2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein lp_2664
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
molecule tags Structural genomics, unknown function
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
3B57A 2PJQA 3DJBA 5DQWA 5DQVA 5IHYA 3DTOA 2QGSA
chains in the Genus database with same CATH superfamily
3RHWA 2NP9A 3RF1A 4HFHA 3UU6A 4EOJB 4JBWF 4ZZCA 4B3ST 5HEGA 2K24A 4G6LB 3K1SA 2C6TB 5FYMA 3V5UA 3QHRB 4NXMT 4EEDA 4ILCA 2CZ6B 5AQJB 2BG9A 3RYHE 3O1HA 3NRYA 2WS3A 2DXCB 4GK5E 2Y6XA 4ZEYA 4G63A 5AFUL 1NENA 3N9PA 2LHNA 5C2TA 2V8SV 1CHUA 3AECA 1MMNA 1C9BA 4EYUA 4CFWB 3LBXB 3PUXF 1JOWA 3H3AA 5ICPB 2XAQB 5LG4A 1J5ET 2LLYA 2ZM0A 4BXXX 4HNVA 3PUVF 3UUBA 4YJ3E 4K0KT 2Q9QD 4GOUA 2C5XB 2XASB 4BJMA 1FKMA 4YT0A 3IF8B 4LMKA 4OB3B 3SFEA 4UEMA 3PJAJ 4A97A 4WBOA 4A5XA 4DV4T 4ISTA 1SHZC 3Q5EA 4AISA 2CLYC 3WAJA 3UUNA 2P9BA 4BCGB 3DDQB 2Z6EA 4YSXA 2IAKA 2W0GA 5AQIB 2V7MA 3OVUA 2YN6A 2XQ5A 1ZOYA 3A8HB 4NXNT 2XTLA 4BCJB 2EHOD 3N9QA 2ZPGB 3A7MA 1E9HB 3LJCA 5CA1E 4YC3B 3DOGB 1UNLD 1AJ3A 1LKXA 4YSYA 3S4UA 5HXEA 1DU2A 4LF6T 1H24B 4CI3B 4PK5A 3RI5A 3H3MA 3BLQB 4F7JB 2ES0A 5L3DB 3KDSE 4CZZB 3BQIA 3MXZA 5LBMA 4AQFA 2IUBA 3ZYMA 2WIHB 1XMQT 1KNZA 5HYAA 5JRCB 3FHNA 2WZHA 5IYZE 4A56A 5GONE 3RGFB 4EOSB 2UXDT 3F57A 4YY3T 4GKKT 3GN5B 3ZMVB 4CN4A 2J1DG 2VL8A 5LGNB 5FL1A 4CN1A 2FJDA 1Y64B 1G73A 4TNWA 2W66A 3DDPB 5JVDE 4CI2B 2PG8A 1N4MA 4LF8T 2LW4A 1OWAA 3ZPOA 3RYIE 2MPKA 4EIWA 1FVVB 4FM4B 1SUMB 4EOIB 2WQYA 2KLQA 1T72A 3OBVE 4L5GA 3NDQA 4K0UA 4HEAA 1UGOA 4L0RA 3EAMA 1TFBA 2BKZB 2WP9A 2WMOA 3EUHA 2L9QA 2CHOA 4BA9A 4O2BE 5L3GB 3L39A 1M7KA 5KXJA 2DHRA 5ABHA 3BLRB 5JH7E 2CZ0B 5L2LA 4CFMB 2V6YB 4YTNA 4ZGDB 3ZEFB 4ZGEB 1H1QB 3JCFA 3C98B 1FMWA 3RPUA 2BVLA 2WJ9A 2C0SA 3UFGA 2X0LB 3X26B 4IHJE 3EJ1B 3P4QA 3WVDB 5LP6E 2DWGA 3CIRA 3HZJA 3ZN0B 2Y48B 4IDPA 1BR1A 3AAIA 4L9IA 2ZMAA 3TLVA 3HL6A 4TN7B 3QUJA 2W2HA 4XAXB 2WAUA 4UELA 2MYSA 3KINB 1YW0A 2X0HA 1US7B 3ZC0A 5LOVE 5FVKA 1FINB 5LGUB 2H7VC 1V29B 5KDMC 5LQFB 4DBRA 1WLXA 4QWNB 5E0OA 3JC6C 2IW5B 5L4HA 1OL1B 3RKOA 4NSTB 3LFMA 3A8GB 1QSDA 3AE5A 4HN9A 3QC9A 4JX5A 5FGKB 3FBLA 5L4EA 3EI0A 5HWXA 3PU3A 3N9MA 1VYWB 4GKJT 4FJOA 1MMGA 3HA4A 3M03A 2X9WA 3X28B 1W09A 5JR9A 5AQKB 4KMCA 4N78D 2V5CA 4NIQA 1L0VA 3I0OA 5ACBA 1H4LD 1M62A 4BBRM 1IREB 4HWIB 3QNUA 2AHJB 3TW7A 4A98A 2QDJA 4OB2B 4KHZF 3TLTA 4ZZBA 5LXTE 2UXBT 2OV9A 1UX5A 2W9ZA 4EC8B 4IIJE 4CFNB 3MI9B 3SFDA 1ZP0A 4CFUB 1MNDA 2LJLA 4B3MT 3SWHA 2ZM8A 2X9XA 3J9X1 3SOLA 3AA1B 1MNEA 4PFPA 2WWVA 4NUVA 2BS4A 1E1HB 2E9XA 4O8SA 2M6BA 1HG2A 5FXVA 3LSVA 3N9OA 3CQCB 2BKPA 4I4TE 2QDYB 2MTQA 2KWIB 2W67A 3P4WA 2D0QB 2WMBB 2VASA 5JDNA 4IDOA 3RC8A 3BHUB 3DTOA 1ENWA 2LHRA 2DI4A 1YQ4A 5FY0A 4II5B 2WZIA 2DL1A 2BS3A 1UNGD 5EFQB 5FMNA 3KVBA 2W63A 4U31A 3RKGA 4UVAB 2NW9A 3JC6D 2CBIA 1JKWA 2J62A 4DV7T 2C5KT 3FZKB 2NTYA 4BCQD 2AXDS 2W2UA 4OX9T 2W00A 3KV9A 4Y72B 3IA3A 2KWHA 3O1JA 5EK4A 3ZMSB 1HNWT 4JI7T 4JEHB 3KFWX 1UUSA 3ONXA 2HPJA 2OA5A 3LK42 3OJAA 4QX7B 4CN6A 3MY5B 3CPZA 2J47A 1MIWA 2N1GA 5LHIB 4B6XA 4HL4A 2WDRA 4TNVA 4YOOA 3L8RA 1GY3B 4DV3T 4HFBA 4X64T 2VURA 3AA7B 3PE0A 4DV6T 2QQ8A 3O1IA 4LF9T 1H25B 2UZEB 1PKDB 3QB5K 1VINA 5L2WB 2Q9QB 4ROCA 3K8PC 2ZPHB 2W9FA 2VWAA 3E0ZA 4E7ZA 3P50A 2WXVB 2JIWA 1XO2A 2Q9QC 4X1YE 4ZOLE 3RIAA 5HAXA 2C5JA 2CYZB 2CXDA 2EHOB 1QMZB 5HBJB 3N9LA 4YOZA 4H63V 2H89A 3HO8A 3JAEA 5BNJB 4IDZA 3N2GE 2D0TA 5HVYB 2PBIA 3EOCB 5FY7A 2G77A 2IHR1 2E5LT 4TTHA 2KMFA 2ZPBB 1P5EB 3VU7H 4P0AA 3Q2MA 4DV0T 5CEIB 4OB0B 3LG7A 5HXSA 2BDEA 2VK9A 3VR8A 3UQ4A 4PK6A 2CWOA 1W0BA 1D1BA 1UGRB 2BKOA 4MFDA 2IMLA 3PU8A 4NUUA 2ZLYA 2XSBA 5FL0A 3A8YC 4KP3C 1HR0T 2YKSA 1Y01A 3MKDA 4YLHA 4JYAT 4I55E 1NEKA 5ETWA 3LDQB 1BU2A 2YDQA 2WU2A 3UTKA 3SS1A 3ABVA 4I3ZB 2BG9C 3QOFA 2ACXA 4KX6A 3AE9A 1WYCA 4HTEA 1W0AA 2BPMB 2CXLA 3FBZA 2NW8A 5DQWA 4HWCA 4C90A 3QK6A 4V1Av 4OB1B 1XDPA 2C5IT 5I5ZB 4ELJA 4JI0T 3RIUA 1BR0A 2R6GF 3VYHB 2D9DA 4UN0A 4LF4T 3VHLA 3C51A 3OYXA 4HFEA 3NZQA 4IL9A 2CZ7B 4NPPA 3AA0B 4U3CA 3RQWA 2K5BB 4LMLA 2V7LA 3QHWB 3BG3A 3PDYA 1OI9B 2IDOB 3DP7A 1JNRA 1H1PB 2CLYB 3PUZF 3L09A 5IUXA 4HWDA 3GTMS 1IJ6A 2DNXA 2ODUA 4TV8E 3AA6B 1IJ5A 2LE8A 4ZS2A 3LBXA 4HE8A 4UXNB 1UGPB 3O0GD 2UUBT 4KRDB 2E2AA 2DLRA 4JI5T 4CXAB 2DD5B 1U4QA 2ZPFB 1OKVB 1D0ZA 5J0ZA 4XBFB 4B3TT 3X24B 2VKJA 3HR0A 3PO3S 5IHYA 5FNVE 5L3CB 3ZMZB 2CCQA 4EZ4A 2LOSA 4I43B 4LOCA 1VOMA 2XQ9A 5HEUA 2YU1A 2VVNA 5LMNT 2D5UA 4RODA 2JQQA 3ANWB 5M4YA 2QFZA 2QRXA 1D3UB 5JDLA 4PFOA 5LMUT 1XWMA 1XNRT 5ABEA 2HN1A 3OYZA 2G0UA 3VRBA 3A8MB 4AQFC 4CXYA 2XQAA 2HN2A 1HFAA 2WM9A 1V9DA 1ZHCA 4E7SA 4WBNE 5DABA 2A2FX 3FZHB 4U2ZA 3QYEA 4EOLB 5JQGE 1MMDA 1VRBA 4QXCB 4HNTA 3I1AA 5FKYA 3OPCA 1T8BA 5AQQB 4KBMB 4PJJA 5JRCA 2IW8B 2HHHT 5HCMA 2XQ6A 3AEDA 4EGWA 3K7AM 4JI8T 2IW9B 3SRZA 5JDQA 5AQUB 4JI3T 3AE4A 2H88A 2IC6A 5FP3A 2X68A 5HCJA 4IL4A 3GN5A 2ZPIB 4F6UB 1GH6B 2KT9A 2JJ9A 4QH5A 4U2YA 1H26B 3PUAA 2D2SA 4AKGA 3CWZB 3K3NA 3POMA 4AKHA 1XDOA 2AE9A 4OFZA 1OEDB 4LMJA 3QYHB 2JQ9A 4UV8B 4JI6T 2ZZDB 4M6VA 2C4GB 3P4RA 4Z90A 5HQ0B 4AKIA 4X20E 1OL2B 2K9AA 4XZCA 1OEDC 1XMOT 3TLUA 3OKQA 2BS2A 4PW8A 3B57A 4BCMD 3QZ5B 2A9UA 3BHVB 4YTMA 5CJ5A 1IBMT 2UUAT 3X25B 1BR2A 3CMLA 3ONLC 4U33A 3MA9A 4DR3T 1FEWA 4EOPB 5F5WA 3TNHB 2ZM6T 1R8IA 2MAWA 4TX5A 4QSHA 4JI2T 3ZT7A 2BKNA 4DR5T 4BCND 4X5TA 2XQ8A 5HEHA 2WDQA 2XHEB 4JV5T 3TN8B 4CXXA 4X62T 3X1DA 4UF0B 2V5DA 3HI2A 2LSYA 5AQHB 3LK3B 2JRKA 4BJNA 4BCQB 4EXTA 4IE0A 1X79A 2WY2A 3ZMTB 5LGTB 4AXPA 5LYJE 1AHJB 2KZ7B 5AQMB 2DCFA 3C4WA 3RH3A 2WFYB 1QUUA 3BK9A 2CCIB 2H7OA 2UU9T 2VKHA 3ZKRA 2B76A 4UVCB 3NBXX 4BCKB 2JMKA 3O9XA 2NR4A 2FJAA 5LMKB 5J1GA 1F5QB 3OTOT 2IN3A 2WU5A 4JLEA 2JGZB 2LSGA 3ZJ1A 3MJXA 5AQSB 3GA8A 1H7CA 2MBGA 4F6SB 2BBJA 3TW6A 4IREA 3RRCA 1O9KA 1HX1B 4LFBT 4TWFA 1I6ZA 1HTJF 1FIOA 2V1DB 2XSAA 4AIUA 2E8IA 1H27B 5HXHA 2K3WA 2CWYA 2PTFA 4ZGJB 2PK2A 2WMNA 4KHPT 2IC9A 1JSUB 2WIPB 1NAFA 3PUWF 1I94T 3LQ5B 4DVDA 3AEFA 5A1LA 3VYGB 4X1IE 4LFCT 4NC6A 3Q5XA 4PAGA 3U3IA 3H4CA 5AQFB 4IDNA 5EK2A 4KI0F 1KK7A 4O4LE 2E9XC 1AD6A 3IEEA 5HEOA 2VQET 2F4VT 2XJ7A 4ANJA 4YHJA 4H63H 1W98B 3HKBE 1GUXA 3RGLA 4IMYB 4YXDA 1J1JA 2H3RA 2LSJA 4YSZA 2C5NB 3AEGA 4Z6YA 2WSSV 2CMRA 5AQNB 1LRZA 2XPKA 4F7SB 2XAJB 3PTRB 2X1NB 3ZC1A 3ZCIA 3UQ7A 2CCHB 2XQ3A 5LBQB 3RC3A 4F6WB 2V7IA 2JPFA 4U7YA 5L3FB 4EZHA 1UX4A 4HWHA 5ADXL 4QX8B 4YFSA 2GK9A 5IDPB 2FJEA 1EZ3A 2FJBA 5EJCA 1YXRA 5LA6E 3WVEB 5CYIB 2YDRA 5AQTB 4WNKA 5CA0E 3ZYLA 3J7Yq 1QLBA 2ODVA 3AVSA 4X65T 2XUEA 2DPPB 2KR6A 1LVFA 3AXJA 2NOXA 4BY7X 3PUSA 5JDFA 2X0YA 2X9HA 3RLFF 3ONJA 4H9NC 4TUYE 5JREA 2UUEB 1E7PA 1UGSB 2C5VB 5IWAT 1HNXT 1N32T 2LT3A 4IGUA 3G06A 4MBQA 4EOQB 1OXZA 5EK3A 4DUYT 4HWFA 5ABGA 5AQOB 4IDQA 4P1NA 1D1AA 3F31A 3RYCE 3M65A 3UFEA 4HGAA 4ZI3C 4X1KE 3CKDA 4MIMA 4Z8XA 3BLHB 4QH4A 4ISSA 5JDMA 4MHCA 5HEJA 4ILAA 3I0QA 1SA0E 4DR2T 1UNHD 3DJBA 3MK7C 4ILBA 2E9XD 2JQHA 5L47A 2XAGB 4JX4A 3Q5DA 5JTGA 2Q9QA 2KSRA 2CHNA 4O2AE 3PUGA 2UZDB 4YTPA 2PK9B 4BCHB 2KMGA 4H9OC 3PURA 3HBLA 5FXZA 3AB3B 3TNIB 2L3LA 2Y8DA 2VL0A 3K3OA 3QZ9B 5AQLB 1VCSA 2XM2A 3ZMUB 4EYYR 2WHBB 5F8PA 2FUPA 2LKGA 1IBLT 3Q5WA 4HFVA 3TNWB 3QXEB 1X9BA 2HPLA 3ESLA 5ABFB 3EVYA 3QYGB 2EHOA 2WB5A 3CQXC 4F6RC 2LEHA 4ERRA 5JDGA 4LF5T 1OKWB 2LM2A 1KF6A 2E5VA 2X51A 4AQYT 1IBKT 5FXXA 2DWKA 3UT5E 3FZMB 5KX5E 1KEYA 5BMVE 4QXBB 1ZP2A 4ILUA 2BG9B 5LJMA 4LFAT 5AQPB 3UUXB 3C4ZA 4DBQA 4JX6A 5AQGB 3FXDB 4IE6A 2M67A 2YU2A 5HNBB 1VOLA 4OYJA 2IVXA 5LNKA 3R84B 3AE1A 3JADA 4ELLA 4CRLB 2YK0A 3UU5A 5LHHB 4QXHB 4AKRB 3C4XA 1E2AA 4G2AA 3NWIA 3AAEB 2K48A 3RIFA 5J2TE 2DXBB 4WYVA 3PJAA 1N36T 2IW6B 3CX7B 3RIUC 3A8LB 1OEDE 3UULA 3NVOA 3ZSSA 4ZI3D 3G33B 3T8OA 1T98A 3TKLB 5CB4E 2X67A 3N9NA 4U74A 4X66T 4B3RT 3F2EA 4BCMB 3ETUA 4QH1A 4ZI7E 1KXUA 4CQIA 3UU4A 3VKHA 2DD4B 4JUYA 2QGSA 2WMAB 3P8CD 3CK6A 4MLKA 2ZCFB 2LOPA 4DUZT 3PV0F 2UXCT 2VB6A 4P09A 3D0TA 4H9SE 1U5PA 4I50E 4UVBB 2M6IA 3CX8B 4BCNB 5L3EB 2A72A 1S94A 2RP4A 2HH7A 2W4XA 5HXRA 4TWHA 4DV5T 1TD6A 2WCAA 2NWBA 2G9XB 1VCTA 4ZI2C 3KV5A 3C50A 3IHRA 1UK5A 3U78A 3HKCE 3E08A 1NWMX 3HKEE 2UXXB 3GWHA 1JNZA 4PJLA 5TAOA 4DR1T 1AISB 5F3JA 2W99A 5IDNB 2UZLB 3EABA 2B1EA 4MALA 4YOSA 4O4IE 4O4JE 3BG5A 4IE4A 3FXEB 1BR4A 5HXCA 2CBJA 3N5LA 2BVMA 4QKNA 3ANWA 1UURA 1URCB 2XZEA 1IZNB 2XQYA 4JI1T 3P7IA 4EOZB 2PHGA 1ZV4X 3A8OB 3KV4A 2VQFT 5LG3A 3ETVA 2CEAA 3KBTA 3QB5A 4HFDA 1FMVA 1UCUA 4ROEA 4PK4A 3TLSA 4OHFA 2V7JA 1H1SB 1J5WA 5H6RB 2V7KA 1YD8G 1IAPA 3EDVA 5LHGB 4JI4T 1T7SA 2CZ1B 1S35A 3EDUA 2YEVC 1B7TA 3CX6B 3AE2A 1FJGT 2X9YA 5FVLA 2CRBA 4EEBA 3ZLIA 4DIDB 4COFA 1KFYA 3R6NA 2WEVB 1CUNA 4LF7T 2I59A 1G3NC 4F70B 3RX6A 3L3PA 3RQUA 3T1YT 1H1RB 5HBEB 3PUYF 3DL1A 4BCPB 1G8XA 1OEDA 4TWDA 3MY1B 4Q25A 2UUCT 1WR6A 5DJQC 4EV6A 4DR4T 4AI6A 4HKAA 3CQGB 4HFIA 3AE3A 2LKHA 2V6XA 2EUFA 3AAAB 2XM1A 4YJ2E 3B5MA 2SPCA 2V6YA 3X20B 2I0MA 4P0BA 4ZI2D 3KHIA 2A3DA 4DV1T 2JQKA 2L8KA 4ZHQE 5JDHA 2YOEA 3T1HT 2W96A 2VVSA 3MACA 4IE5A 4HLQA 4EB6E 4ZS3A 3V5SA 2QVAA 2N9DA 4I0UA 1JSTB 1WYBA 2LRLA 5AQVB 4UR9A 2MOZA 2W62A 4H9PC 3FZLB 4DNDA 2KXPB 3HKDE 4BAYB 4KRCB 3BQLA 1XNQT 2BBHA 1YKHB 2D0UA 4UF0A 2VKDA 4BCIB 1O3XA 4GYRA 4GYSA 1W9RA 5EZYE 5JR9B 3FZFB 2DMEA 5H6QB 2LSIA 3N2KE 4U7IA 4EOOB 3NZPA 1YKEB 4EOKB 3AEAA 2XAHB 2V26A 5BR8T 1O9KB 5JR9C 4ADZA 4F8HA 4C91A 2LM9A 3NRXA 3BG9A 2XAFB 4TZ4C 3CVRA 2QYWA 1KNPA 1SE7A 3ZT5A 3TLWA 2WPAB 5DQVA 4UV9B 4CXWA 2RPAA 3KBUA 2XY8B 1GQEA 2CXFA 4DO0A 1MIYA 3JAFA 2R7GA 2WBLA 4WZXA 2E9XB 4TV9E 3FB2A 4DR7T 4O4HE 3MIAB 1HF8A 5LCYA 5AQRB 4DMWA 4MFRA 4OYKA 2I6HA 3WI3A 3MZKB 3VR9A 3EIDB 4BBSM 4PNIA 2QF7A 4CFXB 1GUXB 1HG5A 2ACZA 4BY1X 3W15B 4AKLA 2UXNB 2ZPEB 4CFVB 4EC9B 3IBPA 2B9RA 2KNDA 1HS7A 2YINA 4JEUB 4DV2T 4F7NB 4OGRB 2IIUA 2NTXA 2CPTA 4Z91A 2PJQA 5HWYA 3UU8A 4QHOA 3AE7A 4OR5B 4PJMA 2RA1A 2YDSA 3M3ZB 2UZBB 3LK2B 3AE8A 5C8YE 2PFVA 1LVKA 3E22E 4FX3B 1WFDA 1MIVA 5L3BB 3BHTB 5FXWA 2BG9E 2JMHA 1OGUB 3NKZA 3ZCJA 5J2UE 4UIGA 3UU3A 4F7LB 3HB9A 4HNUA 4AQGA 2LRKA 4CI1B 2WWUA 3VKGA 4EONB 1D0YA 1HNZT 2I40B 3VRAA 2FBWA 2XQ4A 3AXJB 1N34T 1UGQB 1HCIA 3RRWA 4MFEA 2C5OB 1D1CA 2NW7A 2VKOA 3I9WA 4EORB 3P4SA 4J2CA 3EHZA 4DR6T 1D0XA 1ZKEA 2N2NA 4GIWA 4EOMB 5C3JA 3H37A 2CE7A 1XZYA 3RYFE 3UUMA 1N33T 4YHHT 4WW0A 4OK0A 3A5XA 1MMAA 1OIYB 4U72A 4EAHA 5LB7B 5KMGP 5LJNA 1KNRA 2OLTA 3I9YA 4H9QC 3N2OA 2KINB 2F2CA 2WDVA 3QWLA 4IE7A 2ZM2A 2XQ7A 3K3QC 3PUQA 4DMVA 1OIUB 3BQKA 2QA7A 5CGMA 4BCOB 4H9RC 3ZYKA 4CFUD 4M1PA 3WAKA 3GMIA 4BCFB 2I53A 4FI5A 3P4PA 4PJNA 2LSKA 2X66A 3AE6A 3AVRA 3AEEA 2W61A 3KVAA 1Z0PA 1HX8A 3O4XE 2CJMB 1H28B 2PMIB 2CM0A 5HBHB 4HFCA 3ZT6A 5FY1A 5CFBA 2V22B 1WR0A 3C64A 4ZXLA 2J4GA 1Z8UA 3B13A 2EHOC 3KV6A 1YQ3A 1WRDA 3F5XB 4GK0E 4KUMB 3HHTB 3ZN1B 3ZSTA 3ZJ2A 3Q9DA 3AEBA 5ABFA 5IF1B 4ASKA 3QYBA 1WCRA 1ZEEA 2BZBA 2CA5A 4IT4A
chains in the Genus database with same CATH topology
5LYJE 2BVMA 4QKNA 2KZ7B 3ANWA 2NP9A 2DCFA 2C5KT 1IZNB 3C4WA 3RH3A 1QUUA 3BK9A 2NTYA 2XQYA 2H7OA 2W00A 3P7IA 4EOZB 2VKHA 2K24A 3KV9A 4UVCB 1ZV4X 3NBXX 2KWHA 3O1JA 3KV4A 5FYMA 3V5UA 2JMKA 3O9XA 5EK4A 3ZMSB 3ETVA 2CEAA 3KBTA 5J1GA 1FMVA 1UCUA 4JEHB 3RYHE 3O1HA 4PK4A 3NRYA 4GK5E 4JLEA 4OHFA 2LSGA 3KFWX 3ONXA 2Y6XA 3ZJ1A 3MJXA 2HPJA 2V7JA 4G63A 2OA5A 3GA8A 3LK42 1H7CA 3OJAA 4QX7B 2V7KA 1YD8G 5H6RB 5AFUL 2MBGA 1IAPA 3CPZA 3EDVA 1MIWA 2N1GA 3N9PA 5LHIB 5LHGB 2LHNA 3RRCA 4B6XA 1S35A 3EDUA 2YEVC 1B7TA 3CX6B 1HTJF 1FIOA 2X9YA 2V1DB 1MMNA 3ZLIA 4EYUA 2E8IA 3AA7B 3LBXB 3R6NA 3PE0A 3H3AA 3O1IA 5HXHA 2XAQB 5LG4A 2Q9QB 2CWYA 2ZM0A 1CUNA 2I59A 2WMNA 3K8PC 3RX6A 2IC9A 3L3PA 1NAFA 2VWAA 3E0ZA 4E7ZA 4DVDA 5A1LA 4YJ3E 4X1IE 2Q9QD 3Q5XA 4GOUA 1G8XA 2Q9QC 4PAGA 4X1YE 3U3IA 4ZOLE 5EK2A 2XASB 5HAXA 4BJMA 2C5JA 1KK7A 4O4LE 3IF8B 2E9XC 1WR6A 5DJQC 2CXDA 4UEMA 4AI6A 3IEEA 4HKAA 3CQGB 4WBOA 4ISTA 3AAAB 2EHOB 1SHZC 4YJ2E 3N9LA 2CLYC 2SPCA 3UUNA 2P9BA 3WAJA 4ANJA 4YHJA 4H63H 2Z6EA 4H63V 4P0BA 3HKBE 2IAKA 2W0GA 2V7MA 4ZI2D 2H3RA 2LSJA 2A3DA 4IDZA 2L8KA 4ZHQE 5JDHA 3N2GE 2WSSV 2XTLA 2CMRA 2D0TA 2EHOD 1LRZA 3N9QA 2PBIA 4IE5A 3MACA 5FY7A 3LJCA 4EB6E 2XAJB 4ZS3A 3V5SA 5CA1E 3PTRB 2N9DA 3ZC1A 3ZCIA 1AJ3A 1LKXA 3S4UA 5LBQB 1WYBA 2KMFA 3RC3A 5HXEA 2V7IA 3VU7H 4CI3B 2MOZA 2W62A 4P0AA 4PK5A 4H9PC 3Q2MA 2JPFA 2ES0A 4DNDA 2KXPB 3HKDE 3LG7A 4BAYB 2BDEA 5HXSA 5L3DB 3BQLA 5L3FB 2VK9A 3KDSE 4EZHA 1UX4A 4CZZB 3BQIA 3MXZA 4PK6A 2CWOA 5LBMA 5ADXL 4AQFA 4QX8B 3ZYMA 4YFSA 1YKHB 1D1BA 2D0UA 2GK9A 1KNZA 3PU8A 5HYAA 4NUUA 1EZ3A 4UF0A 5LA6E 3FHNA 2VKDA 5JRCB 4GYRA 1O3XA 2ZLYA 4GYSA 5EZYE 5JR9B 4KP3C 5IYZE 4A56A 5H6QB 2LSIA 5GONE 3MKDA 3N2KE 4YLHA 4WNKA 5CA0E 4I55E 3ZYLA 3F57A 3NZPA 1YKEB 3J7Yq 5ETWA 3UTKA 3GN5B 3ZMVB 2ODVA 3SS1A 3AVSA 2J1DG 2XUEA 2XAHB 2V26A 2VL8A 5LGNB 2ACXA 5JR9C 1LVFA 2NOXA 4ADZA 4C91A 2LM9A 1WYCA 1Y64B 1G73A 3NRXA 3PUSA 4HTEA 5JDFA 2X9HA 5JVDE 4CI2B 2CXLA 2PG8A 2NW8A 5DQWA 2XAFB 3CVRA 3FBZA 4H9NC 4TZ4C 4TUYE 4C90A 5JREA 1OWAA 3QK6A 3ZPOA 4V1Av 3RYIE 2C5IT 2LT3A 5DQVA 4IGUA 4EIWA 4MBQA 1BR0A 1OXZA 4UV9B 4CXWA 3KBUA 5EK3A 2KLQA 2CXFA 4DO0A 3OBVE 3VHLA 4L5GA 3C51A 3OYXA 4K0UA 4HEAA 3NZQA 1MIYA 4L0RA 3AA0B 1D1AA 2K5BB 2WBLA 2WMOA 3EUHA 2L9QA 3F31A 2V7LA 3RYCE 3M65A 2E9XB 3UFEA 4HGAA 4ZI3C 4X1KE 4BA9A 3CKDA 4TV9E 4O2BE 3FB2A 4Z8XA 3PDYA 4O4HE 5L3GB 1HF8A 5LCYA 4ISSA 3DP7A 4DMWA 5JDMA 2CLYB 3L09A 4MFRA 4MHCA 4OYKA 2DHRA 3I0QA 3WI3A 1SA0E 3MZKB 1IJ6A 2DNXA 2ODUA 3DJBA 3MK7C 4TV8E 3AA6B 5JH7E 1IJ5A 2LE8A 4ZS2A 4PNIA 2E9XD 3LBXA 5L2LA 4HE8A 4UXNB 2XAGB 3ZEFB 2Q9QA 1HG5A 4O2AE 3C98B 3PUGA 1FMWA 3W15B 4AKLA 2UXNB 2DLRA 3RPUA 3IBPA 2BVLA 4H9OC 1U4QA 2C0SA 3PURA 2KNDA 5FXZA 1HS7A 3AB3B 1D0ZA 2YINA 2X0LB 4JEUB 4IHJE 2L3LA 2Y8DA 3K3OA 4XBFB 2VKJA 5LP6E 2DWGA 3ZMUB 3HR0A 4EYYR 5IHYA 2NTXA 5F8PA 5FNVE 3ZMZB 5L3CB 2CCQA 3ZN0B 3Q5WA 2Y48B 4EZ4A 2PJQA 2LOSA 1BR1A 4HFVA 5HWYA 4I43B 1VOMA 2HPLA 3ESLA 4QHOA 3EVYA 2YU1A 2EHOA 3AAIA 4L9IA 4PJMA 3CQXC 2ZMAA 4F6RC 2LEHA 2D5UA 2RA1A 4ERRA 5JDGA 3LK2B 2JQQA 3HL6A 4TN7B 3ANWB 3QUJA 5C8YE 5M4YA 2PFVA 4XAXB 2X51A 1LVKA 2WAUA 3E22E 4PFOA 5JDLA 5FXXA 2DWKA 1MIVA 3UT5E 5L3BB 5FXWA 5KX5E 4UELA 2MYSA 3KINB 1YW0A 3ZC0A 1US7B 2JMHA 3OYZA 5BMVE 5LOVE 3ZCJA 2G0UA 5LGUB 4QXBB 2H7VC 4ILUA 4AQFC 5J2UE 5KDMC 4UIGA 4CXYA 5LJMA 4DBRA 1WLXA 4QWNB 5E0OA 1HFAA 2WM9A 1V9DA 3JC6C 2IW5B 3UUXB 1ZHCA 4AQGA 4E7SA 4CI1B 3C4ZA 2WWUA 4WBNE 3VKGA 4DBQA 1D0YA 2A2FX 5DABA 3FXDB 4IE6A 2M67A 3RKOA 3LFMA 1QSDA 2YU2A 5JQGE 1MMDA 4HN9A 1HCIA 3RRWA 3QC9A 1VRBA 4QXCB 1D1CA 2NW7A 2VKOA 3FBLA 3I1AA 4OYJA 5LNKA 3I9WA 5HWXA 3PU3A 3R84B 4J2CA 3N9MA 1D0XA 4KBMB 4PJJA 5JRCA 4FJOA 1ZKEA 2N2NA 1MMGA 3HA4A 2X9WA 4GIWA 2YK0A 5JR9A 3H37A 4KMCA 2CE7A 4N78D 5LHHB 3RYFE 4QXHB 3SRZA 3I0OA 3UUMA 4AKRB 3C4XA 5JDQA 4G2AA 4WW0A 2IC6A 3AAEB 4OK0A 2K48A 5FP3A 2X68A 3A5XA 1MMAA 3GN5A 5J2TE 4U72A 3CX7B 4EAHA 2KT9A 2JJ9A 3UULA 4ZI3D 5KMGP 5LJNA 3PUAA 2D2SA 3I9YA 3CWZB 4AKGA 3K3NA 4H9QC 3N2OA 4AKHA 3T8OA 1T98A 4OFZA 3TKLB 5LXTE 2KINB 1UX5A 4IE7A 5CB4E 2X67A 3N9NA 4IIJE 4U74A 4UV8B 2ZM2A 3F2EA 3ETUA 1MNDA 3K3QC 2LJLA 3PUQA 3SWHA 4ZI7E 2ZM8A 4DMVA 4AKIA 4CQIA 2X9XA 4X20E 3J9X1 3SOLA 2K9AA 3AA1B 3VKHA 4JUYA 2QGSA 1MNEA 3BQKA 3P8CD 4XZCA 2QA7A 3OKQA 4MLKA 4PFPA 4NUVA 1E1HB 4H9RC 2LOPA 2E9XA 4O8SA 4PW8A 3ZYKA 3B57A 2VB6A 4P09A 3D0TA 4M1PA 1HG2A 4H9SE 5FXVA 3WAKA 1U5PA 3N9OA 4I50E 3GMIA 3CQCB 4UVBB 4FI5A 2LSKA 3CX8B 1BR2A 4PJNA 3CMLA 2X66A 5L3EB 2A72A 4I4TE 3MA9A 3AVRA 2MTQA 2KWIB 1S94A 2RP4A 1FEWA 2W61A 2HH7A 3KVAA 5HXRA 1Z0PA 1HX8A 3O4XE 2NWBA 4TX5A 2CM0A 2VASA 4ZI2C 3KV5A 5FY1A 5JDNA 3C50A 3IHRA 3RC8A 3C64A 3U78A 3DTOA 2XHEB 3HKCE 3B13A 3E08A 1NWMX 2LHRA 4CXXA 2DI4A 3HKEE 2UXXB 2EHOC 3GWHA 4PJLA 5FY0A 3KV6A 5TAOA 4UF0B 5F3JA 1WRDA 3HI2A 2LSYA 3LK3B 2JRKA 2B1EA 4MALA 5FMNA 3KVBA 2W63A 4GK0E 4KUMB 3ZN1B 4BJNA 3ZJ2A 3Q9DA 4UVAB 4O4IE 4O4JE 2NW9A 4EXTA 4IE0A 3JC6D 4ASKA 4IE4A 1X79A 3FXEB 1BR4A 1ZEEA 2BZBA 5HXCA 2CA5A 3ZMTB 5LGTB 4AXPA 3N5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B57 A;  2PJQ A;  3DJB A;  5DQW A;  5DQV A;  5IHY A;  3DTO A;  2QGS A; 
#chains in the Genus database with same CATH topology
 3RHW A;  2NP9 A;  3RF1 A;  4HFH A;  3UU6 A;  4EOJ B;  4JBW F;  4ZZC A;  4B3S T;  5HEG A;  2K24 A;  4G6L B;  3K1S A;  2C6T B;  5FYM A;  3V5U A;  3QHR B;  4NXM T;  4EED A;  4ILC A;  2CZ6 B;  5AQJ B;  2BG9 A;  3RYH E;  3O1H A;  3NRY A;  2WS3 A;  2DXC B;  4GK5 E;  2Y6X A;  4ZEY A;  4G63 A;  5AFU L;  1NEN A;  3N9P A;  2LHN A;  5C2T A;  2V8S V;  1CHU A;  3AEC A;  1MMN A;  1C9B A;  4EYU A;  4CFW B;  3LBX B;  3PUX F;  1JOW A;  3H3A A;  5ICP B;  2XAQ B;  5LG4 A;  1J5E T;  2LLY A;  2ZM0 A;  4BXX X;  4HNV A;  3PUV F;  3UUB A;  4YJ3 E;  4K0K T;  2Q9Q D;  4GOU A;  2C5X B;  2XAS B;  4BJM A;  1FKM A;  4YT0 A;  3IF8 B;  4LMK A;  4OB3 B;  3SFE A;  4UEM A;  3PJA J;  4A97 A;  4WBO A;  4A5X A;  4DV4 T;  4IST A;  1SHZ C;  3Q5E A;  4AIS A;  2CLY C;  3WAJ A;  3UUN A;  2P9B A;  4BCG B;  3DDQ B;  2Z6E A;  4YSX A;  2IAK A;  2W0G A;  5AQI B;  2V7M A;  3OVU A;  2YN6 A;  2XQ5 A;  1ZOY A;  3A8H B;  4NXN T;  2XTL A;  4BCJ B;  2EHO D;  3N9Q A;  2ZPG B;  3A7M A;  1E9H B;  3LJC A;  5CA1 E;  4YC3 B;  3DOG B;  1UNL D;  1AJ3 A;  1LKX A;  4YSY A;  3S4U A;  5HXE A;  1DU2 A;  4LF6 T;  1H24 B;  4CI3 B;  4PK5 A;  3RI5 A;  3H3M A;  3BLQ B;  4F7J B;  2ES0 A;  5L3D B;  3KDS E;  4CZZ B;  3BQI A;  3MXZ A;  5LBM A;  4AQF A;  2IUB A;  3ZYM A;  2WIH B;  1XMQ T;  1KNZ A;  5HYA A;  5JRC B;  3FHN A;  2WZH A;  5IYZ E;  4A56 A;  5GON E;  3RGF B;  4EOS B;  2UXD T;  3F57 A;  4YY3 T;  4GKK T;  3GN5 B;  3ZMV B;  4CN4 A;  2J1D G;  2VL8 A;  5LGN B;  5FL1 A;  4CN1 A;  2FJD A;  1Y64 B;  1G73 A;  4TNW A;  2W66 A;  3DDP B;  5JVD E;  4CI2 B;  2PG8 A;  1N4M A;  4LF8 T;  2LW4 A;  1OWA A;  3ZPO A;  3RYI E;  2MPK A;  4EIW A;  1FVV B;  4FM4 B;  1SUM B;  4EOI B;  2WQY A;  2KLQ A;  1T72 A;  3OBV E;  4L5G A;  3NDQ A;  4K0U A;  4HEA A;  1UGO A;  4L0R A;  3EAM A;  1TFB A;  2BKZ B;  2WP9 A;  2WMO A;  3EUH A;  2L9Q A;  2CHO A;  4BA9 A;  4O2B E;  5L3G B;  3L39 A;  1M7K A;  5KXJ A;  2DHR A;  5ABH A;  3BLR B;  5JH7 E;  2CZ0 B;  5L2L A;  4CFM B;  2V6Y B;  4YTN A;  4ZGD B;  3ZEF B;  4ZGE B;  1H1Q B;  3JCF A;  3C98 B;  1FMW A;  3RPU A;  2BVL A;  2WJ9 A;  2C0S A;  3UFG A;  2X0L B;  3X26 B;  4IHJ E;  3EJ1 B;  3P4Q A;  3WVD B;  5LP6 E;  2DWG A;  3CIR A;  3HZJ A;  3ZN0 B;  2Y48 B;  4IDP A;  1BR1 A;  3AAI A;  4L9I A;  2ZMA A;  3TLV A;  3HL6 A;  4TN7 B;  3QUJ A;  2W2H A;  4XAX B;  2WAU A;  4UEL A;  2MYS A;  3KIN B;  1YW0 A;  2X0H A;  1US7 B;  3ZC0 A;  5LOV E;  5FVK A;  1FIN B;  5LGU B;  2H7V C;  1V29 B;  5KDM C;  5LQF B;  4DBR A;  1WLX A;  4QWN B;  5E0O A;  3JC6 C;  2IW5 B;  5L4H A;  1OL1 B;  3RKO A;  4NST B;  3LFM A;  3A8G B;  1QSD A;  3AE5 A;  4HN9 A;  3QC9 A;  4JX5 A;  5FGK B;  3FBL A;  5L4E A;  3EI0 A;  5HWX A;  3PU3 A;  3N9M A;  1VYW B;  4GKJ T;  4FJO A;  1MMG A;  3HA4 A;  3M03 A;  2X9W A;  3X28 B;  1W09 A;  5JR9 A;  5AQK B;  4KMC A;  4N78 D;  2V5C A;  4NIQ A;  1L0V A;  3I0O A;  5ACB A;  1H4L D;  1M62 A;  4BBR M;  1IRE B;  4HWI B;  3QNU A;  2AHJ B;  3TW7 A;  4A98 A;  2QDJ A;  4OB2 B;  4KHZ F;  3TLT A;  4ZZB A;  5LXT E;  2UXB T;  2OV9 A;  1UX5 A;  2W9Z A;  4EC8 B;  4IIJ E;  4CFN B;  3MI9 B;  3SFD A;  1ZP0 A;  4CFU B;  1MND A;  2LJL A;  4B3M T;  3SWH A;  2ZM8 A;  2X9X A;  3J9X 1;  3SOL A;  3AA1 B;  1MNE A;  4PFP A;  2WWV A;  4NUV A;  2BS4 A;  1E1H B;  2E9X A;  4O8S A;  2M6B A;  1HG2 A;  5FXV A;  3LSV A;  3N9O A;  3CQC B;  2BKP A;  4I4T E;  2QDY B;  2MTQ A;  2KWI B;  2W67 A;  3P4W A;  2D0Q B;  2WMB B;  2VAS A;  5JDN A;  4IDO A;  3RC8 A;  3BHU B;  3DTO A;  1ENW A;  2LHR A;  2DI4 A;  1YQ4 A;  5FY0 A;  4II5 B;  2WZI A;  2DL1 A;  2BS3 A;  1UNG D;  5EFQ B;  5FMN A;  3KVB A;  2W63 A;  4U31 A;  3RKG A;  4UVA B;  2NW9 A;  3JC6 D;  2CBI A;  1JKW A;  2J62 A;  4DV7 T;  2C5K T;  3FZK B;  2NTY A;  4BCQ D;  2AXD S;  2W2U A;  4OX9 T;  2W00 A;  3KV9 A;  4Y72 B;  3IA3 A;  2KWH A;  3O1J A;  5EK4 A;  3ZMS B;  1HNW T;  4JI7 T;  4JEH B;  3KFW X;  1UUS A;  3ONX A;  2HPJ A;  2OA5 A;  3LK4 2;  3OJA A;  4QX7 B;  4CN6 A;  3MY5 B;  3CPZ A;  2J47 A;  1MIW A;  2N1G A;  5LHI B;  4B6X A;  4HL4 A;  2WDR A;  4TNV A;  4YOO A;  3L8R A;  1GY3 B;  4DV3 T;  4HFB A;  4X64 T;  2VUR A;  3AA7 B;  3PE0 A;  4DV6 T;  2QQ8 A;  3O1I A;  4LF9 T;  1H25 B;  2UZE B;  1PKD B;  3QB5 K;  1VIN A;  5L2W B;  2Q9Q B;  4ROC A;  3K8P C;  2ZPH B;  2W9F A;  2VWA A;  3E0Z A;  4E7Z A;  3P50 A;  2WXV B;  2JIW A;  1XO2 A;  2Q9Q C;  4X1Y E;  4ZOL E;  3RIA A;  5HAX A;  2C5J A;  2CYZ B;  2CXD A;  2EHO B;  1QMZ B;  5HBJ B;  3N9L A;  4YOZ A;  4H63 V;  2H89 A;  3HO8 A;  3JAE A;  5BNJ B;  4IDZ A;  3N2G E;  2D0T A;  5HVY B;  2PBI A;  3EOC B;  5FY7 A;  2G77 A;  2IHR 1;  2E5L T;  4TTH A;  2KMF A;  2ZPB B;  1P5E B;  3VU7 H;  4P0A A;  3Q2M A;  4DV0 T;  5CEI B;  4OB0 B;  3LG7 A;  5HXS A;  2BDE A;  2VK9 A;  3VR8 A;  3UQ4 A;  4PK6 A;  2CWO A;  1W0B A;  1D1B A;  1UGR B;  2BKO A;  4MFD A;  2IML A;  3PU8 A;  4NUU A;  2ZLY A;  2XSB A;  5FL0 A;  3A8Y C;  4KP3 C;  1HR0 T;  2YKS A;  1Y01 A;  3MKD A;  4YLH A;  4JYA T;  4I55 E;  1NEK A;  5ETW A;  3LDQ B;  1BU2 A;  2YDQ A;  2WU2 A;  3UTK A;  3SS1 A;  3ABV A;  4I3Z B;  2BG9 C;  3QOF A;  2ACX A;  4KX6 A;  3AE9 A;  1WYC A;  4HTE A;  1W0A A;  2BPM B;  2CXL A;  3FBZ A;  2NW8 A;  5DQW A;  4HWC A;  4C90 A;  3QK6 A;  4V1A v;  4OB1 B;  1XDP A;  2C5I T;  5I5Z B;  4ELJ A;  4JI0 T;  3RIU A;  1BR0 A;  2R6G F;  3VYH B;  2D9D A;  4UN0 A;  4LF4 T;  3VHL A;  3C51 A;  3OYX A;  4HFE A;  3NZQ A;  4IL9 A;  2CZ7 B;  4NPP A;  3AA0 B;  4U3C A;  3RQW A;  2K5B B;  4LML A;  2V7L A;  3QHW B;  3BG3 A;  3PDY A;  1OI9 B;  2IDO B;  3DP7 A;  1JNR A;  1H1P B;  2CLY B;  3PUZ F;  3L09 A;  5IUX A;  4HWD A;  3GTM S;  1IJ6 A;  2DNX A;  2ODU A;  4TV8 E;  3AA6 B;  1IJ5 A;  2LE8 A;  4ZS2 A;  3LBX A;  4HE8 A;  4UXN B;  1UGP B;  3O0G D;  2UUB T;  4KRD B;  2E2A A;  2DLR A;  4JI5 T;  4CXA B;  2DD5 B;  1U4Q A;  2ZPF B;  1OKV B;  1D0Z A;  5J0Z A;  4XBF B;  4B3T T;  3X24 B;  2VKJ A;  3HR0 A;  3PO3 S;  5IHY A;  5FNV E;  5L3C B;  3ZMZ B;  2CCQ A;  4EZ4 A;  2LOS A;  4I43 B;  4LOC A;  1VOM A;  2XQ9 A;  5HEU A;  2YU1 A;  2VVN A;  5LMN T;  2D5U A;  4ROD A;  2JQQ A;  3ANW B;  5M4Y A;  2QFZ A;  2QRX A;  1D3U B;  5JDL A;  4PFO A;  5LMU T;  1XWM A;  1XNR T;  5ABE A;  2HN1 A;  3OYZ A;  2G0U A;  3VRB A;  3A8M B;  4AQF C;  4CXY A;  2XQA A;  2HN2 A;  1HFA A;  2WM9 A;  1V9D A;  1ZHC A;  4E7S A;  4WBN E;  5DAB A;  2A2F X;  3FZH B;  4U2Z A;  3QYE A;  4EOL B;  5JQG E;  1MMD A;  1VRB A;  4QXC B;  4HNT A;  3I1A A;  5FKY A;  3OPC A;  1T8B A;  5AQQ B;  4KBM B;  4PJJ A;  5JRC A;  2IW8 B;  2HHH T;  5HCM A;  2XQ6 A;  3AED A;  4EGW A;  3K7A M;  4JI8 T;  2IW9 B;  3SRZ A;  5JDQ A;  5AQU B;  4JI3 T;  3AE4 A;  2H88 A;  2IC6 A;  5FP3 A;  2X68 A;  5HCJ A;  4IL4 A;  3GN5 A;  2ZPI B;  4F6U B;  1GH6 B;  2KT9 A;  2JJ9 A;  4QH5 A;  4U2Y A;  1H26 B;  3PUA A;  2D2S A;  4AKG A;  3CWZ B;  3K3N A;  3POM A;  4AKH A;  1XDO A;  2AE9 A;  4OFZ A;  1OED B;  4LMJ A;  3QYH B;  2JQ9 A;  4UV8 B;  4JI6 T;  2ZZD B;  4M6V A;  2C4G B;  3P4R A;  4Z90 A;  5HQ0 B;  4AKI A;  4X20 E;  1OL2 B;  2K9A A;  4XZC A;  1OED C;  1XMO T;  3TLU A;  3OKQ A;  2BS2 A;  4PW8 A;  3B57 A;  4BCM D;  3QZ5 B;  2A9U A;  3BHV B;  4YTM A;  5CJ5 A;  1IBM T;  2UUA T;  3X25 B;  1BR2 A;  3CML A;  3ONL C;  4U33 A;  3MA9 A;  4DR3 T;  1FEW A;  4EOP B;  5F5W A;  3TNH B;  2ZM6 T;  1R8I A;  2MAW A;  4TX5 A;  4QSH A;  4JI2 T;  3ZT7 A;  2BKN A;  4DR5 T;  4BCN D;  4X5T A;  2XQ8 A;  5HEH A;  2WDQ A;  2XHE B;  4JV5 T;  3TN8 B;  4CXX A;  4X62 T;  3X1D A;  4UF0 B;  2V5D A;  3HI2 A;  2LSY A;  5AQH B;  3LK3 B;  2JRK A;  4BJN A;  4BCQ B;  4EXT A;  4IE0 A;  1X79 A;  2WY2 A;  3ZMT B;  5LGT B;  4AXP A;  5LYJ E;  1AHJ B;  2KZ7 B;  5AQM B;  2DCF A;  3C4W A;  3RH3 A;  2WFY B;  1QUU A;  3BK9 A;  2CCI B;  2H7O A;  2UU9 T;  2VKH A;  3ZKR A;  2B76 A;  4UVC B;  3NBX X;  4BCK B;  2JMK A;  3O9X A;  2NR4 A;  2FJA A;  5LMK B;  5J1G A;  1F5Q B;  3OTO T;  2IN3 A;  2WU5 A;  4JLE A;  2JGZ B;  2LSG A;  3ZJ1 A;  3MJX A;  5AQS B;  3GA8 A;  1H7C A;  2MBG A;  4F6S B;  2BBJ A;  3TW6 A;  4IRE A;  3RRC A;  1O9K A;  1HX1 B;  4LFB T;  4TWF A;  1I6Z A;  1HTJ F;  1FIO A;  2V1D B;  2XSA A;  4AIU A;  2E8I A;  1H27 B;  5HXH A;  2K3W A;  2CWY A;  2PTF A;  4ZGJ B;  2PK2 A;  2WMN A;  4KHP T;  2IC9 A;  1JSU B;  2WIP B;  1NAF A;  3PUW F;  1I94 T;  3LQ5 B;  4DVD A;  3AEF A;  5A1L A;  3VYG B;  4X1I E;  4LFC T;  4NC6 A;  3Q5X A;  4PAG A;  3U3I A;  3H4C A;  5AQF B;  4IDN A;  5EK2 A;  4KI0 F;  1KK7 A;  4O4L E;  2E9X C;  1AD6 A;  3IEE A;  5HEO A;  2VQE T;  2F4V T;  2XJ7 A;  4ANJ A;  4YHJ A;  4H63 H;  1W98 B;  3HKB E;  1GUX A;  3RGL A;  4IMY B;  4YXD A;  1J1J A;  2H3R A;  2LSJ A;  4YSZ A;  2C5N B;  3AEG A;  4Z6Y A;  2WSS V;  2CMR A;  5AQN B;  1LRZ A;  2XPK A;  4F7S B;  2XAJ B;  3PTR B;  2X1N B;  3ZC1 A;  3ZCI A;  3UQ7 A;  2CCH B;  2XQ3 A;  5LBQ B;  3RC3 A;  4F6W B;  2V7I A;  2JPF A;  4U7Y A;  5L3F B;  4EZH A;  1UX4 A;  4HWH A;  5ADX L;  4QX8 B;  4YFS A;  2GK9 A;  5IDP B;  2FJE A;  1EZ3 A;  2FJB A;  5EJC A;  1YXR A;  5LA6 E;  3WVE B;  5CYI B;  2YDR A;  5AQT B;  4WNK A;  5CA0 E;  3ZYL A;  3J7Y q;  1QLB A;  2ODV A;  3AVS A;  4X65 T;  2XUE A;  2DPP B;  2KR6 A;  1LVF A;  3AXJ A;  2NOX A;  4BY7 X;  3PUS A;  5JDF A;  2X0Y A;  2X9H A;  3RLF F;  3ONJ A;  4H9N C;  4TUY E;  5JRE A;  2UUE B;  1E7P A;  1UGS B;  2C5V B;  5IWA T;  1HNX T;  1N32 T;  2LT3 A;  4IGU A;  3G06 A;  4MBQ A;  4EOQ B;  1OXZ A;  5EK3 A;  4DUY T;  4HWF A;  5ABG A;  5AQO B;  4IDQ A;  4P1N A;  1D1A A;  3F31 A;  3RYC E;  3M65 A;  3UFE A;  4HGA A;  4ZI3 C;  4X1K E;  3CKD A;  4MIM A;  4Z8X A;  3BLH B;  4QH4 A;  4ISS A;  5JDM A;  4MHC A;  5HEJ A;  4ILA A;  3I0Q A;  1SA0 E;  4DR2 T;  1UNH D;  3DJB A;  3MK7 C;  4ILB A;  2E9X D;  2JQH A;  5L47 A;  2XAG B;  4JX4 A;  3Q5D A;  5JTG A;  2Q9Q A;  2KSR A;  2CHN A;  4O2A E;  3PUG A;  2UZD B;  4YTP A;  2PK9 B;  4BCH B;  2KMG A;  4H9O C;  3PUR A;  3HBL A;  5FXZ A;  3AB3 B;  3TNI B;  2L3L A;  2Y8D A;  2VL0 A;  3K3O A;  3QZ9 B;  5AQL B;  1VCS A;  2XM2 A;  3ZMU B;  4EYY R;  2WHB B;  5F8P A;  2FUP A;  2LKG A;  1IBL T;  3Q5W A;  4HFV A;  3TNW B;  3QXE B;  1X9B A;  2HPL A;  3ESL A;  5ABF B;  3EVY A;  3QYG B;  2EHO A;  2WB5 A;  3CQX C;  4F6R C;  2LEH A;  4ERR A;  5JDG A;  4LF5 T;  1OKW B;  2LM2 A;  1KF6 A;  2E5V A;  2X51 A;  4AQY T;  1IBK T;  5FXX A;  2DWK A;  3UT5 E;  3FZM B;  5KX5 E;  1KEY A;  5BMV E;  4QXB B;  1ZP2 A;  4ILU A;  2BG9 B;  5LJM A;  4LFA T;  5AQP B;  3UUX B;  3C4Z A;  4DBQ A;  4JX6 A;  5AQG B;  3FXD B;  4IE6 A;  2M67 A;  2YU2 A;  5HNB B;  1VOL A;  4OYJ A;  2IVX A;  5LNK A;  3R84 B;  3AE1 A;  3JAD A;  4ELL A;  4CRL B;  2YK0 A;  3UU5 A;  5LHH B;  4QXH B;  4AKR B;  3C4X A;  1E2A A;  4G2A A;  3NWI A;  3AAE B;  2K48 A;  3RIF A;  5J2T E;  2DXB B;  4WYV A;  3PJA A;  1N36 T;  2IW6 B;  3CX7 B;  3RIU C;  3A8L B;  1OED E;  3UUL A;  3NVO A;  3ZSS A;  4ZI3 D;  3G33 B;  3T8O A;  1T98 A;  3TKL B;  5CB4 E;  2X67 A;  3N9N A;  4U74 A;  4X66 T;  4B3R T;  3F2E A;  4BCM B;  3ETU A;  4QH1 A;  4ZI7 E;  1KXU A;  4CQI A;  3UU4 A;  3VKH A;  2DD4 B;  4JUY A;  2QGS A;  2WMA B;  3P8C D;  3CK6 A;  4MLK A;  2ZCF B;  2LOP A;  4DUZ T;  3PV0 F;  2UXC T;  2VB6 A;  4P09 A;  3D0T A;  4H9S E;  1U5P A;  4I50 E;  4UVB B;  2M6I A;  3CX8 B;  4BCN B;  5L3E B;  2A72 A;  1S94 A;  2RP4 A;  2HH7 A;  2W4X A;  5HXR A;  4TWH A;  4DV5 T;  1TD6 A;  2WCA A;  2NWB A;  2G9X B;  1VCT A;  4ZI2 C;  3KV5 A;  3C50 A;  3IHR A;  1UK5 A;  3U78 A;  3HKC E;  3E08 A;  1NWM X;  3HKE E;  2UXX B;  3GWH A;  1JNZ A;  4PJL A;  5TAO A;  4DR1 T;  1AIS B;  5F3J A;  2W99 A;  5IDN B;  2UZL B;  3EAB A;  2B1E A;  4MAL A;  4YOS A;  4O4I E;  4O4J E;  3BG5 A;  4IE4 A;  3FXE B;  1BR4 A;  5HXC A;  2CBJ A;  3N5L A;  2BVM A;  4QKN A;  3ANW A;  1UUR A;  1URC B;  2XZE A;  1IZN B;  2XQY A;  4JI1 T;  3P7I A;  4EOZ B;  2PHG A;  1ZV4 X;  3A8O B;  3KV4 A;  2VQF T;  5LG3 A;  3ETV A;  2CEA A;  3KBT A;  3QB5 A;  4HFD A;  1FMV A;  1UCU A;  4ROE A;  4PK4 A;  3TLS A;  4OHF A;  2V7J A;  1H1S B;  1J5W A;  5H6R B;  2V7K A;  1YD8 G;  1IAP A;  3EDV A;  5LHG B;  4JI4 T;  1T7S A;  2CZ1 B;  1S35 A;  3EDU A;  2YEV C;  1B7T A;  3CX6 B;  3AE2 A;  1FJG T;  2X9Y A;  5FVL A;  2CRB A;  4EEB A;  3ZLI A;  4DID B;  4COF A;  1KFY A;  3R6N A;  2WEV B;  1CUN A;  4LF7 T;  2I59 A;  1G3N C;  4F70 B;  3RX6 A;  3L3P A;  3RQU A;  3T1Y T;  1H1R B;  5HBE B;  3PUY F;  3DL1 A;  4BCP B;  1G8X A;  1OED A;  4TWD A;  3MY1 B;  4Q25 A;  2UUC T;  1WR6 A;  5DJQ C;  4EV6 A;  4DR4 T;  4AI6 A;  4HKA A;  3CQG B;  4HFI A;  3AE3 A;  2LKH A;  2V6X A;  2EUF A;  3AAA B;  2XM1 A;  4YJ2 E;  3B5M A;  2SPC A;  2V6Y A;  3X20 B;  2I0M A;  4P0B A;  4ZI2 D;  3KHI A;  2A3D A;  4DV1 T;  2JQK A;  2L8K A;  4ZHQ E;  5JDH A;  2YOE A;  3T1H T;  2W96 A;  2VVS A;  3MAC A;  4IE5 A;  4HLQ A;  4EB6 E;  4ZS3 A;  3V5S A;  2QVA A;  2N9D A;  4I0U A;  1JST B;  1WYB A;  2LRL A;  5AQV B;  4UR9 A;  2MOZ A;  2W62 A;  4H9P C;  3FZL B;  4DND A;  2KXP B;  3HKD E;  4BAY B;  4KRC B;  3BQL A;  1XNQ T;  2BBH A;  1YKH B;  2D0U A;  4UF0 A;  2VKD A;  4BCI B;  1O3X A;  4GYR A;  4GYS A;  1W9R A;  5EZY E;  5JR9 B;  3FZF B;  2DME A;  5H6Q B;  2LSI A;  3N2K E;  4U7I A;  4EOO B;  3NZP A;  1YKE B;  4EOK B;  3AEA A;  2XAH B;  2V26 A;  5BR8 T;  1O9K B;  5JR9 C;  4ADZ A;  4F8H A;  4C91 A;  2LM9 A;  3NRX A;  3BG9 A;  2XAF B;  4TZ4 C;  3CVR A;  2QYW A;  1KNP A;  1SE7 A;  3ZT5 A;  3TLW A;  2WPA B;  5DQV A;  4UV9 B;  4CXW A;  2RPA A;  3KBU A;  2XY8 B;  1GQE A;  2CXF A;  4DO0 A;  1MIY A;  3JAF A;  2R7G A;  2WBL A;  4WZX A;  2E9X B;  4TV9 E;  3FB2 A;  4DR7 T;  4O4H E;  3MIA B;  1HF8 A;  5LCY A;  5AQR B;  4DMW A;  4MFR A;  4OYK A;  2I6H A;  3WI3 A;  3MZK B;  3VR9 A;  3EID B;  4BBS M;  4PNI A;  2QF7 A;  4CFX B;  1GUX B;  1HG5 A;  2ACZ A;  4BY1 X;  3W15 B;  4AKL A;  2UXN B;  2ZPE B;  4CFV B;  4EC9 B;  3IBP A;  2B9R A;  2KND A;  1HS7 A;  2YIN A;  4JEU B;  4DV2 T;  4F7N B;  4OGR B;  2IIU A;  2NTX A;  2CPT A;  4Z91 A;  2PJQ A;  5HWY A;  3UU8 A;  4QHO A;  3AE7 A;  4OR5 B;  4PJM A;  2RA1 A;  2YDS A;  3M3Z B;  2UZB B;  3LK2 B;  3AE8 A;  5C8Y E;  2PFV A;  1LVK A;  3E22 E;  4FX3 B;  1WFD A;  1MIV A;  5L3B B;  3BHT B;  5FXW A;  2BG9 E;  2JMH A;  1OGU B;  3NKZ A;  3ZCJ A;  5J2U E;  4UIG A;  3UU3 A;  4F7L B;  3HB9 A;  4HNU A;  4AQG A;  2LRK A;  4CI1 B;  2WWU A;  3VKG A;  4EON B;  1D0Y A;  1HNZ T;  2I40 B;  3VRA A;  2FBW A;  2XQ4 A;  3AXJ B;  1N34 T;  1UGQ B;  1HCI A;  3RRW A;  4MFE A;  2C5O B;  1D1C A;  2NW7 A;  2VKO A;  3I9W A;  4EOR B;  3P4S A;  4J2C A;  3EHZ A;  4DR6 T;  1D0X A;  1ZKE A;  2N2N A;  4GIW A;  4EOM B;  5C3J A;  3H37 A;  2CE7 A;  1XZY A;  3RYF E;  3UUM A;  1N33 T;  4YHH T;  4WW0 A;  4OK0 A;  3A5X A;  1MMA A;  1OIY B;  4U72 A;  4EAH A;  5LB7 B;  5KMG P;  5LJN A;  1KNR A;  2OLT A;  3I9Y A;  4H9Q C;  3N2O A;  2KIN B;  2F2C A;  2WDV A;  3QWL A;  4IE7 A;  2ZM2 A;  2XQ7 A;  3K3Q C;  3PUQ A;  4DMV A;  1OIU B;  3BQK A;  2QA7 A;  5CGM A;  4BCO B;  4H9R C;  3ZYK A;  4CFU D;  4M1P A;  3WAK A;  3GMI A;  4BCF B;  2I53 A;  4FI5 A;  3P4P A;  4PJN A;  2LSK A;  2X66 A;  3AE6 A;  3AVR A;  3AEE A;  2W61 A;  3KVA A;  1Z0P A;  1HX8 A;  3O4X E;  2CJM B;  1H28 B;  2PMI B;  2CM0 A;  5HBH B;  4HFC A;  3ZT6 A;  5FY1 A;  5CFB A;  2V22 B;  1WR0 A;  3C64 A;  4ZXL A;  2J4G A;  1Z8U A;  3B13 A;  2EHO C;  3KV6 A;  1YQ3 A;  1WRD A;  3F5X B;  4GK0 E;  4KUM B;  3HHT B;  3ZN1 B;  3ZST A;  3ZJ2 A;  3Q9D A;  3AEB A;  5ABF A;  5IF1 B;  4ASK A;  3QYB A;  1WCR A;  1ZEE A;  2BZB A;  2CA5 A;  4IT4 A; 
#chains in the Genus database with same CATH homology
 5LYJ E;  2BVM A;  4QKN A;  2KZ7 B;  3ANW A;  2NP9 A;  2DCF A;  2C5K T;  1IZN B;  3C4W A;  3RH3 A;  1QUU A;  3BK9 A;  2NTY A;  2XQY A;  2H7O A;  2W00 A;  3P7I A;  4EOZ B;  2VKH A;  2K24 A;  3KV9 A;  4UVC B;  1ZV4 X;  3NBX X;  2KWH A;  3O1J A;  3KV4 A;  5FYM A;  3V5U A;  2JMK A;  3O9X A;  5EK4 A;  3ZMS B;  3ETV A;  2CEA A;  3KBT A;  5J1G A;  1FMV A;  1UCU A;  4JEH B;  3RYH E;  3O1H A;  4PK4 A;  3NRY A;  4GK5 E;  4JLE A;  4OHF A;  2LSG A;  3KFW X;  3ONX A;  2Y6X A;  3ZJ1 A;  3MJX A;  2HPJ A;  2V7J A;  4G63 A;  2OA5 A;  3GA8 A;  3LK4 2;  1H7C A;  3OJA A;  4QX7 B;  2V7K A;  1YD8 G;  5H6R B;  5AFU L;  2MBG A;  1IAP A;  3CPZ A;  3EDV A;  1MIW A;  2N1G A;  3N9P A;  5LHI B;  5LHG B;  2LHN A;  3RRC A;  4B6X A;  1S35 A;  3EDU A;  2YEV C;  1B7T A;  3CX6 B;  1HTJ F;  1FIO A;  2X9Y A;  2V1D B;  1MMN A;  3ZLI A;  4EYU A;  2E8I A;  3AA7 B;  3LBX B;  3R6N A;  3PE0 A;  3H3A A;  3O1I A;  5HXH A;  2XAQ B;  5LG4 A;  2Q9Q B;  2CWY A;  2ZM0 A;  1CUN A;  2I59 A;  2WMN A;  3K8P C;  3RX6 A;  2IC9 A;  3L3P A;  1NAF A;  2VWA A;  3E0Z A;  4E7Z A;  4DVD A;  5A1L A;  4YJ3 E;  4X1I E;  2Q9Q D;  3Q5X A;  4GOU A;  1G8X A;  2Q9Q C;  4PAG A;  4X1Y E;  3U3I A;  4ZOL E;  5EK2 A;  2XAS B;  5HAX A;  4BJM A;  2C5J A;  1KK7 A;  4O4L E;  3IF8 B;  2E9X C;  1WR6 A;  5DJQ C;  2CXD A;  4UEM A;  4AI6 A;  3IEE A;  4HKA A;  3CQG B;  4WBO A;  4IST A;  3AAA B;  2EHO B;  1SHZ C;  4YJ2 E;  3N9L A;  2CLY C;  2SPC A;  3UUN A;  2P9B A;  3WAJ A;  4ANJ A;  4YHJ A;  4H63 H;  2Z6E A;  4H63 V;  4P0B A;  3HKB E;  2IAK A;  2W0G A;  2V7M A;  4ZI2 D;  2H3R A;  2LSJ A;  2A3D A;  4IDZ A;  2L8K A;  4ZHQ E;  5JDH A;  3N2G E;  2WSS V;  2XTL A;  2CMR A;  2D0T A;  2EHO D;  1LRZ A;  3N9Q A;  2PBI A;  4IE5 A;  3MAC A;  5FY7 A;  3LJC A;  4EB6 E;  2XAJ B;  4ZS3 A;  3V5S A;  5CA1 E;  3PTR B;  2N9D A;  3ZC1 A;  3ZCI A;  1AJ3 A;  1LKX A;  3S4U A;  5LBQ B;  1WYB A;  2KMF A;  3RC3 A;  5HXE A;  2V7I A;  3VU7 H;  4CI3 B;  2MOZ A;  2W62 A;  4P0A A;  4PK5 A;  4H9P C;  3Q2M A;  2JPF A;  2ES0 A;  4DND A;  2KXP B;  3HKD E;  3LG7 A;  4BAY B;  2BDE A;  5HXS A;  5L3D B;  3BQL A;  5L3F B;  2VK9 A;  3KDS E;  4EZH A;  1UX4 A;  4CZZ B;  3BQI A;  3MXZ A;  4PK6 A;  2CWO A;  5LBM A;  5ADX L;  4AQF A;  4QX8 B;  3ZYM A;  4YFS A;  1YKH B;  1D1B A;  2D0U A;  2GK9 A;  1KNZ A;  3PU8 A;  5HYA A;  4NUU A;  1EZ3 A;  4UF0 A;  5LA6 E;  3FHN A;  2VKD A;  5JRC B;  4GYR A;  1O3X A;  2ZLY A;  4GYS A;  5EZY E;  5JR9 B;  4KP3 C;  5IYZ E;  4A56 A;  5H6Q B;  2LSI A;  5GON E;  3MKD A;  3N2K E;  4YLH A;  4WNK A;  5CA0 E;  4I55 E;  3ZYL A;  3F57 A;  3NZP A;  1YKE B;  3J7Y q;  5ETW A;  3UTK A;  3GN5 B;  3ZMV B;  2ODV A;  3SS1 A;  3AVS A;  2J1D G;  2XUE A;  2XAH B;  2V26 A;  2VL8 A;  5LGN B;  2ACX A;  5JR9 C;  1LVF A;  2NOX A;  4ADZ A;  4C91 A;  2LM9 A;  1WYC A;  1Y64 B;  1G73 A;  3NRX A;  3PUS A;  4HTE A;  5JDF A;  2X9H A;  5JVD E;  4CI2 B;  2CXL A;  2PG8 A;  2NW8 A;  5DQW A;  2XAF B;  3CVR A;  3FBZ A;  4H9N C;  4TZ4 C;  4TUY E;  4C90 A;  5JRE A;  1OWA A;  3QK6 A;  3ZPO A;  4V1A v;  3RYI E;  2C5I T;  2LT3 A;  5DQV A;  4IGU A;  4EIW A;  4MBQ A;  1BR0 A;  1OXZ A;  4UV9 B;  4CXW A;  3KBU A;  5EK3 A;  2KLQ A;  2CXF A;  4DO0 A;  3OBV E;  3VHL A;  4L5G A;  3C51 A;  3OYX A;  4K0U A;  4HEA A;  3NZQ A;  1MIY A;  4L0R A;  3AA0 B;  1D1A A;  2K5B B;  2WBL A;  2WMO A;  3EUH A;  2L9Q A;  3F31 A;  2V7L A;  3RYC E;  3M65 A;  2E9X B;  3UFE A;  4HGA A;  4ZI3 C;  4X1K E;  4BA9 A;  3CKD A;  4TV9 E;  4O2B E;  3FB2 A;  4Z8X A;  3PDY A;  4O4H E;  5L3G B;  1HF8 A;  5LCY A;  4ISS A;  3DP7 A;  4DMW A;  5JDM A;  2CLY B;  3L09 A;  4MFR A;  4MHC A;  4OYK A;  2DHR A;  3I0Q A;  3WI3 A;  1SA0 E;  3MZK B;  1IJ6 A;  2DNX A;  2ODU A;  3DJB A;  3MK7 C;  4TV8 E;  3AA6 B;  5JH7 E;  1IJ5 A;  2LE8 A;  4ZS2 A;  4PNI A;  2E9X D;  3LBX A;  5L2L A;  4HE8 A;  4UXN B;  2XAG B;  3ZEF B;  2Q9Q A;  1HG5 A;  4O2A E;  3C98 B;  3PUG A;  1FMW A;  3W15 B;  4AKL A;  2UXN B;  2DLR A;  3RPU A;  3IBP A;  2BVL A;  4H9O C;  1U4Q A;  2C0S A;  3PUR A;  2KND A;  5FXZ A;  1HS7 A;  3AB3 B;  1D0Z A;  2YIN A;  2X0L B;  4JEU B;  4IHJ E;  2L3L A;  2Y8D A;  3K3O A;  4XBF B;  2VKJ A;  5LP6 E;  2DWG A;  3ZMU B;  3HR0 A;  4EYY R;  5IHY A;  2NTX A;  5F8P A;  5FNV E;  3ZMZ B;  5L3C B;  2CCQ A;  3ZN0 B;  3Q5W A;  2Y48 B;  4EZ4 A;  2PJQ A;  2LOS A;  1BR1 A;  4HFV A;  5HWY A;  4I43 B;  1VOM A;  2HPL A;  3ESL A;  4QHO A;  3EVY A;  2YU1 A;  2EHO A;  3AAI A;  4L9I A;  4PJM A;  3CQX C;  2ZMA A;  4F6R C;  2LEH A;  2D5U A;  2RA1 A;  4ERR A;  5JDG A;  3LK2 B;  2JQQ A;  3HL6 A;  4TN7 B;  3ANW B;  3QUJ A;  5C8Y E;  5M4Y A;  2PFV A;  4XAX B;  2X51 A;  1LVK A;  2WAU A;  3E22 E;  4PFO A;  5JDL A;  5FXX A;  2DWK A;  1MIV A;  3UT5 E;  5L3B B;  5FXW A;  5KX5 E;  4UEL A;  2MYS A;  3KIN B;  1YW0 A;  3ZC0 A;  1US7 B;  2JMH A;  3OYZ A;  5BMV E;  5LOV E;  3ZCJ A;  2G0U A;  5LGU B;  4QXB B;  2H7V C;  4ILU A;  4AQF C;  5J2U E;  5KDM C;  4UIG A;  4CXY A;  5LJM A;  4DBR A;  1WLX A;  4QWN B;  5E0O A;  1HFA A;  2WM9 A;  1V9D A;  3JC6 C;  2IW5 B;  3UUX B;  1ZHC A;  4AQG A;  4E7S A;  4CI1 B;  3C4Z A;  2WWU A;  4WBN E;  3VKG A;  4DBQ A;  1D0Y A;  2A2F X;  5DAB A;  3FXD B;  4IE6 A;  2M67 A;  3RKO A;  3LFM A;  1QSD A;  2YU2 A;  5JQG E;  1MMD A;  4HN9 A;  1HCI A;  3RRW A;  3QC9 A;  1VRB A;  4QXC B;  1D1C A;  2NW7 A;  2VKO A;  3FBL A;  3I1A A;  4OYJ A;  5LNK A;  3I9W A;  5HWX A;  3PU3 A;  3R84 B;  4J2C A;  3N9M A;  1D0X A;  4KBM B;  4PJJ A;  5JRC A;  4FJO A;  1ZKE A;  2N2N A;  1MMG A;  3HA4 A;  2X9W A;  4GIW A;  2YK0 A;  5JR9 A;  3H37 A;  4KMC A;  2CE7 A;  4N78 D;  5LHH B;  3RYF E;  4QXH B;  3SRZ A;  3I0O A;  3UUM A;  4AKR B;  3C4X A;  5JDQ A;  4G2A A;  4WW0 A;  2IC6 A;  3AAE B;  4OK0 A;  2K48 A;  5FP3 A;  2X68 A;  3A5X A;  1MMA A;  3GN5 A;  5J2T E;  4U72 A;  3CX7 B;  4EAH A;  2KT9 A;  2JJ9 A;  3UUL A;  4ZI3 D;  5KMG P;  5LJN A;  3PUA A;  2D2S A;  3I9Y A;  3CWZ B;  4AKG A;  3K3N A;  4H9Q C;  3N2O A;  4AKH A;  3T8O A;  1T98 A;  4OFZ A;  3TKL B;  5LXT E;  2KIN B;  1UX5 A;  4IE7 A;  5CB4 E;  2X67 A;  3N9N A;  4IIJ E;  4U74 A;  4UV8 B;  2ZM2 A;  3F2E A;  3ETU A;  1MND A;  3K3Q C;  2LJL A;  3PUQ A;  3SWH A;  4ZI7 E;  2ZM8 A;  4DMV A;  4AKI A;  4CQI A;  2X9X A;  4X20 E;  3J9X 1;  3SOL A;  2K9A A;  3AA1 B;  3VKH A;  4JUY A;  2QGS A;  1MNE A;  3BQK A;  3P8C D;  4XZC A;  2QA7 A;  3OKQ A;  4MLK A;  4PFP A;  4NUV A;  1E1H B;  4H9R C;  2LOP A;  2E9X A;  4O8S A;  4PW8 A;  3ZYK A;  3B57 A;  2VB6 A;  4P09 A;  3D0T A;  4M1P A;  1HG2 A;  4H9S E;  5FXV A;  3WAK A;  1U5P A;  3N9O A;  4I50 E;  3GMI A;  3CQC B;  4UVB B;  4FI5 A;  2LSK A;  3CX8 B;  1BR2 A;  4PJN A;  3CML A;  2X66 A;  5L3E B;  2A72 A;  4I4T E;  3MA9 A;  3AVR A;  2MTQ A;  2KWI B;  1S94 A;  2RP4 A;  1FEW A;  2W61 A;  2HH7 A;  3KVA A;  5HXR A;  1Z0P A;  1HX8 A;  3O4X E;  2NWB A;  4TX5 A;  2CM0 A;  2VAS A;  4ZI2 C;  3KV5 A;  5FY1 A;  5JDN A;  3C50 A;  3IHR A;  3RC8 A;  3C64 A;  3U78 A;  3DTO A;  2XHE B;  3HKC E;  3B13 A;  3E08 A;  1NWM X;  2LHR A;  4CXX A;  2DI4 A;  3HKE E;  2UXX B;  2EHO C;  3GWH A;  4PJL A;  5FY0 A;  3KV6 A;  5TAO A;  4UF0 B;  5F3J A;  1WRD A;  3HI2 A;  2LSY A;  3LK3 B;  2JRK A;  2B1E A;  4MAL A;  5FMN A;  3KVB A;  2W63 A;  4GK0 E;  4KUM B;  3ZN1 B;  4BJN A;  3ZJ2 A;  3Q9D A;  4UVA B;  4O4I E;  4O4J E;  2NW9 A;  4EXT A;  4IE0 A;  3JC6 D;  4ASK A;  4IE4 A;  1X79 A;  3FXE B;  1BR4 A;  1ZEE A;  2BZB A;  5HXC A;  2CA5 A;  3ZMT B;  5LGT B;  4AXP A;  3N5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...