2ZPEB

Nitrosylated fe-type nitrile hydratase with tert-butylisonitrile
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpeB02
4Y28E 2DD4B 1DJ7B 4FM4B 3X20B 2PUKB 4KT0E 3QXEB 1UGSB 3QZ9B 3WVDB 4RKUE 4OB1B 2PUOB 2CZ7B 3X24B 3X28B 3VYHB 3HHTB 1UGPB 2ZPIB 2D0QB 4L6V5 2ZCFB 2ZPGB 3A8MB 3A8HB 4ZGEB 2WSEE 1V29B 3X26B 1AHJB 1PSFA 3A8GB 4ZGJB 2PU9B 1JB0E 4OB2B 5L8RE 2WSCE 1IREB 2CZ0B 2ZPFB 3QZ5B 1QP3A 2PVGB 1PSEA 2PVOB 2ZPBB 3X25B 3QYHB 3A8OB 1GXIE 4OB3B 2ZPEB 2DXCA 3WVEB 2CZ6B 2ZZDA 3A8LB 2DXBA 1UGQB 3LW5E 1QP2A 4ZGDB 2DXCB 2CYZB 2AHJB 2CZ1B 2QDYB 2DXBB 2ZZDB 2PVDB 1UGRB 3VYGA 4XK8E 2DPPB 4OB0B 2WSFE 2O01E 2DD5A 3QYGB 3VYGB 2ZPHB 2DD4A 2DD5B
chains in the Genus database with same CATH superfamily
2HQEA 3MKDA 2WMAB 3CC4T 1TS9A 1DJ7B 1CKAA 3GPLA 1OU9A 3E9GA 4J7IA 3I55Q 4M7DC 1D0XA 4KT0E 1FKMA 4AT1B 3JCMh 1PHTA 1NG2A 2XHCA 2K2VA 2COZA 1UJ0A 1NEGA 2QYZA 4F17A 2EGAA 2DVEA 1TUCA 4JRPA 2OAUA 2O31A 1OGUB 5IT9E 4BCHB 3PNWC 5GAN3 2LNHB 2HCKA 5GAN5 1SKUB 4BI8B 3LH0A 4EOPB 4C0ZA 3OY9A 2WXVB 2M02A 1NPRA 2WACA 2EQKA 3FDRA 1E7PA 4DEXA 4OMLA 1M8VA 1I07A 1U8RA 1AZEA 2QEXT 1X01A 1H27B 3L2ZA 5HK0A 3FJPA 2Z0WA 4C8QB 2CZ0B 1QQJA 3JB9D 4HCZA 3JCMW 4C5EA 1M5Q1 4BE1A 2EQUA 2DBMA 1WYXA 2PVGB 2FPEA 5GAOq 3QPHA 3M9QA 1XJWB 4F6UB 1VQ5A 2BE7D 2WIPB 5J3BA 5LJ3g 3CCJT 1X43A 1Y96A 4M78D 4B6MA 1WQWA 2QF7A 1T3SA 3RESA 4BCNB 4BCMB 5D6WA 2KK4A 1NJIR 4AKIA 3A8OB 2GCXA 4EOLB 4EMHA 5EG2A 3S3MA 1X6GA 4PJOC 4LDVA 3M55A 4YTLA 4IUPA 4BCOB 2L2PA 4HA8A 3VUBA 5DQWA 1OX9A 2B8AA 3MEWA 4PJOG 2HNIA 4IUQA 4C0DC 3BHTB 4E7KA 3CCET 3LWHA 1QW1A 4M6VA 2C5OB 2GQVA 3NMZC 4FW1A 5CAIA 2DPPB 4OB0B 3ZFJA 2F2XA 1YIJQ 3TU4K 1ZUKA 2K5FA 3UT1A 4M7AA 4C92A 4NS5A 2JS0A 1JXMA 2DD5B 5GAN8 2D8HA 2D6FA 5DLOA 4IMYB 2CH4A 4PKCC 3GOXA 1QCNA 2RQRA 4FM4B 1X27A 3OA6A 1K9MU 2VB6A 5KYWB 2AIRB 2DILA 1NJIU 3QJ6A 3G71A 4DQ2A 2DLPA 1G5VA 1RAGB 4XU2A 2E3HA 2KAFA 5GMKj 3INZA 2HL3A 2KRNA 1WLPB 1VQLQ 4J9FA 2CZ7B 3QJYA 2V26A 4WF2A 5KYUA 4FSSA 5IF1B 2ESWA 2NUTB 2A37A 3JCMV 2C5NB 1K9MC 1SPKA 1ZBJA 4EOQB 1MV3A 2FYKA 5GANd 1FXXA 3J7AF 3KHIA 2D0QB 1U1SA 1NJIC 3POMA 1H92A 2CREA 4F7NB 1KXUA 1VYUA 2V8JA 3SHWA 1VQ8T 3HFNA 2RMOA 4M7DB 2W9ZA 2E10A 1X6OA 1D0YA 5L23A 4PJOD 1AWXA 3VS7A 1XOVA 1NYFA 3MP6A 1M1KR 2OTLA 2C6TB 2HQHA 4EMGA 4R56A 2NUZA 5CEIB 4J9IA 2AK5A 2JTFA 2KI7A 4RUGA 4M75C 4LE9A 1VOMA 4M77C 1NBEB 2HL5C 4N4IA 4RTYA 1PSEA 2PVOB 4F7UB 1I1JA 3EGUA 4QQDA 3V8KA 4OR5B 1RAAB 1WI7A 3SFMA 2MAMA 1U06A 3QYHB 1NYGA 4D6WA 5LJ5f 2BKDN 2W2HA 1NM7A 4MDXA 5D6YA 3RKXA 3I56A 2IPOB 2VGNA 1AISB 5M9OA 1YI2A 4NSTB 4M78E 3E1SA 2ZZDB 4CFUD 1JQQA 2QA4T 1UGRB 4QSHA 1QLBA 1I8FA 3NTKA 1YITT 2EAYA 2DXTA 1N8RR 2OTLQ 1V1CA 2K57A 1N4MA 3MEUA 2A0FB 3CPWA 2OJ2A 4EC9B 3J81E 1AEYA 2MI6A 1PCXA 2DD4B 2K6DA 3JAME 4ELYC 2K3BA 3UPUA 3UF4A 2V8KA 2CDTA 4I3ZB 5FU7B 3I56Q 2J6FA 1R0CB 2MMPA 1K8AR 3R6OA 1C0MA 1PG5B 2OX7A 1CSKA 3GIBA 3MP1A 1SRLA 4M75D 1RLPC 4AG2C 4PJLA 5CKBA 4Y92A 3ER0A 2FRWA 4BE0A 1YN8A 1B07A 1BYMA 2YUQA 2IIMA 3V8JA 3E2UA 1JXOA 1JOWA 4M7AG 1N27A 1TH7A 1ZHIA 2YHTA 3EH1A 2RHUA 1I5LA 4XTUA 2HKNA 1GBRA 3J80E 3QHRB 3CCLA 2RB6A 2FPDA 1N8RC 4F7LB 1M2VB 2P0QA 1X75C 1NLOC 3TVTA 3RIRA 4HXJA 1ZSZC 2XU8A 4PJOE 1QLYA 1WJRA 2AZSA 1G3YA 3FJ5A 1LCKA 2OI3A 1MHNA 1PD0A 1LVKA 2X4JA 1QVGS 1UNLD 3M53A 1P5EB 5A0DA 2MK5A 4BDYA 4M77B 4QQ6A 3JCMf 2CZ1B 2M0OA 1T0HA 4LDUA 3JCMe 2VWFA 2RA2A 3CCLQ 1OL1B 2LT1A 2ED1A 3MEVA 4CFMB 2QGGA 2R5MA 1IGUA 1RI9A 3I5RA 2VGMA 2A08A 1VQ5T 2G6FX 3HRSA 2CSQA 1W2BA 3OSSC 2VKNA 1UGSB 3LGFA 3DTOA 3QZ9B 1KC8R 4EC8B 2F2VA 2E6NA 2FRYA 5J39A 1GY3B 2DA9A 1KHCA 4C0GA 2PK2A 1KFZA 1BKBA 4NOYA 1BU2A 3OMGA 2E5QA 3FEOA 2YUNA 2OTJT 3DB4A 2MF2A 4ELJA 1E9HB 2X35A 1YFNA 4B9WA 3S3NA 1BCMA 1PM3A 4HCKA 3DDQB 1B3QA 2IVWA 1AHJB 3EG2A 2Y4XA 1MMGA 3HTRA 2GQIA 4M75E 2EWNA 2FO0A 1Z9ZA 1E6HA 5AYFA 1TSFA 5KCHA 1LOJA 5HBHB 3CBPA 4QVCA 3UATA 2IW8B 1X2QA 1KC8U 1AWWA 2QGSA 3TREA 3G71T 3EIDB 2E1HA 3OBWA 2DKGA 3OBYA 1IHVA 3PMIA 1VQ6T 2COWA 5KE3A 1D3BA 1O9KB 4UN0A 1VYTA 2BKZB 2DXCA 3HRUA 2IVXA 4R0KA 1M3CA 1KC8C 1VQ7A 4ZGDB 2PZ1A 1H1QB 5GANj 2HD0A 4BI3A 1PNJA 1IGQA 1WFWA 1JJ2A 5HVYB 1K1ZA 2C0OA 1OEBA 1ZX6A 4WTOB 2DK3A 1B34A 2OTLT 3F5XB 3LX7A 1M90R 3QYGB 5LJ5d 4V2SA 3OYLA 2AKLA 3G4SA 3AHUA 1KQ2A 4A4EA 4M7DA 3CCSA 1GUXA 1YJNQ 4XTYA 2WHBB 4D8DA 1WHMA 5LJ3f 1U1TA 1RI0A 2P84A 1JU5C 3CCQT 3QUIA 1P92A 4CRIA 3R6NA 3I56T 2YRDA 2FZCB 3OS5A 4OP0A 3VKHA 4N4HA 2O4XA 4F7UA 4QKUA 4II1A 4OF1A 1YI2T 4BCQD 3OW2P 4J5YA 5IXBA 3DOGB 4L6V5 1QWFA 2F69A 3JB9J 2EJFA 4ELLA 2Y90A 4XU3A 4BCFB 2ZAEA 4FYYB 3M0SA 4CRLB 9ATCB 1VQMA 3UA6A 4F7SB 2E12A 1M90U 3OYFA 1BIBA 4HKEA 4JX4A 4BCGB 1URCB 2O9VA 2CT4A 1V76A 3CCSQ 1R77A 2P0KA 5KCOA 2QFZA 2MCNA 4F04B 5GMKl 3OS0A 3PVQA 4C8QG 2BZYA 3D7SB 1XO2A 1KHIA 3V7CA 1IB8A 3MI9B 1M90C 4EORB 4JRQA 1UDLA 3M0RA 3DLMA 4HVWA 4PJOA 2QQSA 4JUVA 1D09B 1X69A 1RAIB 2E5KA 2RN8A 4OB3B 1K0XA 1WHHA 2CP6A 2KRSA 2IG0A 3VS6A 2EYXA 3A8LB 5GAOl 2YDLA 4J9EA 1GRIA 1XQHA 2IN3A 3CCVQ 2A7YA 3VRYA 1Y7XA 3OQ5A 2LX9A 1PKTA 2LJ3A 3VYGA 5IN1A 2LQKA 1I4K1 4FT2A 5GAMj 2EYQA 5DM7R 1HD3A 4A4GA 1HXDA 4RTTA 3OYJA 2H3EB 4E7HA 3VKIA 3M56A 1ZA2B 5FRMA 3CC2Q 3CD6Q 1UNHD 5HQ0B 4L59A 2L3PA 3OYYA 3JCMd 1MNEA 2QQBA 3GF5A 4C8QD 1N9SA 1KQSP 4MMKA 2L8DA 2I40B 3T9NA 1SF9A 3FB9A 4RTWA 2D1XA 4KBMB 3VYHB 2IW6B 1KK7A 5FU6B 2CP3A 2JT4A 5HCKA 3UDCA 2C0IA 2DAQA 1GCQC 1H8KA 2ECZA 4KH0B 4BCND 4BCMD 2MPXC 1MMNA 1K0SA 2WSEE 2JGZB 1KD1R 2UUEB 2UZEB 3MP8A 1ACMB 2QQ8A 4M7DG 1X6BA 4M75A 3JB9F 3O5ZA 3KUFA 4M77A 3UA7A 1YCSB 1JSTB 2M1HA 3KXTA 1H28B 5GAOp 2NWMA 1M1GA 3M0PA 2X51A 2X3XD 3GLXA 4M78F 3CQTA 4HLQA 4BXXX 4WCIA 2W9FA 4J83A 3SWNB 3G6EA 4J7FA 2ABLA 3M54A 4F7UG 2WEVB 1TG0A 5D6XA 4LXCA 4HT9A 2F5KA 3EGXB 4XTWA 2G77A 4Y91A 2LDMA 4ME7A 1YJ9A 3VRZA 3ZBDA 4ROEA 1YIJA 2JXBA 2CP5A 5FWBA 4CC7A 2CYZB 2LJ0A 1YCYA 1G3TA 2I0NA 2QAZA 1BI1A 4AG1C 2GF7A 4JS5A 1KD1U 2WFYB 2W96A 5ICPB 4MIMA 2EYZA 1K9MR 3CMAT 2P0PA 2O01E 4EMKB 3EAEA 4X1VA 2YSQA 1H1SB 2LT4A 2R7GA 4HT8A 4ROCA 3QBYA 1VQLA 1O9SA 3ASKA 2JMCA 2E41A 3G6EQ 1KD1C 2RJEA 3A5ZB 4M7DD 5GAN6 1ZBXA 2RK1A 3CCUQ 2CT3A 2JUFA 2FZKB 2F2WA 5FU7C 4RKUE 1M3AA 1Q81R 1FX7A 1MNDA 1YJ9Q 3OYIA 2QG9B 4DOVA 2DIQA 2NUPA 2VV5A 5GANg 3EHQA 5KE2A 3C95A 5DQVA 3HHTB 1VQ7T 2AKKA 3URGA 1HJDA 2XG8D 2QDJA 3WXMB 1WDXA 4A4FA 1Q82R 1PKSA 4M4ZA 4C8QE 1T0JA 4XTXA 1AWOA 1UB4A 4PJOF 5CVIA 5LJ3d 1EFNA 2LQNA 3C0CA 3JCMc 1VQ9Q 3G4ST 2WSCE 2A3LA 5LJ5j 4PLIA 3PT9A 5CYIB 2QASA 2RD1A 3CCST 4N0AC 1ZSZA 2QQRA 3EFRA 2DERA 3PE0A 1XNIA 3HRTA 3M0QA 2FL7A 2CUBA 5KYYB 1Q81U 1W4SA 3M58A 4FW2A 4JX6A 2YRCA 2DZ9A 1BK2A 4F6WB 1GXIE 1WGSA 2KVQG 4TTHA 2RI2A 4MZPA 2GBQA 4XTZA 1HSQA 2X4XA 1Q95G 2L3RA 2RQVA 2FEIA 1MV0B 4LDXA 1TUGB 3H0IA 1QP2A 4A63B 1Q82U 4LDYA 1Q81C 2K5IA 2QDYB 1BU1A 4PFOA 1UHCA 2GTOA 2VVKA 4M75G 2DX1A 4M77G 1VQMT 8ATCB 2K4YA 3SB2A 3VJPA 1SEMA 3QDRB 1VQNQ 3OYGA 2KQWA 1BIAA 1RAFB 5HNBB 3RR6A 1W6XA 2JTMA 1S72Q 3KBGA 2K7AA 2DMEA 3LLRA 2K79A 1Q82C 3JRZA 4EOIB 2MWOA 1R8OB 1QWEA 3EFOB 5GANh 5I21A 5CKEA 1UEBA 4ATOA 2PK9B 2RHXA 3M57A 4LOCA 3BG3A 1YHQQ 3JB9I 1E7OA 4JJCA 4E7JA 3OW2S 3TNIB 3TNWB 2KDSA 2OAWA 4EDUA 1RADB 2LW4A 5ACBA 1NLPC 1AZGB 3H9NA 4M7DE 3TCJA 1G3NC 2JM8A 2GNCA 1N6AA 5GAMg 1LJOA 5CKDA 3PFSA 3I55T 4Z6YA 2FVUA 2EVRA 2ENMA 3RBBB 3A8GB 2BIVA 2HAXA 3TW6A 1YNZA 3EFSA 4F7UE 4OMQA 2FHDA 3JCMb 3EOCB 4M77D 3BE3A 3GTMS 2QGFB 3LWIA 4DBFA 1ZUUA 3HKSA 1FINB 5IHNA 1QVFA 2PMIB 3VS3A 3VS1A 3LYIA 1MUZA 4IKFA 2K3XA 5CO7A 1E6GA 4LDWA 4L5GA 3CXCS 4KRCB 4JZ4A 5L2WB 4DBQA 1M30A 2F1LA 4YOZA 3CC7Q 3H6ZA 4MMLA 2DXBA 1WXUA 4GLKA 1RAEB 4J9BA 4G6LB 2YUPA 1ZQ1A 3L2UA 5HBEB 1OZ2A 3CCRQ 5EFQB 2EUFA 3GBQA 5A0GA 4ZTFA 3G7ZA 2LC4A 4OGRB 3BG9A 5IHKA 1M27C 3CPFA 4M7AF 1UECA 3H0FA 2HZYA 1NPPA 3QKJA 4C92F 7AT1B 1WIEA 5LL6S 3QYEA 4P5NA 4C0FA 4BY1X 5BNJB 3ZEHA 1KQSS 2NYSA 1LPLA 3G6ET 2K9GA 1OI1A 1EZZB 2LRQA 2PUKB 2BZXA 5FWCA 2RHYA 4NL3A 2KEAA 4JLIA 5GAMh 2RH2A 3HPWA 2HDAA 2EYYA 2C4GB 2DJZA 2J06A 1PC0A 2DIGA 2QQ9A 4X9CA 5KYNA 1Y57A 4IUTA 1YJ9T 2UZLB 2M16A 5LQFB 1OL2B 4EOKB 1YIJT 2XDDA 5HKCA 1UFFA 3META 3TSZA 2QI2A 3CCMQ 4C5IA 3PVLA 2LX7A 4GBQA 2GGRA 2ZCFB 3EG3A 2CJMB 1NEBA 2DFUA 2WMBB 4C8QA 1JSUB 1SHGA 2DO3A 2CH4W 2RM4A 3EGXA 2DMOA 4Z8AA 5DLQE 1GBQA 1VYVA 1K4US 4BE2A 4OMMA 2DVJA 1VQLT 4HCCA 2JN0A 2GFUA 4VUBA 1QP3A 3QWXX 3CPWP 1JEGA 1LNXA 2RI3A 4LUDA 1OV3A 4KH1B 2VUBA 3ZL7C 1W98B 4EPCA 2IW9B 1UGVA 2LNVA 5GJWB 5HK3A 1OX8A 1Y96B 1BI0A 2V8IA 1SSFA 2LZ6B 2YUOA 1PRLC 2G9XB 3OYDA 4FX3B 4M77E 2BE9B 1RABB 3L42A 1M4ZA 3FLGA 1QCOA 3P8HA 3S6WA 1OKWB 2LCLA 1WQ7A 2AHJB 1H26B 2M9UA 1QVFP 1OIUB 1JRIA 3H4CA 1VQKA 1YJNA 4YOOA 5LJ3j 2DD5A 1UG1A 1MMAA 1I0CA 4RODA 2DL5A 2X1NB 1IHWA 1WXTA 3NGPA 4M7AB 1QVPA 5KYWA 2EKOA 4C92B 1VIFA 5FROA 3JSCA 4JRIA 2JOYA 2KXDA 3Q1JA 3DDPB 4BI4A 1FVVB 4BCPB 2X9HA 3QWLA 5CKFA 2NUTA 3BLRB 3NHNA 1ENWA 5FU6C 2DTHA 4DBHA 3EG9B 1GCQA 3V7RA 5GAN7 5KYYA 3U23A 4ZTJA 3CCJQ 1C1AA 4UC4A 5I11A 1VQKQ 2DL8A 2A36A 5KYUB 1EX4A 4FSXA 2ZPGB 3S3OA 2BS3A 2LCCA 4PJMA 2YT6A 1M3BA 4J8OA 4XAXB 1GH6B 2DTIA 2QTXA 3M0TA 5KH6A 1TFBA 5GAN4 4EONB 1SSHA 1ZA1B 2XIDA 5HY6A 2UZDB 3K7AM 1Q86U 1M2OA 3EG1A 3SWNC 3JCMQ 1HK9A 3FC3A 4JDSA 2BUDA 3QHSA 4PJNA 5FLXE 3CCVA 5GAOn 1W2BP 5GMKh 1ZP2A 4LN2A 4A4KA 5LJ5h 4KGXB 2FPFA 5GANf 1JBMA 3EHRA 1PKDB 4AKHA 1SG5A 2ZZDA 1UGQB 1Q86C 3M03A 2JNGA 2EBPA 4HNUA 2ROLA 3CMEA 3REAB 2E3IA 4BCIB 4ZN3A 2V1RA 5GANe 2RHZA 2K2MA 2X3WD 3PMTA 3CC2A 3CD6A 5FRNA 1IXDA 1TUDA 2AZVA 1NE8A 4Z02A 1OPLA 5I5ZB 3BLQB 2RF0A 4KULA 3LGLA 1VQ4A 1OYXA 3BY7A 3DB3A 1ABQA 4EMKC 1JKWA 2I2LA 1OZ3A 2DD4A 2L0AA 3MEAA 3P8DA 4PNOA 1RAHB 4HNVA 1MMDA 1WHJA 3TSWA 1VQ8Q 1PD1A 4JZ3A 2CSIA 4J9DA 2QA4A 3JCMX 2LMJA 2PQWA 4C8QF 3A98A 1WNLA 4RCBA 3VUZA 2X4YA 4IIMA 3RMSA 1I5OB 1UUEA 2EYWA 4FYXB 4C5GA 2KGTA 3BG5A 3HP9A 2KXCA 4ORZA 3GP8A 5IH2A 4YC3B 4GY5A 3FIFA 3CMEQ 1NZ9A 1UE9A 4LD9K 3OMCA 1UNGD 2KT1A 2VXFA 3CCLT 1EIFA 1UGPB 4BD3A 2HQXA 3HL8A 1QKWA 3A8MB 4BCJB 1T3LA 4OGCA 1SHFA 1VQ4Q 3OYEA 4QW2A 4J9HA 2RHIA 1KG1A 4JS4A 4E47A 1H1PB 2CGHA 3X26B 1HYOA 3M4GA 4FIBA 1VOLA 1JJ2P 3EG0A 3MIAB 2DZCA 1M2VA 3E9FA 1GFCA 3M5AA 1UHFA 4N0AA 5C6SA 3HB9A 2QA4Q 2KROA 3NTHA 3BHUB 4YOSA 4NL2A 1YITQ 4X34A 1OPKA 3M4YA 1WHGA 2H8HA 1W1FA 2CS7A 3MO8A 2HBWA 4M78C 4ELZC 2CP0A 4CXAB 2KR6A 4HNTA 1K76A 3DLLA 1G8XA 3VKGA 2V1QA 2EGCA 4QQGA 1WA7A 2CZ6B 1F5QB 3ME9A 5I22A 4F6SB 1GL5A 3H0HA 2RJCA 2WIHB 1H1RB 2CP7A 2WPAB 2O88A 2R57A 1OQKA 5GAMf 2RJDA 3NPFA 4J6YA 2B9RA 4PJJA 1VINA 1N9RA 1GFDA 3C4SA 4XK8E 5EC7A 4BDZA 4CI0C 3CCUA 3HO8A 2CKKA 1H24B 5GAMe 2L89A 2C5VB 3HZJA 4CC3A 5C0MA 2JJ9A 1B7TA 4F14A 3VS2A 2VASA 4M7DF 5LMKB 4PK4A 2P4TA 4JJNK 4EOOB 2D9TA 4MFDA 1TD6A 1BCOA 4KRDB 4AFUC 1G3WA 4CFWB 2LVMA 2PJQA 2EGEA 1O75A 4BCKB 2KMGA 3TNHB 3FRNA 2PUOB 5GAOr 2EQIA 2XKOC 4F7UF 2E6ZA 1QKXA 4Z88A 1VQ9A 1OU8A 3RUXA 2ZPIB 3TN8B 5GJVB 2ED0A 2RQUA 2DNUA 2UZBB 3L2VA 2BZ8A 2J6OA 1VQKT 1A0NB 2HSPA 1YJNT 3I9QA 5CIUA 3MY5B 1VQPA 1M9SA 3L2WA 2XD0A 2VXEA 3ULRB 3EH2A 2EFIA 2C06A 4OMFB 4BUGA 5L8RE 1WHLA 3CPWS 2R5AA 3C12A 1SRMA 2JMAA 2ROTA 4FCYA 5GMKm 1BI3A 1RUWA 2EQJA 2G3RA 2OTJA 1FMKA 3F70A 2LCSA 2J7IA 4BY6C 4AFZC 3EGDB 2E64A 1FMWA 3X25B 4F70B 1O9KA 2XDPA 1D1CA 4O5VA 4BB7A 4TVRA 4N4GA 3GNFB 3RKWA 5DY9A 1VQNA 2QK0A 1QVFS 1VQ5Q 1D3BB 1S72A 5EJCA 2KSSA 2PTKA 2A28A 2DXCB 1VQOA 4DA4A 3IQLA 4NC6A 5GAOm 1VQPQ 2KBTA 4DEYA 3QDFA 3L2QA 2YWWA 2KE9A 3EG9A 4M78B 3LQ5B 3P8BB 1H641 4CFXB 2JS2A 1YHQA 1VQ6A 3UWNA 1U3OA 2H3JA 3EJ1B 1B34B 2KNBB 3LH5A 3BLHB 4HVVA 2OTJQ 3DKMA 3QHWB 3VS5A 1KSWA 3OYBA 1TWBA 4OGEA 3X20B 2GFAA 3CCVT 2XI9A 2KMTA 1GUXB 5LJ3h 1K73R 4J6WA 3QIIA 4IUUA 3M0UA 3L2RA 2HKQB 1WX6A 4EOJB 4HVUA 4RG8A 3X28B 1VQOQ 4ANJA 3PIPA 3CMET 2DYIA 5AT1B 3SEMA 3VV0A 2JW4A 3CC2T 3CD6T 1N5ZA 2EJGA 2O4XB 3C94A 3G71Q 2BPMB 2F2CA 4Z89A 1Y07A 2FG0A 1IRXA 1UTIA 4JRKA 1VQ6Q 4ZGEB 4K11A 4FYVB 1V29B 1VQ4T 1X2KA 2K3YA 5A0LA 4ZGJB 2ATCB 6AT1B 2XICA 2QTVA 3CCQA 4OB2B 4BBRM 1W70A 1G2BA 2DJQA 5FW9A 4M75F 5CQYA 1IREB 5GMKe 4M77F 1K9AA 5LJ5e 2KYBA 2HBPA 1G3SA 3CC7A 4OMPA 5KYXB 3G33B 4JJBA 1F1BB 2DBKA 1W2BS 1YWPA 1QCFA 2CUDA 3O0GD 1KQ1A 2JVVA 1WJQA 4KUIA 1K73U 4CFVB 2WJ9A 3MCAB 2MOXA 1M1KU 1VUBA 3MPUB 2EKHA 2EW3A 2E65A 4RTZA 3CCRA 2KYMA 4PL6A 4MZTA 3KFVA 4JJDA 3B57A 5IHYA 4FYWB 4PJOB 2JM9A 3WVEB 1PWTA 4KGZB 5ECAA 4AMCA 3LW5E 1AD6A 3MHXA 4AFQC 4JX5A 5I2MA 4II5B 1CKBA 2FZGB 4C0DB 1K73C 4HL4A 1M1KC 4MZMA 3OYNA 3QWYA 3CCQQ 2DXUA 4BY6B 4JPBW 1RLQC 2D0NA 3VYGB 2YRVA 4FU6A 2ZPHB 1YI2Q 4OMOA 4PFZA 3NFCA 4BY7X 1D1BA 5IXFA 4M7AC 4C92C 4Y28E 3OYMA 2YLCA 3CEYA 2L5QA 1N8RU 2HMAA 3O8VA 3QXEB 2DF6A 1ZUYA 4C92G 2HSEB 1TOVA 4EIKA 3CCMA 5GAMd 1QMCA 4OVAA 1BB9A 4CFUB 2DEQA 3QYBA 4R55A 1TU0B 4LD6A 3A1PA 4OB1B 3BHVB 1YJWA 4IURA 3X24B 4EOSB 1C6VX 4QVDA 2L3QA 3NDQA 3HFOA 4AI6A 4RTUA 2XDBA 4CC4B 4OMNA 3E19A 5CK9A 3RDVA 2BS2A 2MWPA 2LQ8A 1YBYA 1OULA 2DRMA 2YXYA 2GTJA 1JJ2S 1R0BG 2COYA 2DETA 1K8AU 3TW7A 1TTHB 3CCUT 4JLGA 1J3TA 1PSFA 2KT8A 3DL1A 2PU9B 1BI2A 1I81A 2DE0X 4MFEA 1VA7A 3L1AA 2X4WA 1MGQA 3AT1B 3QZ5B 2RQTA 2EIFA 1GCPA 1ZSGA 3SWNA 4M75B 5J26A 1D0ZA 4RCCA 1K8AC 1S1NA 2W0ZA 2F5TX 3SD4A 4RTXA 1FWZA 2LP5A 3CC4A 2P4RA 1OOTA 2ZGWA 5D7UA 1Y71A 4Q5WA 2Y4YA 1YJWQ 4RTVA 2NLUA 2CCHB 1ARKA 3OW2A 2CCIB 4M7AD 1VQ9T 1C9BA 1FMVA 4C92D 2RO0A 1XTDA 5CR2A 2FB7A 1TXQA 2YLBA 1G83A 2M0YA 1VQPT 4EMKA 1IO6A 4GLMA 5IAYA 2EJ9A 2WSFE 2QEXA 1RL2A 4B9XA 5FGKB 4CFNB 3N5BB 4LUEA 2DL3A 3QO3A 3CC4Q 3OB9A 5IDNB 1UJYA 2B86A 4E2FB 1AT1B 2I53A 3JB9H 1Z9QA 3CXCA 3CCJA 3V7SA 1WZOA 2J05A 3WVDB 2KRMA 1Y0MA 2SRCA 3H8ZA 5LJ5g 2O9SA 3CMAA 5CKHA 3M59A 1KIKA 4ZNXA 1ABOA 1VQNT 2C0TA 3BFMA 4XU1A 1S72T 4BACA 1H25B 2KY9A 2O2OA 2W10A 2PNIA 3CBOA 3EGDA 1VQOT 2NUPB 3BDUA 4D8KA 1WHKA 4QT7A 2PHGA 2E4HA 1QMZB 2XK0A 3CCEA 1ZLMA 3GNGA 3A8HB 2QEXQ 1Q86R 2VYTA 1YWOA 1YHQT 1JB0E 4E7LA 1D1AA 2DEUA 4J9GA 1OI9B 2DRKA 5CCAA 2J6KA 1WXBA 1QVGA 4KGVB 3RNJA 1KJWA 1AWJA 3I5SA 2QDLA 2DYBA 1RACB 2DM1A 3BW1A 4M78A 1KQSA 2MIOA 3CMAQ 1ZSZB 2ZPBB 2RK2A 1FYNA 1Q7YR 3TEEA 2RQWA 4Y72B 3TQ7P 4ZN1A 1WJSA 1H3ZA 3MJXA 2RJFA 4J9CA 2E70A 2SEMA 4J6XA 4E6RA 2CP2A 3CCEQ 3I35A 3RERA 5GAN2 1VIEA 5I2SA 1D3UB 2KR3A 3HSBA 4XU0A 3OYAA 4PFPA 2W99A 1VQ8A 4A53A 4PLLA 2V22B 1H3HA 5CQXA 5LJ3e 4M7AE 1AD5A 2QXFA 3EFOA 4DOWA 1VQ7Q 4C92E 2HEQA 2VC8A 3PIOA 3JV3A 1IZ6A 3CBMA 3CC7T 1U5SA 3JCMJ 2BTTA 3QSUA 4BBSM 3PGGA 3THKA 4RG2A 1M8MA 2JZ2A 3REBB 8AT1B 1Q7YU 4XQ3A 4IIOA 3OYKA 1AOJA 3H41A 1OKVB 3G4SQ 3CCRT 3G1JA 4C8QC 2RNAA 2LQWA 5HBJB 5KYXA 1M1FA 1H4LD 4LNPA 4ESRA 2R58A 1OIYB 3VS4A 1Q7YC 2M51A 3JCMg 2DL4A 2EPDA 2EQMA 4E7SA 2L3SA 2LJ1A 4E7IA 4IUVA 1BBZA 2RPNA 3VS0A 2QQAA 4X9DA 4EOMB 4A54A 1YITA 4C5HA 3OYCA 2K5LA 4HCBA 4A4HA 3CXCP 1YP5A 2LTOA 2ZPFB 4DBRA 1VYWB 2AT1B 3HBLA 4RMOA 2BS4A 4O6JA 1VQMQ 3RKYA 3MY1B 3OYHA 5GMKi 4BCQB 3CCMT 4XTVA 2XMFA 2JTEA 3I55A 2D8JA 4QVZA 3SDZA 1YJWT 4MDWA 4FL6A 3V8LA 2ZPEB 2C5XB 5IDPB 3BDLA 4KRTA 3NTIA 3JCMP 3OS2A 4FT4A 2RI5A 3VU3C 4CC2A 1QVGP 4KUDK 2DXBB 2DTOA 3JB9G 2PVDB 1AVZC 4E7ZA 3RMQA 4AFSC 3RGFB 5IHIA 2MYSA 2DL7A 5A2QE 1WPYA 3QG1A 4F7JB 3OSVA 1JO8A 1PRMC 4AKGA 4M78G 3PO3S 3OS1A 3PTAA 3DJBA 4F16A
chains in the Genus database with same CATH topology
5LL6S 2HQEA 3QYEA 3CCSA 3DKMA 4P5NA 4C0FA 3OYBA 3CC4T 3ZEHA 1DJ7B 1KQSS 3GPLA 4XTYA 3G6ET 3E9GA 1OI1A 4J7IA 4OGEA 4M7DC 3X20B 2LRQA 2PUKB 4KT0E 1FKMA 2GFAA 2RHYA 5LJ3f 3CCVT 1U1TA 3JCMh 4NL3A 2XHCA 2KMTA 2XI9A 2K2VA 4JLIA 5GAMh 5LJ3h 1RI0A 2RH2A 3HPWA 4J6WA 3QIIA 4IUUA 3L2RA 3CCQT 2DJZA 3QUIA 1P92A 2DIGA 4CRIA 3I56T 2DVEA 3OS5A 2QQ9A 4X9CA 4JRPA 2OAUA 4OP0A 4RG8A 3X28B 3VKHA 4IUTA 2O4XA 4N4HA 2M16A 4F7UA 4II1A 5IT9E 1YJ9T 4OF1A 1YIJT 3PIPA 3PNWC 3CMET 2XDDA 5HKCA 1YI2T 3META 3VV0A 5GAN3 2QI2A 4J5YA 5GAN5 3CC2T 4C5IA 3CD6T 2O4XB 2EJGA 3C94A 3LH0A 4BI8B 4L6V5 2ZCFB 2F69A 2EJFA 4C0ZA 3JB9J 2Y90A 4XU3A 3OY9A 1Y07A 1NPRA 2EQKA 2WACA 3FDRA 4JRKA 4C8QA 4ZGEB 2DO3A 1E7PA 2RM4A 1VQMA 1M8VA 1U8RA 1V29B 5DLQE 2QEXT 1X01A 5A0LA 2K3YA 2E12A 4ZGJB 1BIBA 3FJPA 3L2ZA 4HKEA 5HK0A 3OYFA 1M90U 2XICA 3CCQA 4JX4A 4OB2B 4BBRM 4C8QB 4M75F 5CQYA 1IREB 2CZ0B 5GMKe 4M77F 2P0KA 5KCOA 2QFZA 3JB9D 4HCZA 5GMKl 5LJ5e 4BE2A 3JCMW 1VQLT 2HBPA 2JN0A 4C5EA 2GFUA 3OS0A 4HCCA 4VUBA 1G3SA 1M5Q1 1QP3A 4C8QG 2EQUA 4BE1A 2PVGB 3CC7A 1KHIA 5GAOq 1LNXA 3QPHA 3M9QA 3V7CA 2RI3A 1VQ5A 5J3BA 1W2BS 5LJ3g 3CCJT 1M90C 1Y96A 2VUBA 4M78D 1WQWA 4JRQA 1KQ1A 2JVVA 4KUIA 1WJQA 3DLMA 2QF7A 4EPCA 1K73U 2WJ9A 3RESA 4PJOA 3MCAB 2LNVA 2QQSA 4JUVA 5D6WA 1M1KU 1VUBA 2KK4A 2E65A 5HK3A 4AKIA 1Y96B 3A8OB 1BI0A 2GCXA 3CCRA 2V8IA 1SSFA 4PL6A 4MZTA 4EMHA 5EG2A 3OYDA 3S3MA 4OB3B 4M77E 4LDVA 4PJOC 3M55A 4PJOB 3L42A 4YTLA 1M4ZA 2IG0A 4IUPA 3WVEB 4HA8A 3A8LB 3VUBA 3LW5E 3FLGA 5GAOl 3MHXA 4JX5A 2B8AA 3MEWA 5I2MA 2HNIA 4IUQA 3P8HA 4PJOG 3S6WA 4C0DC 4E7KA 1XQHA 4C0DB 1K73C 2LCLA 3LWHA 3CCET 2A7YA 1QW1A 1Y7XA 1WQ7A 2AHJB 4HL4A 4M6VA 2M9UA 4MZMA 1M1KC 3OQ5A 2GQVA 3OYNA 1JRIA 2LX9A 3H4CA 2DXUA 1VQKA 3VYGA 4BY6B 5IN1A 5CAIA 2LQKA 1I4K1 4FT2A 1YJNA 2DPPB 4OB0B 5GAMj 3ZFJA 5LJ3j 2EYQA 5DM7R 2DD5A 4A4GA 1HXDA 3OYJA 3VYGB 2YRVA 4E7HA 4FU6A 2K5FA 2ZPHB 3UT1A 3TU4K 4M7AA 4C92A 3VKIA 3M56A 4NS5A 5FRMA 2DD5B 3NFCA 5GAN8 4L59A 4M7AC 4M7AB 2D6FA 1QVPA 4C92C 5DLOA 4Y28E 2EKOA 4PKCC 1VIFA 4C92B 3OYMA 2YLCA 5FROA 3GOXA 3CEYA 2L5QA 3JSCA 4FM4B 3OYYA 3OA6A 1K9MU 4JRIA 3O8VA 2JOYA 1N8RU 3JCMd 2QQBA 3QXEB 3GF5A 4C92G 3CCMA 3Q1JA 5GAMd 1NJIU 3QJ6A 4OVAA 4C8QD 3G71A 1N9SA 2DEQA 4BI4A 4MMKA 3QYBA 4DQ2A 4R55A 1G5VA 5CKFA 3QWLA 4LD6A 4XU2A 2L8DA 3T9NA 4OB1B 3FB9A 2KAFA 5GMKj 3INZA 1YJWA 2CZ7B 4IURA 3X24B 3QJYA 4QVDA 4WF2A 4KBMB 5FU6C 3VYHB 2DTHA 4AI6A 3HFOA 5FU6B 3UDCA 3V7RA 5GAN7 2XDBA 3JCMV 1K9MC 2FYKA 5GANd 4ZTJA 3E19A 1FXXA 4UC4A 3KHIA 2BS2A 2D0QB 1U1SA 2DAQA 2MWPA 2LQ8A 1YBYA 5CK9A 1NJIC 4FSXA 1JJ2S 1VQ4T 2ZPGB 2V8JA 1VQ8T 4M7DB 3HFNA 2BS3A 3S3OA 2LCCA 1K8AU 2E10A 3TW7A 2WSEE 4J8OA 4XAXB 3CCUT 1X6OA 4JLGA 1PSFA 2DTIA 2QTXA 3MP8A 4PJOD 3DL1A 2QQ8A 2PU9B 1BI2A 1I81A 1XOVA 4M7DG 5KH6A 4MFEA 3MP6A 4M75A 2OTLA 3L1AA 5GAN4 3JB9F 3KUFA 4M77A 2X4WA 4EMGA 4R56A 1MGQA 3QZ5B 2M1HA 3KXTA 5GAOp 2EIFA 2JTFA 1M1GA 2XIDA 5HY6A 4M75C 3GLXA 3SWNA 4M75B 4M77C 5J26A 4N4IA 4RCCA 1PSEA 1K8AC 2PVOB 1Q86U 2F5TX 3SD4A 4F7UB 3CC4A 1FWZA 4M78F 3SWNC 4HLQA 3JCMQ 1HK9A 4J83A 4QQDA 3SWNB 3G6EA 4J7FA 2ZGWA 3V8KA 3FC3A 1Y71A 4Q5WA 2Y4YA 2BUDA 3M54A 3QHSA 4JDSA 5FLXE 3SFMA 2MAMA 4F7UG 3CCVA 3QYHB 4D6WA 2NLUA 5LJ5f 5GAOn 2BKDN 5GMKh 5D6XA 4A4KA 3OW2A 4HT9A 5LJ5h 4MDXA 2F5KA 5D6YA 3RKXA 3I56A 4XTWA 5GANf 4M7AD 2G77A 1VQ9T 1JBMA 4Y91A 2LDMA 4C92D 2VGNA 4AKHA 2ZZDA 1Q86C 4ME7A 1UGQB 2RO0A 3ZBDA 1YJ9A 1XTDA 2JNGA 1YIJA 4HNUA 5CR2A 3CMEA 5M9OA 1YI2A 4ZN3A 2CYZB 1YCYA 2FB7A 1G3TA 3E1SA 4M78E 2RHZA 1BI1A 2ZZDB 2YLBA 3PMTA 5GANe 3CC2A 3CD6A 2QA4T 1UGRB 2GF7A 4QSHA 1QLBA 1I8FA 4JS5A 3NTKA 1KD1U 5FRNA 1YITT 4MIMA 2EAYA 1NE8A 4Z02A 4EMKA 1VQPT 2DXTA 3CMAT 5IAYA 2P0PA 4KULA 2EJ9A 2WSFE 2QEXA 3LGLA 1VQ4A 1OYXA 2K57A 2O01E 3BY7A 3DB3A 3MEUA 4EMKC 1RL2A 4B9XA 4EMKB 3EAEA 2I2LA 3N5BB 1OZ3A 3CPWA 2LT4A 2DD4A 3P8DA 3MEAA 4HT8A 3J81E 3QO3A 4PNOA 3QBYA 1VQLA 3OB9A 4HNVA 1O9SA 3ASKA 1KD1C 2E41A 2MI6A 2RJEA 3A5ZB 2DD4B 4M7DD 5GAN6 3JAME 1ZBXA 4ELYC 2RK1A 3UPUA 3JB9H 2QA4A 2JUFA 2PQWA 3JCMX 2V8KA 3CXCA 4C8QF 3V7SA 3CCJA 1WNLA 4RCBA 3WVDB 3H8ZA 4RKUE 2X4YA 5FU7C 5FU7B 3VUZA 3RMSA 5LJ5g 3CMAA 4C5GA 1FX7A 2MMPA 3HP9A 3BG5A 5CKHA 3M59A 3R6OA 3GP8A 3OYIA 4DOVA 2DIQA 2VV5A 3MP1A 3FIFA 4GY5A 4M75D 1NZ9A 5GANg 1VQNT 3GIBA 5KE2A 4LD9K 3C95A 3OMCA 3BFMA 4XU1A 2VXFA 5CKBA 3HHTB 3CCLT 1S72T 4BACA 1VQ7T 1EIFA 2KY9A 3ER0A 3CBOA 1UGPB 4BE0A 3URGA 1VQOT 4BD3A 3BDUA 2HQXA 2XG8D 1BYMA 2QDJA 3WXMB 2XK0A 3CCEA 3HL8A 4A4FA 3V8JA 3A8MB 4C8QE 3GNGA 3A8HB 4OGCA 3OYEA 4XTXA 4QW2A 1N27A 4M7AG 2RHIA 1UB4A 4PJOF 4JS4A 4E47A 1KG1A 2VYTA 2CGHA 5CVIA 3X26B 5LJ3d 1TH7A 1ZHIA 2YHTA 3M4GA 4FIBA 1YHQT 1JB0E 3JCMc 4E7LA 2RHUA 3G4ST 2DZCA 2WSCE 1I5LA 3M5AA 3E9FA 4N0AA 2A3LA 4XTUA 5C6SA 5LJ5j 4PLIA 3HB9A 3PT9A 5CCAA 1QVGA 2RD1A 3J80E 3CCST 3CCLA 2RB6A 4N0AC 1N8RC 2P0QA 1X75C 3NTHA 2QQRA 4NL2A 3EFRA 3BW1A 4M78A 4X34A 3RIRA 1KQSA 3M4YA 1XNIA 3HRTA 2FL7A 2XU8A 2ZPBB 2CS7A 2RK2A 1W4SA 3M58A 3MO8A 1Q81U 4PJOE 1WJRA 4M78C 4ELZC 4JX6A 3TEEA 2DZ9A 4ZN1A 1G3YA 1WJSA 1GXIE 1H3ZA 1WGSA 2KVQG 2RI2A 2KR6A 4HNTA 1MHNA 2RJFA 4MZPA 3DLLA 2E70A 3VKGA 4J6XA 2X4JA 4XTZA 1QVGS 4QQGA 2L3RA 2X4XA 2CZ6B 3M53A 3ME9A 4LDXA 5A0DA 1QP2A 2RJCA 3RERA 5GAN2 4BDYA 4LDYA 4M77B 4QQ6A 1Q82U 1Q81C 1VIEA 3JCMf 2K5IA 2QDYB 2CZ1B 2M0OA 2R57A 5I2SA 5GAMf 2RJDA 4M75G 3HSBA 4J6YA 4M77G 4XU0A 3OYAA 1VQMT 2K4YA 4LDUA 3SB2A 1VQ8A 1N9RA 3VJPA 4A53A 3C4SA 3QDRB 4PLLA 4XK8E 3JCMe 4CI0C 4BDZA 3CCUA 3OYGA 3HO8A 2KQWA 1BIAA 5CQXA 2CKKA 5GAMe 2RA2A 2L89A 5LJ3e 2JTMA 4M7AE 3KBGA 2QXFA 4DOWA 2LT1A 4C92E 2VC8A 3J7AF 3HZJA 3LLRA 1Q82C 3MEVA 5C0MA 3PIOA 3JRZA 2R5MA 1IZ6A 2MWOA 1R8OB 3CBMA 3CC7T 4M7DF 2VGMA 5GANh 2P4TA 5I21A 3JCMJ 4JJNK 5CKEA 1VQ5T 3QSUA 4BBSM 1UEBA 2D9TA 4MFDA 3HRSA 4ATOA 3PGGA 2RHXA 1G3WA 3M57A 4LOCA 4RG2A 1W2BA 2JZ2A 3BG3A 2LVMA 3OSSC 1Q7YU 1UGSB 3LGFA 4XQ3A 3OYKA 3QZ9B 3JB9I 1O75A 2E6NA 3CCRT 5J39A 1KHCA 2KMGA 4C8QC 4E7JA 3FRNA 2PUOB 4C0GA 5GAOr 3OW2S 1BKBA 2KDSA 4EDUA 4NOYA 2XKOC 1M1FA 4F7UF 2E6ZA 3OMGA 1VQ9A 4M7DE 2E5QA 2R58A 3FEOA 3TCJA 3RUXA 2ZPIB 1Q7YC 3JCMg 2OTJT 3L2VA 2EQMA 1N6AA 2MF2A 4ELJA 3DB4A 5GAMg 1LJOA 2X35A 1VQKT 4E7IA 4IUVA 4B9WA 3S3NA 1YJNT 2QQAA 2IVWA 3PFSA 5CKDA 4X9DA 3I55T 5CIUA 4Z6YA 2FVUA 4A54A 1M9SA 3L2WA 1VQPA 1YITA 1AHJB 4C5HA 3OYCA 2XD0A 3A8GB 2K5LA 2VXEA 4HCBA 2Y4XA 4A4HA 2EFIA 2C06A 4M75E 4OMFB 2EWNA 2BIVA 4BUGA 2HAXA 5L8RE 3TW6A 2LTOA 5AYFA 3CPWS 2R5AA 2ZPFB 3EFSA 4F7UE 2FHDA 5KCHA 4M77D 3JCMb 1LOJA 3LWIA 3HBLA 3C12A 3CBPA 3HKSA 1QVFA 4RMOA 4QVCA 2BS4A 5GMKm 1BI3A 2EQJA 4O6JA 3RKYA 3LYIA 2G3RA 3OYHA 2OTJA 4IKFA 2K3XA 5CO7A 4LDWA 5GMKi 3F70A 1KC8U 4L5GA 3CCMT 4XTVA 3CXCS 4BY6C 3TREA 2E64A 3G71T 3X25B 2E1HA 3OBWA 3I55A 2DKGA 2XDPA 3OBYA 4QVZA 3SDZA 1YJWT 3PMIA 1VQ6T 5KE3A 4O5VA 4BB7A 4MDWA 4FL6A 1D3BA 4TVRA 3V8LA 4N4GA 2ZPEB 3BDLA 2DXCA 3GNFB 3RKWA 5DY9A 3H6ZA 3NTIA 3JCMP 1VQNA 1QVFS 3HRUA 4MMLA 3OS2A 2DXBA 4FT4A 1D3BB 1KC8C 1S72A 1VQ7A 5EJCA 4ZGDB 2KSSA 2RI5A 4GLKA 3VU3C 2DXCB 1ZQ1A 3L2UA 5GANj 2HD0A 4DA4A 1VQOA 4BI3A 4KUDK 4NC6A 5GAOm 2DXBB 2DTOA 1JJ2A 1OZ2A 3JB9G 2PVDB 3L2QA 3RMQA 5A0GA 2DK3A 4ZTFA 4M78B 1B34A 3G7ZA 2LC4A 5A2QE 2OTLT 3P8BB 1H641 3BG9A 3LX7A 1YHQA 1VQ6A 3UWNA 1WPYA 3QYGB 5LJ5d 3QG1A 3OSVA 4V2SA 2H3JA 4AKGA 3OYLA 3CPFA 4M78G 4M7AF 3G4SA 3OS1A 4C92F 1B34B 1NPPA 3QKJA 3PTAA 1KQ2A 3AHUA 4A4EA 4M7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 E;  2DD4 B;  1DJ7 B;  4FM4 B;  3X20 B;  2PUK B;  4KT0 E;  3QXE B;  1UGS B;  3QZ9 B;  3WVD B;  4RKU E;  4OB1 B;  2PUO B;  2CZ7 B;  3X24 B;  3X28 B;  3VYH B;  3HHT B;  1UGP B;  2ZPI B;  2D0Q B;  4L6V 5;  2ZCF B;  2ZPG B;  3A8M B;  3A8H B;  4ZGE B;  2WSE E;  1V29 B;  3X26 B;  1AHJ B;  1PSF A;  3A8G B;  4ZGJ B;  2PU9 B;  1JB0 E;  4OB2 B;  5L8R E;  2WSC E;  1IRE B;  2CZ0 B;  2ZPF B;  3QZ5 B;  1QP3 A;  2PVG B;  1PSE A;  2PVO B;  2ZPB B;  3X25 B;  3QYH B;  3A8O B;  1GXI E;  4OB3 B;  2ZPE B;  2DXC A;  3WVE B;  2CZ6 B;  2ZZD A;  3A8L B;  2DXB A;  1UGQ B;  3LW5 E;  1QP2 A;  4ZGD B;  2DXC B;  2CYZ B;  2AHJ B;  2CZ1 B;  2QDY B;  2DXB B;  2ZZD B;  2PVD B;  1UGR B;  3VYG A;  4XK8 E;  2DPP B;  4OB0 B;  2WSF E;  2O01 E;  2DD5 A;  3QYG B;  3VYG B;  2ZPH B;  2DD4 A;  2DD5 B; 
#chains in the Genus database with same CATH topology
 2HQE A;  3MKD A;  2WMA B;  3CC4 T;  1TS9 A;  1DJ7 B;  1CKA A;  3GPL A;  1OU9 A;  3E9G A;  4J7I A;  3I55 Q;  4M7D C;  1D0X A;  4KT0 E;  1FKM A;  4AT1 B;  3JCM h;  1PHT A;  1NG2 A;  2XHC A;  2K2V A;  2COZ A;  1UJ0 A;  1NEG A;  2QYZ A;  4F17 A;  2EGA A;  2DVE A;  1TUC A;  4JRP A;  2OAU A;  2O31 A;  1OGU B;  5IT9 E;  4BCH B;  3PNW C;  5GAN 3;  2LNH B;  2HCK A;  5GAN 5;  1SKU B;  4BI8 B;  3LH0 A;  4EOP B;  4C0Z A;  3OY9 A;  2WXV B;  2M02 A;  1NPR A;  2WAC A;  2EQK A;  3FDR A;  1E7P A;  4DEX A;  4OML A;  1M8V A;  1I07 A;  1U8R A;  1AZE A;  2QEX T;  1X01 A;  1H27 B;  3L2Z A;  5HK0 A;  3FJP A;  2Z0W A;  4C8Q B;  2CZ0 B;  1QQJ A;  3JB9 D;  4HCZ A;  3JCM W;  4C5E A;  1M5Q 1;  4BE1 A;  2EQU A;  2DBM A;  1WYX A;  2PVG B;  2FPE A;  5GAO q;  3QPH A;  3M9Q A;  1XJW B;  4F6U B;  1VQ5 A;  2BE7 D;  2WIP B;  5J3B A;  5LJ3 g;  3CCJ T;  1X43 A;  1Y96 A;  4M78 D;  4B6M A;  1WQW A;  2QF7 A;  1T3S A;  3RES A;  4BCN B;  4BCM B;  5D6W A;  2KK4 A;  1NJI R;  4AKI A;  3A8O B;  2GCX A;  4EOL B;  4EMH A;  5EG2 A;  3S3M A;  1X6G A;  4PJO C;  4LDV A;  3M55 A;  4YTL A;  4IUP A;  4BCO B;  2L2P A;  4HA8 A;  3VUB A;  5DQW A;  1OX9 A;  2B8A A;  3MEW A;  4PJO G;  2HNI A;  4IUQ A;  4C0D C;  3BHT B;  4E7K A;  3CCE T;  3LWH A;  1QW1 A;  4M6V A;  2C5O B;  2GQV A;  3NMZ C;  4FW1 A;  5CAI A;  2DPP B;  4OB0 B;  3ZFJ A;  2F2X A;  1YIJ Q;  3TU4 K;  1ZUK A;  2K5F A;  3UT1 A;  4M7A A;  4C92 A;  4NS5 A;  2JS0 A;  1JXM A;  2DD5 B;  5GAN 8;  2D8H A;  2D6F A;  5DLO A;  4IMY B;  2CH4 A;  4PKC C;  3GOX A;  1QCN A;  2RQR A;  4FM4 B;  1X27 A;  3OA6 A;  1K9M U;  2VB6 A;  5KYW B;  2AIR B;  2DIL A;  1NJI U;  3QJ6 A;  3G71 A;  4DQ2 A;  2DLP A;  1G5V A;  1RAG B;  4XU2 A;  2E3H A;  2KAF A;  5GMK j;  3INZ A;  2HL3 A;  2KRN A;  1WLP B;  1VQL Q;  4J9F A;  2CZ7 B;  3QJY A;  2V26 A;  4WF2 A;  5KYU A;  4FSS A;  5IF1 B;  2ESW A;  2NUT B;  2A37 A;  3JCM V;  2C5N B;  1K9M C;  1SPK A;  1ZBJ A;  4EOQ B;  1MV3 A;  2FYK A;  5GAN d;  1FXX A;  3J7A F;  3KHI A;  2D0Q B;  1U1S A;  1NJI C;  3POM A;  1H92 A;  2CRE A;  4F7N B;  1KXU A;  1VYU A;  2V8J A;  3SHW A;  1VQ8 T;  3HFN A;  2RMO A;  4M7D B;  2W9Z A;  2E10 A;  1X6O A;  1D0Y A;  5L23 A;  4PJO D;  1AWX A;  3VS7 A;  1XOV A;  1NYF A;  3MP6 A;  1M1K R;  2OTL A;  2C6T B;  2HQH A;  4EMG A;  4R56 A;  2NUZ A;  5CEI B;  4J9I A;  2AK5 A;  2JTF A;  2KI7 A;  4RUG A;  4M75 C;  4LE9 A;  1VOM A;  4M77 C;  1NBE B;  2HL5 C;  4N4I A;  4RTY A;  1PSE A;  2PVO B;  4F7U B;  1I1J A;  3EGU A;  4QQD A;  3V8K A;  4OR5 B;  1RAA B;  1WI7 A;  3SFM A;  2MAM A;  1U06 A;  3QYH B;  1NYG A;  4D6W A;  5LJ5 f;  2BKD N;  2W2H A;  1NM7 A;  4MDX A;  5D6Y A;  3RKX A;  3I56 A;  2IPO B;  2VGN A;  1AIS B;  5M9O A;  1YI2 A;  4NST B;  4M78 E;  3E1S A;  2ZZD B;  4CFU D;  1JQQ A;  2QA4 T;  1UGR B;  4QSH A;  1QLB A;  1I8F A;  3NTK A;  1YIT T;  2EAY A;  2DXT A;  1N8R R;  2OTL Q;  1V1C A;  2K57 A;  1N4M A;  3MEU A;  2A0F B;  3CPW A;  2OJ2 A;  4EC9 B;  3J81 E;  1AEY A;  2MI6 A;  1PCX A;  2DD4 B;  2K6D A;  3JAM E;  4ELY C;  2K3B A;  3UPU A;  3UF4 A;  2V8K A;  2CDT A;  4I3Z B;  5FU7 B;  3I56 Q;  2J6F A;  1R0C B;  2MMP A;  1K8A R;  3R6O A;  1C0M A;  1PG5 B;  2OX7 A;  1CSK A;  3GIB A;  3MP1 A;  1SRL A;  4M75 D;  1RLP C;  4AG2 C;  4PJL A;  5CKB A;  4Y92 A;  3ER0 A;  2FRW A;  4BE0 A;  1YN8 A;  1B07 A;  1BYM A;  2YUQ A;  2IIM A;  3V8J A;  3E2U A;  1JXO A;  1JOW A;  4M7A G;  1N27 A;  1TH7 A;  1ZHI A;  2YHT A;  3EH1 A;  2RHU A;  1I5L A;  4XTU A;  2HKN A;  1GBR A;  3J80 E;  3QHR B;  3CCL A;  2RB6 A;  2FPD A;  1N8R C;  4F7L B;  1M2V B;  2P0Q A;  1X75 C;  1NLO C;  3TVT A;  3RIR A;  4HXJ A;  1ZSZ C;  2XU8 A;  4PJO E;  1QLY A;  1WJR A;  2AZS A;  1G3Y A;  3FJ5 A;  1LCK A;  2OI3 A;  1MHN A;  1PD0 A;  1LVK A;  2X4J A;  1QVG S;  1UNL D;  3M53 A;  1P5E B;  5A0D A;  2MK5 A;  4BDY A;  4M77 B;  4QQ6 A;  3JCM f;  2CZ1 B;  2M0O A;  1T0H A;  4LDU A;  3JCM e;  2VWF A;  2RA2 A;  3CCL Q;  1OL1 B;  2LT1 A;  2ED1 A;  3MEV A;  4CFM B;  2QGG A;  2R5M A;  1IGU A;  1RI9 A;  3I5R A;  2VGM A;  2A08 A;  1VQ5 T;  2G6F X;  3HRS A;  2CSQ A;  1W2B A;  3OSS C;  2VKN A;  1UGS B;  3LGF A;  3DTO A;  3QZ9 B;  1KC8 R;  4EC8 B;  2F2V A;  2E6N A;  2FRY A;  5J39 A;  1GY3 B;  2DA9 A;  1KHC A;  4C0G A;  2PK2 A;  1KFZ A;  1BKB A;  4NOY A;  1BU2 A;  3OMG A;  2E5Q A;  3FEO A;  2YUN A;  2OTJ T;  3DB4 A;  2MF2 A;  4ELJ A;  1E9H B;  2X35 A;  1YFN A;  4B9W A;  3S3N A;  1BCM A;  1PM3 A;  4HCK A;  3DDQ B;  1B3Q A;  2IVW A;  1AHJ B;  3EG2 A;  2Y4X A;  1MMG A;  3HTR A;  2GQI A;  4M75 E;  2EWN A;  2FO0 A;  1Z9Z A;  1E6H A;  5AYF A;  1TSF A;  5KCH A;  1LOJ A;  5HBH B;  3CBP A;  4QVC A;  3UAT A;  2IW8 B;  1X2Q A;  1KC8 U;  1AWW A;  2QGS A;  3TRE A;  3G71 T;  3EID B;  2E1H A;  3OBW A;  2DKG A;  3OBY A;  1IHV A;  3PMI A;  1VQ6 T;  2COW A;  5KE3 A;  1D3B A;  1O9K B;  4UN0 A;  1VYT A;  2BKZ B;  2DXC A;  3HRU A;  2IVX A;  4R0K A;  1M3C A;  1KC8 C;  1VQ7 A;  4ZGD B;  2PZ1 A;  1H1Q B;  5GAN j;  2HD0 A;  4BI3 A;  1PNJ A;  1IGQ A;  1WFW A;  1JJ2 A;  5HVY B;  1K1Z A;  2C0O A;  1OEB A;  1ZX6 A;  4WTO B;  2DK3 A;  1B34 A;  2OTL T;  3F5X B;  3LX7 A;  1M90 R;  3QYG B;  5LJ5 d;  4V2S A;  3OYL A;  2AKL A;  3G4S A;  3AHU A;  1KQ2 A;  4A4E A;  4M7D A;  3CCS A;  1GUX A;  1YJN Q;  4XTY A;  2WHB B;  4D8D A;  1WHM A;  5LJ3 f;  1U1T A;  1RI0 A;  2P84 A;  1JU5 C;  3CCQ T;  3QUI A;  1P92 A;  4CRI A;  3R6N A;  3I56 T;  2YRD A;  2FZC B;  3OS5 A;  4OP0 A;  3VKH A;  4N4H A;  2O4X A;  4F7U A;  4QKU A;  4II1 A;  4OF1 A;  1YI2 T;  4BCQ D;  3OW2 P;  4J5Y A;  5IXB A;  3DOG B;  4L6V 5;  1QWF A;  2F69 A;  3JB9 J;  2EJF A;  4ELL A;  2Y90 A;  4XU3 A;  4BCF B;  2ZAE A;  4FYY B;  3M0S A;  4CRL B;  9ATC B;  1VQM A;  3UA6 A;  4F7S B;  2E12 A;  1M90 U;  3OYF A;  1BIB A;  4HKE A;  4JX4 A;  4BCG B;  1URC B;  2O9V A;  2CT4 A;  1V76 A;  3CCS Q;  1R77 A;  2P0K A;  5KCO A;  2QFZ A;  2MCN A;  4F04 B;  5GMK l;  3OS0 A;  3PVQ A;  4C8Q G;  2BZY A;  3D7S B;  1XO2 A;  1KHI A;  3V7C A;  1IB8 A;  3MI9 B;  1M90 C;  4EOR B;  4JRQ A;  1UDL A;  3M0R A;  3DLM A;  4HVW A;  4PJO A;  2QQS A;  4JUV A;  1D09 B;  1X69 A;  1RAI B;  2E5K A;  2RN8 A;  4OB3 B;  1K0X A;  1WHH A;  2CP6 A;  2KRS A;  2IG0 A;  3VS6 A;  2EYX A;  3A8L B;  5GAO l;  2YDL A;  4J9E A;  1GRI A;  1XQH A;  2IN3 A;  3CCV Q;  2A7Y A;  3VRY A;  1Y7X A;  3OQ5 A;  2LX9 A;  1PKT A;  2LJ3 A;  3VYG A;  5IN1 A;  2LQK A;  1I4K 1;  4FT2 A;  5GAM j;  2EYQ A;  5DM7 R;  1HD3 A;  4A4G A;  1HXD A;  4RTT A;  3OYJ A;  2H3E B;  4E7H A;  3VKI A;  3M56 A;  1ZA2 B;  5FRM A;  3CC2 Q;  3CD6 Q;  1UNH D;  5HQ0 B;  4L59 A;  2L3P A;  3OYY A;  3JCM d;  1MNE A;  2QQB A;  3GF5 A;  4C8Q D;  1N9S A;  1KQS P;  4MMK A;  2L8D A;  2I40 B;  3T9N A;  1SF9 A;  3FB9 A;  4RTW A;  2D1X A;  4KBM B;  3VYH B;  2IW6 B;  1KK7 A;  5FU6 B;  2CP3 A;  2JT4 A;  5HCK A;  3UDC A;  2C0I A;  2DAQ A;  1GCQ C;  1H8K A;  2ECZ A;  4KH0 B;  4BCN D;  4BCM D;  2MPX C;  1MMN A;  1K0S A;  2WSE E;  2JGZ B;  1KD1 R;  2UUE B;  2UZE B;  3MP8 A;  1ACM B;  2QQ8 A;  4M7D G;  1X6B A;  4M75 A;  3JB9 F;  3O5Z A;  3KUF A;  4M77 A;  3UA7 A;  1YCS B;  1JST B;  2M1H A;  3KXT A;  1H28 B;  5GAO p;  2NWM A;  1M1G A;  3M0P A;  2X51 A;  2X3X D;  3GLX A;  4M78 F;  3CQT A;  4HLQ A;  4BXX X;  4WCI A;  2W9F A;  4J83 A;  3SWN B;  3G6E A;  4J7F A;  2ABL A;  3M54 A;  4F7U G;  2WEV B;  1TG0 A;  5D6X A;  4LXC A;  4HT9 A;  2F5K A;  3EGX B;  4XTW A;  2G77 A;  4Y91 A;  2LDM A;  4ME7 A;  1YJ9 A;  3VRZ A;  3ZBD A;  4ROE A;  1YIJ A;  2JXB A;  2CP5 A;  5FWB A;  4CC7 A;  2CYZ B;  2LJ0 A;  1YCY A;  1G3T A;  2I0N A;  2QAZ A;  1BI1 A;  4AG1 C;  2GF7 A;  4JS5 A;  1KD1 U;  2WFY B;  2W96 A;  5ICP B;  4MIM A;  2EYZ A;  1K9M R;  3CMA T;  2P0P A;  2O01 E;  4EMK B;  3EAE A;  4X1V A;  2YSQ A;  1H1S B;  2LT4 A;  2R7G A;  4HT8 A;  4ROC A;  3QBY A;  1VQL A;  1O9S A;  3ASK A;  2JMC A;  2E41 A;  3G6E Q;  1KD1 C;  2RJE A;  3A5Z B;  4M7D D;  5GAN 6;  1ZBX A;  2RK1 A;  3CCU Q;  2CT3 A;  2JUF A;  2FZK B;  2F2W A;  5FU7 C;  4RKU E;  1M3A A;  1Q81 R;  1FX7 A;  1MND A;  1YJ9 Q;  3OYI A;  2QG9 B;  4DOV A;  2DIQ A;  2NUP A;  2VV5 A;  5GAN g;  3EHQ A;  5KE2 A;  3C95 A;  5DQV A;  3HHT B;  1VQ7 T;  2AKK A;  3URG A;  1HJD A;  2XG8 D;  2QDJ A;  3WXM B;  1WDX A;  4A4F A;  1Q82 R;  1PKS A;  4M4Z A;  4C8Q E;  1T0J A;  4XTX A;  1AWO A;  1UB4 A;  4PJO F;  5CVI A;  5LJ3 d;  1EFN A;  2LQN A;  3C0C A;  3JCM c;  1VQ9 Q;  3G4S T;  2WSC E;  2A3L A;  5LJ5 j;  4PLI A;  3PT9 A;  5CYI B;  2QAS A;  2RD1 A;  3CCS T;  4N0A C;  1ZSZ A;  2QQR A;  3EFR A;  2DER A;  3PE0 A;  1XNI A;  3HRT A;  3M0Q A;  2FL7 A;  2CUB A;  5KYY B;  1Q81 U;  1W4S A;  3M58 A;  4FW2 A;  4JX6 A;  2YRC A;  2DZ9 A;  1BK2 A;  4F6W B;  1GXI E;  1WGS A;  2KVQ G;  4TTH A;  2RI2 A;  4MZP A;  2GBQ A;  4XTZ A;  1HSQ A;  2X4X A;  1Q95 G;  2L3R A;  2RQV A;  2FEI A;  1MV0 B;  4LDX A;  1TUG B;  3H0I A;  1QP2 A;  4A63 B;  1Q82 U;  4LDY A;  1Q81 C;  2K5I A;  2QDY B;  1BU1 A;  4PFO A;  1UHC A;  2GTO A;  2VVK A;  4M75 G;  2DX1 A;  4M77 G;  1VQM T;  8ATC B;  2K4Y A;  3SB2 A;  3VJP A;  1SEM A;  3QDR B;  1VQN Q;  3OYG A;  2KQW A;  1BIA A;  1RAF B;  5HNB B;  3RR6 A;  1W6X A;  2JTM A;  1S72 Q;  3KBG A;  2K7A A;  2DME A;  3LLR A;  2K79 A;  1Q82 C;  3JRZ A;  4EOI B;  2MWO A;  1R8O B;  1QWE A;  3EFO B;  5GAN h;  5I21 A;  5CKE A;  1UEB A;  4ATO A;  2PK9 B;  2RHX A;  3M57 A;  4LOC A;  3BG3 A;  1YHQ Q;  3JB9 I;  1E7O A;  4JJC A;  4E7J A;  3OW2 S;  3TNI B;  3TNW B;  2KDS A;  2OAW A;  4EDU A;  1RAD B;  2LW4 A;  5ACB A;  1NLP C;  1AZG B;  3H9N A;  4M7D E;  3TCJ A;  1G3N C;  2JM8 A;  2GNC A;  1N6A A;  5GAM g;  1LJO A;  5CKD A;  3PFS A;  3I55 T;  4Z6Y A;  2FVU A;  2EVR A;  2ENM A;  3RBB B;  3A8G B;  2BIV A;  2HAX A;  3TW6 A;  1YNZ A;  3EFS A;  4F7U E;  4OMQ A;  2FHD A;  3JCM b;  3EOC B;  4M77 D;  3BE3 A;  3GTM S;  2QGF B;  3LWI A;  4DBF A;  1ZUU A;  3HKS A;  1FIN B;  5IHN A;  1QVF A;  2PMI B;  3VS3 A;  3VS1 A;  3LYI A;  1MUZ A;  4IKF A;  2K3X A;  5CO7 A;  1E6G A;  4LDW A;  4L5G A;  3CXC S;  4KRC B;  4JZ4 A;  5L2W B;  4DBQ A;  1M30 A;  2F1L A;  4YOZ A;  3CC7 Q;  3H6Z A;  4MML A;  2DXB A;  1WXU A;  4GLK A;  1RAE B;  4J9B A;  4G6L B;  2YUP A;  1ZQ1 A;  3L2U A;  5HBE B;  1OZ2 A;  3CCR Q;  5EFQ B;  2EUF A;  3GBQ A;  5A0G A;  4ZTF A;  3G7Z A;  2LC4 A;  4OGR B;  3BG9 A;  5IHK A;  1M27 C;  3CPF A;  4M7A F;  1UEC A;  3H0F A;  2HZY A;  1NPP A;  3QKJ A;  4C92 F;  7AT1 B;  1WIE A;  5LL6 S;  3QYE A;  4P5N A;  4C0F A;  4BY1 X;  5BNJ B;  3ZEH A;  1KQS S;  2NYS A;  1LPL A;  3G6E T;  2K9G A;  1OI1 A;  1EZZ B;  2LRQ A;  2PUK B;  2BZX A;  5FWC A;  2RHY A;  4NL3 A;  2KEA A;  4JLI A;  5GAM h;  2RH2 A;  3HPW A;  2HDA A;  2EYY A;  2C4G B;  2DJZ A;  2J06 A;  1PC0 A;  2DIG A;  2QQ9 A;  4X9C A;  5KYN A;  1Y57 A;  4IUT A;  1YJ9 T;  2UZL B;  2M16 A;  5LQF B;  1OL2 B;  4EOK B;  1YIJ T;  2XDD A;  5HKC A;  1UFF A;  3MET A;  3TSZ A;  2QI2 A;  3CCM Q;  4C5I A;  3PVL A;  2LX7 A;  4GBQ A;  2GGR A;  2ZCF B;  3EG3 A;  2CJM B;  1NEB A;  2DFU A;  2WMB B;  4C8Q A;  1JSU B;  1SHG A;  2DO3 A;  2CH4 W;  2RM4 A;  3EGX A;  2DMO A;  4Z8A A;  5DLQ E;  1GBQ A;  1VYV A;  1K4U S;  4BE2 A;  4OMM A;  2DVJ A;  1VQL T;  4HCC A;  2JN0 A;  2GFU A;  4VUB A;  1QP3 A;  3QWX X;  3CPW P;  1JEG A;  1LNX A;  2RI3 A;  4LUD A;  1OV3 A;  4KH1 B;  2VUB A;  3ZL7 C;  1W98 B;  4EPC A;  2IW9 B;  1UGV A;  2LNV A;  5GJW B;  5HK3 A;  1OX8 A;  1Y96 B;  1BI0 A;  2V8I A;  1SSF A;  2LZ6 B;  2YUO A;  1PRL C;  2G9X B;  3OYD A;  4FX3 B;  4M77 E;  2BE9 B;  1RAB B;  3L42 A;  1M4Z A;  3FLG A;  1QCO A;  3P8H A;  3S6W A;  1OKW B;  2LCL A;  1WQ7 A;  2AHJ B;  1H26 B;  2M9U A;  1QVF P;  1OIU B;  1JRI A;  3H4C A;  1VQK A;  1YJN A;  4YOO A;  5LJ3 j;  2DD5 A;  1UG1 A;  1MMA A;  1I0C A;  4ROD A;  2DL5 A;  2X1N B;  1IHW A;  1WXT A;  3NGP A;  4M7A B;  1QVP A;  5KYW A;  2EKO A;  4C92 B;  1VIF A;  5FRO A;  3JSC A;  4JRI A;  2JOY A;  2KXD A;  3Q1J A;  3DDP B;  4BI4 A;  1FVV B;  4BCP B;  2X9H A;  3QWL A;  5CKF A;  2NUT A;  3BLR B;  3NHN A;  1ENW A;  5FU6 C;  2DTH A;  4DBH A;  3EG9 B;  1GCQ A;  3V7R A;  5GAN 7;  5KYY A;  3U23 A;  4ZTJ A;  3CCJ Q;  1C1A A;  4UC4 A;  5I11 A;  1VQK Q;  2DL8 A;  2A36 A;  5KYU B;  1EX4 A;  4FSX A;  2ZPG B;  3S3O A;  2BS3 A;  2LCC A;  4PJM A;  2YT6 A;  1M3B A;  4J8O A;  4XAX B;  1GH6 B;  2DTI A;  2QTX A;  3M0T A;  5KH6 A;  1TFB A;  5GAN 4;  4EON B;  1SSH A;  1ZA1 B;  2XID A;  5HY6 A;  2UZD B;  3K7A M;  1Q86 U;  1M2O A;  3EG1 A;  3SWN C;  3JCM Q;  1HK9 A;  3FC3 A;  4JDS A;  2BUD A;  3QHS A;  4PJN A;  5FLX E;  3CCV A;  5GAO n;  1W2B P;  5GMK h;  1ZP2 A;  4LN2 A;  4A4K A;  5LJ5 h;  4KGX B;  2FPF A;  5GAN f;  1JBM A;  3EHR A;  1PKD B;  4AKH A;  1SG5 A;  2ZZD A;  1UGQ B;  1Q86 C;  3M03 A;  2JNG A;  2EBP A;  4HNU A;  2ROL A;  3CME A;  3REA B;  2E3I A;  4BCI B;  4ZN3 A;  2V1R A;  5GAN e;  2RHZ A;  2K2M A;  2X3W D;  3PMT A;  3CC2 A;  3CD6 A;  5FRN A;  1IXD A;  1TUD A;  2AZV A;  1NE8 A;  4Z02 A;  1OPL A;  5I5Z B;  3BLQ B;  2RF0 A;  4KUL A;  3LGL A;  1VQ4 A;  1OYX A;  3BY7 A;  3DB3 A;  1ABQ A;  4EMK C;  1JKW A;  2I2L A;  1OZ3 A;  2DD4 A;  2L0A A;  3MEA A;  3P8D A;  4PNO A;  1RAH B;  4HNV A;  1MMD A;  1WHJ A;  3TSW A;  1VQ8 Q;  1PD1 A;  4JZ3 A;  2CSI A;  4J9D A;  2QA4 A;  3JCM X;  2LMJ A;  2PQW A;  4C8Q F;  3A98 A;  1WNL A;  4RCB A;  3VUZ A;  2X4Y A;  4IIM A;  3RMS A;  1I5O B;  1UUE A;  2EYW A;  4FYX B;  4C5G A;  2KGT A;  3BG5 A;  3HP9 A;  2KXC A;  4ORZ A;  3GP8 A;  5IH2 A;  4YC3 B;  4GY5 A;  3FIF A;  3CME Q;  1NZ9 A;  1UE9 A;  4LD9 K;  3OMC A;  1UNG D;  2KT1 A;  2VXF A;  3CCL T;  1EIF A;  1UGP B;  4BD3 A;  2HQX A;  3HL8 A;  1QKW A;  3A8M B;  4BCJ B;  1T3L A;  4OGC A;  1SHF A;  1VQ4 Q;  3OYE A;  4QW2 A;  4J9H A;  2RHI A;  1KG1 A;  4JS4 A;  4E47 A;  1H1P B;  2CGH A;  3X26 B;  1HYO A;  3M4G A;  4FIB A;  1VOL A;  1JJ2 P;  3EG0 A;  3MIA B;  2DZC A;  1M2V A;  3E9F A;  1GFC A;  3M5A A;  1UHF A;  4N0A A;  5C6S A;  3HB9 A;  2QA4 Q;  2KRO A;  3NTH A;  3BHU B;  4YOS A;  4NL2 A;  1YIT Q;  4X34 A;  1OPK A;  3M4Y A;  1WHG A;  2H8H A;  1W1F A;  2CS7 A;  3MO8 A;  2HBW A;  4M78 C;  4ELZ C;  2CP0 A;  4CXA B;  2KR6 A;  4HNT A;  1K76 A;  3DLL A;  1G8X A;  3VKG A;  2V1Q A;  2EGC A;  4QQG A;  1WA7 A;  2CZ6 B;  1F5Q B;  3ME9 A;  5I22 A;  4F6S B;  1GL5 A;  3H0H A;  2RJC A;  2WIH B;  1H1R B;  2CP7 A;  2WPA B;  2O88 A;  2R57 A;  1OQK A;  5GAM f;  2RJD A;  3NPF A;  4J6Y A;  2B9R A;  4PJJ A;  1VIN A;  1N9R A;  1GFD A;  3C4S A;  4XK8 E;  5EC7 A;  4BDZ A;  4CI0 C;  3CCU A;  3HO8 A;  2CKK A;  1H24 B;  5GAM e;  2L89 A;  2C5V B;  3HZJ A;  4CC3 A;  5C0M A;  2JJ9 A;  1B7T A;  4F14 A;  3VS2 A;  2VAS A;  4M7D F;  5LMK B;  4PK4 A;  2P4T A;  4JJN K;  4EOO B;  2D9T A;  4MFD A;  1TD6 A;  1BCO A;  4KRD B;  4AFU C;  1G3W A;  4CFW B;  2LVM A;  2PJQ A;  2EGE A;  1O75 A;  4BCK B;  2KMG A;  3TNH B;  3FRN A;  2PUO B;  5GAO r;  2EQI A;  2XKO C;  4F7U F;  2E6Z A;  1QKX A;  4Z88 A;  1VQ9 A;  1OU8 A;  3RUX A;  2ZPI B;  3TN8 B;  5GJV B;  2ED0 A;  2RQU A;  2DNU A;  2UZB B;  3L2V A;  2BZ8 A;  2J6O A;  1VQK T;  1A0N B;  2HSP A;  1YJN T;  3I9Q A;  5CIU A;  3MY5 B;  1VQP A;  1M9S A;  3L2W A;  2XD0 A;  2VXE A;  3ULR B;  3EH2 A;  2EFI A;  2C06 A;  4OMF B;  4BUG A;  5L8R E;  1WHL A;  3CPW S;  2R5A A;  3C12 A;  1SRM A;  2JMA A;  2ROT A;  4FCY A;  5GMK m;  1BI3 A;  1RUW A;  2EQJ A;  2G3R A;  2OTJ A;  1FMK A;  3F70 A;  2LCS A;  2J7I A;  4BY6 C;  4AFZ C;  3EGD B;  2E64 A;  1FMW A;  3X25 B;  4F70 B;  1O9K A;  2XDP A;  1D1C A;  4O5V A;  4BB7 A;  4TVR A;  4N4G A;  3GNF B;  3RKW A;  5DY9 A;  1VQN A;  2QK0 A;  1QVF S;  1VQ5 Q;  1D3B B;  1S72 A;  5EJC A;  2KSS A;  2PTK A;  2A28 A;  2DXC B;  1VQO A;  4DA4 A;  3IQL A;  4NC6 A;  5GAO m;  1VQP Q;  2KBT A;  4DEY A;  3QDF A;  3L2Q A;  2YWW A;  2KE9 A;  3EG9 A;  4M78 B;  3LQ5 B;  3P8B B;  1H64 1;  4CFX B;  2JS2 A;  1YHQ A;  1VQ6 A;  3UWN A;  1U3O A;  2H3J A;  3EJ1 B;  1B34 B;  2KNB B;  3LH5 A;  3BLH B;  4HVV A;  2OTJ Q;  3DKM A;  3QHW B;  3VS5 A;  1KSW A;  3OYB A;  1TWB A;  4OGE A;  3X20 B;  2GFA A;  3CCV T;  2XI9 A;  2KMT A;  1GUX B;  5LJ3 h;  1K73 R;  4J6W A;  3QII A;  4IUU A;  3M0U A;  3L2R A;  2HKQ B;  1WX6 A;  4EOJ B;  4HVU A;  4RG8 A;  3X28 B;  1VQO Q;  4ANJ A;  3PIP A;  3CME T;  2DYI A;  5AT1 B;  3SEM A;  3VV0 A;  2JW4 A;  3CC2 T;  3CD6 T;  1N5Z A;  2EJG A;  2O4X B;  3C94 A;  3G71 Q;  2BPM B;  2F2C A;  4Z89 A;  1Y07 A;  2FG0 A;  1IRX A;  1UTI A;  4JRK A;  1VQ6 Q;  4ZGE B;  4K11 A;  4FYV B;  1V29 B;  1VQ4 T;  1X2K A;  2K3Y A;  5A0L A;  4ZGJ B;  2ATC B;  6AT1 B;  2XIC A;  2QTV A;  3CCQ A;  4OB2 B;  4BBR M;  1W70 A;  1G2B A;  2DJQ A;  5FW9 A;  4M75 F;  5CQY A;  1IRE B;  5GMK e;  4M77 F;  1K9A A;  5LJ5 e;  2KYB A;  2HBP A;  1G3S A;  3CC7 A;  4OMP A;  5KYX B;  3G33 B;  4JJB A;  1F1B B;  2DBK A;  1W2B S;  1YWP A;  1QCF A;  2CUD A;  3O0G D;  1KQ1 A;  2JVV A;  1WJQ A;  4KUI A;  1K73 U;  4CFV B;  2WJ9 A;  3MCA B;  2MOX A;  1M1K U;  1VUB A;  3MPU B;  2EKH A;  2EW3 A;  2E65 A;  4RTZ A;  3CCR A;  2KYM A;  4PL6 A;  4MZT A;  3KFV A;  4JJD A;  3B57 A;  5IHY A;  4FYW B;  4PJO B;  2JM9 A;  3WVE B;  1PWT A;  4KGZ B;  5ECA A;  4AMC A;  3LW5 E;  1AD6 A;  3MHX A;  4AFQ C;  4JX5 A;  5I2M A;  4II5 B;  1CKB A;  2FZG B;  4C0D B;  1K73 C;  4HL4 A;  1M1K C;  4MZM A;  3OYN A;  3QWY A;  3CCQ Q;  2DXU A;  4BY6 B;  4JPB W;  1RLQ C;  2D0N A;  3VYG B;  2YRV A;  4FU6 A;  2ZPH B;  1YI2 Q;  4OMO A;  4PFZ A;  3NFC A;  4BY7 X;  1D1B A;  5IXF A;  4M7A C;  4C92 C;  4Y28 E;  3OYM A;  2YLC A;  3CEY A;  2L5Q A;  1N8R U;  2HMA A;  3O8V A;  3QXE B;  2DF6 A;  1ZUY A;  4C92 G;  2HSE B;  1TOV A;  4EIK A;  3CCM A;  5GAM d;  1QMC A;  4OVA A;  1BB9 A;  4CFU B;  2DEQ A;  3QYB A;  4R55 A;  1TU0 B;  4LD6 A;  3A1P A;  4OB1 B;  3BHV B;  1YJW A;  4IUR A;  3X24 B;  4EOS B;  1C6V X;  4QVD A;  2L3Q A;  3NDQ A;  3HFO A;  4AI6 A;  4RTU A;  2XDB A;  4CC4 B;  4OMN A;  3E19 A;  5CK9 A;  3RDV A;  2BS2 A;  2MWP A;  2LQ8 A;  1YBY A;  1OUL A;  2DRM A;  2YXY A;  2GTJ A;  1JJ2 S;  1R0B G;  2COY A;  2DET A;  1K8A U;  3TW7 A;  1TTH B;  3CCU T;  4JLG A;  1J3T A;  1PSF A;  2KT8 A;  3DL1 A;  2PU9 B;  1BI2 A;  1I81 A;  2DE0 X;  4MFE A;  1VA7 A;  3L1A A;  2X4W A;  1MGQ A;  3AT1 B;  3QZ5 B;  2RQT A;  2EIF A;  1GCP A;  1ZSG A;  3SWN A;  4M75 B;  5J26 A;  1D0Z A;  4RCC A;  1K8A C;  1S1N A;  2W0Z A;  2F5T X;  3SD4 A;  4RTX A;  1FWZ A;  2LP5 A;  3CC4 A;  2P4R A;  1OOT A;  2ZGW A;  5D7U A;  1Y71 A;  4Q5W A;  2Y4Y A;  1YJW Q;  4RTV A;  2NLU A;  2CCH B;  1ARK A;  3OW2 A;  2CCI B;  4M7A D;  1VQ9 T;  1C9B A;  1FMV A;  4C92 D;  2RO0 A;  1XTD A;  5CR2 A;  2FB7 A;  1TXQ A;  2YLB A;  1G83 A;  2M0Y A;  1VQP T;  4EMK A;  1IO6 A;  4GLM A;  5IAY A;  2EJ9 A;  2WSF E;  2QEX A;  1RL2 A;  4B9X A;  5FGK B;  4CFN B;  3N5B B;  4LUE A;  2DL3 A;  3QO3 A;  3CC4 Q;  3OB9 A;  5IDN B;  1UJY A;  2B86 A;  4E2F B;  1AT1 B;  2I53 A;  3JB9 H;  1Z9Q A;  3CXC A;  3CCJ A;  3V7S A;  1WZO A;  2J05 A;  3WVD B;  2KRM A;  1Y0M A;  2SRC A;  3H8Z A;  5LJ5 g;  2O9S A;  3CMA A;  5CKH A;  3M59 A;  1KIK A;  4ZNX A;  1ABO A;  1VQN T;  2C0T A;  3BFM A;  4XU1 A;  1S72 T;  4BAC A;  1H25 B;  2KY9 A;  2O2O A;  2W10 A;  2PNI A;  3CBO A;  3EGD A;  1VQO T;  2NUP B;  3BDU A;  4D8K A;  1WHK A;  4QT7 A;  2PHG A;  2E4H A;  1QMZ B;  2XK0 A;  3CCE A;  1ZLM A;  3GNG A;  3A8H B;  2QEX Q;  1Q86 R;  2VYT A;  1YWO A;  1YHQ T;  1JB0 E;  4E7L A;  1D1A A;  2DEU A;  4J9G A;  1OI9 B;  2DRK A;  5CCA A;  2J6K A;  1WXB A;  1QVG A;  4KGV B;  3RNJ A;  1KJW A;  1AWJ A;  3I5S A;  2QDL A;  2DYB A;  1RAC B;  2DM1 A;  3BW1 A;  4M78 A;  1KQS A;  2MIO A;  3CMA Q;  1ZSZ B;  2ZPB B;  2RK2 A;  1FYN A;  1Q7Y R;  3TEE A;  2RQW A;  4Y72 B;  3TQ7 P;  4ZN1 A;  1WJS A;  1H3Z A;  3MJX A;  2RJF A;  4J9C A;  2E70 A;  2SEM A;  4J6X A;  4E6R A;  2CP2 A;  3CCE Q;  3I35 A;  3RER A;  5GAN 2;  1VIE A;  5I2S A;  1D3U B;  2KR3 A;  3HSB A;  4XU0 A;  3OYA A;  4PFP A;  2W99 A;  1VQ8 A;  4A53 A;  4PLL A;  2V22 B;  1H3H A;  5CQX A;  5LJ3 e;  4M7A E;  1AD5 A;  2QXF A;  3EFO A;  4DOW A;  1VQ7 Q;  4C92 E;  2HEQ A;  2VC8 A;  3PIO A;  3JV3 A;  1IZ6 A;  3CBM A;  3CC7 T;  1U5S A;  3JCM J;  2BTT A;  3QSU A;  4BBS M;  3PGG A;  3THK A;  4RG2 A;  1M8M A;  2JZ2 A;  3REB B;  8AT1 B;  1Q7Y U;  4XQ3 A;  4IIO A;  3OYK A;  1AOJ A;  3H41 A;  1OKV B;  3G4S Q;  3CCR T;  3G1J A;  4C8Q C;  2RNA A;  2LQW A;  5HBJ B;  5KYX A;  1M1F A;  1H4L D;  4LNP A;  4ESR A;  2R58 A;  1OIY B;  3VS4 A;  1Q7Y C;  2M51 A;  3JCM g;  2DL4 A;  2EPD A;  2EQM A;  4E7S A;  2L3S A;  2LJ1 A;  4E7I A;  4IUV A;  1BBZ A;  2RPN A;  3VS0 A;  2QQA A;  4X9D A;  4EOM B;  4A54 A;  1YIT A;  4C5H A;  3OYC A;  2K5L A;  4HCB A;  4A4H A;  3CXC P;  1YP5 A;  2LTO A;  2ZPF B;  4DBR A;  1VYW B;  2AT1 B;  3HBL A;  4RMO A;  2BS4 A;  4O6J A;  1VQM Q;  3RKY A;  3MY1 B;  3OYH A;  5GMK i;  4BCQ B;  3CCM T;  4XTV A;  2XMF A;  2JTE A;  3I55 A;  2D8J A;  4QVZ A;  3SDZ A;  1YJW T;  4MDW A;  4FL6 A;  3V8L A;  2ZPE B;  2C5X B;  5IDP B;  3BDL A;  4KRT A;  3NTI A;  3JCM P;  3OS2 A;  4FT4 A;  2RI5 A;  3VU3 C;  4CC2 A;  1QVG P;  4KUD K;  2DXB B;  2DTO A;  3JB9 G;  2PVD B;  1AVZ C;  4E7Z A;  3RMQ A;  4AFS C;  3RGF B;  5IHI A;  2MYS A;  2DL7 A;  5A2Q E;  1WPY A;  3QG1 A;  4F7J B;  3OSV A;  1JO8 A;  1PRM C;  4AKG A;  4M78 G;  3PO3 S;  3OS1 A;  3PTA A;  3DJB A;  4F16 A; 
#chains in the Genus database with same CATH homology
 5LL6 S;  2HQE A;  3QYE A;  3CCS A;  3DKM A;  4P5N A;  4C0F A;  3OYB A;  3CC4 T;  3ZEH A;  1DJ7 B;  1KQS S;  3GPL A;  4XTY A;  3G6E T;  3E9G A;  1OI1 A;  4J7I A;  4OGE A;  4M7D C;  3X20 B;  2LRQ A;  2PUK B;  4KT0 E;  1FKM A;  2GFA A;  2RHY A;  5LJ3 f;  3CCV T;  1U1T A;  3JCM h;  4NL3 A;  2XHC A;  2KMT A;  2XI9 A;  2K2V A;  4JLI A;  5GAM h;  5LJ3 h;  1RI0 A;  2RH2 A;  3HPW A;  4J6W A;  3QII A;  4IUU A;  3L2R A;  3CCQ T;  2DJZ A;  3QUI A;  1P92 A;  2DIG A;  4CRI A;  3I56 T;  2DVE A;  3OS5 A;  2QQ9 A;  4X9C A;  4JRP A;  2OAU A;  4OP0 A;  4RG8 A;  3X28 B;  3VKH A;  4IUT A;  2O4X A;  4N4H A;  2M16 A;  4F7U A;  4II1 A;  5IT9 E;  1YJ9 T;  4OF1 A;  1YIJ T;  3PIP A;  3PNW C;  3CME T;  2XDD A;  5HKC A;  1YI2 T;  3MET A;  3VV0 A;  5GAN 3;  2QI2 A;  4J5Y A;  5GAN 5;  3CC2 T;  4C5I A;  3CD6 T;  2O4X B;  2EJG A;  3C94 A;  3LH0 A;  4BI8 B;  4L6V 5;  2ZCF B;  2F69 A;  2EJF A;  4C0Z A;  3JB9 J;  2Y90 A;  4XU3 A;  3OY9 A;  1Y07 A;  1NPR A;  2EQK A;  2WAC A;  3FDR A;  4JRK A;  4C8Q A;  4ZGE B;  2DO3 A;  1E7P A;  2RM4 A;  1VQM A;  1M8V A;  1U8R A;  1V29 B;  5DLQ E;  2QEX T;  1X01 A;  5A0L A;  2K3Y A;  2E12 A;  4ZGJ B;  1BIB A;  3FJP A;  3L2Z A;  4HKE A;  5HK0 A;  3OYF A;  1M90 U;  2XIC A;  3CCQ A;  4JX4 A;  4OB2 B;  4BBR M;  4C8Q B;  4M75 F;  5CQY A;  1IRE B;  2CZ0 B;  5GMK e;  4M77 F;  2P0K A;  5KCO A;  2QFZ A;  3JB9 D;  4HCZ A;  5GMK l;  5LJ5 e;  4BE2 A;  3JCM W;  1VQL T;  2HBP A;  2JN0 A;  4C5E A;  2GFU A;  3OS0 A;  4HCC A;  4VUB A;  1G3S A;  1M5Q 1;  1QP3 A;  4C8Q G;  2EQU A;  4BE1 A;  2PVG B;  3CC7 A;  1KHI A;  5GAO q;  1LNX A;  3QPH A;  3M9Q A;  3V7C A;  2RI3 A;  1VQ5 A;  5J3B A;  1W2B S;  5LJ3 g;  3CCJ T;  1M90 C;  1Y96 A;  2VUB A;  4M78 D;  1WQW A;  4JRQ A;  1KQ1 A;  2JVV A;  4KUI A;  1WJQ A;  3DLM A;  2QF7 A;  4EPC A;  1K73 U;  2WJ9 A;  3RES A;  4PJO A;  3MCA B;  2LNV A;  2QQS A;  4JUV A;  5D6W A;  1M1K U;  1VUB A;  2KK4 A;  2E65 A;  5HK3 A;  4AKI A;  1Y96 B;  3A8O B;  1BI0 A;  2GCX A;  3CCR A;  2V8I A;  1SSF A;  4PL6 A;  4MZT A;  4EMH A;  5EG2 A;  3OYD A;  3S3M A;  4OB3 B;  4M77 E;  4LDV A;  4PJO C;  3M55 A;  4PJO B;  3L42 A;  4YTL A;  1M4Z A;  2IG0 A;  4IUP A;  3WVE B;  4HA8 A;  3A8L B;  3VUB A;  3LW5 E;  3FLG A;  5GAO l;  3MHX A;  4JX5 A;  2B8A A;  3MEW A;  5I2M A;  2HNI A;  4IUQ A;  3P8H A;  4PJO G;  3S6W A;  4C0D C;  4E7K A;  1XQH A;  4C0D B;  1K73 C;  2LCL A;  3LWH A;  3CCE T;  2A7Y A;  1QW1 A;  1Y7X A;  1WQ7 A;  2AHJ B;  4HL4 A;  4M6V A;  2M9U A;  4MZM A;  1M1K C;  3OQ5 A;  2GQV A;  3OYN A;  1JRI A;  2LX9 A;  3H4C A;  2DXU A;  1VQK A;  3VYG A;  4BY6 B;  5IN1 A;  5CAI A;  2LQK A;  1I4K 1;  4FT2 A;  1YJN A;  2DPP B;  4OB0 B;  5GAM j;  3ZFJ A;  5LJ3 j;  2EYQ A;  5DM7 R;  2DD5 A;  4A4G A;  1HXD A;  3OYJ A;  3VYG B;  2YRV A;  4E7H A;  4FU6 A;  2K5F A;  2ZPH B;  3UT1 A;  3TU4 K;  4M7A A;  4C92 A;  3VKI A;  3M56 A;  4NS5 A;  5FRM A;  2DD5 B;  3NFC A;  5GAN 8;  4L59 A;  4M7A C;  4M7A B;  2D6F A;  1QVP A;  4C92 C;  5DLO A;  4Y28 E;  2EKO A;  4PKC C;  1VIF A;  4C92 B;  3OYM A;  2YLC A;  5FRO A;  3GOX A;  3CEY A;  2L5Q A;  3JSC A;  4FM4 B;  3OYY A;  3OA6 A;  1K9M U;  4JRI A;  3O8V A;  2JOY A;  1N8R U;  3JCM d;  2QQB A;  3QXE B;  3GF5 A;  4C92 G;  3CCM A;  3Q1J A;  5GAM d;  1NJI U;  3QJ6 A;  4OVA A;  4C8Q D;  3G71 A;  1N9S A;  2DEQ A;  4BI4 A;  4MMK A;  3QYB A;  4DQ2 A;  4R55 A;  1G5V A;  5CKF A;  3QWL A;  4LD6 A;  4XU2 A;  2L8D A;  3T9N A;  4OB1 B;  3FB9 A;  2KAF A;  5GMK j;  3INZ A;  1YJW A;  2CZ7 B;  4IUR A;  3X24 B;  3QJY A;  4QVD A;  4WF2 A;  4KBM B;  5FU6 C;  3VYH B;  2DTH A;  4AI6 A;  3HFO A;  5FU6 B;  3UDC A;  3V7R A;  5GAN 7;  2XDB A;  3JCM V;  1K9M C;  2FYK A;  5GAN d;  4ZTJ A;  3E19 A;  1FXX A;  4UC4 A;  3KHI A;  2BS2 A;  2D0Q B;  1U1S A;  2DAQ A;  2MWP A;  2LQ8 A;  1YBY A;  5CK9 A;  1NJI C;  4FSX A;  1JJ2 S;  1VQ4 T;  2ZPG B;  2V8J A;  1VQ8 T;  4M7D B;  3HFN A;  2BS3 A;  3S3O A;  2LCC A;  1K8A U;  2E10 A;  3TW7 A;  2WSE E;  4J8O A;  4XAX B;  3CCU T;  1X6O A;  4JLG A;  1PSF A;  2DTI A;  2QTX A;  3MP8 A;  4PJO D;  3DL1 A;  2QQ8 A;  2PU9 B;  1BI2 A;  1I81 A;  1XOV A;  4M7D G;  5KH6 A;  4MFE A;  3MP6 A;  4M75 A;  2OTL A;  3L1A A;  5GAN 4;  3JB9 F;  3KUF A;  4M77 A;  2X4W A;  4EMG A;  4R56 A;  1MGQ A;  3QZ5 B;  2M1H A;  3KXT A;  5GAO p;  2EIF A;  2JTF A;  1M1G A;  2XID A;  5HY6 A;  4M75 C;  3GLX A;  3SWN A;  4M75 B;  4M77 C;  5J26 A;  4N4I A;  4RCC A;  1PSE A;  1K8A C;  2PVO B;  1Q86 U;  2F5T X;  3SD4 A;  4F7U B;  3CC4 A;  1FWZ A;  4M78 F;  3SWN C;  4HLQ A;  3JCM Q;  1HK9 A;  4J83 A;  4QQD A;  3SWN B;  3G6E A;  4J7F A;  2ZGW A;  3V8K A;  3FC3 A;  1Y71 A;  4Q5W A;  2Y4Y A;  2BUD A;  3M54 A;  3QHS A;  4JDS A;  5FLX E;  3SFM A;  2MAM A;  4F7U G;  3CCV A;  3QYH B;  4D6W A;  2NLU A;  5LJ5 f;  5GAO n;  2BKD N;  5GMK h;  5D6X A;  4A4K A;  3OW2 A;  4HT9 A;  5LJ5 h;  4MDX A;  2F5K A;  5D6Y A;  3RKX A;  3I56 A;  4XTW A;  5GAN f;  4M7A D;  2G77 A;  1VQ9 T;  1JBM A;  4Y91 A;  2LDM A;  4C92 D;  2VGN A;  4AKH A;  2ZZD A;  1Q86 C;  4ME7 A;  1UGQ B;  2RO0 A;  3ZBD A;  1YJ9 A;  1XTD A;  2JNG A;  1YIJ A;  4HNU A;  5CR2 A;  3CME A;  5M9O A;  1YI2 A;  4ZN3 A;  2CYZ B;  1YCY A;  2FB7 A;  1G3T A;  3E1S A;  4M78 E;  2RHZ A;  1BI1 A;  2ZZD B;  2YLB A;  3PMT A;  5GAN e;  3CC2 A;  3CD6 A;  2QA4 T;  1UGR B;  2GF7 A;  4QSH A;  1QLB A;  1I8F A;  4JS5 A;  3NTK A;  1KD1 U;  5FRN A;  1YIT T;  4MIM A;  2EAY A;  1NE8 A;  4Z02 A;  4EMK A;  1VQP T;  2DXT A;  3CMA T;  5IAY A;  2P0P A;  4KUL A;  2EJ9 A;  2WSF E;  2QEX A;  3LGL A;  1VQ4 A;  1OYX A;  2K57 A;  2O01 E;  3BY7 A;  3DB3 A;  3MEU A;  4EMK C;  1RL2 A;  4B9X A;  4EMK B;  3EAE A;  2I2L A;  3N5B B;  1OZ3 A;  3CPW A;  2LT4 A;  2DD4 A;  3P8D A;  3MEA A;  4HT8 A;  3J81 E;  3QO3 A;  4PNO A;  3QBY A;  1VQL A;  3OB9 A;  4HNV A;  1O9S A;  3ASK A;  1KD1 C;  2E41 A;  2MI6 A;  2RJE A;  3A5Z B;  2DD4 B;  4M7D D;  5GAN 6;  3JAM E;  1ZBX A;  4ELY C;  2RK1 A;  3UPU A;  3JB9 H;  2QA4 A;  2JUF A;  2PQW A;  3JCM X;  2V8K A;  3CXC A;  4C8Q F;  3V7S A;  3CCJ A;  1WNL A;  4RCB A;  3WVD B;  3H8Z A;  4RKU E;  2X4Y A;  5FU7 C;  5FU7 B;  3VUZ A;  3RMS A;  5LJ5 g;  3CMA A;  4C5G A;  1FX7 A;  2MMP A;  3HP9 A;  3BG5 A;  5CKH A;  3M59 A;  3R6O A;  3GP8 A;  3OYI A;  4DOV A;  2DIQ A;  2VV5 A;  3MP1 A;  3FIF A;  4GY5 A;  4M75 D;  1NZ9 A;  5GAN g;  1VQN T;  3GIB A;  5KE2 A;  4LD9 K;  3C95 A;  3OMC A;  3BFM A;  4XU1 A;  2VXF A;  5CKB A;  3HHT B;  3CCL T;  1S72 T;  4BAC A;  1VQ7 T;  1EIF A;  2KY9 A;  3ER0 A;  3CBO A;  1UGP B;  4BE0 A;  3URG A;  1VQO T;  4BD3 A;  3BDU A;  2HQX A;  2XG8 D;  1BYM A;  2QDJ A;  3WXM B;  2XK0 A;  3CCE A;  3HL8 A;  4A4F A;  3V8J A;  3A8M B;  4C8Q E;  3GNG A;  3A8H B;  4OGC A;  3OYE A;  4XTX A;  4QW2 A;  1N27 A;  4M7A G;  2RHI A;  1UB4 A;  4PJO F;  4JS4 A;  4E47 A;  1KG1 A;  2VYT A;  2CGH A;  5CVI A;  3X26 B;  5LJ3 d;  1TH7 A;  1ZHI A;  2YHT A;  3M4G A;  4FIB A;  1YHQ T;  1JB0 E;  3JCM c;  4E7L A;  2RHU A;  3G4S T;  2DZC A;  2WSC E;  1I5L A;  3M5A A;  3E9F A;  4N0A A;  2A3L A;  4XTU A;  5C6S A;  5LJ5 j;  4PLI A;  3HB9 A;  3PT9 A;  5CCA A;  1QVG A;  2RD1 A;  3J80 E;  3CCS T;  3CCL A;  2RB6 A;  4N0A C;  1N8R C;  2P0Q A;  1X75 C;  3NTH A;  2QQR A;  4NL2 A;  3EFR A;  3BW1 A;  4M78 A;  4X34 A;  3RIR A;  1KQS A;  3M4Y A;  1XNI A;  3HRT A;  2FL7 A;  2XU8 A;  2ZPB B;  2CS7 A;  2RK2 A;  1W4S A;  3M58 A;  3MO8 A;  1Q81 U;  4PJO E;  1WJR A;  4M78 C;  4ELZ C;  4JX6 A;  3TEE A;  2DZ9 A;  4ZN1 A;  1G3Y A;  1WJS A;  1GXI E;  1H3Z A;  1WGS A;  2KVQ G;  2RI2 A;  2KR6 A;  4HNT A;  1MHN A;  2RJF A;  4MZP A;  3DLL A;  2E70 A;  3VKG A;  4J6X A;  2X4J A;  4XTZ A;  1QVG S;  4QQG A;  2L3R A;  2X4X A;  2CZ6 B;  3M53 A;  3ME9 A;  4LDX A;  5A0D A;  1QP2 A;  2RJC A;  3RER A;  5GAN 2;  4BDY A;  4LDY A;  4M77 B;  4QQ6 A;  1Q82 U;  1Q81 C;  1VIE A;  3JCM f;  2K5I A;  2QDY B;  2CZ1 B;  2M0O A;  2R57 A;  5I2S A;  5GAM f;  2RJD A;  4M75 G;  3HSB A;  4J6Y A;  4M77 G;  4XU0 A;  3OYA A;  1VQM T;  2K4Y A;  4LDU A;  3SB2 A;  1VQ8 A;  1N9R A;  3VJP A;  4A53 A;  3C4S A;  3QDR B;  4PLL A;  4XK8 E;  3JCM e;  4CI0 C;  4BDZ A;  3CCU A;  3OYG A;  3HO8 A;  2KQW A;  1BIA A;  5CQX A;  2CKK A;  5GAM e;  2RA2 A;  2L89 A;  5LJ3 e;  2JTM A;  4M7A E;  3KBG A;  2QXF A;  4DOW A;  2LT1 A;  4C92 E;  2VC8 A;  3J7A F;  3HZJ A;  3LLR A;  1Q82 C;  3MEV A;  5C0M A;  3PIO A;  3JRZ A;  2R5M A;  1IZ6 A;  2MWO A;  1R8O B;  3CBM A;  3CC7 T;  4M7D F;  2VGM A;  5GAN h;  2P4T A;  5I21 A;  3JCM J;  4JJN K;  5CKE A;  1VQ5 T;  3QSU A;  4BBS M;  1UEB A;  2D9T A;  4MFD A;  3HRS A;  4ATO A;  3PGG A;  2RHX A;  1G3W A;  3M57 A;  4LOC A;  4RG2 A;  1W2B A;  2JZ2 A;  3BG3 A;  2LVM A;  3OSS C;  1Q7Y U;  1UGS B;  3LGF A;  4XQ3 A;  3OYK A;  3QZ9 B;  3JB9 I;  1O75 A;  2E6N A;  3CCR T;  5J39 A;  1KHC A;  2KMG A;  4C8Q C;  4E7J A;  3FRN A;  2PUO B;  4C0G A;  5GAO r;  3OW2 S;  1BKB A;  2KDS A;  4EDU A;  4NOY A;  2XKO C;  1M1F A;  4F7U F;  2E6Z A;  3OMG A;  1VQ9 A;  4M7D E;  2E5Q A;  2R58 A;  3FEO A;  3TCJ A;  3RUX A;  2ZPI B;  1Q7Y C;  3JCM g;  2OTJ T;  3L2V A;  2EQM A;  1N6A A;  2MF2 A;  4ELJ A;  3DB4 A;  5GAM g;  1LJO A;  2X35 A;  1VQK T;  4E7I A;  4IUV A;  4B9W A;  3S3N A;  1YJN T;  2QQA A;  2IVW A;  3PFS A;  5CKD A;  4X9D A;  3I55 T;  5CIU A;  4Z6Y A;  2FVU A;  4A54 A;  1M9S A;  3L2W A;  1VQP A;  1YIT A;  1AHJ B;  4C5H A;  3OYC A;  2XD0 A;  3A8G B;  2K5L A;  2VXE A;  4HCB A;  2Y4X A;  4A4H A;  2EFI A;  2C06 A;  4M75 E;  4OMF B;  2EWN A;  2BIV A;  4BUG A;  2HAX A;  5L8R E;  3TW6 A;  2LTO A;  5AYF A;  3CPW S;  2R5A A;  2ZPF B;  3EFS A;  4F7U E;  2FHD A;  5KCH A;  4M77 D;  3JCM b;  1LOJ A;  3LWI A;  3HBL A;  3C12 A;  3CBP A;  3HKS A;  1QVF A;  4RMO A;  4QVC A;  2BS4 A;  5GMK m;  1BI3 A;  2EQJ A;  4O6J A;  3RKY A;  3LYI A;  2G3R A;  3OYH A;  2OTJ A;  4IKF A;  2K3X A;  5CO7 A;  4LDW A;  5GMK i;  3F70 A;  1KC8 U;  4L5G A;  3CCM T;  4XTV A;  3CXC S;  4BY6 C;  3TRE A;  2E64 A;  3G71 T;  3X25 B;  2E1H A;  3OBW A;  3I55 A;  2DKG A;  2XDP A;  3OBY A;  4QVZ A;  3SDZ A;  1YJW T;  3PMI A;  1VQ6 T;  5KE3 A;  4O5V A;  4BB7 A;  4MDW A;  4FL6 A;  1D3B A;  4TVR A;  3V8L A;  4N4G A;  2ZPE B;  3BDL A;  2DXC A;  3GNF B;  3RKW A;  5DY9 A;  3H6Z A;  3NTI A;  3JCM P;  1VQN A;  1QVF S;  3HRU A;  4MML A;  3OS2 A;  2DXB A;  4FT4 A;  1D3B B;  1KC8 C;  1S72 A;  1VQ7 A;  5EJC A;  4ZGD B;  2KSS A;  2RI5 A;  4GLK A;  3VU3 C;  2DXC B;  1ZQ1 A;  3L2U A;  5GAN j;  2HD0 A;  4DA4 A;  1VQO A;  4BI3 A;  4KUD K;  4NC6 A;  5GAO m;  2DXB B;  2DTO A;  1JJ2 A;  1OZ2 A;  3JB9 G;  2PVD B;  3L2Q A;  3RMQ A;  5A0G A;  2DK3 A;  4ZTF A;  4M78 B;  1B34 A;  3G7Z A;  2LC4 A;  5A2Q E;  2OTL T;  3P8B B;  1H64 1;  3BG9 A;  3LX7 A;  1YHQ A;  1VQ6 A;  3UWN A;  1WPY A;  3QYG B;  5LJ5 d;  3QG1 A;  3OSV A;  4V2S A;  2H3J A;  4AKG A;  3OYL A;  3CPF A;  4M78 G;  4M7A F;  3G4S A;  3OS1 A;  4C92 F;  1B34 B;  1NPP A;  3QKJ A;  3PTA A;  1KQ2 A;  3AHU A;  4A4E A;  4M7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...