2C5NB

Differential binding of inhibitors to active and inactive cdk2 provides insights for drug design
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Differential Binding of Inhibitors to Active and Inactive Cdk2 Provides Insights for Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5nB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2c5nB02
2UZDB 1OIUB 1N4MA 2JGZB 4F7NB 3EJ1B 2F2CA 4EORB 1OKWB 4F6WB 1JKWA 2BKZB 4CFNB 2C6TB 1AISB 4EOOB 1JOWA 1FINB 3DOGB 4F6UB 4EOPB 5LMKB 1O9KA 3EOCB 4BCPB 1UNHD 5HQ0B 4EOQB 3MY1B 2I40B 4BCIB 5EFQB 2WMAB 2G9XB 5IF1B 5HBJB 1ZP2A 2C5XB 4CFXB 4BCGB 4CFVB 4CRLB 2UZBB 4BCND 4YOZA 4EC8B 2R7GA 2IW9B 3TN8B 2I53A 1OIYB 1TFBA 4EC9B 3RGFB 4EOKB 1KXUA 1E9HB 5HBEB 2B9RA 2PK9B 3G33B 3BLHB 1O9KB 1H25B 1GUXB 1OGUB 4RODA 1H24B 3H4CA 1GH6B 1H26B 2C5NB 5BNJB 2W9FA 3MI9B 1H1RB 3MIAB 5I5ZB 4BCMB 4BCNB 1OL1B 3M03A 4BCJB 4KRDB 1FVVB 5ICPB 4ROCA 3QHWB 1OL2B 1C9BA 1VINA 2C4GB 4BCKB 1AD6A 2IW6B 5HVYB 4EOJB 2QDJA 2WMBB 4ROEA 1H4LD 2WPAB 4F70B 2W2HA 5CYIB 4BCMD 3BLRB 3POMA 2V22B 3O0GD 2WIPB 4YC3B 2WHBB 2UZLB 2WEVB 2X1NB 4IMYB 2EUFA 3EIDB 4UN0A 1OI9B 2WIHB 5IDPB 1P5EB 1XO2A 3QHRB 5L2WB 3TNWB 4F7JB 2IW8B 2PK2A 3LQ5B 5ACBA 5FGKB 4YOSA 1JSUB 5HNBB 3BHVB 1URCB 2IVXA 5LQFB 1H28B 4NSTB 1VYWB 4ELLA 4I3ZB 2CCIB 5HBHB 2WFYB 1JSTB 2WXVB 2UZEB 3BLQB 3DDQB 4BCQD 1D3UB 1F5QB 4CFUB 2C5OB 2PHGA 4CFWB 4EONB 2C5VB 1VOLA 3F5XB 1W98B 4YOOA 2BPMB 1PKDB 2PMIB 5IDNB 3TNIB 4F7LB 4CFMB 4CXAB 1QMZB 4BCOB 4EOLB 4F6SB 1BU2A 4TTHA 4EOIB 2CCHB 4KRCB 3TNHB 4BCQB 5CEIB 1H1SB 2CJMB 4BCFB 4CFUD 4EOMB 4EOSB 4II5B 1GUXA 3BHTB 1H1QB 3DDPB 3BHUB 2W9ZA 1H27B 2W96A 1UNGD 1G3NC 4OR5B 1OKVB 4G6LB 4OGRB 4BCHB 2W99A 3MY5B 4FX3B 4F7SB 1GY3B 4ELJA 3K7AM 2UUEB 1UNLD 1H1PB 4Y72B
chains in the Genus database with same CATH superfamily
4JX4A 4F7NB 4EORB 3WVDB 4CFNB 3QXEB 2C6TB 1AISB 4EOOB 3DL1A 4AKHA 5LMKB 4BCPB 3HB9A 3A8HB 1FKMA 3MY1B 2I40B 2G9XB 3X24B 4BCGB 3PO3S 4CRLB 4HNVA 4YOZA 2R7GA 4ZGEB 3TW6A 1KXUA 1E9HB 3QYEA 1O9KB 1GUXB 4RODA 5DQVA 1H26B 2C5NB 5BNJB 4OB1B 3GTMS 3MIAB 4BCNB 5ICPB 1VINA 3A8GB 4BCKB 1AD6A 5HVYB 2WMBB 4F70B 2BS2A 3POMA 3O0GD 3QWLA 2UZLB 4IMYB 2WIHB 1XO2A 5L2WB 2BS4A 4F7JB 2ZPIB 4FM4B 3BHVB 3HBLA 2IVXA 4HLQA 4NSTB 3QYGB 4HL4A 4ELLA 2WFYB 2WXVB 3BLQB 4AKIA 2C5OB 2QF7A 4EONB 2C5VB 5IDNB 4BBRM 3QYHB 2CJMB 3VYGB 1GUXA 3DDPB 4MIMA 1OKVB 2KMGA 2ZPFB 1UGRB 4FX3B 3MY5B 4ELJA 1UNLD 1OIUB 3EJ1B 2F2CA 4OB3B 1JKWA 2BS3A 4JX5A 3B57A 4AI6A 4BCIB 4M6VA 1ZP2A 2LW4A 2UZBB 1OIYB 4EC9B 3RGFB 4EOKB 3BLHB 1OGUB 1H24B 3MI9B 2CZ1B 5I5ZB 4BCJB 4KRDB 2IW6B 4ROEA 2WPAB 2DPPB 4YC3B 2CYZB 2ZPHB 1OI9B 2CZ6B 1V29B 3TNWB 3LQ5B 5ACBA 2ZCFB 3A8OB 4YOSA 5LQFB 2G77A 2KR6A 1VYWB 1ENWA 3HZJA 1JSTB 2UZEB 3DDQB 1D3UB 2AHJB 1F5QB 3BG9A 2PHGA 4CFWB 3F5XB 3TNIB 4CXAB 1BU2A 4BCQB 4CFUD 4EOSB 2WJ9A 3HHTB 4Z6YA 1UNGD 1E7PA 1G3NC 4ZGJB 4F7SB 2ZPBB 4JX6A 3X28B 1N4MA 2JGZB 1OKWB 2BKZB 3HO8A 1FINB 4F6UB 1O9KA 3EOCB 2IN3A 1UNHD 5HQ0B 4EOQB 4BY1X 4MFDA 3VYHB 2QGSA 5HBJB 2C5XB 4BCND 2QDYB 4EC8B 4LOCA 4HNUA 2B9RA 2PK9B 3A8LB 3H4CA 1GH6B 2W9FA 1H1RB 1OL1B 3M03A 1FVVB 1OL2B 2C4GB 1TD6A 1H4LD 2CZ7B 5CYIB 3BG5A 4BCMD 3BLRB 2V22B 2WIPB 2DD4B 2WHBB 3EIDB 5IDPB 1P5EB 3DJBA 3QHRB 2PK2A 5HNBB 1URCB 4NC6A 4I3ZB 2CCIB 3DTOA 4CFUB 3BG3A 1VOLA 2ZPEB 2BPMB 2PMIB 4CFMB 2QFZA 4BCOB 4EOLB 4F6SB 1IREB 4TTHA 4EOIB 2CCHB 4KRCB 3TNHB 4BBSM 5CEIB 4BCFB 4II5B 4OB2B 3BHUB 2W9ZA 1H27B 5DQWA 2ZZDB 2QQ8A 4OR5B 3X20B 4BCHB 2UUEB 4OB0B 4HNTA 3QZ9B 1H1PB 4Y72B 2UZDB 1UGPB 3X25B 4F6WB 2DXCB 3QYBA 5IHYA 1JOWA 3DOGB 4EOPB 2DXBB 1UGQB 2CZ0B 5EFQB 2WMAB 2DD5B 4BXXX 5IF1B 4CFXB 4CFVB 2IW9B 3TN8B 2I53A 1TFBA 2PJQA 3WVEB 5HBEB 3G33B 1H25B 4BCMB 2D0QB 5EJCA 3VKGA 4ROCA 3QHWB 1AHJB 1C9BA 3X26B 4EOJB 2QDJA 2W2HA 4AKGA 2ZPGB 2WEVB 2X1NB 1QLBA 2EUFA 4UN0A 2IW8B 4BY7X 1UGSB 3TW7A 5FGKB 1JSUB 1H28B 5HBHB 4BCQD 1W98B 4YOOA 4MFEA 1PKDB 2DMEA 4F7LB 3A8MB 1QMZB 3KHIA 3QZ5B 4QSHA 1H1SB 4EOMB 3BHTB 1H1QB 3NDQA 2W96A 4ZGDB 4G6LB 4OGRB 2W99A 1GY3B 3K7AM 3VKHA
chains in the Genus database with same CATH topology
2UZDB 1OIUB 1N4MA 2JGZB 4F7NB 3EJ1B 2F2CA 4EORB 1OKWB 4F6WB 1JKWA 2BKZB 4CFNB 2C6TB 1AISB 4EOOB 1JOWA 1FINB 3DOGB 4F6UB 4EOPB 5LMKB 1O9KA 3EOCB 4BCPB 1UNHD 5HQ0B 4EOQB 3MY1B 2I40B 4BCIB 5EFQB 2WMAB 2G9XB 5IF1B 5HBJB 1ZP2A 2C5XB 4CFXB 4BCGB 4CFVB 4CRLB 2UZBB 4BCND 4YOZA 4EC8B 2R7GA 2IW9B 3TN8B 2I53A 1OIYB 1TFBA 4EC9B 3RGFB 4EOKB 1KXUA 1E9HB 5HBEB 2B9RA 2PK9B 3G33B 3BLHB 1O9KB 1H25B 1GUXB 1OGUB 4RODA 1H24B 3H4CA 1GH6B 1H26B 2C5NB 5BNJB 2W9FA 3MI9B 1H1RB 3MIAB 5I5ZB 4BCMB 4BCNB 1OL1B 3M03A 4BCJB 4KRDB 1FVVB 5ICPB 4ROCA 3QHWB 1OL2B 1C9BA 1VINA 2C4GB 4BCKB 1AD6A 2IW6B 5HVYB 4EOJB 2QDJA 2WMBB 4ROEA 1H4LD 2WPAB 4F70B 2W2HA 5CYIB 4BCMD 3BLRB 3POMA 2V22B 3O0GD 2WIPB 4YC3B 2WHBB 2UZLB 2WEVB 2X1NB 4IMYB 2EUFA 3EIDB 4UN0A 1OI9B 2WIHB 5IDPB 1P5EB 1XO2A 3QHRB 5L2WB 3TNWB 4F7JB 2IW8B 2PK2A 3LQ5B 5ACBA 5FGKB 4YOSA 1JSUB 5HNBB 3BHVB 1URCB 2IVXA 5LQFB 1H28B 4NSTB 1VYWB 4ELLA 4I3ZB 2CCIB 5HBHB 2WFYB 1JSTB 2WXVB 2UZEB 3BLQB 3DDQB 4BCQD 1D3UB 1F5QB 4CFUB 2C5OB 2PHGA 4CFWB 4EONB 2C5VB 1VOLA 3F5XB 1W98B 4YOOA 2BPMB 1PKDB 2PMIB 5IDNB 3TNIB 4F7LB 4CFMB 4CXAB 1QMZB 4BCOB 4EOLB 4F6SB 1BU2A 4TTHA 4EOIB 2CCHB 4KRCB 3TNHB 4BCQB 5CEIB 1H1SB 2CJMB 4BCFB 4CFUD 4EOMB 4EOSB 4II5B 1GUXA 3BHTB 1H1QB 3DDPB 3BHUB 2W9ZA 1H27B 2W96A 1UNGD 1G3NC 4OR5B 1OKVB 4G6LB 4OGRB 4BCHB 2W99A 3MY5B 4FX3B 4F7SB 1GY3B 4ELJA 3K7AM 2UUEB 1UNLD 1H1PB 4Y72B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZD B;  1OIU B;  1N4M A;  2JGZ B;  4F7N B;  3EJ1 B;  2F2C A;  4EOR B;  1OKW B;  4F6W B;  1JKW A;  2BKZ B;  4CFN B;  2C6T B;  1AIS B;  4EOO B;  1JOW A;  1FIN B;  3DOG B;  4F6U B;  4EOP B;  5LMK B;  1O9K A;  3EOC B;  4BCP B;  1UNH D;  5HQ0 B;  4EOQ B;  3MY1 B;  2I40 B;  4BCI B;  5EFQ B;  2WMA B;  2G9X B;  5IF1 B;  5HBJ B;  1ZP2 A;  2C5X B;  4CFX B;  4BCG B;  4CFV B;  4CRL B;  2UZB B;  4BCN D;  4YOZ A;  4EC8 B;  2R7G A;  2IW9 B;  3TN8 B;  2I53 A;  1OIY B;  1TFB A;  4EC9 B;  3RGF B;  4EOK B;  1KXU A;  1E9H B;  5HBE B;  2B9R A;  2PK9 B;  3G33 B;  3BLH B;  1O9K B;  1H25 B;  1GUX B;  1OGU B;  4ROD A;  1H24 B;  3H4C A;  1GH6 B;  1H26 B;  2C5N B;  5BNJ B;  2W9F A;  3MI9 B;  1H1R B;  3MIA B;  5I5Z B;  4BCM B;  4BCN B;  1OL1 B;  3M03 A;  4BCJ B;  4KRD B;  1FVV B;  5ICP B;  4ROC A;  3QHW B;  1OL2 B;  1C9B A;  1VIN A;  2C4G B;  4BCK B;  1AD6 A;  2IW6 B;  5HVY B;  4EOJ B;  2QDJ A;  2WMB B;  4ROE A;  1H4L D;  2WPA B;  4F70 B;  2W2H A;  5CYI B;  4BCM D;  3BLR B;  3POM A;  2V22 B;  3O0G D;  2WIP B;  4YC3 B;  2WHB B;  2UZL B;  2WEV B;  2X1N B;  4IMY B;  2EUF A;  3EID B;  4UN0 A;  1OI9 B;  2WIH B;  5IDP B;  1P5E B;  1XO2 A;  3QHR B;  5L2W B;  3TNW B;  4F7J B;  2IW8 B;  2PK2 A;  3LQ5 B;  5ACB A;  5FGK B;  4YOS A;  1JSU B;  5HNB B;  3BHV B;  1URC B;  2IVX A;  5LQF B;  1H28 B;  4NST B;  1VYW B;  4ELL A;  4I3Z B;  2CCI B;  5HBH B;  2WFY B;  1JST B;  2WXV B;  2UZE B;  3BLQ B;  3DDQ B;  4BCQ D;  1D3U B;  1F5Q B;  4CFU B;  2C5O B;  2PHG A;  4CFW B;  4EON B;  2C5V B;  1VOL A;  3F5X B;  1W98 B;  4YOO A;  2BPM B;  1PKD B;  2PMI B;  5IDN B;  3TNI B;  4F7L B;  4CFM B;  4CXA B;  1QMZ B;  4BCO B;  4EOL B;  4F6S B;  1BU2 A;  4TTH A;  4EOI B;  2CCH B;  4KRC B;  3TNH B;  4BCQ B;  5CEI B;  1H1S B;  2CJM B;  4BCF B;  4CFU D;  4EOM B;  4EOS B;  4II5 B;  1GUX A;  3BHT B;  1H1Q B;  3DDP B;  3BHU B;  2W9Z A;  1H27 B;  2W96 A;  1UNG D;  1G3N C;  4OR5 B;  1OKV B;  4G6L B;  4OGR B;  4BCH B;  2W99 A;  3MY5 B;  4FX3 B;  4F7S B;  1GY3 B;  4ELJ A;  3K7A M;  2UUE B;  1UNL D;  1H1P B;  4Y72 B; 
#chains in the Genus database with same CATH topology
 4JX4 A;  4F7N B;  4EOR B;  3WVD B;  4CFN B;  3QXE B;  2C6T B;  1AIS B;  4EOO B;  3DL1 A;  4AKH A;  5LMK B;  4BCP B;  3HB9 A;  3A8H B;  1FKM A;  3MY1 B;  2I40 B;  2G9X B;  3X24 B;  4BCG B;  3PO3 S;  4CRL B;  4HNV A;  4YOZ A;  2R7G A;  4ZGE B;  3TW6 A;  1KXU A;  1E9H B;  3QYE A;  1O9K B;  1GUX B;  4ROD A;  5DQV A;  1H26 B;  2C5N B;  5BNJ B;  4OB1 B;  3GTM S;  3MIA B;  4BCN B;  5ICP B;  1VIN A;  3A8G B;  4BCK B;  1AD6 A;  5HVY B;  2WMB B;  4F70 B;  2BS2 A;  3POM A;  3O0G D;  3QWL A;  2UZL B;  4IMY B;  2WIH B;  1XO2 A;  5L2W B;  2BS4 A;  4F7J B;  2ZPI B;  4FM4 B;  3BHV B;  3HBL A;  2IVX A;  4HLQ A;  4NST B;  3QYG B;  4HL4 A;  4ELL A;  2WFY B;  2WXV B;  3BLQ B;  4AKI A;  2C5O B;  2QF7 A;  4EON B;  2C5V B;  5IDN B;  4BBR M;  3QYH B;  2CJM B;  3VYG B;  1GUX A;  3DDP B;  4MIM A;  1OKV B;  2KMG A;  2ZPF B;  1UGR B;  4FX3 B;  3MY5 B;  4ELJ A;  1UNL D;  1OIU B;  3EJ1 B;  2F2C A;  4OB3 B;  1JKW A;  2BS3 A;  4JX5 A;  3B57 A;  4AI6 A;  4BCI B;  4M6V A;  1ZP2 A;  2LW4 A;  2UZB B;  1OIY B;  4EC9 B;  3RGF B;  4EOK B;  3BLH B;  1OGU B;  1H24 B;  3MI9 B;  2CZ1 B;  5I5Z B;  4BCJ B;  4KRD B;  2IW6 B;  4ROE A;  2WPA B;  2DPP B;  4YC3 B;  2CYZ B;  2ZPH B;  1OI9 B;  2CZ6 B;  1V29 B;  3TNW B;  3LQ5 B;  5ACB A;  2ZCF B;  3A8O B;  4YOS A;  5LQF B;  2G77 A;  2KR6 A;  1VYW B;  1ENW A;  3HZJ A;  1JST B;  2UZE B;  3DDQ B;  1D3U B;  2AHJ B;  1F5Q B;  3BG9 A;  2PHG A;  4CFW B;  3F5X B;  3TNI B;  4CXA B;  1BU2 A;  4BCQ B;  4CFU D;  4EOS B;  2WJ9 A;  3HHT B;  4Z6Y A;  1UNG D;  1E7P A;  1G3N C;  4ZGJ B;  4F7S B;  2ZPB B;  4JX6 A;  3X28 B;  1N4M A;  2JGZ B;  1OKW B;  2BKZ B;  3HO8 A;  1FIN B;  4F6U B;  1O9K A;  3EOC B;  2IN3 A;  1UNH D;  5HQ0 B;  4EOQ B;  4BY1 X;  4MFD A;  3VYH B;  2QGS A;  5HBJ B;  2C5X B;  4BCN D;  2QDY B;  4EC8 B;  4LOC A;  4HNU A;  2B9R A;  2PK9 B;  3A8L B;  3H4C A;  1GH6 B;  2W9F A;  1H1R B;  1OL1 B;  3M03 A;  1FVV B;  1OL2 B;  2C4G B;  1TD6 A;  1H4L D;  2CZ7 B;  5CYI B;  3BG5 A;  4BCM D;  3BLR B;  2V22 B;  2WIP B;  2DD4 B;  2WHB B;  3EID B;  5IDP B;  1P5E B;  3DJB A;  3QHR B;  2PK2 A;  5HNB B;  1URC B;  4NC6 A;  4I3Z B;  2CCI B;  3DTO A;  4CFU B;  3BG3 A;  1VOL A;  2ZPE B;  2BPM B;  2PMI B;  4CFM B;  2QFZ A;  4BCO B;  4EOL B;  4F6S B;  1IRE B;  4TTH A;  4EOI B;  2CCH B;  4KRC B;  3TNH B;  4BBS M;  5CEI B;  4BCF B;  4II5 B;  4OB2 B;  3BHU B;  2W9Z A;  1H27 B;  5DQW A;  2ZZD B;  2QQ8 A;  4OR5 B;  3X20 B;  4BCH B;  2UUE B;  4OB0 B;  4HNT A;  3QZ9 B;  1H1P B;  4Y72 B;  2UZD B;  1UGP B;  3X25 B;  4F6W B;  2DXC B;  3QYB A;  5IHY A;  1JOW A;  3DOG B;  4EOP B;  2DXB B;  1UGQ B;  2CZ0 B;  5EFQ B;  2WMA B;  2DD5 B;  4BXX X;  5IF1 B;  4CFX B;  4CFV B;  2IW9 B;  3TN8 B;  2I53 A;  1TFB A;  2PJQ A;  3WVE B;  5HBE B;  3G33 B;  1H25 B;  4BCM B;  2D0Q B;  5EJC A;  3VKG A;  4ROC A;  3QHW B;  1AHJ B;  1C9B A;  3X26 B;  4EOJ B;  2QDJ A;  2W2H A;  4AKG A;  2ZPG B;  2WEV B;  2X1N B;  1QLB A;  2EUF A;  4UN0 A;  2IW8 B;  4BY7 X;  1UGS B;  3TW7 A;  5FGK B;  1JSU B;  1H28 B;  5HBH B;  4BCQ D;  1W98 B;  4YOO A;  4MFE A;  1PKD B;  2DME A;  4F7L B;  3A8M B;  1QMZ B;  3KHI A;  3QZ5 B;  4QSH A;  1H1S B;  4EOM B;  3BHT B;  1H1Q B;  3NDQ A;  2W96 A;  4ZGD B;  4G6L B;  4OGR B;  2W99 A;  1GY3 B;  3K7A M;  3VKH A; 
#chains in the Genus database with same CATH homology
 2UZD B;  1OIU B;  1N4M A;  2JGZ B;  4F7N B;  3EJ1 B;  2F2C A;  4EOR B;  1OKW B;  4F6W B;  1JKW A;  2BKZ B;  4CFN B;  2C6T B;  1AIS B;  4EOO B;  1JOW A;  1FIN B;  3DOG B;  4F6U B;  4EOP B;  5LMK B;  1O9K A;  3EOC B;  4BCP B;  1UNH D;  5HQ0 B;  4EOQ B;  3MY1 B;  2I40 B;  4BCI B;  5EFQ B;  2WMA B;  2G9X B;  5IF1 B;  5HBJ B;  1ZP2 A;  2C5X B;  4CFX B;  4BCG B;  4CFV B;  4CRL B;  2UZB B;  4BCN D;  4YOZ A;  4EC8 B;  2R7G A;  2IW9 B;  3TN8 B;  2I53 A;  1OIY B;  1TFB A;  4EC9 B;  3RGF B;  4EOK B;  1KXU A;  1E9H B;  5HBE B;  2B9R A;  2PK9 B;  3G33 B;  3BLH B;  1O9K B;  1H25 B;  1GUX B;  1OGU B;  4ROD A;  1H24 B;  3H4C A;  1GH6 B;  1H26 B;  2C5N B;  5BNJ B;  2W9F A;  3MI9 B;  1H1R B;  3MIA B;  5I5Z B;  4BCM B;  4BCN B;  1OL1 B;  3M03 A;  4BCJ B;  4KRD B;  1FVV B;  5ICP B;  4ROC A;  3QHW B;  1OL2 B;  1C9B A;  1VIN A;  2C4G B;  4BCK B;  1AD6 A;  2IW6 B;  5HVY B;  4EOJ B;  2QDJ A;  2WMB B;  4ROE A;  1H4L D;  2WPA B;  4F70 B;  2W2H A;  5CYI B;  4BCM D;  3BLR B;  3POM A;  2V22 B;  3O0G D;  2WIP B;  4YC3 B;  2WHB B;  2UZL B;  2WEV B;  2X1N B;  4IMY B;  2EUF A;  3EID B;  4UN0 A;  1OI9 B;  2WIH B;  5IDP B;  1P5E B;  1XO2 A;  3QHR B;  5L2W B;  3TNW B;  4F7J B;  2IW8 B;  2PK2 A;  3LQ5 B;  5ACB A;  5FGK B;  4YOS A;  1JSU B;  5HNB B;  3BHV B;  1URC B;  2IVX A;  5LQF B;  1H28 B;  4NST B;  1VYW B;  4ELL A;  4I3Z B;  2CCI B;  5HBH B;  2WFY B;  1JST B;  2WXV B;  2UZE B;  3BLQ B;  3DDQ B;  4BCQ D;  1D3U B;  1F5Q B;  4CFU B;  2C5O B;  2PHG A;  4CFW B;  4EON B;  2C5V B;  1VOL A;  3F5X B;  1W98 B;  4YOO A;  2BPM B;  1PKD B;  2PMI B;  5IDN B;  3TNI B;  4F7L B;  4CFM B;  4CXA B;  1QMZ B;  4BCO B;  4EOL B;  4F6S B;  1BU2 A;  4TTH A;  4EOI B;  2CCH B;  4KRC B;  3TNH B;  4BCQ B;  5CEI B;  1H1S B;  2CJM B;  4BCF B;  4CFU D;  4EOM B;  4EOS B;  4II5 B;  1GUX A;  3BHT B;  1H1Q B;  3DDP B;  3BHU B;  2W9Z A;  1H27 B;  2W96 A;  1UNG D;  1G3N C;  4OR5 B;  1OKV B;  4G6L B;  4OGR B;  4BCH B;  2W99 A;  3MY5 B;  4FX3 B;  4F7S B;  1GY3 B;  4ELJ A;  3K7A M;  2UUE B;  1UNL D;  1H1P B;  4Y72 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...