2PJQA

Crystal structure of q88u62_lacpl from lactobacillus plantarum. northeast structural genomics target lpr71
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
215
structure length
206
Chain Sequence
MITETQLTAIQTYALQKLAHDHSGHGRDHLQRVNRLARRLAKDEGANLNLTLAAAWLHDVIDAHQDLIVQLNAQNVTADDQTAIFAIIDHMSFSKSFNGPQKLSLEGQVVQDADRLDAIGAIGIARALYYSGHVGEKIYDPAIAPREHMTREQYRHQPGTAINHFYEKLFKLAALMNTDTAKALAAHRTAVMHEFVDQFKAEWTAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein lp_2664
publication title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum wcfs1
total genus 66
structure length 206
sequence length 215
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2pjqA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2pjqA02
3DJBA 5DQVA 2QGSA 5DQWA 3DTOA 5IHYA 3B57A 2PJQA
chains in the Genus database with same CATH superfamily
2C5JA 3AXJA 1VRBA 2FJDA 3UFGA 4ADZA 4YSZA 5FXVA 3H3AA 1D1BA 4MFEA 2BS4A 3PUXF 5J1GA 3CWZB 4GYRA 4JI6T 3CQCB 5DJQC 5HWYA 3FZLB 4EYUA 3BK9A 3QYBA 4CFVB 3PUSA 4U33A 5JTGA 2LSJA 2YDQA 2LT3A 3Q9DA 1LRZA 2BG9B 4CI1B 1OL2B 4CFXB 2MYSA 2IW9B 2WCAA 3P4SA 4F7JB 3QZ9B 5HVYB 3MA9A 4JUYA 1JNZA 1H1SB 2BKZB 3AA0B 5JR9B 4LF4T 3EDVA 2V6YA 5L2WB 3J7Yq 1QLBA 1V29B 4ISSA 4PK5A 4TWHA 4X5TA 3NZPA 3N9LA 1WYBA 1TFBA 5KXJA 1NWMX 1WR0A 4BCQD 4C90A 4B3ST 3T1HT 4G2AA 4Y72B 3P4RA 3ZPOA 4JX5A 2E9XB 3KVBA 4DUZT 4YTMA 3GA8A 4PFPA 2WMNA 4ILBA 4JI8T 2VL0A 1W09A 3G33B 1D1CA 2PTFA 4G63A 1ZP2A 1KK7A 3RI5A 4DBQA 2QYWA 5HXHA 3MY1B 3QYHB 2WXVB 3ONLC 2DD5B 4NIQA 3AE6A 4PJJA 2WFYB 5IUXA 4AQFA 3UQ4A 3ZYMA 3O9XA 4AKGA 1OXZA 1H28B 1J1JA 2Y6XA 2M67A 3AEAA 3UUMA 2CCHB 1H1RB 1HNWT 2C4GB 1IBKT 4MLKA 3UFEA 5LHGB 2JQKA 5TAOA 4TV9E 5HYAA 3ZMSB 4IDQA 4TZ4C 3JC6C 1IREB 2K24A 3PUQA 3AXJB 1QMZB 5ABGA 2CZ1B 3G06A 2ZM6T 5DQWA 3PDYA 2HPJA 4ISTA 1W0BA 1MMGA 2YKSA 5FL1A 2W67A 3N5LA 3POMA 4QXCB 2XQ9A 2W2UA 3OTOT 4OR5B 4CRLB 4EOQB 4A56A 4FI5A 4BCGB 3ZT7A 4ZS2A 1UGQB 2I0MA 4UEMA 4BCKB 4HEAA 4JI5T 2WZIA 2IW6B 3L8RA 1NEKA 1VOLA 4YJ2E 2H3RA 2WWUA 4WYVA 4ZI3C 5HEGA 1NENA 2YN6A 4YLHA 5IDNB 1HF8A 4JI2T 3ZKRA 3PE0A 4IDNA 1D3UB 2DLRA 2V6YB 2X0LB 3S4UA 1N34T 2W61A 5JDGA 2M6IA 4U7YA 5EK2A 4GIWA 2F4VT 2A9UA 3B13A 3V5SA 1E9HB 3HBLA 4F6WB 3OYXA 2CEAA 1D0XA 3FZFB 2JQ9A 3RX6A 4EOPB 2CZ6B 3RKGA 4UN0A 5LNKA 5AQNB 2WJ9A 3CX6B 5FVKA 4UVBB 3RIUC 1YQ4A 3IHRA 4GOUA 1ENWA 4B6XA 4DV0T 5LBMA 4X1KE 3UUBA 4AQGA 5EZYE 2KR6A 1D0YA 1X79A 2ZMAA 3ZEFB 2NTXA 1FEWA 1O9KA 3PUAA 3ZJ1A 5LCYA 2LLYA 4ZXLA 1IBLT 2WY2A 3K1SA 2KT9A 1UGPB 3LBXA 2KWHA 3AEDA 2A2FX 1T72A 5L47A 2D2SA 3CVRA 3C4WA 2WDVA 3RLFF 4H9NC 2AXDS 4EOOB 1URCB 2H7OA 4P1NA 5CGMA 4JI4T 4MFRA 4LFCT 3X25B 2YINA 4OB1B 2QDYB 4UF0A 3EHZA 3HKDE 3QYGB 3SOLA 3N9NA 3ZN0B 2L8KA 2LKGA 5L3DB 4EC8B 2CZ0B 3WI3A 4ROCA 3FHNA 2KZ7B 4TN7B 5HCJA 3P4PA 3E08A 2D0TA 4Z8XA 5L4EA 3LK42 4GKJT 4LF5T 3M3ZB 1OEDE 3A8YC 2MAWA 4AQYT 1FIOA 2HHHT 3EDUA 4PK4A 1W98B 2XASB 2A3DA 1UNHD 2OLTA 2YU2A 2UUEB 2CZ7B 2UXXB 3UUNA 2J62A 2UZEB 2HN1A 5AQIB 5AQMB 1OGUB 1AD6A 1WLXA 2V7JA 4GK0E 4BCQB 4YTPA 4BCNB 3BQLA 3KDSE 5FMNA 4MBQA 3QZ5B 4PJNA 3A5XA 3VRBA 4MFDA 4ZI2C 5AQPB 1Z0PA 4F7SB 2XTLA 3QYEA 1GQEA 4NUUA 1Y64B 2IIUA 4EORB 2LSIA 5LB7B 4DO0A 3I9WA 5I5ZB 4HFDA 3SS1A 2XQ5A 1VYWB 3UU8A 1O9KB 3ZSTA 3ZN1B 5BNJB 3QB5K 5LG3A 2WU2A 2DL1A 4OYKA 3J9X1 3LBXB 2ZLYA 3F5XB 4BCHB 2DXCB 5HBJB 5L4HA 5HEJA 3JADA 4F70B 3FB2A 2W0GA 3ZJ2A 5LMUT 4ZZCA 3ZYLA 3JC6D 5LYJE 4P09A 1BR1A 3RGLA 3RQWA 3OKQA 1KF6A 4BCJB 1UGOA 1BU2A 4DR2T 4UF0B 5HNBB 4U2YA 4QKNA 3VKGA 2V7KA 1KFYA 4IE5A 4PJLA 1AJ3A 4ERRA 1OEDA 1KNPA 3K3OA 5FYMA 3CIRA 3PU8A 2ZPGB 3MXZA 3N2OA 3M03A 2KNDA 3PUVF 1PKDB 1YKHB 4EOKB 1JNRA 2BKPA 3BLHB 2UXCT 2P9BA 5LGUB 3Q2MA 5BR8T 2VK9A 4ZI3D 3AA7B 2HH7A 5KX5E 2WU5A 2H88A 2DI4A 4HN9A 1F5QB 4YHHT 5J2UE 2WZHA 2IDOB 4JBWF 4QH5A 3LSVA 4N78D 2C5IT 2XZEA 4IE6A 2ZPEB 4ZGJB 2I59A 3PURA 4MIMA 4KI0F 2PBIA 1IZNB 4U31A 2W62A 2VKOA 3JCFA 4DUYT 2XQ8A 4OB2B 3AE9A 2UZLB 2CXLA 4BCMD 2YDRA 3HO8A 3U78A 3CMLA 2I40B 2UU9T 4JX6A 3AAIA 4JYAT 5CA1E 3I0OA 2ES0A 1CUNA 3TLTA 2N2NA 4YXDA 4JI7T 4IL4A 2Q9QC 3LG7A 4DV5T 4BY1X 4CXYA 2IUBA 4PNIA 4CXWA 2BS3A 2L9QA 3LJCA 5AQHB 1G3NC 1SUMB 4A5XA 4YSYA 1VOMA 2LOSA 5CJ5A 5FNVE 2HN2A 5JRCA 2G77A 3FXEB 2PK2A 5FL0A 2XQAA 4KMCA 3TW7A 2OA5A 4DR5T 2ODVA 1VINA 4HWCA 3UT5E 2CA5A 2Z6EA 4DV2T 5FXXA 2NTYA 2X51A 2LW4A 4M6VA 1US7B 2C6TB 5FY7A 5AFUL 4O4JE 2QGSA 2E2AA 2BVMA 4ZGDB 4HFHA 1OEDB 4TTHA 4EOSB 4EEDA 2UZBB 3RIFA 2UXDT 3QHWB 3ONJA 5AQVB 5GONE 4LMJA 3JAFA 2V7MA 5JDMA 2W2HA 5ETWA 3P4QA 5FXWA 3ZC0A 4BCND 2DNXA 2C5VB 4L5GA 5HEUA 3A8OB 3EVYA 3QWLA 1T8BA 4H9RC 1FKMA 3TKLB 3AEGA 1UK5A 3ZYKA 3WVEB 4KRCB 3ZMZB 5HWXA 2QQ8A 3RIAA 4I50E 4IIJE 5JH7E 1WRDA 3DDPB 2QA7A 3U3IA 2E5LT 1EZ3A 4OX9T 5EJCA 5EK4A 5HEHA 1H1QB 4BXXX 4ZI2D 4YC3B 3RYCE 3QOFA 5FY0A 4BCIB 2X67A 3B5MA 2WDRA 4K0UA 2X9HA 3RIUA 4UVAB 2WIPB 1OL1B 2EUFA 4GYSA 4UELA 1YQ3A 3UUXB 4OHFA 2XM2A 1S35A 2VL8A 3RYFE 3W15B 4EIWA 4ZI7E 2W99A 2UUAT 1H26B 2IAKA 3F57A 4E7SA 2W63A 3KBTA 4X64T 2CPTA 2IVXA 1M7KA 2K3WA 2IHR1 3LFMA 2IW5B 3ZT5A 3K3NA 5FXZA 3D0TA 1IJ6A 5H6QB 1SE7A 3EJ1B 5IWAT 1XNRT 3MY5B 1WFDA 4QWNB 2VVSA 3RF1A 5C2TA 2CBJA 5LMKB 5JRCB 1MMDA 2WMBB 3A8MB 4CN4A 2UXBT 4X66T 3HL6A 5F5WA 3EABA 4NC6A 1E2AA 4IE0A 1HFAA 4YOOA 4F8HA 2CYZB 4DV1T 2QRXA 4F6RC 2LRKA 1KEYA 2A72A 3O1HA 2CWYA 2V7IA 4DVDA 2UZDB 3O0GD 3QNUA 5AQRB 3ETVA 3RYHE 3Q5EA 3C64A 4HWHA 2X0YA 3RGFB 3RYIE 4CI2B 2NR4A 1T98A 2DWGA 3VR8A 2XAGB 5L3GB 4CFMB 2C5OB 1MNDA 1T7SA 1N33T 5HXEA 1G73A 3HB9A 3X20B 4O4HE 2JQQA 5KDMC 4X1IE 4I3ZB 5ACBA 4BJMA 2XQ7A 3KFWX 5FGKB 2EHOD 2ACXA 4M1PA 5LGTB 1FJGT 2IMLA 1XMOT 3VU7H 4IMYB 5IF1B 2BBJA 5HQ0B 4DR6T 4CN6A 2LSYA 2ZM8A 2KXPB 3DDQB 4B3TT 5HAXA 2Y8DA 5JDHA 3F2EA 5LGNB 2J47A 3FXDB 4KBMB 4ASKA 5CA0E 4IDOA 4EGWA 5AQTB 1XDPA 2BKNA 3EAMA 4H63H 4U7IA 4QSHA 4AKHA 2D9DA 4CFUB 3MKDA 2W9FA 3BG3A 1X9BA 2JRKA 3X26B 4BCMB 4CQIA 2DD4B 4U2ZA 3FZHB 3RRWA 4LFAT 4BCPB 5LHHB 4JV5T 2X0HA 2J4GA 3HZJA 4IE4A 4WZXA 2VQFT 1GUXA 2G0UA 5CFBA 4IDPA 3PO3S 3K8PC 4PW8A 2UUCT 4IT4A 4LF9T 2BBHA 2VKDA 4DV6T 3L3PA 4QX8B 4TX5A 4U3CA 4NPPA 2JJ9A 4EC9B 2QVAA 4G6LB 2NW7A 2XAFB 3WVDB 2LKHA 4EV6A 2NOXA 4KRDB 4H9QC 4DBRA 3UU6A 3ZLIA 1H7CA 1UURA 5LJMA 1UUSA 5LBQB 5HBEB 4H9PC 3AVSA 5LJNA 3A8GB 1W0AA 2C5KT 3N9QA 3OBVE 2LM2A 2KINB 4EOLB 3A8LB 2V6XA 5IDPB 5IYZE 5J2TE 2JPFA 4A97A 2CJMB 4F6UB 3IEEA 2V5DA 2EHOA 1DU2A 4JEUB 1UGSB 5AQJB 1I94T 5E0OA 5LP6E 2PK9B 4H9OC 5JDLA 1O3XA 4F7NB 2H89A 1WCRA 1L0VA 3QUJA 5CYIB 1BR2A 2X9WA 1HS7A 4OYJA 3IF8B 3BHVB 2E5VA 4DNDA 3AE1A 3ESLA 3HKEE 4HNTA 2WBLA 3H4CA 3JAEA 3DJBA 4MALA 3BLRB 1FMWA 5JDFA 2AE9A 4ZS3A 2V26A 4YOZA 4UVCB 4WBOA 1UGRB 4ELLA 3Q5XA 3FBZA 2CBIA 1ZOYA 4PK6A 4CXAB 3Q5DA 1LKXA 4L0RA 3HA4A 2PHGA 4ELJA 2Q9QA 4AKIA 3AE7A 2ZPHB 1GUXB 2F2CA 5ICPB 2CXDA 3R6NA 5IHYA 3KV4A 1H4LD 2FBWA 1B7TA 4OFZA 3DTOA 4IL9A 2LHRA 4HL4A 4EONB 2LEHA 4HWIB 2WPAB 2PJQA 5AQOB 1Y01A 4PAGA 1MNEA 1UX5A 3T8OA 4CI3B 4IGUA 1M62A 4CFNB 2WIHB 3SRZA 5HCMA 5L3CB 4FX3B 1HG5A 3N9MA 3PUZF 3QK6A 4QXBB 5CB4E 2LSGA 2XQ4A 1WYCA 1YXRA 4QXHB 3ZSSA 5L3FB 1KNRA 4XBFB 3UU4A 4FJOA 2ACZA 3IBPA 5FP3A 3AAAB 5DQVA 4MHCA 2KMGA 3X28B 2V5CA 3PTRB 5LA6E 1XO2A 4EB6E 4I0UA 4WNKA 2W96A 3TNIB 1HNZT 2LM9A 1HCIA 4GKKT 1JSUB 2EHOB 3N9OA 4LFBT 3FZMB 3N2KE 4GK5E 2W9ZA 2WHBB 3K3QC 3RRCA 1IJ5A 2XAHB 1JOWA 3R84B 1HTJF 1UCUA 1OI9B 3AE3A 4HKAA 2D0UA 5M4YA 3NWIA 4CFUD 2X66A 4TWDA 4HWDA 2N9DA 2XY8B 2DPPB 2ZPBB 5FKYA 3AEEA 3PJAJ 2JQHA 1XMQT 3AEFA 3AE8A 4X65T 2CLYC 3RPUA 3KV6A 1YD8G 1UNLD 1WR6A 5LQFB 4F6SB 3V5UA 3TLUA 1QUUA 4KUMB 4I55E 4LMLA 3NZQA 1J5ET 2WB5A 3QXEB 2C0SA 4RODA 5H6RB 2XSBA 5ABEA 3PU3A 1QSDA 1MIVA 5EFQB 1ZV4X 4OB0B 2B1EA 5EK3A 2JIWA 2AHJB 2Q9QB 2BS2A 2XJ7A 3HI2A 3BHUB 3NVOA 3DP7A 1H25B 4DMWA 3BQIA 4EEBA 1MIWA 4Z90A 3VKHA 1G8XA 3CKDA 5J0ZA 2SPCA 3WAJA 2X9XA 3BG9A 1Z8UA 2QFZA 3P50A 3ANWA 2ZPFB 2K5BB 3MIAB 5A1LA 4O8SA 3ZT6A 5AQSB 2BG9C 1HX8A 1OEDC 5AQLB 2CHOA 2VASA 3GMIA 4TWFA 5C3JA 2DCFA 5JR9C 2KWIB 2WM9A 4ROEA 3P7IA 1E7PA 4IHJE 1D0ZA 4J2CA 3UQ7A 3LK3B 1SA0E 4P0BA 3ZCIA 5LOVE 1AISB 2LJLA 2YU1A 4DV3T 2WQYA 4X20E 4H9SE 4EXTA 3NRYA 1SHZC 4ANJA 1IAPA 2CCQA 2CXFA 5F3JA 2E9XC 5LMNT 3CQXC 4X1YE 5JVDE 3F31A 1BR4A 2VVNA 4AI6A 1AHJB 1FINB 5L3BB 4XZCA 2M6BA 4BBRM 3WAKA 2B9RA 5C8YE 3M65A 2MBGA 3AB3B 1C9BA 1LVKA 1HG2A 1ZEEA 4BA9A 1ZHCA 2MTQA 5BMVE 4BAYB 2HPLA 2G9XB 3PUYF 1CHUA 3RH3A 2XHEB 2WSSV 4HFVA 4YSXA 4X62T 2LOPA 4BJNA 4HFEA 3RC8A 4PJMA 2WDQA 5HXCA 2NW9A 4COFA 1N36T 2WMAB 3MACA 2FJBA 4WBNE 5HBHB 2FJAA 1KXUA 2IN3A 1XDOA 3EUHA 2BPMB 1GH6B 3TLSA 1UNGD 4DV4T 2B76A 2WAUA 3VR9A 4QH4A 5F8PA 3SWHA 2H7VC 3CX7B 4TNVA 2QDJA 4UV9B 3PV0F 3CX8B 1NAFA 3C98B 3TW6A 3QHRB 4LF8T 4OB3B 3C51A 1VCSA 3AVRA 4IDZA 2JMHA 4HGAA 1D1AA 1JKWA 4FM4B 1MMAA 5HEOA 3OJAA 2IW8B 4ZOLE 1JSTB 3TNWB 3LK2B 3GTMS 3ANWB 5LXTE 4HE8A 3UULA 1XZYA 3CPZA 2E8IA 3AA1B 2FUPA 2XQ3A 2XSAA 5AQKB 4YFSA 4IE7A 1HX1B 2V8SV 2KLQA 4OGRB 1S94A 2LHNA 2RPAA 2R6GF 2CM0A 3P8CD 1U4QA 1W9RA 4YOSA 3C50A 4TUYE 3UU5A 4B3MT 5CEIB 3AE2A 2XUEA 3GWHA 4UXNB 2V1DB 5KMGP 4YY3T 3L09A 4LF6T 3I1AA 4NUVA 4HNUA 5JDQA 3LDQB 2I6HA 4HFBA 4Z6YA 1ZKEA 3SFDA 2YDSA 3CQGB 2NWBA 2MOZA 1ZP0A 3H3MA 4Q25A 2XPKA 2BDEA 3C4ZA 4TNWA 2BVLA 3ZMVB 2GK9A 3N2GE 4ZHQE 4HNVA 2RP4A 4JI0T 4ZEYA 4AKLA 3AAEB 2N1GA 4E7ZA 3CK6A 2C5NB 4ZGEB 2BZBA 5FVLA 4AQFC 4F7LB 2D5UA 2LRLA 2CE7A 4O2BE 3C4XA 2RA1A 1R8IA 4CN1A 3KVAA 4OK0A 4DV7T 2W4XA 2Q9QD 2VKHA 1YW0A 4EAHA 3AECA 2WS3A 3MJXA 4QX7B 2V7LA 1H1PB 4BCOB 2ZZDB 5LG4A 4CXXA 4AKRB 2VKJA 3DL1A 3OYZA 4PFOA 3E0ZA 3PJAA 2ODUA 5JDNA 5AQQB 3VRAA 4UIGA 1OIUB 4EYYR 4HTEA 4DMVA 4TV8E 3VYHB 3KV9A 2XAJB 3HR0A 4UV8B 4DR1T 1MMNA 4KHZF 3FBLA 3TNHB 2R7GA 2XQ6A 3HKCE 3A7MA 2WMOA 2NP9A 4XAXB 4EZHA 3L39A 3OPCA 3E22E 5ADXL 3AE5A 4HFCA 3ZMTB 4U74A 5FY1A 2CRBA 4DR7T 2BG9E 3I0QA 1J5WA 2ZPIB 2K48A 1UX4A 2PFVA 4AXPA 2ZM0A 4ILUA 4WW0A 4DR4T 3LQ5B 4K0KT 2DWKA 2KSRA 4U72A 4EZ4A 5HXRA 3SFEA 2IC9A 3DOGB 3ZC1A 2C5XB 5AQFB 3ONXA 3UTKA 4NXNT 3FZKB 4KP3C 2VQET 5ABFA 3Q5WA 2E9XD 2ZM2A 3H37A 1OKWB 2FJEA 1HNXT 4I43B 3HKBE 2CHNA 2L3LA 3O1IA 3ABVA 1OWAA 3RKOA 4JI3T 1P5EB 2J1DG 2WP9A 3VHLA 3AA6B 2KMFA 3MZKB 4HWFA 4ZZBA 1XWMA 3EOCB 4BBSM 3X1DA 3X24B 4QHOA 4CFWB 2X68A 3TN8B 3IA3A 2YOEA 3P4WA 2LE8A 2JGZB 3NRXA 5ABHA 5HXSA 2QF7A 4V1Av 4EOZB 3KV5A 1KNZA 2NW8A 4YJ3E 4H63V 3B57A 4JLEA 3UU3A 3KHIA 3O4XE 4EOIB 4II5B 3GN5A 3KINB 4EOJB 4JI1T 2W66A 3NBXX 3HHTB 4DIDB 1XNQT 4O4IE 2IC6A 1VCTA 4BCFB 3VYGB 2YEVC 3EIDB 4KHPT 1H24B 4LF7T 2I53A 1FMVA 3QC9A 5DABA 4YT0A 3ETUA 3RHWA 3ZMUB 4O2AE 4UR9A 3PUWF 3ZCJA 1GY3B 1H27B 2VWAA 3MI9B 3KBUA 1OIYB 4ILCA 2JMKA 4AIUA 4HLQA 4ILAA 4KX6A 3EI0A 2PMIB 1V9DA 2DMEA 2V22B 3AEBA 4LMKA 3TLVA 1N4MA 2DHRA 2CMRA 3PUGA 2BG9A 2XM1A 3O1JA 4BY7X 1YKEB 1FVVB 2WEVB 1E1HB 3TLWA 2VB6A 2K9AA 5JR9A 2CWOA 4O4LE 4B3RT 5L2LA 3K7AM 2UXNB 1MIYA 3NDQA 5JQGE 2LSKA 2CCIB 2EHOC 3T1YT 3NKZA 2PG8A 1N32T 3RQUA 1OKVB 4P0AA 4YTNA 2E9XA 2VURA 5ABFB 4NSTB 2BKOA 1U5PA 4I4TE 4CZZB 4AISA 2D0QB 5L3EB 2ZCFB 2DXBB 4YHJA 4JX4A 3RC3A 3BLQB 2OV9A 4DR3T 5JREA 3BHTB 3BG5A 1TD6A 1BR0A 3A8HB 3OVUA 2YK0A 4HFIA 4L9IA 5AQUB 4NXMT 3QB5A 5LHIB 2X9YA 2CLYB 5AQGB 1LVFA 2W00A 4EOMB 4A98A 4LOCA 2UUBT 2XAQB 4IREA 4Z91A 1IBMT 2X1NB 1I6ZA 1HR0T 2XQYA 3AE4A 3BQKA 3N9PA 2Y48B 4QH1A 3GN5B 3I9YA 4C91A 2MPKA 4JEHB 2WWVA 3MK7C
chains in the Genus database with same CATH topology
2C5JA 2VKDA 3FB2A 2W0GA 1VRBA 3ZJ2A 3C51A 3ZYLA 3L3PA 3AVRA 4QX8B 4IDZA 2JMHA 3JC6D 4TX5A 4HGAA 5LYJE 1D1AA 4P09A 2JJ9A 4ADZA 1BR1A 1MMAA 3OKQA 5FXVA 3H3AA 3OJAA 2NW7A 2XAFB 1D1BA 2NOXA 4H9QC 5J1GA 4UF0B 4ZOLE 3ZLIA 4DBRA 3LK2B 1H7CA 3CWZB 3ANWB 4GYRA 4QKNA 5LJMA 3CQCB 5DJQC 5LXTE 4HE8A 2V7KA 3VKGA 5HWYA 5LBQB 4IE5A 4EYUA 4PJLA 4H9PC 1AJ3A 3UULA 4ERRA 3BK9A 3AVSA 3PUSA 3K3OA 5FYMA 5LJNA 3CPZA 2E8IA 3AA1B 3PU8A 3MXZA 3N2OA 2LSJA 2KNDA 2C5KT 3N9QA 3OBVE 2LT3A 3Q9DA 4YFSA 1YKHB 1LRZA 4IE7A 2KLQA 4CI1B 1S94A 2LHNA 2MYSA 2P9BA 5LGUB 2KINB 3Q2MA 2CM0A 3MA9A 3P8CD 1U4QA 4JUYA 2VK9A 3C50A 4TUYE 5IYZE 4ZI3D 5J2TE 2JPFA 3AA7B 3AA0B 2HH7A 5JR9B 5KX5E 3EDVA 3J7Yq 4ISSA 4PK5A 2XUEA 3NZPA 3N9LA 3GWHA 3IEEA 1WYBA 2DI4A 2EHOA 4UXNB 1NWMX 2V1DB 5KMGP 4HN9A 4C90A 4JEUB 3L09A 5J2UE 3I1AA 4G2AA 5E0OA 4NUVA 5LP6E 5JDQA 4H9OC 3ZPOA 5JDLA 1O3XA 4N78D 1ZKEA 2C5IT 4IE6A 3CQGB 2NWBA 2E9XB 2MOZA 2I59A 3KVBA 3PURA 3GA8A 3QUJA 4PFPA 2PBIA 1BR2A 2BDEA 2WMNA 2X9WA 1HS7A 3C4ZA 2BVLA 4OYJA 1IZNB 2W62A 3IF8B 4DNDA 3ZMVB 2VKOA 2GK9A 3N2GE 1D1CA 3ESLA 3HKEE 4ZHQE 2RP4A 4G63A 2WBLA 4AKLA 1KK7A 3AAEB 3DJBA 4DBQA 4MALA 2N1GA 1FMWA 4E7ZA 5HXHA 5JDFA 2CXLA 4ZS3A 2BZBA 2V26A 4AQFC 3U78A 2D5UA 4O2BE 2CE7A 4UVCB 4WBOA 3C4XA 3CMLA 2RA1A 4PJJA 3AAIA 4AQFA 5CA1E 3I0OA 3KVAA 4OK0A 3Q5XA 2ES0A 1CUNA 3ZYMA 3FBZA 3O9XA 2N2NA 4AKGA 1OXZA 2Q9QD 2VKHA 2Q9QC 4PK6A 1YW0A 3LG7A 4EAHA 3MJXA 2Y6XA 4CXYA 1LKXA 4L0RA 2M67A 3HA4A 3UUMA 4QX7B 4PNIA 2Q9QA 4AKIA 2V7LA 2L9QA 3LJCA 4CXWA 4MLKA 2CXDA 3UFEA 5LG4A 4CXXA 4AKRB 1VOMA 3R6NA 5IHYA 2VKJA 2LOSA 5LHGB 3KV4A 3OYZA 4PFOA 5FNVE 5TAOA 3E0ZA 4TV9E 5JRCA 2ODUA 5JDNA 5HYAA 3ZMSB 4TZ4C 3JC6C 1B7TA 3FXEB 4OFZA 4UIGA 2K24A 4KMCA 4EYYR 4HTEA 4DMVA 3DTOA 3PUQA 2OA5A 2LHRA 5DQWA 3PDYA 4TV8E 2HPJA 2ODVA 2LEHA 4ISTA 3KV9A 2XAJB 3HR0A 2PJQA 4UV8B 3UT5E 2CA5A 1MMNA 2Z6EA 1MMGA 3FBLA 4PAGA 2NTYA 5FXXA 1MNEA 1UX5A 2X51A 3T8OA 4CI3B 4IGUA 3HKCE 3N5LA 4QXCB 1US7B 3SRZA 2WMOA 2NP9A 5L3CB 5FY7A 5AFUL 4XAXB 4O4JE 4EZHA 1HG5A 4A56A 2QGSA 3N9MA 3E22E 3QK6A 4FI5A 2BVMA 5ADXL 4QXBB 3ZMTB 5CB4E 4U74A 2LSGA 5FY1A 4ZS2A 4UEMA 4HEAA 1WYCA 3I0QA 2K48A 1UX4A 4QXHB 2PFVA 5L3FB 4YJ2E 2H3RA 2WWUA 4ZI3C 4AXPA 4XBFB 4FJOA 3IBPA 5FP3A 5GONE 2ZM0A 3AAAB 4YLHA 5DQVA 4ILUA 4MHCA 4WW0A 2V7MA 5JDMA 1HF8A 5LA6E 3PTRB 2DWKA 4U72A 4EZ4A 5HXRA 5ETWA 5FXWA 4EB6E 2IC9A 3ZC0A 3PE0A 3ZC1A 2DNXA 4WNKA 4L5GA 2DLRA 2X0LB 3S4UA 3ONXA 2LM9A 2W61A 3UTKA 1HCIA 5JDGA 3EVYA 2EHOB 4KP3C 3N9OA 4H9RC 3Q5WA 5EK2A 2E9XD 2ZM2A 4GIWA 3N2KE 3H37A 3V5SA 3B13A 4GK5E 3TKLB 3ZYKA 3ZMZB 5HWXA 3K3QC 4I43B 3RRCA 3OYXA 1IJ5A 2CEAA 3HKBE 2XAHB 1D0XA 3R84B 4I50E 4IIJE 2L3LA 1WRDA 3O1IA 3RX6A 5JH7E 1OWAA 1HTJF 1UCUA 2QA7A 3U3IA 3RKOA 4HKAA 2D0UA 5LNKA 5M4YA 1EZ3A 2J1DG 5EK4A 3VHLA 3AA6B 3CX6B 4UVBB 2X66A 4ZI2D 3IHRA 3RYCE 2N9DA 4GOUA 2KMFA 3MZKB 4B6XA 5FY0A 2X67A 4K0UA 4QHOA 2X9HA 2X68A 4X1KE 5LBMA 4UVAB 2CLYC 4AQGA 5EZYE 3RPUA 1D0YA 1X79A 4GYSA 2ZMAA 4UELA 2LE8A 3KV6A 3ZEFB 1YD8G 2NTXA 3UUXB 4OHFA 1WR6A 3NRXA 1FEWA 3V5UA 1S35A 5HXSA 4V1Av 1QUUA 3PUAA 4EOZB 2VL8A 3ZJ1A 3RYFE 3W15B 3KV5A 4KUMB 5LCYA 4I55E 4EIWA 1KNZA 3NZQA 2NW8A 4YJ3E 4ZI7E 4H63V 3B57A 2IAKA 3F57A 4JLEA 4E7SA 2KT9A 2W63A 2C0SA 3KBTA 5H6RB 3O4XE 3LBXA 2KWHA 2A2FX 3GN5A 3PU3A 3KINB 1QSDA 3LFMA 1MIVA 2B1EA 1ZV4X 2IW5B 3K3NA 3NBXX 5EK3A 5FXZA 3D0TA 2Q9QB 1IJ6A 4O4IE 5H6QB 2D2SA 2IC6A 3HI2A 3CVRA 3C4WA 2YEVC 3DP7A 4QWNB 4DMWA 4H9NC 3BQIA 1MIWA 5JRCB 1FMVA 1MMDA 3QC9A 5DABA 3VKHA 3ETUA 1G8XA 3ZMUB 3CKDA 2H7OA 2SPCA 3HL6A 4O2AE 2X9XA 4MFRA 3WAJA 2YINA 3ZCJA 4IE0A 1HFAA 2VWAA 4UF0A 3KBUA 3ANWA 3HKDE 2JMKA 3SOLA 3N9NA 2K5BB 3ZN0B 2L8KA 4F6RC 5A1LA 5L3DB 1V9DA 3WI3A 4O8SA 3FHNA 2KZ7B 2A72A 3O1HA 2CWYA 4TN7B 1HX8A 2V7IA 3E08A 2D0TA 4DVDA 4Z8XA 3LK42 2DHRA 2CMRA 3PUGA 3GMIA 2VASA 3ETVA 2DCFA 1FIOA 3O1JA 3EDUA 1YKEB 4PK4A 3RYHE 2XASB 1E1HB 3C64A 5JR9C 3RYIE 2KWIB 4CI2B 2WM9A 1T98A 2DWGA 3P7IA 4IHJE 2XAGB 2A3DA 1D0ZA 2VB6A 4J2CA 2K9AA 5JR9A 5L3GB 2YU2A 3LK3B 2CWOA 1MNDA 1SA0E 5HXEA 1G73A 4P0BA 3ZCIA 4O4HE 4O4LE 2UXXB 3UUNA 2JQQA 5LOVE 5KDMC 2LJLA 5L2LA 4X1IE 2YU1A 2UXNB 1MIYA 4BJMA 3KFWX 5JQGE 4X20E 4H9SE 2EHOD 2LSKA 3NRYA 2ACXA 4EXTA 2EHOC 1SHZC 4M1PA 4ANJA 1IAPA 2CCQA 5LGTB 2CXFA 5F3JA 2E9XC 1WLXA 3VU7H 3CQXC 2V7JA 4GK0E 4X1YE 2PG8A 5JVDE 3F31A 1BR4A 4P0AA 2LSYA 4AI6A 2E9XA 2ZM8A 3BQLA 5L3BB 2KXPB 4XZCA 3KDSE 5FMNA 5HAXA 4MBQA 4PJNA 3A5XA 2Y8DA 1U5PA 4I4TE 4CZZB 3WAKA 5JDHA 3F2EA 3M65A 2MBGA 3AB3B 5C8YE 5LGNB 1LVKA 1HG2A 3FXDB 5L3EB 1ZEEA 4BA9A 1ZHCA 4KBMB 2MTQA 4ASKA 4ZI2C 5BMVE 5CA0E 4BAYB 4YHJA 2HPLA 3RC3A 3RH3A 1Z0PA 2XHEB 2XTLA 2WSSV 4HFVA 2LOPA 5JREA 4BJNA 4H63H 4NUUA 1Y64B 1BR0A 2LSIA 3RC8A 4PJMA 2YK0A 4AKHA 4DO0A 3I9WA 5HXCA 2NW9A 3MKDA 4L9IA 2JRKA 4CQIA 3MACA 3SS1A 4WBNE 5LHIB 2X9YA 2CLYB 1LVFA 3RRWA 2W00A 3ZN1B 3EUHA 5LHHB 2XAQB 4IE4A 2G0UA 2WAUA 5F8PA 2XQYA 3BQKA 4OYKA 3N9PA 3SWHA 2H7VC 3J9X1 3LBXB 3CX7B 2ZLYA 2Y48B 4UV9B 3GN5B 3K8PC 4PW8A 3CX8B 3I9YA 4C91A 1NAFA 4JEHB 3C98B 3MK7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJB A;  5DQV A;  2QGS A;  5DQW A;  3DTO A;  5IHY A;  3B57 A;  2PJQ A; 
#chains in the Genus database with same CATH topology
 2C5J A;  3AXJ A;  1VRB A;  2FJD A;  3UFG A;  4ADZ A;  4YSZ A;  5FXV A;  3H3A A;  1D1B A;  4MFE A;  2BS4 A;  3PUX F;  5J1G A;  3CWZ B;  4GYR A;  4JI6 T;  3CQC B;  5DJQ C;  5HWY A;  3FZL B;  4EYU A;  3BK9 A;  3QYB A;  4CFV B;  3PUS A;  4U33 A;  5JTG A;  2LSJ A;  2YDQ A;  2LT3 A;  3Q9D A;  1LRZ A;  2BG9 B;  4CI1 B;  1OL2 B;  4CFX B;  2MYS A;  2IW9 B;  2WCA A;  3P4S A;  4F7J B;  3QZ9 B;  5HVY B;  3MA9 A;  4JUY A;  1JNZ A;  1H1S B;  2BKZ B;  3AA0 B;  5JR9 B;  4LF4 T;  3EDV A;  2V6Y A;  5L2W B;  3J7Y q;  1QLB A;  1V29 B;  4ISS A;  4PK5 A;  4TWH A;  4X5T A;  3NZP A;  3N9L A;  1WYB A;  1TFB A;  5KXJ A;  1NWM X;  1WR0 A;  4BCQ D;  4C90 A;  4B3S T;  3T1H T;  4G2A A;  4Y72 B;  3P4R A;  3ZPO A;  4JX5 A;  2E9X B;  3KVB A;  4DUZ T;  4YTM A;  3GA8 A;  4PFP A;  2WMN A;  4ILB A;  4JI8 T;  2VL0 A;  1W09 A;  3G33 B;  1D1C A;  2PTF A;  4G63 A;  1ZP2 A;  1KK7 A;  3RI5 A;  4DBQ A;  2QYW A;  5HXH A;  3MY1 B;  3QYH B;  2WXV B;  3ONL C;  2DD5 B;  4NIQ A;  3AE6 A;  4PJJ A;  2WFY B;  5IUX A;  4AQF A;  3UQ4 A;  3ZYM A;  3O9X A;  4AKG A;  1OXZ A;  1H28 B;  1J1J A;  2Y6X A;  2M67 A;  3AEA A;  3UUM A;  2CCH B;  1H1R B;  1HNW T;  2C4G B;  1IBK T;  4MLK A;  3UFE A;  5LHG B;  2JQK A;  5TAO A;  4TV9 E;  5HYA A;  3ZMS B;  4IDQ A;  4TZ4 C;  3JC6 C;  1IRE B;  2K24 A;  3PUQ A;  3AXJ B;  1QMZ B;  5ABG A;  2CZ1 B;  3G06 A;  2ZM6 T;  5DQW A;  3PDY A;  2HPJ A;  4IST A;  1W0B A;  1MMG A;  2YKS A;  5FL1 A;  2W67 A;  3N5L A;  3POM A;  4QXC B;  2XQ9 A;  2W2U A;  3OTO T;  4OR5 B;  4CRL B;  4EOQ B;  4A56 A;  4FI5 A;  4BCG B;  3ZT7 A;  4ZS2 A;  1UGQ B;  2I0M A;  4UEM A;  4BCK B;  4HEA A;  4JI5 T;  2WZI A;  2IW6 B;  3L8R A;  1NEK A;  1VOL A;  4YJ2 E;  2H3R A;  2WWU A;  4WYV A;  4ZI3 C;  5HEG A;  1NEN A;  2YN6 A;  4YLH A;  5IDN B;  1HF8 A;  4JI2 T;  3ZKR A;  3PE0 A;  4IDN A;  1D3U B;  2DLR A;  2V6Y B;  2X0L B;  3S4U A;  1N34 T;  2W61 A;  5JDG A;  2M6I A;  4U7Y A;  5EK2 A;  4GIW A;  2F4V T;  2A9U A;  3B13 A;  3V5S A;  1E9H B;  3HBL A;  4F6W B;  3OYX A;  2CEA A;  1D0X A;  3FZF B;  2JQ9 A;  3RX6 A;  4EOP B;  2CZ6 B;  3RKG A;  4UN0 A;  5LNK A;  5AQN B;  2WJ9 A;  3CX6 B;  5FVK A;  4UVB B;  3RIU C;  1YQ4 A;  3IHR A;  4GOU A;  1ENW A;  4B6X A;  4DV0 T;  5LBM A;  4X1K E;  3UUB A;  4AQG A;  5EZY E;  2KR6 A;  1D0Y A;  1X79 A;  2ZMA A;  3ZEF B;  2NTX A;  1FEW A;  1O9K A;  3PUA A;  3ZJ1 A;  5LCY A;  2LLY A;  4ZXL A;  1IBL T;  2WY2 A;  3K1S A;  2KT9 A;  1UGP B;  3LBX A;  2KWH A;  3AED A;  2A2F X;  1T72 A;  5L47 A;  2D2S A;  3CVR A;  3C4W A;  2WDV A;  3RLF F;  4H9N C;  2AXD S;  4EOO B;  1URC B;  2H7O A;  4P1N A;  5CGM A;  4JI4 T;  4MFR A;  4LFC T;  3X25 B;  2YIN A;  4OB1 B;  2QDY B;  4UF0 A;  3EHZ A;  3HKD E;  3QYG B;  3SOL A;  3N9N A;  3ZN0 B;  2L8K A;  2LKG A;  5L3D B;  4EC8 B;  2CZ0 B;  3WI3 A;  4ROC A;  3FHN A;  2KZ7 B;  4TN7 B;  5HCJ A;  3P4P A;  3E08 A;  2D0T A;  4Z8X A;  5L4E A;  3LK4 2;  4GKJ T;  4LF5 T;  3M3Z B;  1OED E;  3A8Y C;  2MAW A;  4AQY T;  1FIO A;  2HHH T;  3EDU A;  4PK4 A;  1W98 B;  2XAS B;  2A3D A;  1UNH D;  2OLT A;  2YU2 A;  2UUE B;  2CZ7 B;  2UXX B;  3UUN A;  2J62 A;  2UZE B;  2HN1 A;  5AQI B;  5AQM B;  1OGU B;  1AD6 A;  1WLX A;  2V7J A;  4GK0 E;  4BCQ B;  4YTP A;  4BCN B;  3BQL A;  3KDS E;  5FMN A;  4MBQ A;  3QZ5 B;  4PJN A;  3A5X A;  3VRB A;  4MFD A;  4ZI2 C;  5AQP B;  1Z0P A;  4F7S B;  2XTL A;  3QYE A;  1GQE A;  4NUU A;  1Y64 B;  2IIU A;  4EOR B;  2LSI A;  5LB7 B;  4DO0 A;  3I9W A;  5I5Z B;  4HFD A;  3SS1 A;  2XQ5 A;  1VYW B;  3UU8 A;  1O9K B;  3ZST A;  3ZN1 B;  5BNJ B;  3QB5 K;  5LG3 A;  2WU2 A;  2DL1 A;  4OYK A;  3J9X 1;  3LBX B;  2ZLY A;  3F5X B;  4BCH B;  2DXC B;  5HBJ B;  5L4H A;  5HEJ A;  3JAD A;  4F70 B;  3FB2 A;  2W0G A;  3ZJ2 A;  5LMU T;  4ZZC A;  3ZYL A;  3JC6 D;  5LYJ E;  4P09 A;  1BR1 A;  3RGL A;  3RQW A;  3OKQ A;  1KF6 A;  4BCJ B;  1UGO A;  1BU2 A;  4DR2 T;  4UF0 B;  5HNB B;  4U2Y A;  4QKN A;  3VKG A;  2V7K A;  1KFY A;  4IE5 A;  4PJL A;  1AJ3 A;  4ERR A;  1OED A;  1KNP A;  3K3O A;  5FYM A;  3CIR A;  3PU8 A;  2ZPG B;  3MXZ A;  3N2O A;  3M03 A;  2KND A;  3PUV F;  1PKD B;  1YKH B;  4EOK B;  1JNR A;  2BKP A;  3BLH B;  2UXC T;  2P9B A;  5LGU B;  3Q2M A;  5BR8 T;  2VK9 A;  4ZI3 D;  3AA7 B;  2HH7 A;  5KX5 E;  2WU5 A;  2H88 A;  2DI4 A;  4HN9 A;  1F5Q B;  4YHH T;  5J2U E;  2WZH A;  2IDO B;  4JBW F;  4QH5 A;  3LSV A;  4N78 D;  2C5I T;  2XZE A;  4IE6 A;  2ZPE B;  4ZGJ B;  2I59 A;  3PUR A;  4MIM A;  4KI0 F;  2PBI A;  1IZN B;  4U31 A;  2W62 A;  2VKO A;  3JCF A;  4DUY T;  2XQ8 A;  4OB2 B;  3AE9 A;  2UZL B;  2CXL A;  4BCM D;  2YDR A;  3HO8 A;  3U78 A;  3CML A;  2I40 B;  2UU9 T;  4JX6 A;  3AAI A;  4JYA T;  5CA1 E;  3I0O A;  2ES0 A;  1CUN A;  3TLT A;  2N2N A;  4YXD A;  4JI7 T;  4IL4 A;  2Q9Q C;  3LG7 A;  4DV5 T;  4BY1 X;  4CXY A;  2IUB A;  4PNI A;  4CXW A;  2BS3 A;  2L9Q A;  3LJC A;  5AQH B;  1G3N C;  1SUM B;  4A5X A;  4YSY A;  1VOM A;  2LOS A;  5CJ5 A;  5FNV E;  2HN2 A;  5JRC A;  2G77 A;  3FXE B;  2PK2 A;  5FL0 A;  2XQA A;  4KMC A;  3TW7 A;  2OA5 A;  4DR5 T;  2ODV A;  1VIN A;  4HWC A;  3UT5 E;  2CA5 A;  2Z6E A;  4DV2 T;  5FXX A;  2NTY A;  2X51 A;  2LW4 A;  4M6V A;  1US7 B;  2C6T B;  5FY7 A;  5AFU L;  4O4J E;  2QGS A;  2E2A A;  2BVM A;  4ZGD B;  4HFH A;  1OED B;  4TTH A;  4EOS B;  4EED A;  2UZB B;  3RIF A;  2UXD T;  3QHW B;  3ONJ A;  5AQV B;  5GON E;  4LMJ A;  3JAF A;  2V7M A;  5JDM A;  2W2H A;  5ETW A;  3P4Q A;  5FXW A;  3ZC0 A;  4BCN D;  2DNX A;  2C5V B;  4L5G A;  5HEU A;  3A8O B;  3EVY A;  3QWL A;  1T8B A;  4H9R C;  1FKM A;  3TKL B;  3AEG A;  1UK5 A;  3ZYK A;  3WVE B;  4KRC B;  3ZMZ B;  5HWX A;  2QQ8 A;  3RIA A;  4I50 E;  4IIJ E;  5JH7 E;  1WRD A;  3DDP B;  2QA7 A;  3U3I A;  2E5L T;  1EZ3 A;  4OX9 T;  5EJC A;  5EK4 A;  5HEH A;  1H1Q B;  4BXX X;  4ZI2 D;  4YC3 B;  3RYC E;  3QOF A;  5FY0 A;  4BCI B;  2X67 A;  3B5M A;  2WDR A;  4K0U A;  2X9H A;  3RIU A;  4UVA B;  2WIP B;  1OL1 B;  2EUF A;  4GYS A;  4UEL A;  1YQ3 A;  3UUX B;  4OHF A;  2XM2 A;  1S35 A;  2VL8 A;  3RYF E;  3W15 B;  4EIW A;  4ZI7 E;  2W99 A;  2UUA T;  1H26 B;  2IAK A;  3F57 A;  4E7S A;  2W63 A;  3KBT A;  4X64 T;  2CPT A;  2IVX A;  1M7K A;  2K3W A;  2IHR 1;  3LFM A;  2IW5 B;  3ZT5 A;  3K3N A;  5FXZ A;  3D0T A;  1IJ6 A;  5H6Q B;  1SE7 A;  3EJ1 B;  5IWA T;  1XNR T;  3MY5 B;  1WFD A;  4QWN B;  2VVS A;  3RF1 A;  5C2T A;  2CBJ A;  5LMK B;  5JRC B;  1MMD A;  2WMB B;  3A8M B;  4CN4 A;  2UXB T;  4X66 T;  3HL6 A;  5F5W A;  3EAB A;  4NC6 A;  1E2A A;  4IE0 A;  1HFA A;  4YOO A;  4F8H A;  2CYZ B;  4DV1 T;  2QRX A;  4F6R C;  2LRK A;  1KEY A;  2A72 A;  3O1H A;  2CWY A;  2V7I A;  4DVD A;  2UZD B;  3O0G D;  3QNU A;  5AQR B;  3ETV A;  3RYH E;  3Q5E A;  3C64 A;  4HWH A;  2X0Y A;  3RGF B;  3RYI E;  4CI2 B;  2NR4 A;  1T98 A;  2DWG A;  3VR8 A;  2XAG B;  5L3G B;  4CFM B;  2C5O B;  1MND A;  1T7S A;  1N33 T;  5HXE A;  1G73 A;  3HB9 A;  3X20 B;  4O4H E;  2JQQ A;  5KDM C;  4X1I E;  4I3Z B;  5ACB A;  4BJM A;  2XQ7 A;  3KFW X;  5FGK B;  2EHO D;  2ACX A;  4M1P A;  5LGT B;  1FJG T;  2IML A;  1XMO T;  3VU7 H;  4IMY B;  5IF1 B;  2BBJ A;  5HQ0 B;  4DR6 T;  4CN6 A;  2LSY A;  2ZM8 A;  2KXP B;  3DDQ B;  4B3T T;  5HAX A;  2Y8D A;  5JDH A;  3F2E A;  5LGN B;  2J47 A;  3FXD B;  4KBM B;  4ASK A;  5CA0 E;  4IDO A;  4EGW A;  5AQT B;  1XDP A;  2BKN A;  3EAM A;  4H63 H;  4U7I A;  4QSH A;  4AKH A;  2D9D A;  4CFU B;  3MKD A;  2W9F A;  3BG3 A;  1X9B A;  2JRK A;  3X26 B;  4BCM B;  4CQI A;  2DD4 B;  4U2Z A;  3FZH B;  3RRW A;  4LFA T;  4BCP B;  5LHH B;  4JV5 T;  2X0H A;  2J4G A;  3HZJ A;  4IE4 A;  4WZX A;  2VQF T;  1GUX A;  2G0U A;  5CFB A;  4IDP A;  3PO3 S;  3K8P C;  4PW8 A;  2UUC T;  4IT4 A;  4LF9 T;  2BBH A;  2VKD A;  4DV6 T;  3L3P A;  4QX8 B;  4TX5 A;  4U3C A;  4NPP A;  2JJ9 A;  4EC9 B;  2QVA A;  4G6L B;  2NW7 A;  2XAF B;  3WVD B;  2LKH A;  4EV6 A;  2NOX A;  4KRD B;  4H9Q C;  4DBR A;  3UU6 A;  3ZLI A;  1H7C A;  1UUR A;  5LJM A;  1UUS A;  5LBQ B;  5HBE B;  4H9P C;  3AVS A;  5LJN A;  3A8G B;  1W0A A;  2C5K T;  3N9Q A;  3OBV E;  2LM2 A;  2KIN B;  4EOL B;  3A8L B;  2V6X A;  5IDP B;  5IYZ E;  5J2T E;  2JPF A;  4A97 A;  2CJM B;  4F6U B;  3IEE A;  2V5D A;  2EHO A;  1DU2 A;  4JEU B;  1UGS B;  5AQJ B;  1I94 T;  5E0O A;  5LP6 E;  2PK9 B;  4H9O C;  5JDL A;  1O3X A;  4F7N B;  2H89 A;  1WCR A;  1L0V A;  3QUJ A;  5CYI B;  1BR2 A;  2X9W A;  1HS7 A;  4OYJ A;  3IF8 B;  3BHV B;  2E5V A;  4DND A;  3AE1 A;  3ESL A;  3HKE E;  4HNT A;  2WBL A;  3H4C A;  3JAE A;  3DJB A;  4MAL A;  3BLR B;  1FMW A;  5JDF A;  2AE9 A;  4ZS3 A;  2V26 A;  4YOZ A;  4UVC B;  4WBO A;  1UGR B;  4ELL A;  3Q5X A;  3FBZ A;  2CBI A;  1ZOY A;  4PK6 A;  4CXA B;  3Q5D A;  1LKX A;  4L0R A;  3HA4 A;  2PHG A;  4ELJ A;  2Q9Q A;  4AKI A;  3AE7 A;  2ZPH B;  1GUX B;  2F2C A;  5ICP B;  2CXD A;  3R6N A;  5IHY A;  3KV4 A;  1H4L D;  2FBW A;  1B7T A;  4OFZ A;  3DTO A;  4IL9 A;  2LHR A;  4HL4 A;  4EON B;  2LEH A;  4HWI B;  2WPA B;  2PJQ A;  5AQO B;  1Y01 A;  4PAG A;  1MNE A;  1UX5 A;  3T8O A;  4CI3 B;  4IGU A;  1M62 A;  4CFN B;  2WIH B;  3SRZ A;  5HCM A;  5L3C B;  4FX3 B;  1HG5 A;  3N9M A;  3PUZ F;  3QK6 A;  4QXB B;  5CB4 E;  2LSG A;  2XQ4 A;  1WYC A;  1YXR A;  4QXH B;  3ZSS A;  5L3F B;  1KNR A;  4XBF B;  3UU4 A;  4FJO A;  2ACZ A;  3IBP A;  5FP3 A;  3AAA B;  5DQV A;  4MHC A;  2KMG A;  3X28 B;  2V5C A;  3PTR B;  5LA6 E;  1XO2 A;  4EB6 E;  4I0U A;  4WNK A;  2W96 A;  3TNI B;  1HNZ T;  2LM9 A;  1HCI A;  4GKK T;  1JSU B;  2EHO B;  3N9O A;  4LFB T;  3FZM B;  3N2K E;  4GK5 E;  2W9Z A;  2WHB B;  3K3Q C;  3RRC A;  1IJ5 A;  2XAH B;  1JOW A;  3R84 B;  1HTJ F;  1UCU A;  1OI9 B;  3AE3 A;  4HKA A;  2D0U A;  5M4Y A;  3NWI A;  4CFU D;  2X66 A;  4TWD A;  4HWD A;  2N9D A;  2XY8 B;  2DPP B;  2ZPB B;  5FKY A;  3AEE A;  3PJA J;  2JQH A;  1XMQ T;  3AEF A;  3AE8 A;  4X65 T;  2CLY C;  3RPU A;  3KV6 A;  1YD8 G;  1UNL D;  1WR6 A;  5LQF B;  4F6S B;  3V5U A;  3TLU A;  1QUU A;  4KUM B;  4I55 E;  4LML A;  3NZQ A;  1J5E T;  2WB5 A;  3QXE B;  2C0S A;  4ROD A;  5H6R B;  2XSB A;  5ABE A;  3PU3 A;  1QSD A;  1MIV A;  5EFQ B;  1ZV4 X;  4OB0 B;  2B1E A;  5EK3 A;  2JIW A;  2AHJ B;  2Q9Q B;  2BS2 A;  2XJ7 A;  3HI2 A;  3BHU B;  3NVO A;  3DP7 A;  1H25 B;  4DMW A;  3BQI A;  4EEB A;  1MIW A;  4Z90 A;  3VKH A;  1G8X A;  3CKD A;  5J0Z A;  2SPC A;  3WAJ A;  2X9X A;  3BG9 A;  1Z8U A;  2QFZ A;  3P50 A;  3ANW A;  2ZPF B;  2K5B B;  3MIA B;  5A1L A;  4O8S A;  3ZT6 A;  5AQS B;  2BG9 C;  1HX8 A;  1OED C;  5AQL B;  2CHO A;  2VAS A;  3GMI A;  4TWF A;  5C3J A;  2DCF A;  5JR9 C;  2KWI B;  2WM9 A;  4ROE A;  3P7I A;  1E7P A;  4IHJ E;  1D0Z A;  4J2C A;  3UQ7 A;  3LK3 B;  1SA0 E;  4P0B A;  3ZCI A;  5LOV E;  1AIS B;  2LJL A;  2YU1 A;  4DV3 T;  2WQY A;  4X20 E;  4H9S E;  4EXT A;  3NRY A;  1SHZ C;  4ANJ A;  1IAP A;  2CCQ A;  2CXF A;  5F3J A;  2E9X C;  5LMN T;  3CQX C;  4X1Y E;  5JVD E;  3F31 A;  1BR4 A;  2VVN A;  4AI6 A;  1AHJ B;  1FIN B;  5L3B B;  4XZC A;  2M6B A;  4BBR M;  3WAK A;  2B9R A;  5C8Y E;  3M65 A;  2MBG A;  3AB3 B;  1C9B A;  1LVK A;  1HG2 A;  1ZEE A;  4BA9 A;  1ZHC A;  2MTQ A;  5BMV E;  4BAY B;  2HPL A;  2G9X B;  3PUY F;  1CHU A;  3RH3 A;  2XHE B;  2WSS V;  4HFV A;  4YSX A;  4X62 T;  2LOP A;  4BJN A;  4HFE A;  3RC8 A;  4PJM A;  2WDQ A;  5HXC A;  2NW9 A;  4COF A;  1N36 T;  2WMA B;  3MAC A;  2FJB A;  4WBN E;  5HBH B;  2FJA A;  1KXU A;  2IN3 A;  1XDO A;  3EUH A;  2BPM B;  1GH6 B;  3TLS A;  1UNG D;  4DV4 T;  2B76 A;  2WAU A;  3VR9 A;  4QH4 A;  5F8P A;  3SWH A;  2H7V C;  3CX7 B;  4TNV A;  2QDJ A;  4UV9 B;  3PV0 F;  3CX8 B;  1NAF A;  3C98 B;  3TW6 A;  3QHR B;  4LF8 T;  4OB3 B;  3C51 A;  1VCS A;  3AVR A;  4IDZ A;  2JMH A;  4HGA A;  1D1A A;  1JKW A;  4FM4 B;  1MMA A;  5HEO A;  3OJA A;  2IW8 B;  4ZOL E;  1JST B;  3TNW B;  3LK2 B;  3GTM S;  3ANW B;  5LXT E;  4HE8 A;  3UUL A;  1XZY A;  3CPZ A;  2E8I A;  3AA1 B;  2FUP A;  2XQ3 A;  2XSA A;  5AQK B;  4YFS A;  4IE7 A;  1HX1 B;  2V8S V;  2KLQ A;  4OGR B;  1S94 A;  2LHN A;  2RPA A;  2R6G F;  2CM0 A;  3P8C D;  1U4Q A;  1W9R A;  4YOS A;  3C50 A;  4TUY E;  3UU5 A;  4B3M T;  5CEI B;  3AE2 A;  2XUE A;  3GWH A;  4UXN B;  2V1D B;  5KMG P;  4YY3 T;  3L09 A;  4LF6 T;  3I1A A;  4NUV A;  4HNU A;  5JDQ A;  3LDQ B;  2I6H A;  4HFB A;  4Z6Y A;  1ZKE A;  3SFD A;  2YDS A;  3CQG B;  2NWB A;  2MOZ A;  1ZP0 A;  3H3M A;  4Q25 A;  2XPK A;  2BDE A;  3C4Z A;  4TNW A;  2BVL A;  3ZMV B;  2GK9 A;  3N2G E;  4ZHQ E;  4HNV A;  2RP4 A;  4JI0 T;  4ZEY A;  4AKL A;  3AAE B;  2N1G A;  4E7Z A;  3CK6 A;  2C5N B;  4ZGE B;  2BZB A;  5FVL A;  4AQF C;  4F7L B;  2D5U A;  2LRL A;  2CE7 A;  4O2B E;  3C4X A;  2RA1 A;  1R8I A;  4CN1 A;  3KVA A;  4OK0 A;  4DV7 T;  2W4X A;  2Q9Q D;  2VKH A;  1YW0 A;  4EAH A;  3AEC A;  2WS3 A;  3MJX A;  4QX7 B;  2V7L A;  1H1P B;  4BCO B;  2ZZD B;  5LG4 A;  4CXX A;  4AKR B;  2VKJ A;  3DL1 A;  3OYZ A;  4PFO A;  3E0Z A;  3PJA A;  2ODU A;  5JDN A;  5AQQ B;  3VRA A;  4UIG A;  1OIU B;  4EYY R;  4HTE A;  4DMV A;  4TV8 E;  3VYH B;  3KV9 A;  2XAJ B;  3HR0 A;  4UV8 B;  4DR1 T;  1MMN A;  4KHZ F;  3FBL A;  3TNH B;  2R7G A;  2XQ6 A;  3HKC E;  3A7M A;  2WMO A;  2NP9 A;  4XAX B;  4EZH A;  3L39 A;  3OPC A;  3E22 E;  5ADX L;  3AE5 A;  4HFC A;  3ZMT B;  4U74 A;  5FY1 A;  2CRB A;  4DR7 T;  2BG9 E;  3I0Q A;  1J5W A;  2ZPI B;  2K48 A;  1UX4 A;  2PFV A;  4AXP A;  2ZM0 A;  4ILU A;  4WW0 A;  4DR4 T;  3LQ5 B;  4K0K T;  2DWK A;  2KSR A;  4U72 A;  4EZ4 A;  5HXR A;  3SFE A;  2IC9 A;  3DOG B;  3ZC1 A;  2C5X B;  5AQF B;  3ONX A;  3UTK A;  4NXN T;  3FZK B;  4KP3 C;  2VQE T;  5ABF A;  3Q5W A;  2E9X D;  2ZM2 A;  3H37 A;  1OKW B;  2FJE A;  1HNX T;  4I43 B;  3HKB E;  2CHN A;  2L3L A;  3O1I A;  3ABV A;  1OWA A;  3RKO A;  4JI3 T;  1P5E B;  2J1D G;  2WP9 A;  3VHL A;  3AA6 B;  2KMF A;  3MZK B;  4HWF A;  4ZZB A;  1XWM A;  3EOC B;  4BBS M;  3X1D A;  3X24 B;  4QHO A;  4CFW B;  2X68 A;  3TN8 B;  3IA3 A;  2YOE A;  3P4W A;  2LE8 A;  2JGZ B;  3NRX A;  5ABH A;  5HXS A;  2QF7 A;  4V1A v;  4EOZ B;  3KV5 A;  1KNZ A;  2NW8 A;  4YJ3 E;  4H63 V;  3B57 A;  4JLE A;  3UU3 A;  3KHI A;  3O4X E;  4EOI B;  4II5 B;  3GN5 A;  3KIN B;  4EOJ B;  4JI1 T;  2W66 A;  3NBX X;  3HHT B;  4DID B;  1XNQ T;  4O4I E;  2IC6 A;  1VCT A;  4BCF B;  3VYG B;  2YEV C;  3EID B;  4KHP T;  1H24 B;  4LF7 T;  2I53 A;  1FMV A;  3QC9 A;  5DAB A;  4YT0 A;  3ETU A;  3RHW A;  3ZMU B;  4O2A E;  4UR9 A;  3PUW F;  3ZCJ A;  1GY3 B;  1H27 B;  2VWA A;  3MI9 B;  3KBU A;  1OIY B;  4ILC A;  2JMK A;  4AIU A;  4HLQ A;  4ILA A;  4KX6 A;  3EI0 A;  2PMI B;  1V9D A;  2DME A;  2V22 B;  3AEB A;  4LMK A;  3TLV A;  1N4M A;  2DHR A;  2CMR A;  3PUG A;  2BG9 A;  2XM1 A;  3O1J A;  4BY7 X;  1YKE B;  1FVV B;  2WEV B;  1E1H B;  3TLW A;  2VB6 A;  2K9A A;  5JR9 A;  2CWO A;  4O4L E;  4B3R T;  5L2L A;  3K7A M;  2UXN B;  1MIY A;  3NDQ A;  5JQG E;  2LSK A;  2CCI B;  2EHO C;  3T1Y T;  3NKZ A;  2PG8 A;  1N32 T;  3RQU A;  1OKV B;  4P0A A;  4YTN A;  2E9X A;  2VUR A;  5ABF B;  4NST B;  2BKO A;  1U5P A;  4I4T E;  4CZZ B;  4AIS A;  2D0Q B;  5L3E B;  2ZCF B;  2DXB B;  4YHJ A;  4JX4 A;  3RC3 A;  3BLQ B;  2OV9 A;  4DR3 T;  5JRE A;  3BHT B;  3BG5 A;  1TD6 A;  1BR0 A;  3A8H B;  3OVU A;  2YK0 A;  4HFI A;  4L9I A;  5AQU B;  4NXM T;  3QB5 A;  5LHI B;  2X9Y A;  2CLY B;  5AQG B;  1LVF A;  2W00 A;  4EOM B;  4A98 A;  4LOC A;  2UUB T;  2XAQ B;  4IRE A;  4Z91 A;  1IBM T;  2X1N B;  1I6Z A;  1HR0 T;  2XQY A;  3AE4 A;  3BQK A;  3N9P A;  2Y48 B;  4QH1 A;  3GN5 B;  3I9Y A;  4C91 A;  2MPK A;  4JEH B;  2WWV A;  3MK7 C; 
#chains in the Genus database with same CATH homology
 2C5J A;  2VKD A;  3FB2 A;  2W0G A;  1VRB A;  3ZJ2 A;  3C51 A;  3ZYL A;  3L3P A;  3AVR A;  4QX8 B;  4IDZ A;  2JMH A;  3JC6 D;  4TX5 A;  4HGA A;  5LYJ E;  1D1A A;  4P09 A;  2JJ9 A;  4ADZ A;  1BR1 A;  1MMA A;  3OKQ A;  5FXV A;  3H3A A;  3OJA A;  2NW7 A;  2XAF B;  1D1B A;  2NOX A;  4H9Q C;  5J1G A;  4UF0 B;  4ZOL E;  3ZLI A;  4DBR A;  3LK2 B;  1H7C A;  3CWZ B;  3ANW B;  4GYR A;  4QKN A;  5LJM A;  3CQC B;  5DJQ C;  5LXT E;  4HE8 A;  2V7K A;  3VKG A;  5HWY A;  5LBQ B;  4IE5 A;  4EYU A;  4PJL A;  4H9P C;  1AJ3 A;  3UUL A;  4ERR A;  3BK9 A;  3AVS A;  3PUS A;  3K3O A;  5FYM A;  5LJN A;  3CPZ A;  2E8I A;  3AA1 B;  3PU8 A;  3MXZ A;  3N2O A;  2LSJ A;  2KND A;  2C5K T;  3N9Q A;  3OBV E;  2LT3 A;  3Q9D A;  4YFS A;  1YKH B;  1LRZ A;  4IE7 A;  2KLQ A;  4CI1 B;  1S94 A;  2LHN A;  2MYS A;  2P9B A;  5LGU B;  2KIN B;  3Q2M A;  2CM0 A;  3MA9 A;  3P8C D;  1U4Q A;  4JUY A;  2VK9 A;  3C50 A;  4TUY E;  5IYZ E;  4ZI3 D;  5J2T E;  2JPF A;  3AA7 B;  3AA0 B;  2HH7 A;  5JR9 B;  5KX5 E;  3EDV A;  3J7Y q;  4ISS A;  4PK5 A;  2XUE A;  3NZP A;  3N9L A;  3GWH A;  3IEE A;  1WYB A;  2DI4 A;  2EHO A;  4UXN B;  1NWM X;  2V1D B;  5KMG P;  4HN9 A;  4C90 A;  4JEU B;  3L09 A;  5J2U E;  3I1A A;  4G2A A;  5E0O A;  4NUV A;  5LP6 E;  5JDQ A;  4H9O C;  3ZPO A;  5JDL A;  1O3X A;  4N78 D;  1ZKE A;  2C5I T;  4IE6 A;  3CQG B;  2NWB A;  2E9X B;  2MOZ A;  2I59 A;  3KVB A;  3PUR A;  3GA8 A;  3QUJ A;  4PFP A;  2PBI A;  1BR2 A;  2BDE A;  2WMN A;  2X9W A;  1HS7 A;  3C4Z A;  2BVL A;  4OYJ A;  1IZN B;  2W62 A;  3IF8 B;  4DND A;  3ZMV B;  2VKO A;  2GK9 A;  3N2G E;  1D1C A;  3ESL A;  3HKE E;  4ZHQ E;  2RP4 A;  4G63 A;  2WBL A;  4AKL A;  1KK7 A;  3AAE B;  3DJB A;  4DBQ A;  4MAL A;  2N1G A;  1FMW A;  4E7Z A;  5HXH A;  5JDF A;  2CXL A;  4ZS3 A;  2BZB A;  2V26 A;  4AQF C;  3U78 A;  2D5U A;  4O2B E;  2CE7 A;  4UVC B;  4WBO A;  3C4X A;  3CML A;  2RA1 A;  4PJJ A;  3AAI A;  4AQF A;  5CA1 E;  3I0O A;  3KVA A;  4OK0 A;  3Q5X A;  2ES0 A;  1CUN A;  3ZYM A;  3FBZ A;  3O9X A;  2N2N A;  4AKG A;  1OXZ A;  2Q9Q D;  2VKH A;  2Q9Q C;  4PK6 A;  1YW0 A;  3LG7 A;  4EAH A;  3MJX A;  2Y6X A;  4CXY A;  1LKX A;  4L0R A;  2M67 A;  3HA4 A;  3UUM A;  4QX7 B;  4PNI A;  2Q9Q A;  4AKI A;  2V7L A;  2L9Q A;  3LJC A;  4CXW A;  4MLK A;  2CXD A;  3UFE A;  5LG4 A;  4CXX A;  4AKR B;  1VOM A;  3R6N A;  5IHY A;  2VKJ A;  2LOS A;  5LHG B;  3KV4 A;  3OYZ A;  4PFO A;  5FNV E;  5TAO A;  3E0Z A;  4TV9 E;  5JRC A;  2ODU A;  5JDN A;  5HYA A;  3ZMS B;  4TZ4 C;  3JC6 C;  1B7T A;  3FXE B;  4OFZ A;  4UIG A;  2K24 A;  4KMC A;  4EYY R;  4HTE A;  4DMV A;  3DTO A;  3PUQ A;  2OA5 A;  2LHR A;  5DQW A;  3PDY A;  4TV8 E;  2HPJ A;  2ODV A;  2LEH A;  4IST A;  3KV9 A;  2XAJ B;  3HR0 A;  2PJQ A;  4UV8 B;  3UT5 E;  2CA5 A;  1MMN A;  2Z6E A;  1MMG A;  3FBL A;  4PAG A;  2NTY A;  5FXX A;  1MNE A;  1UX5 A;  2X51 A;  3T8O A;  4CI3 B;  4IGU A;  3HKC E;  3N5L A;  4QXC B;  1US7 B;  3SRZ A;  2WMO A;  2NP9 A;  5L3C B;  5FY7 A;  5AFU L;  4XAX B;  4O4J E;  4EZH A;  1HG5 A;  4A56 A;  2QGS A;  3N9M A;  3E22 E;  3QK6 A;  4FI5 A;  2BVM A;  5ADX L;  4QXB B;  3ZMT B;  5CB4 E;  4U74 A;  2LSG A;  5FY1 A;  4ZS2 A;  4UEM A;  4HEA A;  1WYC A;  3I0Q A;  2K48 A;  1UX4 A;  4QXH B;  2PFV A;  5L3F B;  4YJ2 E;  2H3R A;  2WWU A;  4ZI3 C;  4AXP A;  4XBF B;  4FJO A;  3IBP A;  5FP3 A;  5GON E;  2ZM0 A;  3AAA B;  4YLH A;  5DQV A;  4ILU A;  4MHC A;  4WW0 A;  2V7M A;  5JDM A;  1HF8 A;  5LA6 E;  3PTR B;  2DWK A;  4U72 A;  4EZ4 A;  5HXR A;  5ETW A;  5FXW A;  4EB6 E;  2IC9 A;  3ZC0 A;  3PE0 A;  3ZC1 A;  2DNX A;  4WNK A;  4L5G A;  2DLR A;  2X0L B;  3S4U A;  3ONX A;  2LM9 A;  2W61 A;  3UTK A;  1HCI A;  5JDG A;  3EVY A;  2EHO B;  4KP3 C;  3N9O A;  4H9R C;  3Q5W A;  5EK2 A;  2E9X D;  2ZM2 A;  4GIW A;  3N2K E;  3H37 A;  3V5S A;  3B13 A;  4GK5 E;  3TKL B;  3ZYK A;  3ZMZ B;  5HWX A;  3K3Q C;  4I43 B;  3RRC A;  3OYX A;  1IJ5 A;  2CEA A;  3HKB E;  2XAH B;  1D0X A;  3R84 B;  4I50 E;  4IIJ E;  2L3L A;  1WRD A;  3O1I A;  3RX6 A;  5JH7 E;  1OWA A;  1HTJ F;  1UCU A;  2QA7 A;  3U3I A;  3RKO A;  4HKA A;  2D0U A;  5LNK A;  5M4Y A;  1EZ3 A;  2J1D G;  5EK4 A;  3VHL A;  3AA6 B;  3CX6 B;  4UVB B;  2X66 A;  4ZI2 D;  3IHR A;  3RYC E;  2N9D A;  4GOU A;  2KMF A;  3MZK B;  4B6X A;  5FY0 A;  2X67 A;  4K0U A;  4QHO A;  2X9H A;  2X68 A;  4X1K E;  5LBM A;  4UVA B;  2CLY C;  4AQG A;  5EZY E;  3RPU A;  1D0Y A;  1X79 A;  4GYS A;  2ZMA A;  4UEL A;  2LE8 A;  3KV6 A;  3ZEF B;  1YD8 G;  2NTX A;  3UUX B;  4OHF A;  1WR6 A;  3NRX A;  1FEW A;  3V5U A;  1S35 A;  5HXS A;  4V1A v;  1QUU A;  3PUA A;  4EOZ B;  2VL8 A;  3ZJ1 A;  3RYF E;  3W15 B;  3KV5 A;  4KUM B;  5LCY A;  4I55 E;  4EIW A;  1KNZ A;  3NZQ A;  2NW8 A;  4YJ3 E;  4ZI7 E;  4H63 V;  3B57 A;  2IAK A;  3F57 A;  4JLE A;  4E7S A;  2KT9 A;  2W63 A;  2C0S A;  3KBT A;  5H6R B;  3O4X E;  3LBX A;  2KWH A;  2A2F X;  3GN5 A;  3PU3 A;  3KIN B;  1QSD A;  3LFM A;  1MIV A;  2B1E A;  1ZV4 X;  2IW5 B;  3K3N A;  3NBX X;  5EK3 A;  5FXZ A;  3D0T A;  2Q9Q B;  1IJ6 A;  4O4I E;  5H6Q B;  2D2S A;  2IC6 A;  3HI2 A;  3CVR A;  3C4W A;  2YEV C;  3DP7 A;  4QWN B;  4DMW A;  4H9N C;  3BQI A;  1MIW A;  5JRC B;  1FMV A;  1MMD A;  3QC9 A;  5DAB A;  3VKH A;  3ETU A;  1G8X A;  3ZMU B;  3CKD A;  2H7O A;  2SPC A;  3HL6 A;  4O2A E;  2X9X A;  4MFR A;  3WAJ A;  2YIN A;  3ZCJ A;  4IE0 A;  1HFA A;  2VWA A;  4UF0 A;  3KBU A;  3ANW A;  3HKD E;  2JMK A;  3SOL A;  3N9N A;  2K5B B;  3ZN0 B;  2L8K A;  4F6R C;  5A1L A;  5L3D B;  1V9D A;  3WI3 A;  4O8S A;  3FHN A;  2KZ7 B;  2A72 A;  3O1H A;  2CWY A;  4TN7 B;  1HX8 A;  2V7I A;  3E08 A;  2D0T A;  4DVD A;  4Z8X A;  3LK4 2;  2DHR A;  2CMR A;  3PUG A;  3GMI A;  2VAS A;  3ETV A;  2DCF A;  1FIO A;  3O1J A;  3EDU A;  1YKE B;  4PK4 A;  3RYH E;  2XAS B;  1E1H B;  3C64 A;  5JR9 C;  3RYI E;  2KWI B;  4CI2 B;  2WM9 A;  1T98 A;  2DWG A;  3P7I A;  4IHJ E;  2XAG B;  2A3D A;  1D0Z A;  2VB6 A;  4J2C A;  2K9A A;  5JR9 A;  5L3G B;  2YU2 A;  3LK3 B;  2CWO A;  1MND A;  1SA0 E;  5HXE A;  1G73 A;  4P0B A;  3ZCI A;  4O4H E;  4O4L E;  2UXX B;  3UUN A;  2JQQ A;  5LOV E;  5KDM C;  2LJL A;  5L2L A;  4X1I E;  2YU1 A;  2UXN B;  1MIY A;  4BJM A;  3KFW X;  5JQG E;  4X20 E;  4H9S E;  2EHO D;  2LSK A;  3NRY A;  2ACX A;  4EXT A;  2EHO C;  1SHZ C;  4M1P A;  4ANJ A;  1IAP A;  2CCQ A;  5LGT B;  2CXF A;  5F3J A;  2E9X C;  1WLX A;  3VU7 H;  3CQX C;  2V7J A;  4GK0 E;  4X1Y E;  2PG8 A;  5JVD E;  3F31 A;  1BR4 A;  4P0A A;  2LSY A;  4AI6 A;  2E9X A;  2ZM8 A;  3BQL A;  5L3B B;  2KXP B;  4XZC A;  3KDS E;  5FMN A;  5HAX A;  4MBQ A;  4PJN A;  3A5X A;  2Y8D A;  1U5P A;  4I4T E;  4CZZ B;  3WAK A;  5JDH A;  3F2E A;  3M65 A;  2MBG A;  3AB3 B;  5C8Y E;  5LGN B;  1LVK A;  1HG2 A;  3FXD B;  5L3E B;  1ZEE A;  4BA9 A;  1ZHC A;  4KBM B;  2MTQ A;  4ASK A;  4ZI2 C;  5BMV E;  5CA0 E;  4BAY B;  4YHJ A;  2HPL A;  3RC3 A;  3RH3 A;  1Z0P A;  2XHE B;  2XTL A;  2WSS V;  4HFV A;  2LOP A;  5JRE A;  4BJN A;  4H63 H;  4NUU A;  1Y64 B;  1BR0 A;  2LSI A;  3RC8 A;  4PJM A;  2YK0 A;  4AKH A;  4DO0 A;  3I9W A;  5HXC A;  2NW9 A;  3MKD A;  4L9I A;  2JRK A;  4CQI A;  3MAC A;  3SS1 A;  4WBN E;  5LHI B;  2X9Y A;  2CLY B;  1LVF A;  3RRW A;  2W00 A;  3ZN1 B;  3EUH A;  5LHH B;  2XAQ B;  4IE4 A;  2G0U A;  2WAU A;  5F8P A;  2XQY A;  3BQK A;  4OYK A;  3N9P A;  3SWH A;  2H7V C;  3J9X 1;  3LBX B;  3CX7 B;  2ZLY A;  2Y48 B;  4UV9 B;  3GN5 B;  3K8P C;  4PW8 A;  3CX8 B;  3I9Y A;  4C91 A;  1NAF A;  4JEH B;  3C98 B;  3MK7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...