1AHJB

Nitrile hydratase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords NITRILE HYDRATASE (SUBUNIT ALPHA)
publication title Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold.
pubmed doi rcsb
total genus 53
structure length 212
sequence length 212
chains with identical sequence D, F, H
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ahjB02
3QZ9B 3HHTB 2ZPFB 3A8MB 3X20B 4XK8E 5L8RE 3A8GB 4RKUE 4ZGDB 2DD4B 2PUKB 3VYGA 1DJ7B 4Y28E 2CYZB 3LW5E 2DXBA 2CZ6B 4OB0B 2AHJB 2ZPIB 3WVDB 2DD5B 3X24B 2WSFE 3X26B 3QYGB 1UGQB 2ZPHB 2DD4A 2WSCE 3A8HB 4FM4B 2PU9B 1UGPB 1PSFA 4OB1B 3A8LB 2DXCB 2ZPEB 1UGRB 2DD5A 2CZ7B 2ZPBB 3X28B 2ZCFB 1JB0E 1QP3A 2O01E 3QYHB 2ZZDB 3VYGB 4L6V5 3X25B 2PVOB 3QXEB 2WSEE 2PVDB 2DXCA 3QZ5B 2D0QB 1IREB 3WVEB 1V29B 2CZ1B 1AHJB 3VYHB 2PUOB 2CZ0B 2PVGB 2ZZDA 3A8OB 4ZGJB 4KT0E 1PSEA 2QDYB 4ZGEB 1UGSB 1GXIE 2ZPGB 2DPPB 4OB2B 4OB3B 2DXBB 1QP2A
chains in the Genus database with same CATH superfamily
2E12A 2ZPFB 2DYBA 1VQ5A 2DKGA 4JUVA 4EOKB 2FYKA 2XD0A 4DEXA 2LDMA 4RKUE 2I53A 2RQRA 4PJOG 4A4KA 1Q86U 4BI4A 1QWFA 2VVKA 4KGXB 4CFUD 3CEYA 2QA4T 2PJQA 2W96A 4RCBA 5GAMf 2DEQA 4M78E 1Q86R 1KIKA 4FW1A 2AHJB 1ZP2A 4LNPA 3VUZA 3CC2Q 2OTLT 1M1FA 3POMA 2GBQA 3X24B 4IURA 4M77D 1PRMC 3LH5A 1V76A 5A0LA 4CFVB 4CFXB 3EG0A 2F5KA 2QK0A 1JJ2P 4KGZB 4PJLA 1BCMA 4LDYA 2SRCA 2VC8A 3P8HA 4BCND 1BB9A 1D3BA 5IHYA 2RI3A 4DQ2A 3TW6A 3A8LB 1NYFA 2ZPEB 2QDJA 1N27A 3CPFA 2ECZA 3V8KA 1M5Q1 3E9GA 2ZCFB 4BY7X 4TTHA 1ZHIA 4OMMA 1OZ3A 1BYMA 3OYKA 2HNIA 2CP7A 3LQ5B 2C5OB 1H1RB 3CC2T 4FL6A 3X25B 2ZGWA 3OMCA 3QXEB 3G71Q 1W98B 1MMAA 1S72A 4NL3A 2F2WA 3CPWP 2RJFA 5M9OA 1GBQA 1RL2A 3HRTA 4IIOA 2OAUA 2X51A 4AT1B 3RESA 4J83A 1FYNA 1AEYA 2ED0A 4FCYA 5GMKj 3VS4A 1QLBA 1CKBA 2PTKA 1GH6B 4J9HA 3JB9D 3MHXA 3C94A 2EAYA 2VASA 4C8QE 4K11A 2KRNA 4PJMA 5LJ3j 4F70B 3QDFA 1HD3A 2O88A 2LP5A 2NUPB 5HK0A 4MZMA 3S3NA 1QVFA 1WHMA 4M75E 1VQ8Q 1GCQC 1JQQA 1F1BB 5IH2A 4BCIB 1IO6A 2BS2A 3G71T 1B34A 3J80E 2OTJQ 4AKIA 1JEGA 4F7UB 2BIVA 3QYEA 2EWNA 2I0NA 5KE2A 4BY6C 1T0HA 5LQFB 3KUFA 5LJ3g 4BDZA 1QCOA 2BZYA 5D6WA 1R0BG 4MZPA 5KYUA 3BW1A 5GAMh 3CMEA 3RIRA 3EG1A 2CREA 4MFEA 1I5OB 2MAMA 3PMIA 5FLXE 2F2VA 1Y0MA 2EGAA 2M0YA 2DD4A 1AD5A 4IUPA 5GANe 4Y72B 2HL5C 5HK3A 2G3RA 2P0KA 4J6YA 1RI0A 1URCB 3QHWB 1WYXA 1AISB 2YT6A 3RERA 3MEVA 2QQRA 2QEXQ 1YHQT 3G7ZA 2GQIA 2QQAA 1KXUA 3PFSA 1OKVB 3C4SA 1Q81U 1ABQA 3BG3A 2MPXC 2L3SA 5IAYA 2J6OA 3VS2A 4II5B 3DLLA 2RK1A 1OPKA 1WHJA 1EZZB 4OGCA 1TFBA 3MKDA 3RDVA 3QYBA 3NFCA 4C0FA 5I2MA 3CMAQ 1Q81R 3DTOA 3BDUA 4HCBA 1K73U 1RACB 2DVJA 1J3TA 3JB9J 1SPKA 4E7ZA 1VUBA 2YRVA 5GJVB 4BDYA 4HNVA 4PLLA 2DIQA 3WVEB 5A0DA 2DA9A 2FPDA 3OSVA 1V29B 1RLPC 5CKHA 1AHJB 1QKXA 1K73R 2PZ1A 2RF0A 4RTTA 3INZA 2M9UA 2XMFA 4A4FA 1RABB 1FVVB 1OKWB 2X1NB 1WZOA 2QEXT 1TWBA 4OB3B 2UUEB 3QG1A 3UF4A 2L3PA 4QVZA 5I5ZB 5IHKA 2P84A 3E1SA 3RMQA 3EG2A 4IUQA 3U23A 4CRIA 3BFMA 2DL7A 1Y07A 3CMAT 4B9XA 5FU6B 4V2SA 3DKMA 3EFOA 4NOYA 4BCPB 4M78F 3LH0A 2FRYA 2HKQB 3M58A 4JX4A 1D3BB 1IZ6A 2CSIA 2CYZB 2IVXA 3FRNA 3LW5E 1VQOA 1WXTA 3I55A 1JSUB 4C0GA 5GAOq 4JS5A 2VGMA 4XQ3A 1BU1A 2EQIA 3I9QA 3VS5A 2JMAA 1ZSGA 3QIIA 3A8HB 3AT1B 3PIOA 1VQ4A 4EMHA 5LL6S 1WFWA 3D7SB 2DL8A 3V8JA 1ARKA 2K5IA 2FVUA 5FRNA 1YIJQ 2CT3A 3RKXA 2DJQA 2HBPA 3CQTA 4E7KA 2QTVA 3EFRA 5C6SA 3V8LA 3QJYA 2RHUA 3MP8A 2XDDA 2E4HA 5D6YA 2YLBA 2EKHA 4VUBA 3TSWA 1Q7YU 1C6VX 4LUDA 2JJ9A 1IHWA 1NM7A 4EMGA 1VQ9Q 3NTIA 3CC4A 2PK9B 1Y96A 3OYMA 3CBMA 1G3TA 3UDCA 1Q7YR 2EJFA 3M55A 2HQXA 2CGHA 1G2BA 1U1TA 1YBYA 1B34B 3BLQB 4C8QF 1YIJT 1WXBA 4FT2A 1H1QB 4F6UB 2DX1A 3TVTA 1BIAA 1H92A 1O75A 4M75F 5KYUB 2FEIA 2O2OA 2B9RA 3MIAB 4BB7A 4PL6A 5IN1A 2KROA 4BBRM 4PFOA 2G9XB 2FL7A 1OV3A 2C0TA 1PRLC 4FW2A 2L5QA 1WA7A 2KEAA 4HCKA 2DD4B 3PE0A 2DLPA 2KRMA 2K2VA 1VQ9T 3CCSQ 1FXXA 4ANJA 1VQKA 1Y7XA 4PK4A 3NTKA 1N8RC 2QG9B 1QCFA 4F7JB 2DXBA 4C92A 5GMKi 1U8RA 7AT1B 3R6NA 4EOJB 3VS3A 1SG5A 4GLMA 2PNIA 3BDLA 2HZYA 1PKSA 4OMLA 1WI7A 2K2MA 3FLGA 5D7UA 2EQUA 2PU9B 2E3HA 3M0PA 2F2XA 2WACA 1SHGA 4C5EA 4E7LA 3QHSA 2W0ZA 1FKMA 3GOXA 2DILA 4C92G 3OS0A 2HQHA 2JOYA 5GMKl 1BU2A 3CCST 2LRQA 2LQWA 2MK5A 2EVRA 5DLQE 1IGQA 3M56A 5ECAA 2X35A 3CCVQ 4Z89A 3CCQQ 4N0AA 1WLPB 3HFOA 3HPWA 2W10A 3KBGA 3I5RA 1RUWA 6AT1B 2FG0A 1TUGB 1QVFP 2D0QB 2AKLA 2E64A 2E6NA 2RI5A 3URGA 3FJPA 4KRCB 4OF1A 1ABOA 3JCMd 5IXFA 2YRDA 3QHRB 4HVVA 2L89A 3TREA 2V22B 1UB4A 4LE9A 3EFOB 2YUNA 5FW9A 1VQ7Q 1FMKA 3PGGA 1QWEA 1M90U 4PKCC 3TCJA 2VB6A 1QMZB 3EOCB 3DOGB 1KHCA 5HBEB 3O0GD 3CCVT 4XK8E 4CXAB 3CCQT 1M90R 4OMQA 3A8GB 3SWNA 2QTXA 4BY1X 4J9BA 8ATCB 2UZEB 3JB9F 3M0SA 4JDSA 1I8FA 3V7RA 3CCLT 2LMJA 4XTWA 1I07A 5GAMj 4E7JA 1VQ6Q 2JTFA 3H6ZA 2CT4A 4Y28E 2EPDA 4ELJA 1KC8C 1GUXA 2JT4A 2WMAB 5KYXA 2DERA 2D0NA 2ZPIB 3CD6Q 3SD4A 4OMFB 3C95A 1MMGA 2RD1A 4KULA 4J5YA 1TOVA 4P5NA 1M8MA 2HL3A 4OMPA 1VQ7T 3F70A 1G3WA 4HXJA 2CH4W 2F5TX 2R57A 5GAMg 4HT8A 2EYQA 5EC7A 1IRXA 2LX9A 1VYTA 1MGQA 3UATA 3JCMf 1NPRA 2E70A 4DBFA 4EIKA 3CXCA 2NUPA 1NLPC 1Y96B 3UWNA 1AWWA 1MV3A 2MIOA 4ESRA 2WJ9A 2KT8A 3CXCS 1VQ6T 1UNGD 5FU7C 1OU8A 4JJDA 4F7UA 2MOXA 3CD6T 2LCSA 4MDWA 1N4MA 2HQEA 2KMTA 3ME9A 1WQWA 4MZTA 1X27A 5AT1B 3QBYA 4E47A 2VUBA 2W99A 1AVZC 1YFNA 5FU6C 2EGCA 2NUZA 3QDRB 2K4YA 3T9NA 2DO3A 2CS7A 4RTYA 1ENWA 1NLOC 2PVGB 2VXFA 5DQVA 5J39A 1Z9ZA 1AWXA 1ZUKA 1RADB 4X1VA 1PSEA 1VQ5Q 1WHGA 4M7AA 3QUIA 1JXMA 1PG5B 3CCMA 1VQNA 2MMPA 1KD1U 2DXBB 3MP1A 4C92B 1KHIA 2JTMA 4FYYB 1M3CA 2X3XD 1KD1R 4PJOA 2HKNA 3CBPA 1HK9A 1C1AA 2DTOA 2FB7A 1WQ7A 2DE0X 4BD3A 2OAWA 2RI2A 4M7AG 2EYWA 4E7IA 3TN8B 1Q82U 3HZJA 1RAEB 5GAN3 2LNVA 2HBWA 1F5QB 3MP6A 4QQ6A 4A63B 2P4RA 1Q82R 4PNOA 3LGLA 2BKZB 2WSCE 2HCKA 4N4IA 4M78G 4CC2A 1BBZA 4OB1B 4M77C 2NUTA 1K9MC 2PK2A 5GAOp 1TUCA 3CCJT 3S3MA 1UFFA 2ABLA 5LJ5d 3JCMc 3VYGB 4OR5B 1EX4A 4HVUA 2QA4A 4BCGB 1NJIU 4BUGA 1M3BA 3QWYA 1ZUYA 2DYIA 4XTZA 1OL1B 1G3NC 2OTLA 2LZ6B 3DDQB 1NJIR 3CC7A 2DRKA 1IREB 4F6WB 3PVLA 1H4LD 2WEVB 2LT4A 2ESWA 3SWNB 3M59A 2HEQA 5HQ0B 5LMKB 4Q5WA 4C8QA 1U1SA 2KY9A 1D1CA 2IVWA 1OX9A 3QPHA 3JCMb 4M7DA 3OYIA 5GAN4 5DM7R 1HYOA 2EKOA 1GBRA 1M3AA 1GUXB 2LTOA 4F7SB 3L1AA 4J6WA 5KYXB 3O5ZA 4IKFA 5C0MA 3V7SA 1PHTA 2LVMA 3VS1A 4OGEA 3E2UA 2W9FA 4OMOA 2PMIB 4KRTA 3PT9A 3MEWA 2LJ3A 1OI9B 1G3YA 1WHKA 3EFSA 3EHQA 2EFIA 1SKUB 2B8AA 1ZSZA 4IUTA 4C8QG 4ELLA 1UJ0A 4J8OA 2MCNA 3M53A 3R6OA 4GY5A 4M7DG 1VIFA 1YN8A 5HBJB 5LJ5f 3OS1A 4KRDB 2V8KA 2XHCA 2CCIB 2C5NB 3HKSA 1KQ2A 2JMCA 2JZ2A 2O4XA 1UGQB 2ZPHB 3JAME 4EOMB 2KYMA 3MJXA 2GFUA 3GIBA 1KQSP 4PFPA 5GMKe 1RAAB 1I5LA 2K6DA 3MEAA 4FIBA 2HD0A 3EIDB 5LJ3e 4LXCA 1VQPA 3K7AM 2LC4A 2XICA 5GAOl 1D1BA 2DL5A 2K79A 3M4YA 1QP3A 2YHTA 2K57A 1YJ9A 1TUDA 2Y90A 3H9NA 4XTUA 1Q86C 4M7AB 5CCAA 2A08A 1OYXA 1VQ8T 1JKWA 1WX6A 2DXCA 1P5EB 3L42A 3GPLA 2OTJT 4FSXA 3PVQA 1WXUA 3JB9H 3CCEA 1QMCA 3QWLA 2XDBA 3RGFB 3JCMP 2D8JA 1OIUB 2JGZB 2P0QA 1JOWA 4PJOB 4MIMA 2KXCA 2VKNA 2YUPA 4M77E 2J06A 3VKIA 4D8DA 2DXTA 2EBPA 4QT7A 2JXBA 3QO3A 1X75C 5GMKm 4LUEA 3TNIB 4F14A 2DPPB 3B57A 5EFQB 1W70A 2I2LA 1YHQA 1IB8A 1QP2A 2KK4A 2DMOA 3S6WA 3QWXX 4JLGA 1RAIB 5LJ3d 1G83A 2EIFA 2FPFA 4ELYC 3I55Q 1QVPA 2FHDA 5HVYB 2R5AA 2GGRA 1M27C 1PKDB 1LJOA 1GRIA 5IDNB 5CR2A 2G77A 1Z9QA 5GANd 2K3BA 2NUTB 2CZ6B 3PNWC 1RLQC 1VQ4Q 2IG0A 1JSTB 5LJ5h 1HXDA 2AZVA 3OYNA 5KE3A 3GLXA 4OMNA 1FMWA 9ATCB 1KG1A 1QKWA 5CKFA 1TD6A 4EORB 1M1KU 3L2ZA 2K3YA 3CBOA 1FWZA 2L3QA 5ICPB 1N9SA 4ZN3A 1UEBA 3M03A 4XTVA 1YITA 1PSFA 4JZ3A 3SEMA 2DM1A 3EAEA 1E7PA 4HNTA 1M1KR 3EG9A 2BKDN 2EUFA 1M2VA 1D0YA 1OX8A 2ZPBB 3TW7A 2O31A 1KQ1A 4WTOB 1H26B 3UA6A 2J05A 3OYDA 1HSQA 4JJBA 3SFMA 1PCXA 1W2BP 4C8QB 4DEYA 1YP5A 3CC4Q 2KVQG 4E7HA 4C92C 4M7DB 2CP2A 1VQ4T 4ZNXA 4QQDA 2V1RA 1VOMA 3VS6A 2IW9B 1LPLA 4JX5A 1RAGB 1YCYA 4C92D 3DB3A 1U06A 3PTAA 2RHYA 2K5FA 3GNFB 4RTUA 3V7CA 1SHFA 3THKA 1PC0A 5A2QE 5GANf 3F5XB 4IIMA 4A4EA 4LDUA 3VS7A 1ZSZB 1SSFA 3G33B 1AWOA 2J6KA 2AK5A 2ENMA 4FU6A 2L3RA 1YJNQ 1PD1A 2PQWA 1NBEB 2FPEA 3CC4T 4R55A 2O4XB 2RH2A 3C12A 1VQKQ 5L8RE 4Z6YA 4AKHA 2BZXA 1Q81C 2QQ9A 3EH1A 5KCOA 1R0CB 1K9AA 4E7SA 4HCCA 1PWTA 4A54A 1QCNA 3ZEHA 2DL3A 3QJ6A 1V1CA 1WJQA 1XO2A 3OYBA 2DL4A 3H0IA 2CP0A 3ULRB 3NGPA 5EJCA 1K73C 2KR6A 3HO8A 3TNHB 5D6XA 1O9KA 3JB9I 1WJRA 1E7OA 1H28B 1C0MA 1WGSA 2JUFA 1N9RA 4BXXX 1Y71A 1BIBA 1IGUA 1YIJA 2YLCA 5J26A 4YOOA 4BACA 1VIEA 1YJNT 3OS2A 2KMGA 2XIDA 4BCKB 3MCAB 1JJ2A 5HCKA 3H41A 3TSZA 1N5ZA 4EMKA 3I56Q 4EOPB 2DTIA 2RPNA 3TEEA 3GNGA 1BKBA 4DBQA 1VQKT 1XQHA 2DXCB 3P8DA 2EQJA 1JJ2S 4RTZA 3SWNC 2BS3A 4J9CA 2JVVA 3L2UA 3CCRA 5CIUA 2CSQA 5GAN2 1YJWA 1EFNA 5DLOA 3OYHA 2DZ9A 3FC3A 3BG9A 3QYHB 4ZTJA 5BNJB 1VQ9A 1AZGB 2LJ1A 3DB4A 2QQBA 2IN3A 2W2HA 3OSSC 3JCMg 2K5LA 2UZDB 1MNEA 2F2CA 4A4HA 2QXFA 2CP3A 2J6FA 3CPWA 4GLKA 2LQKA 1T3SA 1QW1A 4M77F 3DLMA 2WIPB 3CPWS 1ZUUA 3I56T 1MV0B 4DA4A 1WPYA 1MHNA 2AT1B 1I4K1 4X9CA 4XU3A 5GANh 3RR6A 2KDSA 1YI2Q 2YXYA 3M9QA 1UHCA 3DL1A 2YDLA 4OB2B 5KYNA 1OI1A 4F7NB 1T0JA 3I35A 3JCMQ 4MFDA 1ZQ1A 2IW8B 3OB9A 4C92E 1BCOA 3FDRA 2QGGA 2K7AA 1K8AU 1X6BA 5CYIB 1OQKA 4EPCA 2PUKB 2EYYA 5L23A 3E9FA 2QDLA 3HP9A 4FT4A 3VYGA 4J9FA 2BUDA 3RMSA 5IHNA 3GF5A 1K8AR 1Q7YC 3M57A 2D9TA 3EG9B 1PM3A 3PO3S 2WMBB 1JRIA 1M2VB 1WIEA 2COZA 1ZLMA 2FO0A 1YI2T 2GTJA 1M8VA 3PIPA 4M7AC 4C5HA 2DK3A 5CK9A 2FZKB 5L2WB 4BI8B 1UGPB 4OGRB 4F04B 3JCMJ 3BHTB 1N6AA 4M7AD 3JCMW 1JU5C 4HCZA 2CUDA 2EYXA 3ZBDA 3S3OA 2L2PA 4MMLA 1E6GA 4PJOC 3FJ5A 1T3LA 3VU3C 4JRIA 3OYLA 4PJJA 2G6FX 2EJGA 2MWOA 1CSKA 4PJOD 5CKEA 3CCLA 2I40B 3VS0A 1KSWA 1G3SA 1O9SA 3ZFJA 1KK7A 1E6HA 1A0NB 3BHUB 1VA7A 4IUUA 5GAMe 1WHLA 4BE0A 5HNBB 1BI3A 2DEUA 1VQ7A 3KFVA 2NLUA 1NEGA 1VQNQ 4JS4A 3CCUA 2ZZDA 2LX7A 1W1FA 1YWPA 2C0IA 3A8OB 3SDZA 4II1A 1QLYA 2LT1A 1TH7A 2IPOB 1KFZA 3EG3A 2KI7A 1O9KB 1I81A 2JS0A 1UTIA 1SEMA 2L0AA 2QI2A 4AFQC 1VQ6A 2RN8A 5IT9E 4BCJB 4EONB 3NPFA 3EGDA 4LOCA 2RHZA 2X4JA 3CD6A 1VQLA 3PMTA 4R0KA 2E6ZA 3NDQA 2FZGB 3SB2A 1QVGA 3TQ7P 4EMKB 1DJ7B 3EJ1B 1M9SA 5LJ5j 2C5XB 1VQNT 3JSCA 1QVGS 2GTOA 1M30A 2CKKA 2QFZA 2B86A 2ZAEA 4DOWA 3OY9A 2P0PA 1LNXA 2BE7D 2H8HA 4AKGA 2DXUA 4BI3A 1VQMA 4M7DC 3MO8A 4ROCA 2MWPA 1GCPA 1K1ZA 4C8QD 1P92A 1IHVA 3OS5A 3M0TA 4LD9K 3M0UA 4M7DD 4M78A 4F7UE 2YUOA 5LJ5g 3FEOA 3ASKA 3GTMS 1NYGA 3G6EA 1JBMA 2GCXA 1M90C 2QA4Q 5IHIA 1MUZA 2DD5A 2EW3A 2KSSA 4JJNK 1W6XA 2V8JA 1ZSZC 2UZBB 1H27B 4GBQA 2R5MA 1VQ5T 3DDPB 3G4SA 2JM8A 4D8KA 3CC7Q 2LCCA 5KYWA 2HAXA 4L6V5 3H8ZA 5GAN5 2PVOB 2KNBB 2RQWA 4BE2A 2RM4A 2DJZA 3RKWA 4EC9B 3HL8A 5FGKB 4M7AE 1NPPA 4TVRA 2M1HA 4RTWA 3JCMh 4HVWA 1MNDA 4HKEA 1VYWB 4E2FB 2J7IA 1S72Q 3O8VA 1PNJA 4RTXA 4AFUC 2EGEA 2PHGA 4JX6A 1VOLA 3OYAA 1Q95G 2QYZA 4BBSM 1UJYA 1UNHD 3A5ZB 4NL2A 4PJOE 1R77A 1PKTA 3E19A 1D0XA 1C9BA 4LN2A 4RG2A 2DZCA 4C92F 4ME7A 3TNWB 1Y57A 3I5SA 2A3LA 2RA2A 3CCJA 3CC7T 4D6WA 3A8MB 2YWWA 5HY6A 2FZCB 2DFUA 5IDPB 2DVEA 2BS4A 4HNUA 1R8OB 5GAN6 2IIMA 4B9WA 1M2OA 1PD0A 1ZX6A 1BK2A 2GF7A 3LWHA 2QQ8A 4NSTB 4C0ZA 3MY5B 5CEIB 1S72T 2HMAA 2RJCA 4EOSB 1H8KA 4OB0B 2EQKA 2KAFA 2BPMB 4M75A 5KCHA 3H0HA 2ED1A 3BLRB 3LGFA 4XAXB 2WSFE 2KGTA 5AYFA 4N4GA 4R56A 4B6MA 4UC4A 3QSUA 1SF9A 2XU8A 2A0FB 3CC2A 1TTHB 3CMEQ 1VQPQ 3JCMX 3HFNA 4YC3B 2ROTA 3L2QA 5EG2A 2WIHB 2KBTA 5IF1B 1YJ9Q 1KD1C 2RQUA 4CFNB 1B07A 4M75G 4RMOA 1D1AA 1JB0E 5IXBA 2LQNA 2ROLA 1D0ZA 2ZZDB 3M4GA 1FMVA 2XK0A 1MMDA 3CCEQ 4BCQB 2WSEE 3WXMB 1FINB 3M54A 4ZTFA 2X4XA 2PVDB 4M7DE 4CI0C 4QVCA 1H3ZA 5CVIA 1LOJA 1Q82C 3CMET 4M77A 1VQPT 3UA7A 1WHHA 1OZ2A 3EGDB 3OYEA 3VYHB 2PUOB 3G71A 5GANj 5HKCA 5DQWA 4FX3B 1QVFS 4J9GA 4L5GA 1YHQQ 1I1JA 2L8DA 4Z8AA 2XDPA 5CO7A 1YJ9T 2X4WA 4F16A 4PJNA 4ZGEB 1UGSB 4QW2A 2CUBA 4AMCA 1NZ9A 2CCHB 3REBB 3HHTB 3VUBA 4AFSC 2RNAA 1CKAA 5GAOn 3EHRA 5GANg 4C5GA 3CCET 4M77G 3FIFA 4UN0A 2KRSA 2DAQA 2RO0A 2KXDA 1ZA1B 2RHIA 2W9ZA 2FRWA 4HA8A 1NJIC 1YNZA 4KH1B 4M78B 2O9SA 3L2RA 1VQ8A 1OOTA 2JN0A 4QSHA 2RHXA 2OTJA 1VINA 1HJDA 4J6XA 4M6VA 4O5VA 2DD5B 4A53A 3X26B 2DTHA 4C0DB 1TXQA 1YITQ 2KR3A 3OBWA 2QGSA 2CJMB 4F7UF 1VQOQ 1X2QA 5KYWB 5FROA 2RQVA 2EQMA 2RQTA 1TG0A 3OA6A 2E5KA 2HSEB 3EGXA 3BHVB 4OVAA 1NG2A 3CXCP 1I0CA 2E65A 2E10A 3J81E 2CZ7B 4CC7A 2A28A 4RG8A 3BG5A 3M0QA 2CP5A 1K76A 3G1JA 1WNLA 1EIFA 1H641 3L2VA 1LCKA 1ZBXA 2AKKA 1BI1A 5A0GA 4AFZC 1GCQA 4LDWA 4PFZA 2QEXA 4M7AF 3OYGA 4KUIA 5FU7B 2KQWA 2NWMA 1N8RU 4IMYB 4OP0A 3JB9G 5KH6A 1OPLA 1YITT 4MDXA 4BE1A 2P4TA 1YWOA 4IUVA 8AT1B 2DRMA 1WJSA 3NHNA 5CQXA 2C0OA 3I55T 3OW2A 1VQOT 4ATOA 1M4ZA 1D3UB 4BCMB 2X9HA 3QKJA 1N8RR 5CQYA 3CMAA 5CKDA 4PJOF 2R7GA 4EMKC 2GQVA 2YSQA 3OW2S 4EOQB 2M02A 3J7AF 1QVGP 1ACMB 2QDYB 4G6LB 2WHBB 2YRCA 4YOSA 4QKUA 2LJ0A 1GXIE 2A36A 2O9VA 1AOJA 4J7FA 4J9EA 1RAFB 1XJWB 2A37A 3VRYA 5LJ3f 3KXTA 4M75B 1OIYB 4N4HA 5FWBA 3LWIA 2KT1A 5I2SA 4JLIA 1XNIA 2QQSA 2JNGA 4CC3A 1UDLA 3UT1A 3M0RA 5GAN8 1FX7A 2EYZA 2V26A 3HRSA 4FYWB 4ZN1A 2BTTA 3P8BB 3BY7A 2C5VB 1TS9A 2H3EB 3VKHA 2EJ9A 2C6TB 3BE3A 2RJDA 2QAZA 3C0CA 4ORZA 1VYVA 4J9IA 1TSFA 3BLHB 5I22A 2LQ8A 4O6JA 4FYVB 2CDTA 3LX7A 4YTLA 5J3BA 4XU1A 4N0AC 1K0XA 3DJBA 3H4CA 2DNUA 2M51A 4CFUB 2DF6A 4L59A 1NE8A 5GJWB 3CCRQ 3A1PA 1YJWQ 1JXOA 4Z02A 3EH2A 5GAOr 1GFDA 4CRLB 2Z0WA 1GL5A 4LDVA 4M77B 4DOVA 4X34A 4JRPA 2H3JA 2RB6A 4MMKA 1E9HB 1XTDA 2E3IA 2WPAB 5KYYA 1ZA2B 4M7DF 2OX7A 1VYUA 1H1SB 1KJWA 2A7YA 4BCNB 2V1QA 3NTHA 4XU0A 1KC8U 4BCFB 2F1LA 2JW4A 2DBMA 1X01A 2MYSA 5ACBA 2XI9A 4NC6A 2JM9A 2E5QA 1H3HA 1OU9A 3ER0A 1KC8R 1OULA 4XTYA 3CCRT 1YJNA 1YJWT 2D8HA 2QGFB 4BCOB 4DBRA 1RAHB 4YOZA 1UNLD 3RBBB 2VYTA 4KUDK 1D09B 1OEBA 3OYYA 1M1KC 2DIGA 3OMGA 1X2KA 1G8XA 5GMKh 3META 3FB9A 4KBMB 4ROEA 1SSHA 3JCMe 1UHFA 4BCHB 4F7LB 5GAN7 5LJ3h 4XTXA 2JS2A 4J7IA 2HDAA 3HB9A 2D1XA 4CC4B 4ZGDB 2ATCB 4I3ZB 1U3OA 3MI9B 1GFCA 2JTEA 3H0FA 3VKGA 2MI6A 4F6SB 3EGXB 3AHUA 3WVDB 2QF7A 3REAB 1U5SA 4PLIA 3CCSA 3HRUA 2LW4A 3I56A 1XOVA 2IW6B 2AIRB 1SRLA 4BCQD 1X6GA 1KQSA 3KHIA 4ELZC 4LDXA 4DBHA 1WDXA 2YUQA 4RUGA 3CCLQ 1G5VA 5I21A 4BY6B 4EOIB 1KQSS 2SEMA 2V8IA 3SHWA 1AD6A 2WFYB 1H25B 2CP6A 3LYIA 3HBLA 3LLRA 2R58A 3OYCA 2VXEA 1TU0B 1B7TA 1AZEA 4JRKA 3RUXA 4C5IA 2WXVB 4EOLB 3MPUB 4FYXB 1GY3B 4QQGA 1SRMA 3CCUQ 3QZ5B 5CAIA 1OL2B 4Y91A 1YI2A 2LCLA 3CCVA 1MMNA 5FWCA 3OYJA 1K0SA 3CCQA 2CZ1B 1UE9A 1LVKA 2MF2A 2OI3A 4XU2A 4M78C 3VRZA 2COYA 1H1PB 3OYFA 4M4ZA 4ZGJB 1ZBJA 2RMOA 5I11A 4M78D 1H24B 4C0DC 1K9MU 2XKOC 1VQLQ 3N5BB 3QZ9B 4NS5A 1NEBA 3M5AA 4JPBW 2UZLB 2CH4A 4E6RA 3NMZC 3X20B 3JRZA 4AG1C 4JJCA 4AI6A 4EC8B 1M1GA 1K9MR 3CCMQ 2VWFA 3VJPA 2E41A 4F17A 1JO8A 3HTRA 2K9GA 4LD6A 3CCUT 2DBKA 4FSSA 1YCSB 3UPUA 1UG1A 5GAOm 2RJEA 4A4GA 1IXDA 1VQMQ 4EDUA 1RI9A 1BI0A 2COWA 1X6OA 3QYGB 1K4US 3IQLA 3TU4K 2LNHB 4KH0B 2XG8D 4J9DA 4JRQA 4HLQA 3G6EQ 3MY1B 2Y4YA 2M0OA 5KYYB 2X3WD 4CFWB 2X4YA 2BZ8A 2VGNA 1VQLT 4FM4B 1X69A 2D6FA 1UUEA 1BI2A 3JV3A 3A98A 1QQJA 2GFAA 3G4SQ 1AWJA 3OW2P 3CCMT 1UGRB 3ZL7C 3OBYA 2OJ2A 3X28B 1B3QA 1W4SA 4BCMD 4C8QC 2M16A 4CFMB 5FRMA 5GAMd 2BE9B 2HSPA 1VQMT 2O01E 1UGVA 4Z88A 1K8AC 2E1HA 4EOOB 1W2BA 3HSBA 4F7UG 1OGUB 2F69A 2Y4XA 1S1NA 4M75C 3VV0A 2AZSA 4HL4A 3JCMV 3GBQA 2KYBA 4JZ4A 4KGVB 3Q1JA 4RTVA 4AG2C 4WF2A 1UECA 1W2BS 3OQ5A 3RKYA 3G6ET 4M75D 1X43A 3GP8A 3MEUA 5LJ5e 4RODA 5CKBA 2VV5A 2RK2A 2GNCA 2K3XA 2CZ0B 2KE9A 4WCIA 5HBHB 4RCCA 2DETA 3L2WA 5DY9A 2OTLQ 3G4ST 3RNJA 3CCJQ 4KT0E 2QASA 1AT1B 4HT9A 2C06A 2DMEA 4QVDA 2ZPGB 4Y92A 2NYSA 3EGUA 4X9DA 2C4GB
chains in the Genus database with same CATH topology
2E12A 3HHTB 2PQWA 1KHCA 2ZPFB 3VUBA 5GAOn 1VQ5A 2DKGA 3CC4T 5GANg 4R55A 3CCVT 2O4XB 2RH2A 3C12A 4JUVA 2FYKA 4XK8E 4M77G 5L8RE 3FIFA 4C5GA 3CCQT 4Z6YA 3A8GB 2DAQA 2LDMA 2RO0A 3SWNA 4RKUE 4AKHA 2QTXA 1Q81C 2QQ9A 4PJOG 4A4KA 2RHIA 5KCOA 1Q86U 4BI4A 4HCCA 3JB9F 4A54A 4HA8A 4JDSA 1I8FA 3ZEHA 1NJIC 3V7RA 3CEYA 3CCLT 3QJ6A 2QA4T 4XTWA 1VQ8A 4M78B 5GAMj 1WJQA 3L2RA 4E7JA 2JTFA 3H6ZA 2JN0A 4RCBA 5GAMf 3OYBA 2DEQA 4Y28E 4ELJA 4QSHA 2RHXA 1KC8C 2OTJA 4M78E 1K73C 5EJCA 2KR6A 3HO8A 4J6XA 4M6VA 5D6XA 3JB9I 2AHJB 3VUZA 2ZPIB 3SD4A 4O5VA 2OTLT 2DD5B 1M1FA 1WJRA 4A53A 4OMFB 3X24B 1WGSA 2JUFA 3X26B 1N9RA 1Y71A 2DTHA 2RD1A 3C95A 4IURA 4J5YA 4KULA 4M77D 1BIBA 4C0DB 4P5NA 1YIJA 2YLCA 1VQ7T 5J26A 3OBWA 3F70A 1G3WA 5A0LA 4BACA 4F7UF 1VIEA 2XD0A 2F5KA 1YJNT 2R57A 2F5TX 3OS2A 5FROA 2KMGA 2XIDA 2EQMA 4LDYA 3MCAB 5GAMg 1JJ2A 2VC8A 4HT8A 3P8HA 2EYQA 3OA6A 2LX9A 4EMKA 2DTIA 1D3BA 3TEEA 3GNGA 1BKBA 4OVAA 1MGQA 1VQKT 2RI3A 3JCMf 1XQHA 1NPRA 4DQ2A 3TW6A 3A8LB 2DXCB 2E70A 3P8DA 2ZPEB 2E65A 2EQJA 3CXCA 2E10A 2QDJA 1N27A 3SWNC 3J81E 3CPFA 2BS3A 1Y96B 3UWNA 2CZ7B 2JVVA 1M5Q1 3V8KA 3L2UA 3E9GA 2ZCFB 3CCRA 4RG8A 5CIUA 5GAN2 3BG5A 1YJWA 5DLOA 2WJ9A 3OYHA 3CXCS 1VQ6T 1WNLA 1ZHIA 2DZ9A 3FC3A 3BG9A 1EIFA 1H641 1OZ3A 3QYHB 5FU7C 3L2VA 1ZBXA 3OYKA 4ZTJA 1VQ9A 2HNIA 1BYMA 1BI1A 4F7UA 5A0GA 3DB4A 2QQBA 4LDWA 3CC2T 3CD6T 4MDWA 3OSSC 4FL6A 2QEXA 3OYGA 3X25B 2ZGWA 2K5LA 3OMCA 4KUIA 5FU7B 2KQWA 3QXEB 2HQEA 2KMTA 3ME9A 1WQWA 3JB9G 4OP0A 1S72A 4A4HA 1N8RU 5KH6A 4MZTA 4NL3A 2QXFA 3QBYA 4E47A 2RJFA 2VUBA 4BE1A 1YITT 4MDXA 2P4TA 1RL2A 5M9OA 4GLKA 3CPWA 3HRTA 4IUVA 2LQKA 2OAUA 1VQOT 1WJSA 5CQXA 5FU6C 3I55T 3OW2A 4ATOA 1QW1A 4M77F 1M4ZA 3QDRB 3QKJA 3RESA 2K4YA 5CQYA 3DLMA 3T9NA 3CMAA 2DO3A 5CKDA 4J83A 4PJOF 3CPWS 2CS7A 3I56T 2PVGB 2GQVA 2VXFA 4EMKC 4DA4A 3OW2S 1WPYA 5GMKj 1MHNA 5J39A 3J7AF 1QLBA 1I4K1 4X9CA 4XU3A 5GANh 2KDSA 1PSEA 2QDYB 3JB9D 3M9QA 3MHXA 3C94A 2EAYA 4C8QE 4M7AA 1GXIE 3QUIA 3CCMA 1VQNA 5LJ3j 3DL1A 4OB2B 2MMPA 4J7FA 1KD1U 1OI1A 5LJ3f 2DXBB 3MP1A 3KXTA 4M75B 4C92B 3JCMQ 4MFDA 1KHIA 5HK0A 4N4HA 4MZMA 3LWIA 3S3NA 5I2SA 4JLIA 1ZQ1A 1QVFA 1XNIA 3OB9A 2JTMA 4M75E 4C92E 2QQSA 3FDRA 2JNGA 2BS2A 1K8AU 3G71T 1B34A 3J80E 3UT1A 4EPCA 4PJOA 4AKIA 5GAN8 1FX7A 4F7UB 2PUKB 2BIVA 3QYEA 4ZN1A 3HRSA 3CBPA 1HK9A 3E9FA 3HP9A 3BY7A 3P8BB 4FT4A 3VYGA 2EWNA 2DTOA 2BUDA 5KE2A 3RMSA 2FB7A 4BY6C 1WQ7A 4BD3A 3GF5A 3KUFA 3VKHA 2EJ9A 5LJ3g 4BDZA 5D6WA 1Q7YC 2RI2A 3CCET 2RJDA 4MZPA 4M7AG 3M57A 2D9TA 4E7IA 3BW1A 3HZJA 5GAMh 3CMEA 3RIRA 1Q82U 2LQ8A 1JRIA 5GAN3 2LNVA 4MFEA 2MAMA 3PMIA 4O6JA 3MP6A 5FLXE 1YI2T 1M8VA 4QQ6A 3LX7A 4YTLA 5J3BA 3PIPA 2DD4A 4XU1A 4N0AC 4C5HA 4M7AC 2DK3A 4PNOA 3LGLA 3H4CA 5CK9A 4IUPA 5GANe 2WSCE 4N4IA 4BI8B 4L59A 1NE8A 5HK3A 1UGPB 3JCMJ 1N6AA 2G3RA 2P0KA 4M78G 4Z02A 4J6YA 4M7AD 5GAOr 3JCMW 4OB1B 1RI0A 4M77C 4HCZA 1K9MC 3RERA 3ZBDA 3MEVA 4MMLA 3S3OA 2QQRA 4PJOC 1YHQT 3G7ZA 4LDVA 5GAOp 4M77B 2QQAA 4DOVA 4X34A 3CCJT 3PFSA 3VU3C 4JRIA 3C4SA 2H3JA 2RB6A 4MMKA 3OYLA 4JRPA 3S3MA 1Q81U 3BG3A 1XTDA 2EJGA 2MWOA 5IAYA 3JCMg 4PJOD 5CKEA 5LJ5d 2RK1A 3JCMc 3VYGB 3DLLA 2QA4A 1NJIU 3CCLA 4M7DF 4OGCA 4BUGA 4XTZA 1O9SA 1G3SA 3ZFJA 2A7YA 3QYBA 3NFCA 3NTHA 4XU0A 5I2MA 4C0FA 1KC8U 3BDUA 4HCBA 1K73U 4IUUA 2OTLA 3JB9J 5GAMe 1VUBA 2YRVA 4BDYA 4HNVA 3CC7A 1X01A 4PLLA 1IREB 4BE0A 2DIQA 2XI9A 1BI3A 4NC6A 3WVEB 5A0DA 2E5QA 3OSVA 1VQ7A 3ER0A 2LT4A 1V29B 2NLUA 4XTYA 1AHJB 5CKHA 3CCRT 1YJNA 1YJWT 3SWNB 3M59A 4JS4A 3CCUA 4Q5WA 4C8QA 2ZZDA 3INZA 1U1SA 2KY9A 3A8OB 2IVWA 2M9UA 2VYTA 4KUDK 3SDZA 3OYYA 3QPHA 1M1KC 3JCMb 4II1A 4A4FA 4M7DA 2DIGA 3OMGA 3OYIA 2QEXT 5GAN4 5DM7R 2EKOA 2LT1A 1TH7A 5GMKh 3META 3FB9A 4OB3B 4KBMB 2LTOA 3L1AA 3QG1A 4J6WA 4QVZA 4IKFA 5C0MA 3JCMe 1I81A 3V7SA 2LVMA 3E1SA 3RMQA 5GAN7 2QI2A 5LJ3h 4OGEA 4XTXA 4IUQA 1VQ6A 4J7IA 4CRIA 5IT9E 3BFMA 1Y07A 4LOCA 2RHZA 3CMAT 3HB9A 3PT9A 4B9XA 3MEWA 2X4JA 4ZGDB 5FU6B 4V2SA 1G3YA 3DKMA 3EFSA 1VQLA 2EFIA 3PMTA 3CD6A 2B8AA 2E6ZA 4NOYA 4IUTA 4M78F 4C8QG 3LH0A 4J8OA 3SB2A 1QVGA 3M53A 4EMKB 3VKGA 2MI6A 4JX4A 3M58A 3R6OA 1DJ7B 1D3BB 1IZ6A 1M9SA 1VIFA 4GY5A 4M7DG 5LJ5j 2CYZB 3FRNA 3LW5E 1JJ2S 3AHUA 1VQOA 1VQNT 3I55A 5LJ5f 4C0GA 3JSCA 5GAOq 1QVGS 3OS1A 4JS5A 3WVDB 2VGMA 2QF7A 2V8KA 2XHCA 4XQ3A 4PLIA 3CCSA 2CKKA 3HRUA 2QFZA 3HKSA 1KQ2A 3I56A 4DOWA 2JZ2A 3OY9A 2O4XA 1UGQB 2P0PA 1LNXA 1XOVA 1VQMA 4AKGA 2DXUA 2ZPHB 4BI3A 4M7DC 3JAME 3MO8A 2MWPA 3QIIA 2GFUA 4C8QD 1P92A 3A8HB 3PIOA 3OS5A 4EMHA 1VQ4A 3GIBA 4LD9K 5LL6S 3V8JA 4M7DD 4M78A 5GMKe 4F7UE 1KQSA 1I5LA 5LJ5g 2K5IA 2FVUA 3FEOA 5FRNA 3ASKA 3KHIA 3MEAA 4ELZC 4FIBA 3RKXA 2HBPA 3G6EA 4E7KA 4LDXA 1JBMA 2HD0A 2GCXA 3EFRA 1M90C 1G5VA 5I21A 4BY6B 5LJ3e 2DD5A 5C6SA 1VQPA 1KQSS 3V8LA 3QJYA 2KSSA 2V8IA 4JJNK 2LC4A 2XICA 2V8JA 5GAOl 2RHUA 2R5MA 3M4YA 3MP8A 1VQ5T 1QP3A 3LYIA 2YHTA 2XDDA 3G4SA 3HBLA 3LLRA 2K57A 2R58A 3OYCA 1YJ9A 2LCCA 2VXEA 5D6YA 2HAXA 2Y90A 4L6V5 2YLBA 4XTUA 1Q86C 3H8ZA 4JRKA 5GAN5 2PVOB 3RUXA 4C5IA 4VUBA 4M7AB 5CCAA 1Q7YU 4BE2A 1OYXA 4QQGA 2RM4A 2DJZA 1VQ8T 3RKWA 2DXCA 3HL8A 4M7AE 3QZ5B 4EMGA 3L42A 5CAIA 1NPPA 3NTIA 4FSXA 4TVRA 3GPLA 3CC4A 2M1HA 1Y96A 2LCLA 4Y91A 3OYMA 3JCMh 3CCVA 3CBMA 1YI2A 3OYJA 1G3TA 3UDCA 3JB9H 3CCEA 3QWLA 4HKEA 3CCQA 2EJFA 3M55A 2XDBA 2CZ1B 2HQXA 2CGHA 2MF2A 1U1TA 1YBYA 3O8VA 4XU2A 1B34B 4M78C 3JCMP 2P0QA 4PJOB 4C8QF 1YIJT 4MIMA 4M77E 3VKIA 4JX6A 3OYAA 4FT2A 3OYFA 4BBSM 4ZGJB 2DXTA 3A5ZB 4NL2A 4PJOE 1BIAA 1X75C 3QO3A 5GMKm 3E19A 4M78D 1O75A 4RG2A 2DZCA 2DPPB 4M75F 4C92F 4C0DC 1K9MU 4ME7A 2XKOC 2I2LA 1YHQA 1QP2A 3N5BB 2KK4A 3QZ9B 2A3LA 2RA2A 3CCJA 4NS5A 4BB7A 3CC7T 3M5AA 4PL6A 5IN1A 3S6WA 4JLGA 4D6WA 3A8MB 4BBRM 5HY6A 3X20B 3JRZA 4AI6A 2FL7A 1M1GA 2L5QA 2DVEA 5LJ3d 2EIFA 2BS4A 2DD4B 4HNUA 1R8OB 2E41A 3VJPA 4ELYC 4B9WA 1QVPA 2FHDA 5GAN6 2R5AA 4LD6A 3CCUT 2K2VA 1VQ9T 2GF7A 3UPUA 1FXXA 1LJOA 1VQKA 5GAOm 2RJEA 2QQ8A 4A4GA 3LWHA 1Y7XA 4M7AF 1N8RC 3NTKA 5CR2A 4C0ZA 2G77A 4EDUA 5GANd 1S72T 2RJCA 2DXBA 2CZ6B 4OB0B 2EQKA 2KAFA 3PNWC 4M75A 4C92A 5KCHA 5GMKi 1U8RA 2IG0A 1BI0A 3LGFA 4XAXB 2WSFE 5LJ5h 1X6OA 3QYGB 1HXDA 3BDLA 3OYNA 5AYFA 3TU4K 2XG8D 4N4GA 5KE3A 4R56A 4JRQA 3GLXA 4HLQA 4UC4A 3QSUA 2XU8A 1KG1A 2Y4YA 2M0OA 5CKFA 3CC2A 2X4YA 3FLGA 1M1KU 2VGNA 3L2ZA 1VQLT 4FM4B 2EQUA 2PU9B 2K3YA 3JCMX 3CBOA 1FWZA 3HFNA 2WACA 2D6FA 3L2QA 1N9SA 4C5EA 4ZN3A 4E7LA 1BI2A 1UEBA 4XTVA 1YITA 1PSFA 3QHSA 5EG2A 2GFAA 3EAEA 1E7PA 4HNTA 3CCMT 1UGRB 1FKMA 3GOXA 1KD1C 2BKDN 3OBYA 4M75G 4C92G 2ZPBB 3TW7A 4RMOA 3OS0A 3X28B 2JOYA 5GMKl 1JB0E 1KQ1A 1W4SA 4C8QC 2LRQA 5DLQE 3CCST 2M16A 5FRMA 5GAMd 3OYDA 3M56A 1VQMT 2O01E 3SFMA 1K8AC 2E1HA 4C8QB 2ZZDB 2X35A 1W2BA 3HSBA 3M4GA 4F7UG 2F69A 2KVQG 2Y4XA 4E7HA 2XK0A 4M75C 3VV0A 4C92C 1VQ4T 4HL4A 4M7DB 3JCMV 4N0AA 2WSEE 4QQDA 3WXMB 3M54A 4ZTFA 2X4XA 3Q1JA 3HFOA 3HPWA 4WF2A 2PVDB 4M7DE 4CI0C 3KBGA 3OQ5A 3RKYA 4QVCA 1W2BS 4JX5A 1H3ZA 3G6ET 1YCYA 4M75D 4C92D 2D0QB 3DB3A 5CVIA 3GP8A 1LOJA 2E64A 2E6NA 3MEUA 5LJ5e 1Q82C 3PTAA 3CMET 2RI5A 2RHYA 4M77A 5CKBA 1VQPT 2K5FA 3URGA 2VV5A 3FJPA 3GNFB 4OF1A 3V7CA 1OZ2A 3G71A 2RK2A 3VYHB 2PUOB 3OYEA 5GANj 5HKCA 5A2QE 2K3XA 2CZ0B 3JCMd 5GANf 4RCCA 1QVFS 4A4EA 3L2WA 4LDUA 2L89A 4L5GA 5DY9A 3TREA 3G4ST 1UB4A 2L8DA 1SSFA 4KT0E 2XDPA 5CO7A 1YJ9T 2X4WA 4HT9A 2C06A 4ZGEB 1UGSB 4FU6A 4QW2A 3PGGA 4QVDA 2ZPGB 2L3RA 1NZ9A 1M90U 4PKCC 4X9DA 3TCJA 2OTJT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QZ9 B;  3HHT B;  2ZPF B;  3A8M B;  3X20 B;  4XK8 E;  5L8R E;  3A8G B;  4RKU E;  4ZGD B;  2DD4 B;  2PUK B;  3VYG A;  1DJ7 B;  4Y28 E;  2CYZ B;  3LW5 E;  2DXB A;  2CZ6 B;  4OB0 B;  2AHJ B;  2ZPI B;  3WVD B;  2DD5 B;  3X24 B;  2WSF E;  3X26 B;  3QYG B;  1UGQ B;  2ZPH B;  2DD4 A;  2WSC E;  3A8H B;  4FM4 B;  2PU9 B;  1UGP B;  1PSF A;  4OB1 B;  3A8L B;  2DXC B;  2ZPE B;  1UGR B;  2DD5 A;  2CZ7 B;  2ZPB B;  3X28 B;  2ZCF B;  1JB0 E;  1QP3 A;  2O01 E;  3QYH B;  2ZZD B;  3VYG B;  4L6V 5;  3X25 B;  2PVO B;  3QXE B;  2WSE E;  2PVD B;  2DXC A;  3QZ5 B;  2D0Q B;  1IRE B;  3WVE B;  1V29 B;  2CZ1 B;  1AHJ B;  3VYH B;  2PUO B;  2CZ0 B;  2PVG B;  2ZZD A;  3A8O B;  4ZGJ B;  4KT0 E;  1PSE A;  2QDY B;  4ZGE B;  1UGS B;  1GXI E;  2ZPG B;  2DPP B;  4OB2 B;  4OB3 B;  2DXB B;  1QP2 A; 
#chains in the Genus database with same CATH topology
 2E12 A;  2ZPF B;  2DYB A;  1VQ5 A;  2DKG A;  4JUV A;  4EOK B;  2FYK A;  2XD0 A;  4DEX A;  2LDM A;  4RKU E;  2I53 A;  2RQR A;  4PJO G;  4A4K A;  1Q86 U;  4BI4 A;  1QWF A;  2VVK A;  4KGX B;  4CFU D;  3CEY A;  2QA4 T;  2PJQ A;  2W96 A;  4RCB A;  5GAM f;  2DEQ A;  4M78 E;  1Q86 R;  1KIK A;  4FW1 A;  2AHJ B;  1ZP2 A;  4LNP A;  3VUZ A;  3CC2 Q;  2OTL T;  1M1F A;  3POM A;  2GBQ A;  3X24 B;  4IUR A;  4M77 D;  1PRM C;  3LH5 A;  1V76 A;  5A0L A;  4CFV B;  4CFX B;  3EG0 A;  2F5K A;  2QK0 A;  1JJ2 P;  4KGZ B;  4PJL A;  1BCM A;  4LDY A;  2SRC A;  2VC8 A;  3P8H A;  4BCN D;  1BB9 A;  1D3B A;  5IHY A;  2RI3 A;  4DQ2 A;  3TW6 A;  3A8L B;  1NYF A;  2ZPE B;  2QDJ A;  1N27 A;  3CPF A;  2ECZ A;  3V8K A;  1M5Q 1;  3E9G A;  2ZCF B;  4BY7 X;  4TTH A;  1ZHI A;  4OMM A;  1OZ3 A;  1BYM A;  3OYK A;  2HNI A;  2CP7 A;  3LQ5 B;  2C5O B;  1H1R B;  3CC2 T;  4FL6 A;  3X25 B;  2ZGW A;  3OMC A;  3QXE B;  3G71 Q;  1W98 B;  1MMA A;  1S72 A;  4NL3 A;  2F2W A;  3CPW P;  2RJF A;  5M9O A;  1GBQ A;  1RL2 A;  3HRT A;  4IIO A;  2OAU A;  2X51 A;  4AT1 B;  3RES A;  4J83 A;  1FYN A;  1AEY A;  2ED0 A;  4FCY A;  5GMK j;  3VS4 A;  1QLB A;  1CKB A;  2PTK A;  1GH6 B;  4J9H A;  3JB9 D;  3MHX A;  3C94 A;  2EAY A;  2VAS A;  4C8Q E;  4K11 A;  2KRN A;  4PJM A;  5LJ3 j;  4F70 B;  3QDF A;  1HD3 A;  2O88 A;  2LP5 A;  2NUP B;  5HK0 A;  4MZM A;  3S3N A;  1QVF A;  1WHM A;  4M75 E;  1VQ8 Q;  1GCQ C;  1JQQ A;  1F1B B;  5IH2 A;  4BCI B;  1IO6 A;  2BS2 A;  3G71 T;  1B34 A;  3J80 E;  2OTJ Q;  4AKI A;  1JEG A;  4F7U B;  2BIV A;  3QYE A;  2EWN A;  2I0N A;  5KE2 A;  4BY6 C;  1T0H A;  5LQF B;  3KUF A;  5LJ3 g;  4BDZ A;  1QCO A;  2BZY A;  5D6W A;  1R0B G;  4MZP A;  5KYU A;  3BW1 A;  5GAM h;  3CME A;  3RIR A;  3EG1 A;  2CRE A;  4MFE A;  1I5O B;  2MAM A;  3PMI A;  5FLX E;  2F2V A;  1Y0M A;  2EGA A;  2M0Y A;  2DD4 A;  1AD5 A;  4IUP A;  5GAN e;  4Y72 B;  2HL5 C;  5HK3 A;  2G3R A;  2P0K A;  4J6Y A;  1RI0 A;  1URC B;  3QHW B;  1WYX A;  1AIS B;  2YT6 A;  3RER A;  3MEV A;  2QQR A;  2QEX Q;  1YHQ T;  3G7Z A;  2GQI A;  2QQA A;  1KXU A;  3PFS A;  1OKV B;  3C4S A;  1Q81 U;  1ABQ A;  3BG3 A;  2MPX C;  2L3S A;  5IAY A;  2J6O A;  3VS2 A;  4II5 B;  3DLL A;  2RK1 A;  1OPK A;  1WHJ A;  1EZZ B;  4OGC A;  1TFB A;  3MKD A;  3RDV A;  3QYB A;  3NFC A;  4C0F A;  5I2M A;  3CMA Q;  1Q81 R;  3DTO A;  3BDU A;  4HCB A;  1K73 U;  1RAC B;  2DVJ A;  1J3T A;  3JB9 J;  1SPK A;  4E7Z A;  1VUB A;  2YRV A;  5GJV B;  4BDY A;  4HNV A;  4PLL A;  2DIQ A;  3WVE B;  5A0D A;  2DA9 A;  2FPD A;  3OSV A;  1V29 B;  1RLP C;  5CKH A;  1AHJ B;  1QKX A;  1K73 R;  2PZ1 A;  2RF0 A;  4RTT A;  3INZ A;  2M9U A;  2XMF A;  4A4F A;  1RAB B;  1FVV B;  1OKW B;  2X1N B;  1WZO A;  2QEX T;  1TWB A;  4OB3 B;  2UUE B;  3QG1 A;  3UF4 A;  2L3P A;  4QVZ A;  5I5Z B;  5IHK A;  2P84 A;  3E1S A;  3RMQ A;  3EG2 A;  4IUQ A;  3U23 A;  4CRI A;  3BFM A;  2DL7 A;  1Y07 A;  3CMA T;  4B9X A;  5FU6 B;  4V2S A;  3DKM A;  3EFO A;  4NOY A;  4BCP B;  4M78 F;  3LH0 A;  2FRY A;  2HKQ B;  3M58 A;  4JX4 A;  1D3B B;  1IZ6 A;  2CSI A;  2CYZ B;  2IVX A;  3FRN A;  3LW5 E;  1VQO A;  1WXT A;  3I55 A;  1JSU B;  4C0G A;  5GAO q;  4JS5 A;  2VGM A;  4XQ3 A;  1BU1 A;  2EQI A;  3I9Q A;  3VS5 A;  2JMA A;  1ZSG A;  3QII A;  3A8H B;  3AT1 B;  3PIO A;  1VQ4 A;  4EMH A;  5LL6 S;  1WFW A;  3D7S B;  2DL8 A;  3V8J A;  1ARK A;  2K5I A;  2FVU A;  5FRN A;  1YIJ Q;  2CT3 A;  3RKX A;  2DJQ A;  2HBP A;  3CQT A;  4E7K A;  2QTV A;  3EFR A;  5C6S A;  3V8L A;  3QJY A;  2RHU A;  3MP8 A;  2XDD A;  2E4H A;  5D6Y A;  2YLB A;  2EKH A;  4VUB A;  3TSW A;  1Q7Y U;  1C6V X;  4LUD A;  2JJ9 A;  1IHW A;  1NM7 A;  4EMG A;  1VQ9 Q;  3NTI A;  3CC4 A;  2PK9 B;  1Y96 A;  3OYM A;  3CBM A;  1G3T A;  3UDC A;  1Q7Y R;  2EJF A;  3M55 A;  2HQX A;  2CGH A;  1G2B A;  1U1T A;  1YBY A;  1B34 B;  3BLQ B;  4C8Q F;  1YIJ T;  1WXB A;  4FT2 A;  1H1Q B;  4F6U B;  2DX1 A;  3TVT A;  1BIA A;  1H92 A;  1O75 A;  4M75 F;  5KYU B;  2FEI A;  2O2O A;  2B9R A;  3MIA B;  4BB7 A;  4PL6 A;  5IN1 A;  2KRO A;  4BBR M;  4PFO A;  2G9X B;  2FL7 A;  1OV3 A;  2C0T A;  1PRL C;  4FW2 A;  2L5Q A;  1WA7 A;  2KEA A;  4HCK A;  2DD4 B;  3PE0 A;  2DLP A;  2KRM A;  2K2V A;  1VQ9 T;  3CCS Q;  1FXX A;  4ANJ A;  1VQK A;  1Y7X A;  4PK4 A;  3NTK A;  1N8R C;  2QG9 B;  1QCF A;  4F7J B;  2DXB A;  4C92 A;  5GMK i;  1U8R A;  7AT1 B;  3R6N A;  4EOJ B;  3VS3 A;  1SG5 A;  4GLM A;  2PNI A;  3BDL A;  2HZY A;  1PKS A;  4OML A;  1WI7 A;  2K2M A;  3FLG A;  5D7U A;  2EQU A;  2PU9 B;  2E3H A;  3M0P A;  2F2X A;  2WAC A;  1SHG A;  4C5E A;  4E7L A;  3QHS A;  2W0Z A;  1FKM A;  3GOX A;  2DIL A;  4C92 G;  3OS0 A;  2HQH A;  2JOY A;  5GMK l;  1BU2 A;  3CCS T;  2LRQ A;  2LQW A;  2MK5 A;  2EVR A;  5DLQ E;  1IGQ A;  3M56 A;  5ECA A;  2X35 A;  3CCV Q;  4Z89 A;  3CCQ Q;  4N0A A;  1WLP B;  3HFO A;  3HPW A;  2W10 A;  3KBG A;  3I5R A;  1RUW A;  6AT1 B;  2FG0 A;  1TUG B;  1QVF P;  2D0Q B;  2AKL A;  2E64 A;  2E6N A;  2RI5 A;  3URG A;  3FJP A;  4KRC B;  4OF1 A;  1ABO A;  3JCM d;  5IXF A;  2YRD A;  3QHR B;  4HVV A;  2L89 A;  3TRE A;  2V22 B;  1UB4 A;  4LE9 A;  3EFO B;  2YUN A;  5FW9 A;  1VQ7 Q;  1FMK A;  3PGG A;  1QWE A;  1M90 U;  4PKC C;  3TCJ A;  2VB6 A;  1QMZ B;  3EOC B;  3DOG B;  1KHC A;  5HBE B;  3O0G D;  3CCV T;  4XK8 E;  4CXA B;  3CCQ T;  1M90 R;  4OMQ A;  3A8G B;  3SWN A;  2QTX A;  4BY1 X;  4J9B A;  8ATC B;  2UZE B;  3JB9 F;  3M0S A;  4JDS A;  1I8F A;  3V7R A;  3CCL T;  2LMJ A;  4XTW A;  1I07 A;  5GAM j;  4E7J A;  1VQ6 Q;  2JTF A;  3H6Z A;  2CT4 A;  4Y28 E;  2EPD A;  4ELJ A;  1KC8 C;  1GUX A;  2JT4 A;  2WMA B;  5KYX A;  2DER A;  2D0N A;  2ZPI B;  3CD6 Q;  3SD4 A;  4OMF B;  3C95 A;  1MMG A;  2RD1 A;  4KUL A;  4J5Y A;  1TOV A;  4P5N A;  1M8M A;  2HL3 A;  4OMP A;  1VQ7 T;  3F70 A;  1G3W A;  4HXJ A;  2CH4 W;  2F5T X;  2R57 A;  5GAM g;  4HT8 A;  2EYQ A;  5EC7 A;  1IRX A;  2LX9 A;  1VYT A;  1MGQ A;  3UAT A;  3JCM f;  1NPR A;  2E70 A;  4DBF A;  4EIK A;  3CXC A;  2NUP A;  1NLP C;  1Y96 B;  3UWN A;  1AWW A;  1MV3 A;  2MIO A;  4ESR A;  2WJ9 A;  2KT8 A;  3CXC S;  1VQ6 T;  1UNG D;  5FU7 C;  1OU8 A;  4JJD A;  4F7U A;  2MOX A;  3CD6 T;  2LCS A;  4MDW A;  1N4M A;  2HQE A;  2KMT A;  3ME9 A;  1WQW A;  4MZT A;  1X27 A;  5AT1 B;  3QBY A;  4E47 A;  2VUB A;  2W99 A;  1AVZ C;  1YFN A;  5FU6 C;  2EGC A;  2NUZ A;  3QDR B;  2K4Y A;  3T9N A;  2DO3 A;  2CS7 A;  4RTY A;  1ENW A;  1NLO C;  2PVG B;  2VXF A;  5DQV A;  5J39 A;  1Z9Z A;  1AWX A;  1ZUK A;  1RAD B;  4X1V A;  1PSE A;  1VQ5 Q;  1WHG A;  4M7A A;  3QUI A;  1JXM A;  1PG5 B;  3CCM A;  1VQN A;  2MMP A;  1KD1 U;  2DXB B;  3MP1 A;  4C92 B;  1KHI A;  2JTM A;  4FYY B;  1M3C A;  2X3X D;  1KD1 R;  4PJO A;  2HKN A;  3CBP A;  1HK9 A;  1C1A A;  2DTO A;  2FB7 A;  1WQ7 A;  2DE0 X;  4BD3 A;  2OAW A;  2RI2 A;  4M7A G;  2EYW A;  4E7I A;  3TN8 B;  1Q82 U;  3HZJ A;  1RAE B;  5GAN 3;  2LNV A;  2HBW A;  1F5Q B;  3MP6 A;  4QQ6 A;  4A63 B;  2P4R A;  1Q82 R;  4PNO A;  3LGL A;  2BKZ B;  2WSC E;  2HCK A;  4N4I A;  4M78 G;  4CC2 A;  1BBZ A;  4OB1 B;  4M77 C;  2NUT A;  1K9M C;  2PK2 A;  5GAO p;  1TUC A;  3CCJ T;  3S3M A;  1UFF A;  2ABL A;  5LJ5 d;  3JCM c;  3VYG B;  4OR5 B;  1EX4 A;  4HVU A;  2QA4 A;  4BCG B;  1NJI U;  4BUG A;  1M3B A;  3QWY A;  1ZUY A;  2DYI A;  4XTZ A;  1OL1 B;  1G3N C;  2OTL A;  2LZ6 B;  3DDQ B;  1NJI R;  3CC7 A;  2DRK A;  1IRE B;  4F6W B;  3PVL A;  1H4L D;  2WEV B;  2LT4 A;  2ESW A;  3SWN B;  3M59 A;  2HEQ A;  5HQ0 B;  5LMK B;  4Q5W A;  4C8Q A;  1U1S A;  2KY9 A;  1D1C A;  2IVW A;  1OX9 A;  3QPH A;  3JCM b;  4M7D A;  3OYI A;  5GAN 4;  5DM7 R;  1HYO A;  2EKO A;  1GBR A;  1M3A A;  1GUX B;  2LTO A;  4F7S B;  3L1A A;  4J6W A;  5KYX B;  3O5Z A;  4IKF A;  5C0M A;  3V7S A;  1PHT A;  2LVM A;  3VS1 A;  4OGE A;  3E2U A;  2W9F A;  4OMO A;  2PMI B;  4KRT A;  3PT9 A;  3MEW A;  2LJ3 A;  1OI9 B;  1G3Y A;  1WHK A;  3EFS A;  3EHQ A;  2EFI A;  1SKU B;  2B8A A;  1ZSZ A;  4IUT A;  4C8Q G;  4ELL A;  1UJ0 A;  4J8O A;  2MCN A;  3M53 A;  3R6O A;  4GY5 A;  4M7D G;  1VIF A;  1YN8 A;  5HBJ B;  5LJ5 f;  3OS1 A;  4KRD B;  2V8K A;  2XHC A;  2CCI B;  2C5N B;  3HKS A;  1KQ2 A;  2JMC A;  2JZ2 A;  2O4X A;  1UGQ B;  2ZPH B;  3JAM E;  4EOM B;  2KYM A;  3MJX A;  2GFU A;  3GIB A;  1KQS P;  4PFP A;  5GMK e;  1RAA B;  1I5L A;  2K6D A;  3MEA A;  4FIB A;  2HD0 A;  3EID B;  5LJ3 e;  4LXC A;  1VQP A;  3K7A M;  2LC4 A;  2XIC A;  5GAO l;  1D1B A;  2DL5 A;  2K79 A;  3M4Y A;  1QP3 A;  2YHT A;  2K57 A;  1YJ9 A;  1TUD A;  2Y90 A;  3H9N A;  4XTU A;  1Q86 C;  4M7A B;  5CCA A;  2A08 A;  1OYX A;  1VQ8 T;  1JKW A;  1WX6 A;  2DXC A;  1P5E B;  3L42 A;  3GPL A;  2OTJ T;  4FSX A;  3PVQ A;  1WXU A;  3JB9 H;  3CCE A;  1QMC A;  3QWL A;  2XDB A;  3RGF B;  3JCM P;  2D8J A;  1OIU B;  2JGZ B;  2P0Q A;  1JOW A;  4PJO B;  4MIM A;  2KXC A;  2VKN A;  2YUP A;  4M77 E;  2J06 A;  3VKI A;  4D8D A;  2DXT A;  2EBP A;  4QT7 A;  2JXB A;  3QO3 A;  1X75 C;  5GMK m;  4LUE A;  3TNI B;  4F14 A;  2DPP B;  3B57 A;  5EFQ B;  1W70 A;  2I2L A;  1YHQ A;  1IB8 A;  1QP2 A;  2KK4 A;  2DMO A;  3S6W A;  3QWX X;  4JLG A;  1RAI B;  5LJ3 d;  1G83 A;  2EIF A;  2FPF A;  4ELY C;  3I55 Q;  1QVP A;  2FHD A;  5HVY B;  2R5A A;  2GGR A;  1M27 C;  1PKD B;  1LJO A;  1GRI A;  5IDN B;  5CR2 A;  2G77 A;  1Z9Q A;  5GAN d;  2K3B A;  2NUT B;  2CZ6 B;  3PNW C;  1RLQ C;  1VQ4 Q;  2IG0 A;  1JST B;  5LJ5 h;  1HXD A;  2AZV A;  3OYN A;  5KE3 A;  3GLX A;  4OMN A;  1FMW A;  9ATC B;  1KG1 A;  1QKW A;  5CKF A;  1TD6 A;  4EOR B;  1M1K U;  3L2Z A;  2K3Y A;  3CBO A;  1FWZ A;  2L3Q A;  5ICP B;  1N9S A;  4ZN3 A;  1UEB A;  3M03 A;  4XTV A;  1YIT A;  1PSF A;  4JZ3 A;  3SEM A;  2DM1 A;  3EAE A;  1E7P A;  4HNT A;  1M1K R;  3EG9 A;  2BKD N;  2EUF A;  1M2V A;  1D0Y A;  1OX8 A;  2ZPB B;  3TW7 A;  2O31 A;  1KQ1 A;  4WTO B;  1H26 B;  3UA6 A;  2J05 A;  3OYD A;  1HSQ A;  4JJB A;  3SFM A;  1PCX A;  1W2B P;  4C8Q B;  4DEY A;  1YP5 A;  3CC4 Q;  2KVQ G;  4E7H A;  4C92 C;  4M7D B;  2CP2 A;  1VQ4 T;  4ZNX A;  4QQD A;  2V1R A;  1VOM A;  3VS6 A;  2IW9 B;  1LPL A;  4JX5 A;  1RAG B;  1YCY A;  4C92 D;  3DB3 A;  1U06 A;  3PTA A;  2RHY A;  2K5F A;  3GNF B;  4RTU A;  3V7C A;  1SHF A;  3THK A;  1PC0 A;  5A2Q E;  5GAN f;  3F5X B;  4IIM A;  4A4E A;  4LDU A;  3VS7 A;  1ZSZ B;  1SSF A;  3G33 B;  1AWO A;  2J6K A;  2AK5 A;  2ENM A;  4FU6 A;  2L3R A;  1YJN Q;  1PD1 A;  2PQW A;  1NBE B;  2FPE A;  3CC4 T;  4R55 A;  2O4X B;  2RH2 A;  3C12 A;  1VQK Q;  5L8R E;  4Z6Y A;  4AKH A;  2BZX A;  1Q81 C;  2QQ9 A;  3EH1 A;  5KCO A;  1R0C B;  1K9A A;  4E7S A;  4HCC A;  1PWT A;  4A54 A;  1QCN A;  3ZEH A;  2DL3 A;  3QJ6 A;  1V1C A;  1WJQ A;  1XO2 A;  3OYB A;  2DL4 A;  3H0I A;  2CP0 A;  3ULR B;  3NGP A;  5EJC A;  1K73 C;  2KR6 A;  3HO8 A;  3TNH B;  5D6X A;  1O9K A;  3JB9 I;  1WJR A;  1E7O A;  1H28 B;  1C0M A;  1WGS A;  2JUF A;  1N9R A;  4BXX X;  1Y71 A;  1BIB A;  1IGU A;  1YIJ A;  2YLC A;  5J26 A;  4YOO A;  4BAC A;  1VIE A;  1YJN T;  3OS2 A;  2KMG A;  2XID A;  4BCK B;  3MCA B;  1JJ2 A;  5HCK A;  3H41 A;  3TSZ A;  1N5Z A;  4EMK A;  3I56 Q;  4EOP B;  2DTI A;  2RPN A;  3TEE A;  3GNG A;  1BKB A;  4DBQ A;  1VQK T;  1XQH A;  2DXC B;  3P8D A;  2EQJ A;  1JJ2 S;  4RTZ A;  3SWN C;  2BS3 A;  4J9C A;  2JVV A;  3L2U A;  3CCR A;  5CIU A;  2CSQ A;  5GAN 2;  1YJW A;  1EFN A;  5DLO A;  3OYH A;  2DZ9 A;  3FC3 A;  3BG9 A;  3QYH B;  4ZTJ A;  5BNJ B;  1VQ9 A;  1AZG B;  2LJ1 A;  3DB4 A;  2QQB A;  2IN3 A;  2W2H A;  3OSS C;  3JCM g;  2K5L A;  2UZD B;  1MNE A;  2F2C A;  4A4H A;  2QXF A;  2CP3 A;  2J6F A;  3CPW A;  4GLK A;  2LQK A;  1T3S A;  1QW1 A;  4M77 F;  3DLM A;  2WIP B;  3CPW S;  1ZUU A;  3I56 T;  1MV0 B;  4DA4 A;  1WPY A;  1MHN A;  2AT1 B;  1I4K 1;  4X9C A;  4XU3 A;  5GAN h;  3RR6 A;  2KDS A;  1YI2 Q;  2YXY A;  3M9Q A;  1UHC A;  3DL1 A;  2YDL A;  4OB2 B;  5KYN A;  1OI1 A;  4F7N B;  1T0J A;  3I35 A;  3JCM Q;  4MFD A;  1ZQ1 A;  2IW8 B;  3OB9 A;  4C92 E;  1BCO A;  3FDR A;  2QGG A;  2K7A A;  1K8A U;  1X6B A;  5CYI B;  1OQK A;  4EPC A;  2PUK B;  2EYY A;  5L23 A;  3E9F A;  2QDL A;  3HP9 A;  4FT4 A;  3VYG A;  4J9F A;  2BUD A;  3RMS A;  5IHN A;  3GF5 A;  1K8A R;  1Q7Y C;  3M57 A;  2D9T A;  3EG9 B;  1PM3 A;  3PO3 S;  2WMB B;  1JRI A;  1M2V B;  1WIE A;  2COZ A;  1ZLM A;  2FO0 A;  1YI2 T;  2GTJ A;  1M8V A;  3PIP A;  4M7A C;  4C5H A;  2DK3 A;  5CK9 A;  2FZK B;  5L2W B;  4BI8 B;  1UGP B;  4OGR B;  4F04 B;  3JCM J;  3BHT B;  1N6A A;  4M7A D;  3JCM W;  1JU5 C;  4HCZ A;  2CUD A;  2EYX A;  3ZBD A;  3S3O A;  2L2P A;  4MML A;  1E6G A;  4PJO C;  3FJ5 A;  1T3L A;  3VU3 C;  4JRI A;  3OYL A;  4PJJ A;  2G6F X;  2EJG A;  2MWO A;  1CSK A;  4PJO D;  5CKE A;  3CCL A;  2I40 B;  3VS0 A;  1KSW A;  1G3S A;  1O9S A;  3ZFJ A;  1KK7 A;  1E6H A;  1A0N B;  3BHU B;  1VA7 A;  4IUU A;  5GAM e;  1WHL A;  4BE0 A;  5HNB B;  1BI3 A;  2DEU A;  1VQ7 A;  3KFV A;  2NLU A;  1NEG A;  1VQN Q;  4JS4 A;  3CCU A;  2ZZD A;  2LX7 A;  1W1F A;  1YWP A;  2C0I A;  3A8O B;  3SDZ A;  4II1 A;  1QLY A;  2LT1 A;  1TH7 A;  2IPO B;  1KFZ A;  3EG3 A;  2KI7 A;  1O9K B;  1I81 A;  2JS0 A;  1UTI A;  1SEM A;  2L0A A;  2QI2 A;  4AFQ C;  1VQ6 A;  2RN8 A;  5IT9 E;  4BCJ B;  4EON B;  3NPF A;  3EGD A;  4LOC A;  2RHZ A;  2X4J A;  3CD6 A;  1VQL A;  3PMT A;  4R0K A;  2E6Z A;  3NDQ A;  2FZG B;  3SB2 A;  1QVG A;  3TQ7 P;  4EMK B;  1DJ7 B;  3EJ1 B;  1M9S A;  5LJ5 j;  2C5X B;  1VQN T;  3JSC A;  1QVG S;  2GTO A;  1M30 A;  2CKK A;  2QFZ A;  2B86 A;  2ZAE A;  4DOW A;  3OY9 A;  2P0P A;  1LNX A;  2BE7 D;  2H8H A;  4AKG A;  2DXU A;  4BI3 A;  1VQM A;  4M7D C;  3MO8 A;  4ROC A;  2MWP A;  1GCP A;  1K1Z A;  4C8Q D;  1P92 A;  1IHV A;  3OS5 A;  3M0T A;  4LD9 K;  3M0U A;  4M7D D;  4M78 A;  4F7U E;  2YUO A;  5LJ5 g;  3FEO A;  3ASK A;  3GTM S;  1NYG A;  3G6E A;  1JBM A;  2GCX A;  1M90 C;  2QA4 Q;  5IHI A;  1MUZ A;  2DD5 A;  2EW3 A;  2KSS A;  4JJN K;  1W6X A;  2V8J A;  1ZSZ C;  2UZB B;  1H27 B;  4GBQ A;  2R5M A;  1VQ5 T;  3DDP B;  3G4S A;  2JM8 A;  4D8K A;  3CC7 Q;  2LCC A;  5KYW A;  2HAX A;  4L6V 5;  3H8Z A;  5GAN 5;  2PVO B;  2KNB B;  2RQW A;  4BE2 A;  2RM4 A;  2DJZ A;  3RKW A;  4EC9 B;  3HL8 A;  5FGK B;  4M7A E;  1NPP A;  4TVR A;  2M1H A;  4RTW A;  3JCM h;  4HVW A;  1MND A;  4HKE A;  1VYW B;  4E2F B;  2J7I A;  1S72 Q;  3O8V A;  1PNJ A;  4RTX A;  4AFU C;  2EGE A;  2PHG A;  4JX6 A;  1VOL A;  3OYA A;  1Q95 G;  2QYZ A;  4BBS M;  1UJY A;  1UNH D;  3A5Z B;  4NL2 A;  4PJO E;  1R77 A;  1PKT A;  3E19 A;  1D0X A;  1C9B A;  4LN2 A;  4RG2 A;  2DZC A;  4C92 F;  4ME7 A;  3TNW B;  1Y57 A;  3I5S A;  2A3L A;  2RA2 A;  3CCJ A;  3CC7 T;  4D6W A;  3A8M B;  2YWW A;  5HY6 A;  2FZC B;  2DFU A;  5IDP B;  2DVE A;  2BS4 A;  4HNU A;  1R8O B;  5GAN 6;  2IIM A;  4B9W A;  1M2O A;  1PD0 A;  1ZX6 A;  1BK2 A;  2GF7 A;  3LWH A;  2QQ8 A;  4NST B;  4C0Z A;  3MY5 B;  5CEI B;  1S72 T;  2HMA A;  2RJC A;  4EOS B;  1H8K A;  4OB0 B;  2EQK A;  2KAF A;  2BPM B;  4M75 A;  5KCH A;  3H0H A;  2ED1 A;  3BLR B;  3LGF A;  4XAX B;  2WSF E;  2KGT A;  5AYF A;  4N4G A;  4R56 A;  4B6M A;  4UC4 A;  3QSU A;  1SF9 A;  2XU8 A;  2A0F B;  3CC2 A;  1TTH B;  3CME Q;  1VQP Q;  3JCM X;  3HFN A;  4YC3 B;  2ROT A;  3L2Q A;  5EG2 A;  2WIH B;  2KBT A;  5IF1 B;  1YJ9 Q;  1KD1 C;  2RQU A;  4CFN B;  1B07 A;  4M75 G;  4RMO A;  1D1A A;  1JB0 E;  5IXB A;  2LQN A;  2ROL A;  1D0Z A;  2ZZD B;  3M4G A;  1FMV A;  2XK0 A;  1MMD A;  3CCE Q;  4BCQ B;  2WSE E;  3WXM B;  1FIN B;  3M54 A;  4ZTF A;  2X4X A;  2PVD B;  4M7D E;  4CI0 C;  4QVC A;  1H3Z A;  5CVI A;  1LOJ A;  1Q82 C;  3CME T;  4M77 A;  1VQP T;  3UA7 A;  1WHH A;  1OZ2 A;  3EGD B;  3OYE A;  3VYH B;  2PUO B;  3G71 A;  5GAN j;  5HKC A;  5DQW A;  4FX3 B;  1QVF S;  4J9G A;  4L5G A;  1YHQ Q;  1I1J A;  2L8D A;  4Z8A A;  2XDP A;  5CO7 A;  1YJ9 T;  2X4W A;  4F16 A;  4PJN A;  4ZGE B;  1UGS B;  4QW2 A;  2CUB A;  4AMC A;  1NZ9 A;  2CCH B;  3REB B;  3HHT B;  3VUB A;  4AFS C;  2RNA A;  1CKA A;  5GAO n;  3EHR A;  5GAN g;  4C5G A;  3CCE T;  4M77 G;  3FIF A;  4UN0 A;  2KRS A;  2DAQ A;  2RO0 A;  2KXD A;  1ZA1 B;  2RHI A;  2W9Z A;  2FRW A;  4HA8 A;  1NJI C;  1YNZ A;  4KH1 B;  4M78 B;  2O9S A;  3L2R A;  1VQ8 A;  1OOT A;  2JN0 A;  4QSH A;  2RHX A;  2OTJ A;  1VIN A;  1HJD A;  4J6X A;  4M6V A;  4O5V A;  2DD5 B;  4A53 A;  3X26 B;  2DTH A;  4C0D B;  1TXQ A;  1YIT Q;  2KR3 A;  3OBW A;  2QGS A;  2CJM B;  4F7U F;  1VQO Q;  1X2Q A;  5KYW B;  5FRO A;  2RQV A;  2EQM A;  2RQT A;  1TG0 A;  3OA6 A;  2E5K A;  2HSE B;  3EGX A;  3BHV B;  4OVA A;  1NG2 A;  3CXC P;  1I0C A;  2E65 A;  2E10 A;  3J81 E;  2CZ7 B;  4CC7 A;  2A28 A;  4RG8 A;  3BG5 A;  3M0Q A;  2CP5 A;  1K76 A;  3G1J A;  1WNL A;  1EIF A;  1H64 1;  3L2V A;  1LCK A;  1ZBX A;  2AKK A;  1BI1 A;  5A0G A;  4AFZ C;  1GCQ A;  4LDW A;  4PFZ A;  2QEX A;  4M7A F;  3OYG A;  4KUI A;  5FU7 B;  2KQW A;  2NWM A;  1N8R U;  4IMY B;  4OP0 A;  3JB9 G;  5KH6 A;  1OPL A;  1YIT T;  4MDX A;  4BE1 A;  2P4T A;  1YWO A;  4IUV A;  8AT1 B;  2DRM A;  1WJS A;  3NHN A;  5CQX A;  2C0O A;  3I55 T;  3OW2 A;  1VQO T;  4ATO A;  1M4Z A;  1D3U B;  4BCM B;  2X9H A;  3QKJ A;  1N8R R;  5CQY A;  3CMA A;  5CKD A;  4PJO F;  2R7G A;  4EMK C;  2GQV A;  2YSQ A;  3OW2 S;  4EOQ B;  2M02 A;  3J7A F;  1QVG P;  1ACM B;  2QDY B;  4G6L B;  2WHB B;  2YRC A;  4YOS A;  4QKU A;  2LJ0 A;  1GXI E;  2A36 A;  2O9V A;  1AOJ A;  4J7F A;  4J9E A;  1RAF B;  1XJW B;  2A37 A;  3VRY A;  5LJ3 f;  3KXT A;  4M75 B;  1OIY B;  4N4H A;  5FWB A;  3LWI A;  2KT1 A;  5I2S A;  4JLI A;  1XNI A;  2QQS A;  2JNG A;  4CC3 A;  1UDL A;  3UT1 A;  3M0R A;  5GAN 8;  1FX7 A;  2EYZ A;  2V26 A;  3HRS A;  4FYW B;  4ZN1 A;  2BTT A;  3P8B B;  3BY7 A;  2C5V B;  1TS9 A;  2H3E B;  3VKH A;  2EJ9 A;  2C6T B;  3BE3 A;  2RJD A;  2QAZ A;  3C0C A;  4ORZ A;  1VYV A;  4J9I A;  1TSF A;  3BLH B;  5I22 A;  2LQ8 A;  4O6J A;  4FYV B;  2CDT A;  3LX7 A;  4YTL A;  5J3B A;  4XU1 A;  4N0A C;  1K0X A;  3DJB A;  3H4C A;  2DNU A;  2M51 A;  4CFU B;  2DF6 A;  4L59 A;  1NE8 A;  5GJW B;  3CCR Q;  3A1P A;  1YJW Q;  1JXO A;  4Z02 A;  3EH2 A;  5GAO r;  1GFD A;  4CRL B;  2Z0W A;  1GL5 A;  4LDV A;  4M77 B;  4DOV A;  4X34 A;  4JRP A;  2H3J A;  2RB6 A;  4MMK A;  1E9H B;  1XTD A;  2E3I A;  2WPA B;  5KYY A;  1ZA2 B;  4M7D F;  2OX7 A;  1VYU A;  1H1S B;  1KJW A;  2A7Y A;  4BCN B;  2V1Q A;  3NTH A;  4XU0 A;  1KC8 U;  4BCF B;  2F1L A;  2JW4 A;  2DBM A;  1X01 A;  2MYS A;  5ACB A;  2XI9 A;  4NC6 A;  2JM9 A;  2E5Q A;  1H3H A;  1OU9 A;  3ER0 A;  1KC8 R;  1OUL A;  4XTY A;  3CCR T;  1YJN A;  1YJW T;  2D8H A;  2QGF B;  4BCO B;  4DBR A;  1RAH B;  4YOZ A;  1UNL D;  3RBB B;  2VYT A;  4KUD K;  1D09 B;  1OEB A;  3OYY A;  1M1K C;  2DIG A;  3OMG A;  1X2K A;  1G8X A;  5GMK h;  3MET A;  3FB9 A;  4KBM B;  4ROE A;  1SSH A;  3JCM e;  1UHF A;  4BCH B;  4F7L B;  5GAN 7;  5LJ3 h;  4XTX A;  2JS2 A;  4J7I A;  2HDA A;  3HB9 A;  2D1X A;  4CC4 B;  4ZGD B;  2ATC B;  4I3Z B;  1U3O A;  3MI9 B;  1GFC A;  2JTE A;  3H0F A;  3VKG A;  2MI6 A;  4F6S B;  3EGX B;  3AHU A;  3WVD B;  2QF7 A;  3REA B;  1U5S A;  4PLI A;  3CCS A;  3HRU A;  2LW4 A;  3I56 A;  1XOV A;  2IW6 B;  2AIR B;  1SRL A;  4BCQ D;  1X6G A;  1KQS A;  3KHI A;  4ELZ C;  4LDX A;  4DBH A;  1WDX A;  2YUQ A;  4RUG A;  3CCL Q;  1G5V A;  5I21 A;  4BY6 B;  4EOI B;  1KQS S;  2SEM A;  2V8I A;  3SHW A;  1AD6 A;  2WFY B;  1H25 B;  2CP6 A;  3LYI A;  3HBL A;  3LLR A;  2R58 A;  3OYC A;  2VXE A;  1TU0 B;  1B7T A;  1AZE A;  4JRK A;  3RUX A;  4C5I A;  2WXV B;  4EOL B;  3MPU B;  4FYX B;  1GY3 B;  4QQG A;  1SRM A;  3CCU Q;  3QZ5 B;  5CAI A;  1OL2 B;  4Y91 A;  1YI2 A;  2LCL A;  3CCV A;  1MMN A;  5FWC A;  3OYJ A;  1K0S A;  3CCQ A;  2CZ1 B;  1UE9 A;  1LVK A;  2MF2 A;  2OI3 A;  4XU2 A;  4M78 C;  3VRZ A;  2COY A;  1H1P B;  3OYF A;  4M4Z A;  4ZGJ B;  1ZBJ A;  2RMO A;  5I11 A;  4M78 D;  1H24 B;  4C0D C;  1K9M U;  2XKO C;  1VQL Q;  3N5B B;  3QZ9 B;  4NS5 A;  1NEB A;  3M5A A;  4JPB W;  2UZL B;  2CH4 A;  4E6R A;  3NMZ C;  3X20 B;  3JRZ A;  4AG1 C;  4JJC A;  4AI6 A;  4EC8 B;  1M1G A;  1K9M R;  3CCM Q;  2VWF A;  3VJP A;  2E41 A;  4F17 A;  1JO8 A;  3HTR A;  2K9G A;  4LD6 A;  3CCU T;  2DBK A;  4FSS A;  1YCS B;  3UPU A;  1UG1 A;  5GAO m;  2RJE A;  4A4G A;  1IXD A;  1VQM Q;  4EDU A;  1RI9 A;  1BI0 A;  2COW A;  1X6O A;  3QYG B;  1K4U S;  3IQL A;  3TU4 K;  2LNH B;  4KH0 B;  2XG8 D;  4J9D A;  4JRQ A;  4HLQ A;  3G6E Q;  3MY1 B;  2Y4Y A;  2M0O A;  5KYY B;  2X3W D;  4CFW B;  2X4Y A;  2BZ8 A;  2VGN A;  1VQL T;  4FM4 B;  1X69 A;  2D6F A;  1UUE A;  1BI2 A;  3JV3 A;  3A98 A;  1QQJ A;  2GFA A;  3G4S Q;  1AWJ A;  3OW2 P;  3CCM T;  1UGR B;  3ZL7 C;  3OBY A;  2OJ2 A;  3X28 B;  1B3Q A;  1W4S A;  4BCM D;  4C8Q C;  2M16 A;  4CFM B;  5FRM A;  5GAM d;  2BE9 B;  2HSP A;  1VQM T;  2O01 E;  1UGV A;  4Z88 A;  1K8A C;  2E1H A;  4EOO B;  1W2B A;  3HSB A;  4F7U G;  1OGU B;  2F69 A;  2Y4X A;  1S1N A;  4M75 C;  3VV0 A;  2AZS A;  4HL4 A;  3JCM V;  3GBQ A;  2KYB A;  4JZ4 A;  4KGV B;  3Q1J A;  4RTV A;  4AG2 C;  4WF2 A;  1UEC A;  1W2B S;  3OQ5 A;  3RKY A;  3G6E T;  4M75 D;  1X43 A;  3GP8 A;  3MEU A;  5LJ5 e;  4ROD A;  5CKB A;  2VV5 A;  2RK2 A;  2GNC A;  2K3X A;  2CZ0 B;  2KE9 A;  4WCI A;  5HBH B;  4RCC A;  2DET A;  3L2W A;  5DY9 A;  2OTL Q;  3G4S T;  3RNJ A;  3CCJ Q;  4KT0 E;  2QAS A;  1AT1 B;  4HT9 A;  2C06 A;  2DME A;  4QVD A;  2ZPG B;  4Y92 A;  2NYS A;  3EGU A;  4X9D A;  2C4G B; 
#chains in the Genus database with same CATH homology
 2E12 A;  3HHT B;  2PQW A;  1KHC A;  2ZPF B;  3VUB A;  5GAO n;  1VQ5 A;  2DKG A;  3CC4 T;  5GAN g;  4R55 A;  3CCV T;  2O4X B;  2RH2 A;  3C12 A;  4JUV A;  2FYK A;  4XK8 E;  4M77 G;  5L8R E;  3FIF A;  4C5G A;  3CCQ T;  4Z6Y A;  3A8G B;  2DAQ A;  2LDM A;  2RO0 A;  3SWN A;  4RKU E;  4AKH A;  2QTX A;  1Q81 C;  2QQ9 A;  4PJO G;  4A4K A;  2RHI A;  5KCO A;  1Q86 U;  4BI4 A;  4HCC A;  3JB9 F;  4A54 A;  4HA8 A;  4JDS A;  1I8F A;  3ZEH A;  1NJI C;  3V7R A;  3CEY A;  3CCL T;  3QJ6 A;  2QA4 T;  4XTW A;  1VQ8 A;  4M78 B;  5GAM j;  1WJQ A;  3L2R A;  4E7J A;  2JTF A;  3H6Z A;  2JN0 A;  4RCB A;  5GAM f;  3OYB A;  2DEQ A;  4Y28 E;  4ELJ A;  4QSH A;  2RHX A;  1KC8 C;  2OTJ A;  4M78 E;  1K73 C;  5EJC A;  2KR6 A;  3HO8 A;  4J6X A;  4M6V A;  5D6X A;  3JB9 I;  2AHJ B;  3VUZ A;  2ZPI B;  3SD4 A;  4O5V A;  2OTL T;  2DD5 B;  1M1F A;  1WJR A;  4A53 A;  4OMF B;  3X24 B;  1WGS A;  2JUF A;  3X26 B;  1N9R A;  1Y71 A;  2DTH A;  2RD1 A;  3C95 A;  4IUR A;  4J5Y A;  4KUL A;  4M77 D;  1BIB A;  4C0D B;  4P5N A;  1YIJ A;  2YLC A;  1VQ7 T;  5J26 A;  3OBW A;  3F70 A;  1G3W A;  5A0L A;  4BAC A;  4F7U F;  1VIE A;  2XD0 A;  2F5K A;  1YJN T;  2R57 A;  2F5T X;  3OS2 A;  5FRO A;  2KMG A;  2XID A;  2EQM A;  4LDY A;  3MCA B;  5GAM g;  1JJ2 A;  2VC8 A;  4HT8 A;  3P8H A;  2EYQ A;  3OA6 A;  2LX9 A;  4EMK A;  2DTI A;  1D3B A;  3TEE A;  3GNG A;  1BKB A;  4OVA A;  1MGQ A;  1VQK T;  2RI3 A;  3JCM f;  1XQH A;  1NPR A;  4DQ2 A;  3TW6 A;  3A8L B;  2DXC B;  2E70 A;  3P8D A;  2ZPE B;  2E65 A;  2EQJ A;  3CXC A;  2E10 A;  2QDJ A;  1N27 A;  3SWN C;  3J81 E;  3CPF A;  2BS3 A;  1Y96 B;  3UWN A;  2CZ7 B;  2JVV A;  1M5Q 1;  3V8K A;  3L2U A;  3E9G A;  2ZCF B;  3CCR A;  4RG8 A;  5CIU A;  5GAN 2;  3BG5 A;  1YJW A;  5DLO A;  2WJ9 A;  3OYH A;  3CXC S;  1VQ6 T;  1WNL A;  1ZHI A;  2DZ9 A;  3FC3 A;  3BG9 A;  1EIF A;  1H64 1;  1OZ3 A;  3QYH B;  5FU7 C;  3L2V A;  1ZBX A;  3OYK A;  4ZTJ A;  1VQ9 A;  2HNI A;  1BYM A;  1BI1 A;  4F7U A;  5A0G A;  3DB4 A;  2QQB A;  4LDW A;  3CC2 T;  3CD6 T;  4MDW A;  3OSS C;  4FL6 A;  2QEX A;  3OYG A;  3X25 B;  2ZGW A;  2K5L A;  3OMC A;  4KUI A;  5FU7 B;  2KQW A;  3QXE B;  2HQE A;  2KMT A;  3ME9 A;  1WQW A;  3JB9 G;  4OP0 A;  1S72 A;  4A4H A;  1N8R U;  5KH6 A;  4MZT A;  4NL3 A;  2QXF A;  3QBY A;  4E47 A;  2RJF A;  2VUB A;  4BE1 A;  1YIT T;  4MDX A;  2P4T A;  1RL2 A;  5M9O A;  4GLK A;  3CPW A;  3HRT A;  4IUV A;  2LQK A;  2OAU A;  1VQO T;  1WJS A;  5CQX A;  5FU6 C;  3I55 T;  3OW2 A;  4ATO A;  1QW1 A;  4M77 F;  1M4Z A;  3QDR B;  3QKJ A;  3RES A;  2K4Y A;  5CQY A;  3DLM A;  3T9N A;  3CMA A;  2DO3 A;  5CKD A;  4J83 A;  4PJO F;  3CPW S;  2CS7 A;  3I56 T;  2PVG B;  2GQV A;  2VXF A;  4EMK C;  4DA4 A;  3OW2 S;  1WPY A;  5GMK j;  1MHN A;  5J39 A;  3J7A F;  1QLB A;  1I4K 1;  4X9C A;  4XU3 A;  5GAN h;  2KDS A;  1PSE A;  2QDY B;  3JB9 D;  3M9Q A;  3MHX A;  3C94 A;  2EAY A;  4C8Q E;  4M7A A;  1GXI E;  3QUI A;  3CCM A;  1VQN A;  5LJ3 j;  3DL1 A;  4OB2 B;  2MMP A;  4J7F A;  1KD1 U;  1OI1 A;  5LJ3 f;  2DXB B;  3MP1 A;  3KXT A;  4M75 B;  4C92 B;  3JCM Q;  4MFD A;  1KHI A;  5HK0 A;  4N4H A;  4MZM A;  3LWI A;  3S3N A;  5I2S A;  4JLI A;  1ZQ1 A;  1QVF A;  1XNI A;  3OB9 A;  2JTM A;  4M75 E;  4C92 E;  2QQS A;  3FDR A;  2JNG A;  2BS2 A;  1K8A U;  3G71 T;  1B34 A;  3J80 E;  3UT1 A;  4EPC A;  4PJO A;  4AKI A;  5GAN 8;  1FX7 A;  4F7U B;  2PUK B;  2BIV A;  3QYE A;  4ZN1 A;  3HRS A;  3CBP A;  1HK9 A;  3E9F A;  3HP9 A;  3BY7 A;  3P8B B;  4FT4 A;  3VYG A;  2EWN A;  2DTO A;  2BUD A;  5KE2 A;  3RMS A;  2FB7 A;  4BY6 C;  1WQ7 A;  4BD3 A;  3GF5 A;  3KUF A;  3VKH A;  2EJ9 A;  5LJ3 g;  4BDZ A;  5D6W A;  1Q7Y C;  2RI2 A;  3CCE T;  2RJD A;  4MZP A;  4M7A G;  3M57 A;  2D9T A;  4E7I A;  3BW1 A;  3HZJ A;  5GAM h;  3CME A;  3RIR A;  1Q82 U;  2LQ8 A;  1JRI A;  5GAN 3;  2LNV A;  4MFE A;  2MAM A;  3PMI A;  4O6J A;  3MP6 A;  5FLX E;  1YI2 T;  1M8V A;  4QQ6 A;  3LX7 A;  4YTL A;  5J3B A;  3PIP A;  2DD4 A;  4XU1 A;  4N0A C;  4C5H A;  4M7A C;  2DK3 A;  4PNO A;  3LGL A;  3H4C A;  5CK9 A;  4IUP A;  5GAN e;  2WSC E;  4N4I A;  4BI8 B;  4L59 A;  1NE8 A;  5HK3 A;  1UGP B;  3JCM J;  1N6A A;  2G3R A;  2P0K A;  4M78 G;  4Z02 A;  4J6Y A;  4M7A D;  5GAO r;  3JCM W;  4OB1 B;  1RI0 A;  4M77 C;  4HCZ A;  1K9M C;  3RER A;  3ZBD A;  3MEV A;  4MML A;  3S3O A;  2QQR A;  4PJO C;  1YHQ T;  3G7Z A;  4LDV A;  5GAO p;  4M77 B;  2QQA A;  4DOV A;  4X34 A;  3CCJ T;  3PFS A;  3VU3 C;  4JRI A;  3C4S A;  2H3J A;  2RB6 A;  4MMK A;  3OYL A;  4JRP A;  3S3M A;  1Q81 U;  3BG3 A;  1XTD A;  2EJG A;  2MWO A;  5IAY A;  3JCM g;  4PJO D;  5CKE A;  5LJ5 d;  2RK1 A;  3JCM c;  3VYG B;  3DLL A;  2QA4 A;  1NJI U;  3CCL A;  4M7D F;  4OGC A;  4BUG A;  4XTZ A;  1O9S A;  1G3S A;  3ZFJ A;  2A7Y A;  3QYB A;  3NFC A;  3NTH A;  4XU0 A;  5I2M A;  4C0F A;  1KC8 U;  3BDU A;  4HCB A;  1K73 U;  4IUU A;  2OTL A;  3JB9 J;  5GAM e;  1VUB A;  2YRV A;  4BDY A;  4HNV A;  3CC7 A;  1X01 A;  4PLL A;  1IRE B;  4BE0 A;  2DIQ A;  2XI9 A;  1BI3 A;  4NC6 A;  3WVE B;  5A0D A;  2E5Q A;  3OSV A;  1VQ7 A;  3ER0 A;  2LT4 A;  1V29 B;  2NLU A;  4XTY A;  1AHJ B;  5CKH A;  3CCR T;  1YJN A;  1YJW T;  3SWN B;  3M59 A;  4JS4 A;  3CCU A;  4Q5W A;  4C8Q A;  2ZZD A;  3INZ A;  1U1S A;  2KY9 A;  3A8O B;  2IVW A;  2M9U A;  2VYT A;  4KUD K;  3SDZ A;  3OYY A;  3QPH A;  1M1K C;  3JCM b;  4II1 A;  4A4F A;  4M7D A;  2DIG A;  3OMG A;  3OYI A;  2QEX T;  5GAN 4;  5DM7 R;  2EKO A;  2LT1 A;  1TH7 A;  5GMK h;  3MET A;  3FB9 A;  4OB3 B;  4KBM B;  2LTO A;  3L1A A;  3QG1 A;  4J6W A;  4QVZ A;  4IKF A;  5C0M A;  3JCM e;  1I81 A;  3V7S A;  2LVM A;  3E1S A;  3RMQ A;  5GAN 7;  2QI2 A;  5LJ3 h;  4OGE A;  4XTX A;  4IUQ A;  1VQ6 A;  4J7I A;  4CRI A;  5IT9 E;  3BFM A;  1Y07 A;  4LOC A;  2RHZ A;  3CMA T;  3HB9 A;  3PT9 A;  4B9X A;  3MEW A;  2X4J A;  4ZGD B;  5FU6 B;  4V2S A;  1G3Y A;  3DKM A;  3EFS A;  1VQL A;  2EFI A;  3PMT A;  3CD6 A;  2B8A A;  2E6Z A;  4NOY A;  4IUT A;  4M78 F;  4C8Q G;  3LH0 A;  4J8O A;  3SB2 A;  1QVG A;  3M53 A;  4EMK B;  3VKG A;  2MI6 A;  4JX4 A;  3M58 A;  3R6O A;  1DJ7 B;  1D3B B;  1IZ6 A;  1M9S A;  1VIF A;  4GY5 A;  4M7D G;  5LJ5 j;  2CYZ B;  3FRN A;  3LW5 E;  1JJ2 S;  3AHU A;  1VQO A;  1VQN T;  3I55 A;  5LJ5 f;  4C0G A;  3JSC A;  5GAO q;  1QVG S;  3OS1 A;  4JS5 A;  3WVD B;  2VGM A;  2QF7 A;  2V8K A;  2XHC A;  4XQ3 A;  4PLI A;  3CCS A;  2CKK A;  3HRU A;  2QFZ A;  3HKS A;  1KQ2 A;  3I56 A;  4DOW A;  2JZ2 A;  3OY9 A;  2O4X A;  1UGQ B;  2P0P A;  1LNX A;  1XOV A;  1VQM A;  4AKG A;  2DXU A;  2ZPH B;  4BI3 A;  4M7D C;  3JAM E;  3MO8 A;  2MWP A;  3QII A;  2GFU A;  4C8Q D;  1P92 A;  3A8H B;  3PIO A;  3OS5 A;  4EMH A;  1VQ4 A;  3GIB A;  4LD9 K;  5LL6 S;  3V8J A;  4M7D D;  4M78 A;  5GMK e;  4F7U E;  1KQS A;  1I5L A;  5LJ5 g;  2K5I A;  2FVU A;  3FEO A;  5FRN A;  3ASK A;  3KHI A;  3MEA A;  4ELZ C;  4FIB A;  3RKX A;  2HBP A;  3G6E A;  4E7K A;  4LDX A;  1JBM A;  2HD0 A;  2GCX A;  3EFR A;  1M90 C;  1G5V A;  5I21 A;  4BY6 B;  5LJ3 e;  2DD5 A;  5C6S A;  1VQP A;  1KQS S;  3V8L A;  3QJY A;  2KSS A;  2V8I A;  4JJN K;  2LC4 A;  2XIC A;  2V8J A;  5GAO l;  2RHU A;  2R5M A;  3M4Y A;  3MP8 A;  1VQ5 T;  1QP3 A;  3LYI A;  2YHT A;  2XDD A;  3G4S A;  3HBL A;  3LLR A;  2K57 A;  2R58 A;  3OYC A;  1YJ9 A;  2LCC A;  2VXE A;  5D6Y A;  2HAX A;  2Y90 A;  4L6V 5;  2YLB A;  4XTU A;  1Q86 C;  3H8Z A;  4JRK A;  5GAN 5;  2PVO B;  3RUX A;  4C5I A;  4VUB A;  4M7A B;  5CCA A;  1Q7Y U;  4BE2 A;  1OYX A;  4QQG A;  2RM4 A;  2DJZ A;  1VQ8 T;  3RKW A;  2DXC A;  3HL8 A;  4M7A E;  3QZ5 B;  4EMG A;  3L42 A;  5CAI A;  1NPP A;  3NTI A;  4FSX A;  4TVR A;  3GPL A;  3CC4 A;  2M1H A;  1Y96 A;  2LCL A;  4Y91 A;  3OYM A;  3JCM h;  3CCV A;  3CBM A;  1YI2 A;  3OYJ A;  1G3T A;  3UDC A;  3JB9 H;  3CCE A;  3QWL A;  4HKE A;  3CCQ A;  2EJF A;  3M55 A;  2XDB A;  2CZ1 B;  2HQX A;  2CGH A;  2MF2 A;  1U1T A;  1YBY A;  3O8V A;  4XU2 A;  1B34 B;  4M78 C;  3JCM P;  2P0Q A;  4PJO B;  4C8Q F;  1YIJ T;  4MIM A;  4M77 E;  3VKI A;  4JX6 A;  3OYA A;  4FT2 A;  3OYF A;  4BBS M;  4ZGJ B;  2DXT A;  3A5Z B;  4NL2 A;  4PJO E;  1BIA A;  1X75 C;  3QO3 A;  5GMK m;  3E19 A;  4M78 D;  1O75 A;  4RG2 A;  2DZC A;  2DPP B;  4M75 F;  4C92 F;  4C0D C;  1K9M U;  4ME7 A;  2XKO C;  2I2L A;  1YHQ A;  1QP2 A;  3N5B B;  2KK4 A;  3QZ9 B;  2A3L A;  2RA2 A;  3CCJ A;  4NS5 A;  4BB7 A;  3CC7 T;  3M5A A;  4PL6 A;  5IN1 A;  3S6W A;  4JLG A;  4D6W A;  3A8M B;  4BBR M;  5HY6 A;  3X20 B;  3JRZ A;  4AI6 A;  2FL7 A;  1M1G A;  2L5Q A;  2DVE A;  5LJ3 d;  2EIF A;  2BS4 A;  2DD4 B;  4HNU A;  1R8O B;  2E41 A;  3VJP A;  4ELY C;  4B9W A;  1QVP A;  2FHD A;  5GAN 6;  2R5A A;  4LD6 A;  3CCU T;  2K2V A;  1VQ9 T;  2GF7 A;  3UPU A;  1FXX A;  1LJO A;  1VQK A;  5GAO m;  2RJE A;  2QQ8 A;  4A4G A;  3LWH A;  1Y7X A;  4M7A F;  1N8R C;  3NTK A;  5CR2 A;  4C0Z A;  2G77 A;  4EDU A;  5GAN d;  1S72 T;  2RJC A;  2DXB A;  2CZ6 B;  4OB0 B;  2EQK A;  2KAF A;  3PNW C;  4M75 A;  4C92 A;  5KCH A;  5GMK i;  1U8R A;  2IG0 A;  1BI0 A;  3LGF A;  4XAX B;  2WSF E;  5LJ5 h;  1X6O A;  3QYG B;  1HXD A;  3BDL A;  3OYN A;  5AYF A;  3TU4 K;  2XG8 D;  4N4G A;  5KE3 A;  4R56 A;  4JRQ A;  3GLX A;  4HLQ A;  4UC4 A;  3QSU A;  2XU8 A;  1KG1 A;  2Y4Y A;  2M0O A;  5CKF A;  3CC2 A;  2X4Y A;  3FLG A;  1M1K U;  2VGN A;  3L2Z A;  1VQL T;  4FM4 B;  2EQU A;  2PU9 B;  2K3Y A;  3JCM X;  3CBO A;  1FWZ A;  3HFN A;  2WAC A;  2D6F A;  3L2Q A;  1N9S A;  4C5E A;  4ZN3 A;  4E7L A;  1BI2 A;  1UEB A;  4XTV A;  1YIT A;  1PSF A;  3QHS A;  5EG2 A;  2GFA A;  3EAE A;  1E7P A;  4HNT A;  3CCM T;  1UGR B;  1FKM A;  3GOX A;  1KD1 C;  2BKD N;  3OBY A;  4M75 G;  4C92 G;  2ZPB B;  3TW7 A;  4RMO A;  3OS0 A;  3X28 B;  2JOY A;  5GMK l;  1JB0 E;  1KQ1 A;  1W4S A;  4C8Q C;  2LRQ A;  5DLQ E;  3CCS T;  2M16 A;  5FRM A;  5GAM d;  3OYD A;  3M56 A;  1VQM T;  2O01 E;  3SFM A;  1K8A C;  2E1H A;  4C8Q B;  2ZZD B;  2X35 A;  1W2B A;  3HSB A;  3M4G A;  4F7U G;  2F69 A;  2KVQ G;  2Y4X A;  4E7H A;  2XK0 A;  4M75 C;  3VV0 A;  4C92 C;  1VQ4 T;  4HL4 A;  4M7D B;  3JCM V;  4N0A A;  2WSE E;  4QQD A;  3WXM B;  3M54 A;  4ZTF A;  2X4X A;  3Q1J A;  3HFO A;  3HPW A;  4WF2 A;  2PVD B;  4M7D E;  4CI0 C;  3KBG A;  3OQ5 A;  3RKY A;  4QVC A;  1W2B S;  4JX5 A;  1H3Z A;  3G6E T;  1YCY A;  4M75 D;  4C92 D;  2D0Q B;  3DB3 A;  5CVI A;  3GP8 A;  1LOJ A;  2E64 A;  2E6N A;  3MEU A;  5LJ5 e;  1Q82 C;  3PTA A;  3CME T;  2RI5 A;  2RHY A;  4M77 A;  5CKB A;  1VQP T;  2K5F A;  3URG A;  2VV5 A;  3FJP A;  3GNF B;  4OF1 A;  3V7C A;  1OZ2 A;  3G71 A;  2RK2 A;  3VYH B;  2PUO B;  3OYE A;  5GAN j;  5HKC A;  5A2Q E;  2K3X A;  2CZ0 B;  3JCM d;  5GAN f;  4RCC A;  1QVF S;  4A4E A;  3L2W A;  4LDU A;  2L89 A;  4L5G A;  5DY9 A;  3TRE A;  3G4S T;  1UB4 A;  2L8D A;  1SSF A;  4KT0 E;  2XDP A;  5CO7 A;  1YJ9 T;  2X4W A;  4HT9 A;  2C06 A;  4ZGE B;  1UGS B;  4FU6 A;  4QW2 A;  3PGG A;  4QVD A;  2ZPG B;  2L3R A;  1NZ9 A;  1M90 U;  4PKC C;  4X9D A;  3TCJ A;  2OTJ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...