7AD 3UT1A 1VQ7A 2O4XA 4L5GA 1VQKT 4M78E 2BKDN 4N4IA 4OB0B 4NOYA 4IUTA 5KCHA 4JUVA 1FWZA 4LD6A 1VQ6A 3HB9A 5CQYA 4F7UA 1M1KU 2YLCA 1ZQ1A 2F5TX 5FLXE 5FU6C 2K2VA 3CPWA 2XK0A 4RG2A 4J6XA 3RMQA 2ZZDB 4RKUE 1BI0A 3MHXA 1Q82C 2PVDB 3RUXA 4M77D 3OYLA 3MEVA 4RCCA 5A0GA 3JCMJ 4E7LA 4P5NA 1VQNA 4M78F 2LDMA 3S6WA 4F7UB 1SSFA 1LOJA 4QVCA 3CD6T 4X9DA 2RI3A 4HCBA 5KCOA 2AHJB 2G77A 4XU0A 3RESA 3TREA 3CCST 5HKCA 2F69A 1UGPB 3TW6A 2DIGA 1I4K1 3R6OA 4HNVA 3JCMW 4XTYA 3QWLA 5GAN2 1ZHIA 2RHYA 3OSVA 3PTAA 3GNGA 2LRQA 3QJ6A 3CCVT 3EFRA 2P4TA 3L2UA 4XTVA 5CIUA 4M7AE 2L89A 1KQ1A 2FB7A 3KXTA 2DIQA 5IN1A 5CKHA 1IZ6A 3S3NA 2DJZA 3PT9A 3OBWA 3CCLA 2DZ9A 3HRUA 4C92D 4QQDA 1QP2A 4MIMA 2K5LA 2RO0A 3EAEA 3E19A 4NL2A 4HCCA 3E9FA 5I21A 2RK1A 2BS2A 1NJIU 1N8RU 1PSFA 5GAOl 3OYIA 2L8DA 2JNGA 5GAMg 4MMKA 4BI8B 3G6ET 2RJDA 4QQ6A 4A53A 4E7HA 4PJOD 3SFMA 1VQ5T 4ELJA 3MCAB 4EMGA 4JX4A 2E6ZA 2DXBB 3T9NA 3JCMd 3QDRB 5I2SA 4M7DG 2RHXA 2L3RA 2JZ2A 2K5FA 3H8ZA 4FM4B 1D3BB 3L2QA 4OB1B 2HBPA 1M4ZA 1TH7A 5GMKh 5M9OA 4BDYA 3OS1A 4PKCC 4XQ3A 3NTKA 2K57A 3JCMV 2EAYA 4DOWA 5LJ3d 4JDSA 3GF5A 3CCMT 3GIBA 1W2BA 3OBYA 4ME7A 2QQSA 4M7AB 3JB9H 2OAUA 5DY9A 5LJ3j 1VQ4A 2K5IA 4C5GA 3FLGA 3M55A 1M90C 3X25B 1JRIA 2Y4XA 1M9SA 1Q7YU 2WACA 2NLUA 3CPFA 4DOVA 5J39A 2X4YA 2RB6A 4PJOE 2A7YA 5GMKj 2E10A 3X24B 1Y96B 1O9SA 2B8AA 3HKSA 4JRQA 2E1HA 2XDDA 2EKOA 4M78D 3G71T 1G3WA 3CC7A 3C12A 3M53A 3PMTA 3QHSA 5GAN7 2VUBA 3WVDB 3CCUA 1FKMA 2LT4A 3QO3A 4OGCA 5FRMA 3VKIA 2HD0A 3OW2A 1WGSA 4JLIA 4MZPA 4ATOA 2QDJA 4C8QD 3VV0A 3ME9A 1XNIA 1VQ9A 5CK9A 1VQLA 3OYGA 4M75A 3CBPA 4QVZA 1VIEA 4WF2A 2C06A 4Q5WA 1JJ2A 4F7UF 5GANg 4XTXA 4EMKA 4A4EA 3QKJA 2KVQG 4M77E 3DLMA 3JRZA 3CC2T 2E12A 2ZPFB 3VYGB 1WJRA 4BY6C 2DXCB 3QYGB 2Y4YA 3HP9A 4MFDA 5I2MA 4JLGA 5CCAA 3I55T 2DXTA 1VQLT 2ZCFB 3OS2A 1PSEA 3CCEA 2KAFA 2D9TA 4LD9K 2XDPA 3M59A 4M7DB 4HNTA 1R8OB 2LCCA 3F70A 3MEAA 4IUVA 3JCMc 4ZN3A 3C94A 3N5BB 1I81A 4VUBA 5D6XA 3S3MA 1BI1A 2DTHA 3FEOA 2CYZB 4C92G 2RD1A 4M78B 3TCJA 3SWNA 2BS3A 4BB7A 4O6JA 4HNUA 5CQXA 1Y71A 3CCRT 2DXBA 1W2BS 4IUUA 5IT9E 3QPHA 1LNXA 1QVPA 3OYDA 3V8KA 3CXCA 1S72A 2KR6A 2IG0A 1YIJT 3MEWA 1KQ2A 1OYXA 1JBMA 2CGHA 2EQKA 2XIDA 5CKFA 5LJ5f 4HT8A 2G3RA 1GXIE 3V8JA 3ZFJA 3GLXA 3SWNC 2XHCA 2JN0A 4JRIA 1W4SA 4XU3A 2LTOA 1VQ8T 2KMTA 2PQWA 2LC4A 1E7PA 3DB4A 4HT9A 2MI6A 2ZPGB 1N6AA 1Q81U 2KDSA 4BE0A 3M9QA 2R58A 2VGNA 4HA8A 4XAXB 2ZPEB 1K9MU 1G5VA 5GANh 3HRTA 3MP6A 4OB2B 5DLOA 1YI2T 3KUFA 4LDXA 1XOVA 4V2SA 4PL6A 3CMAA 5EJCA 3MEUA 1DJ7B 2KMGA 2H3JA 4ZGJB 2QFZA 1YIJA 3QSUA 5C0MA 4IKFA 3P8BB 3M4YA 2DAQA 5GAMj 3OMGA 3BW1A 3WVEB 3M54A 4N0AA 1IREB 1M5Q1 4IURA 3CCRA 3TU4K 4PJOC 2RJCA 1K8AC 5KE2A 3KHIA 3CMAT 2RI5A 2RJEA 4A4GA 3A8OB 4KUIA 1QVFA 4M78A 1H3ZA 3DL1A 3CCQT 2R5MA 3G71A 1WQWA 3CCVA 3P8HA 3V8LA 4ZN1A 3OYJA 4C92C 1B34A 1Q81C 3SD4A 5GAOq 4PLIA 4XTZA 4C0ZA 4M7AF 3INZA 2RHZA 5CVIA 3RIRA 3M57A 4JRPA 2WSCE 2QQ9A 4R55A 3CXCS 5FU7C 1NE8A 3S3OA 3JB9J 3DKMA 4L6V5 3FRNA 2XDBA 3JB9I 3PGGA 3X28B 1B34B 1VQMT 2LCLA 1LJOA 2LVMA 2VC8A 4MDWA 5GMKi 5GANf 3JB9D 3BDLA 5CAIA 3G4ST 3JCMe 2M1HA 1WJQA 4KULA 3QYHB 4XU2A 3G7ZA 4M77C 4C5EA 1M1FA 5IAYA 2FHDA 2RM4A 2R5AA 3NTHA 1OZ3A 4TVRA 3MO8A 4UC4A 3CC7T 4M7DF 2M16A 3V7SA 1H641 4Y28E 4C0GA 2ZPHB 2FYKA 4LDWA 1KQSS 1VQKA 1VQ4T 2GF7A 4PJOB 4PJOA 2LQ8A 1FXXA 1X75C 2VGMA 1VQNT 2XD0A 1RI0A 1Q82U 4O5VA 5GANj 5GMKl 2P0PA 4BBSM 3QIIA 4C92F 3JCMh 4M7AC 3CC2A 2E6NA 2WSEE 3META 1ZBXA 5A0LA 3GNFB 2V8JA 3OYNA 2VXFA 3CCLT 2X35A 5LJ5g 4HCZA 1KC8C 1I5LA 5GAOn 1I8FA 2RI2A 3RKWA 1QLBA 2DD4B 3CCJA 4C8QE 1VQ5A 2JVVA 2PVGB 1P92A 2L5QA 5CKEA 2KY9A 2EYQA 2LT1A 2ZGWA 3QYEA 3NTIA 1G3SA 3H4CA 4L59A 4OF1A 4JS5A 3ZBDA 5CO7A 3JCMQ 4D6WA 2I2LA 4F7UE 4J5YA 4CRIA 5GAMd 1BIAA 4C8QC 2QQRA 5D6WA 4FT4A 2E65A 2ZZDA 4R56A 4NL3A 2EJGA 2QF7A 2LX9A 4DA4A 3LWHA 2VV5A 1MGQA 1WQ7A 4M78C 3CCMA 3GPLA 5GAN3 5L8RE 2F5KA 1K73U 2DO3A 5HK0A 3URGA 2KK4A 3I56A 4M7DE 4HLQA 4BACA 1XQHA 4JS4A 5FRNA 3A8HB 3OYYA 5GANe 3UPUA 2DD4A 2DZCA 3PMIA 4ZTFA 3GOXA 4ZTJA 1YJNT 4C5HA 3JAME 1WNLA 3JSCA 2E41A 5LJ3g 2ZPBB 3QG1A 1VIFA 3A8MB 2QQBA 4N4HA 3OA6A 2GCXA 1YHQT 1K9MC 4C0DC 1N9RA 2XI9A 1RL2A 5HK3A 4M77A 3LWIA 4E7JA 1NJIC 5GAN4 1HK9A 2CS7A 4JJNK 2HAXA 2JUFA 5C6SA 1QVGS 3Q1JA 1UEBA 4ELZC 3I56T 3VYHB 4M6VA 1NZ9A 1WPYA 2R57A 4QQGA 5KH6A 3L2VA 1VQPT 4C5IA 3FC3A 3RKYA 2QQAA 1Y07A 2EQMA 2DTIA 3OYFA 5LJ5h 4M75G 2EJFA 3V7CA 3OSSC 3VKHA 4BBRM 5A0DA 1VQOA 3FDRA 1BI2A 2BIVA 5GAN5 2DEQA 3WXMB 1KD1U 2D0QB 4CI0C 2QTXA 2OTJA 2CKKA 4NC6A 3BY7A 5GAN6 1NPPA 1YHQA 4M78G 3CEYA 4GLKA 3VUZA 5GMKm 3OY9A 2DD5A 4M77G 5GAOm 3JCMX 3J7AF 3HHTB 4M75C 4J8OA 1M1KC 1KG1A 3M5AA 2X4WA 3P8DA 2WSFE 4MZMA 3CBMA 3A8GB 4EMKC 4II1A 4Y91A 1YJ9A 3AHUA 4ZGEB 4MMLA 5DM7R 4Z02A 1YITT 3FJPA 3A8LB 3X20B 2RA2A 4C92A 4MFEA 4EMHA 3GP8A 2GFUA 4LDYA 3SDZA 5LJ5e 1VQ8A 3L2WA 1MHNA 1QP3A 3FIFA 2XG8D 5LJ5d 1KHIA 3BFMA 1VQMA 4BE1A 2VXEA 3JCMf 4M77B 4A54A 3EFSA 3QJYA 3L42A 1X6OA 3H6ZA 5GAMf 3LW5E 4M7DA 2MF2A 3LH0A 4LDUA 3NFCA 2PUKB 4QW2A 2XICA 3JCMb 5GAMh 4E7KA 2DXUA 3OW2S 4Z6YA 5D6YA 2YRVA 4EDUA 3QZ9B 1G3YA 1QVGA 3VUBA 5GAOr 4PJOG 4ELYC 2GQVA 3QBYA 4FL6A 4FU6A 5LJ3e 1UGRB 1V29B 2M0OA 2X4JA 3HSBA 2P0KA 4M75F 2EJ9A 4QSHA 2JTFA 3VJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGQ B;  2CZ6 B;  2ZPF B;  2DD4 B;  3VYG B;  4OB3 B;  2DXC B;  3QYG B;  2PVG B;  3QZ5 B;  2CZ1 B;  2ZCF B;  1AHJ B;  1PSE A;  2DPP B;  1UGS B;  2PVO B;  3X26 B;  2CZ0 B;  2CYZ B;  2ZZD A;  4OB0 B;  2DXB A;  5L8R E;  2DD5 B;  1GXI E;  3A8H B;  2ZZD B;  2DD4 A;  4RKU E;  2PVD B;  2ZPI B;  2ZPG B;  2ZPB B;  1JB0 E;  2AHJ B;  3A8M B;  2O01 E;  1UGP B;  2ZPE B;  3QXE B;  4ZGD B;  4OB2 B;  1DJ7 B;  4ZGJ B;  3VYH B;  1QP2 A;  3WVE B;  1IRE B;  2PUO B;  1PSF A;  3A8O B;  2PU9 B;  2D0Q B;  4KT0 E;  2DD5 A;  3HHT B;  2DXB B;  2WSF E;  2WSC E;  3A8G B;  4ZGE B;  4FM4 B;  3A8L B;  4L6V 5;  3X20 B;  4OB1 B;  3X28 B;  1QP3 A;  3QYH B;  4XK8 E;  2DXC A;  3X25 B;  3LW5 E;  4Y28 E;  2ZPH B;  2PUK B;  3X24 B;  3QZ9 B;  3VYG A;  2QDY B;  2CZ7 B;  3WVD B;  1UGR B;  1V29 B;  2WSE E; 
#chains in the Genus database with same CATH topology
 1BIB A;  1VUB A;  3HZJ A;  2LNV A;  1JXM A;  2Y90 A;  3I5S A;  1WHG A;  3HO8 A;  4J6W A;  2QXF A;  4EC9 B;  2CZ1 B;  4BI3 A;  5LMK B;  2JJ9 A;  2HZY A;  3CCE T;  2CZ0 B;  4M7D D;  2NUT A;  1Q86 U;  2X3X D;  2CP6 A;  5J3B A;  2KQW A;  2MAM A;  4LDV A;  2PZ1 A;  2MWP A;  3EH1 A;  1NM7 A;  3UDC A;  3KBG A;  3BG3 A;  1TUG B;  4ZNX A;  4HL4 A;  4E6R A;  2O9V A;  1VQ7 Q;  1Y7X A;  2ZPI B;  5DLQ E;  1XTD A;  2EQJ A;  2DVE A;  1W70 A;  3LGL A;  1YJ9 T;  1U1T A;  2L3S A;  1QVF P;  4GBQ A;  1NEB A;  1QQJ A;  4ZGD B;  1PD0 A;  5A2Q E;  1RAF B;  3HFN A;  4GLM A;  3TN8 B;  1PWT A;  2DBM A;  2BZ8 A;  5EG2 A;  5J26 A;  4M75 D;  2E64 A;  4J9D A;  1YIT A;  2K3Y A;  1YJW T;  1EIF A;  4BCM B;  3OS5 A;  1FMV A;  3CPW S;  3OYH A;  1H1S B;  1OUL A;  3FB9 A;  4BY6 B;  1M8V A;  2NWM A;  5D7U A;  1RAB B;  1AIS B;  3PE0 A;  1JQQ A;  1LCK A;  3JB9 G;  1N9S A;  2OTJ T;  4PJO F;  1PNJ A;  1WJS A;  3MP8 A;  4FYW B;  1HYO A;  1MMA A;  2CP7 A;  4C8Q B;  4E7I A;  3PFS A;  1QCN A;  1UHF A;  3EHR A;  4AKH A;  5IDN B;  1WHM A;  3O5Z A;  2PNI A;  2DXC A;  1YJ9 Q;  1TD6 A;  4FCY A;  4M7A A;  4CFU B;  2KSS A;  3HPW A;  4KBM B;  4BCN B;  4XU1 A;  4RMO A;  4OML A;  3BLR B;  1YJN A;  1K8A U;  2YHT A;  2V8K A;  4BCF B;  1R0B G;  4N4G A;  1GBR A;  2YUQ A;  2DTO A;  3O8V A;  1VQM Q;  3PIO A;  4LOC A;  2BUD A;  3BHV B;  2DL5 A;  5IH2 A;  1X43 A;  1VQO T;  3BG5 A;  2XU8 A;  3CCJ T;  4DQ2 A;  4AMC A;  2DRK A;  5GAN 8;  4Y92 A;  4B9X A;  2MWO A;  5LJ3 h;  1C1A A;  1PRL C;  5LJ3 f;  1JJ2 S;  3EJ1 B;  2DPP B;  1H8K A;  5FRO A;  1UGS B;  3DB3 A;  3CD6 A;  2OAW A;  3OYE A;  3CQT A;  3VS0 A;  2C6T B;  1VQ7 A;  4L5G A;  1TUC A;  1K4U S;  1VQO Q;  4M78 E;  2BKD N;  4N4I A;  1U3O A;  4LD6 A;  1VQ6 A;  3RR6 A;  5CQY A;  4F7U A;  4HVV A;  2B9R A;  3CCM Q;  1VIN A;  4RG2 A;  3RMQ A;  1TG0 A;  3MHX A;  1Q82 C;  2PVD B;  3OYL A;  5A0G A;  4M78 F;  2DA9 A;  4HCB A;  5KCO A;  1YCS B;  3RES A;  2F69 A;  1UGP B;  4BCN D;  1I4K 1;  3SHW A;  3OSV A;  3GNG A;  2LRQ A;  2L89 A;  4E7Z A;  1WHK A;  3S3N A;  5ACB A;  2DJZ A;  5HBJ B;  3OBW A;  2DZ9 A;  3HRU A;  4C92 D;  2RO0 A;  4NL2 A;  3E9F A;  2RK1 A;  5GAO l;  5GAM g;  4MMK A;  4QQ6 A;  4A53 A;  3THK A;  3EOC B;  4CFN B;  4PJO D;  4EOL B;  4EMG A;  1QWE A;  4CC4 B;  3F5X B;  2QG9 B;  2KYM A;  1D3B B;  2HBP A;  2LP5 A;  8AT1 B;  1TH7 A;  4YOZ A;  4Z89 A;  5GJV B;  3OS1 A;  1N5Z A;  1SRM A;  3NTK A;  2FPE A;  2EAY A;  2QYZ A;  3CCM T;  3GF5 A;  1W2B A;  2K5I A;  5DQV A;  1M90 C;  3CC7 Q;  1X2K A;  2WAC A;  4DOV A;  5J39 A;  2X4Y A;  2A7Y A;  2M02 A;  3X24 B;  1JST B;  2E10 A;  5GMK j;  4JRQ A;  1M90 R;  3CC7 A;  1G3W A;  2VUB A;  1FKM A;  1I0C A;  2IIM A;  2LT4 A;  3QO3 A;  3OW2 A;  2HD0 A;  4MZP A;  4ATO A;  1K8A R;  1G83 A;  1GFC A;  4BCQ B;  4M75 A;  4QVZ A;  2C06 A;  2MK5 A;  3CMA Q;  4PJN A;  4BY6 C;  2Y4Y A;  4MFD A;  2EVR A;  4BCG B;  2LCC A;  4ZN3 A;  3JCM c;  2C5V B;  1SF9 A;  4IIM A;  2RF0 A;  4EOQ B;  1D09 B;  4DBQ A;  1H1P B;  4DBH A;  3EHQ A;  3NGP A;  4BB7 A;  1V76 A;  5CQX A;  2DXB A;  1W2B S;  5IT9 E;  1S72 A;  1QVP A;  3CC4 A;  2QK0 A;  3MEW A;  5LJ5 f;  1PKS A;  1UG1 A;  3SWN C;  1QMZ B;  2XHC A;  2JN0 A;  4JRI A;  4HT9 A;  2NUP B;  4CFM B;  5FGK B;  1IHV A;  3A1P A;  2J05 A;  3M9Q A;  2R58 A;  4XAX B;  2ZPE B;  3HRT A;  2VVK A;  1YI2 T;  1XOV A;  3C0C A;  5EJC A;  4BCO B;  5C0M A;  4OMQ A;  3M4Y A;  2D8J A;  3M54 A;  1VQL Q;  5IDP B;  1M5Q 1;  3CCR A;  2ED1 A;  1Y57 A;  2RJC A;  1T3S A;  3CC2 Q;  2K3B A;  2X9H A;  3A8O B;  1QVF A;  1JO8 A;  1H3Z A;  1Q81 R;  3CCS Q;  3EG9 B;  1M3C A;  4CC3 A;  3CD6 Q;  3OYJ A;  1OX8 A;  1GL5 A;  3SD4 A;  1PHT A;  4PLI A;  4C0Z A;  2RHZ A;  1O9K B;  2KBT A;  2QQ9 A;  1NLP C;  5FU7 C;  3LQ5 B;  2HSP A;  3DKM A;  3X28 B;  1B34 B;  4MDW A;  5HVY B;  4BCK B;  1Q82 R;  5GAN f;  4JZ3 A;  4M77 C;  4C5E A;  2HQH A;  1TSF A;  2FHD A;  5FWB A;  1MMG A;  4M7D F;  4F6U B;  2HSE B;  4FW2 A;  1H64 1;  1YJN Q;  1TXQ A;  2NUZ A;  3REA B;  3VRY A;  4RTZ A;  4LDW A;  1KQS S;  4PJO B;  1VQ4 T;  4PJO A;  2MCN A;  1A0N B;  1FXX A;  2LQ8 A;  2X1N B;  4OR5 B;  1ZSZ C;  2KE9 A;  1RI0 A;  1VQ4 Q;  3EFO B;  4M7A C;  1UFF A;  1OL2 B;  1ZBX A;  2JTE A;  2QGS A;  1KC8 C;  4KRT A;  2KEA A;  3CCJ A;  2BKZ B;  1UNG D;  1VQ5 A;  2K2M A;  2KY9 A;  3VS1 A;  4E7S A;  3NTI A;  4OF1 A;  4L59 A;  4JS5 A;  1ZUU A;  3ZBD A;  1CSK A;  2FEI A;  4FT4 A;  1JJ2 P;  1OX9 A;  2E65 A;  4NL3 A;  4DA4 A;  2VV5 A;  1WQ7 A;  3CCM A;  2UZB B;  2YWW A;  5GAN 3;  4K11 A;  2DFU A;  3I56 A;  4M7D E;  2DL7 A;  2LJ0 A;  4BAC A;  2WIP B;  2MYS A;  3UPU A;  2DD4 A;  3GOX A;  4J9F A;  2BE9 B;  1AT1 B;  2ZPB B;  4EOR B;  1VIF A;  4N4H A;  1YHQ T;  2I53 A;  5GAN 4;  1Q95 G;  4AFU C;  2LQW A;  3Q1J A;  1M8M A;  1OOT A;  4C5I A;  2QQA A;  1VQ9 Q;  3TNI B;  4J9I A;  1E7O A;  3V7C A;  3OSS C;  1H24 B;  2SRC A;  1TTH B;  2YRC A;  1BI2 A;  1R0C B;  3OY9 A;  3QDF A;  3E2U A;  2WSF E;  2KGT A;  2K7A A;  3A8G B;  1EZZ B;  2L0A A;  4PFZ A;  1YJ9 A;  2NUT B;  4Z02 A;  2PTK A;  3A8L B;  3X20 B;  2RA2 A;  4LDY A;  3L2W A;  3FIF A;  2J06 A;  4AFQ C;  2PMI B;  3JCM f;  4M77 B;  2JGZ B;  3LW5 E;  5IHN A;  4M7D A;  2XIC A;  3JCM b;  2DXU A;  3OW2 S;  5FW9 A;  4EDU A;  1QVG A;  1H1R B;  1RI9 A;  5LJ3 e;  4RTX A;  4FL6 A;  1V29 B;  3HSB A;  1VQP Q;  2P0K A;  5IXB A;  3VJP A;  2JTM A;  2O88 A;  4AKI A;  4QVD A;  3OMC A;  3A5Z B;  1VQ7 T;  3C4S A;  1VA7 A;  4OP0 A;  2CZ6 B;  2VYT A;  3RER A;  4BE2 A;  5LJ5 j;  3QUI A;  3KFV A;  1OV3 A;  1GY3 B;  2E5Q A;  4EOI B;  1JU5 C;  1VQN Q;  2QQ8 A;  3J80 E;  1X6G A;  2YUO A;  1OQK A;  1SEM A;  5HBH B;  3JCM P;  4ZTF A;  2XKO C;  8ATC B;  5IHI A;  1Z9Z A;  1YI2 A;  1N8R C;  2QGF B;  1D3B A;  2A3L A;  4BY1 X;  3OYM A;  3CME T;  4XTU A;  1BCM A;  3HFO A;  3TVT A;  5GAM e;  1RLP C;  4J9B A;  4JPB W;  4PFO A;  1KC8 U;  3CCQ A;  3ASK A;  5IHY A;  1YJW A;  3C95 A;  1YNZ A;  1G3N C;  3H0I A;  3L2Z A;  1QVF S;  3OYK A;  3R6N A;  4JX5 A;  4J7F A;  1R77 A;  1ZA2 B;  2PUO B;  2PJQ A;  3M4G A;  4AI6 A;  4A4H A;  4ANJ A;  3VKG A;  2WJ9 A;  5FU6 B;  2EUF A;  2RHU A;  3UWN A;  1SSH A;  2K3X A;  4CXA B;  3LLR A;  4X9C A;  3CME Q;  4GY5 A;  3HBL A;  1UB4 A;  2ENM A;  1WLP B;  2M0Y A;  3L2R A;  1M90 U;  4ELL A;  2EQU A;  4CC2 A;  1VQ8 Q;  2QEX A;  1TFB A;  1W1F A;  2EYW A;  3OYA A;  2FZC B;  1BI3 A;  1KD1 C;  1AZG B;  5LL6 S;  4HVU A;  3M58 A;  1G3T A;  1Q7Y C;  1MMN A;  1NYF A;  4RUG A;  2AIR B;  4OGE A;  4J6Y A;  1HXD A;  3JCM g;  2BS4 A;  1V1C A;  5HY6 A;  2CZ7 B;  2J6F A;  2KRM A;  1GCQ C;  2R7G A;  3EGX B;  1UTI A;  2CUB A;  4RCB A;  4E47 A;  4EPC A;  2MOX A;  1VQ6 T;  4KH1 B;  3QYB A;  4BD3 A;  1ABO A;  2JM8 A;  1RAH B;  3SB2 A;  3BG9 A;  2RH2 A;  2JOY A;  1M2V B;  1YBY A;  1D0X A;  1QWF A;  3RKX A;  1K73 C;  1IXD A;  1NPR A;  2YSQ A;  3PNW C;  4R0K A;  2YDL A;  1KQS P;  1M3B A;  2DK3 A;  3E9G A;  2OX7 A;  2IPO B;  1VQK T;  1I07 A;  4JJC A;  1KK7 A;  2GTO A;  2E3H A;  1YI2 Q;  3MKD A;  5IXF A;  4BXX X;  3I5R A;  2K2V A;  4ESR A;  3CPW A;  3G4S Q;  2ECZ A;  2XK0 A;  4J6X A;  1BI0 A;  3DTO A;  1VQN A;  3BHU B;  4E7L A;  4P5N A;  3I35 A;  4QVC A;  1LOJ A;  3CD6 T;  2DJQ A;  3CCS T;  2DIG A;  3R6O A;  4II5 B;  5ECA A;  3TNH B;  2I0N A;  1ZHI A;  4AFZ C;  3PTA A;  1ZLM A;  4DBF A;  2P4T A;  3L2U A;  5CIU A;  2UUE B;  1KQ1 A;  2FB7 A;  3KXT A;  5CKH A;  1IZ6 A;  3CCL A;  4QQD A;  2K5L A;  3EAE A;  3E19 A;  2EYZ A;  5I21 A;  4F6S B;  4KH0 B;  2W0Z A;  2L8D A;  4BI8 B;  3G6E T;  1J3T A;  2BTT A;  2RJD A;  4E7H A;  1RAA B;  3SFM A;  3ZL7 C;  2X51 A;  1SRL A;  5EC7 A;  2DXB B;  3CCE Q;  5I2S A;  2RHX A;  2JZ2 A;  2K5F A;  3H8Z A;  2KI7 A;  3MI9 B;  4CFU D;  1M4Z A;  1ZUK A;  2J6K A;  4BDY A;  4PKC C;  4XQ3 A;  4DOW A;  3JCM V;  1E6H A;  1G8X A;  1GUX B;  3GIB A;  4ME7 A;  3UAT A;  4LE9 A;  5DY9 A;  1VQ4 A;  3AT1 B;  3M55 A;  2JMA A;  1ZSG A;  3VS7 A;  3HKS A;  2WFY B;  1Y96 B;  4BDZ A;  3G71 T;  3C12 A;  3PMT A;  1OKW B;  1WHL A;  5GAN 7;  4OGC A;  1H4L D;  4JLI A;  3POM A;  1VQ9 A;  1AZE A;  5CK9 A;  3CBP A;  1VIE A;  2HCK A;  4LUE A;  2QDL A;  3GBQ A;  4M77 E;  4BCM D;  2G6F X;  3VYG B;  5IF1 B;  2JT4 A;  2DXC B;  5CCA A;  4FYY B;  3CCE A;  3VS6 A;  2YRD A;  4ROC A;  1R8O B;  3S3M A;  3C94 A;  1IO6 A;  4F7L B;  1W6X A;  5ICP B;  2VWF A;  3SWN A;  1S1N A;  4HNU A;  3CCR T;  2WMA B;  2SEM A;  4IUU A;  1LNX A;  3CXC A;  3CCL Q;  1KQ2 A;  1H3H A;  1JBM A;  2G3R A;  2JW4 A;  3M0U A;  3GLX A;  1W4S A;  2LTO A;  2PQW A;  1E7P A;  2MI6 A;  2ZPG B;  4YOS A;  1MMD A;  1Q81 U;  4FX3 B;  3PVL A;  2VGN A;  4HA8 A;  9ATC B;  1G5V A;  5GAN h;  2A0F B;  2GNC A;  5IHK A;  1YP5 A;  4IIO A;  1WXT A;  3QSU A;  1C6V X;  4IKF A;  3TU4 K;  1K8A C;  2YUN A;  3KHI A;  2RI5 A;  4A4G A;  3EG0 A;  2RQT A;  2G9X B;  3DL1 A;  2J6O A;  4X1V A;  3G71 A;  2F1L A;  3CCV A;  3V8L A;  4ZN1 A;  4M7A F;  3INZ A;  2QAZ A;  3M57 A;  2FPF A;  4R55 A;  1NE8 A;  3S3O A;  1UNH D;  2FZG B;  3JB9 J;  4L6V 5;  1KXU A;  2XDB A;  2IW6 B;  3PGG A;  1VQM T;  2LVM A;  2VC8 A;  1QLY A;  4F17 A;  4F14 A;  5GMK i;  3JB9 D;  3JCM e;  5IAY A;  3QYH B;  2R5A A;  3CCU Q;  1ABQ A;  1OZ3 A;  3NTH A;  3MO8 A;  1PCX A;  3NMZ C;  3CC7 T;  4M4Z A;  2M16 A;  4OMP A;  2ZPH B;  2FYK A;  2GF7 A;  2ROL A;  4EOM B;  4O5V A;  2AZS A;  3JCM h;  4C92 F;  1H25 B;  2FG0 A;  1P5E B;  1VYW B;  3CC2 A;  1YWO A;  3OYN A;  2VXF A;  3CCL T;  2C5X B;  5GAO n;  2DD4 B;  1UNL D;  2DF6 A;  2PVG B;  3EGD B;  1GCP A;  5CKE A;  3QYE A;  1RAI B;  1RUW A;  5KYN A;  2AK5 A;  3I55 Q;  5CO7 A;  1SKU B;  4D6W A;  4F7U E;  2AZV A;  2EYY A;  1PKD B;  1AD5 A;  1FMW A;  2LX9 A;  3LWH A;  3GPL A;  3RDV A;  2DO3 A;  4J9G A;  1B7T A;  3U23 A;  1UE9 A;  2DZC A;  2FZK B;  4C5H A;  3JAM E;  2E41 A;  1M27 C;  4EOO B;  2GCX A;  2K9G A;  2QA4 Q;  1H28 B;  2XI9 A;  3LWI A;  1NJI C;  4E7J A;  1HK9 A;  2CS7 A;  2HAX A;  5C6S A;  4CC7 A;  4M6V A;  1X69 A;  2R57 A;  3RKY A;  1PD1 A;  2EQM A;  2EJF A;  2COZ A;  4BBR M;  4FYV B;  5A0D A;  1VQO A;  2BIV A;  2D0Q B;  2QTX A;  2ED0 A;  3VUZ A;  1M1K C;  4JZ4 A;  4OGR B;  2X4W A;  3P8D A;  4MZM A;  4Y91 A;  4YOO A;  1BU1 A;  5LJ5 e;  1AWX A;  1QP3 A;  4CFW B;  3B57 A;  2MPX C;  3OW2 P;  2VAS A;  3UA6 A;  3EGX A;  1KHI A;  1GBQ A;  1VQM A;  2ROT A;  1OPL A;  3DDQ B;  3EFS A;  3EG3 A;  1BK2 A;  1X6O A;  2UZL B;  3EG2 A;  3NFC A;  2PUK B;  5KYU A;  4E7K A;  5L2W B;  1G3Y A;  4AG2 C;  5GAO r;  5HCK A;  4PJO G;  4ELY C;  4FU6 A;  2E5K A;  1W2B P;  4M75 F;  2EJ9 A;  1UGV A;  2JTF A;  2DM1 A;  1O9K A;  5GMK e;  4HKE A;  1CKA A;  2WHB B;  4Y72 B;  2OTL A;  3BHT B;  4IUQ A;  3DOG B;  4C8Q A;  1M3A A;  3CBO A;  3J81 E;  1UDL A;  3ULR B;  2X4X A;  3HTR A;  3CPW P;  1QKX A;  2E70 A;  4YTL A;  5AYF A;  4PNO A;  1C0M A;  2EQI A;  2F2C A;  1WDX A;  2DX1 A;  2EW3 A;  2MMP A;  1W98 B;  1IGQ A;  4OMM A;  4EC8 B;  3TEE A;  4C92 E;  4OMF B;  5GAN d;  2DD5 B;  1VQ6 Q;  1YWP A;  2W99 A;  1UEC A;  1X27 A;  4HXJ A;  3MP1 A;  1BYM A;  4CFX B;  4A4F A;  4A4K A;  1JB0 E;  4X34 A;  2O01 E;  5CKB A;  2IVW A;  3QXE B;  1ARK A;  2K79 A;  4J83 A;  1FYN A;  3OYB A;  3SWN B;  3OS0 A;  1NYG A;  1KC8 R;  3JB9 F;  3I56 Q;  4OMO A;  4D8K A;  1SPK A;  2QI2 A;  1VQP A;  3LGF A;  4OVA A;  2DYI A;  4KT0 E;  4KGV B;  3LX7 A;  4M75 E;  2V26 A;  2KXD A;  3CCU T;  2RN8 A;  2EBP A;  1QW1 A;  2CSQ A;  1ZA1 B;  2K4Y A;  4FIB A;  4IUP A;  1JOW A;  2YXY A;  1FX7 A;  2HBW A;  4KRC B;  5GJW B;  1VQ9 T;  2D6F A;  2F2V A;  1BKB A;  3ZEH A;  2V8I A;  1WHJ A;  2M9U A;  1KQS A;  5I22 A;  1Q86 C;  1MV0 B;  4MZT A;  3VS5 A;  5CKD A;  5FU7 B;  1D3U B;  3E1S A;  2KXC A;  2A37 A;  2RJF A;  1OZ2 A;  3TQ7 P;  1Q86 R;  3V7R A;  1YHQ Q;  3VYG A;  2QDY B;  4BI4 A;  1WIE A;  4LNP A;  4AG1 C;  2Z0W A;  2FPD A;  1YIT Q;  2RK2 A;  3TSW A;  4M7D C;  4RTY A;  1U1S A;  2D8H A;  3HL8 A;  4AKG A;  2RHI A;  4C8Q F;  1GRI A;  4G6L B;  4RTT A;  4C0F A;  3RMS A;  2FVU A;  1AHJ B;  3OB9 A;  3DDP B;  3PO3 S;  5KYX A;  1X01 A;  5GAO p;  1M1G A;  4F7S B;  3CCS A;  4M7A D;  2KRN A;  4CFV B;  2O4X A;  2O9S A;  4OB0 B;  4NOY A;  4IUT A;  5KCH A;  4JUV A;  1FWZ A;  3CCR Q;  2IVX A;  2YLC A;  1ZQ1 A;  2F5T X;  5FU6 C;  3IQL A;  4PK4 A;  4BCI B;  5FWC A;  1FMK A;  2ZZD B;  3RUX A;  4M77 D;  3MEV A;  4RCC A;  1X6B A;  4F7U B;  1SSF A;  4WCI A;  4X9D A;  2RI3 A;  2AHJ B;  4OMN A;  4XU0 A;  1URC B;  1WA7 A;  3TRE A;  1T0H A;  3TW6 A;  1VOM A;  4HNV A;  4XTY A;  3QWL A;  5GAN 2;  1VQ5 Q;  2AKL A;  4Z8A A;  3CCV T;  4M7A E;  3EFR A;  2DIQ A;  3PT9 A;  2XD0 A;  3CC4 Q;  1U06 A;  1S72 Q;  3QHW B;  4HCC A;  1HSQ A;  1N8R U;  2JNG A;  1IB8 A;  1VOL A;  1OIU B;  2C0O A;  1VQ5 T;  4ELJ A;  2LNH B;  4JX4 A;  4EOJ B;  1D1C A;  2E6Z A;  3QDR B;  1OGU B;  1D1B A;  4OB1 B;  2D0N A;  1WX6 A;  1QVG P;  1EX4 A;  2QGG A;  4JDS A;  3M0R A;  2QQS A;  4M7A B;  3JB9 H;  4C5G A;  1PKT A;  3X25 B;  2Y4X A;  4Z88 A;  3VS3 A;  1Q7Y U;  4DEX A;  2NLU A;  3CPF A;  4QKU A;  3MIA B;  5EFQ B;  5KYX B;  4EOP B;  5HBE B;  4PJO E;  2B8A A;  1O9S A;  1K0S A;  2V1R A;  4J9H A;  3QHS A;  3WVD B;  1PM3 A;  3CCU A;  1UJ0 A;  3VKI A;  2QDJ A;  1F1B B;  4C8Q D;  1OU9 A;  1VQL A;  1TUD A;  3OYG A;  4WF2 A;  1OEB A;  1JJ2 A;  5GAN g;  1K76 A;  3QKJ A;  4A4E A;  4LN2 A;  2KVQ G;  3JRZ A;  3CC2 T;  2E12 A;  2ZPF B;  1N4M A;  1WJR A;  3GTM S;  3HP9 A;  3I55 T;  1VQL T;  4JLG A;  3H0F A;  1WI7 A;  1KIK A;  2D9T A;  3MY1 B;  4BCQ D;  3M59 A;  4LD9 K;  1IHW A;  3MY5 B;  4IUV A;  3N5B B;  4VUB A;  1BI1 A;  2DTH A;  1YN8 A;  2CYZ B;  4C92 G;  2YT6 A;  4M78 B;  3O0G D;  4F6W B;  2ESW A;  2CRE A;  3OYD A;  2EQK A;  2CGH A;  2XID A;  1Q7Y R;  3ZFJ A;  4F04 B;  1N8R R;  3DB4 A;  1SHF A;  2KDS A;  1BBZ A;  1JKW A;  2LW4 A;  2W9F A;  4AFS C;  4KRD B;  5DLO A;  4LXC A;  3CMA A;  2H3J A;  1YIJ A;  3P8B B;  5GAM j;  4N0A A;  2COY A;  4PJO C;  3CMA T;  3SEM A;  2VKN A;  3EGD A;  1XO2 A;  3CCQ T;  2R5M A;  1WFW A;  1WQW A;  1HD3 A;  3P8H A;  4C92 C;  1T3L A;  1B34 A;  2DME A;  2LQN A;  5GAO q;  4XTZ A;  1MUZ A;  3RIR A;  4JRP A;  2HL5 C;  2EGE A;  3CXC S;  2CT4 A;  5HNB B;  2WPA B;  1TWB A;  1LJO A;  1ZBJ A;  1GFD A;  4XU2 A;  3G7Z A;  1M1F A;  1VYT A;  2RM4 A;  1MNE A;  1NLO C;  3BLQ B;  3V7S A;  2JMC A;  5LQF B;  1MV3 A;  4C0G A;  1VQK A;  2X3W D;  3CCV Q;  2VGM A;  4EOS B;  1Q82 U;  5GAN j;  5GMK l;  2OJ2 A;  2EKH A;  4UN0 A;  2DYB A;  2E6N A;  2WMB B;  3MET A;  2QAS A;  5A0L A;  1Z9Q A;  3GNF B;  2V8J A;  1KFZ A;  2KT1 A;  2X35 A;  5LJ5 g;  4RTW A;  2W9Z A;  1I8F A;  2OI3 A;  3RKW A;  1RAC B;  2JVV A;  1P92 A;  2EGC A;  2L5Q A;  2LT1 A;  2EYQ A;  3A98 A;  6AT1 B;  4JJD A;  3JCM Q;  3M03 A;  4J5Y A;  1XJW B;  2QQR A;  2KRS A;  4R56 A;  4KGZ B;  2EJG A;  1BU2 A;  4M78 C;  1MGQ A;  3VS4 A;  1ZSZ B;  2JXB A;  1K73 U;  5HK0 A;  3URG A;  2KK4 A;  1XQH A;  5FRN A;  3M0S A;  4EON B;  1QKW A;  3A8H B;  2L3P A;  3OYY A;  3RBB B;  4BCP B;  3PMI A;  2HKQ B;  1H1Q B;  1WNL A;  1F5Q B;  2H3E B;  3JSC A;  5LJ3 g;  2A28 A;  2IW8 B;  3OA6 A;  2CJM B;  1C9B A;  1ACM B;  2A36 A;  1N9R A;  2FO0 A;  1RLQ C;  1RL2 A;  4LUD A;  5HK3 A;  1HJD A;  2DBK A;  2JUF A;  1UEB A;  3FJ5 A;  4ELZ C;  3VYH B;  1B07 A;  1NZ9 A;  1WPY A;  5KH6 A;  2CT3 A;  1VQP T;  3L2V A;  2VB6 A;  3FC3 A;  3OYF A;  5LJ5 h;  4IMY B;  4M75 G;  2C5O B;  3VKH A;  3FDR A;  1KD1 U;  4CRL B;  1NEG A;  3JV3 A;  4NC6 A;  3BY7 A;  1YHQ A;  4M78 G;  4GLK A;  2DNU A;  3I9Q A;  4M77 G;  3G6E Q;  3EH2 A;  3HHT B;  4M75 C;  1KG1 A;  2JS2 A;  1G2B A;  3CBM A;  4EMK C;  4BCH B;  3AHU A;  5DM7 R;  2OTL Q;  4C92 A;  4MFE A;  4EMH A;  3GP8 A;  1TS9 A;  2CSI A;  3K7A M;  2CCI B;  2CDT A;  4BCJ B;  5LJ5 d;  3BFM A;  1RAE B;  1LVK A;  2VXE A;  5I11 A;  4A54 A;  5GAM f;  2DMO A;  2MF2 A;  4QW2 A;  5GAM h;  2C0I A;  2YRV A;  4ORZ A;  3D7S B;  2DEU A;  2AT1 B;  3VUB A;  2GQV A;  2RPN A;  2COW A;  4QSH A;  2RNA A;  3OQ5 A;  1UGQ B;  5DQW A;  5KE3 A;  2EFI A;  4FYX B;  2NUP A;  2PK9 B;  3VRZ A;  2P4R A;  3L1A A;  2HNI A;  4OB3 B;  2GFA A;  2LQK A;  2EWN A;  2P0Q A;  1Y96 A;  1K0X A;  1OI1 A;  2PVO B;  2KYB A;  2C0T A;  3TW7 A;  4EIK A;  2I40 B;  3BDU A;  4NS5 A;  1N27 A;  2HQX A;  2P84 A;  2EIF A;  3LYI A;  4PJL A;  1QMC A;  2YLB A;  2CUD A;  3ER0 A;  4DBR A;  3G4S A;  1IGU A;  2QEX T;  1K1Z A;  4FSX A;  3M0Q A;  5KYY B;  1PC0 A;  3CC4 T;  1S72 T;  1O75 A;  4EMK B;  1FIN B;  2C5N B;  4PLL A;  3RGF B;  1SG5 A;  3M0T A;  3EG9 A;  2EPD A;  4RG8 A;  4M7A G;  4N0A C;  2O2O A;  5CR2 A;  1OIY B;  1BCO A;  4FW1 A;  2KNB B;  4B9W A;  1YCY A;  4C0D B;  1D0Z A;  2GBQ A;  1I5O B;  4WTO B;  3OYC A;  1WZO A;  4MDX A;  2PU9 B;  2DKG A;  2KR3 A;  1U8R A;  3I55 A;  3HRS A;  2KT8 A;  4J7I A;  2W96 A;  4M77 F;  3DLL A;  2E3I A;  4M75 B;  2ABL A;  2CP2 A;  2M51 A;  1JSU B;  4XTW A;  1H92 A;  2XMF A;  2QEX Q;  2W10 A;  2RQU A;  2BE7 D;  4C92 B;  2O4X B;  4XK8 E;  4ROE A;  2DER A;  4BUG A;  3VU3 C;  2QTV A;  1VYV A;  3CME A;  2RQW A;  1KJW A;  4JX6 A;  4D8D A;  3RNJ A;  2HQE A;  4JRK A;  2OTJ Q;  2EGA A;  4F7U G;  2QA4 T;  3NPF A;  2OTL T;  2FL7 A;  1UHC A;  3UA7 A;  4PJM A;  1YJW Q;  2RQR A;  2WXV B;  1UUE A;  1B3Q A;  2GTJ A;  3QZ5 B;  2BZX A;  4F16 A;  3CCQ Q;  1M1K R;  2HL3 A;  4FT2 A;  4C8Q G;  2QA4 A;  2AKK A;  3X26 B;  3G6E A;  4KUD K;  3M56 A;  3PIP A;  1H26 B;  1KHC A;  4J9E A;  3G71 Q;  2FRW A;  2H8H A;  3UT1 A;  3BLH B;  3MJX A;  1BB9 A;  3HB9 A;  3PVQ A;  1M1K U;  1EFN A;  1OI9 B;  2CH4 W;  5FLX E;  1ZSZ A;  2LMJ A;  2PK2 A;  1GH6 B;  1JEG A;  4RKU E;  5KYW B;  5CEI B;  4FSS A;  3JCM J;  1OL1 B;  2JS0 A;  1IRX A;  1MND A;  2LDM A;  3S6W A;  2LX7 A;  2G77 A;  2PHG A;  4DEY A;  1NJI R;  5HKC A;  3JCM W;  1PRM C;  2CP0 A;  2RHY A;  2E4H A;  3QJ6 A;  1AWO A;  4XTV A;  2K6D A;  1RAG B;  3QHR B;  1NBE B;  5IN1 A;  1AEY A;  3EGU A;  3QWY A;  1AD6 A;  1QP2 A;  4MIM A;  1ZUY A;  2LCS A;  2GQI A;  2BS2 A;  1NJI U;  1PSF A;  3OYI A;  2DE0 X;  3MCA B;  2LZ6 B;  2LJ1 A;  2EYX A;  3T9N A;  3JCM d;  4M7D G;  2HMA A;  2L3R A;  4FM4 B;  3L2Q A;  2WIH B;  5GMK h;  5M9O A;  1NG2 A;  2K57 A;  3QWX X;  5LJ3 d;  3OBY A;  2DL8 A;  4B6M A;  2OAU A;  1D0Y A;  5LJ3 j;  3FLG A;  4ROD A;  1JRI A;  1M9S A;  1ENW A;  2HDA A;  1VQK Q;  2RB6 A;  2V22 B;  2E1H A;  2XDD A;  2EKO A;  4M78 D;  3M53 A;  5FRM A;  1WGS A;  1K9M R;  1FVV B;  2B86 A;  3VV0 A;  3ME9 A;  1XNI A;  1QCF A;  1VYU A;  2NYS A;  4Q5W A;  2CP3 A;  4F7U F;  4XTX A;  4EMK A;  3DLM A;  3QYG B;  5I2M A;  2D1X A;  2DXT A;  2ZCF B;  1T0J A;  1PSE A;  3OS2 A;  2RMO A;  1GUX A;  2KAF A;  3REB B;  2XDP A;  3MPU B;  4M7D B;  2F2W A;  1KSW A;  4HNT A;  1K9A A;  3F70 A;  3MEA A;  7AT1 B;  2L3Q A;  5D6X A;  1I81 A;  3FEO A;  2F2X A;  5KYW A;  2RD1 A;  3TCJ A;  4YC3 B;  3M0P A;  2BS3 A;  4F7N B;  4O6J A;  1Y71 A;  3UF4 A;  1WYX A;  3QPH A;  2CCH B;  3V8K A;  2KR6 A;  2IG0 A;  1YIJ T;  1OYX A;  5CKF A;  1GXI E;  4HT8 A;  3VS2 A;  3V8J A;  4XU3 A;  1VQ8 T;  2KMT A;  2LC4 A;  2HEQ A;  4F70 B;  3G33 B;  1N6A A;  3H0H A;  4BE0 A;  5KYY A;  1M30 A;  3TSZ A;  1K9M U;  2WEV B;  1PG5 B;  3MP6 A;  4OB2 B;  4PFP A;  4LDX A;  3KUF A;  3CCJ Q;  4V2S A;  2DL3 A;  4PL6 A;  3MEU A;  1DJ7 B;  2KMG A;  4ZGJ B;  2QFZ A;  3DJB A;  1M2O A;  4KGX B;  1ZP2 A;  2DAQ A;  3OMG A;  3BW1 A;  3WVE B;  1IRE B;  4IUR A;  2O31 A;  5KE2 A;  2RJE A;  4KUI A;  4M78 A;  1QCO A;  1GCQ A;  3G1J A;  1U5S A;  3CXC P;  3EG1 A;  2DRM A;  2DVJ A;  3H41 A;  1Q81 C;  4RTV A;  5CVI A;  2UZE B;  1WHH A;  2WSC E;  2W2H A;  2HKN A;  5AT1 B;  2J7I A;  1AWW A;  2IN3 A;  3FRN A;  3JB9 I;  4HCK A;  2UZD B;  2LCL A;  1D1A A;  2DLP A;  3BDL A;  5CAI A;  3G4S T;  2M1H A;  1WJQ A;  1M2V A;  4KUL A;  1OKV B;  4TVR A;  4UC4 A;  3EID B;  3H9N A;  4Y28 E;  1X75 C;  1VQN T;  2ATC B;  2DL4 A;  2P0P A;  4BBS M;  3QII A;  2GGR A;  4JJB A;  2WSE E;  1RAD B;  5KYU B;  4NST B;  1YIJ Q;  3EFO A;  4HCZ A;  2IW9 B;  1I5L A;  4RTU A;  2RI2 A;  1QLB A;  4C8Q E;  1AVZ C;  2ZGW A;  1G3S A;  3H4C A;  2MIO A;  2I2L A;  1X2Q A;  4QT7 A;  1I1J A;  1WXB A;  4CRI A;  5GAM d;  2DET A;  1BIA A;  4C8Q C;  2A08 A;  1LPL A;  5D6W A;  1K73 R;  2ZZD A;  2QF7 A;  1AWJ A;  4EOK B;  2RQV A;  3TNW B;  5L8R E;  2F5K A;  1AOJ A;  4HLQ A;  2KRO A;  2YUP A;  1JXO A;  2CH4 A;  4JS4 A;  5I5Z B;  5GAN e;  2FRY A;  1WXU A;  4ZTJ A;  1YJN T;  3NDQ A;  2DIL A;  1KD1 R;  1SHG A;  3QG1 A;  3A8M B;  2QQB A;  5HQ0 B;  1K9M C;  4A63 B;  4C0D C;  1OU8 A;  5L23 A;  4M77 A;  3LH5 A;  4JJN K;  1QVG S;  1Y0M A;  3I56 T;  1OPK A;  4QQG A;  4AT1 B;  3NHN A;  2JM9 A;  1Y07 A;  2DTI A;  4E2F B;  5CYI B;  1YFN A;  4TTH A;  5GAN 5;  2DEQ A;  3WXM B;  4PJJ A;  4CI0 C;  2OTJ A;  2V1Q A;  2CKK A;  5GAN 6;  1NPP A;  4F7J B;  3CEY A;  5GMK m;  2DD5 A;  5GAO m;  3JCM X;  3J7A F;  4J8O A;  3M5A A;  2ZAE A;  4II1 A;  2C4G B;  4ZGE B;  4MML A;  1YIT T;  1E6G A;  3FJP A;  4HVW A;  1ZX6 A;  2GFU A;  1TOV A;  3SDZ A;  1VQ8 A;  3BE3 A;  2LJ3 A;  4J9C A;  1MHN A;  2XG8 D;  5BNJ B;  4BE1 A;  1UJY A;  1E9H B;  2BZY A;  3QJY A;  3L42 A;  3H6Z A;  3LH0 A;  4LDU A;  1CKB A;  2CP5 A;  4BY7 X;  2BPM B;  4Z6Y A;  5D6Y A;  1TU0 B;  4I3Z B;  3QZ9 B;  3QBY A;  1UGR B;  2M0O A;  2X4J A;  1H27 B;  2L2P A; 
#chains in the Genus database with same CATH homology
 1BIB A;  2JTM A;  1VUB A;  3OQ5 A;  3HZJ A;  1UGQ B;  4AKI A;  2LNV A;  3OMC A;  4QVD A;  5KE3 A;  4HKE A;  2EFI A;  5GMK e;  3A5Z B;  2Y90 A;  1VQ7 T;  3C4S A;  3HO8 A;  4J6W A;  4OP0 A;  2CZ6 B;  2VYT A;  2QXF A;  2OTL A;  3RER A;  3L1A A;  4IUQ A;  2HNI A;  4OB3 B;  4C8Q A;  2GFA A;  4BE2 A;  2LQK A;  3CBO A;  3J81 E;  2EWN A;  2P0Q A;  2CZ1 B;  5LJ5 j;  1Y96 A;  3QUI A;  4BI3 A;  2X4X A;  1OI1 A;  2E70 A;  2PVO B;  4YTL A;  5AYF A;  3TW7 A;  2E5Q A;  4PNO A;  3CCE T;  3BDU A;  2CZ0 B;  4NS5 A;  4M7D D;  2QQ8 A;  3J80 E;  2MMP A;  1N27 A;  1Q86 U;  2HQX A;  5J3B A;  2EIF A;  2KQW A;  2MAM A;  3LYI A;  4LDV A;  4OMF B;  2XKO C;  3TEE A;  2YLB A;  4C92 E;  3ER0 A;  3G4S A;  2QEX T;  5GAN d;  4FSX A;  2MWP A;  2DD5 B;  1YI2 A;  3UDC A;  1N8R C;  1D3B A;  2A3L A;  3KBG A;  3BG3 A;  4HL4 A;  3CC4 T;  1S72 T;  1O75 A;  3MP1 A;  3OYM A;  3CME T;  1Y7X A;  2ZPI B;  5DLQ E;  1XTD A;  4EMK B;  1BYM A;  2EQJ A;  4XTU A;  4A4F A;  2DVE A;  3LGL A;  4PLL A;  4A4K A;  1JB0 E;  1YJ9 T;  3HFO A;  4X34 A;  5GAM e;  2O01 E;  4RG8 A;  1U1T A;  4M7A G;  1KC8 U;  5CKB A;  3CC4 A;  4N0A C;  3CCQ A;  2IVW A;  5CR2 A;  3QXE B;  4ZGD B;  3ASK A;  5A2Q E;  4J83 A;  4B9W A;  1YCY A;  3HFN A;  3OYB A;  4C0D B;  3SWN B;  1YJW A;  3C95 A;  3OS0 A;  5EG2 A;  3JB9 F;  5J26 A;  4M75 D;  3L2Z A;  1QVF S;  3OYK A;  2E64 A;  4JX5 A;  4J7F A;  1YIT A;  2K3Y A;  1YJW T;  1EIF A;  2PUO B;  2QI2 A;  3OS5 A;  3OYC A;  1VQP A;  3LGF A;  4OVA A;  2PU9 B;  3M4G A;  4AI6 A;  4MDX A;  4A4H A;  3CPW S;  3OYH A;  2DKG A;  3VKG A;  4KT0 E;  4M75 E;  3LX7 A;  3FB9 A;  2WJ9 A;  4BY6 B;  1M8V A;  5FU6 B;  2RHU A;  3UWN A;  1U8R A;  2K3X A;  3LLR A;  4X9C A;  3HRS A;  3I55 A;  3CCU T;  4GY5 A;  3JB9 G;  3HBL A;  1N9S A;  1UB4 A;  4J7I A;  2OTJ T;  4PJO F;  4M77 F;  3DLL A;  1WJS A;  4M75 B;  3MP8 A;  1QW1 A;  4C8Q B;  4XTW A;  4E7I A;  3PFS A;  4FIB A;  2K4Y A;  3L2R A;  1M90 U;  4IUP A;  2EQU A;  1FX7 A;  1VQ9 T;  2QEX A;  4AKH A;  4C92 B;  2D6F A;  3OYA A;  1BKB A;  1BI3 A;  2O4X B;  4XK8 E;  1KD1 C;  3ZEH A;  2V8I A;  3JCM P;  2M9U A;  1KQS A;  5LL6 S;  2DXC A;  4BUG A;  3VU3 C;  4BDZ A;  4MZT A;  1Q86 C;  3M58 A;  1G3T A;  5CKD A;  5FU7 B;  1Q7Y C;  3E1S A;  4M7A A;  2RJF A;  2KSS A;  3HPW A;  4OGE A;  3CME A;  4J6Y A;  1OZ2 A;  1HXD A;  4KBM B;  4XU1 A;  3V7R A;  3JCM g;  4RMO A;  4JX6 A;  2BS4 A;  1YJN A;  2HQE A;  1K8A U;  2YHT A;  4JRK A;  2V8K A;  5HY6 A;  4N4G A;  2QDY B;  2CZ7 B;  3VYG A;  4BI4 A;  3O8V A;  2DTO A;  4F7U G;  3PIO A;  4LOC A;  2QA4 T;  2BUD A;  2RK2 A;  4RCB A;  2OTL T;  2FL7 A;  1U1S A;  4E47 A;  4M7D C;  3HL8 A;  4EPC A;  1VQO T;  3BG5 A;  4AKG A;  2XU8 A;  4DQ2 A;  3CCJ T;  1VQ6 T;  2RHI A;  3QYB A;  4C8Q F;  5GAN 8;  4BD3 A;  4B9X A;  2MWO A;  5LJ3 h;  3SB2 A;  3BG9 A;  4C0F A;  3RMS A;  3QZ5 B;  2FVU A;  2RH2 A;  5LJ3 f;  1JJ2 S;  1AHJ B;  2JOY A;  2DPP B;  3OB9 A;  1YBY A;  4FT2 A;  4C8Q G;  2QA4 A;  5FRO A;  1X01 A;  1UGS B;  3RKX A;  3X26 B;  3G6E A;  1K73 C;  3DB3 A;  3M56 A;  1NPR A;  4KUD K;  3PIP A;  1KHC A;  3PNW C;  5GAO p;  3CD6 A;  1M1G A;  3OYE A;  2DK3 A;  3E9G A;  3CCS A;  4M7A D;  3UT1 A;  1VQ7 A;  2O4X A;  4L5G A;  1VQK T;  4M78 E;  2BKD N;  4N4I A;  4OB0 B;  4NOY A;  4IUT A;  5KCH A;  4JUV A;  1FWZ A;  4LD6 A;  1VQ6 A;  3HB9 A;  5CQY A;  4F7U A;  1M1K U;  2YLC A;  1ZQ1 A;  2F5T X;  5FLX E;  5FU6 C;  2K2V A;  3CPW A;  2XK0 A;  4RG2 A;  4J6X A;  3RMQ A;  2ZZD B;  4RKU E;  1BI0 A;  3MHX A;  1Q82 C;  2PVD B;  3RUX A;  4M77 D;  3OYL A;  3MEV A;  4RCC A;  5A0G A;  3JCM J;  4E7L A;  4P5N A;  1VQN A;  4M78 F;  2LDM A;  3S6W A;  4F7U B;  1SSF A;  1LOJ A;  4QVC A;  3CD6 T;  4X9D A;  2RI3 A;  4HCB A;  5KCO A;  2AHJ B;  2G77 A;  4XU0 A;  3RES A;  3TRE A;  3CCS T;  5HKC A;  2F69 A;  1UGP B;  3TW6 A;  2DIG A;  1I4K 1;  3R6O A;  4HNV A;  3JCM W;  4XTY A;  3QWL A;  5GAN 2;  1ZHI A;  2RHY A;  3OSV A;  3PTA A;  3GNG A;  2LRQ A;  3QJ6 A;  3CCV T;  3EFR A;  2P4T A;  3L2U A;  4XTV A;  5CIU A;  4M7A E;  2L89 A;  1KQ1 A;  2FB7 A;  3KXT A;  2DIQ A;  5IN1 A;  5CKH A;  1IZ6 A;  3S3N A;  2DJZ A;  3PT9 A;  3OBW A;  3CCL A;  2DZ9 A;  3HRU A;  4C92 D;  4QQD A;  1QP2 A;  4MIM A;  2K5L A;  2RO0 A;  3EAE A;  3E19 A;  4NL2 A;  4HCC A;  3E9F A;  5I21 A;  2RK1 A;  2BS2 A;  1NJI U;  1N8R U;  1PSF A;  5GAO l;  3OYI A;  2L8D A;  2JNG A;  5GAM g;  4MMK A;  4BI8 B;  3G6E T;  2RJD A;  4QQ6 A;  4A53 A;  4E7H A;  4PJO D;  3SFM A;  1VQ5 T;  4ELJ A;  3MCA B;  4EMG A;  4JX4 A;  2E6Z A;  2DXB B;  3T9N A;  3JCM d;  3QDR B;  5I2S A;  4M7D G;  2RHX A;  2L3R A;  2JZ2 A;  2K5F A;  3H8Z A;  4FM4 B;  1D3B B;  3L2Q A;  4OB1 B;  2HBP A;  1M4Z A;  1TH7 A;  5GMK h;  5M9O A;  4BDY A;  3OS1 A;  4PKC C;  4XQ3 A;  3NTK A;  2K57 A;  3JCM V;  2EAY A;  4DOW A;  5LJ3 d;  4JDS A;  3GF5 A;  3CCM T;  3GIB A;  1W2B A;  3OBY A;  4ME7 A;  2QQS A;  4M7A B;  3JB9 H;  2OAU A;  5DY9 A;  5LJ3 j;  1VQ4 A;  2K5I A;  4C5G A;  3FLG A;  3M55 A;  1M90 C;  3X25 B;  1JRI A;  2Y4X A;  1M9S A;  1Q7Y U;  2WAC A;  2NLU A;  3CPF A;  4DOV A;  5J39 A;  2X4Y A;  2RB6 A;  4PJO E;  2A7Y A;  5GMK j;  2E10 A;  3X24 B;  1Y96 B;  1O9S A;  2B8A A;  3HKS A;  4JRQ A;  2E1H A;  2XDD A;  2EKO A;  4M78 D;  3G71 T;  1G3W A;  3CC7 A;  3C12 A;  3M53 A;  3PMT A;  3QHS A;  5GAN 7;  2VUB A;  3WVD B;  3CCU A;  1FKM A;  2LT4 A;  3QO3 A;  4OGC A;  5FRM A;  3VKI A;  2HD0 A;  3OW2 A;  1WGS A;  4JLI A;  4MZP A;  4ATO A;  2QDJ A;  4C8Q D;  3VV0 A;  3ME9 A;  1XNI A;  1VQ9 A;  5CK9 A;  1VQL A;  3OYG A;  4M75 A;  3CBP A;  4QVZ A;  1VIE A;  4WF2 A;  2C06 A;  4Q5W A;  1JJ2 A;  4F7U F;  5GAN g;  4XTX A;  4EMK A;  4A4E A;  3QKJ A;  2KVQ G;  4M77 E;  3DLM A;  3JRZ A;  3CC2 T;  2E12 A;  2ZPF B;  3VYG B;  1WJR A;  4BY6 C;  2DXC B;  3QYG B;  2Y4Y A;  3HP9 A;  4MFD A;  5I2M A;  4JLG A;  5CCA A;  3I55 T;  2DXT A;  1VQL T;  2ZCF B;  3OS2 A;  1PSE A;  3CCE A;  2KAF A;  2D9T A;  4LD9 K;  2XDP A;  3M59 A;  4M7D B;  4HNT A;  1R8O B;  2LCC A;  3F70 A;  3MEA A;  4IUV A;  3JCM c;  4ZN3 A;  3C94 A;  3N5B B;  1I81 A;  4VUB A;  5D6X A;  3S3M A;  1BI1 A;  2DTH A;  3FEO A;  2CYZ B;  4C92 G;  2RD1 A;  4M78 B;  3TCJ A;  3SWN A;  2BS3 A;  4BB7 A;  4O6J A;  4HNU A;  5CQX A;  1Y71 A;  3CCR T;  2DXB A;  1W2B S;  4IUU A;  5IT9 E;  3QPH A;  1LNX A;  1QVP A;  3OYD A;  3V8K A;  3CXC A;  1S72 A;  2KR6 A;  2IG0 A;  1YIJ T;  3MEW A;  1KQ2 A;  1OYX A;  1JBM A;  2CGH A;  2EQK A;  2XID A;  5CKF A;  5LJ5 f;  4HT8 A;  2G3R A;  1GXI E;  3V8J A;  3ZFJ A;  3GLX A;  3SWN C;  2XHC A;  2JN0 A;  4JRI A;  1W4S A;  4XU3 A;  2LTO A;  1VQ8 T;  2KMT A;  2PQW A;  2LC4 A;  1E7P A;  3DB4 A;  4HT9 A;  2MI6 A;  2ZPG B;  1N6A A;  1Q81 U;  2KDS A;  4BE0 A;  3M9Q A;  2R58 A;  2VGN A;  4HA8 A;  4XAX B;  2ZPE B;  1K9M U;  1G5V A;  5GAN h;  3HRT A;  3MP6 A;  4OB2 B;  5DLO A;  1YI2 T;  3KUF A;  4LDX A;  1XOV A;  4V2S A;  4PL6 A;  3CMA A;  5EJC A;  3MEU A;  1DJ7 B;  2KMG A;  2H3J A;  4ZGJ B;  2QFZ A;  1YIJ A;  3QSU A;  5C0M A;  4IKF A;  3P8B B;  3M4Y A;  2DAQ A;  5GAM j;  3OMG A;  3BW1 A;  3WVE B;  3M54 A;  4N0A A;  1IRE B;  1M5Q 1;  4IUR A;  3CCR A;  3TU4 K;  4PJO C;  2RJC A;  1K8A C;  5KE2 A;  3KHI A;  3CMA T;  2RI5 A;  2RJE A;  4A4G A;  3A8O B;  4KUI A;  1QVF A;  4M78 A;  1H3Z A;  3DL1 A;  3CCQ T;  2R5M A;  3G71 A;  1WQW A;  3CCV A;  3P8H A;  3V8L A;  4ZN1 A;  3OYJ A;  4C92 C;  1B34 A;  1Q81 C;  3SD4 A;  5GAO q;  4PLI A;  4XTZ A;  4C0Z A;  4M7A F;  3INZ A;  2RHZ A;  5CVI A;  3RIR A;  3M57 A;  4JRP A;  2WSC E;  2QQ9 A;  4R55 A;  3CXC S;  5FU7 C;  1NE8 A;  3S3O A;  3JB9 J;  3DKM A;  4L6V 5;  3FRN A;  2XDB A;  3JB9 I;  3PGG A;  3X28 B;  1B34 B;  1VQM T;  2LCL A;  1LJO A;  2LVM A;  2VC8 A;  4MDW A;  5GMK i;  5GAN f;  3JB9 D;  3BDL A;  5CAI A;  3G4S T;  3JCM e;  2M1H A;  1WJQ A;  4KUL A;  3QYH B;  4XU2 A;  3G7Z A;  4M77 C;  4C5E A;  1M1F A;  5IAY A;  2FHD A;  2RM4 A;  2R5A A;  3NTH A;  1OZ3 A;  4TVR A;  3MO8 A;  4UC4 A;  3CC7 T;  4M7D F;  2M16 A;  3V7S A;  1H64 1;  4Y28 E;  4C0G A;  2ZPH B;  2FYK A;  4LDW A;  1KQS S;  1VQK A;  1VQ4 T;  2GF7 A;  4PJO B;  4PJO A;  2LQ8 A;  1FXX A;  1X75 C;  2VGM A;  1VQN T;  2XD0 A;  1RI0 A;  1Q82 U;  4O5V A;  5GAN j;  5GMK l;  2P0P A;  4BBS M;  3QII A;  4C92 F;  3JCM h;  4M7A C;  3CC2 A;  2E6N A;  2WSE E;  3MET A;  1ZBX A;  5A0L A;  3GNF B;  2V8J A;  3OYN A;  2VXF A;  3CCL T;  2X35 A;  5LJ5 g;  4HCZ A;  1KC8 C;  1I5L A;  5GAO n;  1I8F A;  2RI2 A;  3RKW A;  1QLB A;  2DD4 B;  3CCJ A;  4C8Q E;  1VQ5 A;  2JVV A;  2PVG B;  1P92 A;  2L5Q A;  5CKE A;  2KY9 A;  2EYQ A;  2LT1 A;  2ZGW A;  3QYE A;  3NTI A;  1G3S A;  3H4C A;  4L59 A;  4OF1 A;  4JS5 A;  3ZBD A;  5CO7 A;  3JCM Q;  4D6W A;  2I2L A;  4F7U E;  4J5Y A;  4CRI A;  5GAM d;  1BIA A;  4C8Q C;  2QQR A;  5D6W A;  4FT4 A;  2E65 A;  2ZZD A;  4R56 A;  4NL3 A;  2EJG A;  2QF7 A;  2LX9 A;  4DA4 A;  3LWH A;  2VV5 A;  1MGQ A;  1WQ7 A;  4M78 C;  3CCM A;  3GPL A;  5GAN 3;  5L8R E;  2F5K A;  1K73 U;  2DO3 A;  5HK0 A;  3URG A;  2KK4 A;  3I56 A;  4M7D E;  4HLQ A;  4BAC A;  1XQH A;  4JS4 A;  5FRN A;  3A8H B;  3OYY A;  5GAN e;  3UPU A;  2DD4 A;  2DZC A;  3PMI A;  4ZTF A;  3GOX A;  4ZTJ A;  1YJN T;  4C5H A;  3JAM E;  1WNL A;  3JSC A;  2E41 A;  5LJ3 g;  2ZPB B;  3QG1 A;  1VIF A;  3A8M B;  2QQB A;  4N4H A;  3OA6 A;  2GCX A;  1YHQ T;  1K9M C;  4C0D C;  1N9R A;  2XI9 A;  1RL2 A;  5HK3 A;  4M77 A;  3LWI A;  4E7J A;  1NJI C;  5GAN 4;  1HK9 A;  2CS7 A;  4JJN K;  2HAX A;  2JUF A;  5C6S A;  1QVG S;  3Q1J A;  1UEB A;  4ELZ C;  3I56 T;  3VYH B;  4M6V A;  1NZ9 A;  1WPY A;  2R57 A;  4QQG A;  5KH6 A;  3L2V A;  1VQP T;  4C5I A;  3FC3 A;  3RKY A;  2QQA A;  1Y07 A;  2EQM A;  2DTI A;  3OYF A;  5LJ5 h;  4M75 G;  2EJF A;  3V7C A;  3OSS C;  3VKH A;  4BBR M;  5A0D A;  1VQO A;  3FDR A;  1BI2 A;  2BIV A;  5GAN 5;  2DEQ A;  3WXM B;  1KD1 U;  2D0Q B;  4CI0 C;  2QTX A;  2OTJ A;  2CKK A;  4NC6 A;  3BY7 A;  5GAN 6;  1NPP A;  1YHQ A;  4M78 G;  3CEY A;  4GLK A;  3VUZ A;  5GMK m;  3OY9 A;  2DD5 A;  4M77 G;  5GAO m;  3JCM X;  3J7A F;  3HHT B;  4M75 C;  4J8O A;  1M1K C;  1KG1 A;  3M5A A;  2X4W A;  3P8D A;  2WSF E;  4MZM A;  3CBM A;  3A8G B;  4EMK C;  4II1 A;  4Y91 A;  1YJ9 A;  3AHU A;  4ZGE B;  4MML A;  5DM7 R;  4Z02 A;  1YIT T;  3FJP A;  3A8L B;  3X20 B;  2RA2 A;  4C92 A;  4MFE A;  4EMH A;  3GP8 A;  2GFU A;  4LDY A;  3SDZ A;  5LJ5 e;  1VQ8 A;  3L2W A;  1MHN A;  1QP3 A;  3FIF A;  2XG8 D;  5LJ5 d;  1KHI A;  3BFM A;  1VQM A;  4BE1 A;  2VXE A;  3JCM f;  4M77 B;  4A54 A;  3EFS A;  3QJY A;  3L42 A;  1X6O A;  3H6Z A;  5GAM f;  3LW5 E;  4M7D A;  2MF2 A;  3LH0 A;  4LDU A;  3NFC A;  2PUK B;  4QW2 A;  2XIC A;  3JCM b;  5GAM h;  4E7K A;  2DXU A;  3OW2 S;  4Z6Y A;  5D6Y A;  2YRV A;  4EDU A;  3QZ9 B;  1G3Y A;  1QVG A;  3VUB A;  5GAO r;  4PJO G;  4ELY C;  2GQV A;  3QBY A;  4FL6 A;  4FU6 A;  5LJ3 e;  1UGR B;  1V29 B;  2M0O A;  2X4J A;  3HSB A;  2P0K A;  4M75 F;  2EJ9 A;  4QSH A;  2JTF A;  3VJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...