2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
b'MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein lp_2664
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural genomics, unknown function
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
5DQVA 5DQWA 5IHYA 3DJBA 2QGSA 3DTOA 2PJQA 3B57A
chains in the Genus database with same CATH superfamily
2WEVB 5AQGB 4KUMB 4JX5A 1H4LD 5LHIB 5J0ZA 2PBIA 2ZM2A 2Y6XA 4Z8XA 2V6XA 5AQTB 2EHOD 2PHGA 4FJOA 1T8BA 3A8HB 5ETWA 3FZMB 2XY8B 2IN3A 4TWHA 3RIFA 2LSKA 4F7LB 2DD4B 1WRDA 3PUQA 1BR4A 2BVMA 3CWZB 1H26B 4LF5T 4CI2B 3UUNA 5LBMA 1WCRA 4BCNB 5HEGA 3PU3A 2XHEB 3Q5EA 3AE8A 3RQUA 5HCJA 4ZI7E 4AQGA 1V29B 3VYHB 4CFMB 4RODA 3JC6D 3RC8A 2BKPA 3AE2A 2JJ9A 5AQKB 2UUAT 4DBRA 1SE7A 1YD8G 3X1DA 4A56A 3ZPOA 2LT3A 5HWYA 2BDEA 2DLRA 3AXJB 4C90A 3H3AA 4KRDB 4TX5A 2WU5A 4XZCA 2BBJA 5CEIB 2VKDA 3HZJA 3AAIA 3GMIA 4PFPA 5FYMA 3UULA 1XNRT 2UXBT 4TN7B 2WXVB 4HNTA 2JIWA 2HPJA 3QOFA 3ZN1B 5TAOA 1OL2B 4P0AA 2CA5A 2KT9A 2K9AA 4E7SA 1AISB 1Y01A 3N9NA 4WNKA 1KNPA 4KRCB 1N34T 3X24B 3ZJ2A 3HB9A 2WU2A 2YDSA 2XJ7A 3TNWB 1KXUA 4Z6YA 2KSRA 1US7B 3SFEA 3AE4A 3TKLB 2CZ7B 4EOLB 5FVKA 5JDFA 2UUEB 2W66A 1X79A 2LSGA 2JMHA 3MKDA 4IE6A 4B3RT 1WR0A 3JAFA 4UELA 2CCQA 3X25B 1MMNA 2BKZB 3ZEFB 3UU5A 4BA9A 3C50A 2MAWA 4G2AA 4DMVA 5LA6E 4AKGA 3CKDA 2WQYA 2LSJA 3G33B 3UU3A 1XDPA 3HR0A 4U2ZA 2ZM6T 1J5WA 5ABFA 3MACA 4ZGEB 3F5XB 3RQWA 3S4UA 5AQPB 3QNUA 1BR2A 3WAJA 3QXEB 3Q5WA 2K5BB 3IF8B 4NUVA 3VRAA 5FL0A 2CXDA 5H6RB 2V26A 2ZPGB 4DV2T 3EABA 5GONE 4KHZF 3UFGA 3LSVA 2V6YB 1IAPA 4CZZB 1FINB 3BG3A 3SFDA 1ZOYA 2E9XC 4XAXB 2CHNA 3P4PA 5LMNT 2UXCT 2X9WA 3EVYA 4G6LB 4GOUA 1HFAA 4HWFA 5AQSB 3HKDE 4AQFC 2IDOB 3HI2A 3QZ9B 1VCSA 5BR8T 2NW8A 3BLRB 3NBXX 1N36T 2HH7A 1R8IA 3LJCA 2LOPA 1D1CA 2VASA 5IYZE 2ODUA 3UU4A 4LF8T 4EOIB 3RYHE 5F5WA 3D0TA 2YK0A 1JSUB 3B57A 4ZGDB 4X20E 4LF7T 2LKGA 1LRZA 1CHUA 4WZXA 4HEAA 4EB6E 3HHTB 3PU8A 4EAHA 4X64T 3EI0A 4UF0B 4IDZA 2QDJA 1PKDB 5LMUT 5L3CB 1O9KB 2CZ0B 3X20B 3K3NA 1ZV4X 4M6VA 4JLEA 3VU7H 2CYZB 3RF1A 1HS7A 2MBGA 2I53A 3JADA 2H3RA 5KX5E 2XQ3A 3CVRA 3GN5B 3QWLA 2V6YA 2VKJA 2WP9A 4CFUD 2V22B 1YKEB 1M7KA 2KR6A 5HEUA 3ZMTB 2L8KA 1WLXA 3UTKA 3CX8B 3MI9B 3KBUA 5M4YA 4GK5E 5LGUB 1QUUA 4MHCA 4DO0A 2CBJA 1OIUB 1OEDA 3UQ4A 4F8HA 3C98B 2MYSA 5DJQC 2CXLA 2CXFA 4X1KE 5AQOB 4M1PA 5BMVE 3UUBA 5HBEB 2XM1A 3AE3A 4LFAT 5LB7B 3VR9A 3QHRB 2E2AA 2CLYC 4QXHB 5JDGA 1G8XA 5FGKB 4EOPB 1T7SA 5AQIB 2D5UA 1JSTB 2IVXA 4CI1B 1XO2A 3L3PA 1JOWA 3T8OA 5KXJA 4H9PC 2WJ9A 4MFEA 1MIWA 2ZPBB 2IC9A 1AD6A 1OXZA 3VHLA 3FXEB 3NRYA 3UUMA 4HWIB 5JRCB 3B13A 3M03A 4JI7T 2PK9B 4ROCA 3FHNA 3N9LA 1O9KA 3CQXC 2UXNB 4TNWA 5CFBA 3P4WA 2VQFT 2IUBA 4YJ3E 4DR4T 4IMYB 5FXXA 4YSYA 4HWCA 5EFQB 3GN5A 2QGSA 4BCFB 5F8PA 4BY1X 3N2OA 4EZ4A 4YLHA 3E22E 5AQMB 4AISA 3OKQA 3ZT7A 2ODVA 4AKLA 3AVRA 2NTXA 4JI5T 2W63A 2XAQB 4H63H 2PMIB 2HHHT 4MIMA 3AEDA 3AA1B 4V1Av 4JI6T 4LFCT 1NEKA 5ABHA 2X0LB 3EAMA 3TW7A 4O4JE 4IDOA 2V8SV 4ZGJB 3ZC0A 3UU8A 3NVOA 1QSDA 2D0UA 3HL6A 5KDMC 4ILAA 2CPTA 5IDNB 1W0AA 2XQ9A 5IDPB 3JAEA 2F2CA 3DTOA 4TV8E 2LM2A 5L3FB 4I3ZB 2ZLYA 1H25B 4F6WB 1FVVB 1BR1A 3FZKB 4HFCA 5LGNB 3EDVA 4PW8A 4YOZA 2VL8A 1UNHD 3FB2A 1SA0E 1H1PB 5FNVE 4DV0T 1BU2A 1VINA 1J1JA 4YTMA 1XDOA 4BAYB 5AQHB 3BG5A 2LM9A 2JPFA 1HG2A 1YXRA 4ZOLE 5ACBA 3X26B 4YOSA 4PK4A 2C5KT 1WYBA 4HWDA 2OV9A 1U5PA 3I0QA 5FL1A 2PTFA 3ANWA 2X0YA 4I4TE 4NC6A 4KHPT 4BCHB 2ZMAA 2WIPB 2IW9B 3DL1A 4F7JB 1W98B 3LK42 2W9FA 2UUCT 2AHJB 4AI6A 3O0GD 4CI3B 2XQ8A 2G9XB 2QDYB 5J2UE 5JQGE 5HAXA 4ISSA 3L09A 1OEDC 3DJBA 3NWIA 3RH3A 1HX8A 1FMWA 3N5LA 4LF6T 1YQ3A 3IA3A 4OYJA 1EZ3A 1IBLT 2I6HA 3ZMUB 2VQET 1OL1B 2CCHB 3QYEA 2IW8B 2W62A 2CHOA 1W9RA 3LQ5B 2XUEA 4IIJE 2KLQA 1E1HB 1I6ZA 2NOXA 1AHJB 3GWHA 2KWHA 4PJMA 5CYIB 5CA1E 2X67A 4OR5B 2WHBB 4XBFB 5LYJE 3AEGA 3A8GB 3RKOA 3CK6A 1OEDE 1UX4A 2CE7A 2JQ9A 3FXDB 2W96A 3ZLIA 5DABA 2XZEA 4UVCB 1URCB 1N33T 2LLYA 1NAFA 2RPAA 4IDPA 2ZCFB 4AKHA 4AQFA 3O1JA 1IZNB 4F6RC 3F2EA 3KV4A 1TFBA 4KP3C 4JBWF 4LF9T 5HCMA 3U3IA 3PUVF 3QUJA 3N2GE 3VKGA 5IWAT 1DU2A 4DR6T 4YOOA 4CRLB 1IBKT 5L2WB 5AQNB 1UGOA 1HR0T 4GKKT 1BR0A 4IE4A 4O4HE 2XAFB 1FJGT 2E8IA 3F31A 4HGAA 3AA6B 2Q9QD 3QK6A 2BS4A 4X1YE 2KXPB 5CA0E 4H63V 2C4GB 3PUGA 2UU9T 5AQJB 5HEHA 2M67A 4KX6A 5DQWA 4GIWA 5J2TE 2C5JA 1UCUA 1VOMA 2OA5A 3OYXA 3ZCJA 2WDRA 5JDHA 4IT4A 5E0OA 3DOGB 2VB6A 4H9NC 3RYFE 4N78D 5CB4E 1OIYB 4ERRA 4EEDA 3P4QA 3NZPA 5LHHB 4QX7B 1H28B 1NWMX 4JI2T 4EOJB 4GK0E 2WWUA 5ADXL 3ABVA 4L5GA 3AE1A 2BBHA 4IGUA 4JYAT 3R84B 4B3ST 2C5IT 4PJLA 5FY1A 1H24B 3LDQB 1Y64B 2ZM0A 1GY3B 5EJCA 2XQ4A 1GQEA 4ZI3C 3B5MA 2HN2A 2WMOA 4YJ2E 4OX9T 2WS3A 1GH6B 1H27B 1M62A 4HFDA 1E2AA 1SUMB 3OBVE 1O3XA 1ZP2A 1D0XA 5AQQB 5L4EA 2DXCB 3PURA 1OI9B 4IL9A 2W9ZA 3PUYF 3ZCIA 1H1SB 2XM2A 5HEJA 4OB2B 4ZI2C 4ILCA 4YXDA 1HTJF 3AXJA 3AECA 4IE5A 4B6XA 3MXZA 5LJNA 2BKOA 4H9SE 1VOLA 5C3JA 5LOVE 4TNVA 2EHOB 1OKWB 3AE7A 3ONJA 5L4HA 3TLUA 4MFDA 3SS1A 1UURA 2R7GA 3RHWA 4UV8B 3EJ1B 4YHHT 3N9OA 4EYYR 2VURA 4JX6A 3TN8B 2X68A 1OWAA 2KMFA 5CGMA 3A5XA 4Y72B 4BCMD 4O2AE 4A97A 3ZT6A 2OLTA 3QZ5B 3N2KE 4QSHA 2W67A 3K3OA 2YN6A 4EONB 4BBSM 1YW0A 3MZKB 5HNBB 3EDUA 3ZSTA 4LOCA 1I94T 5AQFB 5IF1B 5BNJB 4PNIA 4GKJT 2DMEA 2B9RA 4ADZA 2V7MA 2Q9QB 4X66T 4H9QC 5LP6E 2V5DA 3OVUA 4CN4A 5EK2A 2YDRA 3ZSSA 2FJEA 4HFIA 2PG8A 3BHUB 5AQRB 1IBMT 1D0ZA 2YDQA 1E7PA 3L39A 4NSTB 1UGRB 4Q25A 2AXDS 3IHRA 2XTLA 5FXZA 2KNDA 4JX4A 2AE9A 3PUSA 2B76A 4EYUA 4DMWA 3ZN0B 3ZJ1A 1HNXT 2WDQA 3J7Yq 2BZBA 3I0OA 2EHOA 2XPKA 3A8OB 4L0RA 2NR4A 5L3BB 3FBLA 1G3NC 2ES0A 4ILBA 4ZZBA 2JQKA 5L2LA 4ZS3A 2X9YA 4JEHB 3GA8A 5HVYB 2CWOA 3AE6A 3IBPA 3Q2MA 4JI1T 1ZEEA 2V7LA 4COFA 2LSIA 4X5TA 2YU1A 2C5OB 3CX6B 3PE0A 4DV6T 2A72A 1ZKEA 2E9XD 1UNLD 4TUYE 1MIYA 4X62T 3K7AM 3C64A 3TLSA 1S94A 4OB0B 2WCAA 2V7KA 2IC6A 3MIAB 2JRKA 4JV5T 3J9X1 4YC3B 4WW0A 4WBNE 3FZHB 3ONLC 3C4WA 3KV6A 3WI3A 3AB3B 5JREA 4O4LE 3AEEA 2K48A 5HBHB 3BQIA 2IW6B 2RA1A 4DV1T 2CCIB 2D0QB 5KMGP 4CFNB 5LG4A 4PFOA 2XAJB 4BY7X 3SWHA 1N32T 4B3MT 2UXXB 1LVKA 1N4MA 1NENA 2H89A 4BCMB 3N9PA 4UF0A 4PK6A 1YQ4A 2WBLA 2IMLA 2V5CA 3MJXA 1IREB 4Z91A 5H6QB 4YHJA 1ZP0A 4MLKA 2BKNA 2BS3A 1V9DA 4ANJA 2ZM8A 1B7TA 1KNRA 3CPZA 2CM0A 5HXEA 1VCTA 5FXVA 4BCQD 2W99A 4YY3T 3A8YC 1E9HB 4UN0A 3QB5A 2RP4A 2A9UA 2UZEB 1IJ6A 1HCIA 1C9BA 3JCFA 3PV0F 4F6SB 2VKHA 3ZMSB 4QXCB 2DHRA 5LMKB 5ICPB 2M6IA 3AAAB 1W0BA 3W15B 4NXMT 2IHR1 2DWKA 3PUZF 3A8LB 4OK0A 3EIDB 1XZYA 4IDNA 5JH7E 5L3DB 4BJMA 3KV9A 4I50E 4JUYA 2LOSA 2X9HA 4CFWB 5HEOA 2LHNA 1XMOT 4EORB 2LRLA 3K1SA 4ZS2A 3SRZA 2WFYB 2XAGB 2LRKA 3QHWB 2VVSA 3ZC1A 2LE8A 5HXSA 1S35A 4KBMB 3TW6A 3RX6A 4DBQA 3KVBA 4I0UA 4CFUB 4ZEYA 5LGTB 5LBQB 1Z8UA 5JRCA 3KDSE 1VRBA 4EGWA 2ACZA 3DDPB 5HYAA 4LMLA 2W61A 3L8RA 2MOZA 3CX7B 2XSBA 3AVSA 3LFMA 4L9IA 4DR2T 2E9XB 3UT5E 2BG9B 4TZ4C 3OPCA 2C5VB 2EHOC 2X1NB 4HNUA 1HF8A 3ZYKA 2Y48B 2FJAA 3UQ7A 2Y8DA 2NW9A 1HX1B 1MMDA 3C4XA 3PUAA 1JKWA 1MNEA 2WY2A 3R6NA 3Q5DA 1OKVB 2H7VC 4DV3T 4YFSA 4DVDA 3QYHB 5JDQA 3UUXB 3WAKA 2WM9A 4TV9E 2NTYA 3IEEA 2N2NA 3PUXF 5LJMA 1WR6A 3E08A 3H4CA 5F3JA 5CJ5A 1P5EB 5IUXA 4UEMA 5C2TA 4EC8B 3A8MB 3JC6C 2YU2A 3RIAA 3HKBE 3RRCA 5FMNA 4EOSB 2DL1A 1MIVA 4A98A 2DI4A 2N9DA 4HN9A 2EUFA 3MY1B 4BCJB 4LF4T 1AJ3A 4DR7T 4FI5A 1D1BA 4EC9B 5HXRA 2LEHA 4OYKA 3KINB 1HNZT 4WYVA 3RLFF 2ZPFB 2FJBA 3QC9A 2D9DA 2PK2A 4BCQB 2WMNA 3QB5K 4DV5T 2C5NB 1XWMA 3RC3A 3TLWA 2WIHB 4HTEA 1MNDA 2CMRA 2ACXA 4EOKB 2QYWA 4ZXLA 3KVAA 2KZ7B 3T1YT 4GYRA 3FZLB 2UZDB 3QYBA 4JI4T 4TWDA 2VVNA 1UGPB 2NP9A 4LMJA 3QYGB 2DPPB 2WSSV 4JEUB 2BG9A 4IL4A 3KFWX 1H1RB 1FIOA 1UK5A 5FXWA 3TLTA 2QFZA 3BQKA 2FJDA 5JR9B 4EEBA 5ABEA 3P50A 2X9XA 2WDVA 1XMQT 1ENWA 2P9BA 2CWYA 1T98A 4A5XA 1CUNA 4U31A 3AEBA 1JNZA 2CLYB 3P4SA 3PO3S 1KNZA 4IE0A 4ILUA 3PDYA 1H7CA 5A1LA 4U33A 3TNHB 4QH1A 3KHIA 4NUUA 4UVAB 3PUWF 4WBOA 2XQ7A 2LW4A 3V5SA 2J4GA 4F70B 2KWIB 2XQAA 2JQHA 4ISTA 1D1AA 3HO8A 4MFRA 2UZBB 3NKZA 5ABFB 4C91A 5EK4A 5AFUL 2I59A 3M3ZB 2C0SA 2W4XA 5HQ0B 1LVFA 1W09A 4QH5A 2V1DB 3K3QC 4EZHA 4AKIA 4EXTA 3EUHA 3TLVA 4DR5T 2LKHA 2D2SA 4CN1A 5L3GB 4O4IE 1OGUB 2DNXA 5JTGA 3F57A 4HKAA 4H9OC 4ELJA 4QH4A 2WWVA 2ZPIB 3RPUA 2XSAA 4BJNA 3BK9A 5LG3A 3VR8A 4ZHQE 3BLQB 4II5B 3ZMVB 3OTOT 2C5XB 3M65A 4X1IE 2L3LA 5JR9A 4I43B 3UU6A 1MMGA 4FX3B 1QLBA 2SPCA 2QF7A 4IREA 2PJQA 4OB3B 3X28B 3Q9DA 4AKRB 2W00A 4TWFA 2ZZDB 2ZPEB 3BQLA 2B1EA 1KFYA 4CXAB 3RGFB 4K0UA 4KI0F 3DDQB 2XQ6A 3O1HA 4P0BA 1TD6A 2LHRA 2I0MA 4QXBB 3AA7B 4HWHA 2W2UA 3VRBA 4DR1T 4O8SA 5LXTE 3ZYMA 2IIUA 4F7SB 4NXNT 2UUBT 5LQFB 2ZPHB 1LKXA 4QHOA 2HN1A 2VK9A 3E0ZA 3ETVA 3T1HT 3I1AA 2X51A 2K3WA 4OGRB 2A3DA 4EOZB 2GK9A 2W2HA 4GYSA 3I9YA 3ZT5A 5L47A 2JQQA 4PJNA 2D0TA 3P4RA 3PTRB 2A2FX 4JI0T 2CEAA 1D0YA 3ZKRA 3U78A 2DD5B 2BG9C 4YSZA 4OHFA 2WMBB 3RIUA 4AIUA 5HBJB 3POMA 4EV6A 3FZFB 3VYGB 5ABGA 4TTHA 2DCFA 4HNVA 4F7NB 1JNRA 4P09A 2CJMB 1OEDB 2J1DG 1KEYA 2QA7A 4ZI3D 5C8YE 4MALA 5HXHA 5JDNA 5HXCA 2UXDT 3BLHB 4NIQA 2Z6EA 2BG9E 4U7IA 1HG5A 2XQ5A 4JI3T 1UX5A 1X9BA 4ZI2D 1FKMA 1FEWA 4P1NA 3NDQA 4CFXB 3KV5A 3Q5XA 2FUPA 1UGQB 3O1IA 2WMAB 2W0GA 2LSYA 3AEFA 5EZYE 2J47A 4DIDB 2N1GA 4BCIB 1U4QA 3RYCE 4CN6A 4DV7T 5FY7A 2KMGA 4CXXA 1WFDA 4J2CA 5FY0A 4EIWA 4YT0A 2MTQA 4BCPB 4LFBT 4ROEA 2CZ1B 3OJAA 4DUYT 4ZZCA 3P7IA 2WPAB 2WAUA 4U3CA 5J1GA 1J5ET 4DNDA 4O2BE 2H88A 5FP3A 4MBQA 2Q9QA 4ELLA 4PJJA 1ZHCA 3TNIB 3I9WA 5LNKA 4JI8T 4EOQB 2JGZB 2E5VA 4BCGB 5JR9C 3BG9A 4OB1B 1F5QB 4DV4T 3HKCE 5AQVB 3GTMS 1UNGD 3CQCB 3HBLA 2YINA 5LCYA 4BCOB 4HFVA 4IHJE 2MPKA 1L0VA 2CBIA 1QMZB 2IW5B 4ASKA 4B3TT 3RYIE 2BS2A 2CRBA 1Z0PA 3AAEB 4E7ZA 1GUXB 4BXXX 2NW7A 1UUSA 4CQIA 2VKOA 3DP7A 3PJAJ 2PFVA 3LK3B 5FKYA 3PJAA 1H1QB 1IJ5A 2G0UA 3ZMZB 3ONXA 1XNQT 4U7YA 2YKSA 2XQYA 2DXBB 4HLQA 3HA4A 4UV9B 2LJLA 4U2YA 3LBXB 2K24A 2C6TB 2DWGA 4OFZA 3WVEB 3MK7C 1WYCA 2V7IA 2VL0A 4UVBB 4CFVB 4Z90A 1FMVA 5L3EB 2X66A 4F6UB 4EOOB 2KINB 3EHZA 1HNWT 4BBRM 4U74A 3ANWB 3LK2B 4PK5A 5AQUB 3KBTA 4QX8B 1D3UB 2HPLA 3RIUC 3C4ZA 4U72A 3P8CD 3RRWA 4K0KT 3A7MA 2YOEA 3V5UA 1UGSB 3VKHA 4CXYA 4UXNB 2IAKA 4HFEA 2H7OA 2I40B 2X0HA 4AXPA 3AA0B 4HE8A 1KF6A 3RKGA 3ZYLA 3CQGB 4BCND 2XAHB 5JVDE 1T72A 5FVLA 1SHZC 4PAGA 4QWNB 4X65T 3FBZA 3O4XE 4YTPA 2R6GF 3SOLA 1GUXA 3WVDB 3OYZA 2NWBA 4G63A 4H9RC 5LHGB 4NPPA 4QKNA 4HL4A 3CMLA 3C51A 3H3MA 3MY5B 2QQ8A 3HKEE 2M6BA 3NZQA 4DUZT 2JMKA 1G73A 3LBXA 4EOMB 3H37A 5JDLA 2QVAA 3N9QA 5EK3A 2FBWA 4YTNA 4I55E 5HWXA 3N9MA 2QRXA 1MMAA 2UZLB 4CXWA 1VYWB 4IE7A 2XASB 2WZIA 3O9XA 4KMCA 3AEAA 2YEVC 4HFHA 3ETUA 2F4VT 4BCKB 2VWAA 3ESLA 3RI5A 1KK7A 4AQYT 2WB5A 3LG7A 4YSXA 4LMKA 4IDQA 5AQLB 2Q9QC 3EOCB 3K8PC 2BPMB 2CZ6B 2BVLA 2G77A 4HFBA 3AE9A 2J62A 3MA9A 5DQVA 3BHTB 4FM4B 1YKHB 2L9QA 3G06A 2WZHA 3AE5A 5I5ZB 3NRXA 3UFEA 2E5LT 5JDMA 4UIGA 4DR3T 5IHYA 4UR9A 3CIRA 3BHVB 3RGLA 2V7JA 2E9XA
chains in the Genus database with same CATH topology
3AA1B 4JEHB 3GA8A 3BQLA 4V1Av 2B1EA 2X0LB 4O4JE 4KUMB 2CWOA 3IBPA 4K0UA 5LHIB 3ZC0A 3Q2MA 1QSDA 4P0BA 3O1HA 2PBIA 1ZEEA 2ZM2A 2V7LA 2LHRA 2Y6XA 4QXBB 4Z8XA 3AA7B 2EHOD 2D0UA 2LSIA 2YU1A 3HL6A 4FJOA 5KDMC 3CX6B 3PE0A 5ETWA 4O8SA 2A72A 5LXTE 1ZKEA 3ZYMA 2LSKA 2E9XD 4TUYE 3DTOA 1MIYA 4TV8E 1LKXA 3C64A 5L3FB 1WRDA 4QHOA 1S94A 2ZLYA 2VK9A 3E0ZA 3PUQA 2V7KA 1BR4A 1BR1A 3ETVA 3I1AA 2IC6A 2BVMA 3CWZB 2JRKA 2X51A 3J9X1 4WW0A 4WBNE 3EDVA 4PW8A 4CI2B 2VL8A 5LGNB 3FB2A 3UUNA 2A3DA 5LBMA 4EOZB 2GK9A 3C4WA 1SA0E 3KV6A 3AB3B 3PU3A 3WI3A 4GYSA 5JREA 4O4LE 5FNVE 3I9YA 2K48A 2XHEB 3BQIA 2RA1A 4ZI7E 2JQQA 4PJNA 2D0TA 4AQGA 4BAYB 5KMGP 3JC6D 2LM9A 5LG4A 3RC8A 2JPFA 3PTRB 2A2FX 1HG2A 2JJ9A 4DBRA 4PFOA 4ZOLE 2CEAA 1D0YA 1YD8G 2XAJB 4PK4A 4A56A 3ZPOA 2C5KT 2LT3A 5HWYA 3SWHA 2BDEA 1WYBA 2DLRA 3U78A 2UXXB 4C90A 1LVKA 4OHFA 3N9PA 1U5PA 4UF0A 4PK6A 3I0QA 2WBLA 3H3AA 4TX5A 3ANWA 3MJXA 4XZCA 2DCFA 2VKDA 5H6QB 4I4TE 4YHJA 4P09A 3AAIA 3GMIA 2ZMAA 4MLKA 4PFPA 5FYMA 3UULA 3LK42 2J1DG 2QA7A 1V9DA 4TN7B 4MALA 4ANJA 4ZI3D 2ZM8A 5C8YE 1B7TA 4AI6A 4CI3B 3CPZA 5J2UE 2CM0A 5HXEA 5FXVA 5HXHA 5JDNA 5JQGE 2HPJA 5HAXA 4ISSA 5HXCA 3ZN1B 5TAOA 3L09A 3DJBA 4P0AA 3RH3A 2CA5A 2KT9A 1HX8A 2Z6EA 2K9AA 4E7SA 1FMWA 3N5LA 2RP4A 3N9NA 4WNKA 1HG5A 4OYJA 1EZ3A 1IJ6A 3ZMUB 1HCIA 3ZJ2A 1UX5A 2W62A 2VKHA 3ZMSB 4QXCB 2DHRA 4ZI2D 1FEWA 2XUEA 1US7B 4IIJE 2KLQA 1E1HB 3KV5A 3Q5XA 3AAAB 3TKLB 2NOXA 3GWHA 3W15B 3O1IA 2KWHA 4PJMA 2W0GA 2DWKA 5CA1E 2LSYA 2X67A 5JDFA 4OK0A 4XBFB 5EZYE 5LYJE 1X79A 2LSGA 2JMHA 1UX4A 2CE7A 2N1GA 3FXDB 3MKDA 4IE6A 3RKOA 1U4QA 5JH7E 5L3DB 3ZLIA 3RYCE 4BJMA 3KV9A 4I50E 4UELA 5DABA 4JUYA 2CCQA 5FY7A 4CXXA 4UVCB 1MMNA 4J2CA 5FY0A 2LOSA 2X9HA 4EIWA 2LHNA 1NAFA 3ZEFB 2MTQA 4AKHA 4AQFA 3O1JA 4BA9A 3C50A 1IZNB 4G2AA 4F6RC 3F2EA 3KV4A 4DMVA 4KP3C 4ZS2A 3OJAA 5LA6E 3SRZA 2XAGB 3U3IA 3CKDA 4AKGA 2LSJA 3QUJA 3N2GE 3ZC1A 2LE8A 3HR0A 1S35A 3P7IA 4KBMB 5HXSA 3VKGA 2WAUA 3MACA 3RX6A 5J1GA 4DBQA 4DNDA 4O2BE 5FP3A 3KVBA 4MBQA 2Q9QA 4PJJA 3S4UA 5LGTB 5LBQB 1BR2A 1ZHCA 3WAJA 5JRCA 3I9WA 3Q5WA 5LNKA 3KDSE 1VRBA 5HYAA 2K5BB 2W61A 3IF8B 4NUVA 2MOZA 3CX7B 5JR9C 2CXDA 1BR0A 5H6RB 3AVSA 2V26A 3LFMA 4IE4A 4O4HE 4L9IA 2XAFB 2E9XB 3UT5E 2E8IA 5GONE 3HKCE 3F31A 4TZ4C 2EHOC 4HGAA 3CQCB 1IAPA 2Q9QD 3AA6B 1HF8A 4CZZB 3QK6A 3ZYKA 2Y48B 2YINA 4X1YE 2KXPB 5CA0E 2Y8DA 5LCYA 1MMDA 4HFVA 4H63V 2NW9A 3PUGA 4IHJE 3C4XA 2E9XC 3PUAA 4XAXB 1MNEA 3R6NA 2IW5B 2M67A 5J2TE 5DQWA 2H7VC 4GIWA 4ASKA 2X9WA 3RYIE 4YFSA 4DVDA 1Z0PA 5JDQA 3AAEB 4E7ZA 2C5JA 3EVYA 1UCUA 1VOMA 4GOUA 3UUXB 3WAKA 1HFAA 2NW7A 2OA5A 2WM9A 4TV9E 4CQIA 2NTYA 3IEEA 2N2NA 3OYXA 2VKOA 3DP7A 3ZCJA 5LJMA 1WR6A 2PFVA 3LK3B 3E08A 3HKDE 4AQFC 5JDHA 1IJ5A 5E0OA 2G0UA 3ZMZB 5F3JA 3HI2A 3ONXA 2NW8A 3NBXX 2VB6A 4H9NC 3RYFE 2HH7A 4N78D 2XQYA 4UEMA 3LJCA 5CB4E 3HA4A 4UV9B 2LJLA 3JC6C 2LOPA 4ERRA 3LBXB 2K24A 2YU2A 1D1CA 3HKBE 3RRCA 5FMNA 2VASA 2DWGA 3NZPA 2ODUA 5IYZE 4OFZA 4QX7B 1MIVA 5LHHB 3MK7C 1WYCA 1NWMX 3RYHE 2DI4A 4GK0E 2WWUA 3D0TA 2N9DA 2V7IA 5ADXL 4UVBB 4HN9A 1FMVA 2YK0A 4L5GA 5L3EB 3B57A 2X66A 4X20E 4FI5A 1AJ3A 1LRZA 1D1BA 4IGUA 5HXRA 2KINB 2LEHA 3R84B 4OYKA 3KINB 4HEAA 4EB6E 2C5IT 4PJLA 5FY1A 3PU8A 4EAHA 3QC9A 4U74A 2WMNA 4IDZA 1Y64B 4UF0B 2ZM0A 3ANWB 3LK2B 4PK5A 4ZI3C 3RC3A 3KBTA 2WMOA 4HTEA 4YJ2E 1MNDA 4QX8B 5L3CB 2CMRA 2HPLA 3K3NA 1ZV4X 2ACXA 3C4ZA 4U72A 3P8CD 4JLEA 3RRWA 3VU7H 3OBVE 1O3XA 3KVAA 2KZ7B 4GYRA 1D0XA 3V5UA 1HS7A 2MBGA 3VKHA 4CXYA 4UXNB 2NP9A 2H3RA 2WSSV 3PURA 5KX5E 4JEUB 2IAKA 3CVRA 3GN5B 2VKJA 2H7OA 4AXPA 3KFWX 3AA0B 3ZCIA 4HE8A 1FIOA 5FXWA 3ZYLA 3CQGB 4ZI2C 1YKEB 2XAHB 3BQKA 5JR9B 1HTJF 5JVDE 1SHZC 4IE5A 3ZMTB 3MXZA 2L8KA 4B6XA 5LJNA 1WLXA 2X9XA 4H9SE 4PAGA 4QWNB 3FBZA 3O4XE 3UTKA 5LOVE 3CX8B 2P9BA 2CWYA 3KBUA 5M4YA 2EHOB 3SOLA 4GK5E 1T98A 3OYZA 2NWBA 4G63A 4H9RC 5LGUB 1QUUA 4MHCA 5LHGB 4DO0A 1CUNA 4QKNA 3SS1A 3CMLA 3C51A 4UV8B 3N9OA 2CLYB 4EYYR 3HKEE 1KNZA 4IE0A 3C98B 4ILUA 3PDYA 2MYSA 1H7CA 2CXLA 5DJQC 3NZQA 2CXFA 2X68A 4X1KE 4M1PA 1OWAA 2KMFA 5A1LA 3A5XA 2JMKA 5BMVE 1G73A 4O2AE 3LBXA 3N2KE 3H37A 5JDLA 2CLYC 4NUUA 4UVAB 3K3OA 4QXHB 5JDGA 4WBOA 1G8XA 3N9QA 2D5UA 5EK3A 3V5SA 1YW0A 3MZKB 4I55E 3EDUA 4CI1B 5HWXA 3N9MA 2KWIB 4ISTA 1MMAA 4CXWA 1D1AA 3L3PA 4PNIA 3T8OA 4IE7A 4MFRA 4H9PC 2XASB 4C91A 1MIWA 5EK4A 2IC9A 3O9XA 4KMCA 2YEVC 1OXZA 3VHLA 3ETUA 2V7MA 3FXEB 2Q9QB 3NRYA 3UUMA 4ADZA 5AFUL 2I59A 2VWAA 3ESLA 5JRCB 2C0SA 1LVFA 3B13A 2V1DB 1KK7A 4H9QC 3LG7A 5LP6E 3FHNA 3K3QC 4EZHA 3N9LA 5EK2A 4EXTA 4AKIA 2Q9QC 3EUHA 3CQXC 2UXNB 3K8PC 2D2SA 5L3GB 2PG8A 4O4IE 2BVLA 2DNXA 1D0ZA 3F57A 3MA9A 5DQVA 4HKAA 4H9OC 4YJ3E 3RPUA 5FXXA 1YKHB 2L9QA 4BJNA 3BK9A 4ZHQE 3GN5A 3IHRA 2QGSA 2XTLA 5FXZA 2KNDA 5F8PA 3ZMVB 3M65A 3N2OA 4EZ4A 4YLHA 4X1IE 3PUSA 3E22E 2L3LA 5JR9A 4I43B 4EYUA 1MMGA 3NRXA 3UFEA 4DMWA 3ZN0B 3ZJ1A 3OKQA 2SPCA 5JDMA 2ODVA 3J7Yq 2PJQA 4UIGA 4AKLA 2BZBA 3AVRA 2NTXA 5IHYA 2EHOA 3I0OA 2W63A 4L0RA 2XAQB 3Q9DA 4H63H 4AKRB 2W00A 3FBLA 5L3BB 2ES0A 2V7JA 5L2LA 4ZS3A 2X9YA 2E9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQV A;  5DQW A;  5IHY A;  3DJB A;  2QGS A;  3DTO A;  2PJQ A;  3B57 A; 
#chains in the Genus database with same CATH topology
 2WEV B;  5AQG B;  4KUM B;  4JX5 A;  1H4L D;  5LHI B;  5J0Z A;  2PBI A;  2ZM2 A;  2Y6X A;  4Z8X A;  2V6X A;  5AQT B;  2EHO D;  2PHG A;  4FJO A;  1T8B A;  3A8H B;  5ETW A;  3FZM B;  2XY8 B;  2IN3 A;  4TWH A;  3RIF A;  2LSK A;  4F7L B;  2DD4 B;  1WRD A;  3PUQ A;  1BR4 A;  2BVM A;  3CWZ B;  1H26 B;  4LF5 T;  4CI2 B;  3UUN A;  5LBM A;  1WCR A;  4BCN B;  5HEG A;  3PU3 A;  2XHE B;  3Q5E A;  3AE8 A;  3RQU A;  5HCJ A;  4ZI7 E;  4AQG A;  1V29 B;  3VYH B;  4CFM B;  4ROD A;  3JC6 D;  3RC8 A;  2BKP A;  3AE2 A;  2JJ9 A;  5AQK B;  2UUA T;  4DBR A;  1SE7 A;  1YD8 G;  3X1D A;  4A56 A;  3ZPO A;  2LT3 A;  5HWY A;  2BDE A;  2DLR A;  3AXJ B;  4C90 A;  3H3A A;  4KRD B;  4TX5 A;  2WU5 A;  4XZC A;  2BBJ A;  5CEI B;  2VKD A;  3HZJ A;  3AAI A;  3GMI A;  4PFP A;  5FYM A;  3UUL A;  1XNR T;  2UXB T;  4TN7 B;  2WXV B;  4HNT A;  2JIW A;  2HPJ A;  3QOF A;  3ZN1 B;  5TAO A;  1OL2 B;  4P0A A;  2CA5 A;  2KT9 A;  2K9A A;  4E7S A;  1AIS B;  1Y01 A;  3N9N A;  4WNK A;  1KNP A;  4KRC B;  1N34 T;  3X24 B;  3ZJ2 A;  3HB9 A;  2WU2 A;  2YDS A;  2XJ7 A;  3TNW B;  1KXU A;  4Z6Y A;  2KSR A;  1US7 B;  3SFE A;  3AE4 A;  3TKL B;  2CZ7 B;  4EOL B;  5FVK A;  5JDF A;  2UUE B;  2W66 A;  1X79 A;  2LSG A;  2JMH A;  3MKD A;  4IE6 A;  4B3R T;  1WR0 A;  3JAF A;  4UEL A;  2CCQ A;  3X25 B;  1MMN A;  2BKZ B;  3ZEF B;  3UU5 A;  4BA9 A;  3C50 A;  2MAW A;  4G2A A;  4DMV A;  5LA6 E;  4AKG A;  3CKD A;  2WQY A;  2LSJ A;  3G33 B;  3UU3 A;  1XDP A;  3HR0 A;  4U2Z A;  2ZM6 T;  1J5W A;  5ABF A;  3MAC A;  4ZGE B;  3F5X B;  3RQW A;  3S4U A;  5AQP B;  3QNU A;  1BR2 A;  3WAJ A;  3QXE B;  3Q5W A;  2K5B B;  3IF8 B;  4NUV A;  3VRA A;  5FL0 A;  2CXD A;  5H6R B;  2V26 A;  2ZPG B;  4DV2 T;  3EAB A;  5GON E;  4KHZ F;  3UFG A;  3LSV A;  2V6Y B;  1IAP A;  4CZZ B;  1FIN B;  3BG3 A;  3SFD A;  1ZOY A;  2E9X C;  4XAX B;  2CHN A;  3P4P A;  5LMN T;  2UXC T;  2X9W A;  3EVY A;  4G6L B;  4GOU A;  1HFA A;  4HWF A;  5AQS B;  3HKD E;  4AQF C;  2IDO B;  3HI2 A;  3QZ9 B;  1VCS A;  5BR8 T;  2NW8 A;  3BLR B;  3NBX X;  1N36 T;  2HH7 A;  1R8I A;  3LJC A;  2LOP A;  1D1C A;  2VAS A;  5IYZ E;  2ODU A;  3UU4 A;  4LF8 T;  4EOI B;  3RYH E;  5F5W A;  3D0T A;  2YK0 A;  1JSU B;  3B57 A;  4ZGD B;  4X20 E;  4LF7 T;  2LKG A;  1LRZ A;  1CHU A;  4WZX A;  4HEA A;  4EB6 E;  3HHT B;  3PU8 A;  4EAH A;  4X64 T;  3EI0 A;  4UF0 B;  4IDZ A;  2QDJ A;  1PKD B;  5LMU T;  5L3C B;  1O9K B;  2CZ0 B;  3X20 B;  3K3N A;  1ZV4 X;  4M6V A;  4JLE A;  3VU7 H;  2CYZ B;  3RF1 A;  1HS7 A;  2MBG A;  2I53 A;  3JAD A;  2H3R A;  5KX5 E;  2XQ3 A;  3CVR A;  3GN5 B;  3QWL A;  2V6Y A;  2VKJ A;  2WP9 A;  4CFU D;  2V22 B;  1YKE B;  1M7K A;  2KR6 A;  5HEU A;  3ZMT B;  2L8K A;  1WLX A;  3UTK A;  3CX8 B;  3MI9 B;  3KBU A;  5M4Y A;  4GK5 E;  5LGU B;  1QUU A;  4MHC A;  4DO0 A;  2CBJ A;  1OIU B;  1OED A;  3UQ4 A;  4F8H A;  3C98 B;  2MYS A;  5DJQ C;  2CXL A;  2CXF A;  4X1K E;  5AQO B;  4M1P A;  5BMV E;  3UUB A;  5HBE B;  2XM1 A;  3AE3 A;  4LFA T;  5LB7 B;  3VR9 A;  3QHR B;  2E2A A;  2CLY C;  4QXH B;  5JDG A;  1G8X A;  5FGK B;  4EOP B;  1T7S A;  5AQI B;  2D5U A;  1JST B;  2IVX A;  4CI1 B;  1XO2 A;  3L3P A;  1JOW A;  3T8O A;  5KXJ A;  4H9P C;  2WJ9 A;  4MFE A;  1MIW A;  2ZPB B;  2IC9 A;  1AD6 A;  1OXZ A;  3VHL A;  3FXE B;  3NRY A;  3UUM A;  4HWI B;  5JRC B;  3B13 A;  3M03 A;  4JI7 T;  2PK9 B;  4ROC A;  3FHN A;  3N9L A;  1O9K A;  3CQX C;  2UXN B;  4TNW A;  5CFB A;  3P4W A;  2VQF T;  2IUB A;  4YJ3 E;  4DR4 T;  4IMY B;  5FXX A;  4YSY A;  4HWC A;  5EFQ B;  3GN5 A;  2QGS A;  4BCF B;  5F8P A;  4BY1 X;  3N2O A;  4EZ4 A;  4YLH A;  3E22 E;  5AQM B;  4AIS A;  3OKQ A;  3ZT7 A;  2ODV A;  4AKL A;  3AVR A;  2NTX A;  4JI5 T;  2W63 A;  2XAQ B;  4H63 H;  2PMI B;  2HHH T;  4MIM A;  3AED A;  3AA1 B;  4V1A v;  4JI6 T;  4LFC T;  1NEK A;  5ABH A;  2X0L B;  3EAM A;  3TW7 A;  4O4J E;  4IDO A;  2V8S V;  4ZGJ B;  3ZC0 A;  3UU8 A;  3NVO A;  1QSD A;  2D0U A;  3HL6 A;  5KDM C;  4ILA A;  2CPT A;  5IDN B;  1W0A A;  2XQ9 A;  5IDP B;  3JAE A;  2F2C A;  3DTO A;  4TV8 E;  2LM2 A;  5L3F B;  4I3Z B;  2ZLY A;  1H25 B;  4F6W B;  1FVV B;  1BR1 A;  3FZK B;  4HFC A;  5LGN B;  3EDV A;  4PW8 A;  4YOZ A;  2VL8 A;  1UNH D;  3FB2 A;  1SA0 E;  1H1P B;  5FNV E;  4DV0 T;  1BU2 A;  1VIN A;  1J1J A;  4YTM A;  1XDO A;  4BAY B;  5AQH B;  3BG5 A;  2LM9 A;  2JPF A;  1HG2 A;  1YXR A;  4ZOL E;  5ACB A;  3X26 B;  4YOS A;  4PK4 A;  2C5K T;  1WYB A;  4HWD A;  2OV9 A;  1U5P A;  3I0Q A;  5FL1 A;  2PTF A;  3ANW A;  2X0Y A;  4I4T E;  4NC6 A;  4KHP T;  4BCH B;  2ZMA A;  2WIP B;  2IW9 B;  3DL1 A;  4F7J B;  1W98 B;  3LK4 2;  2W9F A;  2UUC T;  2AHJ B;  4AI6 A;  3O0G D;  4CI3 B;  2XQ8 A;  2G9X B;  2QDY B;  5J2U E;  5JQG E;  5HAX A;  4ISS A;  3L09 A;  1OED C;  3DJB A;  3NWI A;  3RH3 A;  1HX8 A;  1FMW A;  3N5L A;  4LF6 T;  1YQ3 A;  3IA3 A;  4OYJ A;  1EZ3 A;  1IBL T;  2I6H A;  3ZMU B;  2VQE T;  1OL1 B;  2CCH B;  3QYE A;  2IW8 B;  2W62 A;  2CHO A;  1W9R A;  3LQ5 B;  2XUE A;  4IIJ E;  2KLQ A;  1E1H B;  1I6Z A;  2NOX A;  1AHJ B;  3GWH A;  2KWH A;  4PJM A;  5CYI B;  5CA1 E;  2X67 A;  4OR5 B;  2WHB B;  4XBF B;  5LYJ E;  3AEG A;  3A8G B;  3RKO A;  3CK6 A;  1OED E;  1UX4 A;  2CE7 A;  2JQ9 A;  3FXD B;  2W96 A;  3ZLI A;  5DAB A;  2XZE A;  4UVC B;  1URC B;  1N33 T;  2LLY A;  1NAF A;  2RPA A;  4IDP A;  2ZCF B;  4AKH A;  4AQF A;  3O1J A;  1IZN B;  4F6R C;  3F2E A;  3KV4 A;  1TFB A;  4KP3 C;  4JBW F;  4LF9 T;  5HCM A;  3U3I A;  3PUV F;  3QUJ A;  3N2G E;  3VKG A;  5IWA T;  1DU2 A;  4DR6 T;  4YOO A;  4CRL B;  1IBK T;  5L2W B;  5AQN B;  1UGO A;  1HR0 T;  4GKK T;  1BR0 A;  4IE4 A;  4O4H E;  2XAF B;  1FJG T;  2E8I A;  3F31 A;  4HGA A;  3AA6 B;  2Q9Q D;  3QK6 A;  2BS4 A;  4X1Y E;  2KXP B;  5CA0 E;  4H63 V;  2C4G B;  3PUG A;  2UU9 T;  5AQJ B;  5HEH A;  2M67 A;  4KX6 A;  5DQW A;  4GIW A;  5J2T E;  2C5J A;  1UCU A;  1VOM A;  2OA5 A;  3OYX A;  3ZCJ A;  2WDR A;  5JDH A;  4IT4 A;  5E0O A;  3DOG B;  2VB6 A;  4H9N C;  3RYF E;  4N78 D;  5CB4 E;  1OIY B;  4ERR A;  4EED A;  3P4Q A;  3NZP A;  5LHH B;  4QX7 B;  1H28 B;  1NWM X;  4JI2 T;  4EOJ B;  4GK0 E;  2WWU A;  5ADX L;  3ABV A;  4L5G A;  3AE1 A;  2BBH A;  4IGU A;  4JYA T;  3R84 B;  4B3S T;  2C5I T;  4PJL A;  5FY1 A;  1H24 B;  3LDQ B;  1Y64 B;  2ZM0 A;  1GY3 B;  5EJC A;  2XQ4 A;  1GQE A;  4ZI3 C;  3B5M A;  2HN2 A;  2WMO A;  4YJ2 E;  4OX9 T;  2WS3 A;  1GH6 B;  1H27 B;  1M62 A;  4HFD A;  1E2A A;  1SUM B;  3OBV E;  1O3X A;  1ZP2 A;  1D0X A;  5AQQ B;  5L4E A;  2DXC B;  3PUR A;  1OI9 B;  4IL9 A;  2W9Z A;  3PUY F;  3ZCI A;  1H1S B;  2XM2 A;  5HEJ A;  4OB2 B;  4ZI2 C;  4ILC A;  4YXD A;  1HTJ F;  3AXJ A;  3AEC A;  4IE5 A;  4B6X A;  3MXZ A;  5LJN A;  2BKO A;  4H9S E;  1VOL A;  5C3J A;  5LOV E;  4TNV A;  2EHO B;  1OKW B;  3AE7 A;  3ONJ A;  5L4H A;  3TLU A;  4MFD A;  3SS1 A;  1UUR A;  2R7G A;  3RHW A;  4UV8 B;  3EJ1 B;  4YHH T;  3N9O A;  4EYY R;  2VUR A;  4JX6 A;  3TN8 B;  2X68 A;  1OWA A;  2KMF A;  5CGM A;  3A5X A;  4Y72 B;  4BCM D;  4O2A E;  4A97 A;  3ZT6 A;  2OLT A;  3QZ5 B;  3N2K E;  4QSH A;  2W67 A;  3K3O A;  2YN6 A;  4EON B;  4BBS M;  1YW0 A;  3MZK B;  5HNB B;  3EDU A;  3ZST A;  4LOC A;  1I94 T;  5AQF B;  5IF1 B;  5BNJ B;  4PNI A;  4GKJ T;  2DME A;  2B9R A;  4ADZ A;  2V7M A;  2Q9Q B;  4X66 T;  4H9Q C;  5LP6 E;  2V5D A;  3OVU A;  4CN4 A;  5EK2 A;  2YDR A;  3ZSS A;  2FJE A;  4HFI A;  2PG8 A;  3BHU B;  5AQR B;  1IBM T;  1D0Z A;  2YDQ A;  1E7P A;  3L39 A;  4NST B;  1UGR B;  4Q25 A;  2AXD S;  3IHR A;  2XTL A;  5FXZ A;  2KND A;  4JX4 A;  2AE9 A;  3PUS A;  2B76 A;  4EYU A;  4DMW A;  3ZN0 B;  3ZJ1 A;  1HNX T;  2WDQ A;  3J7Y q;  2BZB A;  3I0O A;  2EHO A;  2XPK A;  3A8O B;  4L0R A;  2NR4 A;  5L3B B;  3FBL A;  1G3N C;  2ES0 A;  4ILB A;  4ZZB A;  2JQK A;  5L2L A;  4ZS3 A;  2X9Y A;  4JEH B;  3GA8 A;  5HVY B;  2CWO A;  3AE6 A;  3IBP A;  3Q2M A;  4JI1 T;  1ZEE A;  2V7L A;  4COF A;  2LSI A;  4X5T A;  2YU1 A;  2C5O B;  3CX6 B;  3PE0 A;  4DV6 T;  2A72 A;  1ZKE A;  2E9X D;  1UNL D;  4TUY E;  1MIY A;  4X62 T;  3K7A M;  3C64 A;  3TLS A;  1S94 A;  4OB0 B;  2WCA A;  2V7K A;  2IC6 A;  3MIA B;  2JRK A;  4JV5 T;  3J9X 1;  4YC3 B;  4WW0 A;  4WBN E;  3FZH B;  3ONL C;  3C4W A;  3KV6 A;  3WI3 A;  3AB3 B;  5JRE A;  4O4L E;  3AEE A;  2K48 A;  5HBH B;  3BQI A;  2IW6 B;  2RA1 A;  4DV1 T;  2CCI B;  2D0Q B;  5KMG P;  4CFN B;  5LG4 A;  4PFO A;  2XAJ B;  4BY7 X;  3SWH A;  1N32 T;  4B3M T;  2UXX B;  1LVK A;  1N4M A;  1NEN A;  2H89 A;  4BCM B;  3N9P A;  4UF0 A;  4PK6 A;  1YQ4 A;  2WBL A;  2IML A;  2V5C A;  3MJX A;  1IRE B;  4Z91 A;  5H6Q B;  4YHJ A;  1ZP0 A;  4MLK A;  2BKN A;  2BS3 A;  1V9D A;  4ANJ A;  2ZM8 A;  1B7T A;  1KNR A;  3CPZ A;  2CM0 A;  5HXE A;  1VCT A;  5FXV A;  4BCQ D;  2W99 A;  4YY3 T;  3A8Y C;  1E9H B;  4UN0 A;  3QB5 A;  2RP4 A;  2A9U A;  2UZE B;  1IJ6 A;  1HCI A;  1C9B A;  3JCF A;  3PV0 F;  4F6S B;  2VKH A;  3ZMS B;  4QXC B;  2DHR A;  5LMK B;  5ICP B;  2M6I A;  3AAA B;  1W0B A;  3W15 B;  4NXM T;  2IHR 1;  2DWK A;  3PUZ F;  3A8L B;  4OK0 A;  3EID B;  1XZY A;  4IDN A;  5JH7 E;  5L3D B;  4BJM A;  3KV9 A;  4I50 E;  4JUY A;  2LOS A;  2X9H A;  4CFW B;  5HEO A;  2LHN A;  1XMO T;  4EOR B;  2LRL A;  3K1S A;  4ZS2 A;  3SRZ A;  2WFY B;  2XAG B;  2LRK A;  3QHW B;  2VVS A;  3ZC1 A;  2LE8 A;  5HXS A;  1S35 A;  4KBM B;  3TW6 A;  3RX6 A;  4DBQ A;  3KVB A;  4I0U A;  4CFU B;  4ZEY A;  5LGT B;  5LBQ B;  1Z8U A;  5JRC A;  3KDS E;  1VRB A;  4EGW A;  2ACZ A;  3DDP B;  5HYA A;  4LML A;  2W61 A;  3L8R A;  2MOZ A;  3CX7 B;  2XSB A;  3AVS A;  3LFM A;  4L9I A;  4DR2 T;  2E9X B;  3UT5 E;  2BG9 B;  4TZ4 C;  3OPC A;  2C5V B;  2EHO C;  2X1N B;  4HNU A;  1HF8 A;  3ZYK A;  2Y48 B;  2FJA A;  3UQ7 A;  2Y8D A;  2NW9 A;  1HX1 B;  1MMD A;  3C4X A;  3PUA A;  1JKW A;  1MNE A;  2WY2 A;  3R6N A;  3Q5D A;  1OKV B;  2H7V C;  4DV3 T;  4YFS A;  4DVD A;  3QYH B;  5JDQ A;  3UUX B;  3WAK A;  2WM9 A;  4TV9 E;  2NTY A;  3IEE A;  2N2N A;  3PUX F;  5LJM A;  1WR6 A;  3E08 A;  3H4C A;  5F3J A;  5CJ5 A;  1P5E B;  5IUX A;  4UEM A;  5C2T A;  4EC8 B;  3A8M B;  3JC6 C;  2YU2 A;  3RIA A;  3HKB E;  3RRC A;  5FMN A;  4EOS B;  2DL1 A;  1MIV A;  4A98 A;  2DI4 A;  2N9D A;  4HN9 A;  2EUF A;  3MY1 B;  4BCJ B;  4LF4 T;  1AJ3 A;  4DR7 T;  4FI5 A;  1D1B A;  4EC9 B;  5HXR A;  2LEH A;  4OYK A;  3KIN B;  1HNZ T;  4WYV A;  3RLF F;  2ZPF B;  2FJB A;  3QC9 A;  2D9D A;  2PK2 A;  4BCQ B;  2WMN A;  3QB5 K;  4DV5 T;  2C5N B;  1XWM A;  3RC3 A;  3TLW A;  2WIH B;  4HTE A;  1MND A;  2CMR A;  2ACX A;  4EOK B;  2QYW A;  4ZXL A;  3KVA A;  2KZ7 B;  3T1Y T;  4GYR A;  3FZL B;  2UZD B;  3QYB A;  4JI4 T;  4TWD A;  2VVN A;  1UGP B;  2NP9 A;  4LMJ A;  3QYG B;  2DPP B;  2WSS V;  4JEU B;  2BG9 A;  4IL4 A;  3KFW X;  1H1R B;  1FIO A;  1UK5 A;  5FXW A;  3TLT A;  2QFZ A;  3BQK A;  2FJD A;  5JR9 B;  4EEB A;  5ABE A;  3P50 A;  2X9X A;  2WDV A;  1XMQ T;  1ENW A;  2P9B A;  2CWY A;  1T98 A;  4A5X A;  1CUN A;  4U31 A;  3AEB A;  1JNZ A;  2CLY B;  3P4S A;  3PO3 S;  1KNZ A;  4IE0 A;  4ILU A;  3PDY A;  1H7C A;  5A1L A;  4U33 A;  3TNH B;  4QH1 A;  3KHI A;  4NUU A;  4UVA B;  3PUW F;  4WBO A;  2XQ7 A;  2LW4 A;  3V5S A;  2J4G A;  4F70 B;  2KWI B;  2XQA A;  2JQH A;  4IST A;  1D1A A;  3HO8 A;  4MFR A;  2UZB B;  3NKZ A;  5ABF B;  4C91 A;  5EK4 A;  5AFU L;  2I59 A;  3M3Z B;  2C0S A;  2W4X A;  5HQ0 B;  1LVF A;  1W09 A;  4QH5 A;  2V1D B;  3K3Q C;  4EZH A;  4AKI A;  4EXT A;  3EUH A;  3TLV A;  4DR5 T;  2LKH A;  2D2S A;  4CN1 A;  5L3G B;  4O4I E;  1OGU B;  2DNX A;  5JTG A;  3F57 A;  4HKA A;  4H9O C;  4ELJ A;  4QH4 A;  2WWV A;  2ZPI B;  3RPU A;  2XSA A;  4BJN A;  3BK9 A;  5LG3 A;  3VR8 A;  4ZHQ E;  3BLQ B;  4II5 B;  3ZMV B;  3OTO T;  2C5X B;  3M65 A;  4X1I E;  2L3L A;  5JR9 A;  4I43 B;  3UU6 A;  1MMG A;  4FX3 B;  1QLB A;  2SPC A;  2QF7 A;  4IRE A;  2PJQ A;  4OB3 B;  3X28 B;  3Q9D A;  4AKR B;  2W00 A;  4TWF A;  2ZZD B;  2ZPE B;  3BQL A;  2B1E A;  1KFY A;  4CXA B;  3RGF B;  4K0U A;  4KI0 F;  3DDQ B;  2XQ6 A;  3O1H A;  4P0B A;  1TD6 A;  2LHR A;  2I0M A;  4QXB B;  3AA7 B;  4HWH A;  2W2U A;  3VRB A;  4DR1 T;  4O8S A;  5LXT E;  3ZYM A;  2IIU A;  4F7S B;  4NXN T;  2UUB T;  5LQF B;  2ZPH B;  1LKX A;  4QHO A;  2HN1 A;  2VK9 A;  3E0Z A;  3ETV A;  3T1H T;  3I1A A;  2X51 A;  2K3W A;  4OGR B;  2A3D A;  4EOZ B;  2GK9 A;  2W2H A;  4GYS A;  3I9Y A;  3ZT5 A;  5L47 A;  2JQQ A;  4PJN A;  2D0T A;  3P4R A;  3PTR B;  2A2F X;  4JI0 T;  2CEA A;  1D0Y A;  3ZKR A;  3U78 A;  2DD5 B;  2BG9 C;  4YSZ A;  4OHF A;  2WMB B;  3RIU A;  4AIU A;  5HBJ B;  3POM A;  4EV6 A;  3FZF B;  3VYG B;  5ABG A;  4TTH A;  2DCF A;  4HNV A;  4F7N B;  1JNR A;  4P09 A;  2CJM B;  1OED B;  2J1D G;  1KEY A;  2QA7 A;  4ZI3 D;  5C8Y E;  4MAL A;  5HXH A;  5JDN A;  5HXC A;  2UXD T;  3BLH B;  4NIQ A;  2Z6E A;  2BG9 E;  4U7I A;  1HG5 A;  2XQ5 A;  4JI3 T;  1UX5 A;  1X9B A;  4ZI2 D;  1FKM A;  1FEW A;  4P1N A;  3NDQ A;  4CFX B;  3KV5 A;  3Q5X A;  2FUP A;  1UGQ B;  3O1I A;  2WMA B;  2W0G A;  2LSY A;  3AEF A;  5EZY E;  2J47 A;  4DID B;  2N1G A;  4BCI B;  1U4Q A;  3RYC E;  4CN6 A;  4DV7 T;  5FY7 A;  2KMG A;  4CXX A;  1WFD A;  4J2C A;  5FY0 A;  4EIW A;  4YT0 A;  2MTQ A;  4BCP B;  4LFB T;  4ROE A;  2CZ1 B;  3OJA A;  4DUY T;  4ZZC A;  3P7I A;  2WPA B;  2WAU A;  4U3C A;  5J1G A;  1J5E T;  4DND A;  4O2B E;  2H88 A;  5FP3 A;  4MBQ A;  2Q9Q A;  4ELL A;  4PJJ A;  1ZHC A;  3TNI B;  3I9W A;  5LNK A;  4JI8 T;  4EOQ B;  2JGZ B;  2E5V A;  4BCG B;  5JR9 C;  3BG9 A;  4OB1 B;  1F5Q B;  4DV4 T;  3HKC E;  5AQV B;  3GTM S;  1UNG D;  3CQC B;  3HBL A;  2YIN A;  5LCY A;  4BCO B;  4HFV A;  4IHJ E;  2MPK A;  1L0V A;  2CBI A;  1QMZ B;  2IW5 B;  4ASK A;  4B3T T;  3RYI E;  2BS2 A;  2CRB A;  1Z0P A;  3AAE B;  4E7Z A;  1GUX B;  4BXX X;  2NW7 A;  1UUS A;  4CQI A;  2VKO A;  3DP7 A;  3PJA J;  2PFV A;  3LK3 B;  5FKY A;  3PJA A;  1H1Q B;  1IJ5 A;  2G0U A;  3ZMZ B;  3ONX A;  1XNQ T;  4U7Y A;  2YKS A;  2XQY A;  2DXB B;  4HLQ A;  3HA4 A;  4UV9 B;  2LJL A;  4U2Y A;  3LBX B;  2K24 A;  2C6T B;  2DWG A;  4OFZ A;  3WVE B;  3MK7 C;  1WYC A;  2V7I A;  2VL0 A;  4UVB B;  4CFV B;  4Z90 A;  1FMV A;  5L3E B;  2X66 A;  4F6U B;  4EOO B;  2KIN B;  3EHZ A;  1HNW T;  4BBR M;  4U74 A;  3ANW B;  3LK2 B;  4PK5 A;  5AQU B;  3KBT A;  4QX8 B;  1D3U B;  2HPL A;  3RIU C;  3C4Z A;  4U72 A;  3P8C D;  3RRW A;  4K0K T;  3A7M A;  2YOE A;  3V5U A;  1UGS B;  3VKH A;  4CXY A;  4UXN B;  2IAK A;  4HFE A;  2H7O A;  2I40 B;  2X0H A;  4AXP A;  3AA0 B;  4HE8 A;  1KF6 A;  3RKG A;  3ZYL A;  3CQG B;  4BCN D;  2XAH B;  5JVD E;  1T72 A;  5FVL A;  1SHZ C;  4PAG A;  4QWN B;  4X65 T;  3FBZ A;  3O4X E;  4YTP A;  2R6G F;  3SOL A;  1GUX A;  3WVD B;  3OYZ A;  2NWB A;  4G63 A;  4H9R C;  5LHG B;  4NPP A;  4QKN A;  4HL4 A;  3CML A;  3C51 A;  3H3M A;  3MY5 B;  2QQ8 A;  3HKE E;  2M6B A;  3NZQ A;  4DUZ T;  2JMK A;  1G73 A;  3LBX A;  4EOM B;  3H37 A;  5JDL A;  2QVA A;  3N9Q A;  5EK3 A;  2FBW A;  4YTN A;  4I55 E;  5HWX A;  3N9M A;  2QRX A;  1MMA A;  2UZL B;  4CXW A;  1VYW B;  4IE7 A;  2XAS B;  2WZI A;  3O9X A;  4KMC A;  3AEA A;  2YEV C;  4HFH A;  3ETU A;  2F4V T;  4BCK B;  2VWA A;  3ESL A;  3RI5 A;  1KK7 A;  4AQY T;  2WB5 A;  3LG7 A;  4YSX A;  4LMK A;  4IDQ A;  5AQL B;  2Q9Q C;  3EOC B;  3K8P C;  2BPM B;  2CZ6 B;  2BVL A;  2G77 A;  4HFB A;  3AE9 A;  2J62 A;  3MA9 A;  5DQV A;  3BHT B;  4FM4 B;  1YKH B;  2L9Q A;  3G06 A;  2WZH A;  3AE5 A;  5I5Z B;  3NRX A;  3UFE A;  2E5L T;  5JDM A;  4UIG A;  4DR3 T;  5IHY A;  4UR9 A;  3CIR A;  3BHV B;  3RGL A;  2V7J A;  2E9X A; 
#chains in the Genus database with same CATH homology
 3AA1 B;  4JEH B;  3GA8 A;  3BQL A;  4V1A v;  2B1E A;  2X0L B;  4O4J E;  4KUM B;  2CWO A;  3IBP A;  4K0U A;  5LHI B;  3ZC0 A;  3Q2M A;  1QSD A;  4P0B A;  3O1H A;  2PBI A;  1ZEE A;  2ZM2 A;  2V7L A;  2LHR A;  2Y6X A;  4QXB B;  4Z8X A;  3AA7 B;  2EHO D;  2D0U A;  2LSI A;  2YU1 A;  3HL6 A;  4FJO A;  5KDM C;  3CX6 B;  3PE0 A;  5ETW A;  4O8S A;  2A72 A;  5LXT E;  1ZKE A;  3ZYM A;  2LSK A;  2E9X D;  4TUY E;  3DTO A;  1MIY A;  4TV8 E;  1LKX A;  3C64 A;  5L3F B;  1WRD A;  4QHO A;  1S94 A;  2ZLY A;  2VK9 A;  3E0Z A;  3PUQ A;  2V7K A;  1BR4 A;  1BR1 A;  3ETV A;  3I1A A;  2IC6 A;  2BVM A;  3CWZ B;  2JRK A;  2X51 A;  3J9X 1;  4WW0 A;  4WBN E;  3EDV A;  4PW8 A;  4CI2 B;  2VL8 A;  5LGN B;  3FB2 A;  3UUN A;  2A3D A;  5LBM A;  4EOZ B;  2GK9 A;  3C4W A;  1SA0 E;  3KV6 A;  3AB3 B;  3PU3 A;  3WI3 A;  4GYS A;  5JRE A;  4O4L E;  5FNV E;  3I9Y A;  2K48 A;  2XHE B;  3BQI A;  2RA1 A;  4ZI7 E;  2JQQ A;  4PJN A;  2D0T A;  4AQG A;  4BAY B;  5KMG P;  3JC6 D;  2LM9 A;  5LG4 A;  3RC8 A;  2JPF A;  3PTR B;  2A2F X;  1HG2 A;  2JJ9 A;  4DBR A;  4PFO A;  4ZOL E;  2CEA A;  1D0Y A;  1YD8 G;  2XAJ B;  4PK4 A;  4A56 A;  3ZPO A;  2C5K T;  2LT3 A;  5HWY A;  3SWH A;  2BDE A;  1WYB A;  2DLR A;  3U78 A;  2UXX B;  4C90 A;  1LVK A;  4OHF A;  3N9P A;  1U5P A;  4UF0 A;  4PK6 A;  3I0Q A;  2WBL A;  3H3A A;  4TX5 A;  3ANW A;  3MJX A;  4XZC A;  2DCF A;  2VKD A;  5H6Q B;  4I4T E;  4YHJ A;  4P09 A;  3AAI A;  3GMI A;  2ZMA A;  4MLK A;  4PFP A;  5FYM A;  3UUL A;  3LK4 2;  2J1D G;  2QA7 A;  1V9D A;  4TN7 B;  4MAL A;  4ANJ A;  4ZI3 D;  2ZM8 A;  5C8Y E;  1B7T A;  4AI6 A;  4CI3 B;  3CPZ A;  5J2U E;  2CM0 A;  5HXE A;  5FXV A;  5HXH A;  5JDN A;  5JQG E;  2HPJ A;  5HAX A;  4ISS A;  5HXC A;  3ZN1 B;  5TAO A;  3L09 A;  3DJB A;  4P0A A;  3RH3 A;  2CA5 A;  2KT9 A;  1HX8 A;  2Z6E A;  2K9A A;  4E7S A;  1FMW A;  3N5L A;  2RP4 A;  3N9N A;  4WNK A;  1HG5 A;  4OYJ A;  1EZ3 A;  1IJ6 A;  3ZMU B;  1HCI A;  3ZJ2 A;  1UX5 A;  2W62 A;  2VKH A;  3ZMS B;  4QXC B;  2DHR A;  4ZI2 D;  1FEW A;  2XUE A;  1US7 B;  4IIJ E;  2KLQ A;  1E1H B;  3KV5 A;  3Q5X A;  3AAA B;  3TKL B;  2NOX A;  3GWH A;  3W15 B;  3O1I A;  2KWH A;  4PJM A;  2W0G A;  2DWK A;  5CA1 E;  2LSY A;  2X67 A;  5JDF A;  4OK0 A;  4XBF B;  5EZY E;  5LYJ E;  1X79 A;  2LSG A;  2JMH A;  1UX4 A;  2CE7 A;  2N1G A;  3FXD B;  3MKD A;  4IE6 A;  3RKO A;  1U4Q A;  5JH7 E;  5L3D B;  3ZLI A;  3RYC E;  4BJM A;  3KV9 A;  4I50 E;  4UEL A;  5DAB A;  4JUY A;  2CCQ A;  5FY7 A;  4CXX A;  4UVC B;  1MMN A;  4J2C A;  5FY0 A;  2LOS A;  2X9H A;  4EIW A;  2LHN A;  1NAF A;  3ZEF B;  2MTQ A;  4AKH A;  4AQF A;  3O1J A;  4BA9 A;  3C50 A;  1IZN B;  4G2A A;  4F6R C;  3F2E A;  3KV4 A;  4DMV A;  4KP3 C;  4ZS2 A;  3OJA A;  5LA6 E;  3SRZ A;  2XAG B;  3U3I A;  3CKD A;  4AKG A;  2LSJ A;  3QUJ A;  3N2G E;  3ZC1 A;  2LE8 A;  3HR0 A;  1S35 A;  3P7I A;  4KBM B;  5HXS A;  3VKG A;  2WAU A;  3MAC A;  3RX6 A;  5J1G A;  4DBQ A;  4DND A;  4O2B E;  5FP3 A;  3KVB A;  4MBQ A;  2Q9Q A;  4PJJ A;  3S4U A;  5LGT B;  5LBQ B;  1BR2 A;  1ZHC A;  3WAJ A;  5JRC A;  3I9W A;  3Q5W A;  5LNK A;  3KDS E;  1VRB A;  5HYA A;  2K5B B;  2W61 A;  3IF8 B;  4NUV A;  2MOZ A;  3CX7 B;  5JR9 C;  2CXD A;  1BR0 A;  5H6R B;  3AVS A;  2V26 A;  3LFM A;  4IE4 A;  4O4H E;  4L9I A;  2XAF B;  2E9X B;  3UT5 E;  2E8I A;  5GON E;  3HKC E;  3F31 A;  4TZ4 C;  2EHO C;  4HGA A;  3CQC B;  1IAP A;  2Q9Q D;  3AA6 B;  1HF8 A;  4CZZ B;  3QK6 A;  3ZYK A;  2Y48 B;  2YIN A;  4X1Y E;  2KXP B;  5CA0 E;  2Y8D A;  5LCY A;  1MMD A;  4HFV A;  4H63 V;  2NW9 A;  3PUG A;  4IHJ E;  3C4X A;  2E9X C;  3PUA A;  4XAX B;  1MNE A;  3R6N A;  2IW5 B;  2M67 A;  5J2T E;  5DQW A;  2H7V C;  4GIW A;  4ASK A;  2X9W A;  3RYI E;  4YFS A;  4DVD A;  1Z0P A;  5JDQ A;  3AAE B;  4E7Z A;  2C5J A;  3EVY A;  1UCU A;  1VOM A;  4GOU A;  3UUX B;  3WAK A;  1HFA A;  2NW7 A;  2OA5 A;  2WM9 A;  4TV9 E;  4CQI A;  2NTY A;  3IEE A;  2N2N A;  3OYX A;  2VKO A;  3DP7 A;  3ZCJ A;  5LJM A;  1WR6 A;  2PFV A;  3LK3 B;  3E08 A;  3HKD E;  4AQF C;  5JDH A;  1IJ5 A;  5E0O A;  2G0U A;  3ZMZ B;  5F3J A;  3HI2 A;  3ONX A;  2NW8 A;  3NBX X;  2VB6 A;  4H9N C;  3RYF E;  2HH7 A;  4N78 D;  2XQY A;  4UEM A;  3LJC A;  5CB4 E;  3HA4 A;  4UV9 B;  2LJL A;  3JC6 C;  2LOP A;  4ERR A;  3LBX B;  2K24 A;  2YU2 A;  1D1C A;  3HKB E;  3RRC A;  5FMN A;  2VAS A;  2DWG A;  3NZP A;  2ODU A;  5IYZ E;  4OFZ A;  4QX7 B;  1MIV A;  5LHH B;  3MK7 C;  1WYC A;  1NWM X;  3RYH E;  2DI4 A;  4GK0 E;  2WWU A;  3D0T A;  2N9D A;  2V7I A;  5ADX L;  4UVB B;  4HN9 A;  1FMV A;  2YK0 A;  4L5G A;  5L3E B;  3B57 A;  2X66 A;  4X20 E;  4FI5 A;  1AJ3 A;  1LRZ A;  1D1B A;  4IGU A;  5HXR A;  2KIN B;  2LEH A;  3R84 B;  4OYK A;  3KIN B;  4HEA A;  4EB6 E;  2C5I T;  4PJL A;  5FY1 A;  3PU8 A;  4EAH A;  3QC9 A;  4U74 A;  2WMN A;  4IDZ A;  1Y64 B;  4UF0 B;  2ZM0 A;  3ANW B;  3LK2 B;  4PK5 A;  4ZI3 C;  3RC3 A;  3KBT A;  2WMO A;  4HTE A;  4YJ2 E;  1MND A;  4QX8 B;  5L3C B;  2CMR A;  2HPL A;  3K3N A;  1ZV4 X;  2ACX A;  3C4Z A;  4U72 A;  3P8C D;  4JLE A;  3RRW A;  3VU7 H;  3OBV E;  1O3X A;  3KVA A;  2KZ7 B;  4GYR A;  1D0X A;  3V5U A;  1HS7 A;  2MBG A;  3VKH A;  4CXY A;  4UXN B;  2NP9 A;  2H3R A;  2WSS V;  3PUR A;  5KX5 E;  4JEU B;  2IAK A;  3CVR A;  3GN5 B;  2VKJ A;  2H7O A;  4AXP A;  3KFW X;  3AA0 B;  3ZCI A;  4HE8 A;  1FIO A;  5FXW A;  3ZYL A;  3CQG B;  4ZI2 C;  1YKE B;  2XAH B;  3BQK A;  5JR9 B;  1HTJ F;  5JVD E;  1SHZ C;  4IE5 A;  3ZMT B;  3MXZ A;  2L8K A;  4B6X A;  5LJN A;  1WLX A;  2X9X A;  4H9S E;  4PAG A;  4QWN B;  3FBZ A;  3O4X E;  3UTK A;  5LOV E;  3CX8 B;  2P9B A;  2CWY A;  3KBU A;  5M4Y A;  2EHO B;  3SOL A;  4GK5 E;  1T98 A;  3OYZ A;  2NWB A;  4G63 A;  4H9R C;  5LGU B;  1QUU A;  4MHC A;  5LHG B;  4DO0 A;  1CUN A;  4QKN A;  3SS1 A;  3CML A;  3C51 A;  4UV8 B;  3N9O A;  2CLY B;  4EYY R;  3HKE E;  1KNZ A;  4IE0 A;  3C98 B;  4ILU A;  3PDY A;  2MYS A;  1H7C A;  2CXL A;  5DJQ C;  3NZQ A;  2CXF A;  2X68 A;  4X1K E;  4M1P A;  1OWA A;  2KMF A;  5A1L A;  3A5X A;  2JMK A;  5BMV E;  1G73 A;  4O2A E;  3LBX A;  3N2K E;  3H37 A;  5JDL A;  2CLY C;  4NUU A;  4UVA B;  3K3O A;  4QXH B;  5JDG A;  4WBO A;  1G8X A;  3N9Q A;  2D5U A;  5EK3 A;  3V5S A;  1YW0 A;  3MZK B;  4I55 E;  3EDU A;  4CI1 B;  5HWX A;  3N9M A;  2KWI B;  4IST A;  1MMA A;  4CXW A;  1D1A A;  3L3P A;  4PNI A;  3T8O A;  4IE7 A;  4MFR A;  4H9P C;  2XAS B;  4C91 A;  1MIW A;  5EK4 A;  2IC9 A;  3O9X A;  4KMC A;  2YEV C;  1OXZ A;  3VHL A;  3ETU A;  2V7M A;  3FXE B;  2Q9Q B;  3NRY A;  3UUM A;  4ADZ A;  5AFU L;  2I59 A;  2VWA A;  3ESL A;  5JRC B;  2C0S A;  1LVF A;  3B13 A;  2V1D B;  1KK7 A;  4H9Q C;  3LG7 A;  5LP6 E;  3FHN A;  3K3Q C;  4EZH A;  3N9L A;  5EK2 A;  4EXT A;  4AKI A;  2Q9Q C;  3EUH A;  3CQX C;  2UXN B;  3K8P C;  2D2S A;  5L3G B;  2PG8 A;  4O4I E;  2BVL A;  2DNX A;  1D0Z A;  3F57 A;  3MA9 A;  5DQV A;  4HKA A;  4H9O C;  4YJ3 E;  3RPU A;  5FXX A;  1YKH B;  2L9Q A;  4BJN A;  3BK9 A;  4ZHQ E;  3GN5 A;  3IHR A;  2QGS A;  2XTL A;  5FXZ A;  2KND A;  5F8P A;  3ZMV B;  3M65 A;  3N2O A;  4EZ4 A;  4YLH A;  4X1I E;  3PUS A;  3E22 E;  2L3L A;  5JR9 A;  4I43 B;  4EYU A;  1MMG A;  3NRX A;  3UFE A;  4DMW A;  3ZN0 B;  3ZJ1 A;  3OKQ A;  2SPC A;  5JDM A;  2ODV A;  3J7Y q;  2PJQ A;  4UIG A;  4AKL A;  2BZB A;  3AVR A;  2NTX A;  5IHY A;  2EHO A;  3I0O A;  2W63 A;  4L0R A;  2XAQ B;  3Q9D A;  4H63 H;  4AKR B;  2W00 A;  3FBL A;  5L3B B;  2ES0 A;  2V7J A;  5L2L A;  4ZS3 A;  2X9Y A;  2E9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...