2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein lp_2664
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
3DJBA 5DQWA 3B57A 5IHYA 3DTOA 5DQVA 2QGSA 2PJQA
chains in the Genus database with same CATH superfamily
4CFMB 2L3LA 1KXUA 2MBGA 4ILCA 2CZ7B 3K3OA 4PJLA 5BR8T 3BG3A 3H3MA 4CQIA 4AKIA 4CN6A 2Q9QD 5LGNB 3G06A 3HKCE 2E9XA 2OA5A 4CI3B 3WVEB 4XZCA 5FXVA 3MY1B 3K3QC 1HFAA 3A8HB 2N2NA 1ZHCA 4EONB 4FJOA 4GYRA 4UN0A 3CK6A 5FL0A 4YTNA 4ZZBA 3PV0F 2KWIB 3NRYA 5LOVE 1JKWA 1IZNB 2BG9E 4A97A 5LG4A 5LA6E 3PURA 2J62A 4DV7T 2CMRA 3AAAB 4H9PC 4WBNE 2YDQA 5HXHA 1X9BA 4ZI3D 2HPLA 4DR6T 4O4IE 3PU8A 3AA1B 3BG9A 4B3TT 4OB1B 5LP6E 4HNTA 3QYHB 3LJCA 2C5XB 4NXMT 3JAFA 2PBIA 2LHRA 3A8GB 2K5BB 2BS3A 1HF8A 3P4WA 4JLEA 1Y01A 2LKHA 3RGFB 5HEHA 5HXEA 2W63A 3BQLA 4AKGA 2XQ5A 2LW4A 4GIWA 4P0AA 1JSTB 4JX5A 3OBVE 4A5XA 2DPPB 2D2SA 4JI4T 3O1IA 3KBTA 3C4XA 3I9WA 1OWAA 5AQJB 3PTRB 4BCIB 4HL4A 4HTEA 3AE3A 3MKDA 2WM9A 4ISTA 4QHOA 4JI0T 1H26B 3TNHB 1HCIA 3NRXA 2WEVB 4G6LB 3EDUA 4Q25A 3EOCB 2MAWA 4LFBT 2KMFA 4I3ZB 2E9XB 1UCUA 5LHIB 2WBLA 4OYJA 4QKNA 3BLHB 2Q9QA 2AE9A 4CFVB 1N34T 4QXBB 4YJ3E 1HG2A 5KX5E 3DTOA 2BS2A 1O9KB 2XY8B 3AVSA 2WDRA 3NZPA 3LQ5B 2ACZA 2WU5A 2X66A 4OFZA 3AAEB 5IDPB 2X9XA 2Y6XA 4UXNB 2WIPB 3CQXC 5IDNB 1GUXA 3AA0B 3V5SA 2WXVB 1C9BA 2LM9A 4II5B 1XDOA 2L9QA 2LSJA 1IREB 2W00A 3F5XB 1IBMT 5AQKB 5HCJA 5C2TA 4HKAA 3ONLC 2ZPFB 2W96A 2W9ZA 3VRBA 3TNIB 3RC3A 5AFUL 2H88A 2LOPA 4YLHA 4DV6T 4IDOA 4NUUA 3PO3S 1H1RB 1ENWA 4CN4A 1W09A 3GWHA 3A7MA 2JQKA 4P1NA 4U2YA 1UGPB 3ZYLA 2EHOB 2VB6A 3MACA 1BU2A 3KV5A 5F5WA 3QB5A 4U7YA 4N78D 1YXRA 4JI3T 4KRCB 2C5IT 4NXNT 1OIUB 3P4RA 1MMAA 5JR9A 1XZYA 5L3DB 2UXBT 2C6TB 4A98A 2NOXA 4EIWA 3CX6B 4KX6A 3LG7A 3X28B 3HKBE 1PKDB 4HWHA 2PK2A 4EAHA 2MPKA 3ZN1B 3IBPA 1G73A 4KBMB 5IYZE 2XQ9A 2WSSV 3WAKA 3DL1A 1W0BA 5AQIB 3RPUA 4BJMA 3WAJA 5CYIB 5IF1B 4H9NC 2EHOC 4EYYR 1Z8UA 3ABVA 3Q5XA 4EYUA 1F5QB 3R84B 4DR5T 3QZ9B 4ELLA 3GMIA 4H9QC 3F31A 2B1EA 3EVYA 3MA9A 4OR5B 3SOLA 4KHZF 1YD8G 1M7KA 2YN6A 4I43B 3H37A 3RIUC 3MJXA 3ZKRA 4BCHB 2KLQA 4PFPA 4YT0A 1VYWB 4HEAA 1H4LD 3QWLA 2KT9A 3RKGA 2NTYA 3ZJ2A 4CFXB 4EV6A 3FHNA 2BG9A 4WW0A 3ANWA 2IIUA 1R8IA 3ZCJA 1UURA 3NZQA 4CXWA 3SS1A 2V6YB 4BBRM 1D1AA 2VWAA 4DNDA 1SA0E 2I40B 2XAFB 1AD6A 3C98B 2DI4A 2XASB 5L47A 3N9MA 3UTKA 1AHJB 3K7AM 4UF0B 3PUZF 5AQFB 1FINB 3CKDA 3ZCIA 2VURA 3Q5DA 4JV5T 2ODUA 3GA8A 2C5NB 2B9RA 3J7Yq 2ZLYA 2CZ0B 1QSDA 4AKHA 3ZEFB 4DUYT 2NW7A 4IGUA 3AEEA 3TLTA 4ILBA 5LMKB 2LEHA 4KHPT 4L5GA 3P8CD 4ZI2C 1MIWA 2PK9B 2CHOA 4JUYA 4LMJA 2FBWA 2KNDA 2V7LA 2CXFA 4HWFA 3BLQB 5LBQB 3DDQB 3O0GD 2JQ9A 3TNWB 1AISB 3LDQB 4ROEA 5LG3A 4JEHB 2KMGA 2VVNA 4QX8B 2ZPGB 1H25B 4OK0A 2HHHT 2ES0A 4P0BA 3EABA 1XO2A 2L8KA 1E1HB 1IBLT 2A2FX 3I1AA 5ADXL 4H9OC 3HKDE 4DR2T 4PFOA 2C5VB 4UF0A 5FVLA 2X0HA 2FJAA 2WU2A 2M67A 4CFWB 2KR6A 4LMKA 3FZFB 4GK0E 5ABFB 3I0OA 3VR9A 4IHJE 1HX8A 4F6RC 4ZI7E 2PFVA 4LFAT 2E9XC 3E0ZA 3CPZA 3CVRA 5LB7B 2BG9B 2WAUA 2WMNA 1MNDA 4PJJA 2JRKA 4JEUB 3KINB 3C4WA 2X9YA 2V8SV 5C8YE 3OYZA 4KUMB 4HWIB 5J2TE 2LRKA 4IREA 1WCRA 4DR7T 3ETVA 1JOWA 4YY3T 4X65T 3RX6A 2EUFA 2WWUA 3ZC1A 3VYHB 1FIOA 1V9DA 4YOSA 5AQSB 2BKNA 3MZKB 3RQWA 4KP3C 4EXTA 4OGRB 2FUPA 2K24A 2V7MA 4GOUA 4X20E 1V29B 5FVKA 2LM2A 3L39A 4ZS3A 1XDPA 4JI2T 3LBXB 3QHWB 5FXZA 3A8MB 4F7SB 2WB5A 2W9FA 1GY3B 3N5LA 4TNWA 2VQET 4C91A 2C0SA 4RODA 4YSYA 1CHUA 2WS3A 4BJNA 4BCND 3VR8A 3ESLA 3X26B 2XTLA 2NWBA 3CQCB 1OEDC 1W9RA 4EOJB 3LK42 3X1DA 2KXPB 2VL8A 2VL0A 3KHIA 5LHGB 4BCOB 4IDZA 5DQVA 4ZGJB 2JPFA 3P4SA 1OKVB 1ZP2A 2YU2A 2CZ6B 2ZM0A 5FKYA 3IEEA 3VYGB 3RI5A 4DO0A 3CWZB 3CX8B 1I6ZA 1UNLD 3HB9A 5HEGA 3EIDB 2KINB 3TLVA 1VCSA 2XUEA 2V6XA 1OXZA 2W2HA 4U7IA 1H27B 5A1LA 4CN1A 2DMEA 1LRZA 1L0VA 1UGRB 4DR3T 3ZMZB 3LK3B 3OTOT 2Z6EA 2JMKA 4UEMA 4DV1T 3EDVA 2UUBT 2CHNA 3FZMB 1J1JA 2E9XD 3K8PC 2J4GA 4TWHA 1GH6B 2WP9A 5LHHB 3UUMA 1G3NC 2CLYB 1KNZA 5FYMA 3M03A 4B6XA 4EZHA 1KNPA 3N2KE 5ABGA 2IAKA 3N9PA 3KFWX 2QQ8A 5BNJB 2J47A 2XAQB 1UUSA 2X9WA 4HNUA 3K1SA 4F70B 2C5OB 2LSGA 3NWIA 5HQ0B 4ISSA 4YTPA 3ZT6A 2R6GF 3UFEA 1WR6A 3D0TA 4MFRA 3AE2A 3ZMSB 1KEYA 3HL6A 2V22B 3CQGB 3N2OA 4Z8XA 2V6YA 5JDHA 2BKZB 5AQTB 1UGSB 3X25B 3JC6C 3LFMA 3UT5E 3A8LB 4NPPA 2N1GA 1N4MA 3JC6D 5LNKA 2YU1A 4YSZA 2IUBA 4CRLB 1QLBA 4JI1T 4CFNB 3FZKB 3ZMTB 5HXSA 1E9HB 5LJNA 4XAXB 4IL4A 3RH3A 3QYGB 1FMVA 2CCQA 1SE7A 1WYCA 5HNBB 3UQ7A 3AE1A 2BDEA 3UU8A 3T8OA 2B76A 1EZ3A 2QFZA 2DCFA 2DLRA 4UV9B 4F7JB 3PJAJ 4O4HE 3EHZA 3AEBA 4H9SE 4AIUA 3AAIA 4AQFC 5ACBA 3MXZA 1LVFA 1P5EB 2IW5B 4YOZA 2IN3A 4ZS2A 2YOEA 5FY0A 5LMNT 4UV8B 4NUVA 1E2AA 3RRCA 3RYIE 1H1QB 3PU3A 4IT4A 5DQWA 4XBFB 3LBXA 5AQNB 4ASKA 2RP4A 3HO8A 5IHYA 2V1DB 1M62A 2ZM8A 2CCIB 2X9HA 4EZ4A 1ZV4X 3C4ZA 4HFIA 3U3IA 5AQRB 3KDSE 4EB6E 2E2AA 3FZHB 3JAEA 2DWGA 3QNUA 1IAPA 1MMGA 2LJLA 3AE5A 2V26A 3NVOA 1CUNA 3RF1A 3J9X1 4JBWF 3QYEA 1JNRA 2UZEB 5HEOA 3S4UA 4DBRA 3ZN0B 3P50A 2DNXA 2WJ9A 4EGWA 3UU5A 4FX3B 5J1GA 2QA7A 2XQ6A 4ZOLE 5HBEB 4HFEA 2CYZB 3P7IA 2BVLA 1ZKEA 1FEWA 2PMIB 5EJCA 4BCFB 5F8PA 1UK5A 4TX5A 1OIYB 2XJ7A 3OKQA 1YQ4A 2V7KA 2YINA 4BCJB 3VRAA 4KMCA 4M1PA 2ZPBB 1OGUB 4CI1B 3UULA 5HXRA 3RYFE 2UU9T 3UUBA 2X1NB 5ABFA 3X20B 2X51A 2DHRA 4WYVA 4EOKB 3JADA 4AKRB 1NENA 3RIUA 3IF8B 1WLXA 3AEGA 4DVDA 3UU3A 2Y8DA 5J2UE 2BPMB 4X66T 2LE8A 5HBHB 5L4EA 3ZYMA 2C4GB 5H6QB 5KMGP 2V5DA 1D0XA 2WZIA 2AHJB 2QRXA 2FJBA 2I6HA 2LRLA 2YK0A 4BBSM 2CBJA 2DD5B 3B57A 4IE0A 2VK9A 4EORB 3BQKA 3PE0A 4EOPB 3MY5B 2IDOB 5LGUB 3TLWA 5IUXA 1UNGD 2K9AA 4LF7T 2DXCB 4IE7A 4TV9E 5JQGE 3U78A 3ZMUB 1HNWT 3CIRA 2YDRA 3VHLA 4OB2B 2DXBB 4P09A 4PW8A 5ABEA 5HBJB 2D5UA 3UQ4A 3AVRA 3X24B 2ZMAA 3PUSA 2CJMB 2DWKA 4ADZA 3OVUA 1VOMA 3ZPOA 5LCYA 3RGLA 2MYSA 5HXCA 1HNXT 4OB3B 3ZSTA 2XAGB 2WIHB 4JI8T 4ROCA 2EHOD 3POMA 4HNVA 5KXJA 5AQPB 5EK3A 4OX9T 4U3CA 4ZXLA 5M4YA 1OEDE 1FVVB 4EEBA 5C3JA 3PUYF 4QH1A 4BA9A 4F8HA 3LSVA 3KV9A 3N9QA 3FBZA 1N32T 2BKPA 3QXEB 4CXYA 3I0QA 3AEDA 2D9DA 4IE5A 1FMWA 4QH4A 4EOMB 2E8IA 4DR1T 4DV3T 4O8SA 2MOZA 5EFQB 2LOSA 3FB2A 3AEAA 5CGMA 4U74A 2M6BA 2LSIA 4EOSB 3AB3B 5L2WB 1XNQT 1HS7A 4YSXA 4NIQA 4BCMB 5FP3A 4NC6A 1IBKT 5DABA 3KV4A 2AXDS 1D0YA 4MALA 4BCGB 3PUWF 2CM0A 1O9KA 2KZ7B 1IJ6A 3O1HA 2XPKA 5JDGA 3HBLA 5JDNA 5FNVE 2HN2A 4NSTB 2YDSA 3B13A 5J0ZA 2IHR1 2JIWA 4EC9B 4EOOB 5EK2A 2BG9C 3RKOA 2OLTA 2ZZDB 3PJAA 2PG8A 2VKJA 2CWOA 1QMZB 3GN5A 4DV0T 2XAJB 4PK4A 4UVCB 1YKHB 2ZM2A 3L3PA 3K3NA 3SRZA 5ICPB 3KVBA 4EEDA 1VRBA 3QUJA 4YJ2E 3QK6A 4X62T 4PK5A 1H1SB 5LJMA 4DMWA 2W4XA 3RIFA 1WYBA 1VOLA 2CZ1B 3RYHE 4MFEA 4PJNA 4QH5A 2UZBB 3QHRB 3A8YC 3AE8A 2BS4A 2VQFT 5I5ZB 5HVYB 5L3EB 5JDFA 4Z91A 2W99A 3G33B 2JQQA 4I4TE 4EOZB 4JI7T 4LFCT 3NKZA 2HN1A 3AECA 2OV9A 4X1YE 2JQHA 4IDNA 2WMBB 1W0AA 5AQQB 4BXXX 5FGKB 3L8RA 5FXXA 2V7IA 2XAHB 4C90A 2Y48B 4LMLA 4AQYT 5L3GB 4HLQA 2SPCA 1HX1B 3Q5WA 4ERRA 3ANWB 3H4CA 3WI3A 1OKWB 1T72A 4Y72B 3R6NA 1OL1B 2BVMA 2CBIA 3F2EA 2NW9A 2NW8A 1JSUB 3OYXA 4BCNB 1W98B 5AQUB 5HCMA 1DU2A 2H7OA 3T1HT 2RA1A 2G9XB 1N36T 2ZPEB 4Z90A 4KI0F 2ACXA 2G0UA 5L3FB 1I94T 1N33T 5HEUA 2CWYA 1BR4A 2CCHB 4CXAB 2QYWA 5JTGA 2DL1A 1WFDA 4J2CA 4O2BE 1UGOA 1B7TA 3ZC0A 4YC3B 4WNKA 3MI9B 2D0QB 4ANJA 1XNRT 3CX7B 3C50A 1US7B 3ZYKA 4ZI3C 4U33A 5FXWA 1GQEA 2C5JA 2VVSA 5JDMA 2UUEB 1LKXA 4YHHT 3DJBA 3AXJA 1VCTA 2XQ8A 2M6IA 3HKEE 2XQYA 2WMAB 4KRDB 2VASA 5JR9B 4QXCB 1NAFA 2CRBA 1U5PA 1AJ3A 5IWAT 3TLUA 4BY1X 3PUAA 2CLYC 2LSKA 3RYCE 1IJ5A 2UXNB 3AE7A 2VKHA 4AQGA 1OL2B 3NDQA 3TLSA 4MBQA 3GN5B 5GONE 3QYBA 1XWMA 2WDVA 2GK9A 4IIJE 4H63V 1XMOT 3VU7H 3QC9A 1KF6A 4EOQB 1VINA 2BZBA 4I55E 2WY2A 4MLKA 1HG5A 4HFVA 2CE7A 1T98A 3B5MA 1GUXB 4BCMD 1LVKA 4B3MT 3E08A 4YFSA 2K48A 2WQYA 2XHEB 1UX4A 4X64T 1BR1A 4U72A 2XSAA 3JCFA 2CXLA 4X5TA 1URCB 5HEJA 3MIAB 2Q9QB 5AQHB 2H89A 4TTHA 4H63H 4V1Av 4DIDB 4Z6YA 3RIAA 1UX5A 2CPTA 1QUUA 4OHFA 4DUZT 1D1BA 4GK5E 1D0ZA 2JMHA 5LBMA 4YXDA 4LF6T 4IE6A 3P4QA 3P4PA 1YW0A 1FJGT 2A72A 4U2ZA 4ZEYA 4PK6A 5JREA 2WDQA 2HH7A 3T1YT 1ZEEA 5AQGB 1MNEA 3WVDB 3FXDB 1J5WA 3V5UA 4EOIB 3C64A 4LF4T 4DBQA 3M3ZB 3TKLB 5JDLA 3ONJA 5LXTE 1S94A 2DD4B 2WFYB 3O1JA 3BQIA 3AA7B 3GTMS 4CZZB 3AE9A 3E22E 1FKMA 5E0OA 4ZGDB 4HFBA 2VKDA 4ILAA 4JYAT 3N2GE 2NR4A 3EAMA 5JR9C 3O9XA 3DDPB 4AKLA 4BAYB 4WBOA 1Y64B 1WRDA 4IDPA 2UZLB 4AI6A 5LQFB 2WMOA 3SWHA 4QXHB 4CFUD 2QF7A 5FY1A 3Q9DA 5EZYE 3ZT5A 1HR0T 4BCQD 1X79A 1XMQT 1G8XA 3BLRB 4IDQA 2VKOA 5AQLB 3KVAA 5JRCA 4JI6T 1H1PB 2WPAB 3PUGA 3M65A 5CFBA 5HYAA 4MFDA 4G2AA 2LLYA 2NTXA 3ZMVB 2D0UA 4YTMA 4UR9A 1UNHD 4DMVA 1TD6A 4CXXA 4QX7B 2XQAA 2IW9B 4I0UA 1E7PA 3ZLIA 3KV6A 4O2AE 4HGAA 3Q5EA 4F7NB 2X68A 4E7ZA 5CA1E 1D3UB 2NP9A 4B3RT 4TWDA 1OI9B 4GYSA 2W62A 4K0KT 1HNZT 2QVAA 5AQVB 4A56A 2JJ9A 1BR2A 3IA3A 2I0MA 5H6RB 3Q2MA 5HWYA 4DR4T 1MMDA 4U31A 1MIVA 2C5KT 5AQOB 2A9UA 4JI5T 2LHNA 5JDQA 5EK4A 2W2UA 1MMNA 4G63A 1OEDA 3SFDA 1H7CA 4UIGA 2X67A 3A8OB 5CEIB 4F6WB 1H24B 1T8BA 1JNZA 5FL1A 1HTJF 3OPCA 2XM2A 3TW7A 3AE4A 1MIYA 4HFHA 5TAOA 2UZDB 3UUNA 3HHTB 4IMYB 2IC6A 4QSHA 4BCQB 5L3CB 3VKHA 2LSYA 3PDYA 3FZLB 4TZ4C 4HWDA 5CJ5A 4L0RA 2UUAT 2KWHA 4ZGEB 4JX6A 2H7VC 2V7JA 2CEAA 5L3BB 1O3XA 1YQ3A 4HWCA 5L4HA 3DP7A 1SHZC 2ZPIB 2QDJA 1H28B 1Z0PA 5FMNA 4F7LB 4E7SA 2UUCT 5JRCB 3RRWA 4K0UA 4LF9T 4JX4A 4HFDA 4HN9A 4O4JE 3AEFA 2W61A 2ZM6T 3HZJA 4MHCA 2IW6B 3ZJ1A 4I50E 4PAGA 3AE6A 3DOGB 2JGZB 2H3RA 2XZEA 1J5ET 3ZSSA 4GKKT 4TUYE 2XQ3A 4UVBB 2XSBA 3QZ5B 4ZZCA 3LK2B 3BHVB 1S35A 4LF8T 5CA0E 1OEDB 3ONXA 2XM1A 1YKEB 2WZHA 3RHWA 2BBJA 4YHJA 3ETUA 4DV5T 3BG5A 2IVXA 3O4XE 4BCKB 2V5CA 3AA6B 3FBLA 4H9RC 1U4QA 2N9DA 5DJQC 3HI2A 3RC8A 5ETWA 3CMLA 5BMVE 5AQMB 4QWNB 2ZCFB 5L2LA 3UU4A 2X0LB 4UELA 4EOLB 2J1DG 2X0YA 3HR0A 5LMUT 4ILUA 2I59A 3ZT7A 2BKOA 3UU6A 2QGSA 2ZPHB 3RQUA 4LOCA 4AXPA 3BHUB 2BBHA 3TW6A 3F57A 2HPJA 2Q9QC 5ABHA 2D0TA 3BK9A 4PJMA 4TNVA 2XQ7A 4AISA 1T7SA 5KDMC 1KNRA 4BCPB 5JH7E 3IHRA 3QOFA 3PUVF 1WR0A 2IW8B 4X1KE 3OJAA 3QB5K 2LKGA 5CB4E 4IL9A 4ELJA 5LGTB 4F6UB 2MTQA 1D1CA 2K3WA 3UFGA 4COFA 2E5VA 4TWFA 4DV4T 4O4LE 3NBXX 2A3DA 2KSRA 5F3JA 2CXDA 3N9NA 3BHTB 3HA4A 2CA5A 1NEKA 3H3AA 3TN8B 1KK7A 2FJEA 2FJDA 4X1IE 5FY7A 5HAXA 2W0GA 4HFCA 3PUXF 3EJ1B 2IC9A 3L09A 1BR0A 4OB0B 2WHBB 3EUHA 3W15B 4IE4A 1NWMX 2W66A 3N9LA 4L9IA 1TFBA 4AQFA 2IMLA 4EC8B 3PUQA 4ZI2D 4FI5A 3KBUA 3VKGA 4GKJT 2UXXB 4HE8A 3FXEB 1KFYA 1UGQB 2PTFA 2PJQA 4F6SB 2G77A 2RPAA 5LYJE 4UVAB 2P9BA 2E5LT 2YEVC 2I53A 2EHOA 3C51A 2W67A 4CI2B 2UXCT 3UUXB 2UXDT 3AXJB 1ZP0A 3MK7C 3SFEA 2F2CA 2ODVA 4LF5T 2LT3A 2YKSA 5HWXA 1SUMB 2WWVA 4TN7B 2PHGA 3A5XA 4MIMA 2R7GA 2F4VT 4ZHQE 4M6VA 3RLFF 3EI0A 4PNIA 3I9YA 4TV8E 2QDYB 2WCAA 4BY7X 1ZOYA 4OYKA 3N9OA 2XQ4A 4DV2T 4B3ST 4YOOA 4FM4B 5JVDE 4WZXA 4CFUB
chains in the Genus database with same CATH topology
4P09A 2L3LA 4JEUB 4PW8A 2D5UA 2MBGA 3KINB 3K3OA 4PJLA 3C4WA 2X9YA 3AVRA 3O1JA 4CQIA 5C8YE 4AKIA 3OYZA 3BQIA 4KUMB 3AA7B 2Q9QD 2ZMAA 5LGNB 3PUSA 5J2TE 2DWKA 4ADZA 4CZZB 3ZPOA 1VOMA 3E22E 5LCYA 3HKCE 5E0OA 2E9XA 2OA5A 2MYSA 5HXCA 4CI3B 3ETVA 2XAGB 4XZCA 5FXVA 3K3QC 2VKDA 1HFAA 2EHOD 2N2NA 1ZHCA 3RX6A 3N2GE 4FJOA 4GYRA 2WWUA 5JR9C 3O9XA 3ZC1A 2KWIB 3NRYA 1FIOA 1V9DA 5LOVE 4AKLA 4BAYB 5EK3A 1IZNB 4WBOA 3MZKB 1Y64B 1WRDA 5M4YA 4KP3C 5LG4A 5LA6E 4EXTA 3PURA 4AI6A 2CMRA 3AAAB 4H9PC 4WBNE 5HXHA 2WMOA 4ZI3D 3SWHA 4QXHB 2K24A 2HPLA 4O4IE 5FY1A 2V7MA 3Q9DA 3PU8A 5EZYE 3AA1B 4BA9A 1X79A 4GOUA 3KV9A 3N9QA 1G8XA 3FBZA 4X20E 2VKOA 5JRCA 3KVAA 5LP6E 4CXYA 3I0QA 3LJCA 4IE5A 1FMWA 4ZS3A 3LBXB 3PUGA 5FXZA 3M65A 5HYAA 2PBIA 2LHRA 2E8IA 2K5BB 4G2AA 1HF8A 3N5LA 2NTXA 4O8SA 3ZMVB 2D0UA 2MOZA 2LOSA 3FB2A 4JLEA 4DMVA 4C91A 5LJNA 2C0SA 4U74A 4BJNA 2LSIA 3AB3B 4CXXA 5HXEA 4QX7B 3ESLA 2XTLA 2W63A 3ZLIA 1HS7A 3BQLA 4AKGA 3KV6A 4O2AE 4HGAA 2NWBA 2X68A 3CQCB 5FP3A 4E7ZA 5CA1E 5DABA 3KV4A 4GIWA 4P0AA 2NP9A 1D0YA 4MALA 3OBVE 3LK42 2D2SA 2KXPB 3O1IA 2VL8A 4GYSA 2CM0A 2W62A 2KZ7B 3KBTA 3C4XA 3I9WA 1OWAA 4A56A 5LHGB 3PTRB 2JJ9A 4HTEA 1BR2A 4IDZA 1IJ6A 5DQVA 2WM9A 3MKDA 3O1HA 4ISTA 4QHOA 5H6RB 5JDGA 2JPFA 3Q2MA 1HCIA 3NRXA 5HWYA 3EDUA 2YU2A 5JDNA 2ZM0A 5FNVE 1MMDA 2KMFA 3B13A 1MIVA 2E9XB 3IEEA 1UCUA 5LHIB 2C5KT 2WBLA 4OYJA 2LHNA 4QKNA 5JDQA 4DO0A 5EK2A 3RKOA 5EK4A 3CWZB 3CX8B 1MMNA 2Q9QA 4G63A 2PG8A 1H7CA 2VKJA 4QXBB 2CWOA 4YJ3E 1HG2A 2KINB 3GN5A 4UIGA 2X67A 5KX5E 2XAJB 3DTOA 4PK4A 2XUEA 3AVSA 3NZPA 1OXZA 4UVCB 2X66A 4OFZA 1YKHB 2ZM2A 3L3PA 3K3NA 3SRZA 5A1LA 1HTJF 5L3FB 3AAEB 3KVBA 1VRBA 2X9XA 1LRZA 2Y6XA 4UXNB 3CQXC 3QUJA 1MIYA 4YJ2E 3QK6A 3AA0B 5TAOA 3V5SA 2LM9A 4PK5A 3ZMZB 2L9QA 3LK3B 5LJMA 2LSJA 3UUNA 2W00A 2Z6EA 4DMWA 2JMKA 2IC6A 1WYBA 4UEMA 5L3CB 3EDVA 3VKHA 3RYHE 2LSYA 3PDYA 4HKAA 4PJNA 4TZ4C 3RC3A 5AFUL 2E9XD 4L0RA 3K8PC 2LOPA 2KWHA 4YLHA 2H7VC 2V7JA 5LHHB 4NUUA 3UUMA 2CEAA 5L3BB 2CLYB 1O3XA 5L3EB 5JDFA 1KNZA 5FYMA 3DP7A 1SHZC 3GWHA 1Z0PA 2JQQA 5FMNA 4E7SA 4B6XA 4I4TE 4EOZB 5JRCB 3ZYLA 2EHOB 2VB6A 3MACA 4EZHA 3RRWA 3N2KE 4K0UA 3KV5A 2IAKA 3N9PA 3KFWX 4HN9A 4O4JE 4X1YE 2W61A 2XAQB 4MHCA 3ZJ1A 4I50E 2X9WA 4PAGA 4N78D 5FXXA 4C90A 2XAHB 2V7IA 2H3RA 2LSGA 2Y48B 4ISSA 5L3GB 3UFEA 2C5IT 1WR6A 3D0TA 2SPCA 3Q5WA 4MFRA 3ANWB 4ERRA 4TUYE 3WI3A 3ZMSB 4UVBB 1MMAA 5JR9A 3HL6A 3CQGB 3N2OA 4Z8XA 3LK2B 5JDHA 3R6NA 5L3DB 2BVMA 1S35A 5CA0E 3F2EA 3JC6C 3LFMA 3UT5E 3ONXA 2NW8A 2NW9A 1YKEB 2N1GA 2NOXA 4EIWA 3CX6B 3OYXA 4YHJA 3ETUA 3LG7A 3HKBE 3JC6D 5LNKA 2YU1A 4EAHA 3ZN1B 2H7OA 3IBPA 2RA1A 1G73A 4KBMB 5IYZE 3O4XE 2ACXA 2G0UA 2WSSV 3AA6B 3FBLA 4H9RC 1U4QA 3WAKA 4XAXB 3ZMTB 5HXSA 2N9DA 5DJQC 3HI2A 3RPUA 2CWYA 5ETWA 3RH3A 3CMLA 4BJMA 5BMVE 3RC8A 1FMVA 3WAJA 1BR4A 2CCQA 4H9NC 4QWNB 5L2LA 2EHOC 1WYCA 2X0LB 4EYYR 4UELA 4J2CA 2J1DG 4O2BE 3HR0A 2BDEA 3Q5XA 4EYUA 3T8OA 1B7TA 3R84B 1EZ3A 3ZC0A 3GMIA 4ILUA 2I59A 2DCFA 2DLRA 2QGSA 4H9QC 4UV9B 4O4HE 4WNKA 3F31A 2B1EA 4AXPA 3EVYA 3MA9A 3SOLA 4ANJA 3CX7B 3C50A 1US7B 3F57A 4H9SE 3ZYKA 2HPJA 3AAIA 2Q9QC 4AQFC 4ZI3C 3MXZA 1YD8G 4I43B 1LVFA 2D0TA 3H37A 3BK9A 4PJMA 2IW5B 3MJXA 5FXWA 2C5JA 2KLQA 5JDMA 5KDMC 1LKXA 4PFPA 4ZS2A 5FY0A 3DJBA 4UV8B 4NUVA 3RRCA 4HEAA 3RYIE 5JH7E 3HKEE 3IHRA 2KT9A 3PU3A 2NTYA 2XQYA 3ZJ2A 5DQWA 2VASA 5JR9B 3FHNA 4WW0A 4XBFB 3LBXA 3ANWA 4ASKA 2RP4A 4QXCB 3ZCJA 1NAFA 4X1KE 5IHYA 2V1DB 1U5PA 3NZQA 3OJAA 1AJ3A 4CXWA 2ZM8A 3SS1A 2X9HA 5CB4E 4EZ4A 1ZV4X 3C4ZA 1D1AA 2VWAA 3PUAA 3KDSE 3U3IA 4DNDA 1SA0E 2CLYC 2LSKA 2XAFB 4EB6E 3C98B 2DI4A 3RYCE 5LGTB 2XASB 1IJ5A 2MTQA 2UXNB 2VKHA 2DWGA 3N9MA 1IAPA 1MMGA 3UTKA 4AQGA 2LJLA 2V26A 4UF0B 1D1CA 1CUNA 4MBQA 3J9X1 3CKDA 3ZCIA 3GN5B 5GONE 4O4LE 3NBXX 2A3DA 3S4UA 4DBRA 2GK9A 2ODUA 3ZN0B 3GA8A 2DNXA 5F3JA 2CXDA 5J1GA 3J7Yq 2QA7A 4ZOLE 4IIJE 3N9NA 4H63V 3HA4A 2ZLYA 2CA5A 3P7IA 1QSDA 3VU7H 3H3AA 3QC9A 3ZEFB 4AKHA 2BVLA 2NW7A 1KK7A 1ZKEA 4IGUA 1FEWA 4X1IE 5FY7A 5HAXA 2W0GA 5F8PA 2IC9A 2BZBA 2LEHA 3L09A 4TX5A 4I55E 1BR0A 3OKQA 4L5GA 3P8CD 2V7KA 2YINA 4MLKA 3EUHA 3W15B 1HG5A 4HFVA 2CE7A 4IE4A 1T98A 4KMCA 4ZI2C 4M1PA 1NWMX 4L9IA 3N9LA 1MIWA 1LVKA 4CI1B 4AQFA 3E08A 4JUYA 3UULA 5HXRA 4YFSA 2K48A 2XHEB 1UX4A 3RYFE 2KNDA 3PUQA 2V7LA 4ZI2D 1BR1A 4FI5A 2CXFA 3KBUA 3VKGA 4U72A 2UXXB 2CXLA 5LBQB 4HE8A 2X51A 2DHRA 3FXEB 2Q9QB 2PJQA 4H63H 4V1Av 5LYJE 4JEHB 4UVAB 1UX5A 4AKRB 2P9BA 2YEVC 4QX8B 3IF8B 1WLXA 1QUUA 4DVDA 2EHOA 2Y8DA 3C51A 4OK0A 4CI2B 5J2UE 4OHFA 2ES0A 3UUXB 4P0BA 1D1BA 2LE8A 3MK7C 3ZYMA 5H6QB 2L8KA 1E1HB 2ODVA 5KMGP 1D0XA 4GK5E 1D0ZA 2JMHA 2A2FX 5LBMA 3I1AA 5ADXL 4H9OC 3HKDE 2LT3A 5HWXA 4PFOA 4UF0A 4IE6A 1YW0A 2YK0A 4TN7B 3B57A 4IE0A 2M67A 2VK9A 3A5XA 2A72A 4PK6A 5JREA 3BQKA 3PE0A 4ZHQE 2HH7A 1ZEEA 4GK0E 5LGUB 3I0OA 1MNEA 4IHJE 1HX8A 4F6RC 3FXDB 2PFVA 4ZI7E 4PNIA 3I9YA 2E9XC 3V5UA 3E0ZA 4TV8E 3C64A 2K9AA 3CPZA 3CVRA 4OYKA 3N9OA 4IE7A 4TV9E 5JQGE 3U78A 2WAUA 3ZMUB 2WMNA 1MNDA 4DBQA 3VHLA 3TKLB 5JVDE 5JDLA 5LXTE 4PJJA 1S94A 2JRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJB A;  5DQW A;  3B57 A;  5IHY A;  3DTO A;  5DQV A;  2QGS A;  2PJQ A; 
#chains in the Genus database with same CATH topology
 4CFM B;  2L3L A;  1KXU A;  2MBG A;  4ILC A;  2CZ7 B;  3K3O A;  4PJL A;  5BR8 T;  3BG3 A;  3H3M A;  4CQI A;  4AKI A;  4CN6 A;  2Q9Q D;  5LGN B;  3G06 A;  3HKC E;  2E9X A;  2OA5 A;  4CI3 B;  3WVE B;  4XZC A;  5FXV A;  3MY1 B;  3K3Q C;  1HFA A;  3A8H B;  2N2N A;  1ZHC A;  4EON B;  4FJO A;  4GYR A;  4UN0 A;  3CK6 A;  5FL0 A;  4YTN A;  4ZZB A;  3PV0 F;  2KWI B;  3NRY A;  5LOV E;  1JKW A;  1IZN B;  2BG9 E;  4A97 A;  5LG4 A;  5LA6 E;  3PUR A;  2J62 A;  4DV7 T;  2CMR A;  3AAA B;  4H9P C;  4WBN E;  2YDQ A;  5HXH A;  1X9B A;  4ZI3 D;  2HPL A;  4DR6 T;  4O4I E;  3PU8 A;  3AA1 B;  3BG9 A;  4B3T T;  4OB1 B;  5LP6 E;  4HNT A;  3QYH B;  3LJC A;  2C5X B;  4NXM T;  3JAF A;  2PBI A;  2LHR A;  3A8G B;  2K5B B;  2BS3 A;  1HF8 A;  3P4W A;  4JLE A;  1Y01 A;  2LKH A;  3RGF B;  5HEH A;  5HXE A;  2W63 A;  3BQL A;  4AKG A;  2XQ5 A;  2LW4 A;  4GIW A;  4P0A A;  1JST B;  4JX5 A;  3OBV E;  4A5X A;  2DPP B;  2D2S A;  4JI4 T;  3O1I A;  3KBT A;  3C4X A;  3I9W A;  1OWA A;  5AQJ B;  3PTR B;  4BCI B;  4HL4 A;  4HTE A;  3AE3 A;  3MKD A;  2WM9 A;  4IST A;  4QHO A;  4JI0 T;  1H26 B;  3TNH B;  1HCI A;  3NRX A;  2WEV B;  4G6L B;  3EDU A;  4Q25 A;  3EOC B;  2MAW A;  4LFB T;  2KMF A;  4I3Z B;  2E9X B;  1UCU A;  5LHI B;  2WBL A;  4OYJ A;  4QKN A;  3BLH B;  2Q9Q A;  2AE9 A;  4CFV B;  1N34 T;  4QXB B;  4YJ3 E;  1HG2 A;  5KX5 E;  3DTO A;  2BS2 A;  1O9K B;  2XY8 B;  3AVS A;  2WDR A;  3NZP A;  3LQ5 B;  2ACZ A;  2WU5 A;  2X66 A;  4OFZ A;  3AAE B;  5IDP B;  2X9X A;  2Y6X A;  4UXN B;  2WIP B;  3CQX C;  5IDN B;  1GUX A;  3AA0 B;  3V5S A;  2WXV B;  1C9B A;  2LM9 A;  4II5 B;  1XDO A;  2L9Q A;  2LSJ A;  1IRE B;  2W00 A;  3F5X B;  1IBM T;  5AQK B;  5HCJ A;  5C2T A;  4HKA A;  3ONL C;  2ZPF B;  2W96 A;  2W9Z A;  3VRB A;  3TNI B;  3RC3 A;  5AFU L;  2H88 A;  2LOP A;  4YLH A;  4DV6 T;  4IDO A;  4NUU A;  3PO3 S;  1H1R B;  1ENW A;  4CN4 A;  1W09 A;  3GWH A;  3A7M A;  2JQK A;  4P1N A;  4U2Y A;  1UGP B;  3ZYL A;  2EHO B;  2VB6 A;  3MAC A;  1BU2 A;  3KV5 A;  5F5W A;  3QB5 A;  4U7Y A;  4N78 D;  1YXR A;  4JI3 T;  4KRC B;  2C5I T;  4NXN T;  1OIU B;  3P4R A;  1MMA A;  5JR9 A;  1XZY A;  5L3D B;  2UXB T;  2C6T B;  4A98 A;  2NOX A;  4EIW A;  3CX6 B;  4KX6 A;  3LG7 A;  3X28 B;  3HKB E;  1PKD B;  4HWH A;  2PK2 A;  4EAH A;  2MPK A;  3ZN1 B;  3IBP A;  1G73 A;  4KBM B;  5IYZ E;  2XQ9 A;  2WSS V;  3WAK A;  3DL1 A;  1W0B A;  5AQI B;  3RPU A;  4BJM A;  3WAJ A;  5CYI B;  5IF1 B;  4H9N C;  2EHO C;  4EYY R;  1Z8U A;  3ABV A;  3Q5X A;  4EYU A;  1F5Q B;  3R84 B;  4DR5 T;  3QZ9 B;  4ELL A;  3GMI A;  4H9Q C;  3F31 A;  2B1E A;  3EVY A;  3MA9 A;  4OR5 B;  3SOL A;  4KHZ F;  1YD8 G;  1M7K A;  2YN6 A;  4I43 B;  3H37 A;  3RIU C;  3MJX A;  3ZKR A;  4BCH B;  2KLQ A;  4PFP A;  4YT0 A;  1VYW B;  4HEA A;  1H4L D;  3QWL A;  2KT9 A;  3RKG A;  2NTY A;  3ZJ2 A;  4CFX B;  4EV6 A;  3FHN A;  2BG9 A;  4WW0 A;  3ANW A;  2IIU A;  1R8I A;  3ZCJ A;  1UUR A;  3NZQ A;  4CXW A;  3SS1 A;  2V6Y B;  4BBR M;  1D1A A;  2VWA A;  4DND A;  1SA0 E;  2I40 B;  2XAF B;  1AD6 A;  3C98 B;  2DI4 A;  2XAS B;  5L47 A;  3N9M A;  3UTK A;  1AHJ B;  3K7A M;  4UF0 B;  3PUZ F;  5AQF B;  1FIN B;  3CKD A;  3ZCI A;  2VUR A;  3Q5D A;  4JV5 T;  2ODU A;  3GA8 A;  2C5N B;  2B9R A;  3J7Y q;  2ZLY A;  2CZ0 B;  1QSD A;  4AKH A;  3ZEF B;  4DUY T;  2NW7 A;  4IGU A;  3AEE A;  3TLT A;  4ILB A;  5LMK B;  2LEH A;  4KHP T;  4L5G A;  3P8C D;  4ZI2 C;  1MIW A;  2PK9 B;  2CHO A;  4JUY A;  4LMJ A;  2FBW A;  2KND A;  2V7L A;  2CXF A;  4HWF A;  3BLQ B;  5LBQ B;  3DDQ B;  3O0G D;  2JQ9 A;  3TNW B;  1AIS B;  3LDQ B;  4ROE A;  5LG3 A;  4JEH B;  2KMG A;  2VVN A;  4QX8 B;  2ZPG B;  1H25 B;  4OK0 A;  2HHH T;  2ES0 A;  4P0B A;  3EAB A;  1XO2 A;  2L8K A;  1E1H B;  1IBL T;  2A2F X;  3I1A A;  5ADX L;  4H9O C;  3HKD E;  4DR2 T;  4PFO A;  2C5V B;  4UF0 A;  5FVL A;  2X0H A;  2FJA A;  2WU2 A;  2M67 A;  4CFW B;  2KR6 A;  4LMK A;  3FZF B;  4GK0 E;  5ABF B;  3I0O A;  3VR9 A;  4IHJ E;  1HX8 A;  4F6R C;  4ZI7 E;  2PFV A;  4LFA T;  2E9X C;  3E0Z A;  3CPZ A;  3CVR A;  5LB7 B;  2BG9 B;  2WAU A;  2WMN A;  1MND A;  4PJJ A;  2JRK A;  4JEU B;  3KIN B;  3C4W A;  2X9Y A;  2V8S V;  5C8Y E;  3OYZ A;  4KUM B;  4HWI B;  5J2T E;  2LRK A;  4IRE A;  1WCR A;  4DR7 T;  3ETV A;  1JOW A;  4YY3 T;  4X65 T;  3RX6 A;  2EUF A;  2WWU A;  3ZC1 A;  3VYH B;  1FIO A;  1V9D A;  4YOS A;  5AQS B;  2BKN A;  3MZK B;  3RQW A;  4KP3 C;  4EXT A;  4OGR B;  2FUP A;  2K24 A;  2V7M A;  4GOU A;  4X20 E;  1V29 B;  5FVK A;  2LM2 A;  3L39 A;  4ZS3 A;  1XDP A;  4JI2 T;  3LBX B;  3QHW B;  5FXZ A;  3A8M B;  4F7S B;  2WB5 A;  2W9F A;  1GY3 B;  3N5L A;  4TNW A;  2VQE T;  4C91 A;  2C0S A;  4ROD A;  4YSY A;  1CHU A;  2WS3 A;  4BJN A;  4BCN D;  3VR8 A;  3ESL A;  3X26 B;  2XTL A;  2NWB A;  3CQC B;  1OED C;  1W9R A;  4EOJ B;  3LK4 2;  3X1D A;  2KXP B;  2VL8 A;  2VL0 A;  3KHI A;  5LHG B;  4BCO B;  4IDZ A;  5DQV A;  4ZGJ B;  2JPF A;  3P4S A;  1OKV B;  1ZP2 A;  2YU2 A;  2CZ6 B;  2ZM0 A;  5FKY A;  3IEE A;  3VYG B;  3RI5 A;  4DO0 A;  3CWZ B;  3CX8 B;  1I6Z A;  1UNL D;  3HB9 A;  5HEG A;  3EID B;  2KIN B;  3TLV A;  1VCS A;  2XUE A;  2V6X A;  1OXZ A;  2W2H A;  4U7I A;  1H27 B;  5A1L A;  4CN1 A;  2DME A;  1LRZ A;  1L0V A;  1UGR B;  4DR3 T;  3ZMZ B;  3LK3 B;  3OTO T;  2Z6E A;  2JMK A;  4UEM A;  4DV1 T;  3EDV A;  2UUB T;  2CHN A;  3FZM B;  1J1J A;  2E9X D;  3K8P C;  2J4G A;  4TWH A;  1GH6 B;  2WP9 A;  5LHH B;  3UUM A;  1G3N C;  2CLY B;  1KNZ A;  5FYM A;  3M03 A;  4B6X A;  4EZH A;  1KNP A;  3N2K E;  5ABG A;  2IAK A;  3N9P A;  3KFW X;  2QQ8 A;  5BNJ B;  2J47 A;  2XAQ B;  1UUS A;  2X9W A;  4HNU A;  3K1S A;  4F70 B;  2C5O B;  2LSG A;  3NWI A;  5HQ0 B;  4ISS A;  4YTP A;  3ZT6 A;  2R6G F;  3UFE A;  1WR6 A;  3D0T A;  4MFR A;  3AE2 A;  3ZMS B;  1KEY A;  3HL6 A;  2V22 B;  3CQG B;  3N2O A;  4Z8X A;  2V6Y A;  5JDH A;  2BKZ B;  5AQT B;  1UGS B;  3X25 B;  3JC6 C;  3LFM A;  3UT5 E;  3A8L B;  4NPP A;  2N1G A;  1N4M A;  3JC6 D;  5LNK A;  2YU1 A;  4YSZ A;  2IUB A;  4CRL B;  1QLB A;  4JI1 T;  4CFN B;  3FZK B;  3ZMT B;  5HXS A;  1E9H B;  5LJN A;  4XAX B;  4IL4 A;  3RH3 A;  3QYG B;  1FMV A;  2CCQ A;  1SE7 A;  1WYC A;  5HNB B;  3UQ7 A;  3AE1 A;  2BDE A;  3UU8 A;  3T8O A;  2B76 A;  1EZ3 A;  2QFZ A;  2DCF A;  2DLR A;  4UV9 B;  4F7J B;  3PJA J;  4O4H E;  3EHZ A;  3AEB A;  4H9S E;  4AIU A;  3AAI A;  4AQF C;  5ACB A;  3MXZ A;  1LVF A;  1P5E B;  2IW5 B;  4YOZ A;  2IN3 A;  4ZS2 A;  2YOE A;  5FY0 A;  5LMN T;  4UV8 B;  4NUV A;  1E2A A;  3RRC A;  3RYI E;  1H1Q B;  3PU3 A;  4IT4 A;  5DQW A;  4XBF B;  3LBX A;  5AQN B;  4ASK A;  2RP4 A;  3HO8 A;  5IHY A;  2V1D B;  1M62 A;  2ZM8 A;  2CCI B;  2X9H A;  4EZ4 A;  1ZV4 X;  3C4Z A;  4HFI A;  3U3I A;  5AQR B;  3KDS E;  4EB6 E;  2E2A A;  3FZH B;  3JAE A;  2DWG A;  3QNU A;  1IAP A;  1MMG A;  2LJL A;  3AE5 A;  2V26 A;  3NVO A;  1CUN A;  3RF1 A;  3J9X 1;  4JBW F;  3QYE A;  1JNR A;  2UZE B;  5HEO A;  3S4U A;  4DBR A;  3ZN0 B;  3P50 A;  2DNX A;  2WJ9 A;  4EGW A;  3UU5 A;  4FX3 B;  5J1G A;  2QA7 A;  2XQ6 A;  4ZOL E;  5HBE B;  4HFE A;  2CYZ B;  3P7I A;  2BVL A;  1ZKE A;  1FEW A;  2PMI B;  5EJC A;  4BCF B;  5F8P A;  1UK5 A;  4TX5 A;  1OIY B;  2XJ7 A;  3OKQ A;  1YQ4 A;  2V7K A;  2YIN A;  4BCJ B;  3VRA A;  4KMC A;  4M1P A;  2ZPB B;  1OGU B;  4CI1 B;  3UUL A;  5HXR A;  3RYF E;  2UU9 T;  3UUB A;  2X1N B;  5ABF A;  3X20 B;  2X51 A;  2DHR A;  4WYV A;  4EOK B;  3JAD A;  4AKR B;  1NEN A;  3RIU A;  3IF8 B;  1WLX A;  3AEG A;  4DVD A;  3UU3 A;  2Y8D A;  5J2U E;  2BPM B;  4X66 T;  2LE8 A;  5HBH B;  5L4E A;  3ZYM A;  2C4G B;  5H6Q B;  5KMG P;  2V5D A;  1D0X A;  2WZI A;  2AHJ B;  2QRX A;  2FJB A;  2I6H A;  2LRL A;  2YK0 A;  4BBS M;  2CBJ A;  2DD5 B;  3B57 A;  4IE0 A;  2VK9 A;  4EOR B;  3BQK A;  3PE0 A;  4EOP B;  3MY5 B;  2IDO B;  5LGU B;  3TLW A;  5IUX A;  1UNG D;  2K9A A;  4LF7 T;  2DXC B;  4IE7 A;  4TV9 E;  5JQG E;  3U78 A;  3ZMU B;  1HNW T;  3CIR A;  2YDR A;  3VHL A;  4OB2 B;  2DXB B;  4P09 A;  4PW8 A;  5ABE A;  5HBJ B;  2D5U A;  3UQ4 A;  3AVR A;  3X24 B;  2ZMA A;  3PUS A;  2CJM B;  2DWK A;  4ADZ A;  3OVU A;  1VOM A;  3ZPO A;  5LCY A;  3RGL A;  2MYS A;  5HXC A;  1HNX T;  4OB3 B;  3ZST A;  2XAG B;  2WIH B;  4JI8 T;  4ROC A;  2EHO D;  3POM A;  4HNV A;  5KXJ A;  5AQP B;  5EK3 A;  4OX9 T;  4U3C A;  4ZXL A;  5M4Y A;  1OED E;  1FVV B;  4EEB A;  5C3J A;  3PUY F;  4QH1 A;  4BA9 A;  4F8H A;  3LSV A;  3KV9 A;  3N9Q A;  3FBZ A;  1N32 T;  2BKP A;  3QXE B;  4CXY A;  3I0Q A;  3AED A;  2D9D A;  4IE5 A;  1FMW A;  4QH4 A;  4EOM B;  2E8I A;  4DR1 T;  4DV3 T;  4O8S A;  2MOZ A;  5EFQ B;  2LOS A;  3FB2 A;  3AEA A;  5CGM A;  4U74 A;  2M6B A;  2LSI A;  4EOS B;  3AB3 B;  5L2W B;  1XNQ T;  1HS7 A;  4YSX A;  4NIQ A;  4BCM B;  5FP3 A;  4NC6 A;  1IBK T;  5DAB A;  3KV4 A;  2AXD S;  1D0Y A;  4MAL A;  4BCG B;  3PUW F;  2CM0 A;  1O9K A;  2KZ7 B;  1IJ6 A;  3O1H A;  2XPK A;  5JDG A;  3HBL A;  5JDN A;  5FNV E;  2HN2 A;  4NST B;  2YDS A;  3B13 A;  5J0Z A;  2IHR 1;  2JIW A;  4EC9 B;  4EOO B;  5EK2 A;  2BG9 C;  3RKO A;  2OLT A;  2ZZD B;  3PJA A;  2PG8 A;  2VKJ A;  2CWO A;  1QMZ B;  3GN5 A;  4DV0 T;  2XAJ B;  4PK4 A;  4UVC B;  1YKH B;  2ZM2 A;  3L3P A;  3K3N A;  3SRZ A;  5ICP B;  3KVB A;  4EED A;  1VRB A;  3QUJ A;  4YJ2 E;  3QK6 A;  4X62 T;  4PK5 A;  1H1S B;  5LJM A;  4DMW A;  2W4X A;  3RIF A;  1WYB A;  1VOL A;  2CZ1 B;  3RYH E;  4MFE A;  4PJN A;  4QH5 A;  2UZB B;  3QHR B;  3A8Y C;  3AE8 A;  2BS4 A;  2VQF T;  5I5Z B;  5HVY B;  5L3E B;  5JDF A;  4Z91 A;  2W99 A;  3G33 B;  2JQQ A;  4I4T E;  4EOZ B;  4JI7 T;  4LFC T;  3NKZ A;  2HN1 A;  3AEC A;  2OV9 A;  4X1Y E;  2JQH A;  4IDN A;  2WMB B;  1W0A A;  5AQQ B;  4BXX X;  5FGK B;  3L8R A;  5FXX A;  2V7I A;  2XAH B;  4C90 A;  2Y48 B;  4LML A;  4AQY T;  5L3G B;  4HLQ A;  2SPC A;  1HX1 B;  3Q5W A;  4ERR A;  3ANW B;  3H4C A;  3WI3 A;  1OKW B;  1T72 A;  4Y72 B;  3R6N A;  1OL1 B;  2BVM A;  2CBI A;  3F2E A;  2NW9 A;  2NW8 A;  1JSU B;  3OYX A;  4BCN B;  1W98 B;  5AQU B;  5HCM A;  1DU2 A;  2H7O A;  3T1H T;  2RA1 A;  2G9X B;  1N36 T;  2ZPE B;  4Z90 A;  4KI0 F;  2ACX A;  2G0U A;  5L3F B;  1I94 T;  1N33 T;  5HEU A;  2CWY A;  1BR4 A;  2CCH B;  4CXA B;  2QYW A;  5JTG A;  2DL1 A;  1WFD A;  4J2C A;  4O2B E;  1UGO A;  1B7T A;  3ZC0 A;  4YC3 B;  4WNK A;  3MI9 B;  2D0Q B;  4ANJ A;  1XNR T;  3CX7 B;  3C50 A;  1US7 B;  3ZYK A;  4ZI3 C;  4U33 A;  5FXW A;  1GQE A;  2C5J A;  2VVS A;  5JDM A;  2UUE B;  1LKX A;  4YHH T;  3DJB A;  3AXJ A;  1VCT A;  2XQ8 A;  2M6I A;  3HKE E;  2XQY A;  2WMA B;  4KRD B;  2VAS A;  5JR9 B;  4QXC B;  1NAF A;  2CRB A;  1U5P A;  1AJ3 A;  5IWA T;  3TLU A;  4BY1 X;  3PUA A;  2CLY C;  2LSK A;  3RYC E;  1IJ5 A;  2UXN B;  3AE7 A;  2VKH A;  4AQG A;  1OL2 B;  3NDQ A;  3TLS A;  4MBQ A;  3GN5 B;  5GON E;  3QYB A;  1XWM A;  2WDV A;  2GK9 A;  4IIJ E;  4H63 V;  1XMO T;  3VU7 H;  3QC9 A;  1KF6 A;  4EOQ B;  1VIN A;  2BZB A;  4I55 E;  2WY2 A;  4MLK A;  1HG5 A;  4HFV A;  2CE7 A;  1T98 A;  3B5M A;  1GUX B;  4BCM D;  1LVK A;  4B3M T;  3E08 A;  4YFS A;  2K48 A;  2WQY A;  2XHE B;  1UX4 A;  4X64 T;  1BR1 A;  4U72 A;  2XSA A;  3JCF A;  2CXL A;  4X5T A;  1URC B;  5HEJ A;  3MIA B;  2Q9Q B;  5AQH B;  2H89 A;  4TTH A;  4H63 H;  4V1A v;  4DID B;  4Z6Y A;  3RIA A;  1UX5 A;  2CPT A;  1QUU A;  4OHF A;  4DUZ T;  1D1B A;  4GK5 E;  1D0Z A;  2JMH A;  5LBM A;  4YXD A;  4LF6 T;  4IE6 A;  3P4Q A;  3P4P A;  1YW0 A;  1FJG T;  2A72 A;  4U2Z A;  4ZEY A;  4PK6 A;  5JRE A;  2WDQ A;  2HH7 A;  3T1Y T;  1ZEE A;  5AQG B;  1MNE A;  3WVD B;  3FXD B;  1J5W A;  3V5U A;  4EOI B;  3C64 A;  4LF4 T;  4DBQ A;  3M3Z B;  3TKL B;  5JDL A;  3ONJ A;  5LXT E;  1S94 A;  2DD4 B;  2WFY B;  3O1J A;  3BQI A;  3AA7 B;  3GTM S;  4CZZ B;  3AE9 A;  3E22 E;  1FKM A;  5E0O A;  4ZGD B;  4HFB A;  2VKD A;  4ILA A;  4JYA T;  3N2G E;  2NR4 A;  3EAM A;  5JR9 C;  3O9X A;  3DDP B;  4AKL A;  4BAY B;  4WBO A;  1Y64 B;  1WRD A;  4IDP A;  2UZL B;  4AI6 A;  5LQF B;  2WMO A;  3SWH A;  4QXH B;  4CFU D;  2QF7 A;  5FY1 A;  3Q9D A;  5EZY E;  3ZT5 A;  1HR0 T;  4BCQ D;  1X79 A;  1XMQ T;  1G8X A;  3BLR B;  4IDQ A;  2VKO A;  5AQL B;  3KVA A;  5JRC A;  4JI6 T;  1H1P B;  2WPA B;  3PUG A;  3M65 A;  5CFB A;  5HYA A;  4MFD A;  4G2A A;  2LLY A;  2NTX A;  3ZMV B;  2D0U A;  4YTM A;  4UR9 A;  1UNH D;  4DMV A;  1TD6 A;  4CXX A;  4QX7 B;  2XQA A;  2IW9 B;  4I0U A;  1E7P A;  3ZLI A;  3KV6 A;  4O2A E;  4HGA A;  3Q5E A;  4F7N B;  2X68 A;  4E7Z A;  5CA1 E;  1D3U B;  2NP9 A;  4B3R T;  4TWD A;  1OI9 B;  4GYS A;  2W62 A;  4K0K T;  1HNZ T;  2QVA A;  5AQV B;  4A56 A;  2JJ9 A;  1BR2 A;  3IA3 A;  2I0M A;  5H6R B;  3Q2M A;  5HWY A;  4DR4 T;  1MMD A;  4U31 A;  1MIV A;  2C5K T;  5AQO B;  2A9U A;  4JI5 T;  2LHN A;  5JDQ A;  5EK4 A;  2W2U A;  1MMN A;  4G63 A;  1OED A;  3SFD A;  1H7C A;  4UIG A;  2X67 A;  3A8O B;  5CEI B;  4F6W B;  1H24 B;  1T8B A;  1JNZ A;  5FL1 A;  1HTJ F;  3OPC A;  2XM2 A;  3TW7 A;  3AE4 A;  1MIY A;  4HFH A;  5TAO A;  2UZD B;  3UUN A;  3HHT B;  4IMY B;  2IC6 A;  4QSH A;  4BCQ B;  5L3C B;  3VKH A;  2LSY A;  3PDY A;  3FZL B;  4TZ4 C;  4HWD A;  5CJ5 A;  4L0R A;  2UUA T;  2KWH A;  4ZGE B;  4JX6 A;  2H7V C;  2V7J A;  2CEA A;  5L3B B;  1O3X A;  1YQ3 A;  4HWC A;  5L4H A;  3DP7 A;  1SHZ C;  2ZPI B;  2QDJ A;  1H28 B;  1Z0P A;  5FMN A;  4F7L B;  4E7S A;  2UUC T;  5JRC B;  3RRW A;  4K0U A;  4LF9 T;  4JX4 A;  4HFD A;  4HN9 A;  4O4J E;  3AEF A;  2W61 A;  2ZM6 T;  3HZJ A;  4MHC A;  2IW6 B;  3ZJ1 A;  4I50 E;  4PAG A;  3AE6 A;  3DOG B;  2JGZ B;  2H3R A;  2XZE A;  1J5E T;  3ZSS A;  4GKK T;  4TUY E;  2XQ3 A;  4UVB B;  2XSB A;  3QZ5 B;  4ZZC A;  3LK2 B;  3BHV B;  1S35 A;  4LF8 T;  5CA0 E;  1OED B;  3ONX A;  2XM1 A;  1YKE B;  2WZH A;  3RHW A;  2BBJ A;  4YHJ A;  3ETU A;  4DV5 T;  3BG5 A;  2IVX A;  3O4X E;  4BCK B;  2V5C A;  3AA6 B;  3FBL A;  4H9R C;  1U4Q A;  2N9D A;  5DJQ C;  3HI2 A;  3RC8 A;  5ETW A;  3CML A;  5BMV E;  5AQM B;  4QWN B;  2ZCF B;  5L2L A;  3UU4 A;  2X0L B;  4UEL A;  4EOL B;  2J1D G;  2X0Y A;  3HR0 A;  5LMU T;  4ILU A;  2I59 A;  3ZT7 A;  2BKO A;  3UU6 A;  2QGS A;  2ZPH B;  3RQU A;  4LOC A;  4AXP A;  3BHU B;  2BBH A;  3TW6 A;  3F57 A;  2HPJ A;  2Q9Q C;  5ABH A;  2D0T A;  3BK9 A;  4PJM A;  4TNV A;  2XQ7 A;  4AIS A;  1T7S A;  5KDM C;  1KNR A;  4BCP B;  5JH7 E;  3IHR A;  3QOF A;  3PUV F;  1WR0 A;  2IW8 B;  4X1K E;  3OJA A;  3QB5 K;  2LKG A;  5CB4 E;  4IL9 A;  4ELJ A;  5LGT B;  4F6U B;  2MTQ A;  1D1C A;  2K3W A;  3UFG A;  4COF A;  2E5V A;  4TWF A;  4DV4 T;  4O4L E;  3NBX X;  2A3D A;  2KSR A;  5F3J A;  2CXD A;  3N9N A;  3BHT B;  3HA4 A;  2CA5 A;  1NEK A;  3H3A A;  3TN8 B;  1KK7 A;  2FJE A;  2FJD A;  4X1I E;  5FY7 A;  5HAX A;  2W0G A;  4HFC A;  3PUX F;  3EJ1 B;  2IC9 A;  3L09 A;  1BR0 A;  4OB0 B;  2WHB B;  3EUH A;  3W15 B;  4IE4 A;  1NWM X;  2W66 A;  3N9L A;  4L9I A;  1TFB A;  4AQF A;  2IML A;  4EC8 B;  3PUQ A;  4ZI2 D;  4FI5 A;  3KBU A;  3VKG A;  4GKJ T;  2UXX B;  4HE8 A;  3FXE B;  1KFY A;  1UGQ B;  2PTF A;  2PJQ A;  4F6S B;  2G77 A;  2RPA A;  5LYJ E;  4UVA B;  2P9B A;  2E5L T;  2YEV C;  2I53 A;  2EHO A;  3C51 A;  2W67 A;  4CI2 B;  2UXC T;  3UUX B;  2UXD T;  3AXJ B;  1ZP0 A;  3MK7 C;  3SFE A;  2F2C A;  2ODV A;  4LF5 T;  2LT3 A;  2YKS A;  5HWX A;  1SUM B;  2WWV A;  4TN7 B;  2PHG A;  3A5X A;  4MIM A;  2R7G A;  2F4V T;  4ZHQ E;  4M6V A;  3RLF F;  3EI0 A;  4PNI A;  3I9Y A;  4TV8 E;  2QDY B;  2WCA A;  4BY7 X;  1ZOY A;  4OYK A;  3N9O A;  2XQ4 A;  4DV2 T;  4B3S T;  4YOO A;  4FM4 B;  5JVD E;  4WZX A;  4CFU B; 
#chains in the Genus database with same CATH homology
 4P09 A;  2L3L A;  4JEU B;  4PW8 A;  2D5U A;  2MBG A;  3KIN B;  3K3O A;  4PJL A;  3C4W A;  2X9Y A;  3AVR A;  3O1J A;  4CQI A;  5C8Y E;  4AKI A;  3OYZ A;  3BQI A;  4KUM B;  3AA7 B;  2Q9Q D;  2ZMA A;  5LGN B;  3PUS A;  5J2T E;  2DWK A;  4ADZ A;  4CZZ B;  3ZPO A;  1VOM A;  3E22 E;  5LCY A;  3HKC E;  5E0O A;  2E9X A;  2OA5 A;  2MYS A;  5HXC A;  4CI3 B;  3ETV A;  2XAG B;  4XZC A;  5FXV A;  3K3Q C;  2VKD A;  1HFA A;  2EHO D;  2N2N A;  1ZHC A;  3RX6 A;  3N2G E;  4FJO A;  4GYR A;  2WWU A;  5JR9 C;  3O9X A;  3ZC1 A;  2KWI B;  3NRY A;  1FIO A;  1V9D A;  5LOV E;  4AKL A;  4BAY B;  5EK3 A;  1IZN B;  4WBO A;  3MZK B;  1Y64 B;  1WRD A;  5M4Y A;  4KP3 C;  5LG4 A;  5LA6 E;  4EXT A;  3PUR A;  4AI6 A;  2CMR A;  3AAA B;  4H9P C;  4WBN E;  5HXH A;  2WMO A;  4ZI3 D;  3SWH A;  4QXH B;  2K24 A;  2HPL A;  4O4I E;  5FY1 A;  2V7M A;  3Q9D A;  3PU8 A;  5EZY E;  3AA1 B;  4BA9 A;  1X79 A;  4GOU A;  3KV9 A;  3N9Q A;  1G8X A;  3FBZ A;  4X20 E;  2VKO A;  5JRC A;  3KVA A;  5LP6 E;  4CXY A;  3I0Q A;  3LJC A;  4IE5 A;  1FMW A;  4ZS3 A;  3LBX B;  3PUG A;  5FXZ A;  3M65 A;  5HYA A;  2PBI A;  2LHR A;  2E8I A;  2K5B B;  4G2A A;  1HF8 A;  3N5L A;  2NTX A;  4O8S A;  3ZMV B;  2D0U A;  2MOZ A;  2LOS A;  3FB2 A;  4JLE A;  4DMV A;  4C91 A;  5LJN A;  2C0S A;  4U74 A;  4BJN A;  2LSI A;  3AB3 B;  4CXX A;  5HXE A;  4QX7 B;  3ESL A;  2XTL A;  2W63 A;  3ZLI A;  1HS7 A;  3BQL A;  4AKG A;  3KV6 A;  4O2A E;  4HGA A;  2NWB A;  2X68 A;  3CQC B;  5FP3 A;  4E7Z A;  5CA1 E;  5DAB A;  3KV4 A;  4GIW A;  4P0A A;  2NP9 A;  1D0Y A;  4MAL A;  3OBV E;  3LK4 2;  2D2S A;  2KXP B;  3O1I A;  2VL8 A;  4GYS A;  2CM0 A;  2W62 A;  2KZ7 B;  3KBT A;  3C4X A;  3I9W A;  1OWA A;  4A56 A;  5LHG B;  3PTR B;  2JJ9 A;  4HTE A;  1BR2 A;  4IDZ A;  1IJ6 A;  5DQV A;  2WM9 A;  3MKD A;  3O1H A;  4IST A;  4QHO A;  5H6R B;  5JDG A;  2JPF A;  3Q2M A;  1HCI A;  3NRX A;  5HWY A;  3EDU A;  2YU2 A;  5JDN A;  2ZM0 A;  5FNV E;  1MMD A;  2KMF A;  3B13 A;  1MIV A;  2E9X B;  3IEE A;  1UCU A;  5LHI B;  2C5K T;  2WBL A;  4OYJ A;  2LHN A;  4QKN A;  5JDQ A;  4DO0 A;  5EK2 A;  3RKO A;  5EK4 A;  3CWZ B;  3CX8 B;  1MMN A;  2Q9Q A;  4G63 A;  2PG8 A;  1H7C A;  2VKJ A;  4QXB B;  2CWO A;  4YJ3 E;  1HG2 A;  2KIN B;  3GN5 A;  4UIG A;  2X67 A;  5KX5 E;  2XAJ B;  3DTO A;  4PK4 A;  2XUE A;  3AVS A;  3NZP A;  1OXZ A;  4UVC B;  2X66 A;  4OFZ A;  1YKH B;  2ZM2 A;  3L3P A;  3K3N A;  3SRZ A;  5A1L A;  1HTJ F;  5L3F B;  3AAE B;  3KVB A;  1VRB A;  2X9X A;  1LRZ A;  2Y6X A;  4UXN B;  3CQX C;  3QUJ A;  1MIY A;  4YJ2 E;  3QK6 A;  3AA0 B;  5TAO A;  3V5S A;  2LM9 A;  4PK5 A;  3ZMZ B;  2L9Q A;  3LK3 B;  5LJM A;  2LSJ A;  3UUN A;  2W00 A;  2Z6E A;  4DMW A;  2JMK A;  2IC6 A;  1WYB A;  4UEM A;  5L3C B;  3EDV A;  3VKH A;  3RYH E;  2LSY A;  3PDY A;  4HKA A;  4PJN A;  4TZ4 C;  3RC3 A;  5AFU L;  2E9X D;  4L0R A;  3K8P C;  2LOP A;  2KWH A;  4YLH A;  2H7V C;  2V7J A;  5LHH B;  4NUU A;  3UUM A;  2CEA A;  5L3B B;  2CLY B;  1O3X A;  5L3E B;  5JDF A;  1KNZ A;  5FYM A;  3DP7 A;  1SHZ C;  3GWH A;  1Z0P A;  2JQQ A;  5FMN A;  4E7S A;  4B6X A;  4I4T E;  4EOZ B;  5JRC B;  3ZYL A;  2EHO B;  2VB6 A;  3MAC A;  4EZH A;  3RRW A;  3N2K E;  4K0U A;  3KV5 A;  2IAK A;  3N9P A;  3KFW X;  4HN9 A;  4O4J E;  4X1Y E;  2W61 A;  2XAQ B;  4MHC A;  3ZJ1 A;  4I50 E;  2X9W A;  4PAG A;  4N78 D;  5FXX A;  4C90 A;  2XAH B;  2V7I A;  2H3R A;  2LSG A;  2Y48 B;  4ISS A;  5L3G B;  3UFE A;  2C5I T;  1WR6 A;  3D0T A;  2SPC A;  3Q5W A;  4MFR A;  3ANW B;  4ERR A;  4TUY E;  3WI3 A;  3ZMS B;  4UVB B;  1MMA A;  5JR9 A;  3HL6 A;  3CQG B;  3N2O A;  4Z8X A;  3LK2 B;  5JDH A;  3R6N A;  5L3D B;  2BVM A;  1S35 A;  5CA0 E;  3F2E A;  3JC6 C;  3LFM A;  3UT5 E;  3ONX A;  2NW8 A;  2NW9 A;  1YKE B;  2N1G A;  2NOX A;  4EIW A;  3CX6 B;  3OYX A;  4YHJ A;  3ETU A;  3LG7 A;  3HKB E;  3JC6 D;  5LNK A;  2YU1 A;  4EAH A;  3ZN1 B;  2H7O A;  3IBP A;  2RA1 A;  1G73 A;  4KBM B;  5IYZ E;  3O4X E;  2ACX A;  2G0U A;  2WSS V;  3AA6 B;  3FBL A;  4H9R C;  1U4Q A;  3WAK A;  4XAX B;  3ZMT B;  5HXS A;  2N9D A;  5DJQ C;  3HI2 A;  3RPU A;  2CWY A;  5ETW A;  3RH3 A;  3CML A;  4BJM A;  5BMV E;  3RC8 A;  1FMV A;  3WAJ A;  1BR4 A;  2CCQ A;  4H9N C;  4QWN B;  5L2L A;  2EHO C;  1WYC A;  2X0L B;  4EYY R;  4UEL A;  4J2C A;  2J1D G;  4O2B E;  3HR0 A;  2BDE A;  3Q5X A;  4EYU A;  3T8O A;  1B7T A;  3R84 B;  1EZ3 A;  3ZC0 A;  3GMI A;  4ILU A;  2I59 A;  2DCF A;  2DLR A;  2QGS A;  4H9Q C;  4UV9 B;  4O4H E;  4WNK A;  3F31 A;  2B1E A;  4AXP A;  3EVY A;  3MA9 A;  3SOL A;  4ANJ A;  3CX7 B;  3C50 A;  1US7 B;  3F57 A;  4H9S E;  3ZYK A;  2HPJ A;  3AAI A;  2Q9Q C;  4AQF C;  4ZI3 C;  3MXZ A;  1YD8 G;  4I43 B;  1LVF A;  2D0T A;  3H37 A;  3BK9 A;  4PJM A;  2IW5 B;  3MJX A;  5FXW A;  2C5J A;  2KLQ A;  5JDM A;  5KDM C;  1LKX A;  4PFP A;  4ZS2 A;  5FY0 A;  3DJB A;  4UV8 B;  4NUV A;  3RRC A;  4HEA A;  3RYI E;  5JH7 E;  3HKE E;  3IHR A;  2KT9 A;  3PU3 A;  2NTY A;  2XQY A;  3ZJ2 A;  5DQW A;  2VAS A;  5JR9 B;  3FHN A;  4WW0 A;  4XBF B;  3LBX A;  3ANW A;  4ASK A;  2RP4 A;  4QXC B;  3ZCJ A;  1NAF A;  4X1K E;  5IHY A;  2V1D B;  1U5P A;  3NZQ A;  3OJA A;  1AJ3 A;  4CXW A;  2ZM8 A;  3SS1 A;  2X9H A;  5CB4 E;  4EZ4 A;  1ZV4 X;  3C4Z A;  1D1A A;  2VWA A;  3PUA A;  3KDS E;  3U3I A;  4DND A;  1SA0 E;  2CLY C;  2LSK A;  2XAF B;  4EB6 E;  3C98 B;  2DI4 A;  3RYC E;  5LGT B;  2XAS B;  1IJ5 A;  2MTQ A;  2UXN B;  2VKH A;  2DWG A;  3N9M A;  1IAP A;  1MMG A;  3UTK A;  4AQG A;  2LJL A;  2V26 A;  4UF0 B;  1D1C A;  1CUN A;  4MBQ A;  3J9X 1;  3CKD A;  3ZCI A;  3GN5 B;  5GON E;  4O4L E;  3NBX X;  2A3D A;  3S4U A;  4DBR A;  2GK9 A;  2ODU A;  3ZN0 B;  3GA8 A;  2DNX A;  5F3J A;  2CXD A;  5J1G A;  3J7Y q;  2QA7 A;  4ZOL E;  4IIJ E;  3N9N A;  4H63 V;  3HA4 A;  2ZLY A;  2CA5 A;  3P7I A;  1QSD A;  3VU7 H;  3H3A A;  3QC9 A;  3ZEF B;  4AKH A;  2BVL A;  2NW7 A;  1KK7 A;  1ZKE A;  4IGU A;  1FEW A;  4X1I E;  5FY7 A;  5HAX A;  2W0G A;  5F8P A;  2IC9 A;  2BZB A;  2LEH A;  3L09 A;  4TX5 A;  4I55 E;  1BR0 A;  3OKQ A;  4L5G A;  3P8C D;  2V7K A;  2YIN A;  4MLK A;  3EUH A;  3W15 B;  1HG5 A;  4HFV A;  2CE7 A;  4IE4 A;  1T98 A;  4KMC A;  4ZI2 C;  4M1P A;  1NWM X;  4L9I A;  3N9L A;  1MIW A;  1LVK A;  4CI1 B;  4AQF A;  3E08 A;  4JUY A;  3UUL A;  5HXR A;  4YFS A;  2K48 A;  2XHE B;  1UX4 A;  3RYF E;  2KND A;  3PUQ A;  2V7L A;  4ZI2 D;  1BR1 A;  4FI5 A;  2CXF A;  3KBU A;  3VKG A;  4U72 A;  2UXX B;  2CXL A;  5LBQ B;  4HE8 A;  2X51 A;  2DHR A;  3FXE B;  2Q9Q B;  2PJQ A;  4H63 H;  4V1A v;  5LYJ E;  4JEH B;  4UVA B;  1UX5 A;  4AKR B;  2P9B A;  2YEV C;  4QX8 B;  3IF8 B;  1WLX A;  1QUU A;  4DVD A;  2EHO A;  2Y8D A;  3C51 A;  4OK0 A;  4CI2 B;  5J2U E;  4OHF A;  2ES0 A;  3UUX B;  4P0B A;  1D1B A;  2LE8 A;  3MK7 C;  3ZYM A;  5H6Q B;  2L8K A;  1E1H B;  2ODV A;  5KMG P;  1D0X A;  4GK5 E;  1D0Z A;  2JMH A;  2A2F X;  5LBM A;  3I1A A;  5ADX L;  4H9O C;  3HKD E;  2LT3 A;  5HWX A;  4PFO A;  4UF0 A;  4IE6 A;  1YW0 A;  2YK0 A;  4TN7 B;  3B57 A;  4IE0 A;  2M67 A;  2VK9 A;  3A5X A;  2A72 A;  4PK6 A;  5JRE A;  3BQK A;  3PE0 A;  4ZHQ E;  2HH7 A;  1ZEE A;  4GK0 E;  5LGU B;  3I0O A;  1MNE A;  4IHJ E;  1HX8 A;  4F6R C;  3FXD B;  2PFV A;  4ZI7 E;  4PNI A;  3I9Y A;  2E9X C;  3V5U A;  3E0Z A;  4TV8 E;  3C64 A;  2K9A A;  3CPZ A;  3CVR A;  4OYK A;  3N9O A;  4IE7 A;  4TV9 E;  5JQG E;  3U78 A;  2WAU A;  3ZMU B;  2WMN A;  1MND A;  4DBQ A;  3VHL A;  3TKL B;  5JVD E;  5JDL A;  5LXT E;  4PJJ A;  1S94 A;  2JRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...