2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein lp_2664
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
5DQWA 3B57A 3DJBA 5DQVA 2PJQA 2QGSA 3DTOA 5IHYA
chains in the Genus database with same CATH superfamily
1T7SA 2MTQA 4DR1T 1BR0A 2UUAT 2LSKA 3ETUA 2EHOA 3AEEA 1WYCA 3VR8A 3PO3S 1IAPA 3H4CA 4CZZB 3M3ZB 3MK7C 1VOLA 2JQ9A 4IE6A 4F6UB 5LJMA 2V7KA 3MJXA 3NDQA 2BBHA 4U7YA 4DV2T 1XMQT 1U4QA 2WMAB 2FBWA 5EK4A 3BHVB 5CA1E 3HB9A 4YTMA 2E5VA 2CZ7B 4EZHA 1D1AA 4O4IE 1UX4A 5CGMA 1MMNA 4GYRA 3ZMZB 2NP9A 2ZPEB 3FBLA 3QYHB 3PUQA 4EGWA 4YSXA 2V6XA 2CMRA 3E08A 5LGTB 1HX8A 4C90A 2X0HA 4B6XA 4QH5A 2UZLB 1ZV4X 4BY7X 2BS2A 4DIDB 1IREB 4IE4A 3AE5A 3VHLA 3OPCA 2VWAA 3ZC0A 4TWFA 2IVXA 3X25B 5EZYE 4HN9A 4CN4A 2KWHA 2AXDS 3DJBA 2X9XA 1W9RA 4XAXB 4YSYA 5AQHB 4DUYT 4U74A 1HCIA 3EAMA 2G0UA 3A8MB 4CFMB 4ZHQE 3J9X1 5JR9B 4ZGDB 4Q25A 4L9IA 3PDYA 4HNTA 3UULA 2PFVA 4WNKA 1Y01A 1UGOA 3QB5K 4IL9A 3POMA 2YEVC 2CXDA 2CZ6B 5EFQB 4QWNB 4N78D 1AD6A 3TW6A 2A2FX 5A1LA 4HWIB 5KX5E 4X1KE 3MXZA 2Y8DA 2C0SA 3FXEB 2WWUA 1D3UB 4DNDA 3CX7B 2H3RA 4HE8A 2KMGA 4F7SB 5HEHA 4YXDA 2PBIA 4GYSA 2LW4A 1LRZA 4QH4A 4PJLA 4ZI3D 4EOOB 4BCFB 2D0UA 1H28B 2LOSA 5FYMA 4E7SA 2K9AA 5AFUL 4O4HE 3N9OA 2IC9A 5LBMA 4OK0A 4BXXX 2XSAA 2WU5A 1VCSA 2W61A 1QSDA 3ABVA 3HKDE 3RHWA 2WMOA 3L3PA 3KFWX 3BG3A 5BR8T 2NTYA 2X9HA 3AA0B 2ZLYA 3C51A 4TTHA 5IUXA 3N2OA 5JDHA 2WDVA 1YQ3A 5HBHB 2JPFA 2I0MA 2BKOA 3ZT6A 3BQIA 5HQ0B 1XNQT 2N9DA 1FJGT 2ZM2A 5HEJA 3R84B 2LOPA 3ONXA 4BA9A 2D9DA 4J2CA 2Q9QB 3X26B 2XPKA 5JDLA 4CFUD 4CQIA 2L8KA 4QH1A 5LGNB 2W0GA 2CHOA 1QLBA 3HI2A 1UNLD 4NUVA 3RYIE 4MLKA 1EZ3A 2XTLA 4TNVA 5ABFB 4EONB 5F8PA 1IJ6A 2LJLA 4GOUA 3CVRA 2WQYA 3EOCB 3TW7A 1O3XA 5CEIB 1VYWB 4X5TA 4F6RC 5AQTB 4X1IE 2J4GA 4QXBB 1T72A 3NBXX 4MBQA 4HKAA 3GN5B 1ENWA 3IHRA 5JDNA 3I0QA 2LE8A 1NEKA 4O8SA 4HL4A 3AA1B 5BNJB 2FJEA 4PJMA 3ZMUB 2HN2A 5DABA 2IW5B 2X1NB 3EUHA 3A8GB 2VQET 1WR0A 1S35A 3K3OA 5EK2A 2XHEB 4CI3B 5ABGA 2X67A 4ZOLE 3ZC1A 2C5NB 4ERRA 1D0YA 3FZLB 3A8YC 3TNWB 3MA9A 4BCNB 2W96A 2VKDA 3K7AM 4KP3C 5FP3A 4DMVA 4E7ZA 2CYZB 2W2UA 2XQ7A 4KHPT 2BG9C 4BCQB 2NWBA 2XASB 3K1SA 3FZMB 2R7GA 4EOIB 3LK42 4OHFA 3ZPOA 5HXRA 2XY8B 4ZGJB 4DV7T 4MFEA 1HF8A 4O4JE 5IWAT 2X9WA 2WHBB 4JI6T 3OYZA 3RRWA 3E22E 3N2KE 2NTXA 4PK6A 3QWLA 2H7VC 2XAFB 2N1GA 2XUEA 1H1QB 5FXZA 5JR9C 1T8BA 3DP7A 1JSUB 4CXWA 3RYHE 2XSBA 1GY3B 5HNBB 2UZEB 3ZYMA 3MACA 5IDNB 1LKXA 2LKGA 4X20E 4FX3B 2YK0A 4YOZA 1HG5A 5LJNA 1C9BA 1QUUA 4AKRB 3EDVA 3RKOA 4NIQA 5L3DB 2WZIA 1AHJB 3BLQB 4JX5A 4IHJE 3PUSA 4BCGB 3HKBE 4Z90A 4I0UA 5AQPB 5HXEA 2JMKA 4JI8T 2YKSA 3KV9A 2JIWA 2BZBA 4HTEA 5LYJE 1UNHD 2Z6EA 4ADZA 2NW7A 5HVYB 1MMAA 4QKNA 1H1RB 3WVDB 3HBLA 4EOZB 4BCPB 5IDPB 3P7IA 3S4UA 3MZKB 2CRBA 4P1NA 3UU4A 1I94T 2LSYA 2QQ8A 4IDPA 3W15B 3N9NA 3EI0A 3PUGA 1FMVA 3RIUA 2DD4B 2QF7A 1UGPB 2HHHT 3N9MA 2W67A 2BS3A 3H3MA 3AEAA 4IDNA 1HG2A 2CCQA 4EORB 1GQEA 2XAHB 3HHTB 5LB7B 2PHGA 3NZPA 3MKDA 3NRYA 4M6VA 2ZPIB 2LLYA 2QDYB 5H6RB 4IE7A 2CBJA 1IBMT 3VYGB 5LA6E 3VRBA 4TX5A 4CFVB 5E0OA 4AXPA 1J5WA 1GUXB 2DCFA 2C5KT 2W2HA 3AE8A 2LEHA 2WZHA 4KRCB 4MHCA 5L3GB 2XAQB 5LXTE 2B9RA 3MI9B 4FM4B 2WBLA 4G6LB 3D0TA 2WIHB 4L0RA 1N32T 5AQNB 4P0AA 4XBFB 3WVEB 3P8CD 2ZZDB 4F8HA 3CWZB 4P09A 3PJAA 3QUJA 1LVFA 2Q9QD 3ZJ1A 4JI0T 3LG7A 2FUPA 3A5XA 1OWAA 3AE6A 5ACBA 4UV8B 4GIWA 4DV5T 1W0AA 3A8LB 5HCMA 2W9ZA 4F7LB 3I9YA 4JEHB 3WI3A 2QFZA 3U78A 1M62A 1D0XA 4EXTA 1UGQB 4TZ4C 5LG4A 2C5OB 1OIYB 1HTJF 1H7CA 4U7IA 3SS1A 4EEDA 4UVCB 2K5BB 2CLYC 3U3IA 2A72A 3AVSA 3TKLB 3CQXC 3HKCE 1OEDA 3EHZA 3QZ5B 1Z0PA 1HX1B 2H7OA 4YSZA 2FJDA 1VCTA 4IGUA 5L4EA 3ZLIA 2YU2A 1HNWT 4LF4T 2CCHB 2BG9B 3GWHA 5H6QB 3ZSSA 5IHYA 4IE5A 3V5SA 1MNEA 2K24A 5L3FB 5LGUB 1JOWA 2M6BA 2Y48B 2BKZB 1UNGD 2F2CA 1Y64B 1VINA 3UU6A 3N9QA 1ZHCA 4QX7B 1WRDA 1L0VA 2J1DG 2UZDB 2CWYA 2XQ3A 2V8SV 2K48A 5FMNA 3AECA 5KXJA 4AKGA 5AQUB 2DNXA 4X64T 2M6IA 1OL2B 4PAGA 2VASA 3RRCA 3UFGA 2DMEA 2N2NA 2QVAA 4DVDA 2VKOA 3BQLA 3AAAB 4ZEYA 4TNWA 2IW6B 3LQ5B 5L2LA 3RIFA 3CIRA 4BCQD 2XQ8A 2Q9QA 1N4MA 3OBVE 1W98B 2WMBB 3OJAA 1UGSB 2E9XD 3ESLA 5GONE 4B3RT 5KDMC 2JRKA 3RQWA 3L09A 4NXNT 4ZZCA 5ICPB 2PG8A 4OB2B 5JTGA 4U2YA 4TWDA 4F7NB 2CXFA 3KV6A 5C3JA 4B3ST 3I0OA 4C91A 3P4RA 4EOKB 5J0ZA 2MOZA 4HLQA 4UR9A 3G33B 4CXAB 4HGAA 4DR4T 1VOMA 2BKPA 2QRXA 3HL6A 3T1YT 5L2WB 2WSSV 4ZI7E 2OA5A 1XWMA 3ZMVB 1WR6A 4ZZBA 3UUMA 1H27B 3AVRA 3A7MA 2EUFA 4BCKB 4OB1B 5HBJB 5LOVE 2I6HA 1E9HB 2IAKA 3KVAA 3TLUA 2CM0A 4DO0A 3RC8A 4M1PA 4AISA 3A8OB 2VURA 4UELA 3ZCJA 3AE3A 3AE2A 2C5VB 1WYBA 4ZGEB 1KFYA 2G77A 2WCAA 1FEWA 5JRCA 2C5IT 2FJBA 2XQ4A 4BCHB 4MALA 2KZ7B 2M67A 1HR0T 2DWGA 2JQQA 1XO2A 3MY5B 2V22B 1ZP0A 2VKHA 4DUZT 4XZCA 4YTPA 3VKHA 2CXLA 5I5ZB 2WS3A 2WPAB 1H26B 2CHNA 3SOLA 3DDQB 2B1EA 4QX8B 2CEAA 3PURA 2CPTA 4WYVA 1LVKA 5FVKA 1OKVB 1BR2A 5ADXL 1ZEEA 1GH6B 3QNUA 2ZMAA 3O1HA 4HFHA 4BCND 1YQ4A 4JI5T 3Q5DA 5HWYA 1J1JA 4YT0A 3TLSA 3ANWB 3UQ7A 3EVYA 4LMJA 4EEBA 1UX5A 2XQ9A 2EHOB 3RC3A 4K0UA 3LK2B 5LBQB 1UCUA 2ODVA 1KNZA 3R6NA 3HKEE 2UXXB 2DXCB 3AEDA 2NW9A 1NENA 4FI5A 1NWMX 3JC6C 1KEYA 1UK5A 4Z91A 4HFIA 4AQFA 2UU9T 3V5UA 2G9XB 3NZQA 4BCJB 2V26A 3EJ1B 4OB0B 3RYCE 4ILUA 2YDQA 3CQGB 3GMIA 4IDQA 4DBQA 2IC6A 3ONJA 2LM2A 2DWKA 3EDUA 4OYJA 2RP4A 4FJOA 3ZYKA 4JV5T 4IIJE 1MIYA 2E9XC 3RH3A 2BG9A 4LMLA 3RGFB 4EIWA 2KINB 5F5WA 4UEMA 3IBPA 4PJJA 3JC6D 5AQOB 3L8RA 2WEVB 3PE0A 3VR9A 5LHHB 4YY3T 5AQVB 4WZXA 4L5GA 4KBMB 2ZCFB 2X0LB 3C4WA 4U31A 5LMUT 1J5ET 1V29B 4DR3T 2EHOC 4ILBA 4ZS2A 2HPLA 1GUXA 5HEOA 2LHNA 2WFYB 3CKDA 2LT3A 1W0BA 3NVOA 4CFXB 5JR9A 1FIOA 4OR5B 4U3CA 2ODUA 2X0YA 4HWHA 1ZKEA 5HXSA 5DJQC 4HNUA 1OGUB 4LFAT 4BJMA 3QZ9B 3KBUA 3Q5EA 1YD8G 5DQWA 3O9XA 5FXWA 3TLWA 1MNDA 1YW0A 2XQ5A 4ZXLA 2JGZB 4YJ3E 5JDQA 3AE7A 3O1JA 1AJ3A 1XDOA 2IW8B 4AIUA 4DR5T 2XQAA 4AQGA 4YOSA 5FL1A 2ZPGB 3QYGB 4HFVA 2UXDT 5JDGA 4TN7B 1S94A 1JNZA 4KUMB 5JVDE 1HFAA 1MMGA 2NW8A 4ISSA 4YOOA 2K3WA 4JX4A 2XJ7A 3ZN0B 4OB3B 4I43B 2WDRA 4F6SB 3ETVA 4EAHA 2ZM6T 4ZI2D 2JJ9A 3GA8A 4JI4T 4PW8A 1US7B 4EYUA 2YOEA 3CK6A 2IMLA 2LSIA 2SPCA 3DTOA 2W62A 4HFEA 4LF9T 4IDOA 3QC9A 2OLTA 5HCJA 5HEUA 3AXJB 2BVMA 1H1PB 2MYSA 5L4HA 4IREA 3VU7H 3F31A 4IE0A 4AKHA 4CXYA 3LSVA 3B5MA 5HEGA 2L9QA 2ACZA 3FZHB 5FXVA 5JRCB 4F7JB 5LHGB 1KNPA 5HXCA 4HWFA 4LF5T 3AE9A 2C6TB 2PTFA 1HS7A 4NUUA 3Q2MA 3I1AA 2BKNA 5J1GA 2KWIB 2WXVB 4OGRB 5LG3A 1E2AA 2FJAA 1URCB 3GN5A 3IF8B 4IL4A 3RF1A 2H89A 4JI3T 3PU8A 2DD5B 4A97A 3RX6A 1G3NC 4B3MT 4EOMB 4I4TE 4G63A 4BCMB 3O1IA 4H9PC 5AQQB 1WCRA 3QHWB 2E8IA 1G8XA 4EV6A 3ANWA 4EB6E 1E7PA 4AKLA 3O4XE 1UURA 4NXMT 3ZCIA 5FNVE 1ZOYA 1AISB 3L39A 2AE9A 3UUBA 3IA3A 3RIUC 1O9KB 2BDEA 2CCIB 2AHJB 2IHR1 4EC9B 2RA1A 5FY1A 2QGSA 3N5LA 2XQ6A 2WDQA 4CRLB 4EC8B 3ZN1B 5HWXA 2VB6A 2W4XA 4TV9E 3DDPB 3ONLC 2BBJA 2HPJA 3ZSTA 4X66T 2EHOD 2VK9A 1MIVA 4H9OC 3AEGA 3K8PC 4JI7T 4PFOA 1JSTB 3TLVA 2D5UA 3X20B 1N34T 3QYEA 4O2AE 1H4LD 2ZM8A 1YKHB 4JI1T 2JQHA 4K0KT 5JDMA 2V7MA 4Z6YA 4DR2T 4UIGA 3ZJ2A 4YHHT 1TFBA 3M65A 2XAGB 4DV1T 4LF7T 3LBXB 1H1SB 4Y72B 5LMKB 2IIUA 4BJNA 3PUVF 1KXUA 5ABFA 4HFBA 2UXBT 1DU2A 3P4SA 4TWHA 2KLQA 3RKGA 2E9XB 2DPPB 1M7KA 2VVSA 3DOGB 4AQFC 2LM9A 4CFWB 5L47A 4H9SE 4UXNB 4QXCB 3ZEFB 3UTKA 3KV5A 4JYAT 5C8YE 1QMZB 1KK7A 4ASKA 3LDQB 5HAXA 4X65T 3RIAA 4HWDA 3FZFB 4EZ4A 1FVVB 3H37A 3C64A 3N9PA 4ISTA 1W09A 4JI2T 4LFCT 3QXEB 4BY1X 3TNHB 4BAYB 5JQGE 3F5XB 2I53A 2V7JA 2XQYA 3TNIB 2BS4A 4UVAB 2YU1A 4UF0A 3BHTB 2W9FA 1FKMA 3SFEA 4F70B 2X66A 4F6WB 4BBRM 1D1CA 2KSRA 2CA5A 4EOQB 4WBNE 5HYAA 1IBKT 5CB4E 3BK9A 4I50E 2VKJA 3UUNA 2WM9A 2JMHA 5FKYA 5CYIB 4MIMA 2XAJB 4BCOB 4A98A 4P0BA 3Q5XA 4H9RC 2W63A 4ROCA 2WB5A 1OEDC 1OI9B 4LMKA 1SUMB 3KV4A 5JDFA 5CFBA 4UV9B 4U33A 4HFDA 2B76A 4PNIA 2V6YB 2E5LT 3KINB 4LF8T 1KNRA 3P4PA 4YFSA 4NPPA 1SHZC 5LNKA 2DL1A 2J62A 1OKWB 2R6GF 4CFUB 2XZEA 2PMIB 4PFPA 4O4LE 2RPAA 4GKKT 1X79A 4U72A 3UU5A 1OL1B 4UN0A 2KT9A 4GK0E 1N33T 5AQMB 1JKWA 2D0TA 4COFA 3QK6A 3SFDA 1P5EB 4IDZA 2V5CA 2KR6A 1CHUA 5AQJB 3OVUA 1WFDA 2CZ1B 5AQKB 4ZI3C 3P4WA 1TD6A 4EOPB 1E1HB 3C98B 1YKEB 2LSGA 2UUCT 3GTMS 3RQUA 3BLHB 2X9YA 2C5JA 2V7LA 1KF6A 1X9BA 3JCFA 3DL1A 3B13A 5L3EB 3M03A 2OV9A 2CJMB 2D2SA 3RYFE 4HWCA 2DLRA 3O0GD 3JADA 2QYWA 5FVLA 4JUYA 3PJAJ 1OXZA 4ELLA 4IT4A 3MY1B 3X28B 3CX6B 3UUXB 2CZ0B 1OEDB 4CN6A 3OKQA 3TLTA 1D0ZA 3PTRB 5FGKB 1SA0E 4WBOA 3PU3A 4QHOA 2MBGA 4QSHA 4A56A 4BCMD 5ABHA 2ES0A 1IBLT 2LKHA 1PKDB 4NSTB 2C5XB 4ELJA 5IF1B 4HEAA 5ABEA 4AKIA 3K3QC 4DR6T 5C2TA 4JLEA 2DI4A 4YC3B 2I59A 2YDRA 5LQFB 3HO8A 3NWIA 3PUYF 3FZKB 2PK2A 3C4ZA 4H9NC 4Z8XA 3LFMA 1XNRT 2JQKA 4EOSB 3FBZA 5L3CB 2DHRA 3B57A 5KMGP 2LRLA 3CMLA 1H25B 2ZPFB 5CJ5A 5ETWA 2LHRA 1HNZT 1NAFA 3E0ZA 3ZT5A 1IZNB 4BBSM 4EOLB 1UGRB 2V1DB 4YJ2E 4ZI2C 2UZBB 1UUSA 5L3BB 2A3DA 3P50A 2IN3A 3AB3B 3AXJA 5M4YA 4TUYE 4B3TT 2PK9B 4LOCA 2E9XA 3VRAA 1YXRA 4A5XA 2YINA 5CA0E 3FHNA 3G06A 3NKZA 3IEEA 4IMYB 2WP9A 4KI0F 4OFZA 2GK9A 1F5QB 4I55E 3PV0F 2I40B 2HH7A 5AQFB 1R8IA 4MFDA 5TAOA 2E2AA 4RODA 4H63V 4DMWA 3FXDB 3QHRB 3AEFA 4CFNB 2KNDA 4QXHB 2UUEB 4GKJT 3OTOT 3PUWF 2VVNA 4CI1B 3X1DA 3CQCB 3KVBA 3AE4A 1XZYA 3AEBA 2VQFT 5JH7E 3VKGA 3AE1A 3NRXA 3QOFA 5FY0A 3UFEA 5FL0A 2NR4A 3LJCA 2CWOA 4DV4T 2LSJA 4CN1A 3SWHA 1U5PA 2PJQA 2WIPB 2BG9E 1BR1A 3ZT7A 3RGLA 3RI5A 4LFBT 3EIDB 1VRBA 2BVLA 2WMNA 3EABA 3WAKA 2J47A 5LMNT 4YHJA 4H63H 5HXHA 3OYXA 1XDPA 4OYKA 2L3LA 1IJ5A 1V9DA 2HN1A 1BR4A 2CBIA 1N36T 2LRKA 3N2GE 5IYZE 4DV6T 2F4VT 2ACXA 4DV3T 2VL8A 1O9KA 4NC6A 1I6ZA 3K3NA 3F57A 3KDSE 2YN6A 2V6YA 5J2UE 2WJ9A 1CUNA 3HZJA 1Z8UA 3AA6B 1MMDA 2WWVA 1OEDE 3VYHB 4KMCA 3KBTA 4JBWF 4X1YE 4PK4A 2W99A 2WY2A 4MFRA 2KXPB 3JAEA 2C4GB 3PUXF 5AQLB 4HNVA 2UXCT 4AQYT 2IDOB 5EK3A 5FXXA 3JAFA 4OX9T 1OIUB 2NOXA 4PJNA 5AQSB 2QA7A 3I9WA 1JNRA 4ROEA 1ZP2A 1D1BA 3HA4A 4BCIB 1WLXA 2ZPBB 3QB5A 3AAIA 4WW0A 4II5B 3AAEB 3PUAA 5HBEB 3LBXA 3LK3B 2QDJA 3WAJA 3AA7B 3TN8B 2KMFA 4UVBB 2UUBT 1T98A 3N9LA 3A8HB 4GK5E 3J7Yq 2A9UA 2W66A 1H24B 2MAWA 5J2TE 3P4QA 3T8OA 4CI2B 3HR0A 2WU2A 4PK5A 5AQGB 5DQVA 2H88A 2VL0A 4JEUB 2YDSA 4JX6A 2DXBB 4H9QC 4DR7T 3CX8B 3SRZA 2IW9B 2MPKA 3UU3A 3PUZF 1FMWA 4G2AA 3RPUA 3X24B 4ANJA 3QYBA 4AI6A 3C50A 5FY7A 2V5DA 3FB2A 3RLFF 2X68A 2IUBA 5F3JA 4UF0B 3F2EA 2Q9QC 2ZPHB 1HNXT 4O2BE 1FINB 2V7IA 3BLRB 2W00A 4X62T 3Q5WA 3KHIA 3ZMSB 2Y6XA 3T1HT 2ZM0A 3UU8A 1SE7A 5LCYA 3BQKA 5EJCA 4TV8E 4CXXA 5BMVE 5LP6E 4YLHA 2BPMB 2CLYB 3C4XA 3UQ4A 4KX6A 2P9BA 2XM2A 3CPZA 4V1Av 2CE7A 4ILAA 2UXNB 3ZKRA 3H3AA 4EOJB 3UT5E 1MIWA 3Q9DA 4HFCA 4KRDB 4EYYR 2X51A 4LF6T 1XMOT 4DV0T 2XM1A 3MIAB 5JREA 1B7TA 3ZMTB 4U2ZA 3BG9A 2D0QB 5LHIB 3ZYLA 5AQIB 4ZS3A 5AQRB 1G73A 3BHUB 3BG5A 4KHZF 2WAUA 4ILCA 4YTNA 4DBRA 4I3ZB 1BU2A
chains in the Genus database with same CATH topology
3IBPA 4PJJA 1E1HB 3C98B 2MTQA 3JC6D 1BR0A 1HG2A 1YKEB 2LSKA 2LSGA 2CCQA 3PE0A 3ETUA 2EHOA 2XAHB 5LHHB 3NZPA 1WYCA 2X9YA 2C5JA 1IAPA 3MKDA 2V7LA 4CZZB 4L5GA 4KBMB 3NRYA 3B13A 3MK7C 5L3EB 2X0LB 3C4WA 2D2SA 4IE6A 3RYFE 5LJMA 2V7KA 2DLRA 3MJXA 5H6RB 4IE7A 4JUYA 1OXZA 5LA6E 4TX5A 5E0OA 4AXPA 2EHOC 1U4QA 4ZS2A 2HPLA 3CX6B 3UUXB 2LHNA 2DCFA 2C5KT 5CA1E 5EK4A 3CKDA 2LEHA 2LT3A 3OKQA 4MHCA 5JR9A 1FIOA 1D0ZA 5L3GB 3PTRB 4EZHA 2XAQB 1D1AA 4O4IE 1UX4A 5LXTE 1MMNA 2ODUA 1SA0E 4GYRA 3ZMZB 4WBOA 2WBLA 2NP9A 3FBLA 1ZKEA 5HXSA 5DJQC 3PU3A 4QHOA 3PUQA 3D0TA 4BJMA 4L0RA 2MBGA 3KBUA 4XBFB 4P0AA 2CMRA 3E08A 5LGTB 1HX8A 3P8CD 4A56A 2ES0A 4C90A 1YD8G 4B6XA 5DQWA 3O9XA 5FXWA 1ZV4X 3CWZB 4P09A 1MNDA 1YW0A 4IE4A 3QUJA 1LVFA 4YJ3E 3VHLA 4HEAA 5JDQA 3K3QC 4AKIA 2VWAA 3ZC0A 4JLEA 2DI4A 2Q9QD 3O1JA 5EZYE 3ZJ1A 2I59A 1AJ3A 3LG7A 4HN9A 2KWHA 3A5XA 3DJBA 1OWAA 2X9XA 4UV8B 4AQGA 4GIWA 4XAXB 3C4ZA 4H9NC 4Z8XA 3LFMA 4HFVA 5JDGA 3FBZA 4TN7B 5L3CB 1S94A 3B57A 2DHRA 4KUMB 4U74A 5JVDE 1HFAA 1HCIA 1MMGA 2NW8A 2G0UA 5KMGP 4ISSA 3I9YA 4JEHB 3ZN0B 3CMLA 4ZHQE 3WI3A 3J9X1 4I43B 3U78A 5JR9B 5ETWA 2LHRA 3ETVA 4EAHA 1NAFA 1D0XA 4EXTA 4ZI2D 2JJ9A 3GA8A 4PW8A 4L9IA 1US7B 3E0ZA 4EYUA 1IZNB 3PDYA 2LSIA 4TZ4C 3UULA 2SPCA 2V1DB 2PFVA 4YJ2E 4ZI2C 5LG4A 4WNKA 3DTOA 5L3BB 2W62A 2A3DA 1HTJF 3AB3B 1H7CA 2YEVC 3QC9A 2CXDA 3SS1A 5M4YA 4TUYE 2BVMA 2E9XA 4QWNB 4UVCB 2MYSA 2K5BB 4N78D 2CLYC 3U3IA 3VU7H 2A72A 3AVSA 3TKLB 3CQXC 3F31A 2A2FX 5A1LA 2YINA 4IE0A 4AKHA 5CA0E 4CXYA 3HKCE 3FHNA 5KX5E 1Z0PA 4X1KE 2H7OA 4ZI3C 3MXZA 2L9QA 2C0SA 2Y8DA 3IEEA 4OFZA 2GK9A 3FXEB 2WWUA 5FXVA 4IGUA 4I55E 4DNDA 5JRCB 2HH7A 3CX7B 2H3RA 5LHGB 5HXCA 5TAOA 2YU2A 4HE8A 3ZLIA 4H63V 4DMWA 1HS7A 2PBIA 3GWHA 3FXDB 5H6QB 2KNDA 5IHYA 4NUUA 3Q2MA 4GYSA 4QXHB 4IE5A 3V5SA 1MNEA 1LRZA 2K24A 3I1AA 4PJLA 5L3FB 4ZI3D 5LGUB 2Y48B 4CI1B 5J1GA 2D0UA 3CQCB 2LOSA 1Y64B 2KWIB 2K9AA 3KVBA 5FYMA 4E7SA 5AFUL 4O4HE 3N9OA 2IC9A 5LBMA 4OK0A 3N9QA 5JH7E 3VKGA 1ZHCA 3NRXA 4QX7B 3GN5A 3IF8B 1WRDA 5FY0A 3UFEA 2J1DG 3LJCA 2CWYA 3PU8A 2CWOA 2K48A 2LSJA 2W61A 1QSDA 3HKDE 5FMNA 3SWHA 4AKGA 3RX6A 1U5PA 2WMOA 3L3PA 3KFWX 2NTYA 2X9HA 2PJQA 2ZLYA 3AA0B 3C51A 2DNXA 3N2OA 4I4TE 4PAGA 1BR1A 5JDHA 2JPFA 2VASA 3RRCA 4G63A 2N2NA 3O1IA 1VRBA 2BVLA 2WMNA 4H9PC 3BQIA 2VKOA 3BQLA 3WAKA 2N9DA 4DVDA 3AAAB 4YHJA 4H63H 5HXHA 2E8IA 3OYXA 4OYKA 5L2LA 1G8XA 2L3LA 1IJ5A 1V9DA 3ANWA 2ZM2A 4EB6E 3R84B 2LOPA 3ONXA 4AKLA 4BA9A 1BR4A 2Q9QA 4J2CA 2Q9QB 3O4XE 3OBVE 3ZCIA 3N2GE 5IYZE 4CQIA 5FNVE 5JDLA 2L8KA 2ACXA 2W0GA 2VL8A 3OJAA 5LGNB 2E9XD 3ESLA 3HI2A 2BDEA 5GONE 3K3NA 4NUVA 3RYIE 4MLKA 3F57A 1EZ3A 2XTLA 1IJ6A 5F8PA 2LJLA 3KDSE 2JRKA 3CVRA 4GOUA 5KDMC 2RA1A 5J2UE 3L09A 5FY1A 2QGSA 3N5LA 1O3XA 2PG8A 3ZN1B 1CUNA 5HWXA 2VB6A 3AA6B 1MMDA 2CXFA 3KV6A 4F6RC 4X1IE 4TV9E 4QXBB 4KMCA 3NBXX 3KBTA 4X1YE 3I0OA 4MBQA 4C91A 2HPJA 4HKAA 4PK4A 3GN5B 2EHOD 2VK9A 3IHRA 5JDNA 4MFRA 2KXPB 3I0QA 1MIVA 2LE8A 4H9OC 4O8SA 3AA1B 2MOZA 3K8PC 4PFOA 4PJMA 5EK3A 5FXXA 3ZMUB 5DABA 2D5UA 2NOXA 4PJNA 2IW5B 3EUHA 4HGAA 2QA7A 4O2AE 3I9WA 1VOMA 2ZM8A 1S35A 1YKHB 3K3OA 5EK2A 2XHEB 1D1BA 3HA4A 3HL6A 5JDMA 1WLXA 4CI3B 2V7MA 2WSSV 2X67A 4ZOLE 3ZC1A 4ZI7E 2OA5A 4UIGA 3AAIA 3ZJ2A 4WW0A 4ERRA 3ZMVB 1D0YA 1WR6A 3AAEB 3M65A 3PUAA 3UUMA 3LBXA 2XAGB 3LK3B 3LBXB 3MA9A 2VKDA 3WAJA 3AA7B 4KP3C 5FP3A 3AVRA 4DMVA 4E7ZA 4BJNA 2KMFA 5LOVE 4UVBB 1T98A 3N9LA 2IAKA 3KVAA 2KLQA 2CM0A 4GK5E 3J7Yq 2E9XB 2NWBA 4DO0A 4AQFC 5J2TE 2LM9A 3T8OA 4CI2B 2XASB 3RC8A 4M1PA 3HR0A 4PK5A 5DQVA 4UELA 4H9SE 4UXNB 4QXCB 3ZCJA 3ZEFB 4JEUB 3LK42 3UTKA 1WYBA 3KV5A 4OHFA 3ZPOA 5HXRA 4H9QC 5C8YE 3CX8B 1HF8A 4O4JE 1FEWA 5JRCA 1KK7A 4ASKA 2C5IT 4MALA 3SRZA 2KZ7B 2M67A 2DWGA 5HAXA 2JQQA 1FMWA 4G2AA 2X9WA 3RPUA 4EZ4A 2VKHA 3OYZA 4ANJA 4AI6A 3H37A 3C64A 3E22E 3N9PA 3RRWA 4ISTA 3C50A 3N2KE 2NTXA 4PK6A 4XZCA 5FY7A 3VKHA 2H7VC 2XAFB 2CXLA 2N1GA 3FB2A 2X68A 4BAYB 5JQGE 2V7JA 2XQYA 2XUEA 3SOLA 2B1EA 4QX8B 5FXZA 2CEAA 3PURA 5JR9C 4UVAB 5F3JA 1LVKA 2YU1A 3F2EA 4UF0B 2Q9QC 4UF0A 3DP7A 4CXWA 3RYHE 1BR2A 4O2BE 5ADXL 1ZEEA 2X66A 3ZYMA 2V7IA 3MACA 2W00A 1LKXA 3Q5WA 2ZMAA 3O1HA 4X20E 3ZMSB 1D1CA 2Y6XA 2YK0A 2ZM0A 2CA5A 1HG5A 5LJNA 5HWYA 4WBNE 5HYAA 1QUUA 4AKRB 5CB4E 3EDVA 5LCYA 3RKOA 3BK9A 5L3DB 4I50E 2VKJA 3BQKA 4IHJE 3PUSA 3ANWB 3UUNA 3EVYA 2WM9A 4TV8E 2JMHA 4CXXA 5BMVE 1UX5A 2XAJB 5LP6E 4YLHA 2EHOB 3HKBE 2CLYB 4K0UA 4P0BA 3RC3A 3LK2B 5LBQB 1UCUA 3C4XA 3Q5XA 2ODVA 4H9RC 2W63A 5HXEA 1KNZA 3R6NA 2JMKA 3HKEE 2UXXB 2NW9A 3KV9A 3KV4A 2BZBA 2P9BA 3CPZA 4V1Av 4FI5A 1NWMX 3JC6C 4HTEA 2CE7A 5JDFA 2UXNB 4UV9B 5LYJE 4PNIA 3H3AA 2Z6EA 3UT5E 4AQFA 1MIWA 3Q9DA 4ADZA 4EYYR 2NW7A 3V5UA 2X51A 1MMAA 3KINB 4QKNA 3NZQA 2V26A 4EOZB 4YFSA 5JREA 3RYCE 1SHZC 1B7TA 4ILUA 3ZMTB 3CQGB 3GMIA 5LNKA 4DBQA 2IC6A 4PFPA 4O4LE 3P7IA 2DWKA 3EDUA 3S4UA 3MZKB 4OYJA 2RP4A 4FJOA 3ZYLA 3ZYKA 5LHIB 2LSYA 1X79A 4U72A 4ZS3A 3W15B 3N9NA 2KT9A 4GK0E 1G73A 4IIJE 3PUGA 1FMVA 2D0TA 3QK6A 4IDZA 2WAUA 1MIYA 2E9XC 3RH3A 4DBRA 4EIWA 2KINB 3N9MA 4UEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQW A;  3B57 A;  3DJB A;  5DQV A;  2PJQ A;  2QGS A;  3DTO A;  5IHY A; 
#chains in the Genus database with same CATH topology
 1T7S A;  2MTQ A;  4DR1 T;  1BR0 A;  2UUA T;  2LSK A;  3ETU A;  2EHO A;  3AEE A;  1WYC A;  3VR8 A;  3PO3 S;  1IAP A;  3H4C A;  4CZZ B;  3M3Z B;  3MK7 C;  1VOL A;  2JQ9 A;  4IE6 A;  4F6U B;  5LJM A;  2V7K A;  3MJX A;  3NDQ A;  2BBH A;  4U7Y A;  4DV2 T;  1XMQ T;  1U4Q A;  2WMA B;  2FBW A;  5EK4 A;  3BHV B;  5CA1 E;  3HB9 A;  4YTM A;  2E5V A;  2CZ7 B;  4EZH A;  1D1A A;  4O4I E;  1UX4 A;  5CGM A;  1MMN A;  4GYR A;  3ZMZ B;  2NP9 A;  2ZPE B;  3FBL A;  3QYH B;  3PUQ A;  4EGW A;  4YSX A;  2V6X A;  2CMR A;  3E08 A;  5LGT B;  1HX8 A;  4C90 A;  2X0H A;  4B6X A;  4QH5 A;  2UZL B;  1ZV4 X;  4BY7 X;  2BS2 A;  4DID B;  1IRE B;  4IE4 A;  3AE5 A;  3VHL A;  3OPC A;  2VWA A;  3ZC0 A;  4TWF A;  2IVX A;  3X25 B;  5EZY E;  4HN9 A;  4CN4 A;  2KWH A;  2AXD S;  3DJB A;  2X9X A;  1W9R A;  4XAX B;  4YSY A;  5AQH B;  4DUY T;  4U74 A;  1HCI A;  3EAM A;  2G0U A;  3A8M B;  4CFM B;  4ZHQ E;  3J9X 1;  5JR9 B;  4ZGD B;  4Q25 A;  4L9I A;  3PDY A;  4HNT A;  3UUL A;  2PFV A;  4WNK A;  1Y01 A;  1UGO A;  3QB5 K;  4IL9 A;  3POM A;  2YEV C;  2CXD A;  2CZ6 B;  5EFQ B;  4QWN B;  4N78 D;  1AD6 A;  3TW6 A;  2A2F X;  5A1L A;  4HWI B;  5KX5 E;  4X1K E;  3MXZ A;  2Y8D A;  2C0S A;  3FXE B;  2WWU A;  1D3U B;  4DND A;  3CX7 B;  2H3R A;  4HE8 A;  2KMG A;  4F7S B;  5HEH A;  4YXD A;  2PBI A;  4GYS A;  2LW4 A;  1LRZ A;  4QH4 A;  4PJL A;  4ZI3 D;  4EOO B;  4BCF B;  2D0U A;  1H28 B;  2LOS A;  5FYM A;  4E7S A;  2K9A A;  5AFU L;  4O4H E;  3N9O A;  2IC9 A;  5LBM A;  4OK0 A;  4BXX X;  2XSA A;  2WU5 A;  1VCS A;  2W61 A;  1QSD A;  3ABV A;  3HKD E;  3RHW A;  2WMO A;  3L3P A;  3KFW X;  3BG3 A;  5BR8 T;  2NTY A;  2X9H A;  3AA0 B;  2ZLY A;  3C51 A;  4TTH A;  5IUX A;  3N2O A;  5JDH A;  2WDV A;  1YQ3 A;  5HBH B;  2JPF A;  2I0M A;  2BKO A;  3ZT6 A;  3BQI A;  5HQ0 B;  1XNQ T;  2N9D A;  1FJG T;  2ZM2 A;  5HEJ A;  3R84 B;  2LOP A;  3ONX A;  4BA9 A;  2D9D A;  4J2C A;  2Q9Q B;  3X26 B;  2XPK A;  5JDL A;  4CFU D;  4CQI A;  2L8K A;  4QH1 A;  5LGN B;  2W0G A;  2CHO A;  1QLB A;  3HI2 A;  1UNL D;  4NUV A;  3RYI E;  4MLK A;  1EZ3 A;  2XTL A;  4TNV A;  5ABF B;  4EON B;  5F8P A;  1IJ6 A;  2LJL A;  4GOU A;  3CVR A;  2WQY A;  3EOC B;  3TW7 A;  1O3X A;  5CEI B;  1VYW B;  4X5T A;  4F6R C;  5AQT B;  4X1I E;  2J4G A;  4QXB B;  1T72 A;  3NBX X;  4MBQ A;  4HKA A;  3GN5 B;  1ENW A;  3IHR A;  5JDN A;  3I0Q A;  2LE8 A;  1NEK A;  4O8S A;  4HL4 A;  3AA1 B;  5BNJ B;  2FJE A;  4PJM A;  3ZMU B;  2HN2 A;  5DAB A;  2IW5 B;  2X1N B;  3EUH A;  3A8G B;  2VQE T;  1WR0 A;  1S35 A;  3K3O A;  5EK2 A;  2XHE B;  4CI3 B;  5ABG A;  2X67 A;  4ZOL E;  3ZC1 A;  2C5N B;  4ERR A;  1D0Y A;  3FZL B;  3A8Y C;  3TNW B;  3MA9 A;  4BCN B;  2W96 A;  2VKD A;  3K7A M;  4KP3 C;  5FP3 A;  4DMV A;  4E7Z A;  2CYZ B;  2W2U A;  2XQ7 A;  4KHP T;  2BG9 C;  4BCQ B;  2NWB A;  2XAS B;  3K1S A;  3FZM B;  2R7G A;  4EOI B;  3LK4 2;  4OHF A;  3ZPO A;  5HXR A;  2XY8 B;  4ZGJ B;  4DV7 T;  4MFE A;  1HF8 A;  4O4J E;  5IWA T;  2X9W A;  2WHB B;  4JI6 T;  3OYZ A;  3RRW A;  3E22 E;  3N2K E;  2NTX A;  4PK6 A;  3QWL A;  2H7V C;  2XAF B;  2N1G A;  2XUE A;  1H1Q B;  5FXZ A;  5JR9 C;  1T8B A;  3DP7 A;  1JSU B;  4CXW A;  3RYH E;  2XSB A;  1GY3 B;  5HNB B;  2UZE B;  3ZYM A;  3MAC A;  5IDN B;  1LKX A;  2LKG A;  4X20 E;  4FX3 B;  2YK0 A;  4YOZ A;  1HG5 A;  5LJN A;  1C9B A;  1QUU A;  4AKR B;  3EDV A;  3RKO A;  4NIQ A;  5L3D B;  2WZI A;  1AHJ B;  3BLQ B;  4JX5 A;  4IHJ E;  3PUS A;  4BCG B;  3HKB E;  4Z90 A;  4I0U A;  5AQP B;  5HXE A;  2JMK A;  4JI8 T;  2YKS A;  3KV9 A;  2JIW A;  2BZB A;  4HTE A;  5LYJ E;  1UNH D;  2Z6E A;  4ADZ A;  2NW7 A;  5HVY B;  1MMA A;  4QKN A;  1H1R B;  3WVD B;  3HBL A;  4EOZ B;  4BCP B;  5IDP B;  3P7I A;  3S4U A;  3MZK B;  2CRB A;  4P1N A;  3UU4 A;  1I94 T;  2LSY A;  2QQ8 A;  4IDP A;  3W15 B;  3N9N A;  3EI0 A;  3PUG A;  1FMV A;  3RIU A;  2DD4 B;  2QF7 A;  1UGP B;  2HHH T;  3N9M A;  2W67 A;  2BS3 A;  3H3M A;  3AEA A;  4IDN A;  1HG2 A;  2CCQ A;  4EOR B;  1GQE A;  2XAH B;  3HHT B;  5LB7 B;  2PHG A;  3NZP A;  3MKD A;  3NRY A;  4M6V A;  2ZPI B;  2LLY A;  2QDY B;  5H6R B;  4IE7 A;  2CBJ A;  1IBM T;  3VYG B;  5LA6 E;  3VRB A;  4TX5 A;  4CFV B;  5E0O A;  4AXP A;  1J5W A;  1GUX B;  2DCF A;  2C5K T;  2W2H A;  3AE8 A;  2LEH A;  2WZH A;  4KRC B;  4MHC A;  5L3G B;  2XAQ B;  5LXT E;  2B9R A;  3MI9 B;  4FM4 B;  2WBL A;  4G6L B;  3D0T A;  2WIH B;  4L0R A;  1N32 T;  5AQN B;  4P0A A;  4XBF B;  3WVE B;  3P8C D;  2ZZD B;  4F8H A;  3CWZ B;  4P09 A;  3PJA A;  3QUJ A;  1LVF A;  2Q9Q D;  3ZJ1 A;  4JI0 T;  3LG7 A;  2FUP A;  3A5X A;  1OWA A;  3AE6 A;  5ACB A;  4UV8 B;  4GIW A;  4DV5 T;  1W0A A;  3A8L B;  5HCM A;  2W9Z A;  4F7L B;  3I9Y A;  4JEH B;  3WI3 A;  2QFZ A;  3U78 A;  1M62 A;  1D0X A;  4EXT A;  1UGQ B;  4TZ4 C;  5LG4 A;  2C5O B;  1OIY B;  1HTJ F;  1H7C A;  4U7I A;  3SS1 A;  4EED A;  4UVC B;  2K5B B;  2CLY C;  3U3I A;  2A72 A;  3AVS A;  3TKL B;  3CQX C;  3HKC E;  1OED A;  3EHZ A;  3QZ5 B;  1Z0P A;  1HX1 B;  2H7O A;  4YSZ A;  2FJD A;  1VCT A;  4IGU A;  5L4E A;  3ZLI A;  2YU2 A;  1HNW T;  4LF4 T;  2CCH B;  2BG9 B;  3GWH A;  5H6Q B;  3ZSS A;  5IHY A;  4IE5 A;  3V5S A;  1MNE A;  2K24 A;  5L3F B;  5LGU B;  1JOW A;  2M6B A;  2Y48 B;  2BKZ B;  1UNG D;  2F2C A;  1Y64 B;  1VIN A;  3UU6 A;  3N9Q A;  1ZHC A;  4QX7 B;  1WRD A;  1L0V A;  2J1D G;  2UZD B;  2CWY A;  2XQ3 A;  2V8S V;  2K48 A;  5FMN A;  3AEC A;  5KXJ A;  4AKG A;  5AQU B;  2DNX A;  4X64 T;  2M6I A;  1OL2 B;  4PAG A;  2VAS A;  3RRC A;  3UFG A;  2DME A;  2N2N A;  2QVA A;  4DVD A;  2VKO A;  3BQL A;  3AAA B;  4ZEY A;  4TNW A;  2IW6 B;  3LQ5 B;  5L2L A;  3RIF A;  3CIR A;  4BCQ D;  2XQ8 A;  2Q9Q A;  1N4M A;  3OBV E;  1W98 B;  2WMB B;  3OJA A;  1UGS B;  2E9X D;  3ESL A;  5GON E;  4B3R T;  5KDM C;  2JRK A;  3RQW A;  3L09 A;  4NXN T;  4ZZC A;  5ICP B;  2PG8 A;  4OB2 B;  5JTG A;  4U2Y A;  4TWD A;  4F7N B;  2CXF A;  3KV6 A;  5C3J A;  4B3S T;  3I0O A;  4C91 A;  3P4R A;  4EOK B;  5J0Z A;  2MOZ A;  4HLQ A;  4UR9 A;  3G33 B;  4CXA B;  4HGA A;  4DR4 T;  1VOM A;  2BKP A;  2QRX A;  3HL6 A;  3T1Y T;  5L2W B;  2WSS V;  4ZI7 E;  2OA5 A;  1XWM A;  3ZMV B;  1WR6 A;  4ZZB A;  3UUM A;  1H27 B;  3AVR A;  3A7M A;  2EUF A;  4BCK B;  4OB1 B;  5HBJ B;  5LOV E;  2I6H A;  1E9H B;  2IAK A;  3KVA A;  3TLU A;  2CM0 A;  4DO0 A;  3RC8 A;  4M1P A;  4AIS A;  3A8O B;  2VUR A;  4UEL A;  3ZCJ A;  3AE3 A;  3AE2 A;  2C5V B;  1WYB A;  4ZGE B;  1KFY A;  2G77 A;  2WCA A;  1FEW A;  5JRC A;  2C5I T;  2FJB A;  2XQ4 A;  4BCH B;  4MAL A;  2KZ7 B;  2M67 A;  1HR0 T;  2DWG A;  2JQQ A;  1XO2 A;  3MY5 B;  2V22 B;  1ZP0 A;  2VKH A;  4DUZ T;  4XZC A;  4YTP A;  3VKH A;  2CXL A;  5I5Z B;  2WS3 A;  2WPA B;  1H26 B;  2CHN A;  3SOL A;  3DDQ B;  2B1E A;  4QX8 B;  2CEA A;  3PUR A;  2CPT A;  4WYV A;  1LVK A;  5FVK A;  1OKV B;  1BR2 A;  5ADX L;  1ZEE A;  1GH6 B;  3QNU A;  2ZMA A;  3O1H A;  4HFH A;  4BCN D;  1YQ4 A;  4JI5 T;  3Q5D A;  5HWY A;  1J1J A;  4YT0 A;  3TLS A;  3ANW B;  3UQ7 A;  3EVY A;  4LMJ A;  4EEB A;  1UX5 A;  2XQ9 A;  2EHO B;  3RC3 A;  4K0U A;  3LK2 B;  5LBQ B;  1UCU A;  2ODV A;  1KNZ A;  3R6N A;  3HKE E;  2UXX B;  2DXC B;  3AED A;  2NW9 A;  1NEN A;  4FI5 A;  1NWM X;  3JC6 C;  1KEY A;  1UK5 A;  4Z91 A;  4HFI A;  4AQF A;  2UU9 T;  3V5U A;  2G9X B;  3NZQ A;  4BCJ B;  2V26 A;  3EJ1 B;  4OB0 B;  3RYC E;  4ILU A;  2YDQ A;  3CQG B;  3GMI A;  4IDQ A;  4DBQ A;  2IC6 A;  3ONJ A;  2LM2 A;  2DWK A;  3EDU A;  4OYJ A;  2RP4 A;  4FJO A;  3ZYK A;  4JV5 T;  4IIJ E;  1MIY A;  2E9X C;  3RH3 A;  2BG9 A;  4LML A;  3RGF B;  4EIW A;  2KIN B;  5F5W A;  4UEM A;  3IBP A;  4PJJ A;  3JC6 D;  5AQO B;  3L8R A;  2WEV B;  3PE0 A;  3VR9 A;  5LHH B;  4YY3 T;  5AQV B;  4WZX A;  4L5G A;  4KBM B;  2ZCF B;  2X0L B;  3C4W A;  4U31 A;  5LMU T;  1J5E T;  1V29 B;  4DR3 T;  2EHO C;  4ILB A;  4ZS2 A;  2HPL A;  1GUX A;  5HEO A;  2LHN A;  2WFY B;  3CKD A;  2LT3 A;  1W0B A;  3NVO A;  4CFX B;  5JR9 A;  1FIO A;  4OR5 B;  4U3C A;  2ODU A;  2X0Y A;  4HWH A;  1ZKE A;  5HXS A;  5DJQ C;  4HNU A;  1OGU B;  4LFA T;  4BJM A;  3QZ9 B;  3KBU A;  3Q5E A;  1YD8 G;  5DQW A;  3O9X A;  5FXW A;  3TLW A;  1MND A;  1YW0 A;  2XQ5 A;  4ZXL A;  2JGZ B;  4YJ3 E;  5JDQ A;  3AE7 A;  3O1J A;  1AJ3 A;  1XDO A;  2IW8 B;  4AIU A;  4DR5 T;  2XQA A;  4AQG A;  4YOS A;  5FL1 A;  2ZPG B;  3QYG B;  4HFV A;  2UXD T;  5JDG A;  4TN7 B;  1S94 A;  1JNZ A;  4KUM B;  5JVD E;  1HFA A;  1MMG A;  2NW8 A;  4ISS A;  4YOO A;  2K3W A;  4JX4 A;  2XJ7 A;  3ZN0 B;  4OB3 B;  4I43 B;  2WDR A;  4F6S B;  3ETV A;  4EAH A;  2ZM6 T;  4ZI2 D;  2JJ9 A;  3GA8 A;  4JI4 T;  4PW8 A;  1US7 B;  4EYU A;  2YOE A;  3CK6 A;  2IML A;  2LSI A;  2SPC A;  3DTO A;  2W62 A;  4HFE A;  4LF9 T;  4IDO A;  3QC9 A;  2OLT A;  5HCJ A;  5HEU A;  3AXJ B;  2BVM A;  1H1P B;  2MYS A;  5L4H A;  4IRE A;  3VU7 H;  3F31 A;  4IE0 A;  4AKH A;  4CXY A;  3LSV A;  3B5M A;  5HEG A;  2L9Q A;  2ACZ A;  3FZH B;  5FXV A;  5JRC B;  4F7J B;  5LHG B;  1KNP A;  5HXC A;  4HWF A;  4LF5 T;  3AE9 A;  2C6T B;  2PTF A;  1HS7 A;  4NUU A;  3Q2M A;  3I1A A;  2BKN A;  5J1G A;  2KWI B;  2WXV B;  4OGR B;  5LG3 A;  1E2A A;  2FJA A;  1URC B;  3GN5 A;  3IF8 B;  4IL4 A;  3RF1 A;  2H89 A;  4JI3 T;  3PU8 A;  2DD5 B;  4A97 A;  3RX6 A;  1G3N C;  4B3M T;  4EOM B;  4I4T E;  4G63 A;  4BCM B;  3O1I A;  4H9P C;  5AQQ B;  1WCR A;  3QHW B;  2E8I A;  1G8X A;  4EV6 A;  3ANW A;  4EB6 E;  1E7P A;  4AKL A;  3O4X E;  1UUR A;  4NXM T;  3ZCI A;  5FNV E;  1ZOY A;  1AIS B;  3L39 A;  2AE9 A;  3UUB A;  3IA3 A;  3RIU C;  1O9K B;  2BDE A;  2CCI B;  2AHJ B;  2IHR 1;  4EC9 B;  2RA1 A;  5FY1 A;  2QGS A;  3N5L A;  2XQ6 A;  2WDQ A;  4CRL B;  4EC8 B;  3ZN1 B;  5HWX A;  2VB6 A;  2W4X A;  4TV9 E;  3DDP B;  3ONL C;  2BBJ A;  2HPJ A;  3ZST A;  4X66 T;  2EHO D;  2VK9 A;  1MIV A;  4H9O C;  3AEG A;  3K8P C;  4JI7 T;  4PFO A;  1JST B;  3TLV A;  2D5U A;  3X20 B;  1N34 T;  3QYE A;  4O2A E;  1H4L D;  2ZM8 A;  1YKH B;  4JI1 T;  2JQH A;  4K0K T;  5JDM A;  2V7M A;  4Z6Y A;  4DR2 T;  4UIG A;  3ZJ2 A;  4YHH T;  1TFB A;  3M65 A;  2XAG B;  4DV1 T;  4LF7 T;  3LBX B;  1H1S B;  4Y72 B;  5LMK B;  2IIU A;  4BJN A;  3PUV F;  1KXU A;  5ABF A;  4HFB A;  2UXB T;  1DU2 A;  3P4S A;  4TWH A;  2KLQ A;  3RKG A;  2E9X B;  2DPP B;  1M7K A;  2VVS A;  3DOG B;  4AQF C;  2LM9 A;  4CFW B;  5L47 A;  4H9S E;  4UXN B;  4QXC B;  3ZEF B;  3UTK A;  3KV5 A;  4JYA T;  5C8Y E;  1QMZ B;  1KK7 A;  4ASK A;  3LDQ B;  5HAX A;  4X65 T;  3RIA A;  4HWD A;  3FZF B;  4EZ4 A;  1FVV B;  3H37 A;  3C64 A;  3N9P A;  4IST A;  1W09 A;  4JI2 T;  4LFC T;  3QXE B;  4BY1 X;  3TNH B;  4BAY B;  5JQG E;  3F5X B;  2I53 A;  2V7J A;  2XQY A;  3TNI B;  2BS4 A;  4UVA B;  2YU1 A;  4UF0 A;  3BHT B;  2W9F A;  1FKM A;  3SFE A;  4F70 B;  2X66 A;  4F6W B;  4BBR M;  1D1C A;  2KSR A;  2CA5 A;  4EOQ B;  4WBN E;  5HYA A;  1IBK T;  5CB4 E;  3BK9 A;  4I50 E;  2VKJ A;  3UUN A;  2WM9 A;  2JMH A;  5FKY A;  5CYI B;  4MIM A;  2XAJ B;  4BCO B;  4A98 A;  4P0B A;  3Q5X A;  4H9R C;  2W63 A;  4ROC A;  2WB5 A;  1OED C;  1OI9 B;  4LMK A;  1SUM B;  3KV4 A;  5JDF A;  5CFB A;  4UV9 B;  4U33 A;  4HFD A;  2B76 A;  4PNI A;  2V6Y B;  2E5L T;  3KIN B;  4LF8 T;  1KNR A;  3P4P A;  4YFS A;  4NPP A;  1SHZ C;  5LNK A;  2DL1 A;  2J62 A;  1OKW B;  2R6G F;  4CFU B;  2XZE A;  2PMI B;  4PFP A;  4O4L E;  2RPA A;  4GKK T;  1X79 A;  4U72 A;  3UU5 A;  1OL1 B;  4UN0 A;  2KT9 A;  4GK0 E;  1N33 T;  5AQM B;  1JKW A;  2D0T A;  4COF A;  3QK6 A;  3SFD A;  1P5E B;  4IDZ A;  2V5C A;  2KR6 A;  1CHU A;  5AQJ B;  3OVU A;  1WFD A;  2CZ1 B;  5AQK B;  4ZI3 C;  3P4W A;  1TD6 A;  4EOP B;  1E1H B;  3C98 B;  1YKE B;  2LSG A;  2UUC T;  3GTM S;  3RQU A;  3BLH B;  2X9Y A;  2C5J A;  2V7L A;  1KF6 A;  1X9B A;  3JCF A;  3DL1 A;  3B13 A;  5L3E B;  3M03 A;  2OV9 A;  2CJM B;  2D2S A;  3RYF E;  4HWC A;  2DLR A;  3O0G D;  3JAD A;  2QYW A;  5FVL A;  4JUY A;  3PJA J;  1OXZ A;  4ELL A;  4IT4 A;  3MY1 B;  3X28 B;  3CX6 B;  3UUX B;  2CZ0 B;  1OED B;  4CN6 A;  3OKQ A;  3TLT A;  1D0Z A;  3PTR B;  5FGK B;  1SA0 E;  4WBO A;  3PU3 A;  4QHO A;  2MBG A;  4QSH A;  4A56 A;  4BCM D;  5ABH A;  2ES0 A;  1IBL T;  2LKH A;  1PKD B;  4NST B;  2C5X B;  4ELJ A;  5IF1 B;  4HEA A;  5ABE A;  4AKI A;  3K3Q C;  4DR6 T;  5C2T A;  4JLE A;  2DI4 A;  4YC3 B;  2I59 A;  2YDR A;  5LQF B;  3HO8 A;  3NWI A;  3PUY F;  3FZK B;  2PK2 A;  3C4Z A;  4H9N C;  4Z8X A;  3LFM A;  1XNR T;  2JQK A;  4EOS B;  3FBZ A;  5L3C B;  2DHR A;  3B57 A;  5KMG P;  2LRL A;  3CML A;  1H25 B;  2ZPF B;  5CJ5 A;  5ETW A;  2LHR A;  1HNZ T;  1NAF A;  3E0Z A;  3ZT5 A;  1IZN B;  4BBS M;  4EOL B;  1UGR B;  2V1D B;  4YJ2 E;  4ZI2 C;  2UZB B;  1UUS A;  5L3B B;  2A3D A;  3P50 A;  2IN3 A;  3AB3 B;  3AXJ A;  5M4Y A;  4TUY E;  4B3T T;  2PK9 B;  4LOC A;  2E9X A;  3VRA A;  1YXR A;  4A5X A;  2YIN A;  5CA0 E;  3FHN A;  3G06 A;  3NKZ A;  3IEE A;  4IMY B;  2WP9 A;  4KI0 F;  4OFZ A;  2GK9 A;  1F5Q B;  4I55 E;  3PV0 F;  2I40 B;  2HH7 A;  5AQF B;  1R8I A;  4MFD A;  5TAO A;  2E2A A;  4ROD A;  4H63 V;  4DMW A;  3FXD B;  3QHR B;  3AEF A;  4CFN B;  2KND A;  4QXH B;  2UUE B;  4GKJ T;  3OTO T;  3PUW F;  2VVN A;  4CI1 B;  3X1D A;  3CQC B;  3KVB A;  3AE4 A;  1XZY A;  3AEB A;  2VQF T;  5JH7 E;  3VKG A;  3AE1 A;  3NRX A;  3QOF A;  5FY0 A;  3UFE A;  5FL0 A;  2NR4 A;  3LJC A;  2CWO A;  4DV4 T;  2LSJ A;  4CN1 A;  3SWH A;  1U5P A;  2PJQ A;  2WIP B;  2BG9 E;  1BR1 A;  3ZT7 A;  3RGL A;  3RI5 A;  4LFB T;  3EID B;  1VRB A;  2BVL A;  2WMN A;  3EAB A;  3WAK A;  2J47 A;  5LMN T;  4YHJ A;  4H63 H;  5HXH A;  3OYX A;  1XDP A;  4OYK A;  2L3L A;  1IJ5 A;  1V9D A;  2HN1 A;  1BR4 A;  2CBI A;  1N36 T;  2LRK A;  3N2G E;  5IYZ E;  4DV6 T;  2F4V T;  2ACX A;  4DV3 T;  2VL8 A;  1O9K A;  4NC6 A;  1I6Z A;  3K3N A;  3F57 A;  3KDS E;  2YN6 A;  2V6Y A;  5J2U E;  2WJ9 A;  1CUN A;  3HZJ A;  1Z8U A;  3AA6 B;  1MMD A;  2WWV A;  1OED E;  3VYH B;  4KMC A;  3KBT A;  4JBW F;  4X1Y E;  4PK4 A;  2W99 A;  2WY2 A;  4MFR A;  2KXP B;  3JAE A;  2C4G B;  3PUX F;  5AQL B;  4HNV A;  2UXC T;  4AQY T;  2IDO B;  5EK3 A;  5FXX A;  3JAF A;  4OX9 T;  1OIU B;  2NOX A;  4PJN A;  5AQS B;  2QA7 A;  3I9W A;  1JNR A;  4ROE A;  1ZP2 A;  1D1B A;  3HA4 A;  4BCI B;  1WLX A;  2ZPB B;  3QB5 A;  3AAI A;  4WW0 A;  4II5 B;  3AAE B;  3PUA A;  5HBE B;  3LBX A;  3LK3 B;  2QDJ A;  3WAJ A;  3AA7 B;  3TN8 B;  2KMF A;  4UVB B;  2UUB T;  1T98 A;  3N9L A;  3A8H B;  4GK5 E;  3J7Y q;  2A9U A;  2W66 A;  1H24 B;  2MAW A;  5J2T E;  3P4Q A;  3T8O A;  4CI2 B;  3HR0 A;  2WU2 A;  4PK5 A;  5AQG B;  5DQV A;  2H88 A;  2VL0 A;  4JEU B;  2YDS A;  4JX6 A;  2DXB B;  4H9Q C;  4DR7 T;  3CX8 B;  3SRZ A;  2IW9 B;  2MPK A;  3UU3 A;  3PUZ F;  1FMW A;  4G2A A;  3RPU A;  3X24 B;  4ANJ A;  3QYB A;  4AI6 A;  3C50 A;  5FY7 A;  2V5D A;  3FB2 A;  3RLF F;  2X68 A;  2IUB A;  5F3J A;  4UF0 B;  3F2E A;  2Q9Q C;  2ZPH B;  1HNX T;  4O2B E;  1FIN B;  2V7I A;  3BLR B;  2W00 A;  4X62 T;  3Q5W A;  3KHI A;  3ZMS B;  2Y6X A;  3T1H T;  2ZM0 A;  3UU8 A;  1SE7 A;  5LCY A;  3BQK A;  5EJC A;  4TV8 E;  4CXX A;  5BMV E;  5LP6 E;  4YLH A;  2BPM B;  2CLY B;  3C4X A;  3UQ4 A;  4KX6 A;  2P9B A;  2XM2 A;  3CPZ A;  4V1A v;  2CE7 A;  4ILA A;  2UXN B;  3ZKR A;  3H3A A;  4EOJ B;  3UT5 E;  1MIW A;  3Q9D A;  4HFC A;  4KRD B;  4EYY R;  2X51 A;  4LF6 T;  1XMO T;  4DV0 T;  2XM1 A;  3MIA B;  5JRE A;  1B7T A;  3ZMT B;  4U2Z A;  3BG9 A;  2D0Q B;  5LHI B;  3ZYL A;  5AQI B;  4ZS3 A;  5AQR B;  1G73 A;  3BHU B;  3BG5 A;  4KHZ F;  2WAU A;  4ILC A;  4YTN A;  4DBR A;  4I3Z B;  1BU2 A; 
#chains in the Genus database with same CATH homology
 3IBP A;  4PJJ A;  1E1H B;  3C98 B;  2MTQ A;  3JC6 D;  1BR0 A;  1HG2 A;  1YKE B;  2LSK A;  2LSG A;  2CCQ A;  3PE0 A;  3ETU A;  2EHO A;  2XAH B;  5LHH B;  3NZP A;  1WYC A;  2X9Y A;  2C5J A;  1IAP A;  3MKD A;  2V7L A;  4CZZ B;  4L5G A;  4KBM B;  3NRY A;  3B13 A;  3MK7 C;  5L3E B;  2X0L B;  3C4W A;  2D2S A;  4IE6 A;  3RYF E;  5LJM A;  2V7K A;  2DLR A;  3MJX A;  5H6R B;  4IE7 A;  4JUY A;  1OXZ A;  5LA6 E;  4TX5 A;  5E0O A;  4AXP A;  2EHO C;  1U4Q A;  4ZS2 A;  2HPL A;  3CX6 B;  3UUX B;  2LHN A;  2DCF A;  2C5K T;  5CA1 E;  5EK4 A;  3CKD A;  2LEH A;  2LT3 A;  3OKQ A;  4MHC A;  5JR9 A;  1FIO A;  1D0Z A;  5L3G B;  3PTR B;  4EZH A;  2XAQ B;  1D1A A;  4O4I E;  1UX4 A;  5LXT E;  1MMN A;  2ODU A;  1SA0 E;  4GYR A;  3ZMZ B;  4WBO A;  2WBL A;  2NP9 A;  3FBL A;  1ZKE A;  5HXS A;  5DJQ C;  3PU3 A;  4QHO A;  3PUQ A;  3D0T A;  4BJM A;  4L0R A;  2MBG A;  3KBU A;  4XBF B;  4P0A A;  2CMR A;  3E08 A;  5LGT B;  1HX8 A;  3P8C D;  4A56 A;  2ES0 A;  4C90 A;  1YD8 G;  4B6X A;  5DQW A;  3O9X A;  5FXW A;  1ZV4 X;  3CWZ B;  4P09 A;  1MND A;  1YW0 A;  4IE4 A;  3QUJ A;  1LVF A;  4YJ3 E;  3VHL A;  4HEA A;  5JDQ A;  3K3Q C;  4AKI A;  2VWA A;  3ZC0 A;  4JLE A;  2DI4 A;  2Q9Q D;  3O1J A;  5EZY E;  3ZJ1 A;  2I59 A;  1AJ3 A;  3LG7 A;  4HN9 A;  2KWH A;  3A5X A;  3DJB A;  1OWA A;  2X9X A;  4UV8 B;  4AQG A;  4GIW A;  4XAX B;  3C4Z A;  4H9N C;  4Z8X A;  3LFM A;  4HFV A;  5JDG A;  3FBZ A;  4TN7 B;  5L3C B;  1S94 A;  3B57 A;  2DHR A;  4KUM B;  4U74 A;  5JVD E;  1HFA A;  1HCI A;  1MMG A;  2NW8 A;  2G0U A;  5KMG P;  4ISS A;  3I9Y A;  4JEH B;  3ZN0 B;  3CML A;  4ZHQ E;  3WI3 A;  3J9X 1;  4I43 B;  3U78 A;  5JR9 B;  5ETW A;  2LHR A;  3ETV A;  4EAH A;  1NAF A;  1D0X A;  4EXT A;  4ZI2 D;  2JJ9 A;  3GA8 A;  4PW8 A;  4L9I A;  1US7 B;  3E0Z A;  4EYU A;  1IZN B;  3PDY A;  2LSI A;  4TZ4 C;  3UUL A;  2SPC A;  2V1D B;  2PFV A;  4YJ2 E;  4ZI2 C;  5LG4 A;  4WNK A;  3DTO A;  5L3B B;  2W62 A;  2A3D A;  1HTJ F;  3AB3 B;  1H7C A;  2YEV C;  3QC9 A;  2CXD A;  3SS1 A;  5M4Y A;  4TUY E;  2BVM A;  2E9X A;  4QWN B;  4UVC B;  2MYS A;  2K5B B;  4N78 D;  2CLY C;  3U3I A;  3VU7 H;  2A72 A;  3AVS A;  3TKL B;  3CQX C;  3F31 A;  2A2F X;  5A1L A;  2YIN A;  4IE0 A;  4AKH A;  5CA0 E;  4CXY A;  3HKC E;  3FHN A;  5KX5 E;  1Z0P A;  4X1K E;  2H7O A;  4ZI3 C;  3MXZ A;  2L9Q A;  2C0S A;  2Y8D A;  3IEE A;  4OFZ A;  2GK9 A;  3FXE B;  2WWU A;  5FXV A;  4IGU A;  4I55 E;  4DND A;  5JRC B;  2HH7 A;  3CX7 B;  2H3R A;  5LHG B;  5HXC A;  5TAO A;  2YU2 A;  4HE8 A;  3ZLI A;  4H63 V;  4DMW A;  1HS7 A;  2PBI A;  3GWH A;  3FXD B;  5H6Q B;  2KND A;  5IHY A;  4NUU A;  3Q2M A;  4GYS A;  4QXH B;  4IE5 A;  3V5S A;  1MNE A;  1LRZ A;  2K24 A;  3I1A A;  4PJL A;  5L3F B;  4ZI3 D;  5LGU B;  2Y48 B;  4CI1 B;  5J1G A;  2D0U A;  3CQC B;  2LOS A;  1Y64 B;  2KWI B;  2K9A A;  3KVB A;  5FYM A;  4E7S A;  5AFU L;  4O4H E;  3N9O A;  2IC9 A;  5LBM A;  4OK0 A;  3N9Q A;  5JH7 E;  3VKG A;  1ZHC A;  3NRX A;  4QX7 B;  3GN5 A;  3IF8 B;  1WRD A;  5FY0 A;  3UFE A;  2J1D G;  3LJC A;  2CWY A;  3PU8 A;  2CWO A;  2K48 A;  2LSJ A;  2W61 A;  1QSD A;  3HKD E;  5FMN A;  3SWH A;  4AKG A;  3RX6 A;  1U5P A;  2WMO A;  3L3P A;  3KFW X;  2NTY A;  2X9H A;  2PJQ A;  2ZLY A;  3AA0 B;  3C51 A;  2DNX A;  3N2O A;  4I4T E;  4PAG A;  1BR1 A;  5JDH A;  2JPF A;  2VAS A;  3RRC A;  4G63 A;  2N2N A;  3O1I A;  1VRB A;  2BVL A;  2WMN A;  4H9P C;  3BQI A;  2VKO A;  3BQL A;  3WAK A;  2N9D A;  4DVD A;  3AAA B;  4YHJ A;  4H63 H;  5HXH A;  2E8I A;  3OYX A;  4OYK A;  5L2L A;  1G8X A;  2L3L A;  1IJ5 A;  1V9D A;  3ANW A;  2ZM2 A;  4EB6 E;  3R84 B;  2LOP A;  3ONX A;  4AKL A;  4BA9 A;  1BR4 A;  2Q9Q A;  4J2C A;  2Q9Q B;  3O4X E;  3OBV E;  3ZCI A;  3N2G E;  5IYZ E;  4CQI A;  5FNV E;  5JDL A;  2L8K A;  2ACX A;  2W0G A;  2VL8 A;  3OJA A;  5LGN B;  2E9X D;  3ESL A;  3HI2 A;  2BDE A;  5GON E;  3K3N A;  4NUV A;  3RYI E;  4MLK A;  3F57 A;  1EZ3 A;  2XTL A;  1IJ6 A;  5F8P A;  2LJL A;  3KDS E;  2JRK A;  3CVR A;  4GOU A;  5KDM C;  2RA1 A;  5J2U E;  3L09 A;  5FY1 A;  2QGS A;  3N5L A;  1O3X A;  2PG8 A;  3ZN1 B;  1CUN A;  5HWX A;  2VB6 A;  3AA6 B;  1MMD A;  2CXF A;  3KV6 A;  4F6R C;  4X1I E;  4TV9 E;  4QXB B;  4KMC A;  3NBX X;  3KBT A;  4X1Y E;  3I0O A;  4MBQ A;  4C91 A;  2HPJ A;  4HKA A;  4PK4 A;  3GN5 B;  2EHO D;  2VK9 A;  3IHR A;  5JDN A;  4MFR A;  2KXP B;  3I0Q A;  1MIV A;  2LE8 A;  4H9O C;  4O8S A;  3AA1 B;  2MOZ A;  3K8P C;  4PFO A;  4PJM A;  5EK3 A;  5FXX A;  3ZMU B;  5DAB A;  2D5U A;  2NOX A;  4PJN A;  2IW5 B;  3EUH A;  4HGA A;  2QA7 A;  4O2A E;  3I9W A;  1VOM A;  2ZM8 A;  1S35 A;  1YKH B;  3K3O A;  5EK2 A;  2XHE B;  1D1B A;  3HA4 A;  3HL6 A;  5JDM A;  1WLX A;  4CI3 B;  2V7M A;  2WSS V;  2X67 A;  4ZOL E;  3ZC1 A;  4ZI7 E;  2OA5 A;  4UIG A;  3AAI A;  3ZJ2 A;  4WW0 A;  4ERR A;  3ZMV B;  1D0Y A;  1WR6 A;  3AAE B;  3M65 A;  3PUA A;  3UUM A;  3LBX A;  2XAG B;  3LK3 B;  3LBX B;  3MA9 A;  2VKD A;  3WAJ A;  3AA7 B;  4KP3 C;  5FP3 A;  3AVR A;  4DMV A;  4E7Z A;  4BJN A;  2KMF A;  5LOV E;  4UVB B;  1T98 A;  3N9L A;  2IAK A;  3KVA A;  2KLQ A;  2CM0 A;  4GK5 E;  3J7Y q;  2E9X B;  2NWB A;  4DO0 A;  4AQF C;  5J2T E;  2LM9 A;  3T8O A;  4CI2 B;  2XAS B;  3RC8 A;  4M1P A;  3HR0 A;  4PK5 A;  5DQV A;  4UEL A;  4H9S E;  4UXN B;  4QXC B;  3ZCJ A;  3ZEF B;  4JEU B;  3LK4 2;  3UTK A;  1WYB A;  3KV5 A;  4OHF A;  3ZPO A;  5HXR A;  4H9Q C;  5C8Y E;  3CX8 B;  1HF8 A;  4O4J E;  1FEW A;  5JRC A;  1KK7 A;  4ASK A;  2C5I T;  4MAL A;  3SRZ A;  2KZ7 B;  2M67 A;  2DWG A;  5HAX A;  2JQQ A;  1FMW A;  4G2A A;  2X9W A;  3RPU A;  4EZ4 A;  2VKH A;  3OYZ A;  4ANJ A;  4AI6 A;  3H37 A;  3C64 A;  3E22 E;  3N9P A;  3RRW A;  4IST A;  3C50 A;  3N2K E;  2NTX A;  4PK6 A;  4XZC A;  5FY7 A;  3VKH A;  2H7V C;  2XAF B;  2CXL A;  2N1G A;  3FB2 A;  2X68 A;  4BAY B;  5JQG E;  2V7J A;  2XQY A;  2XUE A;  3SOL A;  2B1E A;  4QX8 B;  5FXZ A;  2CEA A;  3PUR A;  5JR9 C;  4UVA B;  5F3J A;  1LVK A;  2YU1 A;  3F2E A;  4UF0 B;  2Q9Q C;  4UF0 A;  3DP7 A;  4CXW A;  3RYH E;  1BR2 A;  4O2B E;  5ADX L;  1ZEE A;  2X66 A;  3ZYM A;  2V7I A;  3MAC A;  2W00 A;  1LKX A;  3Q5W A;  2ZMA A;  3O1H A;  4X20 E;  3ZMS B;  1D1C A;  2Y6X A;  2YK0 A;  2ZM0 A;  2CA5 A;  1HG5 A;  5LJN A;  5HWY A;  4WBN E;  5HYA A;  1QUU A;  4AKR B;  5CB4 E;  3EDV A;  5LCY A;  3RKO A;  3BK9 A;  5L3D B;  4I50 E;  2VKJ A;  3BQK A;  4IHJ E;  3PUS A;  3ANW B;  3UUN A;  3EVY A;  2WM9 A;  4TV8 E;  2JMH A;  4CXX A;  5BMV E;  1UX5 A;  2XAJ B;  5LP6 E;  4YLH A;  2EHO B;  3HKB E;  2CLY B;  4K0U A;  4P0B A;  3RC3 A;  3LK2 B;  5LBQ B;  1UCU A;  3C4X A;  3Q5X A;  2ODV A;  4H9R C;  2W63 A;  5HXE A;  1KNZ A;  3R6N A;  2JMK A;  3HKE E;  2UXX B;  2NW9 A;  3KV9 A;  3KV4 A;  2BZB A;  2P9B A;  3CPZ A;  4V1A v;  4FI5 A;  1NWM X;  3JC6 C;  4HTE A;  2CE7 A;  5JDF A;  2UXN B;  4UV9 B;  5LYJ E;  4PNI A;  3H3A A;  2Z6E A;  3UT5 E;  4AQF A;  1MIW A;  3Q9D A;  4ADZ A;  4EYY R;  2NW7 A;  3V5U A;  2X51 A;  1MMA A;  3KIN B;  4QKN A;  3NZQ A;  2V26 A;  4EOZ B;  4YFS A;  5JRE A;  3RYC E;  1SHZ C;  1B7T A;  4ILU A;  3ZMT B;  3CQG B;  3GMI A;  5LNK A;  4DBQ A;  2IC6 A;  4PFP A;  4O4L E;  3P7I A;  2DWK A;  3EDU A;  3S4U A;  3MZK B;  4OYJ A;  2RP4 A;  4FJO A;  3ZYL A;  3ZYK A;  5LHI B;  2LSY A;  1X79 A;  4U72 A;  4ZS3 A;  3W15 B;  3N9N A;  2KT9 A;  4GK0 E;  1G73 A;  4IIJ E;  3PUG A;  1FMV A;  2D0T A;  3QK6 A;  4IDZ A;  2WAU A;  1MIY A;  2E9X C;  3RH3 A;  4DBR A;  4EIW A;  2KIN B;  3N9M A;  4UEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...