2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein lp_2664
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural genomics, unknown function
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
5DQVA 3DTOA 5IHYA 2QGSA 3B57A 2PJQA 3DJBA 5DQWA
chains in the Genus database with same CATH superfamily
4PAGA 2WIHB 2B76A 3BQIA 1LVKA 4IREA 2OLTA 5ABEA 5EK3A 5HEJA 4AI6A 2PHGA 4EORB 3A8GB 4MHCA 3ZMVB 3RIUC 2ACXA 4G6LB 2EUFA 3A7MA 3CQGB 3L3PA 3A8LB 5JTGA 5JRCA 3AEEA 5HYAA 1Y64B 3T1HT 3QB5K 3LK2B 3ANWB 2V1DB 4Z6YA 4LFCT 5LHIB 1F5QB 1WR0A 4K0UA 5HEUA 4AQYT 3N9NA 4H9OC 4ISSA 2C5IT 4EOOB 2CA5A 3LQ5B 2VQFT 4NUUA 2N9DA 3EJ1B 5CEIB 4CQIA 5IDNB 3SOLA 2A72A 3J9X1 1D1AA 2W66A 3H37A 1UNHD 2LSJA 2WDVA 5LMNT 5FNVE 4WYVA 2C0SA 5I5ZB 2WP9A 3ZKRA 1W98B 4BJMA 4OB1B 5F8PA 3TNHB 1SE7A 2LEHA 4OR5B 2KT9A 1YD8G 4QH1A 5IWAT 1ZHCA 4DV2T 5LJNA 2PBIA 3QHRB 5KX5E 2BG9A 4CFUD 2PFVA 5AQHB 1VINA 2UXBT 5BR8T 3RH3A 2XQ4A 4YC3B 2L3LA 2LRKA 4JYAT 3TLVA 4X1IE 3MI9B 4U7YA 5HEOA 3X26B 4I50E 3FZHB 3ZYMA 5AQSB 2BZBA 4UR9A 3P4WA 2L9QA 3A8YC 3O9XA 2DL1A 5JDNA 3T8OA 4IT4A 1AD6A 3KHIA 4BJNA 5J1GA 1IAPA 3M3ZB 4N78D 2DNXA 4DBRA 3QNUA 3HL6A 1KNZA 2PK9B 1UGSB 3AEAA 4IHJE 3HA4A 5ACBA 2KNDA 3AE4A 1XWMA 2LM9A 2M6BA 5JREA 4I43B 2Y8DA 2E8IA 5CYIB 3Q5XA 4ZS2A 4TWDA 3VR8A 4IE6A 4OYKA 5HWXA 4CFXB 2ACZA 1JSUB 3E0ZA 4LF4T 3CX6B 4NXNT 3HR0A 5LGTB 4LMKA 3M03A 2G77A 2ZM2A 3UTKA 1KFYA 4YOZA 2QGSA 2D5UA 1YKEB 3AAIA 5L3BB 4WNKA 2IW9B 5AQMB 3RPUA 4F6SB 1N33T 2LE8A 2YDQA 2CBJA 5JDMA 4ZGEB 4QX8B 2X9XA 3JAFA 2VKHA 4UXNB 3LDQB 3BHVB 4OGRB 1HS7A 4TNVA 2XAHB 2ODVA 2V7KA 4TN7B 4XAXB 5C3JA 2CZ1B 1D0YA 2E9XC 4WBNE 3B57A 2CJMB 4DR7T 4U2YA 1UK5A 5L4EA 3FB2A 2JQHA 5LYJE 1IREB 2E9XB 1JNRA 5LCYA 4B6XA 5FYMA 4B3RT 3H3MA 2LJLA 2W9ZA 2BKPA 2W62A 4EOMB 4GYRA 4DV6T 3TW7A 3I1AA 4EYYR 2K48A 4HKAA 2UUCT 3P4SA 1T7SA 3ONXA 2C5KT 4PJJA 3OYXA 1UURA 2VKDA 1FJGT 3RIAA 4ASKA 4BCOB 3IHRA 2UXDT 4E7ZA 2KXPB 4HN9A 3VKGA 2Y6XA 1XNQT 3AVRA 4B3TT 1V9DA 3MACA 4ELJA 5LA6E 3X1DA 2WY2A 1I94T 4X64T 5AQTB 2CWOA 5C2TA 5H6QB 3ZJ1A 2XAQB 2G9XB 3PJAA 3UU6A 5FVKA 2VASA 4EOLB 4PJNA 5JDFA 3GA8A 4DR6T 4UF0A 4JEHB 4U33A 5L3CB 3AAEB 3N9LA 4BCQD 1FVVB 3ANWA 5FKYA 1OL2B 3KV6A 2PJQA 3IF8B 5LMUT 2ZZDB 2BDEA 2CZ0B 3K3OA 3ZYKA 1WYCA 3GTMS 2UZDB 4QH4A 5IYZE 2WBLA 3UFEA 2I6HA 4A56A 2DWGA 5FXZA 4HWCA 5M4YA 3VRBA 4DR2T 1E9HB 4II5B 5L2LA 3MY1B 4PNIA 3CKDA 3JC6D 3CVRA 2QQ8A 4AQFC 5FXVA 1VYWB 2CCHB 4TWFA 3AE5A 1D1BA 2WIPB 1MMGA 5A1LA 4DR4T 3MZKB 3NRYA 4GK0E 4JUYA 3H3AA 3KV4A 2XM2A 2D0QB 1MMAA 5LG3A 4IE4A 3RYCE 3ONJA 1Z0PA 2I59A 2IW6B 4I3ZB 2OA5A 4IL4A 4ZZCA 3FXEB 4G63A 1OKVB 5FL1A 4ILUA 3RYFE 2UUBT 4H9NC 4CXYA 3FZFB 4BY1X 3ZJ2A 3ZMUB 4X65T 2JMHA 2XHEB 2X1NB 1J5WA 4WZXA 5FP3A 3N9QA 3KDSE 1T72A 1BR4A 2FJDA 2XJ7A 1H26B 3C4ZA 4IMYB 4H63H 2YU2A 4EAHA 2XZEA 1P5EB 1BU2A 1GH6B 1ZKEA 4QH5A 4U74A 2C5VB 4ZS3A 3OBVE 4BA9A 2VURA 2JIWA 2LSKA 4BCMB 5FY7A 1IJ6A 4HNUA 3MY5B 4JBWF 1AHJB 2PG8A 1YKHB 4LF9T 2KWIB 1GUXB 1XNRT 1H1SB 2DMEA 3A8MB 3QC9A 1US7B 1W09A 1N4MA 2K24A 2WB5A 4XBFB 2LRLA 3K1SA 1O3XA 4EYUA 4YLHA 5EFQB 4ILAA 2LKGA 4YJ3E 4JEUB 2WHBB 3EVYA 1OWAA 4GOUA 4CN4A 3HI2A 4KBMB 2IIUA 1WRDA 4V1Av 4ADZA 2KWHA 3QYGB 2ZPFB 3L09A 3ABVA 2D0UA 2YU1A 4F7JB 4KRDB 5JDGA 5LBMA 2E9XA 2WXVB 2CBIA 4M1PA 5AQUB 4YTMA 3TNIB 4UVCB 4YTPA 1H25B 3LK3B 5DABA 3K8PC 3CWZB 2K9AA 2QDYB 2E5LT 3UT5E 3OYZA 3I9WA 3C64A 2I0MA 4H9SE 5DJQC 3M65A 2H89A 5JQGE 3Q2MA 1XO2A 1O9KB 5HEHA 5HXRA 2MBGA 1H1PB 5AQRB 1X9BA 3MA9A 5CGMA 1QUUA 4YHHT 2CRBA 5LOVE 3BQKA 2CXDA 4HFDA 3F31A 3RC3A 4HNTA 4IDPA 4TWHA 4U2ZA 1SHZC 5L4HA 2DXCB 3BLHB 3N9MA 1G73A 4KUMB 3C51A 2IDOB 3BLRB 4JI3T 2KMGA 1HNXT 5HVYB 3AE3A 4Z91A 4GK5E 2C5JA 2LW4A 1OGUB 2NWBA 2K3WA 3AECA 4HWHA 5HBHB 4JI1T 4O4IE 5EZYE 2PTFA 4XZCA 2QVAA 3T1YT 2LM2A 1BR0A 2X9YA 2RP4A 4FI5A 2KSRA 4CFMB 4KHPT 2HHHT 5KMGP 2V7MA 2YINA 2ZCFB 4OB3B 2GK9A 4TNWA 4EOIB 1ZP2A 3X24B 1MNEA 4I55E 3HBLA 4HGAA 4BCJB 3PUZF 3MXZA 4EEBA 3RI5A 2WSSV 4UIGA 1N36T 1YQ4A 2WAUA 1V29B 1IZNB 4AQFA 4PFPA 2WDQA 3NVOA 2Q9QD 4U7IA 2X9HA 3QWLA 5KDMC 3SS1A 4BCNB 2BBJA 3O0GD 4EOPB 1E2AA 4C91A 1HX8A 3AXJA 4ROCA 3VYGB 1SUMB 2DCFA 2R7GA 3B13A 2E9XD 5AQOB 2DLRA 2FJBA 5ABFB 3MKDA 3SFEA 4B3ST 3ZT7A 3F5XB 2QYWA 2LSGA 5FGKB 2F2CA 2J47A 4EOKB 3QB5A 5LNKA 2CWYA 5HWYA 2DI4A 2IN3A 4HFVA 4KMCA 4HTEA 5CA0E 4ISTA 3P4RA 4IE5A 3C4XA 1CHUA 4CXXA 3U78A 1S94A 2EHOC 5LXTE 1U5PA 3RKOA 3CQXC 2WPAB 3O1JA 2EHOB 2VKJA 5FVLA 3ZT6A 4EV6A 3L8RA 2W2UA 4AIUA 1GUXA 3CPZA 3UQ7A 4ZZBA 3TLUA 3DTOA 3CIRA 5LGUB 4MFRA 4DV0T 2P9BA 1UCUA 2DWKA 2M6IA 5L3GB 4BY7X 3FZKB 4YT0A 4EZ4A 3E08A 2XQ9A 4NSTB 4DNDA 5LG4A 3E22E 3HZJA 5JDLA 3WVEB 4O2BE 2CXLA 4CFWB 4EB6E 3TLTA 2WDRA 2YN6A 1OEDC 1KEYA 2G0UA 3UQ4A 4GYSA 2CZ7B 2BBHA 3ETVA 4ZI3C 4FJOA 4QXCB 5HQ0B 1OEDB 3KINB 3AEFA 2VKOA 1GQEA 3SFDA 4NUVA 4F6WB 1VCTA 1WFDA 3B5MA 4DV4T 3R84B 1OKWB 3BQLA 1H24B 1WLXA 1UGPB 4BCGB 3EDVA 4O4LE 4LF7T 4G2AA 4OHFA 3H4CA 5EJCA 1O9KA 4KX6A 2QF7A 2ZLYA 5BNJB 4ELLA 1H7CA 3EOCB 2XQ3A 3ZMTB 4UV9B 2QRXA 2E5VA 4UVAB 4EGWA 4YFSA 4KI0F 1WCRA 4HEAA 4JI8T 2VVSA 1T98A 4CI1B 3EABA 1YW0A 2IW5B 4HNVA 4LMJA 3IEEA 3AA0B 3RC8A 3FBZA 4QHOA 2A9UA 1XDOA 2W2HA 2BS3A 2LLYA 4MBQA 3DP7A 1ZEEA 3JADA 5LP6E 3V5UA 2LHNA 5EK2A 2CHOA 4IGUA 4AKIA 3DJBA 2RA1A 1OIUB 3VKHA 4LMLA 5HAXA 4EC8B 4YOSA 3RF1A 2FBWA 4CFUB 4GIWA 1FEWA 1E7PA 3RKGA 1XMQT 2H88A 2R6GF 3PURA 2M67A 3UU5A 3NBXX 3ZSSA 4C90A 1HNWT 3HKDE 2I40B 1VRBA 3TLSA 4F70B 5HXHA 4BAYB 3RQWA 3RIUA 4IDOA 4YXDA 5HCJA 1OEDE 1EZ3A 3O1HA 5LHHB 1UNGD 5AQGB 4H9QC 2IAKA 4A5XA 5JDHA 2MYSA 2L8KA 4F7LB 2FJEA 3S4UA 5J2TE 2N2NA 3O1IA 4JI4T 2CM0A 4X62T 2UZBB 1VOLA 2UXCT 4AISA 3LG7A 5HBEB 2OV9A 3UUMA 4DUYT 1JNZA 3WAKA 4IIJE 2VWAA 4HFBA 4KP3C 3V5SA 1H4LD 1YXRA 2YDRA 3QYHB 5ABFA 3ETUA 3MJXA 5HNBB 5J2UE 4H9RC 1QMZB 1TFBA 4MIMA 2V7IA 1D1CA 3GN5B 3DDPB 1OIYB 1QSDA 4X20E 1FIOA 3TN8B 4A97A 4YOOA 3ZCIA 4TV9E 1HG2A 3N5LA 4IDNA 1ZV4X 5LBQB 3AEBA 4ANJA 1D0XA 2KINB 3X25B 5LJMA 4AKRB 4GKJT 2EHOA 2B9RA 4ILCA 2XAGB 2ES0A 2WMNA 2V7JA 4O4JE 3LBXB 2YK0A 4X5TA 4K0KT 3BHTB 3C4WA 3WVDB 4HFEA 1OXZA 3AEGA 3TNWB 2F4VT 2XY8B 3Q5DA 2X51A 3PUYF 3RIFA 2KR6A 4ZEYA 4L9IA 1Y01A 3EUHA 3QUJA 3A5XA 3CQCB 5L2WB 2JQQA 2AE9A 4AKLA 2CEAA 5AQJB 4ZGJB 3MIAB 3Q9DA 3UFGA 2IUBA 4AKGA 3AE2A 3BK9A 2JJ9A 3EIDB 2NW9A 3ZC1A 2LOSA 1NENA 5KXJA 5F3JA 2CZ6B 2Y48B 2V8SV 1OEDA 1E1HB 4JX4A 2J4GA 4FM4B 4PK5A 3AVSA 4ZOLE 3GWHA 4JI7T 2V22B 3UU3A 3QYEA 4BCQB 4A98A 1KF6A 5AQQB 3P4PA 3K7AM 4YSYA 4YSZA 5EK4A 3ZYLA 4PW8A 2VVNA 4DVDA 4PK4A 3RYHE 1S35A 3NZPA 2NP9A 4YHJA 4OFZA 3LFMA 2WM9A 2YKSA 2V6YB 4BCND 2XTLA 4EOQB 2X9WA 3OVUA 3QYBA 3VU7H 1N32T 2CLYC 3UU4A 3DL1A 2C5OB 5HXSA 2WZIA 2HN2A 2V5CA 2CLYB 4OK0A 1HFAA 3ZSTA 3ONLC 3PUWF 2XQAA 2X0HA 4NC6A 4M6VA 1G3NC 4Q25A 2UUEB 2DD4B 2LSYA 3RX6A 3FBLA 3ESLA 4LF8T 2WU5A 3RQUA 4LFBT 3F2EA 2IVXA 2X0YA 1IBMT 4DV3T 3KFWX 4AQGA 4DO0A 1PKDB 1UGOA 4UN0A 2ZM0A 3KVBA 3PU8A 3LK42 3UU8A 4Z90A 1KK7A 2EHOD 4QSHA 1QLBA 2MAWA 5ICPB 2NR4A 3CX7B 5AQPB 3QHWB 2W0GA 4CN6A 3AE9A 4X1KE 5CB4E 4CFNB 4AKHA 4I4TE 3HKCE 3PJAJ 5FXWA 2CXFA 2BVLA 1R8IA 1HCIA 4CI2B 5J0ZA 2BPMB 3NRXA 4JLEA 3FZMB 4DR1T 4YTNA 3HKEE 4LFAT 3N9PA 3O4XE 3N2KE 4DIDB 4UVBB 1KNRA 5JH7E 4CFVB 1LRZA 1FMVA 4BCHB 2ODUA 4P1NA 2D9DA 2QDJA 5L47A 4HFCA 4ILBA 4RODA 4MLKA 2H7VC 3PUVF 4O8SA 3NDQA 1IBKT 4NPPA 3OTOT 3SWHA 2A3DA 5E0OA 4B3MT 2W63A 1VCSA 3KVAA 4ZI3D 4UF0B 1MMNA 3GN5A 4CZZB 1CUNA 3CK6A 1M7KA 3RRCA 2WMOA 2LSIA 2IC6A 3MK7C 1MMDA 3N2OA 4I0UA 1MIVA 3N9OA 3IA3A 3AA6B 3KV5A 1WR6A 4CXWA 2C5NB 3EAMA 4O4HE 4IL9A 2ZM6T 2LHRA 2DPPB 4QKNA 2HH7A 4DV5T 4BCFB 5LQFB 3LJCA 3KBUA 3SRZA 4ROEA 1KNPA 1VOMA 5LMKB 3HKBE 3LBXA 3P4QA 4L0RA 2WWVA 3R6NA 3CMLA 5H6RB 2DD5B 4MALA 4YY3T 3PU3A 4HWDA 4JX5A 2D2SA 4U31A 4HL4A 3EHZA 1HTJF 5C8YE 2D0TA 2NW7A 3FHNA 5ABHA 4ZI2C 3PUSA 5IUXA 3AE7A 3JAEA 2JQ9A 3WAJA 4JV5T 1LKXA 3ZCJA 2XSAA 2HN1A 3BG5A 4BBSM 3CX8B 2PK2A 2W4XA 2BKZB 2ZPHB 1J5ET 3QZ5B 2ZPBB 3K3NA 3D0TA 2H7OA 1ENWA 4E7SA 2CCQA 3UUBA 1WYBA 4GKKT 3EDUA 4JI0T 4BCKB 1UX4A 5AQNB 3OJAA 2YEVC 3PUXF 4UV8B 4LOCA 2WQYA 5L3FB 3QXEB 2LKHA 4DBQA 3RHWA 3BLQB 1M62A 2W99A 2E2AA 2VQET 4F6UB 4YJ2E 3FZLB 5JVDE 1D0ZA 3TW6A 3F57A 3PUAA 3ZEFB 5JR9C 4Z8XA 2V6YA 2IW8B 2JRKA 1NEKA 5HCMA 2K5BB 5JR9B 2WJ9A 3W15B 1AISB 4TTHA 2V7LA 4IE0A 2NTYA 1XDPA 3ZN0B 2IC9A 4FX3B 3I0OA 3BG9A 1NAFA 2X67A 2Q9QC 2YDSA 4EC9B 5JDQA 5CFBA 3JCFA 4COFA 3KBTA 1JSTB 3HB9A 2LOPA 4EOZB 3OKQA 3X20B 2CHNA 4J2CA 5L3EB 2Q9QB 2UUAT 4CRLB 3PUGA 2PMIB 2KZ7B 2MTQA 4PK6A 3AE8A 3U3IA 2I53A 2FJAA 1J1JA 2ZMAA 1JKWA 1C9BA 2XQ7A 1UNLD 3PV0F 4Y72B 2VK9A 1MIYA 5AQFB 4QXHB 3PE0A 2WWUA 2XM1A 5AFUL 2XAFB 3FXDB 3L39A 5AQKB 2ZM8A 2X66A 3QK6A 2V5DA 3I0QA 5CJ5A 4EEDA 2X68A 4EXTA 3AB3B 2VL8A 1DU2A 4EZHA 2JPFA 5LHGB 3POMA 4DUZT 4AXPA 2DHRA 3G06A 1UX5A 3I9YA 4HFHA 2CCIB 4F8HA 3AE6A 5ADXL 1IBLT 5GONE 2W00A 4HWIB 4BCMD 3UULA 4MFEA 2WU2A 1G8XA 5ETWA 4ERRA 3PUQA 4KRCB 3PDYA 2CYZB 2QFZA 4BCPB 3LSVA 3A8HB 2NTXA 2BVMA 1H28B 3VRAA 4HLQA 4MFDA 3RGLA 5LGNB 4P0AA 4UELA 4EOSB 1H1RB 4DMWA 1HG5A 1OL1B 3RGFB 4IDQA 2IMLA 3VYHB 3X28B 1H1QB 3HO8A 2AXDS 3IBPA 3ZPOA 1FKMA 5FY0A 4H9PC 4U3CA 4JI6T 2W9FA 2BS4A 1I6ZA 1HNZT 3DDQB 4TV8E 4EONB 1H27B 4X1YE 2XAJB 2JGZB 4ZHQE 2H3RA 4BXXX 2JQKA 2V6XA 3VHLA 4F6RC 4OX9T 5AQLB 3PTRB 5JRCB 4UEMA 2C6TB 3P7IA 5HEGA 5IHYA 4DR5T 3Q5WA 3RLFF 2XQ8A 3Q5EA 1SA0E 1JOWA 2MPKA 4KHZF 5HBJB 3NWIA 4NXMT 3C50A 1LVFA 1IJ5A 1MNDA 4CN1A 1GY3B 1BR2A 2YOEA 3AE1A 2C5XB 4OB2B 4JI2T 3TKLB 2NOXA 3K3QC 5FXXA 3ZT5A 2WEVB 3KV9A 4OYJA 4ZI7E 5DQWA 1NWMX 2C4GB 2UXXB 3UUNA 4EOJB 4TUYE 3BHUB 3AXJB 5AQVB 2KMFA 4QX7B 2JMKA 3J7Yq 4O2AE 2BS2A 2BG9C 2XQYA 2AHJB 2QA7A 2A2FX 1ZOYA 2CE7A 2SPCA 1T8BA 4QWNB 3AAAB 4LF5T 3ZLIA 4BBRM 1BR1A 2MOZA 2BG9B 3AEDA 2WMAB 4HE8A 4CI3B 2XSBA 4WBOA 1UGQB 1YQ3A 2FUPA 1TD6A 5DQVA 2XUEA 2ZPGB 5FL0A 1U4QA 2ZPIB 1XMOT 5HXCA 5FMNA 4BCIB 2XPKA 2KLQA 2BKNA 2W67A 4DV1T 4QXBB 5FY1A 1UUSA 4OB0B 2IHR1 3C98B 5JR9A 4JX6A 4HWFA 2HPLA 5ABGA 2Z6EA 1AJ3A 1UGRB 4DR3T 4WW0A 3ZMZB 3RYIE 1N34T 2BKOA 2WCAA 3AA1B 2ZPEB 1KXUA 1HX1B 4U72A 5TAOA 3AA7B 2N1GA 2WS3A 3OPCA 4JI5T 3A8OB 2XQ6A 3P50A 3ZC0A 2Q9QA 1W0BA 5F5WA 2V26A 5L3DB 1FMWA 3ZMSB 3JC6C 1ZP0A 4DV7T 2CMRA 1MIWA 2UXNB 4PJMA 2LT3A 1W9RA 1URCB 4NIQA 5IDPB 4CXAB 3P8CD 2J1DG 2CPTA 3GMIA 2HPJA 2W61A 2XQ5A 4LF6T 2RPAA 4H63V 4YSXA 4F7SB 2XASB 2W96A 4F7NB 4PJLA 1D3UB 2B1EA 4TX5A 5HXEA 1B7TA 2WMBB 5CA1E 3HHTB 2UZLB 3QOFA 4ZXLA 2NW8A 2WFYB 3EI0A 4PFOA 4HFIA 4P0BA 2WZHA 4DMVA 3NKZA 3UUXB 5AQIB 2VL0A 1HF8A 4X66T 4L5GA 1FINB 2BG9E 1W0AA 2UU9T 3BG3A 4ZI2D 1OI9B 3G33B 4IDZA 3NZQA 3N2GE 3WI3A 5IF1B 2J62A 1L0VA 3TLWA 3ZN1B 1HR0T 2X0LB 4TZ4C 3DOGB 1Z8UA 1XZYA 3PO3S 4P09A 3VR9A 5LB7B 3QZ9B 4ZGDB 3RRWA 5BMVE 4EIWA 4IE7A 2DXBB 2VB6A 1X79A 2UZEB
chains in the Genus database with same CATH topology
2LSKA 4UV8B 4BAYB 5HXHA 4PAGA 5FY7A 1IJ6A 3BQIA 5L3FB 1LVKA 4DBQA 1EZ3A 3O1HA 2PG8A 1YKHB 2KWIB 5EK3A 5LHHB 3QC9A 1US7B 4AI6A 4H9QC 2IAKA 4YJ2E 2K24A 4XBFB 4MHCA 3ZMVB 5JVDE 1D0ZA 5JDHA 2MYSA 1O3XA 4EYUA 4YLHA 2L8KA 2ACXA 3F57A 3PUAA 4YJ3E 3S4UA 5J2TE 4JEUB 3ZEFB 2N2NA 3O1IA 3EVYA 5JR9C 1OWAA 4Z8XA 2CM0A 4GOUA 3L3PA 3CQGB 3HI2A 2JRKA 5JRCA 4KBMB 5HYAA 1Y64B 1WRDA 2K5BB 3LG7A 5JR9B 4V1Av 3W15B 3LK2B 2V7LA 3ANWB 3UUMA 4IE0A 2NTYA 2V1DB 3WAKA 3ZN0B 4ADZA 2KWHA 4IIJE 5LHIB 2VWAA 3L09A 2D0UA 2IC9A 2YU1A 4KP3C 3I0OA 3V5SA 1NAFA 2X67A 2Q9QC 5JDQA 4K0UA 3ETUA 5JDGA 3KBTA 5LBMA 2E9XA 3N9NA 3MJXA 4H9OC 4ISSA 2LOPA 4EOZB 2C5IT 3OKQA 2CA5A 4M1PA 5J2UE 4H9RC 4J2CA 5L3EB 2Q9QB 2V7IA 4NUUA 1D1CA 2N9DA 3GN5B 4CQIA 3PUGA 4UVCB 3SOLA 2KZ7B 2A72A 2MTQA 4PK6A 1D1AA 3J9X1 3U3IA 1QSDA 4X20E 1FIOA 3LK3B 3H37A 5DABA 3K8PC 2ZMAA 3CWZB 2LSJA 3ZCIA 2K9AA 5FNVE 4TV9E 3UT5E 2C0SA 2VK9A 3OYZA 1MIYA 1HG2A 3I9WA 3C64A 4H9SE 4QXHB 3N5LA 5DJQC 1ZV4X 3M65A 4BJMA 5JQGE 5LBQB 3Q2MA 5F8PA 3PE0A 4ANJA 2WWUA 5AFUL 2LEHA 5HXRA 2KT9A 1D0XA 2XAFB 3FXDB 1YD8G 2ZM8A 2MBGA 2KINB 5LJMA 4AKRB 2X66A 1ZHCA 3QK6A 2EHOA 3MA9A 1QUUA 3I0QA 5LJNA 2PBIA 2XAGB 5KX5E 2ES0A 5LOVE 2X68A 2WMNA 2CXDA 2V7JA 3BQKA 4O4JE 4EXTA 3LBXB 2PFVA 3F31A 2YK0A 3AB3B 3RC3A 2VL8A 4EZHA 2JPFA 3RH3A 5LHGB 1SHZC 4AXPA 2L3LA 2DHRA 3C4WA 3N9MA 4X1IE 1G73A 4KUMB 3C51A 1UX5A 3I9YA 4I50E 3ZYMA 5ADXL 1OXZA 5GONE 2BZBA 2L9QA 3O9XA 2W00A 4GK5E 2C5JA 2X51A 3T8OA 3UULA 5JDNA 4L9IA 4BJNA 5J1GA 3EUHA 2NWBA 1IAPA 3QUJA 3A5XA 3CQCB 2JQQA 1G8XA 4O4IE 5ETWA 4N78D 4AKLA 2CEAA 5EZYE 4ERRA 3Q9DA 2DNXA 4XZCA 4DBRA 3PUQA 4AKGA 3PDYA 3HL6A 1BR0A 2X9YA 3BK9A 1KNZA 2JJ9A 2NW9A 2NTXA 2BVMA 3ZC1A 2RP4A 4IHJE 3HA4A 4FI5A 5LGNB 2LOSA 4P0AA 4UELA 2KNDA 5F3JA 2Y48B 2LM9A 4DMWA 1HG5A 1E1HB 5JREA 5KMGP 2V7MA 2YINA 4PK5A 4I43B 2Y8DA 3AVSA 2E8IA 4ZOLE 2GK9A 3GWHA 3IBPA 3ZPOA 3Q5XA 1MNEA 4I55E 4ZS2A 5FY0A 4H9PC 4IE6A 4OYKA 4HGAA 5HWXA 3E0ZA 3MXZA 5EK4A 3CX6B 2WSSV 3ZYLA 4UIGA 4PW8A 2WAUA 4TV8E 3HR0A 5LGTB 1IZNB 4DVDA 2ZM2A 4PK4A 4AQFA 4X1YE 3UTKA 3RYHE 1S35A 4PFPA 2XAJB 4ZHQE 3NZPA 2QGSA 2D5UA 1YKEB 2H3RA 2NP9A 3AAIA 3LFMA 4OFZA 2WM9A 4WNKA 4YHJA 5L3BB 2Q9QD 3RPUA 3VHLA 4F6RC 2LE8A 2X9HA 2XTLA 3PTRB 5JRCB 4UEMA 2X9WA 5KDMC 5JDMA 3P7IA 4QX8B 3VU7H 2X9XA 5IHYA 3SS1A 2VKHA 4UXNB 2CLYC 3Q5WA 1HS7A 2XAHB 4C91A 2ODVA 2V7KA 5HXSA 4TN7B 4XAXB 1SA0E 1HX8A 1D0YA 2E9XC 4WBNE 3B57A 2CLYB 2DCFA 4OK0A 1HFAA 3B13A 3C50A 1LVFA 2E9XD 1IJ5A 3FB2A 2DLRA 1MNDA 5LYJE 1BR2A 3MKDA 2E9XB 5LCYA 4B6XA 5FYMA 2LJLA 3TKLB 2NOXA 2LSGA 2W62A 3K3QC 5FXXA 4OYJA 3KV9A 4GYRA 2LSYA 3RX6A 3FBLA 4ZI7E 5DQWA 5LNKA 1NWMX 2CWYA 3ESLA 3I1AA 5HWYA 2K48A 2UXXB 3UUNA 4HKAA 4EYYR 2DI4A 4HFVA 4KMCA 4HTEA 4TUYE 3F2EA 5CA0E 4ISTA 3ONXA 2C5KT 4IE5A 3C4XA 3KFWX 4CXXA 3U78A 4PJJA 1S94A 3OYXA 4AQGA 4DO0A 2KMFA 4QX7B 2EHOC 2VKDA 2ZM0A 3KVBA 5LXTE 1U5PA 2JMKA 3PU8A 3LK42 3RKOA 3J7Yq 4O2AE 4ASKA 3CQXC 3O1JA 1KK7A 2EHOD 2XQYA 3IHRA 2QA7A 2A2FX 4E7ZA 2KXPB 3CX7B 2CE7A 2SPCA 4HN9A 3VKGA 2EHOB 2VKJA 2Y6XA 3AVRA 4QWNB 3AAAB 3ZLIA 1BR1A 1V9DA 2MOZA 3MACA 5LA6E 2W0GA 4X1KE 3CPZA 4HE8A 5CB4E 4CI3B 4WBOA 2CWOA 4AKHA 4I4TE 5H6QB 3HKCE 3ZJ1A 5DQVA 3DTOA 2XAQB 2XUEA 5FXWA 2CXFA 2BVLA 5LGUB 1U4QA 4MFRA 1HCIA 4CI2B 3NRXA 2P9BA 4JLEA 1UCUA 5HXCA 5FMNA 2DWKA 2VASA 2KLQA 3HKEE 4PJNA 5JDFA 5L3GB 3N9PA 3O4XE 3N2KE 3GA8A 4QXBB 4UF0A 5FY1A 4JEHB 4EZ4A 5L3CB 4UVBB 3AAEB 3C98B 5JR9A 5JH7E 3N9LA 2HPLA 3E08A 1LRZA 3ANWA 1FMVA 2ODUA 3KV6A 4DNDA 2PJQA 2Z6EA 3IF8B 5LG4A 3E22E 1AJ3A 5JDLA 4WW0A 2BDEA 3K3OA 3ZMZB 3RYIE 3ZYKA 4MLKA 4O2BE 2CXLA 4EB6E 2H7VC 1WYCA 4O8SA 3AA1B 4U72A 5TAOA 2G0UA 5IYZE 3AA7B 2N1GA 4GYSA 2WBLA 3ETVA 4ZI3C 3UFEA 4A56A 3SWHA 2A3DA 2DWGA 5E0OA 4FJOA 5FXZA 2W63A 3ZC0A 4QXCB 5M4YA 3KVAA 4ZI3D 2Q9QA 3KINB 4UF0B 1MMNA 2VKOA 3GN5A 2V26A 5L3DB 1FMWA 4NUVA 3JC6C 3ZMSB 4CZZB 5L2LA 2CMRA 1CUNA 1MIWA 2UXNB 4PJMA 4PNIA 3CKDA 3R84B 2LT3A 2WMOA 3RRCA 3JC6D 2LSIA 3BQLA 2IC6A 3CVRA 3MK7C 1MMDA 1WLXA 3EDVA 3N2OA 4O4LE 4AQFC 1MIVA 3N9OA 5FXVA 4G2AA 3P8CD 2J1DG 3GMIA 3AA6B 2HPJA 2W61A 3KV5A 1WR6A 4OHFA 1D1BA 4CXWA 4H63V 1MMGA 4O4HE 2LHRA 2XASB 5A1LA 3MZKB 4QKNA 2HH7A 3NRYA 4PJLA 2B1EA 4TX5A 5HXEA 4GK0E 1B7TA 2ZLYA 5CA1E 4JUYA 3LJCA 3H3AA 3KBUA 3SRZA 1H7CA 3KV4A 3ZMTB 4UV9B 2NW8A 1VOMA 3HKBE 1MMAA 3LBXA 4UVAB 4PFOA 4L0RA 4P0BA 4IE4A 4YFSA 3R6NA 3RYCE 4HEAA 4DMVA 3CMLA 3UUXB 5H6RB 1Z0PA 2I59A 4MALA 1HF8A 1T98A 3PU3A 4CI1B 2OA5A 2D2SA 4L5GA 1YW0A 2IW5B 1HTJF 5C8YE 2D0TA 2NW7A 3FXEB 4G63A 3FHNA 3IEEA 4ILUA 3RYFE 4ZI2C 3AA0B 3RC8A 3PUSA 3FBZA 4H9NC 4QHOA 4CXYA 4ZI2D 3ZJ2A 4MBQA 3DP7A 4IDZA 3WAJA 3ZMUB 3NZQA 1ZEEA 5LP6E 3V5UA 2JMHA 2LHNA 2XHEB 1LKXA 3N2GE 3WI3A 3ZCJA 5EK2A 4IGUA 2RA1A 3DJBA 3ZN1B 4AKIA 5FP3A 2X0LB 3VKHA 3N9QA 4TZ4C 3CX8B 3KDSE 5HAXA 4GIWA 1BR4A 1FEWA 4P09A 3C4ZA 4H63H 2YU2A 3K3NA 3RRWA 4EAHA 3D0TA 2H7OA 3PURA 2M67A 4E7SA 3NBXX 5BMVE 2CCQA 4EIWA 1WYBA 4IE7A 4C90A 1ZKEA 3EDUA 3HKDE 1UX4A 1VRBA 4U74A 2VB6A 4ZS3A 3OBVE 4BA9A 1X79A 3OJAA 2YEVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQV A;  3DTO A;  5IHY A;  2QGS A;  3B57 A;  2PJQ A;  3DJB A;  5DQW A; 
#chains in the Genus database with same CATH topology
 4PAG A;  2WIH B;  2B76 A;  3BQI A;  1LVK A;  4IRE A;  2OLT A;  5ABE A;  5EK3 A;  5HEJ A;  4AI6 A;  2PHG A;  4EOR B;  3A8G B;  4MHC A;  3ZMV B;  3RIU C;  2ACX A;  4G6L B;  2EUF A;  3A7M A;  3CQG B;  3L3P A;  3A8L B;  5JTG A;  5JRC A;  3AEE A;  5HYA A;  1Y64 B;  3T1H T;  3QB5 K;  3LK2 B;  3ANW B;  2V1D B;  4Z6Y A;  4LFC T;  5LHI B;  1F5Q B;  1WR0 A;  4K0U A;  5HEU A;  4AQY T;  3N9N A;  4H9O C;  4ISS A;  2C5I T;  4EOO B;  2CA5 A;  3LQ5 B;  2VQF T;  4NUU A;  2N9D A;  3EJ1 B;  5CEI B;  4CQI A;  5IDN B;  3SOL A;  2A72 A;  3J9X 1;  1D1A A;  2W66 A;  3H37 A;  1UNH D;  2LSJ A;  2WDV A;  5LMN T;  5FNV E;  4WYV A;  2C0S A;  5I5Z B;  2WP9 A;  3ZKR A;  1W98 B;  4BJM A;  4OB1 B;  5F8P A;  3TNH B;  1SE7 A;  2LEH A;  4OR5 B;  2KT9 A;  1YD8 G;  4QH1 A;  5IWA T;  1ZHC A;  4DV2 T;  5LJN A;  2PBI A;  3QHR B;  5KX5 E;  2BG9 A;  4CFU D;  2PFV A;  5AQH B;  1VIN A;  2UXB T;  5BR8 T;  3RH3 A;  2XQ4 A;  4YC3 B;  2L3L A;  2LRK A;  4JYA T;  3TLV A;  4X1I E;  3MI9 B;  4U7Y A;  5HEO A;  3X26 B;  4I50 E;  3FZH B;  3ZYM A;  5AQS B;  2BZB A;  4UR9 A;  3P4W A;  2L9Q A;  3A8Y C;  3O9X A;  2DL1 A;  5JDN A;  3T8O A;  4IT4 A;  1AD6 A;  3KHI A;  4BJN A;  5J1G A;  1IAP A;  3M3Z B;  4N78 D;  2DNX A;  4DBR A;  3QNU A;  3HL6 A;  1KNZ A;  2PK9 B;  1UGS B;  3AEA A;  4IHJ E;  3HA4 A;  5ACB A;  2KND A;  3AE4 A;  1XWM A;  2LM9 A;  2M6B A;  5JRE A;  4I43 B;  2Y8D A;  2E8I A;  5CYI B;  3Q5X A;  4ZS2 A;  4TWD A;  3VR8 A;  4IE6 A;  4OYK A;  5HWX A;  4CFX B;  2ACZ A;  1JSU B;  3E0Z A;  4LF4 T;  3CX6 B;  4NXN T;  3HR0 A;  5LGT B;  4LMK A;  3M03 A;  2G77 A;  2ZM2 A;  3UTK A;  1KFY A;  4YOZ A;  2QGS A;  2D5U A;  1YKE B;  3AAI A;  5L3B B;  4WNK A;  2IW9 B;  5AQM B;  3RPU A;  4F6S B;  1N33 T;  2LE8 A;  2YDQ A;  2CBJ A;  5JDM A;  4ZGE B;  4QX8 B;  2X9X A;  3JAF A;  2VKH A;  4UXN B;  3LDQ B;  3BHV B;  4OGR B;  1HS7 A;  4TNV A;  2XAH B;  2ODV A;  2V7K A;  4TN7 B;  4XAX B;  5C3J A;  2CZ1 B;  1D0Y A;  2E9X C;  4WBN E;  3B57 A;  2CJM B;  4DR7 T;  4U2Y A;  1UK5 A;  5L4E A;  3FB2 A;  2JQH A;  5LYJ E;  1IRE B;  2E9X B;  1JNR A;  5LCY A;  4B6X A;  5FYM A;  4B3R T;  3H3M A;  2LJL A;  2W9Z A;  2BKP A;  2W62 A;  4EOM B;  4GYR A;  4DV6 T;  3TW7 A;  3I1A A;  4EYY R;  2K48 A;  4HKA A;  2UUC T;  3P4S A;  1T7S A;  3ONX A;  2C5K T;  4PJJ A;  3OYX A;  1UUR A;  2VKD A;  1FJG T;  3RIA A;  4ASK A;  4BCO B;  3IHR A;  2UXD T;  4E7Z A;  2KXP B;  4HN9 A;  3VKG A;  2Y6X A;  1XNQ T;  3AVR A;  4B3T T;  1V9D A;  3MAC A;  4ELJ A;  5LA6 E;  3X1D A;  2WY2 A;  1I94 T;  4X64 T;  5AQT B;  2CWO A;  5C2T A;  5H6Q B;  3ZJ1 A;  2XAQ B;  2G9X B;  3PJA A;  3UU6 A;  5FVK A;  2VAS A;  4EOL B;  4PJN A;  5JDF A;  3GA8 A;  4DR6 T;  4UF0 A;  4JEH B;  4U33 A;  5L3C B;  3AAE B;  3N9L A;  4BCQ D;  1FVV B;  3ANW A;  5FKY A;  1OL2 B;  3KV6 A;  2PJQ A;  3IF8 B;  5LMU T;  2ZZD B;  2BDE A;  2CZ0 B;  3K3O A;  3ZYK A;  1WYC A;  3GTM S;  2UZD B;  4QH4 A;  5IYZ E;  2WBL A;  3UFE A;  2I6H A;  4A56 A;  2DWG A;  5FXZ A;  4HWC A;  5M4Y A;  3VRB A;  4DR2 T;  1E9H B;  4II5 B;  5L2L A;  3MY1 B;  4PNI A;  3CKD A;  3JC6 D;  3CVR A;  2QQ8 A;  4AQF C;  5FXV A;  1VYW B;  2CCH B;  4TWF A;  3AE5 A;  1D1B A;  2WIP B;  1MMG A;  5A1L A;  4DR4 T;  3MZK B;  3NRY A;  4GK0 E;  4JUY A;  3H3A A;  3KV4 A;  2XM2 A;  2D0Q B;  1MMA A;  5LG3 A;  4IE4 A;  3RYC E;  3ONJ A;  1Z0P A;  2I59 A;  2IW6 B;  4I3Z B;  2OA5 A;  4IL4 A;  4ZZC A;  3FXE B;  4G63 A;  1OKV B;  5FL1 A;  4ILU A;  3RYF E;  2UUB T;  4H9N C;  4CXY A;  3FZF B;  4BY1 X;  3ZJ2 A;  3ZMU B;  4X65 T;  2JMH A;  2XHE B;  2X1N B;  1J5W A;  4WZX A;  5FP3 A;  3N9Q A;  3KDS E;  1T72 A;  1BR4 A;  2FJD A;  2XJ7 A;  1H26 B;  3C4Z A;  4IMY B;  4H63 H;  2YU2 A;  4EAH A;  2XZE A;  1P5E B;  1BU2 A;  1GH6 B;  1ZKE A;  4QH5 A;  4U74 A;  2C5V B;  4ZS3 A;  3OBV E;  4BA9 A;  2VUR A;  2JIW A;  2LSK A;  4BCM B;  5FY7 A;  1IJ6 A;  4HNU A;  3MY5 B;  4JBW F;  1AHJ B;  2PG8 A;  1YKH B;  4LF9 T;  2KWI B;  1GUX B;  1XNR T;  1H1S B;  2DME A;  3A8M B;  3QC9 A;  1US7 B;  1W09 A;  1N4M A;  2K24 A;  2WB5 A;  4XBF B;  2LRL A;  3K1S A;  1O3X A;  4EYU A;  4YLH A;  5EFQ B;  4ILA A;  2LKG A;  4YJ3 E;  4JEU B;  2WHB B;  3EVY A;  1OWA A;  4GOU A;  4CN4 A;  3HI2 A;  4KBM B;  2IIU A;  1WRD A;  4V1A v;  4ADZ A;  2KWH A;  3QYG B;  2ZPF B;  3L09 A;  3ABV A;  2D0U A;  2YU1 A;  4F7J B;  4KRD B;  5JDG A;  5LBM A;  2E9X A;  2WXV B;  2CBI A;  4M1P A;  5AQU B;  4YTM A;  3TNI B;  4UVC B;  4YTP A;  1H25 B;  3LK3 B;  5DAB A;  3K8P C;  3CWZ B;  2K9A A;  2QDY B;  2E5L T;  3UT5 E;  3OYZ A;  3I9W A;  3C64 A;  2I0M A;  4H9S E;  5DJQ C;  3M65 A;  2H89 A;  5JQG E;  3Q2M A;  1XO2 A;  1O9K B;  5HEH A;  5HXR A;  2MBG A;  1H1P B;  5AQR B;  1X9B A;  3MA9 A;  5CGM A;  1QUU A;  4YHH T;  2CRB A;  5LOV E;  3BQK A;  2CXD A;  4HFD A;  3F31 A;  3RC3 A;  4HNT A;  4IDP A;  4TWH A;  4U2Z A;  1SHZ C;  5L4H A;  2DXC B;  3BLH B;  3N9M A;  1G73 A;  4KUM B;  3C51 A;  2IDO B;  3BLR B;  4JI3 T;  2KMG A;  1HNX T;  5HVY B;  3AE3 A;  4Z91 A;  4GK5 E;  2C5J A;  2LW4 A;  1OGU B;  2NWB A;  2K3W A;  3AEC A;  4HWH A;  5HBH B;  4JI1 T;  4O4I E;  5EZY E;  2PTF A;  4XZC A;  2QVA A;  3T1Y T;  2LM2 A;  1BR0 A;  2X9Y A;  2RP4 A;  4FI5 A;  2KSR A;  4CFM B;  4KHP T;  2HHH T;  5KMG P;  2V7M A;  2YIN A;  2ZCF B;  4OB3 B;  2GK9 A;  4TNW A;  4EOI B;  1ZP2 A;  3X24 B;  1MNE A;  4I55 E;  3HBL A;  4HGA A;  4BCJ B;  3PUZ F;  3MXZ A;  4EEB A;  3RI5 A;  2WSS V;  4UIG A;  1N36 T;  1YQ4 A;  2WAU A;  1V29 B;  1IZN B;  4AQF A;  4PFP A;  2WDQ A;  3NVO A;  2Q9Q D;  4U7I A;  2X9H A;  3QWL A;  5KDM C;  3SS1 A;  4BCN B;  2BBJ A;  3O0G D;  4EOP B;  1E2A A;  4C91 A;  1HX8 A;  3AXJ A;  4ROC A;  3VYG B;  1SUM B;  2DCF A;  2R7G A;  3B13 A;  2E9X D;  5AQO B;  2DLR A;  2FJB A;  5ABF B;  3MKD A;  3SFE A;  4B3S T;  3ZT7 A;  3F5X B;  2QYW A;  2LSG A;  5FGK B;  2F2C A;  2J47 A;  4EOK B;  3QB5 A;  5LNK A;  2CWY A;  5HWY A;  2DI4 A;  2IN3 A;  4HFV A;  4KMC A;  4HTE A;  5CA0 E;  4IST A;  3P4R A;  4IE5 A;  3C4X A;  1CHU A;  4CXX A;  3U78 A;  1S94 A;  2EHO C;  5LXT E;  1U5P A;  3RKO A;  3CQX C;  2WPA B;  3O1J A;  2EHO B;  2VKJ A;  5FVL A;  3ZT6 A;  4EV6 A;  3L8R A;  2W2U A;  4AIU A;  1GUX A;  3CPZ A;  3UQ7 A;  4ZZB A;  3TLU A;  3DTO A;  3CIR A;  5LGU B;  4MFR A;  4DV0 T;  2P9B A;  1UCU A;  2DWK A;  2M6I A;  5L3G B;  4BY7 X;  3FZK B;  4YT0 A;  4EZ4 A;  3E08 A;  2XQ9 A;  4NST B;  4DND A;  5LG4 A;  3E22 E;  3HZJ A;  5JDL A;  3WVE B;  4O2B E;  2CXL A;  4CFW B;  4EB6 E;  3TLT A;  2WDR A;  2YN6 A;  1OED C;  1KEY A;  2G0U A;  3UQ4 A;  4GYS A;  2CZ7 B;  2BBH A;  3ETV A;  4ZI3 C;  4FJO A;  4QXC B;  5HQ0 B;  1OED B;  3KIN B;  3AEF A;  2VKO A;  1GQE A;  3SFD A;  4NUV A;  4F6W B;  1VCT A;  1WFD A;  3B5M A;  4DV4 T;  3R84 B;  1OKW B;  3BQL A;  1H24 B;  1WLX A;  1UGP B;  4BCG B;  3EDV A;  4O4L E;  4LF7 T;  4G2A A;  4OHF A;  3H4C A;  5EJC A;  1O9K A;  4KX6 A;  2QF7 A;  2ZLY A;  5BNJ B;  4ELL A;  1H7C A;  3EOC B;  2XQ3 A;  3ZMT B;  4UV9 B;  2QRX A;  2E5V A;  4UVA B;  4EGW A;  4YFS A;  4KI0 F;  1WCR A;  4HEA A;  4JI8 T;  2VVS A;  1T98 A;  4CI1 B;  3EAB A;  1YW0 A;  2IW5 B;  4HNV A;  4LMJ A;  3IEE A;  3AA0 B;  3RC8 A;  3FBZ A;  4QHO A;  2A9U A;  1XDO A;  2W2H A;  2BS3 A;  2LLY A;  4MBQ A;  3DP7 A;  1ZEE A;  3JAD A;  5LP6 E;  3V5U A;  2LHN A;  5EK2 A;  2CHO A;  4IGU A;  4AKI A;  3DJB A;  2RA1 A;  1OIU B;  3VKH A;  4LML A;  5HAX A;  4EC8 B;  4YOS A;  3RF1 A;  2FBW A;  4CFU B;  4GIW A;  1FEW A;  1E7P A;  3RKG A;  1XMQ T;  2H88 A;  2R6G F;  3PUR A;  2M67 A;  3UU5 A;  3NBX X;  3ZSS A;  4C90 A;  1HNW T;  3HKD E;  2I40 B;  1VRB A;  3TLS A;  4F70 B;  5HXH A;  4BAY B;  3RQW A;  3RIU A;  4IDO A;  4YXD A;  5HCJ A;  1OED E;  1EZ3 A;  3O1H A;  5LHH B;  1UNG D;  5AQG B;  4H9Q C;  2IAK A;  4A5X A;  5JDH A;  2MYS A;  2L8K A;  4F7L B;  2FJE A;  3S4U A;  5J2T E;  2N2N A;  3O1I A;  4JI4 T;  2CM0 A;  4X62 T;  2UZB B;  1VOL A;  2UXC T;  4AIS A;  3LG7 A;  5HBE B;  2OV9 A;  3UUM A;  4DUY T;  1JNZ A;  3WAK A;  4IIJ E;  2VWA A;  4HFB A;  4KP3 C;  3V5S A;  1H4L D;  1YXR A;  2YDR A;  3QYH B;  5ABF A;  3ETU A;  3MJX A;  5HNB B;  5J2U E;  4H9R C;  1QMZ B;  1TFB A;  4MIM A;  2V7I A;  1D1C A;  3GN5 B;  3DDP B;  1OIY B;  1QSD A;  4X20 E;  1FIO A;  3TN8 B;  4A97 A;  4YOO A;  3ZCI A;  4TV9 E;  1HG2 A;  3N5L A;  4IDN A;  1ZV4 X;  5LBQ B;  3AEB A;  4ANJ A;  1D0X A;  2KIN B;  3X25 B;  5LJM A;  4AKR B;  4GKJ T;  2EHO A;  2B9R A;  4ILC A;  2XAG B;  2ES0 A;  2WMN A;  2V7J A;  4O4J E;  3LBX B;  2YK0 A;  4X5T A;  4K0K T;  3BHT B;  3C4W A;  3WVD B;  4HFE A;  1OXZ A;  3AEG A;  3TNW B;  2F4V T;  2XY8 B;  3Q5D A;  2X51 A;  3PUY F;  3RIF A;  2KR6 A;  4ZEY A;  4L9I A;  1Y01 A;  3EUH A;  3QUJ A;  3A5X A;  3CQC B;  5L2W B;  2JQQ A;  2AE9 A;  4AKL A;  2CEA A;  5AQJ B;  4ZGJ B;  3MIA B;  3Q9D A;  3UFG A;  2IUB A;  4AKG A;  3AE2 A;  3BK9 A;  2JJ9 A;  3EID B;  2NW9 A;  3ZC1 A;  2LOS A;  1NEN A;  5KXJ A;  5F3J A;  2CZ6 B;  2Y48 B;  2V8S V;  1OED A;  1E1H B;  4JX4 A;  2J4G A;  4FM4 B;  4PK5 A;  3AVS A;  4ZOL E;  3GWH A;  4JI7 T;  2V22 B;  3UU3 A;  3QYE A;  4BCQ B;  4A98 A;  1KF6 A;  5AQQ B;  3P4P A;  3K7A M;  4YSY A;  4YSZ A;  5EK4 A;  3ZYL A;  4PW8 A;  2VVN A;  4DVD A;  4PK4 A;  3RYH E;  1S35 A;  3NZP A;  2NP9 A;  4YHJ A;  4OFZ A;  3LFM A;  2WM9 A;  2YKS A;  2V6Y B;  4BCN D;  2XTL A;  4EOQ B;  2X9W A;  3OVU A;  3QYB A;  3VU7 H;  1N32 T;  2CLY C;  3UU4 A;  3DL1 A;  2C5O B;  5HXS A;  2WZI A;  2HN2 A;  2V5C A;  2CLY B;  4OK0 A;  1HFA A;  3ZST A;  3ONL C;  3PUW F;  2XQA A;  2X0H A;  4NC6 A;  4M6V A;  1G3N C;  4Q25 A;  2UUE B;  2DD4 B;  2LSY A;  3RX6 A;  3FBL A;  3ESL A;  4LF8 T;  2WU5 A;  3RQU A;  4LFB T;  3F2E A;  2IVX A;  2X0Y A;  1IBM T;  4DV3 T;  3KFW X;  4AQG A;  4DO0 A;  1PKD B;  1UGO A;  4UN0 A;  2ZM0 A;  3KVB A;  3PU8 A;  3LK4 2;  3UU8 A;  4Z90 A;  1KK7 A;  2EHO D;  4QSH A;  1QLB A;  2MAW A;  5ICP B;  2NR4 A;  3CX7 B;  5AQP B;  3QHW B;  2W0G A;  4CN6 A;  3AE9 A;  4X1K E;  5CB4 E;  4CFN B;  4AKH A;  4I4T E;  3HKC E;  3PJA J;  5FXW A;  2CXF A;  2BVL A;  1R8I A;  1HCI A;  4CI2 B;  5J0Z A;  2BPM B;  3NRX A;  4JLE A;  3FZM B;  4DR1 T;  4YTN A;  3HKE E;  4LFA T;  3N9P A;  3O4X E;  3N2K E;  4DID B;  4UVB B;  1KNR A;  5JH7 E;  4CFV B;  1LRZ A;  1FMV A;  4BCH B;  2ODU A;  4P1N A;  2D9D A;  2QDJ A;  5L47 A;  4HFC A;  4ILB A;  4ROD A;  4MLK A;  2H7V C;  3PUV F;  4O8S A;  3NDQ A;  1IBK T;  4NPP A;  3OTO T;  3SWH A;  2A3D A;  5E0O A;  4B3M T;  2W63 A;  1VCS A;  3KVA A;  4ZI3 D;  4UF0 B;  1MMN A;  3GN5 A;  4CZZ B;  1CUN A;  3CK6 A;  1M7K A;  3RRC A;  2WMO A;  2LSI A;  2IC6 A;  3MK7 C;  1MMD A;  3N2O A;  4I0U A;  1MIV A;  3N9O A;  3IA3 A;  3AA6 B;  3KV5 A;  1WR6 A;  4CXW A;  2C5N B;  3EAM A;  4O4H E;  4IL9 A;  2ZM6 T;  2LHR A;  2DPP B;  4QKN A;  2HH7 A;  4DV5 T;  4BCF B;  5LQF B;  3LJC A;  3KBU A;  3SRZ A;  4ROE A;  1KNP A;  1VOM A;  5LMK B;  3HKB E;  3LBX A;  3P4Q A;  4L0R A;  2WWV A;  3R6N A;  3CML A;  5H6R B;  2DD5 B;  4MAL A;  4YY3 T;  3PU3 A;  4HWD A;  4JX5 A;  2D2S A;  4U31 A;  4HL4 A;  3EHZ A;  1HTJ F;  5C8Y E;  2D0T A;  2NW7 A;  3FHN A;  5ABH A;  4ZI2 C;  3PUS A;  5IUX A;  3AE7 A;  3JAE A;  2JQ9 A;  3WAJ A;  4JV5 T;  1LKX A;  3ZCJ A;  2XSA A;  2HN1 A;  3BG5 A;  4BBS M;  3CX8 B;  2PK2 A;  2W4X A;  2BKZ B;  2ZPH B;  1J5E T;  3QZ5 B;  2ZPB B;  3K3N A;  3D0T A;  2H7O A;  1ENW A;  4E7S A;  2CCQ A;  3UUB A;  1WYB A;  4GKK T;  3EDU A;  4JI0 T;  4BCK B;  1UX4 A;  5AQN B;  3OJA A;  2YEV C;  3PUX F;  4UV8 B;  4LOC A;  2WQY A;  5L3F B;  3QXE B;  2LKH A;  4DBQ A;  3RHW A;  3BLQ B;  1M62 A;  2W99 A;  2E2A A;  2VQE T;  4F6U B;  4YJ2 E;  3FZL B;  5JVD E;  1D0Z A;  3TW6 A;  3F57 A;  3PUA A;  3ZEF B;  5JR9 C;  4Z8X A;  2V6Y A;  2IW8 B;  2JRK A;  1NEK A;  5HCM A;  2K5B B;  5JR9 B;  2WJ9 A;  3W15 B;  1AIS B;  4TTH A;  2V7L A;  4IE0 A;  2NTY A;  1XDP A;  3ZN0 B;  2IC9 A;  4FX3 B;  3I0O A;  3BG9 A;  1NAF A;  2X67 A;  2Q9Q C;  2YDS A;  4EC9 B;  5JDQ A;  5CFB A;  3JCF A;  4COF A;  3KBT A;  1JST B;  3HB9 A;  2LOP A;  4EOZ B;  3OKQ A;  3X20 B;  2CHN A;  4J2C A;  5L3E B;  2Q9Q B;  2UUA T;  4CRL B;  3PUG A;  2PMI B;  2KZ7 B;  2MTQ A;  4PK6 A;  3AE8 A;  3U3I A;  2I53 A;  2FJA A;  1J1J A;  2ZMA A;  1JKW A;  1C9B A;  2XQ7 A;  1UNL D;  3PV0 F;  4Y72 B;  2VK9 A;  1MIY A;  5AQF B;  4QXH B;  3PE0 A;  2WWU A;  2XM1 A;  5AFU L;  2XAF B;  3FXD B;  3L39 A;  5AQK B;  2ZM8 A;  2X66 A;  3QK6 A;  2V5D A;  3I0Q A;  5CJ5 A;  4EED A;  2X68 A;  4EXT A;  3AB3 B;  2VL8 A;  1DU2 A;  4EZH A;  2JPF A;  5LHG B;  3POM A;  4DUZ T;  4AXP A;  2DHR A;  3G06 A;  1UX5 A;  3I9Y A;  4HFH A;  2CCI B;  4F8H A;  3AE6 A;  5ADX L;  1IBL T;  5GON E;  2W00 A;  4HWI B;  4BCM D;  3UUL A;  4MFE A;  2WU2 A;  1G8X A;  5ETW A;  4ERR A;  3PUQ A;  4KRC B;  3PDY A;  2CYZ B;  2QFZ A;  4BCP B;  3LSV A;  3A8H B;  2NTX A;  2BVM A;  1H28 B;  3VRA A;  4HLQ A;  4MFD A;  3RGL A;  5LGN B;  4P0A A;  4UEL A;  4EOS B;  1H1R B;  4DMW A;  1HG5 A;  1OL1 B;  3RGF B;  4IDQ A;  2IML A;  3VYH B;  3X28 B;  1H1Q B;  3HO8 A;  2AXD S;  3IBP A;  3ZPO A;  1FKM A;  5FY0 A;  4H9P C;  4U3C A;  4JI6 T;  2W9F A;  2BS4 A;  1I6Z A;  1HNZ T;  3DDQ B;  4TV8 E;  4EON B;  1H27 B;  4X1Y E;  2XAJ B;  2JGZ B;  4ZHQ E;  2H3R A;  4BXX X;  2JQK A;  2V6X A;  3VHL A;  4F6R C;  4OX9 T;  5AQL B;  3PTR B;  5JRC B;  4UEM A;  2C6T B;  3P7I A;  5HEG A;  5IHY A;  4DR5 T;  3Q5W A;  3RLF F;  2XQ8 A;  3Q5E A;  1SA0 E;  1JOW A;  2MPK A;  4KHZ F;  5HBJ B;  3NWI A;  4NXM T;  3C50 A;  1LVF A;  1IJ5 A;  1MND A;  4CN1 A;  1GY3 B;  1BR2 A;  2YOE A;  3AE1 A;  2C5X B;  4OB2 B;  4JI2 T;  3TKL B;  2NOX A;  3K3Q C;  5FXX A;  3ZT5 A;  2WEV B;  3KV9 A;  4OYJ A;  4ZI7 E;  5DQW A;  1NWM X;  2C4G B;  2UXX B;  3UUN A;  4EOJ B;  4TUY E;  3BHU B;  3AXJ B;  5AQV B;  2KMF A;  4QX7 B;  2JMK A;  3J7Y q;  4O2A E;  2BS2 A;  2BG9 C;  2XQY A;  2AHJ B;  2QA7 A;  2A2F X;  1ZOY A;  2CE7 A;  2SPC A;  1T8B A;  4QWN B;  3AAA B;  4LF5 T;  3ZLI A;  4BBR M;  1BR1 A;  2MOZ A;  2BG9 B;  3AED A;  2WMA B;  4HE8 A;  4CI3 B;  2XSB A;  4WBO A;  1UGQ B;  1YQ3 A;  2FUP A;  1TD6 A;  5DQV A;  2XUE A;  2ZPG B;  5FL0 A;  1U4Q A;  2ZPI B;  1XMO T;  5HXC A;  5FMN A;  4BCI B;  2XPK A;  2KLQ A;  2BKN A;  2W67 A;  4DV1 T;  4QXB B;  5FY1 A;  1UUS A;  4OB0 B;  2IHR 1;  3C98 B;  5JR9 A;  4JX6 A;  4HWF A;  2HPL A;  5ABG A;  2Z6E A;  1AJ3 A;  1UGR B;  4DR3 T;  4WW0 A;  3ZMZ B;  3RYI E;  1N34 T;  2BKO A;  2WCA A;  3AA1 B;  2ZPE B;  1KXU A;  1HX1 B;  4U72 A;  5TAO A;  3AA7 B;  2N1G A;  2WS3 A;  3OPC A;  4JI5 T;  3A8O B;  2XQ6 A;  3P50 A;  3ZC0 A;  2Q9Q A;  1W0B A;  5F5W A;  2V26 A;  5L3D B;  1FMW A;  3ZMS B;  3JC6 C;  1ZP0 A;  4DV7 T;  2CMR A;  1MIW A;  2UXN B;  4PJM A;  2LT3 A;  1W9R A;  1URC B;  4NIQ A;  5IDP B;  4CXA B;  3P8C D;  2J1D G;  2CPT A;  3GMI A;  2HPJ A;  2W61 A;  2XQ5 A;  4LF6 T;  2RPA A;  4H63 V;  4YSX A;  4F7S B;  2XAS B;  2W96 A;  4F7N B;  4PJL A;  1D3U B;  2B1E A;  4TX5 A;  5HXE A;  1B7T A;  2WMB B;  5CA1 E;  3HHT B;  2UZL B;  3QOF A;  4ZXL A;  2NW8 A;  2WFY B;  3EI0 A;  4PFO A;  4HFI A;  4P0B A;  2WZH A;  4DMV A;  3NKZ A;  3UUX B;  5AQI B;  2VL0 A;  1HF8 A;  4X66 T;  4L5G A;  1FIN B;  2BG9 E;  1W0A A;  2UU9 T;  3BG3 A;  4ZI2 D;  1OI9 B;  3G33 B;  4IDZ A;  3NZQ A;  3N2G E;  3WI3 A;  5IF1 B;  2J62 A;  1L0V A;  3TLW A;  3ZN1 B;  1HR0 T;  2X0L B;  4TZ4 C;  3DOG B;  1Z8U A;  1XZY A;  3PO3 S;  4P09 A;  3VR9 A;  5LB7 B;  3QZ9 B;  4ZGD B;  3RRW A;  5BMV E;  4EIW A;  4IE7 A;  2DXB B;  2VB6 A;  1X79 A;  2UZE B; 
#chains in the Genus database with same CATH homology
 2LSK A;  4UV8 B;  4BAY B;  5HXH A;  4PAG A;  5FY7 A;  1IJ6 A;  3BQI A;  5L3F B;  1LVK A;  4DBQ A;  1EZ3 A;  3O1H A;  2PG8 A;  1YKH B;  2KWI B;  5EK3 A;  5LHH B;  3QC9 A;  1US7 B;  4AI6 A;  4H9Q C;  2IAK A;  4YJ2 E;  2K24 A;  4XBF B;  4MHC A;  3ZMV B;  5JVD E;  1D0Z A;  5JDH A;  2MYS A;  1O3X A;  4EYU A;  4YLH A;  2L8K A;  2ACX A;  3F57 A;  3PUA A;  4YJ3 E;  3S4U A;  5J2T E;  4JEU B;  3ZEF B;  2N2N A;  3O1I A;  3EVY A;  5JR9 C;  1OWA A;  4Z8X A;  2CM0 A;  4GOU A;  3L3P A;  3CQG B;  3HI2 A;  2JRK A;  5JRC A;  4KBM B;  5HYA A;  1Y64 B;  1WRD A;  2K5B B;  3LG7 A;  5JR9 B;  4V1A v;  3W15 B;  3LK2 B;  2V7L A;  3ANW B;  3UUM A;  4IE0 A;  2NTY A;  2V1D B;  3WAK A;  3ZN0 B;  4ADZ A;  2KWH A;  4IIJ E;  5LHI B;  2VWA A;  3L09 A;  2D0U A;  2IC9 A;  2YU1 A;  4KP3 C;  3I0O A;  3V5S A;  1NAF A;  2X67 A;  2Q9Q C;  5JDQ A;  4K0U A;  3ETU A;  5JDG A;  3KBT A;  5LBM A;  2E9X A;  3N9N A;  3MJX A;  4H9O C;  4ISS A;  2LOP A;  4EOZ B;  2C5I T;  3OKQ A;  2CA5 A;  4M1P A;  5J2U E;  4H9R C;  4J2C A;  5L3E B;  2Q9Q B;  2V7I A;  4NUU A;  1D1C A;  2N9D A;  3GN5 B;  4CQI A;  3PUG A;  4UVC B;  3SOL A;  2KZ7 B;  2A72 A;  2MTQ A;  4PK6 A;  1D1A A;  3J9X 1;  3U3I A;  1QSD A;  4X20 E;  1FIO A;  3LK3 B;  3H37 A;  5DAB A;  3K8P C;  2ZMA A;  3CWZ B;  2LSJ A;  3ZCI A;  2K9A A;  5FNV E;  4TV9 E;  3UT5 E;  2C0S A;  2VK9 A;  3OYZ A;  1MIY A;  1HG2 A;  3I9W A;  3C64 A;  4H9S E;  4QXH B;  3N5L A;  5DJQ C;  1ZV4 X;  3M65 A;  4BJM A;  5JQG E;  5LBQ B;  3Q2M A;  5F8P A;  3PE0 A;  4ANJ A;  2WWU A;  5AFU L;  2LEH A;  5HXR A;  2KT9 A;  1D0X A;  2XAF B;  3FXD B;  1YD8 G;  2ZM8 A;  2MBG A;  2KIN B;  5LJM A;  4AKR B;  2X66 A;  1ZHC A;  3QK6 A;  2EHO A;  3MA9 A;  1QUU A;  3I0Q A;  5LJN A;  2PBI A;  2XAG B;  5KX5 E;  2ES0 A;  5LOV E;  2X68 A;  2WMN A;  2CXD A;  2V7J A;  3BQK A;  4O4J E;  4EXT A;  3LBX B;  2PFV A;  3F31 A;  2YK0 A;  3AB3 B;  3RC3 A;  2VL8 A;  4EZH A;  2JPF A;  3RH3 A;  5LHG B;  1SHZ C;  4AXP A;  2L3L A;  2DHR A;  3C4W A;  3N9M A;  4X1I E;  1G73 A;  4KUM B;  3C51 A;  1UX5 A;  3I9Y A;  4I50 E;  3ZYM A;  5ADX L;  1OXZ A;  5GON E;  2BZB A;  2L9Q A;  3O9X A;  2W00 A;  4GK5 E;  2C5J A;  2X51 A;  3T8O A;  3UUL A;  5JDN A;  4L9I A;  4BJN A;  5J1G A;  3EUH A;  2NWB A;  1IAP A;  3QUJ A;  3A5X A;  3CQC B;  2JQQ A;  1G8X A;  4O4I E;  5ETW A;  4N78 D;  4AKL A;  2CEA A;  5EZY E;  4ERR A;  3Q9D A;  2DNX A;  4XZC A;  4DBR A;  3PUQ A;  4AKG A;  3PDY A;  3HL6 A;  1BR0 A;  2X9Y A;  3BK9 A;  1KNZ A;  2JJ9 A;  2NW9 A;  2NTX A;  2BVM A;  3ZC1 A;  2RP4 A;  4IHJ E;  3HA4 A;  4FI5 A;  5LGN B;  2LOS A;  4P0A A;  4UEL A;  2KND A;  5F3J A;  2Y48 B;  2LM9 A;  4DMW A;  1HG5 A;  1E1H B;  5JRE A;  5KMG P;  2V7M A;  2YIN A;  4PK5 A;  4I43 B;  2Y8D A;  3AVS A;  2E8I A;  4ZOL E;  2GK9 A;  3GWH A;  3IBP A;  3ZPO A;  3Q5X A;  1MNE A;  4I55 E;  4ZS2 A;  5FY0 A;  4H9P C;  4IE6 A;  4OYK A;  4HGA A;  5HWX A;  3E0Z A;  3MXZ A;  5EK4 A;  3CX6 B;  2WSS V;  3ZYL A;  4UIG A;  4PW8 A;  2WAU A;  4TV8 E;  3HR0 A;  5LGT B;  1IZN B;  4DVD A;  2ZM2 A;  4PK4 A;  4AQF A;  4X1Y E;  3UTK A;  3RYH E;  1S35 A;  4PFP A;  2XAJ B;  4ZHQ E;  3NZP A;  2QGS A;  2D5U A;  1YKE B;  2H3R A;  2NP9 A;  3AAI A;  3LFM A;  4OFZ A;  2WM9 A;  4WNK A;  4YHJ A;  5L3B B;  2Q9Q D;  3RPU A;  3VHL A;  4F6R C;  2LE8 A;  2X9H A;  2XTL A;  3PTR B;  5JRC B;  4UEM A;  2X9W A;  5KDM C;  5JDM A;  3P7I A;  4QX8 B;  3VU7 H;  2X9X A;  5IHY A;  3SS1 A;  2VKH A;  4UXN B;  2CLY C;  3Q5W A;  1HS7 A;  2XAH B;  4C91 A;  2ODV A;  2V7K A;  5HXS A;  4TN7 B;  4XAX B;  1SA0 E;  1HX8 A;  1D0Y A;  2E9X C;  4WBN E;  3B57 A;  2CLY B;  2DCF A;  4OK0 A;  1HFA A;  3B13 A;  3C50 A;  1LVF A;  2E9X D;  1IJ5 A;  3FB2 A;  2DLR A;  1MND A;  5LYJ E;  1BR2 A;  3MKD A;  2E9X B;  5LCY A;  4B6X A;  5FYM A;  2LJL A;  3TKL B;  2NOX A;  2LSG A;  2W62 A;  3K3Q C;  5FXX A;  4OYJ A;  3KV9 A;  4GYR A;  2LSY A;  3RX6 A;  3FBL A;  4ZI7 E;  5DQW A;  5LNK A;  1NWM X;  2CWY A;  3ESL A;  3I1A A;  5HWY A;  2K48 A;  2UXX B;  3UUN A;  4HKA A;  4EYY R;  2DI4 A;  4HFV A;  4KMC A;  4HTE A;  4TUY E;  3F2E A;  5CA0 E;  4IST A;  3ONX A;  2C5K T;  4IE5 A;  3C4X A;  3KFW X;  4CXX A;  3U78 A;  4PJJ A;  1S94 A;  3OYX A;  4AQG A;  4DO0 A;  2KMF A;  4QX7 B;  2EHO C;  2VKD A;  2ZM0 A;  3KVB A;  5LXT E;  1U5P A;  2JMK A;  3PU8 A;  3LK4 2;  3RKO A;  3J7Y q;  4O2A E;  4ASK A;  3CQX C;  3O1J A;  1KK7 A;  2EHO D;  2XQY A;  3IHR A;  2QA7 A;  2A2F X;  4E7Z A;  2KXP B;  3CX7 B;  2CE7 A;  2SPC A;  4HN9 A;  3VKG A;  2EHO B;  2VKJ A;  2Y6X A;  3AVR A;  4QWN B;  3AAA B;  3ZLI A;  1BR1 A;  1V9D A;  2MOZ A;  3MAC A;  5LA6 E;  2W0G A;  4X1K E;  3CPZ A;  4HE8 A;  5CB4 E;  4CI3 B;  4WBO A;  2CWO A;  4AKH A;  4I4T E;  5H6Q B;  3HKC E;  3ZJ1 A;  5DQV A;  3DTO A;  2XAQ B;  2XUE A;  5FXW A;  2CXF A;  2BVL A;  5LGU B;  1U4Q A;  4MFR A;  1HCI A;  4CI2 B;  3NRX A;  2P9B A;  4JLE A;  1UCU A;  5HXC A;  5FMN A;  2DWK A;  2VAS A;  2KLQ A;  3HKE E;  4PJN A;  5JDF A;  5L3G B;  3N9P A;  3O4X E;  3N2K E;  3GA8 A;  4QXB B;  4UF0 A;  5FY1 A;  4JEH B;  4EZ4 A;  5L3C B;  4UVB B;  3AAE B;  3C98 B;  5JR9 A;  5JH7 E;  3N9L A;  2HPL A;  3E08 A;  1LRZ A;  3ANW A;  1FMV A;  2ODU A;  3KV6 A;  4DND A;  2PJQ A;  2Z6E A;  3IF8 B;  5LG4 A;  3E22 E;  1AJ3 A;  5JDL A;  4WW0 A;  2BDE A;  3K3O A;  3ZMZ B;  3RYI E;  3ZYK A;  4MLK A;  4O2B E;  2CXL A;  4EB6 E;  2H7V C;  1WYC A;  4O8S A;  3AA1 B;  4U72 A;  5TAO A;  2G0U A;  5IYZ E;  3AA7 B;  2N1G A;  4GYS A;  2WBL A;  3ETV A;  4ZI3 C;  3UFE A;  4A56 A;  3SWH A;  2A3D A;  2DWG A;  5E0O A;  4FJO A;  5FXZ A;  2W63 A;  3ZC0 A;  4QXC B;  5M4Y A;  3KVA A;  4ZI3 D;  2Q9Q A;  3KIN B;  4UF0 B;  1MMN A;  2VKO A;  3GN5 A;  2V26 A;  5L3D B;  1FMW A;  4NUV A;  3JC6 C;  3ZMS B;  4CZZ B;  5L2L A;  2CMR A;  1CUN A;  1MIW A;  2UXN B;  4PJM A;  4PNI A;  3CKD A;  3R84 B;  2LT3 A;  2WMO A;  3RRC A;  3JC6 D;  2LSI A;  3BQL A;  2IC6 A;  3CVR A;  3MK7 C;  1MMD A;  1WLX A;  3EDV A;  3N2O A;  4O4L E;  4AQF C;  1MIV A;  3N9O A;  5FXV A;  4G2A A;  3P8C D;  2J1D G;  3GMI A;  3AA6 B;  2HPJ A;  2W61 A;  3KV5 A;  1WR6 A;  4OHF A;  1D1B A;  4CXW A;  4H63 V;  1MMG A;  4O4H E;  2LHR A;  2XAS B;  5A1L A;  3MZK B;  4QKN A;  2HH7 A;  3NRY A;  4PJL A;  2B1E A;  4TX5 A;  5HXE A;  4GK0 E;  1B7T A;  2ZLY A;  5CA1 E;  4JUY A;  3LJC A;  3H3A A;  3KBU A;  3SRZ A;  1H7C A;  3KV4 A;  3ZMT B;  4UV9 B;  2NW8 A;  1VOM A;  3HKB E;  1MMA A;  3LBX A;  4UVA B;  4PFO A;  4L0R A;  4P0B A;  4IE4 A;  4YFS A;  3R6N A;  3RYC E;  4HEA A;  4DMV A;  3CML A;  3UUX B;  5H6R B;  1Z0P A;  2I59 A;  4MAL A;  1HF8 A;  1T98 A;  3PU3 A;  4CI1 B;  2OA5 A;  2D2S A;  4L5G A;  1YW0 A;  2IW5 B;  1HTJ F;  5C8Y E;  2D0T A;  2NW7 A;  3FXE B;  4G63 A;  3FHN A;  3IEE A;  4ILU A;  3RYF E;  4ZI2 C;  3AA0 B;  3RC8 A;  3PUS A;  3FBZ A;  4H9N C;  4QHO A;  4CXY A;  4ZI2 D;  3ZJ2 A;  4MBQ A;  3DP7 A;  4IDZ A;  3WAJ A;  3ZMU B;  3NZQ A;  1ZEE A;  5LP6 E;  3V5U A;  2JMH A;  2LHN A;  2XHE B;  1LKX A;  3N2G E;  3WI3 A;  3ZCJ A;  5EK2 A;  4IGU A;  2RA1 A;  3DJB A;  3ZN1 B;  4AKI A;  5FP3 A;  2X0L B;  3VKH A;  3N9Q A;  4TZ4 C;  3CX8 B;  3KDS E;  5HAX A;  4GIW A;  1BR4 A;  1FEW A;  4P09 A;  3C4Z A;  4H63 H;  2YU2 A;  3K3N A;  3RRW A;  4EAH A;  3D0T A;  2H7O A;  3PUR A;  2M67 A;  4E7S A;  3NBX X;  5BMV E;  2CCQ A;  4EIW A;  1WYB A;  4IE7 A;  4C90 A;  1ZKE A;  3EDU A;  3HKD E;  1UX4 A;  1VRB A;  4U74 A;  2VB6 A;  4ZS3 A;  3OBV E;  4BA9 A;  1X79 A;  3OJA A;  2YEV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...