2ZPEB

Nitrosylated fe-type nitrile hydratase with tert-butylisonitrile
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
211
structure length
211
Chain Sequence
MDGVHDLAGVQGFGKVPHTVNADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrile hydratase subunit alpha
publication title Catalytic mechanism of nitrile hydratase proposed by time-resolved X-ray crystallography using a novel substrate, tert-butylisonitrile
pubmed doi rcsb
molecule tags Lyase
total genus 59
structure length 211
sequence length 211
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 2008-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2zpeB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2zpeB02
3A8LB 2DD4A 3VYGA 1AHJB 1IREB 2WSFE 1PSFA 3HHTB 2DD5B 2CZ7B 2ZPFB 4ZGJB 2ZPEB 2WSEE 1DJ7B 4OB3B 2AHJB 2ZZDA 2PVDB 1JB0E 2CZ1B 4OB0B 2O01E 2DXBA 2DXCB 2ZCFB 1QP3A 2PUOB 4L6V5 1UGQB 4Y28E 2CYZB 2PUKB 1UGSB 4XK8E 3LW5E 2ZPIB 2ZPGB 1QP2A 3QZ5B 4ZGEB 4OB2B 2DD5A 3QZ9B 3WVDB 3X20B 2PVGB 2CZ0B 2PU9B 3WVEB 2DPPB 3VYHB 3A8OB 2ZPHB 3A8GB 1PSEA 3A8MB 1GXIE 2DD4B 4OB1B 5L8RE 2WSCE 3X28B 3VYGB 2DXCA 1V29B 2PVOB 3X24B 4KT0E 1UGRB 1UGPB 4RKUE 4FM4B 2D0QB 2QDYB 3X25B 3X26B 4ZGDB 2ZZDB 3QXEB 3QYHB 3QYGB 3A8HB 2DXBB 2CZ6B 2ZPBB
chains in the Genus database with same CATH superfamily
4VUBA 2KE9A 1M2OA 1VOMA 1WDXA 1W1FA 1YJ9T 4FL6A 3NDQA 2P84A 4CC2A 4L59A 1LPLA 4L5GA 2ZAEA 5KE3A 3KUFA 3M5AA 1T3SA 4CFWB 5GAN2 5J3BA 1UJ0A 2A08A 2EPDA 2DD5B 2ZPFB 2EGEA 3BHUB 2D6FA 2HD0A 1K4US 2DZCA 4RCCA 1PKSA 3UPUA 4Z89A 1LVKA 4HT9A 2KVQG 3M0UA 3CPWS 3OYJA 5GAOr 5AYFA 2JMCA 4FYWB 2DXCB 1YNZA 4NL3A 1E6GA 2RQVA 4GLKA 3VV0A 3CQTA 1IRXA 3EG2A 4J83A 3VS0A 4ZNXA 3E2UA 5GANd 2ZPIB 3O8VA 3V8JA 4OB2B 3DDPB 1PD1A 2E3HA 4KRTA 1SSHA 4F14A 3QJ6A 4AMCA 3F70A 1OPLA 5EJCA 3OYLA 1M1GA 3CXCS 1M2VA 2DAQA 5GAN7 5GAN4 1BIBA 4ANJA 2PK9B 4F7UE 4DBHA 2HBPA 1K8AU 4OGEA 5KCOA 2DIGA 2K3XA 1Q86R 1RLPC 3OYMA 2E5KA 5GAOn 2JMAA 3CEYA 1OU8A 4NL2A 4HNUA 4F7UF 2DL8A 4BE1A 1SHFA 2KRSA 1AISB 4BCIB 1R0BG 3CBMA 3Q1JA 4JX4A 4CFNB 1UGVA 1KG1A 3FLGA 5GAOm 4PKCC 3F5XB 1TTHB 3EGDA 3R6NA 2XKOC 1VQ7A 2NUZA 4LDWA 3GPLA 3MEVA 2K5LA 5FRNA 4FU6A 2DO3A 5LJ3d 1A0NB 2K57A 4D8KA 2RMOA 4HVUA 1O9KB 3URGA 1VQNQ 1VQOQ 2G9XB 2BZ8A 4M4ZA 1WHHA 1N27A 1B34A 2L3QA 1EX4A 2EFIA 4EC9B 1KQSA 1W70A 4F6SB 3VS1A 1WXTA 3M58A 1QVGS 2NYSA 3GNGA 1GFCA 4CXAB 2YDLA 5IH2A 1K0SA 1BKBA 4BCMD 3JCMc 2C5OB 2FHDA 4PJMA 1QVPA 4PJJA 2J05A 4PFOA 3CCEA 1ZHIA 4EOQB 4EIKA 1VUBA 3RIRA 5KYUB 3JCMh 3JCMb 4J9BA 2K7AA 2CDTA 1YJWQ 1TD6A 3H9NA 2G3RA 1RAFB 4C8QA 5J39A 1D0ZA 4M77D 2RB6A 1NBEB 1OI1A 1XNIA 2LCCA 2E70A 3V7RA 4C5EA 4Q5WA 4Z88A 1PKDB 5FWBA 2FPFA 4KGVB 3OYEA 1QVFP 3L2UA 1VQNT 1VQOT 2X4XA 2L3SA 2KXDA 1KD1C 1JXMA 4PJOD 1B7TA 4IUQA 2W9FA 3A8MB 1HYOA 1NLOC 1Q95G 4BCKB 3JB9H 3VYGB 1WXBA 1TU0B 1QMZB 3M53A 2K2MA 1EZZB 4FYYB 4KT0E 3OW2P 2A36A 2X3XD 4DQ2A 2KT1A 2JM9A 2PJQA 4J8OA 4M77G 4J9GA 4JZ4A 3VUBA 1YJWT 5D6XA 4QVCA 2RHIA 3QYHB 4PJOG 2A0FB 4PLIA 5DLQE 4M7DB 2OAUA 1ZBXA 4N4IA 4FT4A 1Q82U 2KR6A 3C94A 4C92A 2HQEA 1R77A 1H1RB 2K2VA 1JJ2P 5I2MA 3RBBB 4M78A 2X4JA 1PSFA 2BTTA 1R8OB 2CCHB 1N9RA 2CREA 2X35A 3EH1A 4CC4B 4OMFB 1WYXA 1H4LD 2E4HA 5IF1B 4A4HA 2DNUA 2COZA 3KFVA 3OBWA 3VUZA 1W2BS 1BBZA 3J7AF 4XU0A 1YHQQ 1WHGA 5KYXA 1R0CB 4RUGA 5CEIB 4C0GA 3JB9I 3OSVA 2DZ9A 1MGQA 5FROA 3H41A 5C0MA 3RMQA 2EVRA 2OX7A 4E6RA 4BCND 2PUKB 1M27C 1KD1R 3OS1A 1WHMA 1B07A 5HK0A 4PLLA 2E64A 3MY1B 1QP2A 3MP6A 4M78C 2E12A 3EJ1B 3BG9A 4AKHA 2W96A 1BYMA 1U1TA 2J6KA 2DPPB 3BLQB 4A63B 1WQ7A 3SD4A 4MMKA 3H8ZA 2QEXT 1KHIA 2M51A 2CT4A 2X4YA 4PNOA 2DD4B 2LMJA 3PVQA 1VQOA 3X28B 3CC4Q 1RABB 2D1XA 4FT2A 2YUQA 4J6WA 5HVYB 4J9IA 3J81E 4YTLA 4BDZA 4CFVB 2FVUA 5LJ5h 3CCLQ 2JVVA 2I40B 1D3UB 1NJIU 4RKUE 4JJNK 3JCMP 4C5IA 1PC0A 1S1NA 5CKHA 1I07A 2CH4W 4CFUB 5IN1A 3OYYA 4F16A 4HNTA 1SHGA 4J6YA 2LQKA 1S72T 1NYFA 1Q81C 2DXBB 4BY7X 1NEGA 3H0IA 2DEUA 1OIUB 2RH2A 2BS4A 3VRYA 1XTDA 2I0NA 2HCKA 4BI4A 1GRIA 5A0DA 2DETA 1WLPB 3EGXA 5GAMg 3LGLA 1HJDA 4BCOB 4QQGA 4UN0A 5AT1B 5IAYA 1JSTB 1EFNA 5HK3A 3CMEQ 3JCMd 2R5MA 2C6TB 1ZBJA 1TFBA 2C5XB 2BS2A 2D0NA 4JX5A 3CC4T 1IB8A 2WSEE 2L5QA 1H3HA 2RI2A 3G71Q 1VIFA 2BKDN 4JRIA 3CCLT 3CCUQ 1AOJA 5CKDA 3PMTA 3MKDA 3EIDB 2JTFA 2QDJA 2RQTA 5CQXA 4AFZC 2V22B 3E9FA 2BE7D 4PK4A 2EJ9A 3E9GA 3H0HA 1H1PB 2OTJA 4ZN1A 5GAN8 1U5SA 1U3OA 1HK9A 1VQKQ 2ED0A 2JT4A 2B9RA 2FZGB 4HVVA 4RTUA 3ME9A 1K9MC 2DJZA 2O88A 2CUDA 4N4HA 2W0ZA 3WVEB 1E9HB 1SEMA 1UB4A 1OIYB 4R56A 1VQLQ 2EQKA 4M7AE 1B3QA 1QQJA 2DL7A 2L2PA 3RERA 3GIBA 3CMET 4OB1B 1X69A 2ABLA 3TW7A 1VA7A 2CS7A 2F2VA 5IDNB 2QEXA 1M1KC 4M7AF 2YUOA 1H27B 5L2WB 5GMKl 1FVVB 3E19A 3G71T 3CC7Q 1SRMA 4MFEA 1N6AA 5ACBA 3CCUT 4ATOA 4FYVB 2C4GB 3OYFA 2Y4YA 3J80E 1ZSGA 4YOZA 4F17A 3GBQA 3I55Q 2OI3A 1JSUB 1QWFA 1JKWA 3QXEB 3BHTB 2J06A 4GY5A 3QYGB 2YUPA 4C8QE 4KGZB 2E65A 2CZ6B 1T3LA 4BBSM 3SB2A 5A2QE 1S72A 3TNWB 1WPYA 5GMKj 3M59A 2JM8A 3LGFA 5I21A 2RHYA 3QYEA 4KGXB 4IUUA 1X01A 2V1QA 4CI0C 4C8QF 5KYWB 2YSQA 3RKYA 3CMAQ 4HT8A 2Y4XA 4IMYB 1OX9A 4O5VA 5I2SA 1WX6A 3LH5A 1GCQA 2HDAA 2MAMA 2AIRB 2EJGA 3OMCA 4F7JB 3RMSA 3VS2A 3NTIA 4HL4A 2QFZA 4BCQB 1N8RR 1QKXA 2W2HA 4EOIB 1UFFA 2KRNA 1UDLA 2EQIA 3HZJA 4HA8A 3CC4A 2PUOB 1AWOA 2UZLB 3DJBA 1K9MR 5GANg 5IHNA 3HFOA 4A53A 3UT1A 4EMGA 3I55T 1GH6B 4A54A 2LJ0A 3VU3C 2IIMA 4G6LB 1H1QB 4QSHA 4CRIA 1QW1A 4E7SA 2OTLA 5L23A 1TWBA 3TW6A 4ZTJA 4C92E 3QZ9B 4DBQA 1F1BB 5DQVA 2PVGB 2F1LA 4TTHA 2QK0A 4Y91A 3OA6A 3CCRA 4HLQA 1M1KR 2DA9A 3P8BB 1NPRA 2XICA 2ZPHB 5LJ5d 4AG1C 2CSIA 2FPEA 4C92F 3CMAT 1X6BA 4QW2A 4C0DC 4EC8B 2COWA 1YIJA 3KXTA 1CSKA 2BZXA 4E7LA 1UNGD 2QGGA 4M78F 1WIEA 1PD0A 1OU9A 3HSBA 3CMEA 2FEIA 4X1VA 1FMWA 5KH6A 2MOXA 4A4EA 4ZTFA 3CCQQ 1TH7A 1D3BA 4DOWA 4BXXX 3WXMB 5LJ3g 1D0XA 2ESWA 3EG9B 3G71A 2ZZDB 2A28A 3G7ZA 1X27A 3CCUA 2CKKA 4K11A 4ELZC 1G3TA 3A8HB 2EGCA 4BCNB 4M7DG 2ZPBB 3MPUB 2WIPB 3PO3S 1VQ6A 5KE2A 1I5OB 1JO8A 2HSPA 1LNXA 2KQWA 2B86A 2P4RA 5GANj 1M3BA 2MMPA 1GBRA 3HBLA 3BDLA 2ZGWA 4IKFA 3LQ5B 1BCOA 1RAEB 4OP0A 4F70B 4IUTA 2DVEA 5CYIB 1WHLA 1IGUA 1TG0A 3M57A 3G33B 4JRKA 2ATCB 3L1AA 5LJ3f 1JB0E 3VS4A 3TNIB 4M75E 3S3MA 1KC8C 1RI0A 2O01E 5I5ZB 3LWIA 1GUXA 1BIAA 1WXUA 4BE2A 2ROTA 2QAZA 2CJMB 3M54A 4M78B 4BD3A 5EC7A 4EOOB 4KUDK 4ELJA 5M9OA 4YOOA 3EFRA 2NLUA 2KK4A 2DYBA 4AKGA 2KI7A 4ZGEB 2C5NB 2I53A 2RO0A 2FPDA 5LJ3j 2PU9B 3OY9A 2QTXA 4CFUD 2AKLA 3HTRA 3G4SQ 1FMKA 5IXBA 2CP2A 5HBEB 3OYHA 1Q86U 1YWPA 4J7FA 4B6MA 1GXIE 1H25B 2QA4Q 5EG2A 3D7SB 4BI8B 2LX7A 2VYTA 3H4CA 3GLXA 1UTIA 3SEMA 1VQ9Q 4LNPA 2EKOA 4QVZA 1ZA2B 3TSZA 2DTIA 1I8FA 2DVJA 1JEGA 2RN8A 3DL1A 3PVLA 3PMIA 2V8KA 4XTZA 3V7CA 2XD0A 2EIFA 1IHWA 4RODA 3CD6Q 1D1BA 9ATCB 4ME7A 2X4WA 1E6HA 4BCHB 4RTVA 2F5TX 3QHSA 2E41A 3DB4A 3C95A 1QCNA 1ZP2A 1IO6A 3GOXA 3MEUA 2YRVA 2QQAA 1WGSA 1YJNQ 3RGFB 4XTWA 3A5ZB 2FRWA 4BACA 1AHJB 2GNCA 3LLRA 2VV5A 3G4ST 5HBHB 1ZUUA 3NFCA 4M77A 1QVFS 1XQHA 3SWNA 1QWEA 1U1SA 2RJEA 4AFSC 1VIEA 3S6WA 4D6WA 1KC8R 3LH0A 2KRMA 2QA4T 3V8LA 3QHWB 3JB9F 3BY7A 4BI3A 4B9WA 3MEWA 2CCIB 4J5YA 3H6ZA 4IIMA 3UATA 1VQ9T 2RF0A 3NTHA 1KXUA 3CCSQ 1K73C 4PJOA 2SRCA 1MMNA 1YITQ 1Y57A 3OW2S 3OYNA 3BFMA 3PGGA 1I4K1 2ZCFB 4OR5B 3FDRA 5IHKA 3CCJQ 3DTOA 1JRIA 3QO3A 1RAHB 4M7AA 4LDUA 1UNHD 1UGQB 2KSSA 3EGXB 4Y28E 1YJ9A 3CD6T 2ECZA 2NUTA 4HCCA 3QJYA 3M0RA 3FJPA 4P5NA 3HO8A 1W4SA 4MIMA 2HL3A 4Z6YA 5CQYA 1Y71A 2JJ9A 2LQNA 2M0OA 2VB6A 1X75C 1YJNT 1RI9A 3TEEA 3SWNC 4RTYA 1M8VA 1URCB 1FXXA 4QKUA 4JUVA 3VYHB 2W10A 8ATCB 1O9SA 3RESA 2K79A 3SHWA 1JJ2S 5LL6S 2JTMA 1G2BA 3S3OA 2V8IA 5CCAA 4D8DA 2FO0A 1UHFA 3OYCA 1RLQC 2O9VA 1BU2A 2FL7A 2RJFA 4F7UB 2F2CA 2KMTA 4OMOA 1ABOA 4M7AC 2LP5A 4FW1A 3ZEHA 1YITT 1RAIB 1I1JA 3CCJT 4LDYA 1UE9A 2KAFA 2WFYB 3X25B 1AWJA 3EH2A 4JJDA 3OYGA 4BCQD 1D1AA 3POMA 3QPHA 1ZX6A 2DE0X 1QMCA 3FIFA 3JCMg 3QIIA 1P5EB 1W6XA 4EMKA 3OYIA 3CCMQ 1MV3A 2HQHA 2QQSA 1G83A 4BY6C 1BK2A 1K73R 5CAIA 1JQQA 4MDWA 4C8QC 3EFOA 1VQMQ 5DQWA 5GMKm 2HQXA 4RG2A 4OB3B 1WQWA 2AHJB 1ZQ1A 4JS5A 2GCXA 2GGRA 1GY3B 1K0XA 1V1CA 2QG9B 2QI2A 5CO7A 4JLIA 2OJ2A 2NUPB 2UZDB 1Y96A 4RG8A 4FYXB 1KD1U 1OULA 2FZCB 1QLYA 2JOYA 2VXEA 1F5QB 4A4KA 2GTOA 2DMOA 2RI3A 2E1HA 3LWHA 4OVAA 3EHRA 4EMKC 2JZ2A 2K5FA 4AFQC 2WMAB 3FB9A 4XTVA 2DIQA 2DD5A 4HKEA 3CD6A 2RM4A 3EAEA 3L42A 4YOSA 4MZPA 1C6VX 1G8XA 2KYMA 2VVKA 3CCMT 2EJFA 3MP8A 2EYZA 4NS5A 4CC3A 3AHUA 4C0DB 2R7GA 2JS2A 3BW1A 2WEVB 2EQUA 4C0ZA 2PTKA 3EHQA 1ACMB 1VQMT 1YJNA 4C92C 1C0MA 4Y92A 2DXCA 3M4GA 2PZ1A 5HCKA 1UGRB 3OS0A 2HKNA 1OOTA 2EBPA 1ZSZA 1M8MA 3RKWA 4HNVA 2CP6A 2YRDA 5FLXE 4LD6A 2EWNA 2K3YA 2KDSA 1G3SA 2E5QA 3X26B 1N4MA 1H28B 5GJWB 1WHKA 3BLRB 3QKJA 2YWWA 5CKEA 3MI9B 1VQNA 4NSTB 3CCJA 2EYYA 4C5HA 3TREA 4LDXA 1H8KA 1QCOA 4X9CA 2JUFA 3B57A 2DKGA 2KGTA 1KIKA 5KYYB 4M75A 1RAAB 1AEYA 2Z0WA 2XHCA 1YHQT 2DYIA 2QGFB 3I5SA 3FJ5A 3G6EQ 3C4SA 4C92D 2PNIA 3HKSA 1AWWA 3ZFJA 1VQ8Q 2CZ7B 2H8HA 1CKBA 2ROLA 4M78D 3JAME 5IHIA 2ZPEB 3BG5A 2O2OA 5ICPB 1RADB 1ZSZC 4EOLB 2KBTA 3OYBA 1K9AA 2FB7A 5GAOl 1YJWA 4X9DA 4E7KA 2X9HA 2RI5A 2WHBB 5CVIA 3N5BB 5GMKe 4JPBW 1JOWA 1H92A 2K9GA 1O9KA 1W2BP 1PNJA 1KSWA 3HRTA 1H641 3LW5E 4M75C 2RQWA 2F69A 4M78G 1NE8A 4JJBA 1QCFA 4OMNA 5LJ5g 1C9BA 2C0TA 1YBYA 3WVDB 3QG1A 5FGKB 1OGUB 4J6XA 2P0QA 3A8OB 3G6ET 4BDYA 4J9EA 2BZYA 3PTAA 2P4TA 3CCVQ 3L2ZA 4M77E 5KYUA 1VQ8T 3O0GD 5GAMf 2DF6A 3CCMA 3HPWA 2QQ8A 4GLMA 1G3NC 4N0AA 2EYQA 1VQMA 4M77F 5HNBB 4PJOE 1VQ5Q 2VGNA 1BI0A 2WJ9A 4CRLB 4PJOF 2CT3A 4DBFA 2IW6B 1BU1A 1MV0B 1NYGA 2BE9B 5FU6C 2CSQA 5GAMj 1M90C 4DEYA 4OMQA 1WNLA 1MMDA 1IZ6A 1Q81R 3RDVA 3VYGA 2D8JA 1NM7A 4BE0A 1Z9ZA 3PFSA 5LJ5j 3CCVT 1YHQA 1N8RU 4N0AC 3UWNA 3HL8A 4IURA 4RCBA 3VS5A 4LOCA 2M16A 4J9HA 3V8KA 3HB9A 4BUGA 1M2VB 4JS4A 1VQKT 4MZTA 3E1SA 5KCHA 1K9MU 2JN0A 4DEXA 2KROA 5GANe 4M7DA 1OI9B 1GBQA 3DDQB 1VQ5T 1SKUB 3EOCB 4R55A 1VQLT 3OS2A 3JRZA 5DY9A 1WA7A 2F5KA 2L0AA 1UGSB 1OZ2A 5A0GA 5IXFA 5C6SA 4HXJA 1VQPQ 2VC8A 2VASA 2ZPGB 4AI6A 2D8HA 1M1KU 3SWNB 3M0QA 1NPPA 3NPFA 2KR3A 5GAN5 3EGDB 3TSWA 2CZ0B 1M3AA 1W2BA 3CC7T 3PT9A 2XDPA 3PIPA 4LD9K 4FX3B 2LT1A 2RHXA 1PSEA 2C5VB 1U8RA 1G3WA 5A0LA 2HZYA 3CCLA 1D09B 1ZLMA 1M5Q1 1RUWA 1BB9A 1YCYA 1KQ1A 2LCSA 3G6EA 1V29B 4BCJB 1T0HA 3X24B 1B34B 4M7AB 2VXFA 2L3PA 2GQIA 2EUFA 2R57A 2EW3A 1N9SA 4F7UG 2DL3A 4V2SA 4A4GA 1KQSS 2DXUA 4YC3B 2DRMA 3IQLA 4E7HA 1M90R 5LJ3e 2LQWA 2JGZB 2YT6A 1FMVA 1GCQC 3PIOA 4RTXA 2KXCA 1D1CA 2LNHB 4J7IA 4LN2A 1BI2A 3QYBA 2DJQA 2LZ6B 2W99A 1VQPT 5GANf 3FEOA 1Q7YC 2DD4A 2O4XA 1VQ7Q 1AZGB 1BCMA 2DX1A 3VS7A 4C8QB 4II5B 1HXDA 2CP7A 3CPFA 2IVXA 3FC3A 2V26A 2E10A 2DBMA 5GAOp 4LXCA 3VJPA 3QDRB 1SRLA 1X43A 4NC6A 5CK9A 2JNGA 4DA4A 2DRKA 4HVWA 1YP5A 2BIVA 5LMKB 4XU1A 5CKFA 5ECAA 4BB7A 4MFDA 2DXBA 2X3WD 3CCEQ 2P0PA 2KY9A 1VQKA 2COYA 1WI7A 3LYIA 1K76A 2IVWA 4EMKB 1NZ9A 4HCZA 3OBYA 4XK8E 5FU7C 2WIHB 2DK3A 3REAB 1PHTA 1PRLC 1H24B 3H0FA 1OKWB 2LRQA 2YXYA 1VQLA 2JTEA 3X20B 1M3CA 2EGAA 1VQ7T 2LC4A 3CCQT 1Q86C 2AT1B 2QQRA 2VUBA 2BPMB 4C92B 4E7ZA 4J9DA 1TUDA 3CC7A 4AT1B 4M75F 2WSCE 3OS5A 3OSSC 3M0SA 1GL5A 2KNBB 6AT1B 2EKHA 4HCBA 3I55A 2DILA 1OQKA 2LX9A 2MK5A 3CBPA 3META 4KH1B 2XMFA 2BUDA 4MMLA 1MNDA 3M03A 2YRCA 3MP1A 2W9ZA 1Z9QA 4EOSB 2LTOA 3CCET 1Q7YR 2MF2A 1I5LA 4RTTA 1K8AC 2CP3A 5KYXB 1YFNA 2KT8A 2CP5A 1KK7A 4WTOB 2I2LA 2PQWA 3A8LB 3CMAA 1VQ4Q 4KBMB 2L89A 3DB3A 2YLCA 1KJWA 5D6YA 1UUEA 1X2KA 4ELLA 2MIOA 2XI9A 1KC8U 3EG0A 4MZMA 2OAWA 4JDSA 5IDPB 2HBWA 1VQPA 2DFUA 4JLGA 4BCFB 4EOKB 3EG1A 2RPNA 1ZSZB 3CC2Q 2AZVA 2DL4A 2LCLA 2C0IA 2EYXA 1RAGB 3P8HA 2XK0A 2QGSA 1PRMC 2CH4A 3KHIA 2EQJA 1PKTA 2YUNA 2PVDB 5GJVB 3MHXA 3I9QA 1WZOA 2MYSA 5FRMA 5I22A 1OZ3A 2RQRA 1TSFA 2YHTA 3QHRB 2MPXC 1VYWB 4M75B 2CYZB 2H3EB 2RNAA 3M9QA 2GFUA 1Y0MA 3PNWC 1YN8A 1ZUYA 5KYWA 1N5ZA 4JRPA 1U06A 4ORZA 2MI6A 4N4GA 1XOVA 1OL2B 2O31A 1VQ4T 3JV3A 5DM7R 2K5IA 2P0KA 1FYNA 2GF7A 4KRCB 1PWTA 4XTYA 3S3NA 3AT1B 4LUDA 3JCMW 3A8GB 2DBKA 2LJ1A 3BDUA 4IIOA 2UUEB 2HL5C 2XDDA 3M0TA 3CC2T 1JXOA 3CCQA 3ZBDA 3G1JA 2M02A 2SEMA 3CPWP 1K8AR 2RK1A 4LDVA 3VRZA 1UGPB 4C5GA 1E7OA 4OMPA 4M77C 5GAOq 3EG3A 4M7DE 4FM4B 2QDYB 5IHYA 1VYTA 3A1PA 2GFAA 1X2QA 3QWYA 1YWOA 3TU4K 2K4YA 1KFZA 5FU6B 2BKZB 4LUEA 4E2FB 1TXQA 4EDUA 4PJOC 2IN3A 4M7DF 3O5ZA 4RTWA 1ZUKA 3JCMe 5KYNA 2RHUA 2AK5A 4OMLA 3VKIA 2KMGA 1XO2A 3CXCP 4C0FA 4Y72B 1K73U 3CCST 1QLBA 5D7UA 2PK2A 1X6GA 5BNJB 3SDZA 3HHTB 1H3ZA 3VKGA 2IPOB 4ZGJB 1KQ2A 4TVRA 1RACB 2FG0A 1AZEA 4JX6A 3EFSA 2XDBA 1YCSB 1Q82C 1XJWB 3EG9A 1UG1A 2ZZDA 1SG5A 1WFWA 4OB0B 2HMAA 1HSQA 4L6V5 3LX7A 4XU3A 3THKA 3QBYA 1NLPC 4PL6A 1IXDA 2WPAB 4M7AD 4BCPB 3G4SA 1Y07A 4PFPA 4J9FA 3TQ7P 3UDCA 1BI3A 3HRUA 1GCPA 4B9XA 4OMMA 3MY5B 2OTJQ 2QA4A 4KUIA 4ZN3A 1QVGP 3JCMV 2EQMA 2EYWA 2FRYA 2YLBA 2X51A 3UF4A 2BS3A 3L2QA 3GP8A 1VQ9A 1UEBA 1FWZA 1VQ4A 2J6OA 3JCMf 2QQ9A 3V7SA 5LQFB 5L8RE 1M4ZA 2FZKB 1TUCA 1Y7XA 3MO8A 2MWOA 4M7AG 5EFQB 2R58A 5HKCA 4C8QD 4IUPA 3CC2A 5GAN3 2DL5A 3JCMX 4AKIA 3RR6A 4CC7A 2QEXQ 2QXFA 3QUIA 3K7AM 2DLPA 3M0PA 1OV3A 2E6ZA 5J26A 3CPWA 3MJXA 1P92A 2EAYA 2QASA 1ABQA 1PCXA 2HSEB 4XTUA 3KBGA 3BLHB 3U23A 3M55A 1TOVA 2WXVB 1MUZA 1JBMA 4J9CA 4XTXA 1NJIC 3OMGA 1OEBA 2OTJT 1Q82R 1OYXA 3M56A 2RHZA 3JCMQ 4C8QG 3MIAB 2WSFE 4EMHA 1S72Q 1WJQA 2DEQA 2DERA 1WJRA 3CCSA 1AVZC 3CXCA 1YITA 3ULRB 2LT4A 3QDFA 4QQDA 1MMAA 1SSFA 7AT1B 2VKNA 4IUVA 4KULA 1DJ7B 2CUBA 2VGMA 4EONB 3T9NA 4EOMB 4FSXA 5GAMe 1FKMA 1AD6A 3BHVB 2LW4A 2PHGA 1BI1A 4EORB 3QWXX 3I35A 3QWLA 5GAMh 2V1RA 5DLOA 4PFZA 3TNHB 2PMIB 5FU7B 2O4XB 2KYBA 1IHVA 5D6WA 3NGPA 4BCGB 1D3BB 5GMKi 5LJ5e 2C0OA 5FWCA 1JU5C 2GQVA 1QVFA 5IT9E 2L8DA 3QZ5B 1VOLA 2DTOA 1WHJA 1NG2A 1WJSA 2OTLQ 4CFXB 1ENWA 4F7LB 3OYAA 4WF2A 5HQ0B 5GMKh 3OW2A 1RL2A 2M1HA 4E47A 4C92G 3CCRQ 5I11A 4OGRB 1FINB 3JB9J 2E6NA 3I56Q 2JXBA 1QVGA 2D9TA 3ASKA 1OL1B 4DOVA 4UC4A 1EIFA 1YIJQ 2IW8B 3M4YA 2D0QB 4F6WB 2QDLA 1V76A 2RJDA 2GBQA 1NJIR 2O9SA 1ZA1B 1D0YA 4BBRM 2HKQB 3CBOA 3DLMA 2DTHA 4GBQA 2XU8A 4Z8AA 1JJ2A 3L2WA 4OGCA 1KHCA 2WMBB 1GUXB 1Q81U 2J6FA 8AT1B 1YI2Q 3REBB 2A3LA 4LE9A 3PE0A 2G6FX 2OTLT 3JCMJ 4I3ZB 1VQ6Q 2KEAA 4F7UA 4M75D 5LJ5f 4F04B 1N8RC 1SF9A 1SPKA 3GNFB 3CCRT 2LJ3A 2IG0A 3QSUA 4M6VA 4XU2A 3I56T 2LQ8A 2ENMA 5CR2A 2DXTA 2MWPA 3NTKA 1LCKA 2K3BA 2L3RA 1FX7A 2CZ1B 1GFDA 1YIJT 2FYKA 3RUXA 2K6DA 1K1ZA 1QP3A 3R6OA 1O75A 2NWMA 3DOGB 3GF5A 2LDMA 3HRSA 3SFMA 1M30A 4FIBA 3OYKA 4M75G 3NHNA 2QYZA 3RKXA 4EPCA 4BCMB 2H3JA 2UZBB 4JJCA 3TVTA 2DMEA 2QQBA 3L2RA 2LVMA 4EOPB 1X6OA 4ESRA 3TN8B 1YI2T 2M0YA 4JZ3A 1MHNA 1VQ6T 5GANh 4FSSA 2HNIA 2VWFA 3DKMA 5HY6A 1AWXA 2A37A 3GTMS 4QQ6A 2NUPA 2HEQA 3I5RA 2PVOB 1OX8A 2IW9B 1PG5B 3BE3A 2RA2A 4F7NB 4A4FA 4M77B 1M90U 1TS9A 3C12A 2RJCA 1UECA 2A7YA 3VS6A 4PJLA 5FW9A 2Y90A 1C1AA 1MNEA 1E7PA 4Z02A 4KRDB 4ZGDB 2UZEB 4PJOB 3JB9D 4BY1X 2AKKA 2V8JA 1HD3A 1M9SA 5GAN6 4AG2C 1UJYA 2B8AA 4OF1A 2MCNA 1NEBA 4E7IA 4F7SB 1OPKA 4M7DC 1MMGA 4XQ3A 1H1SB 2X1NB 2DM1A 1VQ8A 2C06A 2NUTB 2RK2A 2WACA 1VYUA 1IREB 4R0KA 4NOYA 1PM3A 3A98A 3C0CA 4QT7A 3TCJA 5LJ3h 5GAMd 4X34A 1J3TA 4FCYA 1TUGB 3JB9G 4RTZA 1VYVA 3ER0A 4AFUC 4RMOA 4HCKA 1VINA 2G77A 5HBJB 1AT1B 3HP9A 1G5VA 4CFMB 4F6UB 4BY6B 2M9UA 2CP0A 2GTJA 4M78E 3I56A 3OQ5A 3OYDA 4QVDA 3VKHA 1UHCA 2LNVA 2ED1A 2JW4A 1OKVB 5KYYA 2HAXA 4M7DD 2F2XA 3OB9A 1IGQA 3ZL7C 4ELYC 2AZSA 1YJ9Q 1M1FA 2RQUA 2XG8D 3EGUA 2RD1A 1G3YA 3P8DA 4WCIA 3CCVA 2CGHA 2XIDA 4ROEA 1I0CA 5CIUA 4DBRA 1AD5A 2QF7A 1UNLD 1LOJA 4PJNA 3MEAA 2R5AA 3VS3A 5CKBA 1LJOA 3UA6A 4MDXA 1YI2A 4KH0B 1VQ5A 1ARKA 3HFNA 4JRQA 4EOJB 4II1A 1W98B 3INZA 2QTVA 3RNJA 3EFOB 3BG3A 4E7JA 1QKWA 4O6JA 3JSCA 2E3IA 2JS0A 1Q7YU 2J7IA 1H26B 3FRNA 3NMZC 3UA7A 1CKAA 1T0JA 4FW2A 3MCAB 3L2VA 3DLLA 4ROCA 1KQSP 4XAXB 1I81A 1Y96B 2F2WA
chains in the Genus database with same CATH topology
4VUBA 2RHUA 4X9CA 3VKIA 3SB2A 2KMGA 2JUFA 1WPYA 5A2QE 2DKGA 3M59A 4C0FA 5GMKj 5I21A 3LGFA 4FL6A 1YJ9T 2RHYA 3QYEA 4M75A 4IUUA 1K73U 2XHCA 4L59A 1QLBA 3CCST 1X01A 4L5GA 1YHQT 5KE3A 4CI0C 3C4SA 4C92D 3KUFA 4C8QF 3M5AA 3HKSA 5GAN2 3ZFJA 5J3BA 3SDZA 3HHTB 3RKYA 4HT8A 2Y4XA 1H3ZA 2DD5B 2CZ7B 2ZPFB 3VKGA 4ZGJB 1KQ2A 4TVRA 4M78D 3JAME 4O5VA 5I2SA 2ZPEB 4JX6A 3BG5A 3EFSA 2D6FA 2HD0A 2MAMA 2EJGA 2DZCA 3OMCA 3RMSA 3OYBA 4RCCA 2FB7A 3NTIA 4HL4A 1Q82C 5GAOl 2QFZA 1YJWA 4X9DA 3UPUA 4E7KA 2RI5A 2ZZDA 5CVIA 4HT9A 2KVQG 3CPWS 3OYJA 5GAOr 3N5BB 5AYFA 4OB0B 5GMKe 3HZJA 4HA8A 3CC4A 2DXCB 2PUOB 4L6V5 5GANg 4NL3A 3HFOA 4A53A 3UT1A 4EMGA 3LX7A 4GLKA 3I55T 4XU3A 3QBYA 4A54A 4PL6A 3VU3C 3VV0A 3HRTA 4QSHA 4CRIA 4M7AD 1QW1A 1H641 4J83A 3LW5E 2OTLA 4M75C 4M78G 2F69A 1Q81U 1NE8A 5GANd 5LJ5g 2ZPIB 3G4SA 1Y07A 3UDCA 3TW6A 3O8VA 3V8JA 1YBYA 4OB2B 1BI3A 3HRUA 4B9XA 3QZ9B 4C92E 4ZTJA 3WVDB 3QG1A 2PVGB 3OA6A 4Y91A 3CCRA 2QA4A 4KUIA 4ZN3A 4HLQA 3QJ6A 3F70A 4J6XA 2P0QA 3JCMV 2EQMA 5EJCA 3OYLA 3P8BB 1M1GA 1NPRA 2XICA 3CXCS 3A8OB 2ZPHB 2DAQA 3G6ET 4BDYA 2YLBA 5LJ5d 5GAN7 5GAN4 3PTAA 2BS3A 3L2QA 3GP8A 1BIBA 2P4TA 4F7UE 1VQ9A 3L2ZA 4M77E 1UEBA 4C92F 1FWZA 4QW2A 2HBPA 3JCMf 4C0DC 1VQ4A 1VQ8T 2QQ9A 3V7SA 1K8AU 5L8RE 1YIJA 4OGEA 5GAMf 3KXTA 1M4ZA 2DIGA 5KCOA 2K3XA 3CCMA 4E7LA 3HPWA 4M78F 2QQ8A 1Y7XA 3MO8A 3OYMA 5GAOn 2MWOA 3HSBA 3CEYA 4M7AG 4N0AA 4NL2A 3CMEA 4HNUA 2EYQA 4F7UF 1VQMA 5KH6A 4M77F 5HKCA 2R58A 4C8QD 4IUPA 4PJOE 4A4EA 4BE1A 5GAN3 4ZTFA 3CC2A 1TH7A 3JCMX 1D3BA 4AKIA 2VGNA 3CBMA 3Q1JA 4DOWA 2QXFA 3QUIA 4JX4A 1BI0A 2WJ9A 3WXMB 5LJ3g 2E6ZA 5J26A 3CPWA 3G71A 1P92A 1KG1A 2ZZDB 2EAYA 3FLGA 4PKCC 3G7ZA 5GAOm 4PJOF 3CCUA 2CKKA 2XKOC 1G3TA 4ELZC 1VQ7A 3A8HB 4LDWA 4XTUA 3KBGA 4M7DG 3GPLA 2ZPBB 3MEVA 2K5LA 5FU6C 5GAMj 5FRNA 1M90C 3M55A 4FU6A 2DO3A 5KE2A 1VQ6A 5LJ3d 1JBMA 2K57A 1LNXA 2KQWA 4JRPA 5GANj 1WNLA 4XTXA 1NJIC 3URGA 1IZ6A 3OMGA 2OTJT 3VYGA 1OYXA 3M56A 2RHZA 3JCMQ 4C8QG 1N27A 1B34A 2WSFE 2MMPA 4EMHA 2EFIA 4BE0A 1KQSA 1WJQA 2DEQA 3PFSA 3M58A 1QVGS 3HBLA 3BDLA 1WJRA 2ZGWA 5LJ5j 3CCVT 4IKFA 3GNGA 3CCSA 1YHQA 1N8RU 4N0AC 3UWNA 3HL8A 3CXCA 1BKBA 4IURA 1YITA 4OP0A 3JCMc 2LT4A 4QQDA 4RCBA 1SSFA 4LOCA 2M16A 4IUTA 2DVEA 3HB9A 3V8KA 2FHDA 4IUVA 4KULA 3M57A 1DJ7B 1QVPA 2VGMA 4JRKA 3CCEA 4JS4A 1ZHIA 3L1AA 5LJ3f 1VQKT 4MZTA 1VUBA 3RIRA 3T9NA 3E1SA 4FSXA 5GAMe 5KCHA 1JB0E 1K9MU 1FKMA 2JN0A 4M75E 3JCMh 1BI1A 3S3MA 1KC8C 1RI0A 5GANe 2O01E 4M7DA 3QWLA 5GAMh 1VQ5T 3JCMb 3LWIA 5DLOA 1BIAA 4R55A 2G3RA 4BE2A 5FU7B 1VQLT 2O4XB 3OS2A 3JRZA 5D6WA 5DY9A 3M54A 2F5KA 4C8QA 1UGSB 1D3BB 1OZ2A 4M78B 4BD3A 4BUGA 5A0GA 5C6SA 5J39A 2GQVA 5GMKi 4ELJA 5LJ5e 5M9OA 4KUDK 1QVFA 2VC8A 3EFRA 4M77D 2NLUA 2L8DA 2KK4A 4AKGA 2ZPGB 4AI6A 2RB6A 3QZ5B 1OI1A 1XNIA 4ZGEB 2E70A 2LCCA 1NPPA 3SWNB 3V7RA 4C5EA 1M1KU 4Q5WA 2DTOA 2RO0A 5LJ3j 5GAN5 1WJSA 2CZ0B 2PU9B 3OYEA 1W2BA 3OY9A 2QTXA 3L2UA 3CC7T 3PT9A 1VQNT 1VQOT 2X4XA 2XDPA 3PIPA 3OYAA 4LD9K 4WF2A 3RUXA 1KD1C 2LT1A 2RHXA 1PSEA 4PJOD 1Q86U 5GMKh 3OYHA 3OW2A 1RL2A 4IUQA 2M1HA 1G3WA 4J7FA 4E47A 5A0LA 4C92G 3A8MB 1U8RA 1GXIE 3CCLA 5EG2A 3JB9J 3JB9H 4BI8B 1M5Q1 3VYGB 2VYTA 3M53A 3H4CA 1KQ1A 1YCYA 2E6NA 1V29B 3GLXA 3G6EA 3X24B 1B34B 4KT0E 4M7AB 1S72A 1QVGA 2VXFA 2D9TA 2EKOA 3ASKA 4DQ2A 4QVZA 2R57A 4DOVA 1N9SA 4J8OA 4F7UG 4UC4A 4M77G 4V2SA 1EIFA 2DTIA 4A4GA 1I8FA 1KQSS 2DXUA 3DL1A 4E7HA 3M4YA 2D0QB 3PMIA 5LJ3e 2V8KA 3VUBA 4XTZA 3V7CA 2RJDA 1YJWT 5D6XA 4QVCA 2XD0A 3PIOA 2EIFA 2RHIA 3QYHB 4ME7A 4BBRM 4PJOG 2X4WA 4J7IA 3CBOA 3DLMA 2DTHA 4PLIA 2F5TX 5DLQE 2XU8A 4M7DB 3QHSA 1BI2A 1JJ2A 3QYBA 2E41A 3L2WA 2OAUA 4OGCA 3DB4A 3C95A 1ZBXA 4N4IA 1KHCA 1VQPT 3GOXA 3MEUA 2YRVA 2QQAA 4FT4A 2KR6A 3C94A 1WGSA 4C92A 5GANf 3FEOA 1Q82U 1Q7YC 2DD4A 2HQEA 2O4XA 4XTWA 2K2VA 2A3LA 3A5ZB 5I2MA 4C8QB 4BACA 1AHJB 4M78A 2OTLT 3LLRA 1HXDA 3JCMJ 2X4JA 1PSFA 2VV5A 3CPFA 3G4ST 3FC3A 1R8OB 3NFCA 1N9RA 4M75D 4F7UA 2E10A 4M77A 5LJ5f 1N8RC 5GAOp 3VJPA 1QVFS 1XQHA 3SWNA 2X35A 1U1SA 2RJEA 1VIEA 3S6WA 4D6WA 3GNFB 3LH0A 3QDRB 3CCRT 2IG0A 4OMFB 4NC6A 2QA4T 3V8LA 3QSUA 5CK9A 3JB9F 3BY7A 4M6VA 4A4HA 2JNGA 4B9WA 4BI3A 4DA4A 3MEWA 3OBWA 4J5YA 3H6ZA 4XU2A 3VUZA 3I56T 2LQ8A 5CR2A 1W2BS 2DXTA 2BIVA 4XU1A 2MWPA 1VQ9T 3NTKA 3NTHA 4XU0A 3J7AF 1K73C 4PJOA 2L3RA 5CKFA 4BB7A 1FX7A 2CZ1B 4MFDA 1YIJT 4C0GA 3JB9I 3OYNA 2FYKA 3BFMA 3OSVA 3PGGA 1I4K1 1QP3A 2ZCFB 2DXBA 1O75A 2DZ9A 3FDRA 3GF5A 3R6OA 1MGQA 1JRIA 3QO3A 5FROA 2LDMA 2P0PA 4M7AA 2KY9A 1VQKA 4LDUA 3HRSA 1UGQB 3LYIA 5C0MA 3SFMA 2KSSA 4Y28E 3RMQA 4BDZA 2IVWA 1YJ9A 3CD6A 3CD6T 4FIBA 3OYKA 4EMKB 1NZ9A 4M75G 2PUKB 4HCZA 3OBYA 4XK8E 5FU7C 2DK3A 3OS1A 3RKXA 3QJYA 4HCCA 4EPCA 5HK0A 3FJPA 4PLLA 2E64A 4P5NA 2H3JA 3HO8A 1QP2A 2LRQA 1W4SA 3MP6A 4M78C 2E12A 1VQLA 4MIMA 4Z6YA 2QQBA 3BG9A 5CQYA 1Y71A 2LVMA 2M0OA 3X20B 4AKHA 3L2RA 1X75C 1BYMA 1YJNT 1X6OA 1U1TA 3TEEA 1VQ7T 3SWNC 2LC4A 1M8VA 1FXXA 2DPPB 1YI2T 3CCQT 4JUVA 3VYHB 1Q86C 1WQ7A 3SD4A 2QQRA 3H8ZA 4MMKA 1MHNA 2QEXT 1O9SA 1KHIA 2VUBA 3RESA 1VQ6T 4C92B 5GANh 1JJ2S 2HNIA 2X4YA 4PNOA 5LL6S 2DD4B 2JTMA 3DKMA 5HY6A 3CC7A 4QQ6A 2V8IA 4M75F 5CCAA 2WSCE 3OS5A 3OSSC 3S3OA 3X28B 1VQOA 4FT2A 2PVOB 2RA2A 3OYCA 4HCBA 2RJFA 2FL7A 4J6WA 4F7UB 3J81E 4YTLA 4M77B 4A4FA 3I55A 2FVUA 5LJ5h 1M90U 2JVVA 2KMTA 4M7AC 2LX9A 3C12A 3CBPA 3META 2RJCA 3ZEHA 4RKUE 1NJIU 4JJNK 2A7YA 4C5IA 3OW2S 3JCMP 1YITT 2BUDA 4MMLA 2Y90A 5CKHA 3MP1A 3CCJT 4LDYA 5IN1A 2KAFA 2LTOA 3OYYA 3CCET 3X25B 1E7PA 2MF2A 1I5LA 4Z02A 4HNTA 1K8AC 4ZGDB 4J6YA 2LQKA 1S72T 4PJOB 3JB9D 2V8JA 3OYGA 1M9SA 5GAN6 1Q81C 2DXBB 2B8AA 4OF1A 3QPHA 2RH2A 2BS4A 4E7IA 2I2LA 1XTDA 2PQWA 4M7DC 2XDBA 3FIFA 3JCMg 4BI4A 3A8LB 5A0DA 4XQ3A 3CMAA 3QIIA 1VQ8A 4KBMB 2L89A 3DB3A 5GAMg 2YLCA 3LGLA 5D6YA 4EMKA 4QQGA 2C06A 3OYIA 2RK2A 2WACA 4BBSM 2XI9A 1KC8U 1IREB 2QQSA 4MZMA 4JDSA 4BY6C 1VQPA 4NOYA 3TCJA 5IAYA 5CAIA 4C8QC 4JLGA 4MDWA 5HK3A 3JCMd 2R5MA 5LJ3h 2LCLA 5GMKm 5GAMd 4X34A 3P8HA 2HQXA 2XK0A 2BS2A 4RG2A 3JB9G 4JX5A 3CC4T 3KHIA 2WSEE 2L5QA 4OB3B 1WQWA 2AHJB 1ZQ1A 2EQJA 2RI2A 3ER0A 4JS5A 2GCXA 4RMOA 2PVDB 1VIFA 2BKDN 3MHXA 4JRIA 2G77A 3CCLT 2QI2A 3HP9A 5CO7A 4JLIA 5FRMA 1G5VA 4BY6B 2M9UA 5CKDA 3PMTA 4M78E 2JTFA 3I56A 3OQ5A 2QDJA 3OYDA 1OZ3A 1Y96A 4RG8A 4QVDA 5CQXA 3VKHA 2YHTA 3E9FA 2LNVA 1KD1U 2JOYA 2HAXA 4M7DD 2VXEA 4M75B 4A4KA 2CYZB 2EJ9A 3M9QA 2RI3A 3E9GA 3OB9A 3CMAT 2GFUA 2OTJA 2E1HA 4ELYC 3LWHA 3PNWC 4OVAA 4ZN1A 5GAN8 1HK9A 4EMKC 2JZ2A 2K5FA 3FB9A 3ME9A 2DIQA 1M1FA 2DJZA 2DD5A 2XG8D 4XTVA 1K9MC 4HKEA 2RD1A 1G3YA 3P8DA 2RM4A 3EAEA 3L42A 2MI6A 4N4GA 3CCVA 1XOVA 4N4HA 4MZPA 1VQ4T 5DM7R 2K5IA 2P0KA 3WVEB 2GF7A 2CGHA 4XTYA 3S3NA 2XIDA 3CCMT 2EJFA 3MP8A 4NS5A 5CIUA 1UB4A 3JCMW 3AHUA 4R56A 3A8GB 4C0DB 2EQKA 4M7AE 3BW1A 3RERA 2EQUA 4C0ZA 2QF7A 3BDUA 3GIBA 1LOJA 3CMET 3MEAA 2R5AA 1VQMT 1YJNA 2XDDA 4OB1B 5CKBA 1LJOA 4MDXA 4C92C 3CC2T 1YI2A 3CCQA 3ZBDA 1VQ5A 2DXCA 3M4GA 3TW7A 2CS7A 3HFNA 2QEXA 4JRQA 1M1KC 1UGRB 4II1A 4M7AF 3OS0A 2RK1A 3INZA 5GMKl 4E7JA 3BG3A 3E19A 3G71T 4O6JA 4MFEA 1N6AA 3JSCA 4LDVA 1UGPB 3RKWA 4HNVA 1Q7YU 4C5GA 3CCUT 4ATOA 3FRNA 4M77C 5GAOq 3OYFA 5FLXE 4M7DE 4FM4B 2Y4YA 3J80E 4LD6A 2EWNA 2QDYB 2K3YA 2KDSA 1G3SA 2GFAA 2E5QA 3TU4K 3X26B 3QXEB 3MCAB 2K4YA 3L2VA 3DLLA 3QKJA 5FU6B 4GY5A 5CKEA 3QYGB 1VQNA 4EDUA 4C8QE 4PJOC 2E65A 4XAXB 4C5HA 2CZ6B 1I81A 3TREA 3CCJA 4LDXA 3JCMe 4M7DF 1Y96B 5IT9E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8L B;  2DD4 A;  3VYG A;  1AHJ B;  1IRE B;  2WSF E;  1PSF A;  3HHT B;  2DD5 B;  2CZ7 B;  2ZPF B;  4ZGJ B;  2ZPE B;  2WSE E;  1DJ7 B;  4OB3 B;  2AHJ B;  2ZZD A;  2PVD B;  1JB0 E;  2CZ1 B;  4OB0 B;  2O01 E;  2DXB A;  2DXC B;  2ZCF B;  1QP3 A;  2PUO B;  4L6V 5;  1UGQ B;  4Y28 E;  2CYZ B;  2PUK B;  1UGS B;  4XK8 E;  3LW5 E;  2ZPI B;  2ZPG B;  1QP2 A;  3QZ5 B;  4ZGE B;  4OB2 B;  2DD5 A;  3QZ9 B;  3WVD B;  3X20 B;  2PVG B;  2CZ0 B;  2PU9 B;  3WVE B;  2DPP B;  3VYH B;  3A8O B;  2ZPH B;  3A8G B;  1PSE A;  3A8M B;  1GXI E;  2DD4 B;  4OB1 B;  5L8R E;  2WSC E;  3X28 B;  3VYG B;  2DXC A;  1V29 B;  2PVO B;  3X24 B;  4KT0 E;  1UGR B;  1UGP B;  4RKU E;  4FM4 B;  2D0Q B;  2QDY B;  3X25 B;  3X26 B;  4ZGD B;  2ZZD B;  3QXE B;  3QYH B;  3QYG B;  3A8H B;  2DXB B;  2CZ6 B;  2ZPB B; 
#chains in the Genus database with same CATH topology
 4VUB A;  2KE9 A;  1M2O A;  1VOM A;  1WDX A;  1W1F A;  1YJ9 T;  4FL6 A;  3NDQ A;  2P84 A;  4CC2 A;  4L59 A;  1LPL A;  4L5G A;  2ZAE A;  5KE3 A;  3KUF A;  3M5A A;  1T3S A;  4CFW B;  5GAN 2;  5J3B A;  1UJ0 A;  2A08 A;  2EPD A;  2DD5 B;  2ZPF B;  2EGE A;  3BHU B;  2D6F A;  2HD0 A;  1K4U S;  2DZC A;  4RCC A;  1PKS A;  3UPU A;  4Z89 A;  1LVK A;  4HT9 A;  2KVQ G;  3M0U A;  3CPW S;  3OYJ A;  5GAO r;  5AYF A;  2JMC A;  4FYW B;  2DXC B;  1YNZ A;  4NL3 A;  1E6G A;  2RQV A;  4GLK A;  3VV0 A;  3CQT A;  1IRX A;  3EG2 A;  4J83 A;  3VS0 A;  4ZNX A;  3E2U A;  5GAN d;  2ZPI B;  3O8V A;  3V8J A;  4OB2 B;  3DDP B;  1PD1 A;  2E3H A;  4KRT A;  1SSH A;  4F14 A;  3QJ6 A;  4AMC A;  3F70 A;  1OPL A;  5EJC A;  3OYL A;  1M1G A;  3CXC S;  1M2V A;  2DAQ A;  5GAN 7;  5GAN 4;  1BIB A;  4ANJ A;  2PK9 B;  4F7U E;  4DBH A;  2HBP A;  1K8A U;  4OGE A;  5KCO A;  2DIG A;  2K3X A;  1Q86 R;  1RLP C;  3OYM A;  2E5K A;  5GAO n;  2JMA A;  3CEY A;  1OU8 A;  4NL2 A;  4HNU A;  4F7U F;  2DL8 A;  4BE1 A;  1SHF A;  2KRS A;  1AIS B;  4BCI B;  1R0B G;  3CBM A;  3Q1J A;  4JX4 A;  4CFN B;  1UGV A;  1KG1 A;  3FLG A;  5GAO m;  4PKC C;  3F5X B;  1TTH B;  3EGD A;  3R6N A;  2XKO C;  1VQ7 A;  2NUZ A;  4LDW A;  3GPL A;  3MEV A;  2K5L A;  5FRN A;  4FU6 A;  2DO3 A;  5LJ3 d;  1A0N B;  2K57 A;  4D8K A;  2RMO A;  4HVU A;  1O9K B;  3URG A;  1VQN Q;  1VQO Q;  2G9X B;  2BZ8 A;  4M4Z A;  1WHH A;  1N27 A;  1B34 A;  2L3Q A;  1EX4 A;  2EFI A;  4EC9 B;  1KQS A;  1W70 A;  4F6S B;  3VS1 A;  1WXT A;  3M58 A;  1QVG S;  2NYS A;  3GNG A;  1GFC A;  4CXA B;  2YDL A;  5IH2 A;  1K0S A;  1BKB A;  4BCM D;  3JCM c;  2C5O B;  2FHD A;  4PJM A;  1QVP A;  4PJJ A;  2J05 A;  4PFO A;  3CCE A;  1ZHI A;  4EOQ B;  4EIK A;  1VUB A;  3RIR A;  5KYU B;  3JCM h;  3JCM b;  4J9B A;  2K7A A;  2CDT A;  1YJW Q;  1TD6 A;  3H9N A;  2G3R A;  1RAF B;  4C8Q A;  5J39 A;  1D0Z A;  4M77 D;  2RB6 A;  1NBE B;  1OI1 A;  1XNI A;  2LCC A;  2E70 A;  3V7R A;  4C5E A;  4Q5W A;  4Z88 A;  1PKD B;  5FWB A;  2FPF A;  4KGV B;  3OYE A;  1QVF P;  3L2U A;  1VQN T;  1VQO T;  2X4X A;  2L3S A;  2KXD A;  1KD1 C;  1JXM A;  4PJO D;  1B7T A;  4IUQ A;  2W9F A;  3A8M B;  1HYO A;  1NLO C;  1Q95 G;  4BCK B;  3JB9 H;  3VYG B;  1WXB A;  1TU0 B;  1QMZ B;  3M53 A;  2K2M A;  1EZZ B;  4FYY B;  4KT0 E;  3OW2 P;  2A36 A;  2X3X D;  4DQ2 A;  2KT1 A;  2JM9 A;  2PJQ A;  4J8O A;  4M77 G;  4J9G A;  4JZ4 A;  3VUB A;  1YJW T;  5D6X A;  4QVC A;  2RHI A;  3QYH B;  4PJO G;  2A0F B;  4PLI A;  5DLQ E;  4M7D B;  2OAU A;  1ZBX A;  4N4I A;  4FT4 A;  1Q82 U;  2KR6 A;  3C94 A;  4C92 A;  2HQE A;  1R77 A;  1H1R B;  2K2V A;  1JJ2 P;  5I2M A;  3RBB B;  4M78 A;  2X4J A;  1PSF A;  2BTT A;  1R8O B;  2CCH B;  1N9R A;  2CRE A;  2X35 A;  3EH1 A;  4CC4 B;  4OMF B;  1WYX A;  1H4L D;  2E4H A;  5IF1 B;  4A4H A;  2DNU A;  2COZ A;  3KFV A;  3OBW A;  3VUZ A;  1W2B S;  1BBZ A;  3J7A F;  4XU0 A;  1YHQ Q;  1WHG A;  5KYX A;  1R0C B;  4RUG A;  5CEI B;  4C0G A;  3JB9 I;  3OSV A;  2DZ9 A;  1MGQ A;  5FRO A;  3H41 A;  5C0M A;  3RMQ A;  2EVR A;  2OX7 A;  4E6R A;  4BCN D;  2PUK B;  1M27 C;  1KD1 R;  3OS1 A;  1WHM A;  1B07 A;  5HK0 A;  4PLL A;  2E64 A;  3MY1 B;  1QP2 A;  3MP6 A;  4M78 C;  2E12 A;  3EJ1 B;  3BG9 A;  4AKH A;  2W96 A;  1BYM A;  1U1T A;  2J6K A;  2DPP B;  3BLQ B;  4A63 B;  1WQ7 A;  3SD4 A;  4MMK A;  3H8Z A;  2QEX T;  1KHI A;  2M51 A;  2CT4 A;  2X4Y A;  4PNO A;  2DD4 B;  2LMJ A;  3PVQ A;  1VQO A;  3X28 B;  3CC4 Q;  1RAB B;  2D1X A;  4FT2 A;  2YUQ A;  4J6W A;  5HVY B;  4J9I A;  3J81 E;  4YTL A;  4BDZ A;  4CFV B;  2FVU A;  5LJ5 h;  3CCL Q;  2JVV A;  2I40 B;  1D3U B;  1NJI U;  4RKU E;  4JJN K;  3JCM P;  4C5I A;  1PC0 A;  1S1N A;  5CKH A;  1I07 A;  2CH4 W;  4CFU B;  5IN1 A;  3OYY A;  4F16 A;  4HNT A;  1SHG A;  4J6Y A;  2LQK A;  1S72 T;  1NYF A;  1Q81 C;  2DXB B;  4BY7 X;  1NEG A;  3H0I A;  2DEU A;  1OIU B;  2RH2 A;  2BS4 A;  3VRY A;  1XTD A;  2I0N A;  2HCK A;  4BI4 A;  1GRI A;  5A0D A;  2DET A;  1WLP B;  3EGX A;  5GAM g;  3LGL A;  1HJD A;  4BCO B;  4QQG A;  4UN0 A;  5AT1 B;  5IAY A;  1JST B;  1EFN A;  5HK3 A;  3CME Q;  3JCM d;  2R5M A;  2C6T B;  1ZBJ A;  1TFB A;  2C5X B;  2BS2 A;  2D0N A;  4JX5 A;  3CC4 T;  1IB8 A;  2WSE E;  2L5Q A;  1H3H A;  2RI2 A;  3G71 Q;  1VIF A;  2BKD N;  4JRI A;  3CCL T;  3CCU Q;  1AOJ A;  5CKD A;  3PMT A;  3MKD A;  3EID B;  2JTF A;  2QDJ A;  2RQT A;  5CQX A;  4AFZ C;  2V22 B;  3E9F A;  2BE7 D;  4PK4 A;  2EJ9 A;  3E9G A;  3H0H A;  1H1P B;  2OTJ A;  4ZN1 A;  5GAN 8;  1U5S A;  1U3O A;  1HK9 A;  1VQK Q;  2ED0 A;  2JT4 A;  2B9R A;  2FZG B;  4HVV A;  4RTU A;  3ME9 A;  1K9M C;  2DJZ A;  2O88 A;  2CUD A;  4N4H A;  2W0Z A;  3WVE B;  1E9H B;  1SEM A;  1UB4 A;  1OIY B;  4R56 A;  1VQL Q;  2EQK A;  4M7A E;  1B3Q A;  1QQJ A;  2DL7 A;  2L2P A;  3RER A;  3GIB A;  3CME T;  4OB1 B;  1X69 A;  2ABL A;  3TW7 A;  1VA7 A;  2CS7 A;  2F2V A;  5IDN B;  2QEX A;  1M1K C;  4M7A F;  2YUO A;  1H27 B;  5L2W B;  5GMK l;  1FVV B;  3E19 A;  3G71 T;  3CC7 Q;  1SRM A;  4MFE A;  1N6A A;  5ACB A;  3CCU T;  4ATO A;  4FYV B;  2C4G B;  3OYF A;  2Y4Y A;  3J80 E;  1ZSG A;  4YOZ A;  4F17 A;  3GBQ A;  3I55 Q;  2OI3 A;  1JSU B;  1QWF A;  1JKW A;  3QXE B;  3BHT B;  2J06 A;  4GY5 A;  3QYG B;  2YUP A;  4C8Q E;  4KGZ B;  2E65 A;  2CZ6 B;  1T3L A;  4BBS M;  3SB2 A;  5A2Q E;  1S72 A;  3TNW B;  1WPY A;  5GMK j;  3M59 A;  2JM8 A;  3LGF A;  5I21 A;  2RHY A;  3QYE A;  4KGX B;  4IUU A;  1X01 A;  2V1Q A;  4CI0 C;  4C8Q F;  5KYW B;  2YSQ A;  3RKY A;  3CMA Q;  4HT8 A;  2Y4X A;  4IMY B;  1OX9 A;  4O5V A;  5I2S A;  1WX6 A;  3LH5 A;  1GCQ A;  2HDA A;  2MAM A;  2AIR B;  2EJG A;  3OMC A;  4F7J B;  3RMS A;  3VS2 A;  3NTI A;  4HL4 A;  2QFZ A;  4BCQ B;  1N8R R;  1QKX A;  2W2H A;  4EOI B;  1UFF A;  2KRN A;  1UDL A;  2EQI A;  3HZJ A;  4HA8 A;  3CC4 A;  2PUO B;  1AWO A;  2UZL B;  3DJB A;  1K9M R;  5GAN g;  5IHN A;  3HFO A;  4A53 A;  3UT1 A;  4EMG A;  3I55 T;  1GH6 B;  4A54 A;  2LJ0 A;  3VU3 C;  2IIM A;  4G6L B;  1H1Q B;  4QSH A;  4CRI A;  1QW1 A;  4E7S A;  2OTL A;  5L23 A;  1TWB A;  3TW6 A;  4ZTJ A;  4C92 E;  3QZ9 B;  4DBQ A;  1F1B B;  5DQV A;  2PVG B;  2F1L A;  4TTH A;  2QK0 A;  4Y91 A;  3OA6 A;  3CCR A;  4HLQ A;  1M1K R;  2DA9 A;  3P8B B;  1NPR A;  2XIC A;  2ZPH B;  5LJ5 d;  4AG1 C;  2CSI A;  2FPE A;  4C92 F;  3CMA T;  1X6B A;  4QW2 A;  4C0D C;  4EC8 B;  2COW A;  1YIJ A;  3KXT A;  1CSK A;  2BZX A;  4E7L A;  1UNG D;  2QGG A;  4M78 F;  1WIE A;  1PD0 A;  1OU9 A;  3HSB A;  3CME A;  2FEI A;  4X1V A;  1FMW A;  5KH6 A;  2MOX A;  4A4E A;  4ZTF A;  3CCQ Q;  1TH7 A;  1D3B A;  4DOW A;  4BXX X;  3WXM B;  5LJ3 g;  1D0X A;  2ESW A;  3EG9 B;  3G71 A;  2ZZD B;  2A28 A;  3G7Z A;  1X27 A;  3CCU A;  2CKK A;  4K11 A;  4ELZ C;  1G3T A;  3A8H B;  2EGC A;  4BCN B;  4M7D G;  2ZPB B;  3MPU B;  2WIP B;  3PO3 S;  1VQ6 A;  5KE2 A;  1I5O B;  1JO8 A;  2HSP A;  1LNX A;  2KQW A;  2B86 A;  2P4R A;  5GAN j;  1M3B A;  2MMP A;  1GBR A;  3HBL A;  3BDL A;  2ZGW A;  4IKF A;  3LQ5 B;  1BCO A;  1RAE B;  4OP0 A;  4F70 B;  4IUT A;  2DVE A;  5CYI B;  1WHL A;  1IGU A;  1TG0 A;  3M57 A;  3G33 B;  4JRK A;  2ATC B;  3L1A A;  5LJ3 f;  1JB0 E;  3VS4 A;  3TNI B;  4M75 E;  3S3M A;  1KC8 C;  1RI0 A;  2O01 E;  5I5Z B;  3LWI A;  1GUX A;  1BIA A;  1WXU A;  4BE2 A;  2ROT A;  2QAZ A;  2CJM B;  3M54 A;  4M78 B;  4BD3 A;  5EC7 A;  4EOO B;  4KUD K;  4ELJ A;  5M9O A;  4YOO A;  3EFR A;  2NLU A;  2KK4 A;  2DYB A;  4AKG A;  2KI7 A;  4ZGE B;  2C5N B;  2I53 A;  2RO0 A;  2FPD A;  5LJ3 j;  2PU9 B;  3OY9 A;  2QTX A;  4CFU D;  2AKL A;  3HTR A;  3G4S Q;  1FMK A;  5IXB A;  2CP2 A;  5HBE B;  3OYH A;  1Q86 U;  1YWP A;  4J7F A;  4B6M A;  1GXI E;  1H25 B;  2QA4 Q;  5EG2 A;  3D7S B;  4BI8 B;  2LX7 A;  2VYT A;  3H4C A;  3GLX A;  1UTI A;  3SEM A;  1VQ9 Q;  4LNP A;  2EKO A;  4QVZ A;  1ZA2 B;  3TSZ A;  2DTI A;  1I8F A;  2DVJ A;  1JEG A;  2RN8 A;  3DL1 A;  3PVL A;  3PMI A;  2V8K A;  4XTZ A;  3V7C A;  2XD0 A;  2EIF A;  1IHW A;  4ROD A;  3CD6 Q;  1D1B A;  9ATC B;  4ME7 A;  2X4W A;  1E6H A;  4BCH B;  4RTV A;  2F5T X;  3QHS A;  2E41 A;  3DB4 A;  3C95 A;  1QCN A;  1ZP2 A;  1IO6 A;  3GOX A;  3MEU A;  2YRV A;  2QQA A;  1WGS A;  1YJN Q;  3RGF B;  4XTW A;  3A5Z B;  2FRW A;  4BAC A;  1AHJ B;  2GNC A;  3LLR A;  2VV5 A;  3G4S T;  5HBH B;  1ZUU A;  3NFC A;  4M77 A;  1QVF S;  1XQH A;  3SWN A;  1QWE A;  1U1S A;  2RJE A;  4AFS C;  1VIE A;  3S6W A;  4D6W A;  1KC8 R;  3LH0 A;  2KRM A;  2QA4 T;  3V8L A;  3QHW B;  3JB9 F;  3BY7 A;  4BI3 A;  4B9W A;  3MEW A;  2CCI B;  4J5Y A;  3H6Z A;  4IIM A;  3UAT A;  1VQ9 T;  2RF0 A;  3NTH A;  1KXU A;  3CCS Q;  1K73 C;  4PJO A;  2SRC A;  1MMN A;  1YIT Q;  1Y57 A;  3OW2 S;  3OYN A;  3BFM A;  3PGG A;  1I4K 1;  2ZCF B;  4OR5 B;  3FDR A;  5IHK A;  3CCJ Q;  3DTO A;  1JRI A;  3QO3 A;  1RAH B;  4M7A A;  4LDU A;  1UNH D;  1UGQ B;  2KSS A;  3EGX B;  4Y28 E;  1YJ9 A;  3CD6 T;  2ECZ A;  2NUT A;  4HCC A;  3QJY A;  3M0R A;  3FJP A;  4P5N A;  3HO8 A;  1W4S A;  4MIM A;  2HL3 A;  4Z6Y A;  5CQY A;  1Y71 A;  2JJ9 A;  2LQN A;  2M0O A;  2VB6 A;  1X75 C;  1YJN T;  1RI9 A;  3TEE A;  3SWN C;  4RTY A;  1M8V A;  1URC B;  1FXX A;  4QKU A;  4JUV A;  3VYH B;  2W10 A;  8ATC B;  1O9S A;  3RES A;  2K79 A;  3SHW A;  1JJ2 S;  5LL6 S;  2JTM A;  1G2B A;  3S3O A;  2V8I A;  5CCA A;  4D8D A;  2FO0 A;  1UHF A;  3OYC A;  1RLQ C;  2O9V A;  1BU2 A;  2FL7 A;  2RJF A;  4F7U B;  2F2C A;  2KMT A;  4OMO A;  1ABO A;  4M7A C;  2LP5 A;  4FW1 A;  3ZEH A;  1YIT T;  1RAI B;  1I1J A;  3CCJ T;  4LDY A;  1UE9 A;  2KAF A;  2WFY B;  3X25 B;  1AWJ A;  3EH2 A;  4JJD A;  3OYG A;  4BCQ D;  1D1A A;  3POM A;  3QPH A;  1ZX6 A;  2DE0 X;  1QMC A;  3FIF A;  3JCM g;  3QII A;  1P5E B;  1W6X A;  4EMK A;  3OYI A;  3CCM Q;  1MV3 A;  2HQH A;  2QQS A;  1G83 A;  4BY6 C;  1BK2 A;  1K73 R;  5CAI A;  1JQQ A;  4MDW A;  4C8Q C;  3EFO A;  1VQM Q;  5DQW A;  5GMK m;  2HQX A;  4RG2 A;  4OB3 B;  1WQW A;  2AHJ B;  1ZQ1 A;  4JS5 A;  2GCX A;  2GGR A;  1GY3 B;  1K0X A;  1V1C A;  2QG9 B;  2QI2 A;  5CO7 A;  4JLI A;  2OJ2 A;  2NUP B;  2UZD B;  1Y96 A;  4RG8 A;  4FYX B;  1KD1 U;  1OUL A;  2FZC B;  1QLY A;  2JOY A;  2VXE A;  1F5Q B;  4A4K A;  2GTO A;  2DMO A;  2RI3 A;  2E1H A;  3LWH A;  4OVA A;  3EHR A;  4EMK C;  2JZ2 A;  2K5F A;  4AFQ C;  2WMA B;  3FB9 A;  4XTV A;  2DIQ A;  2DD5 A;  4HKE A;  3CD6 A;  2RM4 A;  3EAE A;  3L42 A;  4YOS A;  4MZP A;  1C6V X;  1G8X A;  2KYM A;  2VVK A;  3CCM T;  2EJF A;  3MP8 A;  2EYZ A;  4NS5 A;  4CC3 A;  3AHU A;  4C0D B;  2R7G A;  2JS2 A;  3BW1 A;  2WEV B;  2EQU A;  4C0Z A;  2PTK A;  3EHQ A;  1ACM B;  1VQM T;  1YJN A;  4C92 C;  1C0M A;  4Y92 A;  2DXC A;  3M4G A;  2PZ1 A;  5HCK A;  1UGR B;  3OS0 A;  2HKN A;  1OOT A;  2EBP A;  1ZSZ A;  1M8M A;  3RKW A;  4HNV A;  2CP6 A;  2YRD A;  5FLX E;  4LD6 A;  2EWN A;  2K3Y A;  2KDS A;  1G3S A;  2E5Q A;  3X26 B;  1N4M A;  1H28 B;  5GJW B;  1WHK A;  3BLR B;  3QKJ A;  2YWW A;  5CKE A;  3MI9 B;  1VQN A;  4NST B;  3CCJ A;  2EYY A;  4C5H A;  3TRE A;  4LDX A;  1H8K A;  1QCO A;  4X9C A;  2JUF A;  3B57 A;  2DKG A;  2KGT A;  1KIK A;  5KYY B;  4M75 A;  1RAA B;  1AEY A;  2Z0W A;  2XHC A;  1YHQ T;  2DYI A;  2QGF B;  3I5S A;  3FJ5 A;  3G6E Q;  3C4S A;  4C92 D;  2PNI A;  3HKS A;  1AWW A;  3ZFJ A;  1VQ8 Q;  2CZ7 B;  2H8H A;  1CKB A;  2ROL A;  4M78 D;  3JAM E;  5IHI A;  2ZPE B;  3BG5 A;  2O2O A;  5ICP B;  1RAD B;  1ZSZ C;  4EOL B;  2KBT A;  3OYB A;  1K9A A;  2FB7 A;  5GAO l;  1YJW A;  4X9D A;  4E7K A;  2X9H A;  2RI5 A;  2WHB B;  5CVI A;  3N5B B;  5GMK e;  4JPB W;  1JOW A;  1H92 A;  2K9G A;  1O9K A;  1W2B P;  1PNJ A;  1KSW A;  3HRT A;  1H64 1;  3LW5 E;  4M75 C;  2RQW A;  2F69 A;  4M78 G;  1NE8 A;  4JJB A;  1QCF A;  4OMN A;  5LJ5 g;  1C9B A;  2C0T A;  1YBY A;  3WVD B;  3QG1 A;  5FGK B;  1OGU B;  4J6X A;  2P0Q A;  3A8O B;  3G6E T;  4BDY A;  4J9E A;  2BZY A;  3PTA A;  2P4T A;  3CCV Q;  3L2Z A;  4M77 E;  5KYU A;  1VQ8 T;  3O0G D;  5GAM f;  2DF6 A;  3CCM A;  3HPW A;  2QQ8 A;  4GLM A;  1G3N C;  4N0A A;  2EYQ A;  1VQM A;  4M77 F;  5HNB B;  4PJO E;  1VQ5 Q;  2VGN A;  1BI0 A;  2WJ9 A;  4CRL B;  4PJO F;  2CT3 A;  4DBF A;  2IW6 B;  1BU1 A;  1MV0 B;  1NYG A;  2BE9 B;  5FU6 C;  2CSQ A;  5GAM j;  1M90 C;  4DEY A;  4OMQ A;  1WNL A;  1MMD A;  1IZ6 A;  1Q81 R;  3RDV A;  3VYG A;  2D8J A;  1NM7 A;  4BE0 A;  1Z9Z A;  3PFS A;  5LJ5 j;  3CCV T;  1YHQ A;  1N8R U;  4N0A C;  3UWN A;  3HL8 A;  4IUR A;  4RCB A;  3VS5 A;  4LOC A;  2M16 A;  4J9H A;  3V8K A;  3HB9 A;  4BUG A;  1M2V B;  4JS4 A;  1VQK T;  4MZT A;  3E1S A;  5KCH A;  1K9M U;  2JN0 A;  4DEX A;  2KRO A;  5GAN e;  4M7D A;  1OI9 B;  1GBQ A;  3DDQ B;  1VQ5 T;  1SKU B;  3EOC B;  4R55 A;  1VQL T;  3OS2 A;  3JRZ A;  5DY9 A;  1WA7 A;  2F5K A;  2L0A A;  1UGS B;  1OZ2 A;  5A0G A;  5IXF A;  5C6S A;  4HXJ A;  1VQP Q;  2VC8 A;  2VAS A;  2ZPG B;  4AI6 A;  2D8H A;  1M1K U;  3SWN B;  3M0Q A;  1NPP A;  3NPF A;  2KR3 A;  5GAN 5;  3EGD B;  3TSW A;  2CZ0 B;  1M3A A;  1W2B A;  3CC7 T;  3PT9 A;  2XDP A;  3PIP A;  4LD9 K;  4FX3 B;  2LT1 A;  2RHX A;  1PSE A;  2C5V B;  1U8R A;  1G3W A;  5A0L A;  2HZY A;  3CCL A;  1D09 B;  1ZLM A;  1M5Q 1;  1RUW A;  1BB9 A;  1YCY A;  1KQ1 A;  2LCS A;  3G6E A;  1V29 B;  4BCJ B;  1T0H A;  3X24 B;  1B34 B;  4M7A B;  2VXF A;  2L3P A;  2GQI A;  2EUF A;  2R57 A;  2EW3 A;  1N9S A;  4F7U G;  2DL3 A;  4V2S A;  4A4G A;  1KQS S;  2DXU A;  4YC3 B;  2DRM A;  3IQL A;  4E7H A;  1M90 R;  5LJ3 e;  2LQW A;  2JGZ B;  2YT6 A;  1FMV A;  1GCQ C;  3PIO A;  4RTX A;  2KXC A;  1D1C A;  2LNH B;  4J7I A;  4LN2 A;  1BI2 A;  3QYB A;  2DJQ A;  2LZ6 B;  2W99 A;  1VQP T;  5GAN f;  3FEO A;  1Q7Y C;  2DD4 A;  2O4X A;  1VQ7 Q;  1AZG B;  1BCM A;  2DX1 A;  3VS7 A;  4C8Q B;  4II5 B;  1HXD A;  2CP7 A;  3CPF A;  2IVX A;  3FC3 A;  2V26 A;  2E10 A;  2DBM A;  5GAO p;  4LXC A;  3VJP A;  3QDR B;  1SRL A;  1X43 A;  4NC6 A;  5CK9 A;  2JNG A;  4DA4 A;  2DRK A;  4HVW A;  1YP5 A;  2BIV A;  5LMK B;  4XU1 A;  5CKF A;  5ECA A;  4BB7 A;  4MFD A;  2DXB A;  2X3W D;  3CCE Q;  2P0P A;  2KY9 A;  1VQK A;  2COY A;  1WI7 A;  3LYI A;  1K76 A;  2IVW A;  4EMK B;  1NZ9 A;  4HCZ A;  3OBY A;  4XK8 E;  5FU7 C;  2WIH B;  2DK3 A;  3REA B;  1PHT A;  1PRL C;  1H24 B;  3H0F A;  1OKW B;  2LRQ A;  2YXY A;  1VQL A;  2JTE A;  3X20 B;  1M3C A;  2EGA A;  1VQ7 T;  2LC4 A;  3CCQ T;  1Q86 C;  2AT1 B;  2QQR A;  2VUB A;  2BPM B;  4C92 B;  4E7Z A;  4J9D A;  1TUD A;  3CC7 A;  4AT1 B;  4M75 F;  2WSC E;  3OS5 A;  3OSS C;  3M0S A;  1GL5 A;  2KNB B;  6AT1 B;  2EKH A;  4HCB A;  3I55 A;  2DIL A;  1OQK A;  2LX9 A;  2MK5 A;  3CBP A;  3MET A;  4KH1 B;  2XMF A;  2BUD A;  4MML A;  1MND A;  3M03 A;  2YRC A;  3MP1 A;  2W9Z A;  1Z9Q A;  4EOS B;  2LTO A;  3CCE T;  1Q7Y R;  2MF2 A;  1I5L A;  4RTT A;  1K8A C;  2CP3 A;  5KYX B;  1YFN A;  2KT8 A;  2CP5 A;  1KK7 A;  4WTO B;  2I2L A;  2PQW A;  3A8L B;  3CMA A;  1VQ4 Q;  4KBM B;  2L89 A;  3DB3 A;  2YLC A;  1KJW A;  5D6Y A;  1UUE A;  1X2K A;  4ELL A;  2MIO A;  2XI9 A;  1KC8 U;  3EG0 A;  4MZM A;  2OAW A;  4JDS A;  5IDP B;  2HBW A;  1VQP A;  2DFU A;  4JLG A;  4BCF B;  4EOK B;  3EG1 A;  2RPN A;  1ZSZ B;  3CC2 Q;  2AZV A;  2DL4 A;  2LCL A;  2C0I A;  2EYX A;  1RAG B;  3P8H A;  2XK0 A;  2QGS A;  1PRM C;  2CH4 A;  3KHI A;  2EQJ A;  1PKT A;  2YUN A;  2PVD B;  5GJV B;  3MHX A;  3I9Q A;  1WZO A;  2MYS A;  5FRM A;  5I22 A;  1OZ3 A;  2RQR A;  1TSF A;  2YHT A;  3QHR B;  2MPX C;  1VYW B;  4M75 B;  2CYZ B;  2H3E B;  2RNA A;  3M9Q A;  2GFU A;  1Y0M A;  3PNW C;  1YN8 A;  1ZUY A;  5KYW A;  1N5Z A;  4JRP A;  1U06 A;  4ORZ A;  2MI6 A;  4N4G A;  1XOV A;  1OL2 B;  2O31 A;  1VQ4 T;  3JV3 A;  5DM7 R;  2K5I A;  2P0K A;  1FYN A;  2GF7 A;  4KRC B;  1PWT A;  4XTY A;  3S3N A;  3AT1 B;  4LUD A;  3JCM W;  3A8G B;  2DBK A;  2LJ1 A;  3BDU A;  4IIO A;  2UUE B;  2HL5 C;  2XDD A;  3M0T A;  3CC2 T;  1JXO A;  3CCQ A;  3ZBD A;  3G1J A;  2M02 A;  2SEM A;  3CPW P;  1K8A R;  2RK1 A;  4LDV A;  3VRZ A;  1UGP B;  4C5G A;  1E7O A;  4OMP A;  4M77 C;  5GAO q;  3EG3 A;  4M7D E;  4FM4 B;  2QDY B;  5IHY A;  1VYT A;  3A1P A;  2GFA A;  1X2Q A;  3QWY A;  1YWO A;  3TU4 K;  2K4Y A;  1KFZ A;  5FU6 B;  2BKZ B;  4LUE A;  4E2F B;  1TXQ A;  4EDU A;  4PJO C;  2IN3 A;  4M7D F;  3O5Z A;  4RTW A;  1ZUK A;  3JCM e;  5KYN A;  2RHU A;  2AK5 A;  4OML A;  3VKI A;  2KMG A;  1XO2 A;  3CXC P;  4C0F A;  4Y72 B;  1K73 U;  3CCS T;  1QLB A;  5D7U A;  2PK2 A;  1X6G A;  5BNJ B;  3SDZ A;  3HHT B;  1H3Z A;  3VKG A;  2IPO B;  4ZGJ B;  1KQ2 A;  4TVR A;  1RAC B;  2FG0 A;  1AZE A;  4JX6 A;  3EFS A;  2XDB A;  1YCS B;  1Q82 C;  1XJW B;  3EG9 A;  1UG1 A;  2ZZD A;  1SG5 A;  1WFW A;  4OB0 B;  2HMA A;  1HSQ A;  4L6V 5;  3LX7 A;  4XU3 A;  3THK A;  3QBY A;  1NLP C;  4PL6 A;  1IXD A;  2WPA B;  4M7A D;  4BCP B;  3G4S A;  1Y07 A;  4PFP A;  4J9F A;  3TQ7 P;  3UDC A;  1BI3 A;  3HRU A;  1GCP A;  4B9X A;  4OMM A;  3MY5 B;  2OTJ Q;  2QA4 A;  4KUI A;  4ZN3 A;  1QVG P;  3JCM V;  2EQM A;  2EYW A;  2FRY A;  2YLB A;  2X51 A;  3UF4 A;  2BS3 A;  3L2Q A;  3GP8 A;  1VQ9 A;  1UEB A;  1FWZ A;  1VQ4 A;  2J6O A;  3JCM f;  2QQ9 A;  3V7S A;  5LQF B;  5L8R E;  1M4Z A;  2FZK B;  1TUC A;  1Y7X A;  3MO8 A;  2MWO A;  4M7A G;  5EFQ B;  2R58 A;  5HKC A;  4C8Q D;  4IUP A;  3CC2 A;  5GAN 3;  2DL5 A;  3JCM X;  4AKI A;  3RR6 A;  4CC7 A;  2QEX Q;  2QXF A;  3QUI A;  3K7A M;  2DLP A;  3M0P A;  1OV3 A;  2E6Z A;  5J26 A;  3CPW A;  3MJX A;  1P92 A;  2EAY A;  2QAS A;  1ABQ A;  1PCX A;  2HSE B;  4XTU A;  3KBG A;  3BLH B;  3U23 A;  3M55 A;  1TOV A;  2WXV B;  1MUZ A;  1JBM A;  4J9C A;  4XTX A;  1NJI C;  3OMG A;  1OEB A;  2OTJ T;  1Q82 R;  1OYX A;  3M56 A;  2RHZ A;  3JCM Q;  4C8Q G;  3MIA B;  2WSF E;  4EMH A;  1S72 Q;  1WJQ A;  2DEQ A;  2DER A;  1WJR A;  3CCS A;  1AVZ C;  3CXC A;  1YIT A;  3ULR B;  2LT4 A;  3QDF A;  4QQD A;  1MMA A;  1SSF A;  7AT1 B;  2VKN A;  4IUV A;  4KUL A;  1DJ7 B;  2CUB A;  2VGM A;  4EON B;  3T9N A;  4EOM B;  4FSX A;  5GAM e;  1FKM A;  1AD6 A;  3BHV B;  2LW4 A;  2PHG A;  1BI1 A;  4EOR B;  3QWX X;  3I35 A;  3QWL A;  5GAM h;  2V1R A;  5DLO A;  4PFZ A;  3TNH B;  2PMI B;  5FU7 B;  2O4X B;  2KYB A;  1IHV A;  5D6W A;  3NGP A;  4BCG B;  1D3B B;  5GMK i;  5LJ5 e;  2C0O A;  5FWC A;  1JU5 C;  2GQV A;  1QVF A;  5IT9 E;  2L8D A;  3QZ5 B;  1VOL A;  2DTO A;  1WHJ A;  1NG2 A;  1WJS A;  2OTL Q;  4CFX B;  1ENW A;  4F7L B;  3OYA A;  4WF2 A;  5HQ0 B;  5GMK h;  3OW2 A;  1RL2 A;  2M1H A;  4E47 A;  4C92 G;  3CCR Q;  5I11 A;  4OGR B;  1FIN B;  3JB9 J;  2E6N A;  3I56 Q;  2JXB A;  1QVG A;  2D9T A;  3ASK A;  1OL1 B;  4DOV A;  4UC4 A;  1EIF A;  1YIJ Q;  2IW8 B;  3M4Y A;  2D0Q B;  4F6W B;  2QDL A;  1V76 A;  2RJD A;  2GBQ A;  1NJI R;  2O9S A;  1ZA1 B;  1D0Y A;  4BBR M;  2HKQ B;  3CBO A;  3DLM A;  2DTH A;  4GBQ A;  2XU8 A;  4Z8A A;  1JJ2 A;  3L2W A;  4OGC A;  1KHC A;  2WMB B;  1GUX B;  1Q81 U;  2J6F A;  8AT1 B;  1YI2 Q;  3REB B;  2A3L A;  4LE9 A;  3PE0 A;  2G6F X;  2OTL T;  3JCM J;  4I3Z B;  1VQ6 Q;  2KEA A;  4F7U A;  4M75 D;  5LJ5 f;  4F04 B;  1N8R C;  1SF9 A;  1SPK A;  3GNF B;  3CCR T;  2LJ3 A;  2IG0 A;  3QSU A;  4M6V A;  4XU2 A;  3I56 T;  2LQ8 A;  2ENM A;  5CR2 A;  2DXT A;  2MWP A;  3NTK A;  1LCK A;  2K3B A;  2L3R A;  1FX7 A;  2CZ1 B;  1GFD A;  1YIJ T;  2FYK A;  3RUX A;  2K6D A;  1K1Z A;  1QP3 A;  3R6O A;  1O75 A;  2NWM A;  3DOG B;  3GF5 A;  2LDM A;  3HRS A;  3SFM A;  1M30 A;  4FIB A;  3OYK A;  4M75 G;  3NHN A;  2QYZ A;  3RKX A;  4EPC A;  4BCM B;  2H3J A;  2UZB B;  4JJC A;  3TVT A;  2DME A;  2QQB A;  3L2R A;  2LVM A;  4EOP B;  1X6O A;  4ESR A;  3TN8 B;  1YI2 T;  2M0Y A;  4JZ3 A;  1MHN A;  1VQ6 T;  5GAN h;  4FSS A;  2HNI A;  2VWF A;  3DKM A;  5HY6 A;  1AWX A;  2A37 A;  3GTM S;  4QQ6 A;  2NUP A;  2HEQ A;  3I5R A;  2PVO B;  1OX8 A;  2IW9 B;  1PG5 B;  3BE3 A;  2RA2 A;  4F7N B;  4A4F A;  4M77 B;  1M90 U;  1TS9 A;  3C12 A;  2RJC A;  1UEC A;  2A7Y A;  3VS6 A;  4PJL A;  5FW9 A;  2Y90 A;  1C1A A;  1MNE A;  1E7P A;  4Z02 A;  4KRD B;  4ZGD B;  2UZE B;  4PJO B;  3JB9 D;  4BY1 X;  2AKK A;  2V8J A;  1HD3 A;  1M9S A;  5GAN 6;  4AG2 C;  1UJY A;  2B8A A;  4OF1 A;  2MCN A;  1NEB A;  4E7I A;  4F7S B;  1OPK A;  4M7D C;  1MMG A;  4XQ3 A;  1H1S B;  2X1N B;  2DM1 A;  1VQ8 A;  2C06 A;  2NUT B;  2RK2 A;  2WAC A;  1VYU A;  1IRE B;  4R0K A;  4NOY A;  1PM3 A;  3A98 A;  3C0C A;  4QT7 A;  3TCJ A;  5LJ3 h;  5GAM d;  4X34 A;  1J3T A;  4FCY A;  1TUG B;  3JB9 G;  4RTZ A;  1VYV A;  3ER0 A;  4AFU C;  4RMO A;  4HCK A;  1VIN A;  2G77 A;  5HBJ B;  1AT1 B;  3HP9 A;  1G5V A;  4CFM B;  4F6U B;  4BY6 B;  2M9U A;  2CP0 A;  2GTJ A;  4M78 E;  3I56 A;  3OQ5 A;  3OYD A;  4QVD A;  3VKH A;  1UHC A;  2LNV A;  2ED1 A;  2JW4 A;  1OKV B;  5KYY A;  2HAX A;  4M7D D;  2F2X A;  3OB9 A;  1IGQ A;  3ZL7 C;  4ELY C;  2AZS A;  1YJ9 Q;  1M1F A;  2RQU A;  2XG8 D;  3EGU A;  2RD1 A;  1G3Y A;  3P8D A;  4WCI A;  3CCV A;  2CGH A;  2XID A;  4ROE A;  1I0C A;  5CIU A;  4DBR A;  1AD5 A;  2QF7 A;  1UNL D;  1LOJ A;  4PJN A;  3MEA A;  2R5A A;  3VS3 A;  5CKB A;  1LJO A;  3UA6 A;  4MDX A;  1YI2 A;  4KH0 B;  1VQ5 A;  1ARK A;  3HFN A;  4JRQ A;  4EOJ B;  4II1 A;  1W98 B;  3INZ A;  2QTV A;  3RNJ A;  3EFO B;  3BG3 A;  4E7J A;  1QKW A;  4O6J A;  3JSC A;  2E3I A;  2JS0 A;  1Q7Y U;  2J7I A;  1H26 B;  3FRN A;  3NMZ C;  3UA7 A;  1CKA A;  1T0J A;  4FW2 A;  3MCA B;  3L2V A;  3DLL A;  4ROC A;  1KQS P;  4XAX B;  1I81 A;  1Y96 B;  2F2W A; 
#chains in the Genus database with same CATH homology
 4VUB A;  2RHU A;  4X9C A;  3VKI A;  3SB2 A;  2KMG A;  2JUF A;  1WPY A;  5A2Q E;  2DKG A;  3M59 A;  4C0F A;  5GMK j;  5I21 A;  3LGF A;  4FL6 A;  1YJ9 T;  2RHY A;  3QYE A;  4M75 A;  4IUU A;  1K73 U;  2XHC A;  4L59 A;  1QLB A;  3CCS T;  1X01 A;  4L5G A;  1YHQ T;  5KE3 A;  4CI0 C;  3C4S A;  4C92 D;  3KUF A;  4C8Q F;  3M5A A;  3HKS A;  5GAN 2;  3ZFJ A;  5J3B A;  3SDZ A;  3HHT B;  3RKY A;  4HT8 A;  2Y4X A;  1H3Z A;  2DD5 B;  2CZ7 B;  2ZPF B;  3VKG A;  4ZGJ B;  1KQ2 A;  4TVR A;  4M78 D;  3JAM E;  4O5V A;  5I2S A;  2ZPE B;  4JX6 A;  3BG5 A;  3EFS A;  2D6F A;  2HD0 A;  2MAM A;  2EJG A;  2DZC A;  3OMC A;  3RMS A;  3OYB A;  4RCC A;  2FB7 A;  3NTI A;  4HL4 A;  1Q82 C;  5GAO l;  2QFZ A;  1YJW A;  4X9D A;  3UPU A;  4E7K A;  2RI5 A;  2ZZD A;  5CVI A;  4HT9 A;  2KVQ G;  3CPW S;  3OYJ A;  5GAO r;  3N5B B;  5AYF A;  4OB0 B;  5GMK e;  3HZJ A;  4HA8 A;  3CC4 A;  2DXC B;  2PUO B;  4L6V 5;  5GAN g;  4NL3 A;  3HFO A;  4A53 A;  3UT1 A;  4EMG A;  3LX7 A;  4GLK A;  3I55 T;  4XU3 A;  3QBY A;  4A54 A;  4PL6 A;  3VU3 C;  3VV0 A;  3HRT A;  4QSH A;  4CRI A;  4M7A D;  1QW1 A;  1H64 1;  4J83 A;  3LW5 E;  2OTL A;  4M75 C;  4M78 G;  2F69 A;  1Q81 U;  1NE8 A;  5GAN d;  5LJ5 g;  2ZPI B;  3G4S A;  1Y07 A;  3UDC A;  3TW6 A;  3O8V A;  3V8J A;  1YBY A;  4OB2 B;  1BI3 A;  3HRU A;  4B9X A;  3QZ9 B;  4C92 E;  4ZTJ A;  3WVD B;  3QG1 A;  2PVG B;  3OA6 A;  4Y91 A;  3CCR A;  2QA4 A;  4KUI A;  4ZN3 A;  4HLQ A;  3QJ6 A;  3F70 A;  4J6X A;  2P0Q A;  3JCM V;  2EQM A;  5EJC A;  3OYL A;  3P8B B;  1M1G A;  1NPR A;  2XIC A;  3CXC S;  3A8O B;  2ZPH B;  2DAQ A;  3G6E T;  4BDY A;  2YLB A;  5LJ5 d;  5GAN 7;  5GAN 4;  3PTA A;  2BS3 A;  3L2Q A;  3GP8 A;  1BIB A;  2P4T A;  4F7U E;  1VQ9 A;  3L2Z A;  4M77 E;  1UEB A;  4C92 F;  1FWZ A;  4QW2 A;  2HBP A;  3JCM f;  4C0D C;  1VQ4 A;  1VQ8 T;  2QQ9 A;  3V7S A;  1K8A U;  5L8R E;  1YIJ A;  4OGE A;  5GAM f;  3KXT A;  1M4Z A;  2DIG A;  5KCO A;  2K3X A;  3CCM A;  4E7L A;  3HPW A;  4M78 F;  2QQ8 A;  1Y7X A;  3MO8 A;  3OYM A;  5GAO n;  2MWO A;  3HSB A;  3CEY A;  4M7A G;  4N0A A;  4NL2 A;  3CME A;  4HNU A;  2EYQ A;  4F7U F;  1VQM A;  5KH6 A;  4M77 F;  5HKC A;  2R58 A;  4C8Q D;  4IUP A;  4PJO E;  4A4E A;  4BE1 A;  5GAN 3;  4ZTF A;  3CC2 A;  1TH7 A;  3JCM X;  1D3B A;  4AKI A;  2VGN A;  3CBM A;  3Q1J A;  4DOW A;  2QXF A;  3QUI A;  4JX4 A;  1BI0 A;  2WJ9 A;  3WXM B;  5LJ3 g;  2E6Z A;  5J26 A;  3CPW A;  3G71 A;  1P92 A;  1KG1 A;  2ZZD B;  2EAY A;  3FLG A;  4PKC C;  3G7Z A;  5GAO m;  4PJO F;  3CCU A;  2CKK A;  2XKO C;  1G3T A;  4ELZ C;  1VQ7 A;  3A8H B;  4LDW A;  4XTU A;  3KBG A;  4M7D G;  3GPL A;  2ZPB B;  3MEV A;  2K5L A;  5FU6 C;  5GAM j;  5FRN A;  1M90 C;  3M55 A;  4FU6 A;  2DO3 A;  5KE2 A;  1VQ6 A;  5LJ3 d;  1JBM A;  2K57 A;  1LNX A;  2KQW A;  4JRP A;  5GAN j;  1WNL A;  4XTX A;  1NJI C;  3URG A;  1IZ6 A;  3OMG A;  2OTJ T;  3VYG A;  1OYX A;  3M56 A;  2RHZ A;  3JCM Q;  4C8Q G;  1N27 A;  1B34 A;  2WSF E;  2MMP A;  4EMH A;  2EFI A;  4BE0 A;  1KQS A;  1WJQ A;  2DEQ A;  3PFS A;  3M58 A;  1QVG S;  3HBL A;  3BDL A;  1WJR A;  2ZGW A;  5LJ5 j;  3CCV T;  4IKF A;  3GNG A;  3CCS A;  1YHQ A;  1N8R U;  4N0A C;  3UWN A;  3HL8 A;  3CXC A;  1BKB A;  4IUR A;  1YIT A;  4OP0 A;  3JCM c;  2LT4 A;  4QQD A;  4RCB A;  1SSF A;  4LOC A;  2M16 A;  4IUT A;  2DVE A;  3HB9 A;  3V8K A;  2FHD A;  4IUV A;  4KUL A;  3M57 A;  1DJ7 B;  1QVP A;  2VGM A;  4JRK A;  3CCE A;  4JS4 A;  1ZHI A;  3L1A A;  5LJ3 f;  1VQK T;  4MZT A;  1VUB A;  3RIR A;  3T9N A;  3E1S A;  4FSX A;  5GAM e;  5KCH A;  1JB0 E;  1K9M U;  1FKM A;  2JN0 A;  4M75 E;  3JCM h;  1BI1 A;  3S3M A;  1KC8 C;  1RI0 A;  5GAN e;  2O01 E;  4M7D A;  3QWL A;  5GAM h;  1VQ5 T;  3JCM b;  3LWI A;  5DLO A;  1BIA A;  4R55 A;  2G3R A;  4BE2 A;  5FU7 B;  1VQL T;  2O4X B;  3OS2 A;  3JRZ A;  5D6W A;  5DY9 A;  3M54 A;  2F5K A;  4C8Q A;  1UGS B;  1D3B B;  1OZ2 A;  4M78 B;  4BD3 A;  4BUG A;  5A0G A;  5C6S A;  5J39 A;  2GQV A;  5GMK i;  4ELJ A;  5LJ5 e;  5M9O A;  4KUD K;  1QVF A;  2VC8 A;  3EFR A;  4M77 D;  2NLU A;  2L8D A;  2KK4 A;  4AKG A;  2ZPG B;  4AI6 A;  2RB6 A;  3QZ5 B;  1OI1 A;  1XNI A;  4ZGE B;  2E70 A;  2LCC A;  1NPP A;  3SWN B;  3V7R A;  4C5E A;  1M1K U;  4Q5W A;  2DTO A;  2RO0 A;  5LJ3 j;  5GAN 5;  1WJS A;  2CZ0 B;  2PU9 B;  3OYE A;  1W2B A;  3OY9 A;  2QTX A;  3L2U A;  3CC7 T;  3PT9 A;  1VQN T;  1VQO T;  2X4X A;  2XDP A;  3PIP A;  3OYA A;  4LD9 K;  4WF2 A;  3RUX A;  1KD1 C;  2LT1 A;  2RHX A;  1PSE A;  4PJO D;  1Q86 U;  5GMK h;  3OYH A;  3OW2 A;  1RL2 A;  4IUQ A;  2M1H A;  1G3W A;  4J7F A;  4E47 A;  5A0L A;  4C92 G;  3A8M B;  1U8R A;  1GXI E;  3CCL A;  5EG2 A;  3JB9 J;  3JB9 H;  4BI8 B;  1M5Q 1;  3VYG B;  2VYT A;  3M53 A;  3H4C A;  1KQ1 A;  1YCY A;  2E6N A;  1V29 B;  3GLX A;  3G6E A;  3X24 B;  1B34 B;  4KT0 E;  4M7A B;  1S72 A;  1QVG A;  2VXF A;  2D9T A;  2EKO A;  3ASK A;  4DQ2 A;  4QVZ A;  2R57 A;  4DOV A;  1N9S A;  4J8O A;  4F7U G;  4UC4 A;  4M77 G;  4V2S A;  1EIF A;  2DTI A;  4A4G A;  1I8F A;  1KQS S;  2DXU A;  3DL1 A;  4E7H A;  3M4Y A;  2D0Q B;  3PMI A;  5LJ3 e;  2V8K A;  3VUB A;  4XTZ A;  3V7C A;  2RJD A;  1YJW T;  5D6X A;  4QVC A;  2XD0 A;  3PIO A;  2EIF A;  2RHI A;  3QYH B;  4ME7 A;  4BBR M;  4PJO G;  2X4W A;  4J7I A;  3CBO A;  3DLM A;  2DTH A;  4PLI A;  2F5T X;  5DLQ E;  2XU8 A;  4M7D B;  3QHS A;  1BI2 A;  1JJ2 A;  3QYB A;  2E41 A;  3L2W A;  2OAU A;  4OGC A;  3DB4 A;  3C95 A;  1ZBX A;  4N4I A;  1KHC A;  1VQP T;  3GOX A;  3MEU A;  2YRV A;  2QQA A;  4FT4 A;  2KR6 A;  3C94 A;  1WGS A;  4C92 A;  5GAN f;  3FEO A;  1Q82 U;  1Q7Y C;  2DD4 A;  2HQE A;  2O4X A;  4XTW A;  2K2V A;  2A3L A;  3A5Z B;  5I2M A;  4C8Q B;  4BAC A;  1AHJ B;  4M78 A;  2OTL T;  3LLR A;  1HXD A;  3JCM J;  2X4J A;  1PSF A;  2VV5 A;  3CPF A;  3G4S T;  3FC3 A;  1R8O B;  3NFC A;  1N9R A;  4M75 D;  4F7U A;  2E10 A;  4M77 A;  5LJ5 f;  1N8R C;  5GAO p;  3VJP A;  1QVF S;  1XQH A;  3SWN A;  2X35 A;  1U1S A;  2RJE A;  1VIE A;  3S6W A;  4D6W A;  3GNF B;  3LH0 A;  3QDR B;  3CCR T;  2IG0 A;  4OMF B;  4NC6 A;  2QA4 T;  3V8L A;  3QSU A;  5CK9 A;  3JB9 F;  3BY7 A;  4M6V A;  4A4H A;  2JNG A;  4B9W A;  4BI3 A;  4DA4 A;  3MEW A;  3OBW A;  4J5Y A;  3H6Z A;  4XU2 A;  3VUZ A;  3I56 T;  2LQ8 A;  5CR2 A;  1W2B S;  2DXT A;  2BIV A;  4XU1 A;  2MWP A;  1VQ9 T;  3NTK A;  3NTH A;  4XU0 A;  3J7A F;  1K73 C;  4PJO A;  2L3R A;  5CKF A;  4BB7 A;  1FX7 A;  2CZ1 B;  4MFD A;  1YIJ T;  4C0G A;  3JB9 I;  3OYN A;  2FYK A;  3BFM A;  3OSV A;  3PGG A;  1I4K 1;  1QP3 A;  2ZCF B;  2DXB A;  1O75 A;  2DZ9 A;  3FDR A;  3GF5 A;  3R6O A;  1MGQ A;  1JRI A;  3QO3 A;  5FRO A;  2LDM A;  2P0P A;  4M7A A;  2KY9 A;  1VQK A;  4LDU A;  3HRS A;  1UGQ B;  3LYI A;  5C0M A;  3SFM A;  2KSS A;  4Y28 E;  3RMQ A;  4BDZ A;  2IVW A;  1YJ9 A;  3CD6 A;  3CD6 T;  4FIB A;  3OYK A;  4EMK B;  1NZ9 A;  4M75 G;  2PUK B;  4HCZ A;  3OBY A;  4XK8 E;  5FU7 C;  2DK3 A;  3OS1 A;  3RKX A;  3QJY A;  4HCC A;  4EPC A;  5HK0 A;  3FJP A;  4PLL A;  2E64 A;  4P5N A;  2H3J A;  3HO8 A;  1QP2 A;  2LRQ A;  1W4S A;  3MP6 A;  4M78 C;  2E12 A;  1VQL A;  4MIM A;  4Z6Y A;  2QQB A;  3BG9 A;  5CQY A;  1Y71 A;  2LVM A;  2M0O A;  3X20 B;  4AKH A;  3L2R A;  1X75 C;  1BYM A;  1YJN T;  1X6O A;  1U1T A;  3TEE A;  1VQ7 T;  3SWN C;  2LC4 A;  1M8V A;  1FXX A;  2DPP B;  1YI2 T;  3CCQ T;  4JUV A;  3VYH B;  1Q86 C;  1WQ7 A;  3SD4 A;  2QQR A;  3H8Z A;  4MMK A;  1MHN A;  2QEX T;  1O9S A;  1KHI A;  2VUB A;  3RES A;  1VQ6 T;  4C92 B;  5GAN h;  1JJ2 S;  2HNI A;  2X4Y A;  4PNO A;  5LL6 S;  2DD4 B;  2JTM A;  3DKM A;  5HY6 A;  3CC7 A;  4QQ6 A;  2V8I A;  4M75 F;  5CCA A;  2WSC E;  3OS5 A;  3OSS C;  3S3O A;  3X28 B;  1VQO A;  4FT2 A;  2PVO B;  2RA2 A;  3OYC A;  4HCB A;  2RJF A;  2FL7 A;  4J6W A;  4F7U B;  3J81 E;  4YTL A;  4M77 B;  4A4F A;  3I55 A;  2FVU A;  5LJ5 h;  1M90 U;  2JVV A;  2KMT A;  4M7A C;  2LX9 A;  3C12 A;  3CBP A;  3MET A;  2RJC A;  3ZEH A;  4RKU E;  1NJI U;  4JJN K;  2A7Y A;  4C5I A;  3OW2 S;  3JCM P;  1YIT T;  2BUD A;  4MML A;  2Y90 A;  5CKH A;  3MP1 A;  3CCJ T;  4LDY A;  5IN1 A;  2KAF A;  2LTO A;  3OYY A;  3CCE T;  3X25 B;  1E7P A;  2MF2 A;  1I5L A;  4Z02 A;  4HNT A;  1K8A C;  4ZGD B;  4J6Y A;  2LQK A;  1S72 T;  4PJO B;  3JB9 D;  2V8J A;  3OYG A;  1M9S A;  5GAN 6;  1Q81 C;  2DXB B;  2B8A A;  4OF1 A;  3QPH A;  2RH2 A;  2BS4 A;  4E7I A;  2I2L A;  1XTD A;  2PQW A;  4M7D C;  2XDB A;  3FIF A;  3JCM g;  4BI4 A;  3A8L B;  5A0D A;  4XQ3 A;  3CMA A;  3QII A;  1VQ8 A;  4KBM B;  2L89 A;  3DB3 A;  5GAM g;  2YLC A;  3LGL A;  5D6Y A;  4EMK A;  4QQG A;  2C06 A;  3OYI A;  2RK2 A;  2WAC A;  4BBS M;  2XI9 A;  1KC8 U;  1IRE B;  2QQS A;  4MZM A;  4JDS A;  4BY6 C;  1VQP A;  4NOY A;  3TCJ A;  5IAY A;  5CAI A;  4C8Q C;  4JLG A;  4MDW A;  5HK3 A;  3JCM d;  2R5M A;  5LJ3 h;  2LCL A;  5GMK m;  5GAM d;  4X34 A;  3P8H A;  2HQX A;  2XK0 A;  2BS2 A;  4RG2 A;  3JB9 G;  4JX5 A;  3CC4 T;  3KHI A;  2WSE E;  2L5Q A;  4OB3 B;  1WQW A;  2AHJ B;  1ZQ1 A;  2EQJ A;  2RI2 A;  3ER0 A;  4JS5 A;  2GCX A;  4RMO A;  2PVD B;  1VIF A;  2BKD N;  3MHX A;  4JRI A;  2G77 A;  3CCL T;  2QI2 A;  3HP9 A;  5CO7 A;  4JLI A;  5FRM A;  1G5V A;  4BY6 B;  2M9U A;  5CKD A;  3PMT A;  4M78 E;  2JTF A;  3I56 A;  3OQ5 A;  2QDJ A;  3OYD A;  1OZ3 A;  1Y96 A;  4RG8 A;  4QVD A;  5CQX A;  3VKH A;  2YHT A;  3E9F A;  2LNV A;  1KD1 U;  2JOY A;  2HAX A;  4M7D D;  2VXE A;  4M75 B;  4A4K A;  2CYZ B;  2EJ9 A;  3M9Q A;  2RI3 A;  3E9G A;  3OB9 A;  3CMA T;  2GFU A;  2OTJ A;  2E1H A;  4ELY C;  3LWH A;  3PNW C;  4OVA A;  4ZN1 A;  5GAN 8;  1HK9 A;  4EMK C;  2JZ2 A;  2K5F A;  3FB9 A;  3ME9 A;  2DIQ A;  1M1F A;  2DJZ A;  2DD5 A;  2XG8 D;  4XTV A;  1K9M C;  4HKE A;  2RD1 A;  1G3Y A;  3P8D A;  2RM4 A;  3EAE A;  3L42 A;  2MI6 A;  4N4G A;  3CCV A;  1XOV A;  4N4H A;  4MZP A;  1VQ4 T;  5DM7 R;  2K5I A;  2P0K A;  3WVE B;  2GF7 A;  2CGH A;  4XTY A;  3S3N A;  2XID A;  3CCM T;  2EJF A;  3MP8 A;  4NS5 A;  5CIU A;  1UB4 A;  3JCM W;  3AHU A;  4R56 A;  3A8G B;  4C0D B;  2EQK A;  4M7A E;  3BW1 A;  3RER A;  2EQU A;  4C0Z A;  2QF7 A;  3BDU A;  3GIB A;  1LOJ A;  3CME T;  3MEA A;  2R5A A;  1VQM T;  1YJN A;  2XDD A;  4OB1 B;  5CKB A;  1LJO A;  4MDX A;  4C92 C;  3CC2 T;  1YI2 A;  3CCQ A;  3ZBD A;  1VQ5 A;  2DXC A;  3M4G A;  3TW7 A;  2CS7 A;  3HFN A;  2QEX A;  4JRQ A;  1M1K C;  1UGR B;  4II1 A;  4M7A F;  3OS0 A;  2RK1 A;  3INZ A;  5GMK l;  4E7J A;  3BG3 A;  3E19 A;  3G71 T;  4O6J A;  4MFE A;  1N6A A;  3JSC A;  4LDV A;  1UGP B;  3RKW A;  4HNV A;  1Q7Y U;  4C5G A;  3CCU T;  4ATO A;  3FRN A;  4M77 C;  5GAO q;  3OYF A;  5FLX E;  4M7D E;  4FM4 B;  2Y4Y A;  3J80 E;  4LD6 A;  2EWN A;  2QDY B;  2K3Y A;  2KDS A;  1G3S A;  2GFA A;  2E5Q A;  3TU4 K;  3X26 B;  3QXE B;  3MCA B;  2K4Y A;  3L2V A;  3DLL A;  3QKJ A;  5FU6 B;  4GY5 A;  5CKE A;  3QYG B;  1VQN A;  4EDU A;  4C8Q E;  4PJO C;  2E65 A;  4XAX B;  4C5H A;  2CZ6 B;  1I81 A;  3TRE A;  3CCJ A;  4LDX A;  3JCM e;  4M7D F;  1Y96 B;  5IT9 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...