1AHJB

Nitrile hydratase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRILE HYDRATASE (SUBUNIT ALPHA)
publication title Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold.
pubmed doi rcsb
molecule tags Lyase
total genus 53
structure length 212
sequence length 212
chains with identical sequence D, F, H
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ahjB02
2WSEE 3WVEB 1PSEA 4ZGDB 1UGSB 1QP2A 4OB3B 3VYGA 2PVGB 2PUOB 1JB0E 4XK8E 1V29B 2WSCE 2QDYB 3X24B 2DXBA 2ZZDB 4OB2B 2ZPHB 2O01E 2ZPGB 3X25B 2PUKB 3A8HB 3A8OB 4FM4B 2ZPIB 1GXIE 3A8GB 3X20B 2D0QB 3QZ5B 4Y28E 3WVDB 2DPPB 4KT0E 1IREB 2DD4B 2ZZDA 3A8MB 1DJ7B 3HHTB 2CZ7B 4ZGEB 3QYGB 1AHJB 2CZ6B 2PU9B 3QZ9B 4OB0B 2DD5B 1PSFA 2DXCB 2CZ1B 4ZGJB 1UGPB 2ZPEB 3QXEB 2WSFE 2AHJB 3QYHB 1UGQB 3X28B 2DD4A 3X26B 3VYGB 4OB1B 3VYHB 2CZ0B 3LW5E 2ZCFB 2ZPFB 2ZPBB 4RKUE 2DXBB 2CYZB 2DD5A 4L6V5 2DXCA 5L8RE 2PVOB 2PVDB 3A8LB 1UGRB 1QP3A
chains in the Genus database with same CATH superfamily
5J26A 3OY9A 3HKSA 4M78F 3WVEB 1IZ6A 4ZGDB 1M27C 2EYQA 3M9QA 4E7HA 1X2KA 3G6EA 4M7AA 1QP2A 4LDWA 4BB7A 3GLXA 1GBQA 3MP1A 3I56Q 1VQ8Q 1JB0E 1X6BA 2DBKA 5C0MA 2LNHB 5CKFA 5KE2A 5GAMg 4OMFB 4D6WA 3OS1A 2DXBA 5GANe 4OB2B 3RESA 3G4SA 1B07A 1GRIA 4JRKA 2UZLB 4OR5B 2HKQB 3X25B 4FYWB 2PUKB 2J05A 3HP9A 1UHFA 4AMCA 4CC3A 2C0IA 3M56A 1M8VA 3H41A 4HCKA 3JCMg 2SEMA 1BB9A 3EGDA 3ME9A 3C4SA 2FVUA 2H8HA 4M75G 2LQ8A 2DETA 1VQMQ 5FU6C 1M9SA 2HKNA 1H26B 1JSUB 3TW6A 1AHJB 1N5ZA 1KHCA 1PHTA 3MPUB 3PT9A 1OI9B 2XHCA 2A28A 3TNWB 4HNUA 4DOWA 3EG9A 5GAN3 1VQ9T 2CREA 2QFZA 2GNCA 5GAN4 5I2MA 5IXFA 1UB4A 2ZAEA 3G7ZA 1VOLA 3M0TA 3X28B 1NZ9A 1KQ1A 4UC4A 3JCMW 1YJWA 1OEBA 1HXDA 1JXMA 1T3LA 5GMKl 2LW4A 2X3WD 3TNIB 1TOVA 2VGNA 2WPAB 3I55Q 2DXBB 2E70A 1PG5B 4Z02A 1OPLA 2FO0A 2HBPA 4EOMB 4M7DE 3RKXA 3E19A 4RTWA 3A8LB 1ENWA 4BXXX 1SHFA 5GAN6 4IUTA 1ZSGA 5IH2A 4KUIA 2FZGB 1X27A 2MMPA 4BCIB 3CCSA 4E7IA 3EH2A 2QTXA 3CC7A 2YUNA 1UECA 2L3PA 1OI1A 2QQ8A 1QMCA 2OX7A 2YDLA 2X9HA 2OAWA 1VQKQ 1VA7A 2F2WA 2DLPA 5CK9A 1R8OB 3URGA 4Y92A 4DEXA 2J6FA 4O6JA 2LP5A 5FW9A 2I53A 3VUBA 2VC8A 3EG9B 1MMDA 1WJQA 1AWOA 2DTIA 4M7DA 4C5IA 3PIOA 1YCSB 2KGTA 4EOOB 3QDRB 3SB2A 1M1KC 3G4SQ 3TU4K 4BCKB 2ABLA 1MUZA 1WQ7A 5KYYA 4AG2C 4EIKA 1TFBA 2O9SA 4NL2A 3SEMA 1TU0B 3DL1A 4OMPA 4ROCA 4HLQA 3GTMS 3V7RA 1YP5A 2ESWA 2VVKA 2DA9A 3RGFB 2F1LA 1ABQA 2FZKB 2RB6A 2LTOA 2M0YA 2HCKA 2K5FA 2JJ9A 3M0RA 3ER0A 2OTLA 1WHMA 1BK2A 3CMAT 1VQPA 3EGUA 3CCUA 3X26B 1S1NA 4OB1B 4KRTA 2KSSA 4OGEA 4BUGA 1WHJA 2AZSA 3KBGA 1TWBA 1NJIR 3OYFA 1SPKA 2W2HA 4JJNK 3M0QA 2EVRA 4QKUA 4L6V5 5GAOq 3DKMA 1E6HA 1M30A 4N4GA 5ICPB 1W70A 1OL2B 1ZBJA 3PO3S 5GMKm 2XICA 2IVXA 5GAN8 4BBSM 4M7DB 1EZZB 3G71A 4MZPA 1BYMA 3CPWP 4QW2A 4CFUB 1N6AA 3J80E 5GAMf 2CKKA 2WSCE 4WCIA 2WEVB 4EONB 5KYYB 2IVWA 1GCPA 1RAEB 1X6GA 2V1QA 4FSXA 1VYUA 4J7FA 3CEYA 2AK5A 3R6NA 1TSFA 2IIMA 2EKOA 2KEAA 4N0AC 4XU3A 2MI6A 3PMTA 2M1HA 3JCMf 3CXCS 1G3YA 2A08A 4CFWB 1KD1C 3CC7Q 2BKZB 1VQ7A 4C5HA 2EW3A 3G6ET 1RI0A 1ZSZC 2F69A 1H28B 4M77E 3OYLA 4KGZB 1V1CA 1LCKA 1QMZB 3OA6A 2QQBA 3QYEA 2LDMA 2DL3A 1AOJA 5HCKA 5LJ3d 1TD6A 1GCQA 2KT1A 5D6XA 3WXMB 4BY7X 5C6SA 1FMKA 3EG2A 2EWNA 2RM4A 3SWNC 1AEYA 4BE1A 1I0CA 2COYA 2JZ2A 1RAIB 1G3TA 3ZFJA 4J9IA 1VQ5T 3LH5A 3D7SB 2FEIA 5I2SA 1WHLA 2GTJA 2KROA 3OYNA 1VQLA 2KXDA 2RD1A 2DRMA 2YRDA 4IIMA 2LT1A 3RMQA 3M54A 4KRDB 1QVGP 3I5SA 4C8QC 1M3CA 1YITT 3MHXA 3FLGA 4AG1C 3M4YA 2DD5A 3MY1B 2ROTA 4AT1B 4ZTJA 8AT1B 2GQIA 1YI2T 4M77A 2P0QA 5FRMA 3OS2A 1I4K1 2D9TA 1Q7YR 1QVFP 1Z9ZA 4FT2A 2GFAA 2UZEB 1FMVA 3VRZA 3OYDA 1KG1A 2HSPA 1NJIU 2RQRA 1OGUB 2KR6A 1IRXA 4CFVB 3OYIA 5GAOr 4OB3B 3QJYA 3V8LA 5I5ZB 1SRLA 1WIEA 4OMMA 1X01A 3HRSA 2YLCA 1Z9QA 5LJ5j 3JB9H 2E41A 1W4SA 3BE3A 3M0SA 2CH4W 3NFCA 1PNJA 2DFUA 3NTIA 1YJWT 2EGAA 2RI3A 2ZPGB 3RNJA 1JQQA 4EMKC 5GMKh 1WDXA 1AISB 4HCBA 3MJXA 2O9VA 4F7NB 4ZNXA 3LGLA 4BBRM 1K0SA 3P8BB 2DMOA 3CMET 2KDSA 3OW2A 2DPPB 2LC4A 5I22A 1XNIA 1YJNA 1IREB 4ME7A 1VQ9A 1BI3A 1RUWA 4YC3B 2JTEA 3CCST 1PWTA 2MPXC 4JS5A 7AT1B 1FX7A 2BZXA 1Q95G 4F6UB 3MP6A 4LE9A 3HL8A 4J9DA 3S6WA 1H1SB 2DD5B 2K5IA 4M7AC 5IXBA 3MIAB 1Y07A 3MEAA 2PQWA 4M77B 1ABOA 4M78E 1YWOA 4ZN1A 3L2UA 2F5TX 1VQ7Q 1ZP2A 2EYXA 1H27B 2K5LA 5D7UA 3QDFA 1ZUUA 4E7ZA 2EJ9A 1BBZA 5GAMh 2DYIA 3JV3A 4Z6YA 3OSVA 1MMNA 4IUUA 1BCOA 2X51A 4BCND 1OU8A 3L1AA 4JZ4A 5DLOA 4HNVA 1UFFA 2ENMA 4QSHA 5GANd 5L8RE 3JRZA 3TW7A 1AWWA 4FCYA 1BIBA 3JCMh 4KULA 4C8QD 3THKA 4C0FA 3BG9A 4EOQB 2QI2A 4PJOD 1SEMA 1I1JA 2NUTA 3GP8A 4M78A 1MHNA 3KXTA 2VXEA 2HL5C 3LH0A 1KFZA 2VGMA 1VIFA 2DYBA 1NBEB 2OTLT 3H4CA 2RK2A 1QKWA 1VQPT 5A0GA 2VWFA 2E64A 3CCUT 3CCQQ 3BDLA 1Q7YU 2J06A 3LWHA 2HQXA 4Y72B 1MV3A 4FYYB 4JX6A 3QKJA 3EIDB 1PKSA 2M02A 4GBQA 4LDYA 1FWZA 2CDTA 2OTJT 2KI7A 4NSTB 5EC7A 3RR6A 4HA8A 3WVDB 4MDXA 2KY9A 5IHNA 1NE8A 2QAZA 1I5OB 4RODA 1UDLA 3EJ1B 4C92A 3OYHA 3MI9B 2K9GA 5LJ5e 1SKUB 4K11A 4E7LA 4UN0A 3MP8A 2LZ6B 1IO6A 5KYXA 4C8QG 3CMAA 1TTHB 1KHIA 3QHSA 4PJOG 3C0CA 4A4GA 2R5AA 4CRIA 4WF2A 1NG2A 3VS3A 5IAYA 3DDPB 2B8AA 1W98B 4KBMB 4ANJA 4CC7A 4OGRB 4KRCB 4YOOA 2XU8A 4RTXA 2NUTB 3QIIA 2DX1A 5HY6A 4M78B 2E3IA 3OYCA 2D6FA 2ZCFB 1NPRA 2ZPFB 1NEBA 3VS0A 3M55A 2SRCA 2FRWA 1H8KA 3CPWA 5IT9E 2RJDA 3L2ZA 3L2QA 4M7DC 3VS6A 2DERA 5IF1B 2RN8A 1SSFA 1K0XA 4BY1X 4J9GA 2DVEA 1VYWB 3PNWC 2YXYA 4HKEA 1OQKA 2C0TA 2KMTA 2YUQA 4JRQA 1ZUYA 5A2QE 3FJPA 4OGCA 3REBB 3SDZA 1H641 4Q5WA 2RPNA 3FRNA 2MOXA 1U3OA 2DZ9A 4C92B 1O9SA 5FWBA 1AD6A 2HMAA 3M58A 3CD6T 2KQWA 1Q86R 5KYXB 2JUFA 1QQJA 5J39A 3JB9F 1M1GA 2O01E 4DEYA 2PK2A 1XJWB 2RK1A 4AKIA 2QQ9A 1VQLT 5CKBA 4J9HA 4ORZA 2KVQG 2EGCA 1GH6B 4M7AG 1B7TA 2YHTA 2CP3A 4RG2A 1WYXA 2E1HA 1VYTA 4FM4B 3PVLA 2W9FA 2WIHB 5CQXA 4R0KA 2P4RA 3OYYA 1N8RR 1D0YA 3VKGA 1EIFA 1Y57A 4JLGA 5GAN5 3N5BB 4DBFA 2WFYB 2RA2A 3F70A 5DQWA 1VQ5A 4AFQC 4IKFA 3AHUA 4F6SB 4Z88A 1MMAA 2CT3A 2LJ3A 3MEVA 4XAXB 2HEQA 2XDBA 4ELLA 1QVGA 3MO8A 2E6NA 2JVVA 1TXQA 4C92F 3I5RA 2MIOA 1YJ9A 1QWEA 2DJQA 4CFNB 3QJ6A 4BDYA 1YITA 4HXJA 1V76A 4FSSA 2W96A 3CCVT 4R55A 2QA4T 1YI2A 5BNJB 2E3HA 4EDUA 4VUBA 1WXBA 1LPLA 5CEIB 3LWIA 1QVFA 1GL5A 2CT4A 3H0HA 2XI9A 3VYHB 2I2LA 1VQ6T 2DMEA 5HBEB 1PCXA 2K2VA 2DK3A 3EHQA 4E2FB 5LJ3g 4II1A 2QEXT 4BY6B 1YJNT 1RAAB 2M51A 3OW2P 3JB9J 3CC2Q 1D1CA 3CC4A 1N4MA 1Q82R 1Y96A 2DZCA 4M75A 3NTKA 1G8XA 4PJOF 3OYGA 2A0FB 2WSEE 4NL3A 1S72Q 4MFEA 1MNDA 3ZEHA 4PKCC 1PSEA 1RABB 2XG8D 2QDLA 2WIPB 1YBYA 2BTTA 1UNGD 4CRLB 3EFOA 3FIFA 2WJ9A 2F2CA 1OX8A 3L2RA 1V29B 3CPWS 2QDYB 3X24B 2NYSA 2R7GA 2Y90A 4X9DA 3EH1A 3CMEA 2V8IA 4X1VA 4EOIB 2E4HA 1K8AR 2LMJA 2BUDA 2KMGA 4I3ZB 2NWMA 1GY3B 3QHRB 4HVUA 1XOVA 1HSQA 1K9MR 1Q86U 2V8KA 4OMOA 1JU5C 4ELJA 3JCMQ 2B9RA 4JX5A 3OS5A 1MMGA 5GJWB 3VKIA 1PKDB 1NYFA 1BKBA 2A37A 2LX7A 2WACA 3BHTB 4ZGEB 2XIDA 1OPKA 5ECAA 2X4JA 2VASA 2VYTA 3H8ZA 4M77C 1WNLA 2PU9B 3QZ9B 1H24B 1LOJA 1E6GA 2QDJA 2FPEA 5EJCA 4PFPA 2L3SA 3G6EQ 2E12A 4E47A 1CSKA 4LNPA 4CI0C 1N8RU 1Y96B 2JTFA 1NJIC 4J9FA 2MYSA 4M75B 4RTUA 2DE0X 3VS2A 1AVZC 2LCCA 3QXEB 2R58A 5D6WA 2E65A 1ZA1B 1KC8R 1F5QB 1H3ZA 1SSHA 4M4ZA 2NLUA 2A7YA 2UUEB 1TH7A 1VQ5Q 3EFOB 2COWA 1UJYA 4ROEA 3LW5E 1PC0A 1QVGS 2EGEA 2QQSA 2AT1B 1XQHA 1WXTA 3CCRT 2GFUA 3C94A 3F5XB 3BHUB 3JCMJ 2D8JA 1YI2Q 2CSIA 4J83A 3QPHA 2KRNA 1OX9A 4X9CA 3MEUA 1NEGA 4EORB 3P8HA 1G5VA 2RHYA 1ZX6A 1VINA 4XK8E 4L59A 4M75F 1KQSA 3LLRA 2RH2A 3C12A 3QUIA 2OTJA 3RKYA 2C6TB 1WFWA 4A54A 4A4KA 5GANg 3S3MA 1QWFA 2A36A 1YN8A 1P5EB 3UA7A 5GMKj 3M53A 4QT7A 1YJWQ 1U06A 4J6WA 3OMCA 2JXBA 2K3YA 4BCQD 1G2BA 1N9SA 3QZ5B 4BCPB 2EYYA 4HCZA 4KT0E 4PNOA 3HZJA 1LNXA 4LDUA 3EG1A 3RKWA 4JZ3A 3UF4A 2JTMA 1K8AU 4X34A 4QVCA 3VRYA 2I40B 3CMEQ 4J9CA 3KFVA 1T0HA 2CP7A 4XTXA 2E5KA 2L2PA 1C9BA 3META 1WQWA 1K9MU 1FXXA 2O4XA 5FU7C 3CCSQ 3S3NA 3JCMP 2YRVA 2RMOA 3CCMT 5EFQB 4M78C 3H6ZA 2ZPEB 3OBYA 4AI6A 4RTTA 4IURA 4DOVA 3NTHA 1VQNT 3LQ5B 2DXUA 5GJVB 1T3SA 5KH6A 4BCFB 2GBQA 2DM1A 5GAMj 2RHZA 1ZQ1A 1Q7YC 4EOSB 4PK4A 2BPMB 3TSZA 1UNHD 2Y4XA 3HO8A 4RKUE 4TTHA 2X4WA 5LJ3f 2HDAA 1WGSA 4M6VA 3BLRB 5GAN7 3QSUA 1D3BA 4EOPB 2CCHB 3O5ZA 3L2WA 4DA4A 2P4TA 4DBHA 1UE9A 3CD6A 4JLIA 4EOLB 2CP5A 4F7UG 4OVAA 2V22B 2G3RA 1YHQT 1YJ9T 4MZMA 4F14A 2KXCA 2GQVA 3MY5B 3KUFA 2DIGA 3AT1B 4YTLA 4BCMD 3P8DA 2LJ0A 3GF5A 3G1JA 2OTLQ 5LJ5d 2FHDA 4E7KA 2A3LA 2AKKA 1VQPQ 2HZYA 2KE9A 4FU6A 3SD4A 4QQGA 5KCHA 2O4XB 2RHUA 2HNIA 3CCUQ 3O0GD 5IN1A 3UPUA 3E2UA 3CC4T 4XU0A 2LJ1A 5FU6B 3CCLT 4XTVA 1BCMA 3DTOA 2EQKA 3UT1A 3O8VA 2OTJQ 3HTRA 3PFSA 2CCIB 3A8MB 3HHTB 2FPDA 1E7OA 4EPCA 2EQIA 3OS0A 3POMA 4R56A 3CCVA 4MFDA 1OKWB 2XD0A 2QA4A 5GMKe 4MMKA 5DQVA 1RLPC 5A0DA 3G71Q 1UHCA 5HVYB 1D3BB 1JEGA 1VQ6A 3VS1A 2ED1A 1IB8A 4IUVA 4AFZC 1R0BG 2QEXA 3OYJA 2AHJB 4PJMA 4RTZA 3GOXA 2DIQA 2PJQA 1PD0A 1U1TA 3A1PA 4ELZC 1QLYA 2VB6A 2W0ZA 2E5QA 2JS0A 3HPWA 2VKNA 2EJGA 1I81A 4OMLA 5CKDA 1CKAA 1AWJA 4L5GA 3CBMA 3OYAA 5A0LA 2K2MA 1NYGA 4P5NA 2D8HA 3HFNA 5IHYA 1UTIA 4BD3A 4LD6A 2IW9B 1ACMB 3OMGA 3RUXA 5FRNA 1UGSB 4A4EA 2W10A 1BI0A 3OSSC 2DBMA 1E7PA 3H9NA 1ZA2B 4J6XA 2XKOC 5GAMe 2NUZA 1ARKA 5KYWA 3REAB 4OMNA 5IDPB 3FJ5A 3HRTA 4E7JA 1NM7A 5GANf 2FL7A 1NLPC 5IHIA 1IHWA 1JRIA 3CD6Q 4Y91A 4C92E 1G3SA 5CKHA 4D8DA 1VQLQ 5LL6S 4OF1A 3JCMe 2J6KA 1QLBA 1EX4A 4B9XA 4Y28E 1TUDA 3A98A 3RMSA 1X6OA 2D1XA 1M90R 1N9RA 3M03A 4F7UF 5HBHB 4CC4B 1WZOA 5LJ3h 3CCJT 3I9QA 3DB4A 5D6YA 2IW8B 3TREA 4JRPA 4LUDA 3K7AM 3I56A 3EGXA 4RCCA 1VQ8A 4C0GA 2EUFA 4PJOE 2RHXA 4DBQA 4ZN3A 4PJLA 1YIJT 1KQSP 3R6OA 1K73R 1UGPB 2WXVB 1ZSZA 3JCMc 9ATCB 1Y71A 2V26A 2I0NA 4ATOA 1KK7A 3CCRA 1KQ2A 1NLOC 1QVPA 1TS9A 1BI1A 2BE9B 4IUPA 2DAQA 5KYWB 3CCVQ 1GFCA 3SWNA 3OQ5A 2QA4Q 4XU2A 1G3WA 4E7SA 4XTWA 3M0UA 1M5Q1 4EMHA 3M0PA 3JCMb 4JJDA 3OW2S 2FZCB 2B86A 1ZLMA 2LQKA 4QVZA 2QEXQ 3QWLA 4F7SB 1YJNQ 1WXUA 4NC6A 1Q86C 2KRSA 2QK0A 1VQ9Q 1UGRB 3RIRA 1OZ3A 1QP3A 3OYMA 1IHVA 4C8QA 2G9XB 2K57A 1TUGB 1W2BP 4M7AD 4PJOA 4A53A 1Y7XA 3DLMA 4HNTA 4XU1A 2DXTA 2YWWA 4C0DB 2X4XA 1M8MA 5ACBA 3KHIA 1D09B 2RQVA 5IDNB 1Q81R 1N8RC 1X75C 3VU3C 4RTVA 4YOSA 1D0XA 3VUZA 5FLXE 3EGXB 2QG9B 1BU2A 3BG5A 1C6VX 5GAOp 2C5NB 2KK4A 4A63B 2F2VA 4KH0B 3QHWB 3CBOA 1P92A 2W9ZA 1MNEA 1JKWA 1ZSZB 2ZGWA 1X43A 2JNGA 3L2VA 4EMKA 1TG0A 3CCMA 1PM3A 1J3TA 2OAUA 3SWNB 2LT4A 3RERA 2MWOA 1VQNA 2X3XD 4IIOA 4BCNB 2J7IA 2YLBA 1H1RB 2HQHA 1U8RA 1AD5A 1HJDA 1M90U 2CZ1B 4ZGJB 3NGPA 2DVJA 2QQRA 3TN8B 1JBMA 3I35A 2PTKA 2KBTA 1Q82C 2BS4A 4C8QB 1D1AA 3L42A 2BZYA 2HAXA 4PJOB 3CCET 3QG1A 4M75E 4RTYA 1SG5A 4OP0A 2HBWA 2CZ0B 5GANh 4C0ZA 2GTOA 1VQ4T 2DTHA 3V7CA 2P84A 3CCQT 1K73U 4QQDA 1H92A 3E9FA 1YHQA 2MCNA 4A4FA 2GF7A 2DEQA 1U5SA 3JCMX 3OYKA 2PVDB 2EQMA 4PJNA 3CCRQ 4JRIA 2PK9B 1K8AC 1FKMA 1R0CB 3ULRB 2PZ1A 4A4HA 3CMAQ 2ATCB 2JOYA 3M5AA 1I8FA 3UA6A 4EMKB 1UJ0A 2HQEA 4HCCA 2P0KA 4JJCA 3OB9A 1K9MC 2QGSA 3CCLA 4GLMA 4C8QF 4PL6A 4J6YA 4D8KA 3BLHB 3EOCB 2VUBA 3VV0A 4DBRA 2FYKA 4HL4A 2G6FX 5CAIA 3JSCA 1OIUB 4N4IA 5L2WB 4M7DD 2L89A 2L3RA 2RF0A 1M3AA 1XTDA 2K4YA 1AT1B 1Q81U 3EAEA 3VJPA 4CFUD 1KIKA 3GPLA 1GCQC 4XTZA 1GFDA 1QCNA 1KC8C 2DL4A 1F1BB 4FL6A 2DL5A 4M7AB 5KE3A 5FGKB 1SHGA 1T0JA 6AT1B 2ED0A 1A0NB 5LJ5g 1K1ZA 1JJ2P 2J6OA 1D0ZA 2CZ6B 1VIEA 2BZ8A 2JM9A 4ESRA 5GAOm 5HK0A 2RJFA 4OB0B 2FRYA 4RG8A 1MV0B 3RDVA 2C5VB 2L0AA 1OU9A 5M9OA 4ELYC 2AKLA 4F70B 4LN2A 1OZ2A 3HBLA 1AWXA 3EG3A 4G6LB 1WA7A 3LGFA 3GBQA 3CCMQ 1VYVA 2O31A 4JUVA 2YRCA 1WJSA 2MAMA 2HSEB 2KT8A 1VQOT 4MIMA 1VQNQ 2O2OA 3EGDB 3VS7A 1C1AA 5CCAA 4PLIA 2CP0A 4M7DG 3CXCA 4FIBA 2RNAA 2QASA 3ASKA 4AFUC 4CC2A 5CR2A 2BE7D 3PE0A 4JX4A 5CQYA 5HK3A 4BCJB 2FG0A 4M7AF 2JS2A 2QF7A 4RMOA 3I56T 2RI5A 1VQ8T 2KR3A 2RQWA 2ROLA 1UEBA 2RJCA 3H0IA 1PD1A 1YHQQ 2M16A 2COZA 1YJ9Q 1H1QB 3MCAB 3PIPA 2EJFA 2LNVA 4JDSA 2E6ZA 4KH1B 3HSBA 1PKTA 1YITQ 4ZTFA 3JB9I 3S3OA 2RQTA 3ZBDA 5DLQE 3DLLA 1IGUA 5IHKA 3A8HB 3A8OB 1QVFS 2QYZA 2OJ2A 3CCJA 1QCFA 4KGVB 1C0MA 2X35A 4J5YA 1BI2A 2EQJA 2WHBB 1Q82U 1OYXA 1VQMT 3CC4Q 2C06A 3CPFA 3CCLQ 2XMFA 5CKEA 2RQUA 1YIJA 2ZZDA 1ZHIA 1YWPA 4EC8B 3A5ZB 3QYGB 1JSTB 2K7AA 5DY9A 3CC2T 1WI7A 2EPDA 4HVVA 2O88A 1LVKA 3EHRA 4IUQA 1KJWA 4FW2A 1M1KR 1S72T 2CGHA 3TQ7P 2LQWA 3PTAA 1URCB 2EAYA 1FVVB 2DL7A 1RI9A 2PNIA 2VV5A 4JPBW 1OIYB 3I55T 2DD4A 1VOMA 4EMGA 2DKGA 3B57A 1FMWA 1W2BA 1I5LA 2CH4A 4LD9K 2UZDB 1VUBA 2DEUA 3U23A 2D0NA 3Q1JA 3TNHB 2OI3A 5GAMd 3H0FA 3TVTA 3QWYA 2F5KA 3BDUA 1G83A 2MF2A 1XO2A 2DJZA 3GNGA 3M4GA 4M77D 2LX9A 2FB7A 4KGXB 2L8DA 1WJRA 2QQAA 3HFOA 4IMYB 3SHWA 4F7LB 3C95A 3J81E 5I21A 4C0DC 2JT4A 1H1PB 2EYZA 8ATCB 3T9NA 4BE0A 3J7AF 4EC9B 4F7UE 1RADB 3VYGA 3JCMd 1VQKT 1M2VA 3QO3A 2IPOB 2DNUA 3PGGA 4F7JB 1KC8U 2ZZDB 2K3BA 3G33B 2AIRB 2K3XA 4PFZA 1UGVA 1D3UB 4CFXB 4Z8AA 5HKCA 4AKHA 2IN3A 4HT8A 2QGFB 4MZTA 2Z0WA 5CYIB 4C92C 4BCHB 2LQNA 3DJBA 2WMAB 4FYXB 4M7DF 3QBYA 1PRMC 4LDVA 1IXDA 3BW1A 1D1BA 2KRMA 2LCSA 3G4ST 1WHGA 5HQ0B 4XTYA 2D0QB 3BG3A 2JM8A 2CP6A 1FINB 3NDQA 1BU1A 4M77G 2MWPA 1U1SA 4OMQA 2DD4B 1DJ7B 2CZ7B 3VKHA 4J7IA 5LJ3j 2V8JA 5LJ5f 3OBWA 4F7UA 4YOZA 4J9BA 1CKBA 3CCJQ 3CCEA 1SF9A 2CP2A 1KD1R 2YUPA 4PJOC 4LXCA 2QXFA 2M9UA 2RHIA 1HYOA 1VQ4A 5FWCA 1KQSS 2DL8A 3CCQA 4JJBA 1RL2A 1O9KA 1LJOA 2IG0A 4XQ3A 1YIJQ 4HT9A 3MKDA 3TSWA 3HRUA 2M0OA 5KYUA 3VYGB 2KYBA 4LOCA 1RACB 2CUBA 4F6WB 1B34A 1M2VB 2PMIB 1ZUKA 2R5MA 3DDQB 2KNBB 2ZPBB 5J3BA 3V7SA 1M1KU 2YUOA 4CFMB 5EG2A 1MGQA 1N27A 1GBRA 4PLLA 4MDWA 2DF6A 2L5QA 4QQ6A 1H4LD 3TEEA 1K9AA 2LCLA 1WLPB 3BFMA 5I11A 1I07A 4GY5A 4FYVB 4BY6C 3JB9D 1OV3A 2CUDA 1W1FA 4CXAB 3CBPA 4RUGA 3E1SA 4BCQB 4BE2A 1W2BS 2UZBB 2K79A 2X4YA 4M78D 2P0PA 4HVWA 5AT1B 3DOGB 2DILA 2FPFA 2PUOB 1NPPA 1E9HB 4QVDA 5LQFB 4LUEA 4BDZA 2W99A 1H3HA 3V8JA 2JMAA 2K6DA 4LDXA 4FT4A 1M90C 4F7UB 2AZVA 2BS2A 5LMKB 3EFSA 1JJ2A 5HNBB 5KYNA 3LYIA 3CC7T 1WPYA 1QW1A 4BACA 2KAFA 4BI4A 2EBPA 2ZPIB 3E9GA 1GXIE 3A8GB 3X20B 3CXCP 3NPFA 2HL3A 1TUCA 3UDCA 1O9KB 3FEOA 2VXFA 3JCMV 1RLQC 4B9WA 5L23A 4C92D 1FYNA 1K73C 1JO8A 2EKHA 4TVRA 4BI3A 1EFNA 1YFNA 5KYUB 2IW6B 1X69A 3JAME 2DO3A 2C5XB 3BLQB 1B34B 4F17A 4Z89A 3JB9G 2MK5A 1R77A 1G3NC 2RO0A 1UUEA 3GIBA 4RCBA 5GMKi 1VQOA 1M2OA 3DB3A 5GAN2 2DTOA 4M78G 3ZL7C 4J9EA 2BIVA 2CS7A 1JXOA 4WTOB 3BY7A 2XDPA 2RI2A 1X2QA 2NUPA 4XTUA 1B3QA 3INZA 1OKVB 4GLKA 4B6MA 1RAHB 2CJMB 2HD0A 3FB9A 3EG0A 1UGQB 4C5EA 1OULA 4NOYA 2EFIA 4N0AA 3OYBA 5DM7R 4M75C 2KYMA 1H25B 1KD1U 5LJ3e 2EQUA 1GUXA 1M1FA 2QGGA 2C4GB 4C8QE 5GANj 4N4HA 3CCEQ 3SFMA 1WHKA 4M77F 4BCMB 2GCXA 2F2XA 2XDDA 3IQLA 1HD3A 2DXCA 2H3EB 3M59A 1VQ4Q 2DRKA 3QYBA 2RJEA 5CVIA 4C92G 4BCOB 3VS4A 1WX6A 1Q81C 5KCOA 3VS5A 2BKDN 4KUDK 2C5OB 4J8OA 2PHGA 5FROA 4FW1A 3FDRA 1BIAA 2PVGB 1UG1A 1QCOA 5LJ5h 1W6XA 3PVQA 1PRLC 4E6RA 4BCGB 4BI8B 1VQ6Q 2ZPHB 2EIFA 1IGQA 1YCYA 1KSWA 1VQMA 1YNZA 2R57A 3G71T 3FC3A 2XK0A 5CIUA 2YT6A 2NUPB 4II5B 3CC2A 2WMBB 2C0OA 2Y4YA 1JOWA 5CO7A 2BS3A 1RAGB 3CQTA 3OYEA 3TCJA 4FX3B 5FU7B 1M4ZA 1S72A 3HB9A 1ZBXA 4F16A 4NS5A 1O75A 4AFSC 3M57A 2L3QA 3EFRA 5HBJB 2CSQA 1GUXB 1JJ2S 2EYWA 1AZGB 2ECZA 2JW4A 4EOKB 1SRMA 5GAOl 3I55A 2QTVA 1VQ7T 1PSFA 1M3BA 4M7AE 2DXCB 1AZEA 2V1RA 4JS4A 3MEWA 1HK9A 4PJJA 1K4US 1WHHA 2GGRA 2WSFE 3UWNA 3GNFB 2JGZB 4F04B 2JMCA 5AYFA 1OL1B 4EOJB 3QYHB 3UATA 1UNLD 4AKGA 2LRQA 2X1NB 1KXUA 3V8KA 4O5VA 4MMLA 3PMIA 2E10A 1Y0MA 3NHNA 5GAOn 4DQ2A 1VQOQ 4C5GA 4PFOA 3RBBB 2CYZB 1K76A 2YSQA 4V2SA 2LVMA 3LX7A 3NMZC 4M75D 2H3JA 1VQKA 1RAFB 2JN0A 3QWXX 3BHVB 1OOTA 1QKXA 2PVOB 2G77A
chains in the Genus database with same CATH topology
3JCMh 2QF7A 4KULA 5J26A 4C8QD 3HKSA 4M78F 4RMOA 3OY9A 2RI5A 3I56T 1VQ8T 3WVEB 4C0FA 3BG9A 1IZ6A 4OVAA 4ZGDB 2EYQA 2QI2A 3M9QA 2G3RA 4F7UG 4E7HA 4PJOD 4M7AA 3G6EA 1QP2A 4LDWA 1YHQT 1UEBA 3GP8A 4BB7A 1YJ9T 3GLXA 4M78A 4MZMA 1MHNA 3KXTA 3MP1A 2VXEA 3LH0A 2RJCA 1JB0E 2VGMA 1VIFA 5C0MA 2OTLT 5CKFA 2GQVA 5KE2A 3H4CA 5GAMg 3KUFA 4OMFB 4D6WA 3OS1A 2DIGA 2DXBA 2M16A 2RK2A 1VQPT 5GANe 4OB2B 3MCAB 4YTLA 3RESA 5A0GA 3PIPA 3G4SA 2EJFA 4JRKA 2E64A 3P8DA 2LNVA 3CCUT 3GF5A 4JDSA 2E6ZA 3BDLA 3HSBA 5LJ5d 1Q7YU 3LWHA 2FHDA 3JB9I 4E7KA 2A3LA 2HQXA 3S3OA 4ZTFA 3ZBDA 5DLQE 4FU6A 3X25B 3SD4A 2PUKB 4QQGA 2O4XB 4JX6A 2HNIA 2RHUA 3A8HB 3QKJA 5IN1A 5KCHA 3HP9A 3A8OB 3UPUA 1QVFS 3CCJA 4LDYA 3M56A 1M8VA 3CC4T 4XU0A 1FWZA 2X35A 4J5YA 1BI2A 2EQJA 5FU6B 3CCLT 2OTJT 4XTVA 4HA8A 3JCMg 1Q82U 1OYXA 3WVDB 1VQMT 2KY9A 4MDXA 2EQKA 1NE8A 2C06A 3ME9A 3CPFA 3UT1A 3C4SA 2FVUA 3O8VA 4C92A 3OYHA 4M75G 3PFSA 2LQ8A 5CKEA 5LJ5e 1YIJA 2ZZDA 3A8MB 1ZHIA 3HHTB 4EPCA 4E7LA 5FU6C 1M9SA 3MP8A 3A5ZB 3QYGB 3OS0A 3TW6A 1AHJB 4C8QG 3CMAA 1KHIA 1KHCA 5DY9A 3CC2T 3QHSA 4R56A 3CCVA 4MFDA 4PJOG 2XD0A 4A4GA 2R5AA 2QA4A 3PT9A 4CRIA 2XHCA 4MMKA 5GMKe 5A0DA 4WF2A 4IUQA 4HNUA 4DOWA 1D3BB 1VQ9T 5GAN3 1VQ6A 5IAYA 1S72T 2QFZA 4IUVA 5GAN4 2B8AA 2CGHA 5I2MA 2QEXA 3OYJA 2AHJB 1UB4A 3PTAA 3G7ZA 3GOXA 2EAYA 4KBMB 2DIQA 2VV5A 3X28B 1NZ9A 1KQ1A 1U1TA 2XU8A 4UC4A 3I55T 2DD4A 3JCMW 1YJWA 1HXDA 3QIIA 4EMGA 5HY6A 4ELZC 4M78B 2E5QA 5GMKl 2DKGA 3DLLA 1I5LA 3OYCA 1W2BA 2D6FA 3HPWA 2VGNA 4LD9K 1VUBA 2ZCFB 2EJGA 1NPRA 2ZPFB 1I81A 2DXBB 2E70A 3M55A 3Q1JA 5GAMd 5CKDA 4Z02A 4L5GA 3CBMA 3CPWA 2F5KA 3OYAA 5IT9E 3BDUA 2MF2A 2RJDA 2DJZA 2HBPA 5A0LA 3L2ZA 4M7DE 3GNGA 3M4GA 3RKXA 3E19A 4M77D 4P5NA 3L2QA 4M7DC 2LX9A 3HFNA 2FB7A 1SSFA 2L8DA 3A8LB 1WJRA 5GAN6 2QQAA 4IUTA 3HFOA 4BD3A 2DVEA 4LD6A 3PNWC 4KUIA 3C95A 4HKEA 3J81E 5I21A 4C0DC 3T9NA 2KMTA 3OMGA 3RUXA 1UGSB 4JRQA 5FRNA 4BE0A 3J7AF 2MMPA 4A4EA 1BI0A 3OSSC 5A2QE 3CCSA 3FJPA 4OGCA 1E7PA 3SDZA 1H641 4J6XA 4F7UE 3VYGA 4Q5WA 2XKOC 3FRNA 5GAMe 3JCMd 4E7IA 2QTXA 1VQKT 3CC7A 2DZ9A 3QO3A 3PGGA 4C92B 1O9SA 1KC8U 2ZZDB 1OI1A 2QQ8A 3HRTA 3M58A 4E7JA 3CD6T 2K3XA 2KQWA 2JUFA 5J39A 5HKCA 5GANf 1M1GA 4AKHA 2O01E 1VQLT 4HT8A 2RK1A 4AKIA 2FL7A 2QQ9A 4MZTA 1JRIA 5CK9A 1R8OB 3URGA 5CKBA 4Y91A 4C92E 4C92C 2KVQG 1G3SA 4M7AG 4M7DF 3QBYA 5CKHA 4O6JA 2YHTA 4LDVA 4RG2A 3BW1A 5LL6S 4OF1A 3VUBA 2E1HA 2VC8A 4FM4B 3JCMe 5CQXA 3G4ST 1WJQA 1QLBA 2DTIA 4XTYA 2D0QB 3BG3A 4M7DA 4C5IA 3OYYA 4B9XA 4Y28E 3RMSA 3PIOA 1X6OA 1N9RA 3QDRB 3SB2A 1M1KC 3VKGA 1EIFA 5GAN5 4JLGA 4M77G 2MWPA 1U1SA 3TU4K 4F7UF 2DD4B 3N5BB 1DJ7B 1WQ7A 2CZ7B 3VKHA 4J7IA 5LJ3h 2RA2A 5LJ3j 2V8JA 3F70A 5LJ5f 3CCJT 3OBWA 3DB4A 1VQ5A 4IKFA 5D6YA 4NL2A 3AHUA 4F7UA 3TREA 4JRPA 3DL1A 4HLQA 3V7RA 3I56A 4RCCA 1VQ8A 3CCEA 3MEVA 4XAXB 4C0GA 2RB6A 2LTOA 1QVGA 2RHXA 3MO8A 2E6NA 2XDBA 2JVVA 4C92F 4PJOC 4PJOE 2K5FA 4ZN3A 1YIJT 1YJ9A 2QXFA 2M9UA 2RHIA 3R6OA 1VQ4A 1UGPB 1KQSS 3JCMc 3CCQA 3ER0A 3QJ6A 2OTLA 4BDYA 1YITA 1RL2A 1Y71A 1LJOA 2IG0A 3CMAT 4XQ3A 1VQPA 4ATOA 3CCVT 4HT9A 3CCRA 1KQ2A 4R55A 3CCUA 1QVPA 2QA4T 1YI2A 3X26B 3HRUA 4EDUA 1BI1A 2M0OA 4VUBA 3VYGB 3LWIA 1QVFA 4IUPA 4OB1B 2XI9A 4LOCA 2DAQA 3VYHB 1B34A 2KSSA 2I2LA 4OGEA 3SWNA 3OQ5A 4BUGA 1VQ6T 2R5MA 3V7SA 2ZPBB 2DK3A 2K2VA 4XU2A 1G3WA 3KBGA 4XTWA 5J3BA 1M1KU 5LJ3g 2QEXT 4II1A 5EG2A 1M5Q1 1MGQA 4BY6B 3OYFA 1YJNT 1N27A 4EMHA 3JCMb 4JJNK 3JB9J 3CC4A 4PLLA 3OW2S 4L6V5 4MDWA 5GAOq 2L5QA 3DKMA 4QQ6A 1Y96A 2LQKA 2DZCA 4M75A 4QVZA 3QWLA 3TEEA 2LCLA 4N4GA 3NTKA 3BFMA 4NC6A 1Q86C 4PJOF 3OYGA 1UGRB 4GY5A 1QP3A 1OZ3A 2WSEE 3RIRA 3OYMA 4BY6C 4NL3A 3JB9D 4MFEA 5GMKm 2XICA 4C8QA 3ZEHA 4PKCC 1PSEA 2K57A 4M7AD 3CBPA 5GAN8 3E1SA 2XG8D 4BE2A 4BBSM 4A53A 1W2BS 4M7DB 4PJOA 1YBYA 1Y7XA 2X4YA 3DLMA 4HNTA 2P0PA 4M78D 3G71A 3FIFA 2WJ9A 4MZPA 2PUOB 4XU1A 1BYMA 1NPPA 3L2RA 4QW2A 1N6AA 4QVDA 2DXTA 3J80E 5GAMf 2CKKA 1V29B 2WSCE 3CPWS 2QDYB 3X24B 4C0DB 4BDZA 2X4XA 3V8JA 2IVWA 2Y90A 4LDXA 3KHIA 4X9DA 4FT4A 1M90C 3CMEA 1N8RC 1X75C 3VU3C 2V8IA 4FSXA 3JB9H 4F7UB 4JLIA 4J7FA 3VUZA 2BS2A 3CEYA 5FLXE 3EFSA 1JJ2A 2BUDA 2KMGA 3LYIA 2EKOA 3BG5A 3CC7T 1WPYA 1QW1A 4N0AC 5GAOp 2KK4A 4XU3A 2KAFA 4BI4A 4BACA 2ZPIB 3E9GA 2MI6A 1GXIE 3CBOA 3A8GB 3X20B 1P92A 1XOVA 3PMTA 2ZGWA 2M1HA 3JCMf 3CXCS 1G3YA 3UDCA 1KD1C 1Q86U 2V8KA 3FEOA 2VXFA 4ELJA 3JCMV 3JCMQ 2JNGA 4JX5A 3OS5A 3L2VA 4B9WA 4C5HA 3VKIA 1VQ7A 4EMKA 4C92D 1K73C 1BKBA 3CCMA 4TVRA 2WACA 4BI3A 4ZGEB 2XIDA 2X4JA 2OAUA 3G6ET 1RI0A 2F69A 2DO3A 2VYTA 3H8ZA 4M77C 4M77E 3JAME 1B34B 3OYLA 3JB9G 3SWNB 1WNLA 2LT4A 2PU9B 3OA6A 3RERA 3QZ9B 2QQBA 1LOJA 3QYEA 2LDMA 2QDJA 2MWOA 5EJCA 2RO0A 1VQNA 3GIBA 4RCBA 5GMKi 2YLBA 5LJ3d 1VQOA 2E12A 3DB3A 2DTOA 4M78G 4E47A 5GAN2 1U8RA 2BIVA 1M90U 2CZ1B 4ZGJB 5D6XA 3WXMB 2CS7A 1Y96B 2JTFA 5C6SA 3BY7A 4CI0C 2XDPA 2EWNA 2RI2A 2RM4A 4M75B 2QQRA 4XTUA 1JBMA 3SWNC 4BE1A 2LCCA 3INZA 3QXEB 2R58A 5D6WA 2E65A 4GLKA 2JZ2A 3ZFJA 1G3TA 1H3ZA 1VQ5T 3JB9F 2HD0A 1Q82C 3FB9A 2BS4A 4C8QB 1UGQB 4C5EA 3L42A 2NLUA 2A7YA 4NOYA 5I2SA 2HAXA 2EFIA 4PJOB 1TH7A 4N0AA 3CCET 3OYNA 3QG1A 3OYBA 4M75E 1VQLA 2RD1A 4M75C 5DM7R 4OP0A 1KD1U 5LJ3e 2LT1A 2CZ0B 5GANh 3RMQA 2EQUA 3LW5E 4C0ZA 1M1FA 5GANj 3M54A 2DTHA 4C8QE 1VQ4T 4C8QC 3V7CA 4N4HA 3SFMA 3CCQT 1K73U 4QQDA 4M77F 1YITT 1QVGS 2QQSA 3MHXA 3E9FA 2GCXA 3FLGA 1YHQA 2XDDA 3M4YA 1NJIC 1XQHA 2DD5A 4A4FA 2DXCA 2GF7A 2GFUA 3C94A 3M59A 3CCRT 4ZTJA 2DEQA 3JCMX 3QYBA 2RJEA 4M77A 5CVIA 4C92G 3OYKA 1YI2T 2PVDB 2EQMA 2P0QA 5FRMA 3OS2A 1Q81C 5KCOA 3JCMJ 1I4K1 2BKDN 2D9TA 4JRIA 4KUDK 4FT2A 1K8AC 2GFAA 4J8OA 1FKMA 3OYDA 1KG1A 4J83A 5FROA 4A4HA 3QPHA 1NJIU 2KR6A 3OYIA 5GAOr 4OB3B 3FDRA 3QJYA 3V8LA 4X9CA 1BIAA 1X01A 3HRSA 2PVGB 2JOYA 2YLCA 3M5AA 3MEUA 3P8HA 5LJ5h 2RHYA 1I8FA 4EMKB 5LJ5j 2E41A 2HQEA 1W4SA 2P0KA 4XK8E 4L59A 4M75F 4HCCA 3OB9A 1KQSA 3LLRA 1K9MC 2RH2A 3C12A 3QUIA 4BI8B 2OTJA 3CCLA 2ZPHB 3NFCA 3RKYA 4A4KA 4A54A 3NTIA 4C8QF 5GANg 2EIFA 1YJWT 1YCYA 3S3MA 1VQMA 4PL6A 4J6YA 2RI3A 2ZPGB 5GMKh 2VUBA 4EMKC 3VV0A 2R57A 3M53A 5GMKj 2FYKA 3G71T 1G5VA 4HCBA 4HL4A 5CAIA 3FC3A 3JSCA 4J6WA 2XK0A 3OMCA 3LGLA 5CIUA 4N4IA 2K3YA 4M7DD 1N9SA 2L89A 4BBRM 2L3RA 3CC2A 3QZ5B 3P8BB 2Y4YA 3CMET 2KDSA 1XTDA 2K4YA 2BS3A 2DPPB 2LC4A 4HCZA 4KT0E 5CO7A 3OW2A 1Q81U 3EAEA 4PNOA 3VJPA 1XNIA 3OYEA 1YJNA 3GPLA 1IREB 3HZJA 1LNXA 4LDUA 3TCJA 4XTZA 3RKWA 4ME7A 2JTMA 1K8AU 4X34A 1VQ9A 5FU7B 4QVCA 1BI3A 1KC8C 4FL6A 1M4ZA 5KE3A 3HB9A 1ZBXA 4M7AB 1S72A 4NS5A 1O75A 5LJ5g 3M57A 3CCST 3EFRA 2CZ6B 1VIEA 4XTXA 5GAOm 1JJ2S 5HK0A 4JS5A 1FX7A 2RJFA 4OB0B 3META 1WQWA 4RG8A 3MP6A 5GAOl 3I55A 1K9MU 1FXXA 3HL8A 3S6WA 2O4XA 1VQ7T 5FU7C 2DD5B 1PSFA 3S3NA 4M7AE 2DXCB 2K5IA 4M7AC 3JCMP 2YRVA 5M9OA 4JS4A 1Y07A 3CCMT 3MEAA 2PQWA 3MEWA 4M77B 4M78E 4ELYC 4ZN1A 4M78C 3L2UA 3H6ZA 2F5TX 1HK9A 2ZPEB 2WSFE 1OZ2A 3HBLA 3GNFB 3OBYA 4AI6A 3UWNA 5AYFA 2K5LA 3LGFA 4IURA 4DOVA 3QYHB 3NTHA 1VQNT 2DXUA 5KH6A 2EJ9A 4AKGA 4JUVA 1WJSA 1VQOT 2MAMA 5GAMh 2LRQA 5GAMj 4MIMA 4Z6YA 2RHZA 1ZQ1A 1Q7YC 3OSVA 3V8KA 4O5VA 4MMLA 3PMIA 2E10A 4IUUA 5CCAA 5GAOn 4PLIA 2Y4XA 3HO8A 4DQ2A 4C5GA 4RKUE 2X4WA 5LJ3f 1N8RU 4M7DG 3CXCA 1WGSA 4FIBA 2CYZB 4M6VA 3L1AA 3ASKA 5DLOA 4V2SA 4HNVA 5CR2A 4QSHA 2LVMA 4JX4A 3LX7A 5CQYA 5HK3A 5GANd 5GAN7 4M75D 2H3JA 1D3BA 5L8RE 3JRZA 1VQKA 2JN0A 3QSUA 2PVOB 3TW7A 3L2WA 4DA4A 2G77A 2P4TA 4M7AF 3CD6A 1BIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSE E;  3WVE B;  1PSE A;  4ZGD B;  1UGS B;  1QP2 A;  4OB3 B;  3VYG A;  2PVG B;  2PUO B;  1JB0 E;  4XK8 E;  1V29 B;  2WSC E;  2QDY B;  3X24 B;  2DXB A;  2ZZD B;  4OB2 B;  2ZPH B;  2O01 E;  2ZPG B;  3X25 B;  2PUK B;  3A8H B;  3A8O B;  4FM4 B;  2ZPI B;  1GXI E;  3A8G B;  3X20 B;  2D0Q B;  3QZ5 B;  4Y28 E;  3WVD B;  2DPP B;  4KT0 E;  1IRE B;  2DD4 B;  2ZZD A;  3A8M B;  1DJ7 B;  3HHT B;  2CZ7 B;  4ZGE B;  3QYG B;  1AHJ B;  2CZ6 B;  2PU9 B;  3QZ9 B;  4OB0 B;  2DD5 B;  1PSF A;  2DXC B;  2CZ1 B;  4ZGJ B;  1UGP B;  2ZPE B;  3QXE B;  2WSF E;  2AHJ B;  3QYH B;  1UGQ B;  3X28 B;  2DD4 A;  3X26 B;  3VYG B;  4OB1 B;  3VYH B;  2CZ0 B;  3LW5 E;  2ZCF B;  2ZPF B;  2ZPB B;  4RKU E;  2DXB B;  2CYZ B;  2DD5 A;  4L6V 5;  2DXC A;  5L8R E;  2PVO B;  2PVD B;  3A8L B;  1UGR B;  1QP3 A; 
#chains in the Genus database with same CATH topology
 5J26 A;  3OY9 A;  3HKS A;  4M78 F;  3WVE B;  1IZ6 A;  4ZGD B;  1M27 C;  2EYQ A;  3M9Q A;  4E7H A;  1X2K A;  3G6E A;  4M7A A;  1QP2 A;  4LDW A;  4BB7 A;  3GLX A;  1GBQ A;  3MP1 A;  3I56 Q;  1VQ8 Q;  1JB0 E;  1X6B A;  2DBK A;  5C0M A;  2LNH B;  5CKF A;  5KE2 A;  5GAM g;  4OMF B;  4D6W A;  3OS1 A;  2DXB A;  5GAN e;  4OB2 B;  3RES A;  3G4S A;  1B07 A;  1GRI A;  4JRK A;  2UZL B;  4OR5 B;  2HKQ B;  3X25 B;  4FYW B;  2PUK B;  2J05 A;  3HP9 A;  1UHF A;  4AMC A;  4CC3 A;  2C0I A;  3M56 A;  1M8V A;  3H41 A;  4HCK A;  3JCM g;  2SEM A;  1BB9 A;  3EGD A;  3ME9 A;  3C4S A;  2FVU A;  2H8H A;  4M75 G;  2LQ8 A;  2DET A;  1VQM Q;  5FU6 C;  1M9S A;  2HKN A;  1H26 B;  1JSU B;  3TW6 A;  1AHJ B;  1N5Z A;  1KHC A;  1PHT A;  3MPU B;  3PT9 A;  1OI9 B;  2XHC A;  2A28 A;  3TNW B;  4HNU A;  4DOW A;  3EG9 A;  5GAN 3;  1VQ9 T;  2CRE A;  2QFZ A;  2GNC A;  5GAN 4;  5I2M A;  5IXF A;  1UB4 A;  2ZAE A;  3G7Z A;  1VOL A;  3M0T A;  3X28 B;  1NZ9 A;  1KQ1 A;  4UC4 A;  3JCM W;  1YJW A;  1OEB A;  1HXD A;  1JXM A;  1T3L A;  5GMK l;  2LW4 A;  2X3W D;  3TNI B;  1TOV A;  2VGN A;  2WPA B;  3I55 Q;  2DXB B;  2E70 A;  1PG5 B;  4Z02 A;  1OPL A;  2FO0 A;  2HBP A;  4EOM B;  4M7D E;  3RKX A;  3E19 A;  4RTW A;  3A8L B;  1ENW A;  4BXX X;  1SHF A;  5GAN 6;  4IUT A;  1ZSG A;  5IH2 A;  4KUI A;  2FZG B;  1X27 A;  2MMP A;  4BCI B;  3CCS A;  4E7I A;  3EH2 A;  2QTX A;  3CC7 A;  2YUN A;  1UEC A;  2L3P A;  1OI1 A;  2QQ8 A;  1QMC A;  2OX7 A;  2YDL A;  2X9H A;  2OAW A;  1VQK Q;  1VA7 A;  2F2W A;  2DLP A;  5CK9 A;  1R8O B;  3URG A;  4Y92 A;  4DEX A;  2J6F A;  4O6J A;  2LP5 A;  5FW9 A;  2I53 A;  3VUB A;  2VC8 A;  3EG9 B;  1MMD A;  1WJQ A;  1AWO A;  2DTI A;  4M7D A;  4C5I A;  3PIO A;  1YCS B;  2KGT A;  4EOO B;  3QDR B;  3SB2 A;  1M1K C;  3G4S Q;  3TU4 K;  4BCK B;  2ABL A;  1MUZ A;  1WQ7 A;  5KYY A;  4AG2 C;  4EIK A;  1TFB A;  2O9S A;  4NL2 A;  3SEM A;  1TU0 B;  3DL1 A;  4OMP A;  4ROC A;  4HLQ A;  3GTM S;  3V7R A;  1YP5 A;  2ESW A;  2VVK A;  2DA9 A;  3RGF B;  2F1L A;  1ABQ A;  2FZK B;  2RB6 A;  2LTO A;  2M0Y A;  2HCK A;  2K5F A;  2JJ9 A;  3M0R A;  3ER0 A;  2OTL A;  1WHM A;  1BK2 A;  3CMA T;  1VQP A;  3EGU A;  3CCU A;  3X26 B;  1S1N A;  4OB1 B;  4KRT A;  2KSS A;  4OGE A;  4BUG A;  1WHJ A;  2AZS A;  3KBG A;  1TWB A;  1NJI R;  3OYF A;  1SPK A;  2W2H A;  4JJN K;  3M0Q A;  2EVR A;  4QKU A;  4L6V 5;  5GAO q;  3DKM A;  1E6H A;  1M30 A;  4N4G A;  5ICP B;  1W70 A;  1OL2 B;  1ZBJ A;  3PO3 S;  5GMK m;  2XIC A;  2IVX A;  5GAN 8;  4BBS M;  4M7D B;  1EZZ B;  3G71 A;  4MZP A;  1BYM A;  3CPW P;  4QW2 A;  4CFU B;  1N6A A;  3J80 E;  5GAM f;  2CKK A;  2WSC E;  4WCI A;  2WEV B;  4EON B;  5KYY B;  2IVW A;  1GCP A;  1RAE B;  1X6G A;  2V1Q A;  4FSX A;  1VYU A;  4J7F A;  3CEY A;  2AK5 A;  3R6N A;  1TSF A;  2IIM A;  2EKO A;  2KEA A;  4N0A C;  4XU3 A;  2MI6 A;  3PMT A;  2M1H A;  3JCM f;  3CXC S;  1G3Y A;  2A08 A;  4CFW B;  1KD1 C;  3CC7 Q;  2BKZ B;  1VQ7 A;  4C5H A;  2EW3 A;  3G6E T;  1RI0 A;  1ZSZ C;  2F69 A;  1H28 B;  4M77 E;  3OYL A;  4KGZ B;  1V1C A;  1LCK A;  1QMZ B;  3OA6 A;  2QQB A;  3QYE A;  2LDM A;  2DL3 A;  1AOJ A;  5HCK A;  5LJ3 d;  1TD6 A;  1GCQ A;  2KT1 A;  5D6X A;  3WXM B;  4BY7 X;  5C6S A;  1FMK A;  3EG2 A;  2EWN A;  2RM4 A;  3SWN C;  1AEY A;  4BE1 A;  1I0C A;  2COY A;  2JZ2 A;  1RAI B;  1G3T A;  3ZFJ A;  4J9I A;  1VQ5 T;  3LH5 A;  3D7S B;  2FEI A;  5I2S A;  1WHL A;  2GTJ A;  2KRO A;  3OYN A;  1VQL A;  2KXD A;  2RD1 A;  2DRM A;  2YRD A;  4IIM A;  2LT1 A;  3RMQ A;  3M54 A;  4KRD B;  1QVG P;  3I5S A;  4C8Q C;  1M3C A;  1YIT T;  3MHX A;  3FLG A;  4AG1 C;  3M4Y A;  2DD5 A;  3MY1 B;  2ROT A;  4AT1 B;  4ZTJ A;  8AT1 B;  2GQI A;  1YI2 T;  4M77 A;  2P0Q A;  5FRM A;  3OS2 A;  1I4K 1;  2D9T A;  1Q7Y R;  1QVF P;  1Z9Z A;  4FT2 A;  2GFA A;  2UZE B;  1FMV A;  3VRZ A;  3OYD A;  1KG1 A;  2HSP A;  1NJI U;  2RQR A;  1OGU B;  2KR6 A;  1IRX A;  4CFV B;  3OYI A;  5GAO r;  4OB3 B;  3QJY A;  3V8L A;  5I5Z B;  1SRL A;  1WIE A;  4OMM A;  1X01 A;  3HRS A;  2YLC A;  1Z9Q A;  5LJ5 j;  3JB9 H;  2E41 A;  1W4S A;  3BE3 A;  3M0S A;  2CH4 W;  3NFC A;  1PNJ A;  2DFU A;  3NTI A;  1YJW T;  2EGA A;  2RI3 A;  2ZPG B;  3RNJ A;  1JQQ A;  4EMK C;  5GMK h;  1WDX A;  1AIS B;  4HCB A;  3MJX A;  2O9V A;  4F7N B;  4ZNX A;  3LGL A;  4BBR M;  1K0S A;  3P8B B;  2DMO A;  3CME T;  2KDS A;  3OW2 A;  2DPP B;  2LC4 A;  5I22 A;  1XNI A;  1YJN A;  1IRE B;  4ME7 A;  1VQ9 A;  1BI3 A;  1RUW A;  4YC3 B;  2JTE A;  3CCS T;  1PWT A;  2MPX C;  4JS5 A;  7AT1 B;  1FX7 A;  2BZX A;  1Q95 G;  4F6U B;  3MP6 A;  4LE9 A;  3HL8 A;  4J9D A;  3S6W A;  1H1S B;  2DD5 B;  2K5I A;  4M7A C;  5IXB A;  3MIA B;  1Y07 A;  3MEA A;  2PQW A;  4M77 B;  1ABO A;  4M78 E;  1YWO A;  4ZN1 A;  3L2U A;  2F5T X;  1VQ7 Q;  1ZP2 A;  2EYX A;  1H27 B;  2K5L A;  5D7U A;  3QDF A;  1ZUU A;  4E7Z A;  2EJ9 A;  1BBZ A;  5GAM h;  2DYI A;  3JV3 A;  4Z6Y A;  3OSV A;  1MMN A;  4IUU A;  1BCO A;  2X51 A;  4BCN D;  1OU8 A;  3L1A A;  4JZ4 A;  5DLO A;  4HNV A;  1UFF A;  2ENM A;  4QSH A;  5GAN d;  5L8R E;  3JRZ A;  3TW7 A;  1AWW A;  4FCY A;  1BIB A;  3JCM h;  4KUL A;  4C8Q D;  3THK A;  4C0F A;  3BG9 A;  4EOQ B;  2QI2 A;  4PJO D;  1SEM A;  1I1J A;  2NUT A;  3GP8 A;  4M78 A;  1MHN A;  3KXT A;  2VXE A;  2HL5 C;  3LH0 A;  1KFZ A;  2VGM A;  1VIF A;  2DYB A;  1NBE B;  2OTL T;  3H4C A;  2RK2 A;  1QKW A;  1VQP T;  5A0G A;  2VWF A;  2E64 A;  3CCU T;  3CCQ Q;  3BDL A;  1Q7Y U;  2J06 A;  3LWH A;  2HQX A;  4Y72 B;  1MV3 A;  4FYY B;  4JX6 A;  3QKJ A;  3EID B;  1PKS A;  2M02 A;  4GBQ A;  4LDY A;  1FWZ A;  2CDT A;  2OTJ T;  2KI7 A;  4NST B;  5EC7 A;  3RR6 A;  4HA8 A;  3WVD B;  4MDX A;  2KY9 A;  5IHN A;  1NE8 A;  2QAZ A;  1I5O B;  4ROD A;  1UDL A;  3EJ1 B;  4C92 A;  3OYH A;  3MI9 B;  2K9G A;  5LJ5 e;  1SKU B;  4K11 A;  4E7L A;  4UN0 A;  3MP8 A;  2LZ6 B;  1IO6 A;  5KYX A;  4C8Q G;  3CMA A;  1TTH B;  1KHI A;  3QHS A;  4PJO G;  3C0C A;  4A4G A;  2R5A A;  4CRI A;  4WF2 A;  1NG2 A;  3VS3 A;  5IAY A;  3DDP B;  2B8A A;  1W98 B;  4KBM B;  4ANJ A;  4CC7 A;  4OGR B;  4KRC B;  4YOO A;  2XU8 A;  4RTX A;  2NUT B;  3QII A;  2DX1 A;  5HY6 A;  4M78 B;  2E3I A;  3OYC A;  2D6F A;  2ZCF B;  1NPR A;  2ZPF B;  1NEB A;  3VS0 A;  3M55 A;  2SRC A;  2FRW A;  1H8K A;  3CPW A;  5IT9 E;  2RJD A;  3L2Z A;  3L2Q A;  4M7D C;  3VS6 A;  2DER A;  5IF1 B;  2RN8 A;  1SSF A;  1K0X A;  4BY1 X;  4J9G A;  2DVE A;  1VYW B;  3PNW C;  2YXY A;  4HKE A;  1OQK A;  2C0T A;  2KMT A;  2YUQ A;  4JRQ A;  1ZUY A;  5A2Q E;  3FJP A;  4OGC A;  3REB B;  3SDZ A;  1H64 1;  4Q5W A;  2RPN A;  3FRN A;  2MOX A;  1U3O A;  2DZ9 A;  4C92 B;  1O9S A;  5FWB A;  1AD6 A;  2HMA A;  3M58 A;  3CD6 T;  2KQW A;  1Q86 R;  5KYX B;  2JUF A;  1QQJ A;  5J39 A;  3JB9 F;  1M1G A;  2O01 E;  4DEY A;  2PK2 A;  1XJW B;  2RK1 A;  4AKI A;  2QQ9 A;  1VQL T;  5CKB A;  4J9H A;  4ORZ A;  2KVQ G;  2EGC A;  1GH6 B;  4M7A G;  1B7T A;  2YHT A;  2CP3 A;  4RG2 A;  1WYX A;  2E1H A;  1VYT A;  4FM4 B;  3PVL A;  2W9F A;  2WIH B;  5CQX A;  4R0K A;  2P4R A;  3OYY A;  1N8R R;  1D0Y A;  3VKG A;  1EIF A;  1Y57 A;  4JLG A;  5GAN 5;  3N5B B;  4DBF A;  2WFY B;  2RA2 A;  3F70 A;  5DQW A;  1VQ5 A;  4AFQ C;  4IKF A;  3AHU A;  4F6S B;  4Z88 A;  1MMA A;  2CT3 A;  2LJ3 A;  3MEV A;  4XAX B;  2HEQ A;  2XDB A;  4ELL A;  1QVG A;  3MO8 A;  2E6N A;  2JVV A;  1TXQ A;  4C92 F;  3I5R A;  2MIO A;  1YJ9 A;  1QWE A;  2DJQ A;  4CFN B;  3QJ6 A;  4BDY A;  1YIT A;  4HXJ A;  1V76 A;  4FSS A;  2W96 A;  3CCV T;  4R55 A;  2QA4 T;  1YI2 A;  5BNJ B;  2E3H A;  4EDU A;  4VUB A;  1WXB A;  1LPL A;  5CEI B;  3LWI A;  1QVF A;  1GL5 A;  2CT4 A;  3H0H A;  2XI9 A;  3VYH B;  2I2L A;  1VQ6 T;  2DME A;  5HBE B;  1PCX A;  2K2V A;  2DK3 A;  3EHQ A;  4E2F B;  5LJ3 g;  4II1 A;  2QEX T;  4BY6 B;  1YJN T;  1RAA B;  2M51 A;  3OW2 P;  3JB9 J;  3CC2 Q;  1D1C A;  3CC4 A;  1N4M A;  1Q82 R;  1Y96 A;  2DZC A;  4M75 A;  3NTK A;  1G8X A;  4PJO F;  3OYG A;  2A0F B;  2WSE E;  4NL3 A;  1S72 Q;  4MFE A;  1MND A;  3ZEH A;  4PKC C;  1PSE A;  1RAB B;  2XG8 D;  2QDL A;  2WIP B;  1YBY A;  2BTT A;  1UNG D;  4CRL B;  3EFO A;  3FIF A;  2WJ9 A;  2F2C A;  1OX8 A;  3L2R A;  1V29 B;  3CPW S;  2QDY B;  3X24 B;  2NYS A;  2R7G A;  2Y90 A;  4X9D A;  3EH1 A;  3CME A;  2V8I A;  4X1V A;  4EOI B;  2E4H A;  1K8A R;  2LMJ A;  2BUD A;  2KMG A;  4I3Z B;  2NWM A;  1GY3 B;  3QHR B;  4HVU A;  1XOV A;  1HSQ A;  1K9M R;  1Q86 U;  2V8K A;  4OMO A;  1JU5 C;  4ELJ A;  3JCM Q;  2B9R A;  4JX5 A;  3OS5 A;  1MMG A;  5GJW B;  3VKI A;  1PKD B;  1NYF A;  1BKB A;  2A37 A;  2LX7 A;  2WAC A;  3BHT B;  4ZGE B;  2XID A;  1OPK A;  5ECA A;  2X4J A;  2VAS A;  2VYT A;  3H8Z A;  4M77 C;  1WNL A;  2PU9 B;  3QZ9 B;  1H24 B;  1LOJ A;  1E6G A;  2QDJ A;  2FPE A;  5EJC A;  4PFP A;  2L3S A;  3G6E Q;  2E12 A;  4E47 A;  1CSK A;  4LNP A;  4CI0 C;  1N8R U;  1Y96 B;  2JTF A;  1NJI C;  4J9F A;  2MYS A;  4M75 B;  4RTU A;  2DE0 X;  3VS2 A;  1AVZ C;  2LCC A;  3QXE B;  2R58 A;  5D6W A;  2E65 A;  1ZA1 B;  1KC8 R;  1F5Q B;  1H3Z A;  1SSH A;  4M4Z A;  2NLU A;  2A7Y A;  2UUE B;  1TH7 A;  1VQ5 Q;  3EFO B;  2COW A;  1UJY A;  4ROE A;  3LW5 E;  1PC0 A;  1QVG S;  2EGE A;  2QQS A;  2AT1 B;  1XQH A;  1WXT A;  3CCR T;  2GFU A;  3C94 A;  3F5X B;  3BHU B;  3JCM J;  2D8J A;  1YI2 Q;  2CSI A;  4J83 A;  3QPH A;  2KRN A;  1OX9 A;  4X9C A;  3MEU A;  1NEG A;  4EOR B;  3P8H A;  1G5V A;  2RHY A;  1ZX6 A;  1VIN A;  4XK8 E;  4L59 A;  4M75 F;  1KQS A;  3LLR A;  2RH2 A;  3C12 A;  3QUI A;  2OTJ A;  3RKY A;  2C6T B;  1WFW A;  4A54 A;  4A4K A;  5GAN g;  3S3M A;  1QWF A;  2A36 A;  1YN8 A;  1P5E B;  3UA7 A;  5GMK j;  3M53 A;  4QT7 A;  1YJW Q;  1U06 A;  4J6W A;  3OMC A;  2JXB A;  2K3Y A;  4BCQ D;  1G2B A;  1N9S A;  3QZ5 B;  4BCP B;  2EYY A;  4HCZ A;  4KT0 E;  4PNO A;  3HZJ A;  1LNX A;  4LDU A;  3EG1 A;  3RKW A;  4JZ3 A;  3UF4 A;  2JTM A;  1K8A U;  4X34 A;  4QVC A;  3VRY A;  2I40 B;  3CME Q;  4J9C A;  3KFV A;  1T0H A;  2CP7 A;  4XTX A;  2E5K A;  2L2P A;  1C9B A;  3MET A;  1WQW A;  1K9M U;  1FXX A;  2O4X A;  5FU7 C;  3CCS Q;  3S3N A;  3JCM P;  2YRV A;  2RMO A;  3CCM T;  5EFQ B;  4M78 C;  3H6Z A;  2ZPE B;  3OBY A;  4AI6 A;  4RTT A;  4IUR A;  4DOV A;  3NTH A;  1VQN T;  3LQ5 B;  2DXU A;  5GJV B;  1T3S A;  5KH6 A;  4BCF B;  2GBQ A;  2DM1 A;  5GAM j;  2RHZ A;  1ZQ1 A;  1Q7Y C;  4EOS B;  4PK4 A;  2BPM B;  3TSZ A;  1UNH D;  2Y4X A;  3HO8 A;  4RKU E;  4TTH A;  2X4W A;  5LJ3 f;  2HDA A;  1WGS A;  4M6V A;  3BLR B;  5GAN 7;  3QSU A;  1D3B A;  4EOP B;  2CCH B;  3O5Z A;  3L2W A;  4DA4 A;  2P4T A;  4DBH A;  1UE9 A;  3CD6 A;  4JLI A;  4EOL B;  2CP5 A;  4F7U G;  4OVA A;  2V22 B;  2G3R A;  1YHQ T;  1YJ9 T;  4MZM A;  4F14 A;  2KXC A;  2GQV A;  3MY5 B;  3KUF A;  2DIG A;  3AT1 B;  4YTL A;  4BCM D;  3P8D A;  2LJ0 A;  3GF5 A;  3G1J A;  2OTL Q;  5LJ5 d;  2FHD A;  4E7K A;  2A3L A;  2AKK A;  1VQP Q;  2HZY A;  2KE9 A;  4FU6 A;  3SD4 A;  4QQG A;  5KCH A;  2O4X B;  2RHU A;  2HNI A;  3CCU Q;  3O0G D;  5IN1 A;  3UPU A;  3E2U A;  3CC4 T;  4XU0 A;  2LJ1 A;  5FU6 B;  3CCL T;  4XTV A;  1BCM A;  3DTO A;  2EQK A;  3UT1 A;  3O8V A;  2OTJ Q;  3HTR A;  3PFS A;  2CCI B;  3A8M B;  3HHT B;  2FPD A;  1E7O A;  4EPC A;  2EQI A;  3OS0 A;  3POM A;  4R56 A;  3CCV A;  4MFD A;  1OKW B;  2XD0 A;  2QA4 A;  5GMK e;  4MMK A;  5DQV A;  1RLP C;  5A0D A;  3G71 Q;  1UHC A;  5HVY B;  1D3B B;  1JEG A;  1VQ6 A;  3VS1 A;  2ED1 A;  1IB8 A;  4IUV A;  4AFZ C;  1R0B G;  2QEX A;  3OYJ A;  2AHJ B;  4PJM A;  4RTZ A;  3GOX A;  2DIQ A;  2PJQ A;  1PD0 A;  1U1T A;  3A1P A;  4ELZ C;  1QLY A;  2VB6 A;  2W0Z A;  2E5Q A;  2JS0 A;  3HPW A;  2VKN A;  2EJG A;  1I81 A;  4OML A;  5CKD A;  1CKA A;  1AWJ A;  4L5G A;  3CBM A;  3OYA A;  5A0L A;  2K2M A;  1NYG A;  4P5N A;  2D8H A;  3HFN A;  5IHY A;  1UTI A;  4BD3 A;  4LD6 A;  2IW9 B;  1ACM B;  3OMG A;  3RUX A;  5FRN A;  1UGS B;  4A4E A;  2W10 A;  1BI0 A;  3OSS C;  2DBM A;  1E7P A;  3H9N A;  1ZA2 B;  4J6X A;  2XKO C;  5GAM e;  2NUZ A;  1ARK A;  5KYW A;  3REA B;  4OMN A;  5IDP B;  3FJ5 A;  3HRT A;  4E7J A;  1NM7 A;  5GAN f;  2FL7 A;  1NLP C;  5IHI A;  1IHW A;  1JRI A;  3CD6 Q;  4Y91 A;  4C92 E;  1G3S A;  5CKH A;  4D8D A;  1VQL Q;  5LL6 S;  4OF1 A;  3JCM e;  2J6K A;  1QLB A;  1EX4 A;  4B9X A;  4Y28 E;  1TUD A;  3A98 A;  3RMS A;  1X6O A;  2D1X A;  1M90 R;  1N9R A;  3M03 A;  4F7U F;  5HBH B;  4CC4 B;  1WZO A;  5LJ3 h;  3CCJ T;  3I9Q A;  3DB4 A;  5D6Y A;  2IW8 B;  3TRE A;  4JRP A;  4LUD A;  3K7A M;  3I56 A;  3EGX A;  4RCC A;  1VQ8 A;  4C0G A;  2EUF A;  4PJO E;  2RHX A;  4DBQ A;  4ZN3 A;  4PJL A;  1YIJ T;  1KQS P;  3R6O A;  1K73 R;  1UGP B;  2WXV B;  1ZSZ A;  3JCM c;  9ATC B;  1Y71 A;  2V26 A;  2I0N A;  4ATO A;  1KK7 A;  3CCR A;  1KQ2 A;  1NLO C;  1QVP A;  1TS9 A;  1BI1 A;  2BE9 B;  4IUP A;  2DAQ A;  5KYW B;  3CCV Q;  1GFC A;  3SWN A;  3OQ5 A;  2QA4 Q;  4XU2 A;  1G3W A;  4E7S A;  4XTW A;  3M0U A;  1M5Q 1;  4EMH A;  3M0P A;  3JCM b;  4JJD A;  3OW2 S;  2FZC B;  2B86 A;  1ZLM A;  2LQK A;  4QVZ A;  2QEX Q;  3QWL A;  4F7S B;  1YJN Q;  1WXU A;  4NC6 A;  1Q86 C;  2KRS A;  2QK0 A;  1VQ9 Q;  1UGR B;  3RIR A;  1OZ3 A;  1QP3 A;  3OYM A;  1IHV A;  4C8Q A;  2G9X B;  2K57 A;  1TUG B;  1W2B P;  4M7A D;  4PJO A;  4A53 A;  1Y7X A;  3DLM A;  4HNT A;  4XU1 A;  2DXT A;  2YWW A;  4C0D B;  2X4X A;  1M8M A;  5ACB A;  3KHI A;  1D09 B;  2RQV A;  5IDN B;  1Q81 R;  1N8R C;  1X75 C;  3VU3 C;  4RTV A;  4YOS A;  1D0X A;  3VUZ A;  5FLX E;  3EGX B;  2QG9 B;  1BU2 A;  3BG5 A;  1C6V X;  5GAO p;  2C5N B;  2KK4 A;  4A63 B;  2F2V A;  4KH0 B;  3QHW B;  3CBO A;  1P92 A;  2W9Z A;  1MNE A;  1JKW A;  1ZSZ B;  2ZGW A;  1X43 A;  2JNG A;  3L2V A;  4EMK A;  1TG0 A;  3CCM A;  1PM3 A;  1J3T A;  2OAU A;  3SWN B;  2LT4 A;  3RER A;  2MWO A;  1VQN A;  2X3X D;  4IIO A;  4BCN B;  2J7I A;  2YLB A;  1H1R B;  2HQH A;  1U8R A;  1AD5 A;  1HJD A;  1M90 U;  2CZ1 B;  4ZGJ B;  3NGP A;  2DVJ A;  2QQR A;  3TN8 B;  1JBM A;  3I35 A;  2PTK A;  2KBT A;  1Q82 C;  2BS4 A;  4C8Q B;  1D1A A;  3L42 A;  2BZY A;  2HAX A;  4PJO B;  3CCE T;  3QG1 A;  4M75 E;  4RTY A;  1SG5 A;  4OP0 A;  2HBW A;  2CZ0 B;  5GAN h;  4C0Z A;  2GTO A;  1VQ4 T;  2DTH A;  3V7C A;  2P84 A;  3CCQ T;  1K73 U;  4QQD A;  1H92 A;  3E9F A;  1YHQ A;  2MCN A;  4A4F A;  2GF7 A;  2DEQ A;  1U5S A;  3JCM X;  3OYK A;  2PVD B;  2EQM A;  4PJN A;  3CCR Q;  4JRI A;  2PK9 B;  1K8A C;  1FKM A;  1R0C B;  3ULR B;  2PZ1 A;  4A4H A;  3CMA Q;  2ATC B;  2JOY A;  3M5A A;  1I8F A;  3UA6 A;  4EMK B;  1UJ0 A;  2HQE A;  4HCC A;  2P0K A;  4JJC A;  3OB9 A;  1K9M C;  2QGS A;  3CCL A;  4GLM A;  4C8Q F;  4PL6 A;  4J6Y A;  4D8K A;  3BLH B;  3EOC B;  2VUB A;  3VV0 A;  4DBR A;  2FYK A;  4HL4 A;  2G6F X;  5CAI A;  3JSC A;  1OIU B;  4N4I A;  5L2W B;  4M7D D;  2L89 A;  2L3R A;  2RF0 A;  1M3A A;  1XTD A;  2K4Y A;  1AT1 B;  1Q81 U;  3EAE A;  3VJP A;  4CFU D;  1KIK A;  3GPL A;  1GCQ C;  4XTZ A;  1GFD A;  1QCN A;  1KC8 C;  2DL4 A;  1F1B B;  4FL6 A;  2DL5 A;  4M7A B;  5KE3 A;  5FGK B;  1SHG A;  1T0J A;  6AT1 B;  2ED0 A;  1A0N B;  5LJ5 g;  1K1Z A;  1JJ2 P;  2J6O A;  1D0Z A;  2CZ6 B;  1VIE A;  2BZ8 A;  2JM9 A;  4ESR A;  5GAO m;  5HK0 A;  2RJF A;  4OB0 B;  2FRY A;  4RG8 A;  1MV0 B;  3RDV A;  2C5V B;  2L0A A;  1OU9 A;  5M9O A;  4ELY C;  2AKL A;  4F70 B;  4LN2 A;  1OZ2 A;  3HBL A;  1AWX A;  3EG3 A;  4G6L B;  1WA7 A;  3LGF A;  3GBQ A;  3CCM Q;  1VYV A;  2O31 A;  4JUV A;  2YRC A;  1WJS A;  2MAM A;  2HSE B;  2KT8 A;  1VQO T;  4MIM A;  1VQN Q;  2O2O A;  3EGD B;  3VS7 A;  1C1A A;  5CCA A;  4PLI A;  2CP0 A;  4M7D G;  3CXC A;  4FIB A;  2RNA A;  2QAS A;  3ASK A;  4AFU C;  4CC2 A;  5CR2 A;  2BE7 D;  3PE0 A;  4JX4 A;  5CQY A;  5HK3 A;  4BCJ B;  2FG0 A;  4M7A F;  2JS2 A;  2QF7 A;  4RMO A;  3I56 T;  2RI5 A;  1VQ8 T;  2KR3 A;  2RQW A;  2ROL A;  1UEB A;  2RJC A;  3H0I A;  1PD1 A;  1YHQ Q;  2M16 A;  2COZ A;  1YJ9 Q;  1H1Q B;  3MCA B;  3PIP A;  2EJF A;  2LNV A;  4JDS A;  2E6Z A;  4KH1 B;  3HSB A;  1PKT A;  1YIT Q;  4ZTF A;  3JB9 I;  3S3O A;  2RQT A;  3ZBD A;  5DLQ E;  3DLL A;  1IGU A;  5IHK A;  3A8H B;  3A8O B;  1QVF S;  2QYZ A;  2OJ2 A;  3CCJ A;  1QCF A;  4KGV B;  1C0M A;  2X35 A;  4J5Y A;  1BI2 A;  2EQJ A;  2WHB B;  1Q82 U;  1OYX A;  1VQM T;  3CC4 Q;  2C06 A;  3CPF A;  3CCL Q;  2XMF A;  5CKE A;  2RQU A;  1YIJ A;  2ZZD A;  1ZHI A;  1YWP A;  4EC8 B;  3A5Z B;  3QYG B;  1JST B;  2K7A A;  5DY9 A;  3CC2 T;  1WI7 A;  2EPD A;  4HVV A;  2O88 A;  1LVK A;  3EHR A;  4IUQ A;  1KJW A;  4FW2 A;  1M1K R;  1S72 T;  2CGH A;  3TQ7 P;  2LQW A;  3PTA A;  1URC B;  2EAY A;  1FVV B;  2DL7 A;  1RI9 A;  2PNI A;  2VV5 A;  4JPB W;  1OIY B;  3I55 T;  2DD4 A;  1VOM A;  4EMG A;  2DKG A;  3B57 A;  1FMW A;  1W2B A;  1I5L A;  2CH4 A;  4LD9 K;  2UZD B;  1VUB A;  2DEU A;  3U23 A;  2D0N A;  3Q1J A;  3TNH B;  2OI3 A;  5GAM d;  3H0F A;  3TVT A;  3QWY A;  2F5K A;  3BDU A;  1G83 A;  2MF2 A;  1XO2 A;  2DJZ A;  3GNG A;  3M4G A;  4M77 D;  2LX9 A;  2FB7 A;  4KGX B;  2L8D A;  1WJR A;  2QQA A;  3HFO A;  4IMY B;  3SHW A;  4F7L B;  3C95 A;  3J81 E;  5I21 A;  4C0D C;  2JT4 A;  1H1P B;  2EYZ A;  8ATC B;  3T9N A;  4BE0 A;  3J7A F;  4EC9 B;  4F7U E;  1RAD B;  3VYG A;  3JCM d;  1VQK T;  1M2V A;  3QO3 A;  2IPO B;  2DNU A;  3PGG A;  4F7J B;  1KC8 U;  2ZZD B;  2K3B A;  3G33 B;  2AIR B;  2K3X A;  4PFZ A;  1UGV A;  1D3U B;  4CFX B;  4Z8A A;  5HKC A;  4AKH A;  2IN3 A;  4HT8 A;  2QGF B;  4MZT A;  2Z0W A;  5CYI B;  4C92 C;  4BCH B;  2LQN A;  3DJB A;  2WMA B;  4FYX B;  4M7D F;  3QBY A;  1PRM C;  4LDV A;  1IXD A;  3BW1 A;  1D1B A;  2KRM A;  2LCS A;  3G4S T;  1WHG A;  5HQ0 B;  4XTY A;  2D0Q B;  3BG3 A;  2JM8 A;  2CP6 A;  1FIN B;  3NDQ A;  1BU1 A;  4M77 G;  2MWP A;  1U1S A;  4OMQ A;  2DD4 B;  1DJ7 B;  2CZ7 B;  3VKH A;  4J7I A;  5LJ3 j;  2V8J A;  5LJ5 f;  3OBW A;  4F7U A;  4YOZ A;  4J9B A;  1CKB A;  3CCJ Q;  3CCE A;  1SF9 A;  2CP2 A;  1KD1 R;  2YUP A;  4PJO C;  4LXC A;  2QXF A;  2M9U A;  2RHI A;  1HYO A;  1VQ4 A;  5FWC A;  1KQS S;  2DL8 A;  3CCQ A;  4JJB A;  1RL2 A;  1O9K A;  1LJO A;  2IG0 A;  4XQ3 A;  1YIJ Q;  4HT9 A;  3MKD A;  3TSW A;  3HRU A;  2M0O A;  5KYU A;  3VYG B;  2KYB A;  4LOC A;  1RAC B;  2CUB A;  4F6W B;  1B34 A;  1M2V B;  2PMI B;  1ZUK A;  2R5M A;  3DDQ B;  2KNB B;  2ZPB B;  5J3B A;  3V7S A;  1M1K U;  2YUO A;  4CFM B;  5EG2 A;  1MGQ A;  1N27 A;  1GBR A;  4PLL A;  4MDW A;  2DF6 A;  2L5Q A;  4QQ6 A;  1H4L D;  3TEE A;  1K9A A;  2LCL A;  1WLP B;  3BFM A;  5I11 A;  1I07 A;  4GY5 A;  4FYV B;  4BY6 C;  3JB9 D;  1OV3 A;  2CUD A;  1W1F A;  4CXA B;  3CBP A;  4RUG A;  3E1S A;  4BCQ B;  4BE2 A;  1W2B S;  2UZB B;  2K79 A;  2X4Y A;  4M78 D;  2P0P A;  4HVW A;  5AT1 B;  3DOG B;  2DIL A;  2FPF A;  2PUO B;  1NPP A;  1E9H B;  4QVD A;  5LQF B;  4LUE A;  4BDZ A;  2W99 A;  1H3H A;  3V8J A;  2JMA A;  2K6D A;  4LDX A;  4FT4 A;  1M90 C;  4F7U B;  2AZV A;  2BS2 A;  5LMK B;  3EFS A;  1JJ2 A;  5HNB B;  5KYN A;  3LYI A;  3CC7 T;  1WPY A;  1QW1 A;  4BAC A;  2KAF A;  4BI4 A;  2EBP A;  2ZPI B;  3E9G A;  1GXI E;  3A8G B;  3X20 B;  3CXC P;  3NPF A;  2HL3 A;  1TUC A;  3UDC A;  1O9K B;  3FEO A;  2VXF A;  3JCM V;  1RLQ C;  4B9W A;  5L23 A;  4C92 D;  1FYN A;  1K73 C;  1JO8 A;  2EKH A;  4TVR A;  4BI3 A;  1EFN A;  1YFN A;  5KYU B;  2IW6 B;  1X69 A;  3JAM E;  2DO3 A;  2C5X B;  3BLQ B;  1B34 B;  4F17 A;  4Z89 A;  3JB9 G;  2MK5 A;  1R77 A;  1G3N C;  2RO0 A;  1UUE A;  3GIB A;  4RCB A;  5GMK i;  1VQO A;  1M2O A;  3DB3 A;  5GAN 2;  2DTO A;  4M78 G;  3ZL7 C;  4J9E A;  2BIV A;  2CS7 A;  1JXO A;  4WTO B;  3BY7 A;  2XDP A;  2RI2 A;  1X2Q A;  2NUP A;  4XTU A;  1B3Q A;  3INZ A;  1OKV B;  4GLK A;  4B6M A;  1RAH B;  2CJM B;  2HD0 A;  3FB9 A;  3EG0 A;  1UGQ B;  4C5E A;  1OUL A;  4NOY A;  2EFI A;  4N0A A;  3OYB A;  5DM7 R;  4M75 C;  2KYM A;  1H25 B;  1KD1 U;  5LJ3 e;  2EQU A;  1GUX A;  1M1F A;  2QGG A;  2C4G B;  4C8Q E;  5GAN j;  4N4H A;  3CCE Q;  3SFM A;  1WHK A;  4M77 F;  4BCM B;  2GCX A;  2F2X A;  2XDD A;  3IQL A;  1HD3 A;  2DXC A;  2H3E B;  3M59 A;  1VQ4 Q;  2DRK A;  3QYB A;  2RJE A;  5CVI A;  4C92 G;  4BCO B;  3VS4 A;  1WX6 A;  1Q81 C;  5KCO A;  3VS5 A;  2BKD N;  4KUD K;  2C5O B;  4J8O A;  2PHG A;  5FRO A;  4FW1 A;  3FDR A;  1BIA A;  2PVG B;  1UG1 A;  1QCO A;  5LJ5 h;  1W6X A;  3PVQ A;  1PRL C;  4E6R A;  4BCG B;  4BI8 B;  1VQ6 Q;  2ZPH B;  2EIF A;  1IGQ A;  1YCY A;  1KSW A;  1VQM A;  1YNZ A;  2R57 A;  3G71 T;  3FC3 A;  2XK0 A;  5CIU A;  2YT6 A;  2NUP B;  4II5 B;  3CC2 A;  2WMB B;  2C0O A;  2Y4Y A;  1JOW A;  5CO7 A;  2BS3 A;  1RAG B;  3CQT A;  3OYE A;  3TCJ A;  4FX3 B;  5FU7 B;  1M4Z A;  1S72 A;  3HB9 A;  1ZBX A;  4F16 A;  4NS5 A;  1O75 A;  4AFS C;  3M57 A;  2L3Q A;  3EFR A;  5HBJ B;  2CSQ A;  1GUX B;  1JJ2 S;  2EYW A;  1AZG B;  2ECZ A;  2JW4 A;  4EOK B;  1SRM A;  5GAO l;  3I55 A;  2QTV A;  1VQ7 T;  1PSF A;  1M3B A;  4M7A E;  2DXC B;  1AZE A;  2V1R A;  4JS4 A;  3MEW A;  1HK9 A;  4PJJ A;  1K4U S;  1WHH A;  2GGR A;  2WSF E;  3UWN A;  3GNF B;  2JGZ B;  4F04 B;  2JMC A;  5AYF A;  1OL1 B;  4EOJ B;  3QYH B;  3UAT A;  1UNL D;  4AKG A;  2LRQ A;  2X1N B;  1KXU A;  3V8K A;  4O5V A;  4MML A;  3PMI A;  2E10 A;  1Y0M A;  3NHN A;  5GAO n;  4DQ2 A;  1VQO Q;  4C5G A;  4PFO A;  3RBB B;  2CYZ B;  1K76 A;  2YSQ A;  4V2S A;  2LVM A;  3LX7 A;  3NMZ C;  4M75 D;  2H3J A;  1VQK A;  1RAF B;  2JN0 A;  3QWX X;  3BHV B;  1OOT A;  1QKX A;  2PVO B;  2G77 A; 
#chains in the Genus database with same CATH homology
 3JCM h;  2QF7 A;  4KUL A;  5J26 A;  4C8Q D;  3HKS A;  4M78 F;  4RMO A;  3OY9 A;  2RI5 A;  3I56 T;  1VQ8 T;  3WVE B;  4C0F A;  3BG9 A;  1IZ6 A;  4OVA A;  4ZGD B;  2EYQ A;  2QI2 A;  3M9Q A;  2G3R A;  4F7U G;  4E7H A;  4PJO D;  4M7A A;  3G6E A;  1QP2 A;  4LDW A;  1YHQ T;  1UEB A;  3GP8 A;  4BB7 A;  1YJ9 T;  3GLX A;  4M78 A;  4MZM A;  1MHN A;  3KXT A;  3MP1 A;  2VXE A;  3LH0 A;  2RJC A;  1JB0 E;  2VGM A;  1VIF A;  5C0M A;  2OTL T;  5CKF A;  2GQV A;  5KE2 A;  3H4C A;  5GAM g;  3KUF A;  4OMF B;  4D6W A;  3OS1 A;  2DIG A;  2DXB A;  2M16 A;  2RK2 A;  1VQP T;  5GAN e;  4OB2 B;  3MCA B;  4YTL A;  3RES A;  5A0G A;  3PIP A;  3G4S A;  2EJF A;  4JRK A;  2E64 A;  3P8D A;  2LNV A;  3CCU T;  3GF5 A;  4JDS A;  2E6Z A;  3BDL A;  3HSB A;  5LJ5 d;  1Q7Y U;  3LWH A;  2FHD A;  3JB9 I;  4E7K A;  2A3L A;  2HQX A;  3S3O A;  4ZTF A;  3ZBD A;  5DLQ E;  4FU6 A;  3X25 B;  3SD4 A;  2PUK B;  4QQG A;  2O4X B;  4JX6 A;  2HNI A;  2RHU A;  3A8H B;  3QKJ A;  5IN1 A;  5KCH A;  3HP9 A;  3A8O B;  3UPU A;  1QVF S;  3CCJ A;  4LDY A;  3M56 A;  1M8V A;  3CC4 T;  4XU0 A;  1FWZ A;  2X35 A;  4J5Y A;  1BI2 A;  2EQJ A;  5FU6 B;  3CCL T;  2OTJ T;  4XTV A;  4HA8 A;  3JCM g;  1Q82 U;  1OYX A;  3WVD B;  1VQM T;  2KY9 A;  4MDX A;  2EQK A;  1NE8 A;  2C06 A;  3ME9 A;  3CPF A;  3UT1 A;  3C4S A;  2FVU A;  3O8V A;  4C92 A;  3OYH A;  4M75 G;  3PFS A;  2LQ8 A;  5CKE A;  5LJ5 e;  1YIJ A;  2ZZD A;  3A8M B;  1ZHI A;  3HHT B;  4EPC A;  4E7L A;  5FU6 C;  1M9S A;  3MP8 A;  3A5Z B;  3QYG B;  3OS0 A;  3TW6 A;  1AHJ B;  4C8Q G;  3CMA A;  1KHI A;  1KHC A;  5DY9 A;  3CC2 T;  3QHS A;  4R56 A;  3CCV A;  4MFD A;  4PJO G;  2XD0 A;  4A4G A;  2R5A A;  2QA4 A;  3PT9 A;  4CRI A;  2XHC A;  4MMK A;  5GMK e;  5A0D A;  4WF2 A;  4IUQ A;  4HNU A;  4DOW A;  1D3B B;  1VQ9 T;  5GAN 3;  1VQ6 A;  5IAY A;  1S72 T;  2QFZ A;  4IUV A;  5GAN 4;  2B8A A;  2CGH A;  5I2M A;  2QEX A;  3OYJ A;  2AHJ B;  1UB4 A;  3PTA A;  3G7Z A;  3GOX A;  2EAY A;  4KBM B;  2DIQ A;  2VV5 A;  3X28 B;  1NZ9 A;  1KQ1 A;  1U1T A;  2XU8 A;  4UC4 A;  3I55 T;  2DD4 A;  3JCM W;  1YJW A;  1HXD A;  3QII A;  4EMG A;  5HY6 A;  4ELZ C;  4M78 B;  2E5Q A;  5GMK l;  2DKG A;  3DLL A;  1I5L A;  3OYC A;  1W2B A;  2D6F A;  3HPW A;  2VGN A;  4LD9 K;  1VUB A;  2ZCF B;  2EJG A;  1NPR A;  2ZPF B;  1I81 A;  2DXB B;  2E70 A;  3M55 A;  3Q1J A;  5GAM d;  5CKD A;  4Z02 A;  4L5G A;  3CBM A;  3CPW A;  2F5K A;  3OYA A;  5IT9 E;  3BDU A;  2MF2 A;  2RJD A;  2DJZ A;  2HBP A;  5A0L A;  3L2Z A;  4M7D E;  3GNG A;  3M4G A;  3RKX A;  3E19 A;  4M77 D;  4P5N A;  3L2Q A;  4M7D C;  2LX9 A;  3HFN A;  2FB7 A;  1SSF A;  2L8D A;  3A8L B;  1WJR A;  5GAN 6;  2QQA A;  4IUT A;  3HFO A;  4BD3 A;  2DVE A;  4LD6 A;  3PNW C;  4KUI A;  3C95 A;  4HKE A;  3J81 E;  5I21 A;  4C0D C;  3T9N A;  2KMT A;  3OMG A;  3RUX A;  1UGS B;  4JRQ A;  5FRN A;  4BE0 A;  3J7A F;  2MMP A;  4A4E A;  1BI0 A;  3OSS C;  5A2Q E;  3CCS A;  3FJP A;  4OGC A;  1E7P A;  3SDZ A;  1H64 1;  4J6X A;  4F7U E;  3VYG A;  4Q5W A;  2XKO C;  3FRN A;  5GAM e;  3JCM d;  4E7I A;  2QTX A;  1VQK T;  3CC7 A;  2DZ9 A;  3QO3 A;  3PGG A;  4C92 B;  1O9S A;  1KC8 U;  2ZZD B;  1OI1 A;  2QQ8 A;  3HRT A;  3M58 A;  4E7J A;  3CD6 T;  2K3X A;  2KQW A;  2JUF A;  5J39 A;  5HKC A;  5GAN f;  1M1G A;  4AKH A;  2O01 E;  1VQL T;  4HT8 A;  2RK1 A;  4AKI A;  2FL7 A;  2QQ9 A;  4MZT A;  1JRI A;  5CK9 A;  1R8O B;  3URG A;  5CKB A;  4Y91 A;  4C92 E;  4C92 C;  2KVQ G;  1G3S A;  4M7A G;  4M7D F;  3QBY A;  5CKH A;  4O6J A;  2YHT A;  4LDV A;  4RG2 A;  3BW1 A;  5LL6 S;  4OF1 A;  3VUB A;  2E1H A;  2VC8 A;  4FM4 B;  3JCM e;  5CQX A;  3G4S T;  1WJQ A;  1QLB A;  2DTI A;  4XTY A;  2D0Q B;  3BG3 A;  4M7D A;  4C5I A;  3OYY A;  4B9X A;  4Y28 E;  3RMS A;  3PIO A;  1X6O A;  1N9R A;  3QDR B;  3SB2 A;  1M1K C;  3VKG A;  1EIF A;  5GAN 5;  4JLG A;  4M77 G;  2MWP A;  1U1S A;  3TU4 K;  4F7U F;  2DD4 B;  3N5B B;  1DJ7 B;  1WQ7 A;  2CZ7 B;  3VKH A;  4J7I A;  5LJ3 h;  2RA2 A;  5LJ3 j;  2V8J A;  3F70 A;  5LJ5 f;  3CCJ T;  3OBW A;  3DB4 A;  1VQ5 A;  4IKF A;  5D6Y A;  4NL2 A;  3AHU A;  4F7U A;  3TRE A;  4JRP A;  3DL1 A;  4HLQ A;  3V7R A;  3I56 A;  4RCC A;  1VQ8 A;  3CCE A;  3MEV A;  4XAX B;  4C0G A;  2RB6 A;  2LTO A;  1QVG A;  2RHX A;  3MO8 A;  2E6N A;  2XDB A;  2JVV A;  4C92 F;  4PJO C;  4PJO E;  2K5F A;  4ZN3 A;  1YIJ T;  1YJ9 A;  2QXF A;  2M9U A;  2RHI A;  3R6O A;  1VQ4 A;  1UGP B;  1KQS S;  3JCM c;  3CCQ A;  3ER0 A;  3QJ6 A;  2OTL A;  4BDY A;  1YIT A;  1RL2 A;  1Y71 A;  1LJO A;  2IG0 A;  3CMA T;  4XQ3 A;  1VQP A;  4ATO A;  3CCV T;  4HT9 A;  3CCR A;  1KQ2 A;  4R55 A;  3CCU A;  1QVP A;  2QA4 T;  1YI2 A;  3X26 B;  3HRU A;  4EDU A;  1BI1 A;  2M0O A;  4VUB A;  3VYG B;  3LWI A;  1QVF A;  4IUP A;  4OB1 B;  2XI9 A;  4LOC A;  2DAQ A;  3VYH B;  1B34 A;  2KSS A;  2I2L A;  4OGE A;  3SWN A;  3OQ5 A;  4BUG A;  1VQ6 T;  2R5M A;  3V7S A;  2ZPB B;  2DK3 A;  2K2V A;  4XU2 A;  1G3W A;  3KBG A;  4XTW A;  5J3B A;  1M1K U;  5LJ3 g;  2QEX T;  4II1 A;  5EG2 A;  1M5Q 1;  1MGQ A;  4BY6 B;  3OYF A;  1YJN T;  1N27 A;  4EMH A;  3JCM b;  4JJN K;  3JB9 J;  3CC4 A;  4PLL A;  3OW2 S;  4L6V 5;  4MDW A;  5GAO q;  2L5Q A;  3DKM A;  4QQ6 A;  1Y96 A;  2LQK A;  2DZC A;  4M75 A;  4QVZ A;  3QWL A;  3TEE A;  2LCL A;  4N4G A;  3NTK A;  3BFM A;  4NC6 A;  1Q86 C;  4PJO F;  3OYG A;  1UGR B;  4GY5 A;  1QP3 A;  1OZ3 A;  2WSE E;  3RIR A;  3OYM A;  4BY6 C;  4NL3 A;  3JB9 D;  4MFE A;  5GMK m;  2XIC A;  4C8Q A;  3ZEH A;  4PKC C;  1PSE A;  2K57 A;  4M7A D;  3CBP A;  5GAN 8;  3E1S A;  2XG8 D;  4BE2 A;  4BBS M;  4A53 A;  1W2B S;  4M7D B;  4PJO A;  1YBY A;  1Y7X A;  2X4Y A;  3DLM A;  4HNT A;  2P0P A;  4M78 D;  3G71 A;  3FIF A;  2WJ9 A;  4MZP A;  2PUO B;  4XU1 A;  1BYM A;  1NPP A;  3L2R A;  4QW2 A;  1N6A A;  4QVD A;  2DXT A;  3J80 E;  5GAM f;  2CKK A;  1V29 B;  2WSC E;  3CPW S;  2QDY B;  3X24 B;  4C0D B;  4BDZ A;  2X4X A;  3V8J A;  2IVW A;  2Y90 A;  4LDX A;  3KHI A;  4X9D A;  4FT4 A;  1M90 C;  3CME A;  1N8R C;  1X75 C;  3VU3 C;  2V8I A;  4FSX A;  3JB9 H;  4F7U B;  4JLI A;  4J7F A;  3VUZ A;  2BS2 A;  3CEY A;  5FLX E;  3EFS A;  1JJ2 A;  2BUD A;  2KMG A;  3LYI A;  2EKO A;  3BG5 A;  3CC7 T;  1WPY A;  1QW1 A;  4N0A C;  5GAO p;  2KK4 A;  4XU3 A;  2KAF A;  4BI4 A;  4BAC A;  2ZPI B;  3E9G A;  2MI6 A;  1GXI E;  3CBO A;  3A8G B;  3X20 B;  1P92 A;  1XOV A;  3PMT A;  2ZGW A;  2M1H A;  3JCM f;  3CXC S;  1G3Y A;  3UDC A;  1KD1 C;  1Q86 U;  2V8K A;  3FEO A;  2VXF A;  4ELJ A;  3JCM V;  3JCM Q;  2JNG A;  4JX5 A;  3OS5 A;  3L2V A;  4B9W A;  4C5H A;  3VKI A;  1VQ7 A;  4EMK A;  4C92 D;  1K73 C;  1BKB A;  3CCM A;  4TVR A;  2WAC A;  4BI3 A;  4ZGE B;  2XID A;  2X4J A;  2OAU A;  3G6E T;  1RI0 A;  2F69 A;  2DO3 A;  2VYT A;  3H8Z A;  4M77 C;  4M77 E;  3JAM E;  1B34 B;  3OYL A;  3JB9 G;  3SWN B;  1WNL A;  2LT4 A;  2PU9 B;  3OA6 A;  3RER A;  3QZ9 B;  2QQB A;  1LOJ A;  3QYE A;  2LDM A;  2QDJ A;  2MWO A;  5EJC A;  2RO0 A;  1VQN A;  3GIB A;  4RCB A;  5GMK i;  2YLB A;  5LJ3 d;  1VQO A;  2E12 A;  3DB3 A;  2DTO A;  4M78 G;  4E47 A;  5GAN 2;  1U8R A;  2BIV A;  1M90 U;  2CZ1 B;  4ZGJ B;  5D6X A;  3WXM B;  2CS7 A;  1Y96 B;  2JTF A;  5C6S A;  3BY7 A;  4CI0 C;  2XDP A;  2EWN A;  2RI2 A;  2RM4 A;  4M75 B;  2QQR A;  4XTU A;  1JBM A;  3SWN C;  4BE1 A;  2LCC A;  3INZ A;  3QXE B;  2R58 A;  5D6W A;  2E65 A;  4GLK A;  2JZ2 A;  3ZFJ A;  1G3T A;  1H3Z A;  1VQ5 T;  3JB9 F;  2HD0 A;  1Q82 C;  3FB9 A;  2BS4 A;  4C8Q B;  1UGQ B;  4C5E A;  3L42 A;  2NLU A;  2A7Y A;  4NOY A;  5I2S A;  2HAX A;  2EFI A;  4PJO B;  1TH7 A;  4N0A A;  3CCE T;  3OYN A;  3QG1 A;  3OYB A;  4M75 E;  1VQL A;  2RD1 A;  4M75 C;  5DM7 R;  4OP0 A;  1KD1 U;  5LJ3 e;  2LT1 A;  2CZ0 B;  5GAN h;  3RMQ A;  2EQU A;  3LW5 E;  4C0Z A;  1M1F A;  5GAN j;  3M54 A;  2DTH A;  4C8Q E;  1VQ4 T;  4C8Q C;  3V7C A;  4N4H A;  3SFM A;  3CCQ T;  1K73 U;  4QQD A;  4M77 F;  1YIT T;  1QVG S;  2QQS A;  3MHX A;  3E9F A;  2GCX A;  3FLG A;  1YHQ A;  2XDD A;  3M4Y A;  1NJI C;  1XQH A;  2DD5 A;  4A4F A;  2DXC A;  2GF7 A;  2GFU A;  3C94 A;  3M59 A;  3CCR T;  4ZTJ A;  2DEQ A;  3JCM X;  3QYB A;  2RJE A;  4M77 A;  5CVI A;  4C92 G;  3OYK A;  1YI2 T;  2PVD B;  2EQM A;  2P0Q A;  5FRM A;  3OS2 A;  1Q81 C;  5KCO A;  3JCM J;  1I4K 1;  2BKD N;  2D9T A;  4JRI A;  4KUD K;  4FT2 A;  1K8A C;  2GFA A;  4J8O A;  1FKM A;  3OYD A;  1KG1 A;  4J83 A;  5FRO A;  4A4H A;  3QPH A;  1NJI U;  2KR6 A;  3OYI A;  5GAO r;  4OB3 B;  3FDR A;  3QJY A;  3V8L A;  4X9C A;  1BIA A;  1X01 A;  3HRS A;  2PVG B;  2JOY A;  2YLC A;  3M5A A;  3MEU A;  3P8H A;  5LJ5 h;  2RHY A;  1I8F A;  4EMK B;  5LJ5 j;  2E41 A;  2HQE A;  1W4S A;  2P0K A;  4XK8 E;  4L59 A;  4M75 F;  4HCC A;  3OB9 A;  1KQS A;  3LLR A;  1K9M C;  2RH2 A;  3C12 A;  3QUI A;  4BI8 B;  2OTJ A;  3CCL A;  2ZPH B;  3NFC A;  3RKY A;  4A4K A;  4A54 A;  3NTI A;  4C8Q F;  5GAN g;  2EIF A;  1YJW T;  1YCY A;  3S3M A;  1VQM A;  4PL6 A;  4J6Y A;  2RI3 A;  2ZPG B;  5GMK h;  2VUB A;  4EMK C;  3VV0 A;  2R57 A;  3M53 A;  5GMK j;  2FYK A;  3G71 T;  1G5V A;  4HCB A;  4HL4 A;  5CAI A;  3FC3 A;  3JSC A;  4J6W A;  2XK0 A;  3OMC A;  3LGL A;  5CIU A;  4N4I A;  2K3Y A;  4M7D D;  1N9S A;  2L89 A;  4BBR M;  2L3R A;  3CC2 A;  3QZ5 B;  3P8B B;  2Y4Y A;  3CME T;  2KDS A;  1XTD A;  2K4Y A;  2BS3 A;  2DPP B;  2LC4 A;  4HCZ A;  4KT0 E;  5CO7 A;  3OW2 A;  1Q81 U;  3EAE A;  4PNO A;  3VJP A;  1XNI A;  3OYE A;  1YJN A;  3GPL A;  1IRE B;  3HZJ A;  1LNX A;  4LDU A;  3TCJ A;  4XTZ A;  3RKW A;  4ME7 A;  2JTM A;  1K8A U;  4X34 A;  1VQ9 A;  5FU7 B;  4QVC A;  1BI3 A;  1KC8 C;  4FL6 A;  1M4Z A;  5KE3 A;  3HB9 A;  1ZBX A;  4M7A B;  1S72 A;  4NS5 A;  1O75 A;  5LJ5 g;  3M57 A;  3CCS T;  3EFR A;  2CZ6 B;  1VIE A;  4XTX A;  5GAO m;  1JJ2 S;  5HK0 A;  4JS5 A;  1FX7 A;  2RJF A;  4OB0 B;  3MET A;  1WQW A;  4RG8 A;  3MP6 A;  5GAO l;  3I55 A;  1K9M U;  1FXX A;  3HL8 A;  3S6W A;  2O4X A;  1VQ7 T;  5FU7 C;  2DD5 B;  1PSF A;  3S3N A;  4M7A E;  2DXC B;  2K5I A;  4M7A C;  3JCM P;  2YRV A;  5M9O A;  4JS4 A;  1Y07 A;  3CCM T;  3MEA A;  2PQW A;  3MEW A;  4M77 B;  4M78 E;  4ELY C;  4ZN1 A;  4M78 C;  3L2U A;  3H6Z A;  2F5T X;  1HK9 A;  2ZPE B;  2WSF E;  1OZ2 A;  3HBL A;  3GNF B;  3OBY A;  4AI6 A;  3UWN A;  5AYF A;  2K5L A;  3LGF A;  4IUR A;  4DOV A;  3QYH B;  3NTH A;  1VQN T;  2DXU A;  5KH6 A;  2EJ9 A;  4AKG A;  4JUV A;  1WJS A;  1VQO T;  2MAM A;  5GAM h;  2LRQ A;  5GAM j;  4MIM A;  4Z6Y A;  2RHZ A;  1ZQ1 A;  1Q7Y C;  3OSV A;  3V8K A;  4O5V A;  4MML A;  3PMI A;  2E10 A;  4IUU A;  5CCA A;  5GAO n;  4PLI A;  2Y4X A;  3HO8 A;  4DQ2 A;  4C5G A;  4RKU E;  2X4W A;  5LJ3 f;  1N8R U;  4M7D G;  3CXC A;  1WGS A;  4FIB A;  2CYZ B;  4M6V A;  3L1A A;  3ASK A;  5DLO A;  4V2S A;  4HNV A;  5CR2 A;  4QSH A;  2LVM A;  4JX4 A;  3LX7 A;  5CQY A;  5HK3 A;  5GAN d;  5GAN 7;  4M75 D;  2H3J A;  1D3B A;  5L8R E;  3JRZ A;  1VQK A;  2JN0 A;  3QSU A;  2PVO B;  3TW7 A;  3L2W A;  4DA4 A;  2G77 A;  2P4T A;  4M7A F;  3CD6 A;  1BIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...