1AHJB

Nitrile hydratase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
b'MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRILE HYDRATASE (SUBUNIT ALPHA)
publication title Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold.
pubmed doi rcsb
molecule tags Lyase
total genus 53
structure length 212
sequence length 212
chains with identical sequence D, F, H
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ahjB02
2DXCB 3A8GB 2DD4B 1PSEA 3LW5E 4L6V5 1QP2A 2ZPHB 4RKUE 3HHTB 2ZPFB 4OB3B 1UGPB 2CZ7B 4Y28E 2PVDB 3WVEB 1IREB 2D0QB 3A8MB 4ZGEB 2ZCFB 4ZGDB 2ZZDA 3X25B 1QP3A 3WVDB 2DD5A 3QZ5B 2PVOB 1V29B 2DXCA 2CZ0B 3X24B 2DD4A 3QZ9B 2ZPEB 1UGSB 3VYHB 3QYGB 5L8RE 1GXIE 4FM4B 2PUOB 1DJ7B 2PUKB 2WSCE 2CZ1B 3A8OB 4OB1B 3A8LB 1PSFA 2DXBB 2ZPGB 1UGRB 3QYHB 3X28B 3A8HB 1UGQB 2DPPB 2WSEE 2DXBA 2ZPIB 2ZPBB 3X26B 1JB0E 2O01E 2CZ6B 3VYGB 4OB2B 4ZGJB 2WSFE 2PVGB 2ZZDB 4XK8E 2AHJB 1AHJB 2CYZB 3QXEB 3X20B 4KT0E 2DD5B 4OB0B 3VYGA 2QDYB 2PU9B
chains in the Genus database with same CATH superfamily
1QLBA 1ZA2B 4EMKB 4MZTA 1Z9ZA 1T3SA 1GRIA 5ECAA 1YN8A 3QDRB 3A8GB 1CSKA 2DEQA 3CC7A 1WPYA 4KRDB 3GP8A 3QKJA 2DE0X 3VRZA 4M7AB 2JN0A 1UGPB 1ZUUA 3RESA 4ORZA 1K0SA 2EAYA 4QVDA 1H3ZA 1YITT 2RHXA 5LJ3e 2D1XA 4IIMA 1Q95G 3EG0A 2LJ0A 2L3QA 1VQ4A 1NE8A 2QQ8A 1NEBA 1MUZA 1PCXA 2QEXA 1LJOA 2MYSA 3LGLA 1U5SA 4JLGA 2VV5A 5GAN8 1A0NB 4BCJB 1J3TA 2K3BA 4PKCC 4PJLA 2GCXA 2GQIA 4XTVA 2OAUA 4EC9B 2ZPEB 1R0BG 3CD6Q 5HCKA 4OP0A 5HBHB 2QQAA 2YWWA 2HZYA 2JMCA 2WJ9A 3IQLA 1IO6A 4DBHA 1GXIE 5CKEA 4PJOE 1YFNA 1I8FA 1ZBJA 1P5EB 2MI6A 4IUPA 4OB1B 2RD1A 3PVQA 1MMDA 3OW2A 2ZPGB 4II5B 2PTKA 1AISB 3CCJQ 3JCMJ 1S72T 1FVVB 2LP5A 2HDAA 4M75F 2UZLB 2QTVA 2EYXA 1YP5A 2IW6B 5KYXA 2LRQA 1K0XA 1N6AA 1OL1B 3E2UA 3OYHA 3S3OA 1VOMA 3PIOA 3EGDB 3CCUT 3L2QA 2W0ZA 2XI9A 1ZX6A 2DLPA 2AK5A 2KMGA 4EOIB 2RQRA 3EGDA 2DXCB 4M7AG 4XTZA 5KCHA 3DLLA 2LZ6B 4AG1C 2DRMA 2DMEA 2UZBB 3THKA 2J6OA 1QQJA 2VXFA 2KQWA 3EH2A 3DB3A 2IVWA 4JZ3A 1EFNA 4OF1A 3CCVT 2M0OA 2CZ7B 2KRSA 1M90C 1G2BA 4AMCA 2E12A 1N8RU 1JEGA 1RAHB 4BCOB 1KD1R 1RAFB 2AZVA 2OI3A 4HCBA 1WHGA 4X9CA 1OYXA 1EX4A 5I5ZB 2CDTA 4BCFB 1M3AA 4YOZA 1VQKQ 1O75A 4M75C 3OYGA 1KC8C 2K5FA 4FYVB 4K11A 2KROA 4C5EA 1Q86R 5CKFA 3MKDA 1UTIA 2D6FA 1JKWA 1GY3B 3NTHA 4M7DB 4E47A 4AI6A 1UEBA 3G4ST 2RO0A 1WIEA 5FU7B 3JV3A 1ABQA 2PK9B 3OBYA 2X1NB 4FM4B 5IDNB 4IKFA 4II1A 1D3UB 1FMVA 5HY6A 3TNHB 3BHTB 2WFYB 3CCRQ 4DBQA 5IAYA 1VQ7T 4RTZA 5IXFA 3CD6T 1WX6A 2W9FA 3OW2S 1JXMA 2WIPB 2PQWA 3UA6A 1H4LD 5CYIB 1MGQA 2ZPBB 1WZOA 2L3RA 3JCMf 1K8AC 3EAEA 3VS1A 3DB4A 2D0NA 3LX7A 1QVGP 1H3HA 2I0NA 2LJ3A 4M7AD 4JZ4A 2A08A 4WTOB 2DL3A 1VQKA 2W99A 1MNEA 5J26A 2ESWA 5GMKl 3CCJT 4HVWA 1MV0B 1XOVA 2P0PA 2X4JA 2MMPA 4AFZC 4JJBA 2CP7A 4RG2A 4CC2A 4IIOA 2E70A 1RAAB 3M4GA 5CO7A 1YIJQ 3TNIB 1D0YA 1PSEA 2COWA 3LW5E 3HFNA 1QKXA 2QI2A 4MDXA 2HQHA 2UUEB 2RI3A 2KNBB 4BY6B 2VGMA 5AYFA 1M1KC 3CMAT 1H28B 3MEVA 2A3LA 1IREB 1C1AA 2KK4A 1MHNA 4OMFB 4F04B 3CCRA 4OMOA 4Z88A 3J7AF 2EGAA 2BS3A 3WVDB 1RI9A 2UZDB 4CFUB 2IG0A 3NTKA 4M7DG 1W2BS 3JAME 2F2CA 2KRMA 1M27C 4R0KA 3JCMc 3JRZA 3DLMA 3REBB 4E7ZA 4F7UF 2DTHA 3EFOA 4EOMB 2BZYA 3JCMe 2RJFA 1KG1A 2BKZB 4ESRA 3CCSQ 4ELYC 1TD6A 1Y0MA 4JLIA 1X6OA 4XU0A 4M77A 2C0TA 2M51A 2ZAEA 3ZFJA 2YRCA 2HL3A 3HFOA 2BUDA 2OTLT 1G83A 3OQ5A 1H92A 1UB4A 2EW3A 5FU6C 2PUOB 4DBRA 4C92A 2DTIA 4AFSC 1HJDA 3SWNC 3RKXA 4LDXA 3BHVB 3MP1A 1OOTA 2LT1A 1BI2A 2DL4A 1YIJA 4BY7X 5LJ5g 1NM7A 5CCAA 1NLPC 4R55A 4CFXB 2QQ9A 3H0IA 5CVIA 5LJ3j 2C5XB 3CCLQ 4OMQA 2DFUA 5CQYA 4EMKC 4KULA 2DJQA 4J7FA 3MI9B 5KYWB 1D1CA 2IIMA 2O01E 5GAOn 2CZ6B 1BBZA 4LDUA 1U1SA 3H41A 3N5BB 2JTEA 5LJ5h 3QHSA 4M7AE 4F7JB 4J9BA 5HNBB 1O9KA 3VUBA 3CCEQ 2DL8A 1SEMA 2HEQA 1E7PA 2A0FB 4J6YA 3RMSA 2ABLA 1M9SA 3EG1A 3H9NA 1VQ6T 1SPKA 2K5LA 1AZGB 2QGFB 3EFSA 3OBWA 2VVKA 5KE2A 4EOOB 2F2VA 1D1AA 2X4WA 4BB7A 4PJOA 2FRYA 4M7DD 4JS4A 5GAMg 2R5MA 4E7SA 4QSHA 1WHJA 3A5ZB 4M77G 1K9MC 5KCOA 4YTLA 3G33B 2O31A 3T9NA 3CCLA 1WQ7A 1JU5C 1E6GA 1NLOC 5IXBA 1QLYA 1AZEA 1NYGA 4TVRA 4JRKA 1H26B 4CFVB 5GAMh 2CUBA 3OYBA 2OTJQ 2EGEA 1WJQA 2CP5A 4P5NA 1TU0B 3HRSA 4Z89A 1SF9A 3DJBA 2YUQA 2K7AA 1K73C 2K4YA 3CCEA 3S6WA 2RQUA 4KRCB 1WNLA 1B34A 4PFPA 4UC4A 4Z6YA 1KSWA 5FGKB 3OS5A 3CCST 1T3LA 2B86A 2E3IA 2M1HA 2DZ9A 4XAXB 3G71Q 3GPLA 2QQBA 1YJNQ 1I4K1 2DL5A 3CBOA 5FRNA 2LQKA 1GCQC 2CT3A 3QSUA 4MZPA 3MHXA 4QQ6A 2LX7A 4NOYA 3E9FA 2FPEA 2VB6A 2X3WD 4EIKA 3JB9D 4AKHA 2L0AA 2KGTA 3FEOA 3MPUB 3V8KA 1GFCA 2PVGB 2JW4A 1I07A 4XK8E 1G3NC 2F2WA 2WACA 4HVVA 3CMEQ 4RTWA 1BB9A 2RA2A 3JSCA 3GOXA 1VQLT 1WYXA 4M75A 2I40B 2Y4XA 4FYWB 2OTJA 3DOGB 2ECZA 2XIDA 4Z02A 4QT7A 3M0UA 3CC4T 1SSFA 3SHWA 1XNIA 4M77D 5IN1A 2FPDA 4LDYA 2ZPHB 2M0YA 4ELZC 5GAN7 1X69A 4CXAB 2R7GA 3WVEB 3A1PA 1YI2T 4CFMB 4M7DE 4RCBA 4NL2A 5FU7C 4BCPB 3HTRA 2PJQA 1VQMT 1M4ZA 1VQNT 1E7OA 3G71A 3Q1JA 1YJNA 1N4MA 3K7AM 1RAEB 1CKAA 3CPFA 1HYOA 3H0HA 2L89A 4V2SA 3HL8A 2MOXA 2DEUA 3H0FA 3P8HA 3EG3A 3QYGB 4LDWA 1Y96B 3CMEA 4E2FB 4LN2A 3META 1VQOQ 1VIEA 2DM1A 2KBTA 3S3NA 4OMNA 1EIFA 2RQVA 2VKNA 2BZXA 4FL6A 4BCGB 1NJIR 3RDVA 4C8QB 2DXBB 2DO3A 4D8DA 4F14A 5GAN6 1PC0A 2RQTA 2XU8A 1Q81C 4BCMB 1ZHIA 4OR5B 3ASKA 2G77A 3L42A 4M75G 1OKWB 2QF7A 2DXBA 3GNFB 5HKCA 4EOSB 2X35A 1BU1A 3O8VA 4RTVA 1S72Q 3E9GA 2LJ1A 2DJZA 4DEYA 1YITA 4BY6C 3VUZA 1M1FA 2F5KA 2QG9B 1Q82U 3CCUQ 2ENMA 1NZ9A 1VQ5Q 2K9GA 3VRYA 3P8BB 1KXUA 2MK5A 2RQWA 2V8KA 2DTOA 4HLQA 3I9QA 5GMKi 1K9AA 1TOVA 3BW1A 3OY9A 1PD1A 1OPLA 3VJPA 4F7SB 5FU6B 4LNPA 2CGHA 3PMTA 3SWNB 1QW1A 4FYYB 4M77E 2GGRA 4D8KA 3BLHB 2ZPFB 4OB3B 3L2UA 1BU2A 5GMKh 2PHGA 5KYYA 1E9HB 1W6XA 1UNHD 3SDZA 5I2MA 3A8MB 2P4TA 2YXYA 3GTMS 2JS2A 1B7TA 2LC4A 5M9OA 2EQKA 4JX4A 4KGXB 3ULRB 4BBRM 2ZZDA 4JJDA 4LD6A 5GAMd 1QWFA 5J3BA 5LJ5f 1LCKA 4YOSA 4PJJA 4AFQC 1M8MA 1KD1C 1S72A 4EMKA 4BCQB 4AG2C 3OYEA 4JRQA 2RJCA 1T0JA 2XDBA 2K2VA 4F7UB 4J9IA 1NPRA 3TREA 3FJPA 2BZ8A 1QVFP 3OYCA 3VYHB 2E5QA 3G4SQ 1OIYB 4KUDK 3CCUA 4M7AA 1Q7YR 1Q86C 2FEIA 3F5XB 1JQQA 1ZUYA 4M78F 4F7UA 1YCSB 2G6FX 2JOYA 4C8QG 2XD0A 2J7IA 4J9EA 4HL4A 4M75D 2KVQG 2JGZB 2CREA 4C0DC 5GAOp 4ME7A 3NFCA 3TSZA 4BCHB 3RIRA 1ZUKA 1OIUB 4KRTA 1VQ7Q 2C5NB 3A8HB 2BKDN 2DK3A 3MY1B 4XU2A 2RHZA 3CCVA 1VQOT 2ZPIB 1QCNA 2I53A 2Y90A 4NS5A 1MNDA 2DYIA 4HVUA 5GAMf 1OZ3A 3KXTA 3VKHA 2C0IA 3JB9J 4ZGJB 3RERA 2EWNA 4O5VA 1T0HA 3H4CA 1M8VA 1WFWA 4KT0E 2K6DA 5LJ5e 2DD5B 3QDFA 4GBQA 2LCLA 5AT1B 2BE7D 2PNIA 3EG9B 2KMTA 5FW9A 3QWXX 3LWHA 3TCJA 1WGSA 4PJNA 4ELJA 2ED1A 4M78C 3G4SA 3O0GD 2LMJA 1GUXB 3CPWP 2FPFA 5DM7R 2OAWA 1VQ5T 1SKUB 2QGSA 2KRNA 2BE9B 3OSVA 3CMAQ 4XTYA 5GAOm 3I56T 4RCCA 1BKBA 1OPKA 3POMA 2FZGB 2EBPA 3C12A 2GTJA 1VQ7A 5HK0A 3CD6A 1P92A 1AOJA 3C0CA 3BFMA 4F7UG 1KHIA 4N0AC 3JCMX 1M90U 1RUWA 5D6WA 2IW8B 2PVOB 2DXCA 2LTOA 4C8QD 4EMGA 1VINA 1GCQA 3CCMT 5I21A 5I11A 4BCMD 4EDUA 4PFOA 3URGA 2J6KA 2K3XA 1KC8U 1KQ1A 3CC2T 2HBWA 3QG1A 1X6BA 3SD4A 2QAZA 3BE3A 2OTLQ 1D09B 2COYA 3I55T 3CCJA 3VKIA 1FX7A 3OSSC 2AKKA 4VUBA 2DBKA 3A8OB 2X4XA 3L2VA 4EORB 3EGUA 4OGEA 4MIMA 5FROA 5GANj 4M75E 3R6OA 3M57A 1NYFA 5KYUB 2W96A 2Y4YA 2RI5A 3EHQA 1UGQB 2KT8A 3HRUA 1PD0A 3OMCA 1JJ2P 2CS7A 3CMAA 2O88A 5GJVB 4M7DA 1ENWA 3UATA 4RTYA 3G7ZA 2YDLA 4C8QF 4RG8A 5CR2A 4ZN3A 2FO0A 1C9BA 3PNWC 3DTOA 1K8AU 1YWOA 1PRMC 1UG1A 2EKHA 1LNXA 2WXVB 2AKLA 1JXOA 4AFUC 2CSQA 1FMWA 2HQXA 2HSPA 2DZCA 2OX7A 1YCYA 2KI7A 2DVJA 3TU4K 2LQ8A 1OQKA 1PG5B 1ZLMA 4J6WA 3GNGA 4DBFA 1QVPA 2FVUA 1VQ6Q 4BCQD 2OTLA 1VQ9T 3RR6A 1WDXA 1F1BB 5GAN4 4Y28E 2XG8D 1KJWA 1V76A 1QCFA 5IHNA 1URCB 2CH4W 1FWZA 3FRNA 3LH0A 4OMPA 1M1KU 1IRXA 1WHLA 3J81E 5EC7A 2CP3A 4JX5A 3MP6A 1M2VB 4C8QC 2KR6A 3BLQB 2CZ0B 1IHVA 3X24B 4BE2A 4C8QE 4YC3B 3MEAA 3M0SA 4EOJB 1G3SA 1WXTA 3I35A 4FU6A 1KHCA 4A4KA 3JB9H 3LGFA 5IT9E 2QFZA 1C0MA 2KY9A 1VOLA 4L59A 2MCNA 3HBLA 2WMAB 2K79A 4RTUA 3ZL7C 3M03A 4BI8B 3TNWB 3CBPA 2EVRA 1M1GA 5CKDA 3OYAA 1D0ZA 4BCKB 5LJ3g 1VQ6A 4TTHA 2GNCA 5A0LA 4NSTB 2VC8A 4EMHA 3MP8A 3F70A 1H641 4MDWA 4F6WB 4KH0B 1TS9A 1D3BB 4I3ZB 1OEBA 2LCCA 2EGCA 4C0GA 1RADB 2HNIA 2D9TA 1N8RR 2CT4A 2JTFA 1OV3A 1QKWA 1SHFA 4WCIA 2JNGA 1KC8R 5LJ3h 4D6WA 4X34A 5EJCA 4A4HA 2EPDA 2HD0A 2GFUA 1WJSA 2JUFA 3VS7A 4QVZA 1VQLQ 2NUZA 2HBPA 2C06A 2EKOA 2RK2A 3MCAB 1H1RB 1QCOA 3CC4Q 2IVXA 1QP2A 4ATOA 3M53A 1WHHA 3HHTB 3HRTA 4C0DB 2V22B 1G8XA 5KYWA 1UDLA 4FYXB 1Y07A 3M58A 3NGPA 3GF5A 4F7UE 1YI2Q 1M3CA 2KDSA 3CCSA 2RI2A 4CRLB 3ER0A 3QYEA 1QVFA 5LMKB 1VQMQ 2DF6A 3HP9A 1VQNQ 2QGGA 2EYQA 3M55A 5GJWB 4C0FA 3PFSA 5LQFB 3OA6A 3QZ5B 2BS2A 1H24B 5CIUA 2CUDA 3TSWA 3VS0A 1JSTB 1GBRA 2G9XB 4E6RA 1K9MU 2O4XB 4IMYB 2HMAA 3LH5A 5KE3A 4QQDA 4HCKA 5IHYA 1R0CB 4E7JA 1H1PB 2DIQA 2W10A 3B57A 3RGFB 2QQSA 5GANd 5D6XA 3FDRA 3E19A 3EHRA 1VQLA 3REAB 3OW2P 1GH6B 4HNTA 4BY1X 4M78B 1WJRA 4MMLA 4ZTJA 1H8KA 4AKGA 3UWNA 5IH2A 5DLOA 1K73U 3CC4A 2DBMA 1RAIB 1TXQA 4J9GA 5BNJB 3X28B 2P4RA 1PHTA 2HSEB 4CFWB 2F2XA 1ZBXA 1UGVA 2NLUA 2RF0A 3TN8B 4CC7A 3CEYA 1NJIC 4XTWA 1YI2A 4BXXX 4FSSA 5GAN5 4E7IA 2V26A 3NMZC 4OB2B 1G5VA 1IZ6A 1VQMA 4JX6A 1VQNA 5ICPB 2AHJB 3EJ1B 1K1ZA 2CKKA 2RB6A 3CPWA 1PKTA 2G3RA 2YT6A 1PNJA 2HKQB 5L23A 3L2WA 2YSQA 2X3XD 4C0ZA 2DERA 4N0AA 1OGUB 5CK9A 2WMBB 2O9VA 2YUOA 3HKSA 2R57A 3HZJA 2W2HA 2DD4B 1XJWB 5GANf 2DVEA 3PIPA 5FWBA 3CCQT 3M0PA 2DILA 2RPNA 2L5QA 3OS2A 4HT8A 2LQWA 2KT1A 2VXEA 3VU3C 4J8OA 4OVAA 2D0QB 3UA7A 4EOQB 1W2BP 2DA9A 4WF2A 5GAOl 2SRCA 1SG5A 3I5RA 3VV0A 4HNVA 3FLGA 2YLBA 1C6VX 2QA4Q 2YUNA 3DL1A 1QP3A 3BG3A 4CFUD 2J05A 2WPAB 1QVFS 3V7RA 2UZEB 4E7KA 3V8JA 2KYMA 2X9HA 4N4GA 2HQEA 2NYSA 2PMIB 4J6XA 5DY9A 4J9CA 3MEUA 4IUTA 4M78G 5HBJB 3M0TA 4RUGA 1VQ8T 3G6ET 2C4GB 2Z0WA 2QXFA 3V7CA 1N9RA 2GFAA 1RLQC 1JJ2A 2VWFA 2V1QA 2EJGA 1H1SB 1SRMA 2E6ZA 4XTXA 1Q7YC 2RH2A 8ATCB 1GBQA 1X2KA 3BDUA 4ZTFA 3EIDB 2HCKA 2WSEE 1RAGB 3NDQA 2I2LA 2R58A 2C5VB 2J6FA 2XDPA 5LJ3d 1Q81U 5DQWA 1JO8A 1Y96A 1SHGA 1AWXA 2B8AA 4EPCA 1QVGA 3BG5A 4HXJA 1G3TA 4DOVA 1UECA 3CPWS 5KYNA 3CQTA 4IURA 1BCMA 4ROCA 2BPMB 5LL6S 4C8QA 5CQXA 2ZGWA 3SFMA 4EOPB 2O9SA 4B9WA 1RI0A 1W4SA 4BCIB 4C92F 3QYBA 4C5GA 5C0MA 1UNGD 1QWEA 3SEMA 1M2OA 1AEYA 3M59A 1PKDB 4LOCA 3V7SA 3CC7Q 2CSIA 1UHCA 4F7LB 1X75C 3DDPB 1NBEB 3JCMP 2SEMA 3I56Q 2RM4A 2HAXA 4QW2A 3X25B 3DDQB 2QASA 3OMGA 4MZMA 1I1JA 4M78D 4PFZA 7AT1B 2JM9A 1FYNA 3LWIA 5LJ3f 1WXUA 1VQOA 2LQNA 2P84A 2NUTB 5GAN2 4LUDA 1VQPT 1VQ4Q 3CCMQ 3SWNA 4JDSA 2EQJA 4R56A 2LCSA 2QA4T 1YJ9T 1I5LA 3PE0A 3RNJA 3QHRB 5L2WB 1ZSGA 1KD1U 1AWOA 1D0XA 2NUTA 3CC2Q 4ROEA 3EFRA 1WXBA 2WSCE 2E1HA 1K4US 2CCIB 3I55Q 1OI9B 2ROLA 3LQ5B 4LXCA 1BI0A 1YHQT 4C92C 1JJ2S 1RABB 3A8LB 3KFVA 4FT2A 1UJ0A 2DNUA 1Q86U 4A63B 1GCPA 2XK0A 3ZBDA 4PJOF 2F1LA 1FXXA 2FL7A 2PK2A 3TQ7P 1H27B 2H3JA 2JTMA 1VQ5A 2QDJA 1X43A 1BIBA 4KH1B 3X26B 3CXCP 4O6JA 1MV3A 3I56A 1XO2A 4BE1A 1AWJA 1BI1A 1SSHA 1BK2A 1H1QB 2YUPA 1TUGB 3SB2A 1KQSP 2J06A 4BDZA 5ACBA 1WI7A 3QXEB 1YJWT 1FKMA 4CFNB 4BBSM 1QVGS 1H25B 4KGZB 3H6ZA 4LUEA 1QMZB 4JUVA 1F5QB 3CCMA 3VS2A 3MY5B 4ZN1A 5GAOr 3HPWA 1EZZB 4PJMA 2NUPB 3TW6A 1ARKA 4RKUE 1AD5A 3CC2A 2GTOA 3A98A 3NTIA 1XQHA 4CC4B 1TUDA 3AHUA 1VQ9Q 1LOJA 3I55A 4E7HA 2AZSA 3PMIA 1BIAA 2NUPA 4XU3A 1N27A 4Y91A 1V1CA 1IB8A 4N4HA 2K57A 1VIFA 4FW2A 4J7IA 3LLRA 4PJOC 2CH4A 2LW4A 5FLXE 1Q81R 1K76A 2DMOA 4FW1A 3MEWA 3U23A 3M9QA 2DD5A 5A0GA 4IUVA 3OS1A 2KSSA 5CKBA 1JRIA 1VYTA 4M78E 3RUXA 3EG2A 3EG9A 1B07A 4A4GA 4XU1A 2H3EB 3MIAB 2VASA 2EQIA 1NPPA 3CC7T 4MFEA 3KUFA 2EJFA 4HCZA 5KYXB 2IN3A 1GUXA 2RHYA 4N4IA 3OYYA 3MO8A 4BUGA 2LT4A 3J80E 3S3MA 5L8RE 2QYZA 2QQRA 2EJ9A 1DJ7B 4HKEA 4QVCA 5HQ0B 3M56A 1Q82R 2NWMA 1R77A 4C5IA 5GANg 1VQ4T 2K3YA 2VUBA 3QYHB 2QEXT 3EH1A 5GAMe 4XTUA 1R8OB 3RKYA 2DPPB 3PGGA 2RN8A 4B9XA 1W98B 2KR3A 1VQ9A 3NHNA 2YRVA 3OYDA 3EGXB 1JB0E 1RL2A 2MWOA 3RKWA 2EQUA 2M9UA 4BCNB 5A2QE 4RTTA 1UUEA 1BI3A 4IUQA 4GY5A 4Y92A 2WSFE 4IUUA 4RODA 5GANh 4HCCA 3EGXA 4J9FA 1TTHB 1AHJB 3X20B 2QTXA 1LPLA 3OS0A 2H8HA 1OL2B 3JCMd 3M0QA 3RMQA 1TUCA 2F69A 2M16A 2PZ1A 4BD3A 1W2BA 2A37A 3HO8A 1N8RC 1JBMA 2EYZA 5KYUA 3P8DA 3H8ZA 4MFDA 2E10A 2O2OA 1MMGA 3QWYA 1HK9A 5IF1B 2DAQA 3WXMB 4DQ2A 5IHIA 5GAOq 2PVDB 1TWBA 4A53A 4JJNK 1I5OB 1WLPB 2WEVB 4ELLA 4A54A 1TG0A 4OGCA 5CEIB 1U3OA 3QJ6A 2FRWA 3L1AA 3GIBA 2JM8A 1OI1A 2ED0A 2LX9A 4X1VA 3C4SA 1E6HA 4AT1B 1UGSB 2A36A 1Y71A 2M02A 2QDLA 3JCMQ 3OYFA 1QMCA 2DIGA 3VS5A 3UDCA 3G1JA 3I5SA 4EOKB 4ZNXA 2E3HA 1OULA 1MMNA 1UE9A 1PM3A 3M54A 3DKMA 1ZQ1A 3BDLA 1PSFA 1G3YA 1D1BA 2R5AA 4OGRB 3VS4A 1IGUA 4C5HA 4KUIA 2HKNA 1M2VA 2XICA 2JMAA 3D7SB 4LD9K 4KGVB 2C6TB 5I22A 4AKIA 2XHCA 2YRDA 2FG0A 1ZSZC 2E65A 8AT1B 1IXDA 2DKGA 4BE0A 4DEXA 1SRLA 4RMOA 3OYLA 4FX3B 3TW7A 1Y57A 1UNLD 4FT4A 1U1TA 3TVTA 3BHUB 2MIOA 3EFOB 1AVZC 5EFQB 1BYMA 3M5AA 2L8DA 1M90R 1ACMB 4M7AF 2GF7A 2AIRB 4M77B 4YOOA 4FIBA 4L6V5 3R6NA 2GQVA 2EFIA 2LDMA 2B9RA 4HT9A 1PRLC 2LNHB 4PL6A 1NEGA 3CCQQ 4QKUA 4C92B 2XDDA 3BLRB 4JJCA 1D3BA 1RLPC 1PKSA 1JSUB 2L3SA 2XKOC 1GL5A 4ZGEB 2ZCFB 1M3BA 4BDYA 2L3PA 2P0QA 1VQKT 3OB9A 5GAN3 4FSXA 3PT9A 3V8LA 3FB9A 1AT1B 4BI3A 4Y72B 4ANJA 2KXCA 2EYWA 4M4ZA 2MPXC 2ROTA 2GBQA 2E6NA 4NC6A 1OU9A 2D8HA 5CAIA 5DQVA 1CKBA 3PTAA 3EOCB 4GLKA 5GMKe 4EOLB 3AT1B 2K2MA 4OMLA 5A0DA 3ME9A 2WHBB 4PLLA 1PWTA 2FHDA 2RJDA 2DXTA 4BCND 3HSBA 1VQ8Q 2WIHB 3G6EQ 1O9KB 3CBMA 2HL5C 4M7AC 4JS5A 2CZ1B 1X2QA 2DYBA 2F5TX 3CCRT 5LJ5j 3CXCA 1S1NA 2OJ2A 2XMFA 1K8AR 3FIFA 3UT1A 4BI4A 3MJXA 1VA7A 1UGRB 2X4YA 5FRMA 1KQSA 3CCQA 4B6MA 3JB9G 2BS4A 1MMAA 3M4YA 4PJOB 4NL3A 3INZA 2MWPA 2EQMA 2RMOA 2O4XA 4F6SB 5D6YA 2E41A 1ZA1B 3FJ5A 4JRPA 1BCOA 3E1SA 3OYJA 1N5ZA 2KXDA 3ZEHA 1OKVB 2AT1B 1TSFA 2DRKA 4J83A 4CC3A 1NJIU 4OB0B 4PK4A 3JCMV 4HNUA 2QDYB 4M78A 4F16A 3BY7A 1UJYA 3C94A 5I2SA 1YIJT 2C0OA 2D8JA 2VYTA 3BG9A 1M1KR 2A28A 2RHUA 1X01A 4C92G 1UFFA 2E5KA 1N9SA 2K5IA 3LYIA 1O9SA 3OYNA 1ZP2A 4UN0A 5GAMj 1VQ8A 1KIKA 3QO3A 3G6EA 2CP2A 2CP6A 3TEEA 4A4FA 4KBMB 4LDVA 2FZCB 1B34B 2L2PA 4CRIA 4ZGDB 1U8RA 4F70B 1WA7A 2LVMA 4RTXA 4QQGA 5DLQE 2RHIA 1KFZA 5J39A 2CJMB 1OU8A 3QUIA 3KBGA 4M7DF 3L2ZA 3JCMW 4J9HA 3PO3S 4MMKA 5HVYB 3QWLA 1JOWA 2DD4A 1VYUA 2V8JA 1GFDA 3QZ9B 1VQPQ 1VYVA 2DETA 2YLCA 4F17A 4Q5WA 4BACA 1YJ9Q 1G3WA 4Z8AA 1X6GA 3O5ZA 1RACB 1IHWA 2JXBA 4M75B 2EYYA 5CKHA 3UF4A 4CI0C 1YWPA 3NPFA 2FZKB 3CCLT 1I81A 3QBYA 4PJOG 4DOWA 3CXCS 1YHQQ 1XTDA 2JS0A 2C5OB 2VGNA 2DL7A 2DX1A 4A4EA 1KQSS 2IPOB 4JRIA 1HXDA 2W9ZA 1OZ2A 1M30A 2V1RA 1Q7YU 2RK1A 5D7UA 2BIVA 2YHTA 5C6SA 3VYGB 3GLXA 2FYKA 4M7DC 1VYWB 9ATCB 4FCYA 4E7LA 4C92D 3CCET 2KAFA 2RNAA 5GMKm 3OYMA 1WHMA 5GANe 3VYGA 5KH6A 1YJWQ 3FC3A 4GLMA 4M6VA 3M0RA 3UPUA 1YITQ 4PLIA 3JB9F 4EC8B 2E64A 1VUBA 3VS3A 2QK0A 3QHWB 1W1FA 1VQPA 3PVLA 4L5GA 1Y7XA 3JCMg 6AT1B 3OYIA 1K9MR 2EUFA 2QA4A 1YJ9A 2JVVA 1Z9QA 4HA8A 3QJYA 1HD3A 1W70A 2V8IA 3JCMb 2KE9A 2CCHB 1WQWA 4OMMA 1NG2A 2MAMA 1YHQA 1IGQA 1UHFA 2IW9B 4G6LB 2DXUA 4M77F 1OX8A 1AWWA 4EONB 1FMKA 1ABOA 3HB9A 2X51A 3JCMh 3GBQA 2CP0A 1K73R 2OTJT 1ZSZB 1V29B 1LVKA 1YBYA 1B3QA 2RJEA 3KHIA 5EG2A 2BTTA 1FINB 5IHKA 2KYBA 5HBEB 4PNOA 2JT4A 1M5Q1 2EIFA 1ZSZA 3VS6A 2JZ2A 3L2RA 1X27A 1AD6A 4PJOD 4X9DA 5LJ5d 2KEAA 1KK7A 4XQ3A 3QIIA 1U06A 5IDPB 1TFBA 2LNVA 1OX9A 2PUKB 1YJWA 3OYKA 2MF2A 4JPBW 1TH7A 1I0CA 4J9DA 4F7NB 3JB9I 2E4HA 3G71T 3VKGA 1YJNT 5FWCA 2A7YA 3QPHA 4LE9A 2COZA 2QEXQ 1Q82C 3C95A 2P0KA 1HSQA 2JJ9A 5KYYB 4M77C 1YNZA 2FB7A 4J5YA 1WHKA 3CMET 1KQ2A 3RBBB 2ZZDB 5HK3A 5GMKj 2CYZB 3CCVQ 4DA4A 4C92E 2ATCB 4F6UB 2PU9B
chains in the Genus database with same CATH topology
2OTJA 3RMQA 4QVZA 1QLBA 2F69A 4EMKB 2HBPA 2M16A 4MZTA 4BD3A 2XIDA 4Z02A 1W2BA 2C06A 3HO8A 3QDRB 1N8RC 3CC4T 3A8GB 1JBMA 2EKOA 2DEQA 1SSFA 3CC7A 1XNIA 1WPYA 2RK2A 3MCAB 3H8ZA 4MFDA 3P8DA 2E10A 4M77D 3QKJA 5IN1A 3GP8A 4LDYA 1QP2A 1HK9A 2ZPHB 4M7AB 4ELZC 4ATOA 3M53A 3HHTB 3HRTA 2DAQA 3WXMB 2JN0A 4C0DB 4DQ2A 5GAN7 1UGPB 1Y07A 3RESA 3M58A 5GAOq 3WVEB 2PVDB 4A53A 4JJNK 1YI2T 4M7DE 2EAYA 3GF5A 4NL2A 4RCBA 5FU7C 4F7UE 4QVDA 1H3ZA 1YITT 4A54A 2KDSA 2RHXA 5LJ3e 1VQMT 1M4ZA 1VQNT 3CCSA 3G71A 1VQ4A 2RI2A 3ER0A 3Q1JA 3QYEA 1NE8A 4OGCA 1YJNA 1QVFA 2QQ8A 3HP9A 2EYQA 3M55A 4C0FA 3QJ6A 3CPFA 3PFSA 2QEXA 1LJOA 3L1AA 3LGLA 3OA6A 3QZ5B 2BS2A 3GIBA 4JLGA 5CIUA 1OI1A 2VV5A 5GAN8 2L89A 4PKCC 2LX9A 4V2SA 2GCXA 1K9MU 3HL8A 2O4XB 3C4SA 3P8HA 2OAUA 4XTVA 5KE3A 4QQDA 2ZPEB 1UGSB 1Y71A 4E7JA 3QYGB 4LDWA 1Y96B 4OP0A 3JCMQ 3OYFA 2DIQA 2QQAA 3CMEA 2DIGA 2WJ9A 3UDCA 2QQSA 5GANd 3META 5CKEA 1GXIE 4PJOE 5D6XA 1I8FA 3FDRA 1VIEA 3E19A 3S3NA 1VQLA 3M54A 4HNTA 4M78B 1EIFA 1WJRA 3DKMA 4MMLA 4ZTJA 1ZQ1A 2MI6A 4FL6A 4IUPA 4OB1B 2RD1A 3BDLA 1PSFA 4C8QB 2DXBB 4AKGA 2DO3A 3UWNA 5GAN6 5DLOA 1K73U 3CC4A 3OW2A 1G3YA 2ZPGB 2XU8A 1Q81C 2R5AA 1ZHIA 3X28B 1ZBXA 2NLUA 3JCMJ 3ASKA 4C5HA 2G77A 4KUIA 3L42A 1S72T 2XICA 4M75G 2QF7A 2DXBA 3CEYA 3GNFB 5HKCA 1NJIC 4LD9K 2X35A 3O8VA 4M75F 4AKIA 4XTWA 2XHCA 3E9GA 1YI2A 5GAN5 2DJZA 2E65A 2LRQA 4E7IA 1N6AA 3OYHA 4OB2B 2DKGA 3S3OA 4BY6C 3PIOA 4BE0A 1YITA 3VUZA 1G5VA 4RMOA 3CCUT 1IZ6A 3L2QA 1VQMA 4JX6A 3OYLA 1VQNA 1M1FA 2AHJB 2XI9A 2F5KA 1Q82U 2RB6A 2CKKA 3CPWA 3TW7A 1NZ9A 2G3RA 3P8BB 4FT4A 2KMGA 1U1TA 3L2WA 4C0ZA 2V8KA 2DTOA 4N0AA 4HLQA 5GMKi 2DXCB 5CK9A 4M7AG 4XTZA 1BYMA 3BW1A 5KCHA 3OY9A 3DLLA 3HKSA 2R57A 3HZJA 2L8DA 3M5AA 2DD4B 4M7AF 3VJPA 5GANf 2GF7A 5FU6B 4M77B 2DVEA 4FIBA 4L6V5 3PIPA 2VXFA 2CGHA 2GQVA 2KQWA 3PMTA 2EFIA 2LDMA 3DB3A 3SWNB 3CCQT 4HT9A 1QW1A 2IVWA 4PL6A 4M77E 3L2UA 2L5QA 2ZPFB 4OB3B 4OF1A 3OS2A 4HT8A 3CCVT 2VXEA 2M0OA 3VU3C 2CZ7B 5GMKh 4C92B 2XDDA 4J8OA 4OVAA 1M90C 2D0QB 1D3BA 2E12A 1N8RU 3SDZA 4WF2A 5GAOl 5I2MA 3A8MB 2XKOC 3VV0A 2P4TA 4HNVA 4ZGEB 2ZCFB 2LC4A 3FLGA 5M9OA 4BDYA 2EQKA 4HCBA 2YLBA 4X9CA 2P0QA 4JX4A 1VQKT 4BBRM 1OYXA 2ZZDA 3OB9A 4FSXA 3PT9A 3DL1A 1QP3A 4LD6A 3V8LA 5GAN3 3BG3A 3FB9A 5GAMd 4BI3A 5J3BA 1O75A 4M75C 5LJ5f 3OYGA 1QVFS 1KC8C 2K5FA 1KD1C 4C5EA 5CKFA 1S72A 4EMKA 2D6FA 3V7RA 3OYEA 4E7KA 4JRQA 2E6NA 3V8JA 2RJCA 3NTHA 4M7DB 4E47A 2XDBA 2K2VA 4N4GA 4F7UB 2HQEA 4NC6A 4AI6A 1UEBA 5CAIA 1NPRA 3TREA 3FJPA 2RO0A 3G4ST 4J6XA 3OYCA 3PTAA 5FU7B 5DY9A 3VYHB 2E5QA 3MEUA 4GLKA 4IUTA 4M78G 5GMKe 3CCUA 4KUDK 4M7AA 1Q86C 5A0DA 1VQ8T 3ME9A 4PLLA 4M78F 3G6ET 3OBYA 4FM4B 2FHDA 2JOYA 2RJDA 4C8QG 2QXFA 3V7CA 2DXTA 4F7UA 2XD0A 3HSBA 1N9RA 4HL4A 4M7AC 3CBMA 4IKFA 2GFAA 4JS5A 2CZ1B 2KVQG 4II1A 4M75D 1JJ2A 2F5TX 4C0DC 5GAOp 3CCRT 2EJGA 5LJ5j 4ME7A 4XTXA 2E6ZA 3NFCA 5HY6A 3CXCA 3RIRA 3FIFA 1Q7YC 5IAYA 3UT1A 1VQ7T 4BI4A 3CD6T 1UGRB 2X4YA 2RH2A 5FRMA 3A8HB 3OW2S 1KQSA 3BDUA 3CCQA 3JB9G 2BS4A 4ZTFA 3M4YA 2BKDN 2DK3A 4XU2A 2WSEE 4PJOB 2PQWA 2RHZA 4NL3A 3CCVA 3INZA 1VQOT 2ZPIB 2MWPA 3JCMf 1MGQA 2ZPBB 2EQMA 2I2LA 2L3RA 2O4XA 2R58A 5D6YA 3EAEA 2Y90A 4NS5A 2E41A 2XDPA 5GAMf 3DB4A 3LX7A 5LJ3d 1OZ3A 1Q81U 3KXTA 3VKHA 4M7AD 3JB9J 4ZGJB 1Y96A 3RERA 4JRPA 3E1SA 3OYJA 1VQKA 2EWNA 3ZEHA 2B8AA 4O5VA 5J26A 3H4CA 4EPCA 1QVGA 3BG5A 5GMKl 1M8VA 1G3TA 4J83A 3CCJT 4KT0E 5LJ5e 1NJIU 2DD5B 4OB0B 3JCMV 4DOVA 4HNUA 3CPWS 2QDYB 1XOVA 4M78A 2P0PA 2X4JA 2LCLA 2MMPA 3BY7A 3C94A 5I2SA 1YIJT 4RG2A 4IURA 2VYTA 2E70A 3BG9A 2KMTA 3M4GA 5CO7A 5LL6S 3TCJA 4C8QA 2RHUA 3LWHA 1X01A 2Y4XA 1PSEA 1WGSA 3LW5E 3HFNA 4ELJA 4M78C 2ZGWA 5CQXA 3SFMA 4C92G 3G4SA 4B9WA 1RI0A 1N9SA 2K5IA 1W4SA 2QI2A 3LYIA 1O9SA 5DM7R 4C92F 3OYNA 4MDXA 2RI3A 4BY6B 5GAMj 2VGMA 3QYBA 4C5GA 5AYFA 5C0MA 1VQ5T 1VQ8A 3QO3A 1M1KC 3G6EA 3CMAT 3MEVA 2A3LA 1IREB 3TEEA 4A4FA 2KK4A 3M59A 3OSVA 4LOCA 4KBMB 1MHNA 4LDVA 4XTYA 5GAOm 3V7SA 4OMFB 3I56T 4RCCA 1B34B 1X75C 3CCRA 1BKBA 3JCMP 4CRIA 4ZGDB 2RM4A 1U8RA 2HAXA 3J7AF 4QW2A 3C12A 1VQ7A 3X25B 2BS3A 3CCLT 3WVDB 5HK0A 3OMGA 3CD6A 1P92A 3NTKA 2IG0A 2LVMA 4MZMA 3BFMA 4QQGA 1W2BS 4M7DG 4M78D 5DLQE 2RHIA 4F7UG 3JAME 1KHIA 4N0AC 3JCMc 5J39A 3JCMX 3QUIA 1M90U 3JRZA 3KBGA 4M7DF 3L2ZA 3JCMW 5D6WA 3DLMA 3LWIA 4MMKA 2PVOB 2DTHA 2DXCA 2LTOA 5LJ3f 4C8QD 4F7UF 4EMGA 3QWLA 1VQOA 3JCMe 2RJFA 3CCMT 1KG1A 5I21A 2DD4A 5GAN2 4ELYC 1VQPT 4EDUA 4JLIA 4XU0A 1X6OA 2V8JA 3URGA 4M77A 3QZ9B 3SWNA 3ZFJA 4JDSA 2EQJA 4R56A 2K3XA 1KC8U 1I5LA 2QA4T 1KQ1A 1YJ9T 1K8AC 3CC2T 3HFOA 2BUDA 2OTLT 2YLCA 4BACA 4Q5WA 3QG1A 1KD1U 3OQ5A 3SD4A 1UB4A 5FU6C 1G3WA 2PUOB 4C92A 2DTIA 3EFRA 3SWNC 3I55T 2WSCE 2E1HA 3RKXA 3VKIA 3CCJA 4LDXA 1FX7A 3OSSC 4VUBA 3MP1A 4M75B 3A8OB 5CKHA 2LT1A 1BI2A 2X4XA 3L2VA 1YIJA 4OGEA 4CI0C 4MIMA 1BI0A 5FROA 5GANj 4C92C 1YHQT 4M75E 3A8LB 5LJ5g 5CCAA 1JJ2S 3R6OA 4FT2A 1I81A 3QBYA 2QQ9A 3M57A 5CVIA 4PJOG 4DOWA 4R55A 3CXCS 5LJ3j 1Q86U 2XK0A 3ZBDA 1XTDA 2Y4YA 4PJOF 2RI5A 2VGNA 5CQYA 1UGQB 1FXXA 2FL7A 4KULA 4A4EA 4EMKC 4J7FA 3HRUA 2H3JA 3OMCA 1KQSS 2JTMA 4JRIA 1VQ5A 2QDJA 1HXDA 1OZ2A 1BIBA 2CS7A 3CMAA 4M7DA 3X26B 2O01E 1Q7YU 2RK1A 4O6JA 5GAOn 2CZ6B 2BIVA 4LDUA 3I56A 4BE1A 3G7ZA 2YHTA 5C6SA 3VYGB 1U1SA 3GLXA 3N5BB 4C8QF 1BI1A 4RG8A 2FYKA 5LJ5h 4M7DC 3QHSA 5CR2A 4ZN3A 3SB2A 4M7AE 4E7LA 4C92D 3CCET 2KAFA 5GMKm 4BDZA 3PNWC 3QXEB 3OYMA 1YJWT 1K8AU 5GANe 1FKMA 3VYGA 4BBSM 3VUBA 1QVGS 1LNXA 5KH6A 3FC3A 4M6VA 3H6ZA 3UPUA 2HQXA 4JUVA 1E7PA 4PLIA 3CCMA 2E64A 3JB9F 1VUBA 2DZCA 4J6YA 1YCYA 3RMSA 1M9SA 3TU4K 1VQPA 4ZN1A 2LQ8A 5GAOr 3HPWA 1VQ6T 3TW6A 2K5LA 3EFSA 3OBWA 3GNGA 4J6WA 4L5GA 1QVPA 1Y7XA 2FVUA 4RKUE 3JCMg 5KE2A 3OYIA 2QA4A 1YJ9A 3CC2A 2OTLA 2X4WA 4BB7A 1VQ9T 4PJOA 2JVVA 3NTIA 4M7DD 1XQHA 5GAMg 4JS4A 2R5MA 5GAN4 4Y28E 3AHUA 1LOJA 4QSHA 2XG8D 4HA8A 3PMIA 1BIAA 3QJYA 4XU3A 3I55A 4E7HA 1N27A 4Y91A 2V8IA 3JCMb 4N4HA 2K57A 1VIFA 3A5ZB 4PJOC 4J7IA 3LLRA 1WQWA 4M77G 1K9MC 2MAMA 5FLXE 5KCOA 1YHQA 1FWZA 4YTLA 3T9NA 2DXUA 1WQ7A 4M77F 3FRNA 3LH0A 3CCLA 3MEWA 3M9QA 1M1KU 3HB9A 2DD5A 5A0GA 4IUVA 4TVRA 4JRKA 3JCMh 3J81E 3OS1A 2KSSA 5CKBA 4JX5A 2OTJT 1JRIA 3MP6A 1V29B 4M78E 4C8QC 3RUXA 1YBYA 2KR6A 2RJEA 5GAMh 4A4GA 3KHIA 4XU1A 3OYBA 2CZ0B 1WJQA 3X24B 4P5NA 4BE2A 5EG2A 4C8QE 3CC7T 1NPPA 4MFEA 3KUFA 2EJFA 3HRSA 3MEAA 4HCZA 4PNOA 1M5Q1 2EIFA 1G3SA 4FU6A 2RHYA 2JZ2A 4N4IA 1KHCA 3L2RA 4PJOD 3OYYA 3MO8A 4BUGA 1K73C 2LT4A 4A4KA 2K4YA 3LGFA 4X9DA 5LJ5d 3J80E 5IT9E 3S3MA 5L8RE 4XQ3A 3JB9H 3CCEA 2QQRA 3S6WA 2QFZA 3QIIA 2EJ9A 1DJ7B 2KY9A 2LNVA 4HKEA 2PUKB 1YJWA 4L59A 4QVCA 3HBLA 3M56A 3OYKA 2MF2A 1WNLA 4BI8B 1B34A 4UC4A 4Z6YA 1TH7A 3CBPA 3OS5A 4C5IA 3JB9I 3CCST 2GFUA 5GANg 1M1GA 3G71T 3VKGA 1VQ4T 2M1HA 5CKDA 3OYAA 1YJNT 2DZ9A 2K3YA 2VUBA 4XAXB 5LJ3g 1VQ6A 2A7YA 3QYHB 5A0LA 2QQBA 3GPLA 2QEXT 3QPHA 1I4K1 3CBOA 5GAMe 4XTUA 5FRNA 1R8OB 2VC8A 3RKYA 2DPPB 3PGGA 4B9XA 4EMHA 2LQKA 3MP8A 1Q82C 3QSUA 1VQ9A 4MZPA 3C95A 3F70A 3MHXA 2P0KA 4NOYA 4QQ6A 2YRVA 3E9FA 1H641 4MDWA 3OYDA 1JB0E 1RL2A 2MWOA 4M77C 3RKWA 2EQUA 1D3BB 2M9UA 5A2QE 2FB7A 3JB9D 2LCCA 4C0GA 4AKHA 4J5YA 2HNIA 1BI3A 2D9TA 4GY5A 4IUQA 3FEOA 3V8KA 2WSFE 3CMET 1KQ2A 2PVGB 4IUUA 5GANh 4HCCA 2ZZDB 2JTFA 4XK8E 5HK3A 2WACA 5GMKj 1AHJB 2CYZB 2JNGA 4DA4A 3X20B 2QTXA 5LJ3h 4D6WA 4X34A 2RA2A 3JSCA 3OS0A 5EJCA 4C92E 3GOXA 1VQLT 2PU9B 4M75A 4A4HA 2HD0A 1WJSA 2JUFA 3JCMd
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXC B;  3A8G B;  2DD4 B;  1PSE A;  3LW5 E;  4L6V 5;  1QP2 A;  2ZPH B;  4RKU E;  3HHT B;  2ZPF B;  4OB3 B;  1UGP B;  2CZ7 B;  4Y28 E;  2PVD B;  3WVE B;  1IRE B;  2D0Q B;  3A8M B;  4ZGE B;  2ZCF B;  4ZGD B;  2ZZD A;  3X25 B;  1QP3 A;  3WVD B;  2DD5 A;  3QZ5 B;  2PVO B;  1V29 B;  2DXC A;  2CZ0 B;  3X24 B;  2DD4 A;  3QZ9 B;  2ZPE B;  1UGS B;  3VYH B;  3QYG B;  5L8R E;  1GXI E;  4FM4 B;  2PUO B;  1DJ7 B;  2PUK B;  2WSC E;  2CZ1 B;  3A8O B;  4OB1 B;  3A8L B;  1PSF A;  2DXB B;  2ZPG B;  1UGR B;  3QYH B;  3X28 B;  3A8H B;  1UGQ B;  2DPP B;  2WSE E;  2DXB A;  2ZPI B;  2ZPB B;  3X26 B;  1JB0 E;  2O01 E;  2CZ6 B;  3VYG B;  4OB2 B;  4ZGJ B;  2WSF E;  2PVG B;  2ZZD B;  4XK8 E;  2AHJ B;  1AHJ B;  2CYZ B;  3QXE B;  3X20 B;  4KT0 E;  2DD5 B;  4OB0 B;  3VYG A;  2QDY B;  2PU9 B; 
#chains in the Genus database with same CATH topology
 1QLB A;  1ZA2 B;  4EMK B;  4MZT A;  1Z9Z A;  1T3S A;  1GRI A;  5ECA A;  1YN8 A;  3QDR B;  3A8G B;  1CSK A;  2DEQ A;  3CC7 A;  1WPY A;  4KRD B;  3GP8 A;  3QKJ A;  2DE0 X;  3VRZ A;  4M7A B;  2JN0 A;  1UGP B;  1ZUU A;  3RES A;  4ORZ A;  1K0S A;  2EAY A;  4QVD A;  1H3Z A;  1YIT T;  2RHX A;  5LJ3 e;  2D1X A;  4IIM A;  1Q95 G;  3EG0 A;  2LJ0 A;  2L3Q A;  1VQ4 A;  1NE8 A;  2QQ8 A;  1NEB A;  1MUZ A;  1PCX A;  2QEX A;  1LJO A;  2MYS A;  3LGL A;  1U5S A;  4JLG A;  2VV5 A;  5GAN 8;  1A0N B;  4BCJ B;  1J3T A;  2K3B A;  4PKC C;  4PJL A;  2GCX A;  2GQI A;  4XTV A;  2OAU A;  4EC9 B;  2ZPE B;  1R0B G;  3CD6 Q;  5HCK A;  4OP0 A;  5HBH B;  2QQA A;  2YWW A;  2HZY A;  2JMC A;  2WJ9 A;  3IQL A;  1IO6 A;  4DBH A;  1GXI E;  5CKE A;  4PJO E;  1YFN A;  1I8F A;  1ZBJ A;  1P5E B;  2MI6 A;  4IUP A;  4OB1 B;  2RD1 A;  3PVQ A;  1MMD A;  3OW2 A;  2ZPG B;  4II5 B;  2PTK A;  1AIS B;  3CCJ Q;  3JCM J;  1S72 T;  1FVV B;  2LP5 A;  2HDA A;  4M75 F;  2UZL B;  2QTV A;  2EYX A;  1YP5 A;  2IW6 B;  5KYX A;  2LRQ A;  1K0X A;  1N6A A;  1OL1 B;  3E2U A;  3OYH A;  3S3O A;  1VOM A;  3PIO A;  3EGD B;  3CCU T;  3L2Q A;  2W0Z A;  2XI9 A;  1ZX6 A;  2DLP A;  2AK5 A;  2KMG A;  4EOI B;  2RQR A;  3EGD A;  2DXC B;  4M7A G;  4XTZ A;  5KCH A;  3DLL A;  2LZ6 B;  4AG1 C;  2DRM A;  2DME A;  2UZB B;  3THK A;  2J6O A;  1QQJ A;  2VXF A;  2KQW A;  3EH2 A;  3DB3 A;  2IVW A;  4JZ3 A;  1EFN A;  4OF1 A;  3CCV T;  2M0O A;  2CZ7 B;  2KRS A;  1M90 C;  1G2B A;  4AMC A;  2E12 A;  1N8R U;  1JEG A;  1RAH B;  4BCO B;  1KD1 R;  1RAF B;  2AZV A;  2OI3 A;  4HCB A;  1WHG A;  4X9C A;  1OYX A;  1EX4 A;  5I5Z B;  2CDT A;  4BCF B;  1M3A A;  4YOZ A;  1VQK Q;  1O75 A;  4M75 C;  3OYG A;  1KC8 C;  2K5F A;  4FYV B;  4K11 A;  2KRO A;  4C5E A;  1Q86 R;  5CKF A;  3MKD A;  1UTI A;  2D6F A;  1JKW A;  1GY3 B;  3NTH A;  4M7D B;  4E47 A;  4AI6 A;  1UEB A;  3G4S T;  2RO0 A;  1WIE A;  5FU7 B;  3JV3 A;  1ABQ A;  2PK9 B;  3OBY A;  2X1N B;  4FM4 B;  5IDN B;  4IKF A;  4II1 A;  1D3U B;  1FMV A;  5HY6 A;  3TNH B;  3BHT B;  2WFY B;  3CCR Q;  4DBQ A;  5IAY A;  1VQ7 T;  4RTZ A;  5IXF A;  3CD6 T;  1WX6 A;  2W9F A;  3OW2 S;  1JXM A;  2WIP B;  2PQW A;  3UA6 A;  1H4L D;  5CYI B;  1MGQ A;  2ZPB B;  1WZO A;  2L3R A;  3JCM f;  1K8A C;  3EAE A;  3VS1 A;  3DB4 A;  2D0N A;  3LX7 A;  1QVG P;  1H3H A;  2I0N A;  2LJ3 A;  4M7A D;  4JZ4 A;  2A08 A;  4WTO B;  2DL3 A;  1VQK A;  2W99 A;  1MNE A;  5J26 A;  2ESW A;  5GMK l;  3CCJ T;  4HVW A;  1MV0 B;  1XOV A;  2P0P A;  2X4J A;  2MMP A;  4AFZ C;  4JJB A;  2CP7 A;  4RG2 A;  4CC2 A;  4IIO A;  2E70 A;  1RAA B;  3M4G A;  5CO7 A;  1YIJ Q;  3TNI B;  1D0Y A;  1PSE A;  2COW A;  3LW5 E;  3HFN A;  1QKX A;  2QI2 A;  4MDX A;  2HQH A;  2UUE B;  2RI3 A;  2KNB B;  4BY6 B;  2VGM A;  5AYF A;  1M1K C;  3CMA T;  1H28 B;  3MEV A;  2A3L A;  1IRE B;  1C1A A;  2KK4 A;  1MHN A;  4OMF B;  4F04 B;  3CCR A;  4OMO A;  4Z88 A;  3J7A F;  2EGA A;  2BS3 A;  3WVD B;  1RI9 A;  2UZD B;  4CFU B;  2IG0 A;  3NTK A;  4M7D G;  1W2B S;  3JAM E;  2F2C A;  2KRM A;  1M27 C;  4R0K A;  3JCM c;  3JRZ A;  3DLM A;  3REB B;  4E7Z A;  4F7U F;  2DTH A;  3EFO A;  4EOM B;  2BZY A;  3JCM e;  2RJF A;  1KG1 A;  2BKZ B;  4ESR A;  3CCS Q;  4ELY C;  1TD6 A;  1Y0M A;  4JLI A;  1X6O A;  4XU0 A;  4M77 A;  2C0T A;  2M51 A;  2ZAE A;  3ZFJ A;  2YRC A;  2HL3 A;  3HFO A;  2BUD A;  2OTL T;  1G83 A;  3OQ5 A;  1H92 A;  1UB4 A;  2EW3 A;  5FU6 C;  2PUO B;  4DBR A;  4C92 A;  2DTI A;  4AFS C;  1HJD A;  3SWN C;  3RKX A;  4LDX A;  3BHV B;  3MP1 A;  1OOT A;  2LT1 A;  1BI2 A;  2DL4 A;  1YIJ A;  4BY7 X;  5LJ5 g;  1NM7 A;  5CCA A;  1NLP C;  4R55 A;  4CFX B;  2QQ9 A;  3H0I A;  5CVI A;  5LJ3 j;  2C5X B;  3CCL Q;  4OMQ A;  2DFU A;  5CQY A;  4EMK C;  4KUL A;  2DJQ A;  4J7F A;  3MI9 B;  5KYW B;  1D1C A;  2IIM A;  2O01 E;  5GAO n;  2CZ6 B;  1BBZ A;  4LDU A;  1U1S A;  3H41 A;  3N5B B;  2JTE A;  5LJ5 h;  3QHS A;  4M7A E;  4F7J B;  4J9B A;  5HNB B;  1O9K A;  3VUB A;  3CCE Q;  2DL8 A;  1SEM A;  2HEQ A;  1E7P A;  2A0F B;  4J6Y A;  3RMS A;  2ABL A;  1M9S A;  3EG1 A;  3H9N A;  1VQ6 T;  1SPK A;  2K5L A;  1AZG B;  2QGF B;  3EFS A;  3OBW A;  2VVK A;  5KE2 A;  4EOO B;  2F2V A;  1D1A A;  2X4W A;  4BB7 A;  4PJO A;  2FRY A;  4M7D D;  4JS4 A;  5GAM g;  2R5M A;  4E7S A;  4QSH A;  1WHJ A;  3A5Z B;  4M77 G;  1K9M C;  5KCO A;  4YTL A;  3G33 B;  2O31 A;  3T9N A;  3CCL A;  1WQ7 A;  1JU5 C;  1E6G A;  1NLO C;  5IXB A;  1QLY A;  1AZE A;  1NYG A;  4TVR A;  4JRK A;  1H26 B;  4CFV B;  5GAM h;  2CUB A;  3OYB A;  2OTJ Q;  2EGE A;  1WJQ A;  2CP5 A;  4P5N A;  1TU0 B;  3HRS A;  4Z89 A;  1SF9 A;  3DJB A;  2YUQ A;  2K7A A;  1K73 C;  2K4Y A;  3CCE A;  3S6W A;  2RQU A;  4KRC B;  1WNL A;  1B34 A;  4PFP A;  4UC4 A;  4Z6Y A;  1KSW A;  5FGK B;  3OS5 A;  3CCS T;  1T3L A;  2B86 A;  2E3I A;  2M1H A;  2DZ9 A;  4XAX B;  3G71 Q;  3GPL A;  2QQB A;  1YJN Q;  1I4K 1;  2DL5 A;  3CBO A;  5FRN A;  2LQK A;  1GCQ C;  2CT3 A;  3QSU A;  4MZP A;  3MHX A;  4QQ6 A;  2LX7 A;  4NOY A;  3E9F A;  2FPE A;  2VB6 A;  2X3W D;  4EIK A;  3JB9 D;  4AKH A;  2L0A A;  2KGT A;  3FEO A;  3MPU B;  3V8K A;  1GFC A;  2PVG B;  2JW4 A;  1I07 A;  4XK8 E;  1G3N C;  2F2W A;  2WAC A;  4HVV A;  3CME Q;  4RTW A;  1BB9 A;  2RA2 A;  3JSC A;  3GOX A;  1VQL T;  1WYX A;  4M75 A;  2I40 B;  2Y4X A;  4FYW B;  2OTJ A;  3DOG B;  2ECZ A;  2XID A;  4Z02 A;  4QT7 A;  3M0U A;  3CC4 T;  1SSF A;  3SHW A;  1XNI A;  4M77 D;  5IN1 A;  2FPD A;  4LDY A;  2ZPH B;  2M0Y A;  4ELZ C;  5GAN 7;  1X69 A;  4CXA B;  2R7G A;  3WVE B;  3A1P A;  1YI2 T;  4CFM B;  4M7D E;  4RCB A;  4NL2 A;  5FU7 C;  4BCP B;  3HTR A;  2PJQ A;  1VQM T;  1M4Z A;  1VQN T;  1E7O A;  3G71 A;  3Q1J A;  1YJN A;  1N4M A;  3K7A M;  1RAE B;  1CKA A;  3CPF A;  1HYO A;  3H0H A;  2L89 A;  4V2S A;  3HL8 A;  2MOX A;  2DEU A;  3H0F A;  3P8H A;  3EG3 A;  3QYG B;  4LDW A;  1Y96 B;  3CME A;  4E2F B;  4LN2 A;  3MET A;  1VQO Q;  1VIE A;  2DM1 A;  2KBT A;  3S3N A;  4OMN A;  1EIF A;  2RQV A;  2VKN A;  2BZX A;  4FL6 A;  4BCG B;  1NJI R;  3RDV A;  4C8Q B;  2DXB B;  2DO3 A;  4D8D A;  4F14 A;  5GAN 6;  1PC0 A;  2RQT A;  2XU8 A;  1Q81 C;  4BCM B;  1ZHI A;  4OR5 B;  3ASK A;  2G77 A;  3L42 A;  4M75 G;  1OKW B;  2QF7 A;  2DXB A;  3GNF B;  5HKC A;  4EOS B;  2X35 A;  1BU1 A;  3O8V A;  4RTV A;  1S72 Q;  3E9G A;  2LJ1 A;  2DJZ A;  4DEY A;  1YIT A;  4BY6 C;  3VUZ A;  1M1F A;  2F5K A;  2QG9 B;  1Q82 U;  3CCU Q;  2ENM A;  1NZ9 A;  1VQ5 Q;  2K9G A;  3VRY A;  3P8B B;  1KXU A;  2MK5 A;  2RQW A;  2V8K A;  2DTO A;  4HLQ A;  3I9Q A;  5GMK i;  1K9A A;  1TOV A;  3BW1 A;  3OY9 A;  1PD1 A;  1OPL A;  3VJP A;  4F7S B;  5FU6 B;  4LNP A;  2CGH A;  3PMT A;  3SWN B;  1QW1 A;  4FYY B;  4M77 E;  2GGR A;  4D8K A;  3BLH B;  2ZPF B;  4OB3 B;  3L2U A;  1BU2 A;  5GMK h;  2PHG A;  5KYY A;  1E9H B;  1W6X A;  1UNH D;  3SDZ A;  5I2M A;  3A8M B;  2P4T A;  2YXY A;  3GTM S;  2JS2 A;  1B7T A;  2LC4 A;  5M9O A;  2EQK A;  4JX4 A;  4KGX B;  3ULR B;  4BBR M;  2ZZD A;  4JJD A;  4LD6 A;  5GAM d;  1QWF A;  5J3B A;  5LJ5 f;  1LCK A;  4YOS A;  4PJJ A;  4AFQ C;  1M8M A;  1KD1 C;  1S72 A;  4EMK A;  4BCQ B;  4AG2 C;  3OYE A;  4JRQ A;  2RJC A;  1T0J A;  2XDB A;  2K2V A;  4F7U B;  4J9I A;  1NPR A;  3TRE A;  3FJP A;  2BZ8 A;  1QVF P;  3OYC A;  3VYH B;  2E5Q A;  3G4S Q;  1OIY B;  4KUD K;  3CCU A;  4M7A A;  1Q7Y R;  1Q86 C;  2FEI A;  3F5X B;  1JQQ A;  1ZUY A;  4M78 F;  4F7U A;  1YCS B;  2G6F X;  2JOY A;  4C8Q G;  2XD0 A;  2J7I A;  4J9E A;  4HL4 A;  4M75 D;  2KVQ G;  2JGZ B;  2CRE A;  4C0D C;  5GAO p;  4ME7 A;  3NFC A;  3TSZ A;  4BCH B;  3RIR A;  1ZUK A;  1OIU B;  4KRT A;  1VQ7 Q;  2C5N B;  3A8H B;  2BKD N;  2DK3 A;  3MY1 B;  4XU2 A;  2RHZ A;  3CCV A;  1VQO T;  2ZPI B;  1QCN A;  2I53 A;  2Y90 A;  4NS5 A;  1MND A;  2DYI A;  4HVU A;  5GAM f;  1OZ3 A;  3KXT A;  3VKH A;  2C0I A;  3JB9 J;  4ZGJ B;  3RER A;  2EWN A;  4O5V A;  1T0H A;  3H4C A;  1M8V A;  1WFW A;  4KT0 E;  2K6D A;  5LJ5 e;  2DD5 B;  3QDF A;  4GBQ A;  2LCL A;  5AT1 B;  2BE7 D;  2PNI A;  3EG9 B;  2KMT A;  5FW9 A;  3QWX X;  3LWH A;  3TCJ A;  1WGS A;  4PJN A;  4ELJ A;  2ED1 A;  4M78 C;  3G4S A;  3O0G D;  2LMJ A;  1GUX B;  3CPW P;  2FPF A;  5DM7 R;  2OAW A;  1VQ5 T;  1SKU B;  2QGS A;  2KRN A;  2BE9 B;  3OSV A;  3CMA Q;  4XTY A;  5GAO m;  3I56 T;  4RCC A;  1BKB A;  1OPK A;  3POM A;  2FZG B;  2EBP A;  3C12 A;  2GTJ A;  1VQ7 A;  5HK0 A;  3CD6 A;  1P92 A;  1AOJ A;  3C0C A;  3BFM A;  4F7U G;  1KHI A;  4N0A C;  3JCM X;  1M90 U;  1RUW A;  5D6W A;  2IW8 B;  2PVO B;  2DXC A;  2LTO A;  4C8Q D;  4EMG A;  1VIN A;  1GCQ A;  3CCM T;  5I21 A;  5I11 A;  4BCM D;  4EDU A;  4PFO A;  3URG A;  2J6K A;  2K3X A;  1KC8 U;  1KQ1 A;  3CC2 T;  2HBW A;  3QG1 A;  1X6B A;  3SD4 A;  2QAZ A;  3BE3 A;  2OTL Q;  1D09 B;  2COY A;  3I55 T;  3CCJ A;  3VKI A;  1FX7 A;  3OSS C;  2AKK A;  4VUB A;  2DBK A;  3A8O B;  2X4X A;  3L2V A;  4EOR B;  3EGU A;  4OGE A;  4MIM A;  5FRO A;  5GAN j;  4M75 E;  3R6O A;  3M57 A;  1NYF A;  5KYU B;  2W96 A;  2Y4Y A;  2RI5 A;  3EHQ A;  1UGQ B;  2KT8 A;  3HRU A;  1PD0 A;  3OMC A;  1JJ2 P;  2CS7 A;  3CMA A;  2O88 A;  5GJV B;  4M7D A;  1ENW A;  3UAT A;  4RTY A;  3G7Z A;  2YDL A;  4C8Q F;  4RG8 A;  5CR2 A;  4ZN3 A;  2FO0 A;  1C9B A;  3PNW C;  3DTO A;  1K8A U;  1YWO A;  1PRM C;  1UG1 A;  2EKH A;  1LNX A;  2WXV B;  2AKL A;  1JXO A;  4AFU C;  2CSQ A;  1FMW A;  2HQX A;  2HSP A;  2DZC A;  2OX7 A;  1YCY A;  2KI7 A;  2DVJ A;  3TU4 K;  2LQ8 A;  1OQK A;  1PG5 B;  1ZLM A;  4J6W A;  3GNG A;  4DBF A;  1QVP A;  2FVU A;  1VQ6 Q;  4BCQ D;  2OTL A;  1VQ9 T;  3RR6 A;  1WDX A;  1F1B B;  5GAN 4;  4Y28 E;  2XG8 D;  1KJW A;  1V76 A;  1QCF A;  5IHN A;  1URC B;  2CH4 W;  1FWZ A;  3FRN A;  3LH0 A;  4OMP A;  1M1K U;  1IRX A;  1WHL A;  3J81 E;  5EC7 A;  2CP3 A;  4JX5 A;  3MP6 A;  1M2V B;  4C8Q C;  2KR6 A;  3BLQ B;  2CZ0 B;  1IHV A;  3X24 B;  4BE2 A;  4C8Q E;  4YC3 B;  3MEA A;  3M0S A;  4EOJ B;  1G3S A;  1WXT A;  3I35 A;  4FU6 A;  1KHC A;  4A4K A;  3JB9 H;  3LGF A;  5IT9 E;  2QFZ A;  1C0M A;  2KY9 A;  1VOL A;  4L59 A;  2MCN A;  3HBL A;  2WMA B;  2K79 A;  4RTU A;  3ZL7 C;  3M03 A;  4BI8 B;  3TNW B;  3CBP A;  2EVR A;  1M1G A;  5CKD A;  3OYA A;  1D0Z A;  4BCK B;  5LJ3 g;  1VQ6 A;  4TTH A;  2GNC A;  5A0L A;  4NST B;  2VC8 A;  4EMH A;  3MP8 A;  3F70 A;  1H64 1;  4MDW A;  4F6W B;  4KH0 B;  1TS9 A;  1D3B B;  4I3Z B;  1OEB A;  2LCC A;  2EGC A;  4C0G A;  1RAD B;  2HNI A;  2D9T A;  1N8R R;  2CT4 A;  2JTF A;  1OV3 A;  1QKW A;  1SHF A;  4WCI A;  2JNG A;  1KC8 R;  5LJ3 h;  4D6W A;  4X34 A;  5EJC A;  4A4H A;  2EPD A;  2HD0 A;  2GFU A;  1WJS A;  2JUF A;  3VS7 A;  4QVZ A;  1VQL Q;  2NUZ A;  2HBP A;  2C06 A;  2EKO A;  2RK2 A;  3MCA B;  1H1R B;  1QCO A;  3CC4 Q;  2IVX A;  1QP2 A;  4ATO A;  3M53 A;  1WHH A;  3HHT B;  3HRT A;  4C0D B;  2V22 B;  1G8X A;  5KYW A;  1UDL A;  4FYX B;  1Y07 A;  3M58 A;  3NGP A;  3GF5 A;  4F7U E;  1YI2 Q;  1M3C A;  2KDS A;  3CCS A;  2RI2 A;  4CRL B;  3ER0 A;  3QYE A;  1QVF A;  5LMK B;  1VQM Q;  2DF6 A;  3HP9 A;  1VQN Q;  2QGG A;  2EYQ A;  3M55 A;  5GJW B;  4C0F A;  3PFS A;  5LQF B;  3OA6 A;  3QZ5 B;  2BS2 A;  1H24 B;  5CIU A;  2CUD A;  3TSW A;  3VS0 A;  1JST B;  1GBR A;  2G9X B;  4E6R A;  1K9M U;  2O4X B;  4IMY B;  2HMA A;  3LH5 A;  5KE3 A;  4QQD A;  4HCK A;  5IHY A;  1R0C B;  4E7J A;  1H1P B;  2DIQ A;  2W10 A;  3B57 A;  3RGF B;  2QQS A;  5GAN d;  5D6X A;  3FDR A;  3E19 A;  3EHR A;  1VQL A;  3REA B;  3OW2 P;  1GH6 B;  4HNT A;  4BY1 X;  4M78 B;  1WJR A;  4MML A;  4ZTJ A;  1H8K A;  4AKG A;  3UWN A;  5IH2 A;  5DLO A;  1K73 U;  3CC4 A;  2DBM A;  1RAI B;  1TXQ A;  4J9G A;  5BNJ B;  3X28 B;  2P4R A;  1PHT A;  2HSE B;  4CFW B;  2F2X A;  1ZBX A;  1UGV A;  2NLU A;  2RF0 A;  3TN8 B;  4CC7 A;  3CEY A;  1NJI C;  4XTW A;  1YI2 A;  4BXX X;  4FSS A;  5GAN 5;  4E7I A;  2V26 A;  3NMZ C;  4OB2 B;  1G5V A;  1IZ6 A;  1VQM A;  4JX6 A;  1VQN A;  5ICP B;  2AHJ B;  3EJ1 B;  1K1Z A;  2CKK A;  2RB6 A;  3CPW A;  1PKT A;  2G3R A;  2YT6 A;  1PNJ A;  2HKQ B;  5L23 A;  3L2W A;  2YSQ A;  2X3X D;  4C0Z A;  2DER A;  4N0A A;  1OGU B;  5CK9 A;  2WMB B;  2O9V A;  2YUO A;  3HKS A;  2R57 A;  3HZJ A;  2W2H A;  2DD4 B;  1XJW B;  5GAN f;  2DVE A;  3PIP A;  5FWB A;  3CCQ T;  3M0P A;  2DIL A;  2RPN A;  2L5Q A;  3OS2 A;  4HT8 A;  2LQW A;  2KT1 A;  2VXE A;  3VU3 C;  4J8O A;  4OVA A;  2D0Q B;  3UA7 A;  4EOQ B;  1W2B P;  2DA9 A;  4WF2 A;  5GAO l;  2SRC A;  1SG5 A;  3I5R A;  3VV0 A;  4HNV A;  3FLG A;  2YLB A;  1C6V X;  2QA4 Q;  2YUN A;  3DL1 A;  1QP3 A;  3BG3 A;  4CFU D;  2J05 A;  2WPA B;  1QVF S;  3V7R A;  2UZE B;  4E7K A;  3V8J A;  2KYM A;  2X9H A;  4N4G A;  2HQE A;  2NYS A;  2PMI B;  4J6X A;  5DY9 A;  4J9C A;  3MEU A;  4IUT A;  4M78 G;  5HBJ B;  3M0T A;  4RUG A;  1VQ8 T;  3G6E T;  2C4G B;  2Z0W A;  2QXF A;  3V7C A;  1N9R A;  2GFA A;  1RLQ C;  1JJ2 A;  2VWF A;  2V1Q A;  2EJG A;  1H1S B;  1SRM A;  2E6Z A;  4XTX A;  1Q7Y C;  2RH2 A;  8ATC B;  1GBQ A;  1X2K A;  3BDU A;  4ZTF A;  3EID B;  2HCK A;  2WSE E;  1RAG B;  3NDQ A;  2I2L A;  2R58 A;  2C5V B;  2J6F A;  2XDP A;  5LJ3 d;  1Q81 U;  5DQW A;  1JO8 A;  1Y96 A;  1SHG A;  1AWX A;  2B8A A;  4EPC A;  1QVG A;  3BG5 A;  4HXJ A;  1G3T A;  4DOV A;  1UEC A;  3CPW S;  5KYN A;  3CQT A;  4IUR A;  1BCM A;  4ROC A;  2BPM B;  5LL6 S;  4C8Q A;  5CQX A;  2ZGW A;  3SFM A;  4EOP B;  2O9S A;  4B9W A;  1RI0 A;  1W4S A;  4BCI B;  4C92 F;  3QYB A;  4C5G A;  5C0M A;  1UNG D;  1QWE A;  3SEM A;  1M2O A;  1AEY A;  3M59 A;  1PKD B;  4LOC A;  3V7S A;  3CC7 Q;  2CSI A;  1UHC A;  4F7L B;  1X75 C;  3DDP B;  1NBE B;  3JCM P;  2SEM A;  3I56 Q;  2RM4 A;  2HAX A;  4QW2 A;  3X25 B;  3DDQ B;  2QAS A;  3OMG A;  4MZM A;  1I1J A;  4M78 D;  4PFZ A;  7AT1 B;  2JM9 A;  1FYN A;  3LWI A;  5LJ3 f;  1WXU A;  1VQO A;  2LQN A;  2P84 A;  2NUT B;  5GAN 2;  4LUD A;  1VQP T;  1VQ4 Q;  3CCM Q;  3SWN A;  4JDS A;  2EQJ A;  4R56 A;  2LCS A;  2QA4 T;  1YJ9 T;  1I5L A;  3PE0 A;  3RNJ A;  3QHR B;  5L2W B;  1ZSG A;  1KD1 U;  1AWO A;  1D0X A;  2NUT A;  3CC2 Q;  4ROE A;  3EFR A;  1WXB A;  2WSC E;  2E1H A;  1K4U S;  2CCI B;  3I55 Q;  1OI9 B;  2ROL A;  3LQ5 B;  4LXC A;  1BI0 A;  1YHQ T;  4C92 C;  1JJ2 S;  1RAB B;  3A8L B;  3KFV A;  4FT2 A;  1UJ0 A;  2DNU A;  1Q86 U;  4A63 B;  1GCP A;  2XK0 A;  3ZBD A;  4PJO F;  2F1L A;  1FXX A;  2FL7 A;  2PK2 A;  3TQ7 P;  1H27 B;  2H3J A;  2JTM A;  1VQ5 A;  2QDJ A;  1X43 A;  1BIB A;  4KH1 B;  3X26 B;  3CXC P;  4O6J A;  1MV3 A;  3I56 A;  1XO2 A;  4BE1 A;  1AWJ A;  1BI1 A;  1SSH A;  1BK2 A;  1H1Q B;  2YUP A;  1TUG B;  3SB2 A;  1KQS P;  2J06 A;  4BDZ A;  5ACB A;  1WI7 A;  3QXE B;  1YJW T;  1FKM A;  4CFN B;  4BBS M;  1QVG S;  1H25 B;  4KGZ B;  3H6Z A;  4LUE A;  1QMZ B;  4JUV A;  1F5Q B;  3CCM A;  3VS2 A;  3MY5 B;  4ZN1 A;  5GAO r;  3HPW A;  1EZZ B;  4PJM A;  2NUP B;  3TW6 A;  1ARK A;  4RKU E;  1AD5 A;  3CC2 A;  2GTO A;  3A98 A;  3NTI A;  1XQH A;  4CC4 B;  1TUD A;  3AHU A;  1VQ9 Q;  1LOJ A;  3I55 A;  4E7H A;  2AZS A;  3PMI A;  1BIA A;  2NUP A;  4XU3 A;  1N27 A;  4Y91 A;  1V1C A;  1IB8 A;  4N4H A;  2K57 A;  1VIF A;  4FW2 A;  4J7I A;  3LLR A;  4PJO C;  2CH4 A;  2LW4 A;  5FLX E;  1Q81 R;  1K76 A;  2DMO A;  4FW1 A;  3MEW A;  3U23 A;  3M9Q A;  2DD5 A;  5A0G A;  4IUV A;  3OS1 A;  2KSS A;  5CKB A;  1JRI A;  1VYT A;  4M78 E;  3RUX A;  3EG2 A;  3EG9 A;  1B07 A;  4A4G A;  4XU1 A;  2H3E B;  3MIA B;  2VAS A;  2EQI A;  1NPP A;  3CC7 T;  4MFE A;  3KUF A;  2EJF A;  4HCZ A;  5KYX B;  2IN3 A;  1GUX A;  2RHY A;  4N4I A;  3OYY A;  3MO8 A;  4BUG A;  2LT4 A;  3J80 E;  3S3M A;  5L8R E;  2QYZ A;  2QQR A;  2EJ9 A;  1DJ7 B;  4HKE A;  4QVC A;  5HQ0 B;  3M56 A;  1Q82 R;  2NWM A;  1R77 A;  4C5I A;  5GAN g;  1VQ4 T;  2K3Y A;  2VUB A;  3QYH B;  2QEX T;  3EH1 A;  5GAM e;  4XTU A;  1R8O B;  3RKY A;  2DPP B;  3PGG A;  2RN8 A;  4B9X A;  1W98 B;  2KR3 A;  1VQ9 A;  3NHN A;  2YRV A;  3OYD A;  3EGX B;  1JB0 E;  1RL2 A;  2MWO A;  3RKW A;  2EQU A;  2M9U A;  4BCN B;  5A2Q E;  4RTT A;  1UUE A;  1BI3 A;  4IUQ A;  4GY5 A;  4Y92 A;  2WSF E;  4IUU A;  4ROD A;  5GAN h;  4HCC A;  3EGX A;  4J9F A;  1TTH B;  1AHJ B;  3X20 B;  2QTX A;  1LPL A;  3OS0 A;  2H8H A;  1OL2 B;  3JCM d;  3M0Q A;  3RMQ A;  1TUC A;  2F69 A;  2M16 A;  2PZ1 A;  4BD3 A;  1W2B A;  2A37 A;  3HO8 A;  1N8R C;  1JBM A;  2EYZ A;  5KYU A;  3P8D A;  3H8Z A;  4MFD A;  2E10 A;  2O2O A;  1MMG A;  3QWY A;  1HK9 A;  5IF1 B;  2DAQ A;  3WXM B;  4DQ2 A;  5IHI A;  5GAO q;  2PVD B;  1TWB A;  4A53 A;  4JJN K;  1I5O B;  1WLP B;  2WEV B;  4ELL A;  4A54 A;  1TG0 A;  4OGC A;  5CEI B;  1U3O A;  3QJ6 A;  2FRW A;  3L1A A;  3GIB A;  2JM8 A;  1OI1 A;  2ED0 A;  2LX9 A;  4X1V A;  3C4S A;  1E6H A;  4AT1 B;  1UGS B;  2A36 A;  1Y71 A;  2M02 A;  2QDL A;  3JCM Q;  3OYF A;  1QMC A;  2DIG A;  3VS5 A;  3UDC A;  3G1J A;  3I5S A;  4EOK B;  4ZNX A;  2E3H A;  1OUL A;  1MMN A;  1UE9 A;  1PM3 A;  3M54 A;  3DKM A;  1ZQ1 A;  3BDL A;  1PSF A;  1G3Y A;  1D1B A;  2R5A A;  4OGR B;  3VS4 A;  1IGU A;  4C5H A;  4KUI A;  2HKN A;  1M2V A;  2XIC A;  2JMA A;  3D7S B;  4LD9 K;  4KGV B;  2C6T B;  5I22 A;  4AKI A;  2XHC A;  2YRD A;  2FG0 A;  1ZSZ C;  2E65 A;  8AT1 B;  1IXD A;  2DKG A;  4BE0 A;  4DEX A;  1SRL A;  4RMO A;  3OYL A;  4FX3 B;  3TW7 A;  1Y57 A;  1UNL D;  4FT4 A;  1U1T A;  3TVT A;  3BHU B;  2MIO A;  3EFO B;  1AVZ C;  5EFQ B;  1BYM A;  3M5A A;  2L8D A;  1M90 R;  1ACM B;  4M7A F;  2GF7 A;  2AIR B;  4M77 B;  4YOO A;  4FIB A;  4L6V 5;  3R6N A;  2GQV A;  2EFI A;  2LDM A;  2B9R A;  4HT9 A;  1PRL C;  2LNH B;  4PL6 A;  1NEG A;  3CCQ Q;  4QKU A;  4C92 B;  2XDD A;  3BLR B;  4JJC A;  1D3B A;  1RLP C;  1PKS A;  1JSU B;  2L3S A;  2XKO C;  1GL5 A;  4ZGE B;  2ZCF B;  1M3B A;  4BDY A;  2L3P A;  2P0Q A;  1VQK T;  3OB9 A;  5GAN 3;  4FSX A;  3PT9 A;  3V8L A;  3FB9 A;  1AT1 B;  4BI3 A;  4Y72 B;  4ANJ A;  2KXC A;  2EYW A;  4M4Z A;  2MPX C;  2ROT A;  2GBQ A;  2E6N A;  4NC6 A;  1OU9 A;  2D8H A;  5CAI A;  5DQV A;  1CKB A;  3PTA A;  3EOC B;  4GLK A;  5GMK e;  4EOL B;  3AT1 B;  2K2M A;  4OML A;  5A0D A;  3ME9 A;  2WHB B;  4PLL A;  1PWT A;  2FHD A;  2RJD A;  2DXT A;  4BCN D;  3HSB A;  1VQ8 Q;  2WIH B;  3G6E Q;  1O9K B;  3CBM A;  2HL5 C;  4M7A C;  4JS5 A;  2CZ1 B;  1X2Q A;  2DYB A;  2F5T X;  3CCR T;  5LJ5 j;  3CXC A;  1S1N A;  2OJ2 A;  2XMF A;  1K8A R;  3FIF A;  3UT1 A;  4BI4 A;  3MJX A;  1VA7 A;  1UGR B;  2X4Y A;  5FRM A;  1KQS A;  3CCQ A;  4B6M A;  3JB9 G;  2BS4 A;  1MMA A;  3M4Y A;  4PJO B;  4NL3 A;  3INZ A;  2MWP A;  2EQM A;  2RMO A;  2O4X A;  4F6S B;  5D6Y A;  2E41 A;  1ZA1 B;  3FJ5 A;  4JRP A;  1BCO A;  3E1S A;  3OYJ A;  1N5Z A;  2KXD A;  3ZEH A;  1OKV B;  2AT1 B;  1TSF A;  2DRK A;  4J83 A;  4CC3 A;  1NJI U;  4OB0 B;  4PK4 A;  3JCM V;  4HNU A;  2QDY B;  4M78 A;  4F16 A;  3BY7 A;  1UJY A;  3C94 A;  5I2S A;  1YIJ T;  2C0O A;  2D8J A;  2VYT A;  3BG9 A;  1M1K R;  2A28 A;  2RHU A;  1X01 A;  4C92 G;  1UFF A;  2E5K A;  1N9S A;  2K5I A;  3LYI A;  1O9S A;  3OYN A;  1ZP2 A;  4UN0 A;  5GAM j;  1VQ8 A;  1KIK A;  3QO3 A;  3G6E A;  2CP2 A;  2CP6 A;  3TEE A;  4A4F A;  4KBM B;  4LDV A;  2FZC B;  1B34 B;  2L2P A;  4CRI A;  4ZGD B;  1U8R A;  4F70 B;  1WA7 A;  2LVM A;  4RTX A;  4QQG A;  5DLQ E;  2RHI A;  1KFZ A;  5J39 A;  2CJM B;  1OU8 A;  3QUI A;  3KBG A;  4M7D F;  3L2Z A;  3JCM W;  4J9H A;  3PO3 S;  4MMK A;  5HVY B;  3QWL A;  1JOW A;  2DD4 A;  1VYU A;  2V8J A;  1GFD A;  3QZ9 B;  1VQP Q;  1VYV A;  2DET A;  2YLC A;  4F17 A;  4Q5W A;  4BAC A;  1YJ9 Q;  1G3W A;  4Z8A A;  1X6G A;  3O5Z A;  1RAC B;  1IHW A;  2JXB A;  4M75 B;  2EYY A;  5CKH A;  3UF4 A;  4CI0 C;  1YWP A;  3NPF A;  2FZK B;  3CCL T;  1I81 A;  3QBY A;  4PJO G;  4DOW A;  3CXC S;  1YHQ Q;  1XTD A;  2JS0 A;  2C5O B;  2VGN A;  2DL7 A;  2DX1 A;  4A4E A;  1KQS S;  2IPO B;  4JRI A;  1HXD A;  2W9Z A;  1OZ2 A;  1M30 A;  2V1R A;  1Q7Y U;  2RK1 A;  5D7U A;  2BIV A;  2YHT A;  5C6S A;  3VYG B;  3GLX A;  2FYK A;  4M7D C;  1VYW B;  9ATC B;  4FCY A;  4E7L A;  4C92 D;  3CCE T;  2KAF A;  2RNA A;  5GMK m;  3OYM A;  1WHM A;  5GAN e;  3VYG A;  5KH6 A;  1YJW Q;  3FC3 A;  4GLM A;  4M6V A;  3M0R A;  3UPU A;  1YIT Q;  4PLI A;  3JB9 F;  4EC8 B;  2E64 A;  1VUB A;  3VS3 A;  2QK0 A;  3QHW B;  1W1F A;  1VQP A;  3PVL A;  4L5G A;  1Y7X A;  3JCM g;  6AT1 B;  3OYI A;  1K9M R;  2EUF A;  2QA4 A;  1YJ9 A;  2JVV A;  1Z9Q A;  4HA8 A;  3QJY A;  1HD3 A;  1W70 A;  2V8I A;  3JCM b;  2KE9 A;  2CCH B;  1WQW A;  4OMM A;  1NG2 A;  2MAM A;  1YHQ A;  1IGQ A;  1UHF A;  2IW9 B;  4G6L B;  2DXU A;  4M77 F;  1OX8 A;  1AWW A;  4EON B;  1FMK A;  1ABO A;  3HB9 A;  2X51 A;  3JCM h;  3GBQ A;  2CP0 A;  1K73 R;  2OTJ T;  1ZSZ B;  1V29 B;  1LVK A;  1YBY A;  1B3Q A;  2RJE A;  3KHI A;  5EG2 A;  2BTT A;  1FIN B;  5IHK A;  2KYB A;  5HBE B;  4PNO A;  2JT4 A;  1M5Q 1;  2EIF A;  1ZSZ A;  3VS6 A;  2JZ2 A;  3L2R A;  1X27 A;  1AD6 A;  4PJO D;  4X9D A;  5LJ5 d;  2KEA A;  1KK7 A;  4XQ3 A;  3QII A;  1U06 A;  5IDP B;  1TFB A;  2LNV A;  1OX9 A;  2PUK B;  1YJW A;  3OYK A;  2MF2 A;  4JPB W;  1TH7 A;  1I0C A;  4J9D A;  4F7N B;  3JB9 I;  2E4H A;  3G71 T;  3VKG A;  1YJN T;  5FWC A;  2A7Y A;  3QPH A;  4LE9 A;  2COZ A;  2QEX Q;  1Q82 C;  3C95 A;  2P0K A;  1HSQ A;  2JJ9 A;  5KYY B;  4M77 C;  1YNZ A;  2FB7 A;  4J5Y A;  1WHK A;  3CME T;  1KQ2 A;  3RBB B;  2ZZD B;  5HK3 A;  5GMK j;  2CYZ B;  3CCV Q;  4DA4 A;  4C92 E;  2ATC B;  4F6U B;  2PU9 B; 
#chains in the Genus database with same CATH homology
 2OTJ A;  3RMQ A;  4QVZ A;  1QLB A;  2F69 A;  4EMK B;  2HBP A;  2M16 A;  4MZT A;  4BD3 A;  2XID A;  4Z02 A;  1W2B A;  2C06 A;  3HO8 A;  3QDR B;  1N8R C;  3CC4 T;  3A8G B;  1JBM A;  2EKO A;  2DEQ A;  1SSF A;  3CC7 A;  1XNI A;  1WPY A;  2RK2 A;  3MCA B;  3H8Z A;  4MFD A;  3P8D A;  2E10 A;  4M77 D;  3QKJ A;  5IN1 A;  3GP8 A;  4LDY A;  1QP2 A;  1HK9 A;  2ZPH B;  4M7A B;  4ELZ C;  4ATO A;  3M53 A;  3HHT B;  3HRT A;  2DAQ A;  3WXM B;  2JN0 A;  4C0D B;  4DQ2 A;  5GAN 7;  1UGP B;  1Y07 A;  3RES A;  3M58 A;  5GAO q;  3WVE B;  2PVD B;  4A53 A;  4JJN K;  1YI2 T;  4M7D E;  2EAY A;  3GF5 A;  4NL2 A;  4RCB A;  5FU7 C;  4F7U E;  4QVD A;  1H3Z A;  1YIT T;  4A54 A;  2KDS A;  2RHX A;  5LJ3 e;  1VQM T;  1M4Z A;  1VQN T;  3CCS A;  3G71 A;  1VQ4 A;  2RI2 A;  3ER0 A;  3Q1J A;  3QYE A;  1NE8 A;  4OGC A;  1YJN A;  1QVF A;  2QQ8 A;  3HP9 A;  2EYQ A;  3M55 A;  4C0F A;  3QJ6 A;  3CPF A;  3PFS A;  2QEX A;  1LJO A;  3L1A A;  3LGL A;  3OA6 A;  3QZ5 B;  2BS2 A;  3GIB A;  4JLG A;  5CIU A;  1OI1 A;  2VV5 A;  5GAN 8;  2L89 A;  4PKC C;  2LX9 A;  4V2S A;  2GCX A;  1K9M U;  3HL8 A;  2O4X B;  3C4S A;  3P8H A;  2OAU A;  4XTV A;  5KE3 A;  4QQD A;  2ZPE B;  1UGS B;  1Y71 A;  4E7J A;  3QYG B;  4LDW A;  1Y96 B;  4OP0 A;  3JCM Q;  3OYF A;  2DIQ A;  2QQA A;  3CME A;  2DIG A;  2WJ9 A;  3UDC A;  2QQS A;  5GAN d;  3MET A;  5CKE A;  1GXI E;  4PJO E;  5D6X A;  1I8F A;  3FDR A;  1VIE A;  3E19 A;  3S3N A;  1VQL A;  3M54 A;  4HNT A;  4M78 B;  1EIF A;  1WJR A;  3DKM A;  4MML A;  4ZTJ A;  1ZQ1 A;  2MI6 A;  4FL6 A;  4IUP A;  4OB1 B;  2RD1 A;  3BDL A;  1PSF A;  4C8Q B;  2DXB B;  4AKG A;  2DO3 A;  3UWN A;  5GAN 6;  5DLO A;  1K73 U;  3CC4 A;  3OW2 A;  1G3Y A;  2ZPG B;  2XU8 A;  1Q81 C;  2R5A A;  1ZHI A;  3X28 B;  1ZBX A;  2NLU A;  3JCM J;  3ASK A;  4C5H A;  2G77 A;  4KUI A;  3L42 A;  1S72 T;  2XIC A;  4M75 G;  2QF7 A;  2DXB A;  3CEY A;  3GNF B;  5HKC A;  1NJI C;  4LD9 K;  2X35 A;  3O8V A;  4M75 F;  4AKI A;  4XTW A;  2XHC A;  3E9G A;  1YI2 A;  5GAN 5;  2DJZ A;  2E65 A;  2LRQ A;  4E7I A;  1N6A A;  3OYH A;  4OB2 B;  2DKG A;  3S3O A;  4BY6 C;  3PIO A;  4BE0 A;  1YIT A;  3VUZ A;  1G5V A;  4RMO A;  3CCU T;  1IZ6 A;  3L2Q A;  1VQM A;  4JX6 A;  3OYL A;  1VQN A;  1M1F A;  2AHJ B;  2XI9 A;  2F5K A;  1Q82 U;  2RB6 A;  2CKK A;  3CPW A;  3TW7 A;  1NZ9 A;  2G3R A;  3P8B B;  4FT4 A;  2KMG A;  1U1T A;  3L2W A;  4C0Z A;  2V8K A;  2DTO A;  4N0A A;  4HLQ A;  5GMK i;  2DXC B;  5CK9 A;  4M7A G;  4XTZ A;  1BYM A;  3BW1 A;  5KCH A;  3OY9 A;  3DLL A;  3HKS A;  2R57 A;  3HZJ A;  2L8D A;  3M5A A;  2DD4 B;  4M7A F;  3VJP A;  5GAN f;  2GF7 A;  5FU6 B;  4M77 B;  2DVE A;  4FIB A;  4L6V 5;  3PIP A;  2VXF A;  2CGH A;  2GQV A;  2KQW A;  3PMT A;  2EFI A;  2LDM A;  3DB3 A;  3SWN B;  3CCQ T;  4HT9 A;  1QW1 A;  2IVW A;  4PL6 A;  4M77 E;  3L2U A;  2L5Q A;  2ZPF B;  4OB3 B;  4OF1 A;  3OS2 A;  4HT8 A;  3CCV T;  2VXE A;  2M0O A;  3VU3 C;  2CZ7 B;  5GMK h;  4C92 B;  2XDD A;  4J8O A;  4OVA A;  1M90 C;  2D0Q B;  1D3B A;  2E12 A;  1N8R U;  3SDZ A;  4WF2 A;  5GAO l;  5I2M A;  3A8M B;  2XKO C;  3VV0 A;  2P4T A;  4HNV A;  4ZGE B;  2ZCF B;  2LC4 A;  3FLG A;  5M9O A;  4BDY A;  2EQK A;  4HCB A;  2YLB A;  4X9C A;  2P0Q A;  4JX4 A;  1VQK T;  4BBR M;  1OYX A;  2ZZD A;  3OB9 A;  4FSX A;  3PT9 A;  3DL1 A;  1QP3 A;  4LD6 A;  3V8L A;  5GAN 3;  3BG3 A;  3FB9 A;  5GAM d;  4BI3 A;  5J3B A;  1O75 A;  4M75 C;  5LJ5 f;  3OYG A;  1QVF S;  1KC8 C;  2K5F A;  1KD1 C;  4C5E A;  5CKF A;  1S72 A;  4EMK A;  2D6F A;  3V7R A;  3OYE A;  4E7K A;  4JRQ A;  2E6N A;  3V8J A;  2RJC A;  3NTH A;  4M7D B;  4E47 A;  2XDB A;  2K2V A;  4N4G A;  4F7U B;  2HQE A;  4NC6 A;  4AI6 A;  1UEB A;  5CAI A;  1NPR A;  3TRE A;  3FJP A;  2RO0 A;  3G4S T;  4J6X A;  3OYC A;  3PTA A;  5FU7 B;  5DY9 A;  3VYH B;  2E5Q A;  3MEU A;  4GLK A;  4IUT A;  4M78 G;  5GMK e;  3CCU A;  4KUD K;  4M7A A;  1Q86 C;  5A0D A;  1VQ8 T;  3ME9 A;  4PLL A;  4M78 F;  3G6E T;  3OBY A;  4FM4 B;  2FHD A;  2JOY A;  2RJD A;  4C8Q G;  2QXF A;  3V7C A;  2DXT A;  4F7U A;  2XD0 A;  3HSB A;  1N9R A;  4HL4 A;  4M7A C;  3CBM A;  4IKF A;  2GFA A;  4JS5 A;  2CZ1 B;  2KVQ G;  4II1 A;  4M75 D;  1JJ2 A;  2F5T X;  4C0D C;  5GAO p;  3CCR T;  2EJG A;  5LJ5 j;  4ME7 A;  4XTX A;  2E6Z A;  3NFC A;  5HY6 A;  3CXC A;  3RIR A;  3FIF A;  1Q7Y C;  5IAY A;  3UT1 A;  1VQ7 T;  4BI4 A;  3CD6 T;  1UGR B;  2X4Y A;  2RH2 A;  5FRM A;  3A8H B;  3OW2 S;  1KQS A;  3BDU A;  3CCQ A;  3JB9 G;  2BS4 A;  4ZTF A;  3M4Y A;  2BKD N;  2DK3 A;  4XU2 A;  2WSE E;  4PJO B;  2PQW A;  2RHZ A;  4NL3 A;  3CCV A;  3INZ A;  1VQO T;  2ZPI B;  2MWP A;  3JCM f;  1MGQ A;  2ZPB B;  2EQM A;  2I2L A;  2L3R A;  2O4X A;  2R58 A;  5D6Y A;  3EAE A;  2Y90 A;  4NS5 A;  2E41 A;  2XDP A;  5GAM f;  3DB4 A;  3LX7 A;  5LJ3 d;  1OZ3 A;  1Q81 U;  3KXT A;  3VKH A;  4M7A D;  3JB9 J;  4ZGJ B;  1Y96 A;  3RER A;  4JRP A;  3E1S A;  3OYJ A;  1VQK A;  2EWN A;  3ZEH A;  2B8A A;  4O5V A;  5J26 A;  3H4C A;  4EPC A;  1QVG A;  3BG5 A;  5GMK l;  1M8V A;  1G3T A;  4J83 A;  3CCJ T;  4KT0 E;  5LJ5 e;  1NJI U;  2DD5 B;  4OB0 B;  3JCM V;  4DOV A;  4HNU A;  3CPW S;  2QDY B;  1XOV A;  4M78 A;  2P0P A;  2X4J A;  2LCL A;  2MMP A;  3BY7 A;  3C94 A;  5I2S A;  1YIJ T;  4RG2 A;  4IUR A;  2VYT A;  2E70 A;  3BG9 A;  2KMT A;  3M4G A;  5CO7 A;  5LL6 S;  3TCJ A;  4C8Q A;  2RHU A;  3LWH A;  1X01 A;  2Y4X A;  1PSE A;  1WGS A;  3LW5 E;  3HFN A;  4ELJ A;  4M78 C;  2ZGW A;  5CQX A;  3SFM A;  4C92 G;  3G4S A;  4B9W A;  1RI0 A;  1N9S A;  2K5I A;  1W4S A;  2QI2 A;  3LYI A;  1O9S A;  5DM7 R;  4C92 F;  3OYN A;  4MDX A;  2RI3 A;  4BY6 B;  5GAM j;  2VGM A;  3QYB A;  4C5G A;  5AYF A;  5C0M A;  1VQ5 T;  1VQ8 A;  3QO3 A;  1M1K C;  3G6E A;  3CMA T;  3MEV A;  2A3L A;  1IRE B;  3TEE A;  4A4F A;  2KK4 A;  3M59 A;  3OSV A;  4LOC A;  4KBM B;  1MHN A;  4LDV A;  4XTY A;  5GAO m;  3V7S A;  4OMF B;  3I56 T;  4RCC A;  1B34 B;  1X75 C;  3CCR A;  1BKB A;  3JCM P;  4CRI A;  4ZGD B;  2RM4 A;  1U8R A;  2HAX A;  3J7A F;  4QW2 A;  3C12 A;  1VQ7 A;  3X25 B;  2BS3 A;  3CCL T;  3WVD B;  5HK0 A;  3OMG A;  3CD6 A;  1P92 A;  3NTK A;  2IG0 A;  2LVM A;  4MZM A;  3BFM A;  4QQG A;  1W2B S;  4M7D G;  4M78 D;  5DLQ E;  2RHI A;  4F7U G;  3JAM E;  1KHI A;  4N0A C;  3JCM c;  5J39 A;  3JCM X;  3QUI A;  1M90 U;  3JRZ A;  3KBG A;  4M7D F;  3L2Z A;  3JCM W;  5D6W A;  3DLM A;  3LWI A;  4MMK A;  2PVO B;  2DTH A;  2DXC A;  2LTO A;  5LJ3 f;  4C8Q D;  4F7U F;  4EMG A;  3QWL A;  1VQO A;  3JCM e;  2RJF A;  3CCM T;  1KG1 A;  5I21 A;  2DD4 A;  5GAN 2;  4ELY C;  1VQP T;  4EDU A;  4JLI A;  4XU0 A;  1X6O A;  2V8J A;  3URG A;  4M77 A;  3QZ9 B;  3SWN A;  3ZFJ A;  4JDS A;  2EQJ A;  4R56 A;  2K3X A;  1KC8 U;  1I5L A;  2QA4 T;  1KQ1 A;  1YJ9 T;  1K8A C;  3CC2 T;  3HFO A;  2BUD A;  2OTL T;  2YLC A;  4BAC A;  4Q5W A;  3QG1 A;  1KD1 U;  3OQ5 A;  3SD4 A;  1UB4 A;  5FU6 C;  1G3W A;  2PUO B;  4C92 A;  2DTI A;  3EFR A;  3SWN C;  3I55 T;  2WSC E;  2E1H A;  3RKX A;  3VKI A;  3CCJ A;  4LDX A;  1FX7 A;  3OSS C;  4VUB A;  3MP1 A;  4M75 B;  3A8O B;  5CKH A;  2LT1 A;  1BI2 A;  2X4X A;  3L2V A;  1YIJ A;  4OGE A;  4CI0 C;  4MIM A;  1BI0 A;  5FRO A;  5GAN j;  4C92 C;  1YHQ T;  4M75 E;  3A8L B;  5LJ5 g;  5CCA A;  1JJ2 S;  3R6O A;  4FT2 A;  1I81 A;  3QBY A;  2QQ9 A;  3M57 A;  5CVI A;  4PJO G;  4DOW A;  4R55 A;  3CXC S;  5LJ3 j;  1Q86 U;  2XK0 A;  3ZBD A;  1XTD A;  2Y4Y A;  4PJO F;  2RI5 A;  2VGN A;  5CQY A;  1UGQ B;  1FXX A;  2FL7 A;  4KUL A;  4A4E A;  4EMK C;  4J7F A;  3HRU A;  2H3J A;  3OMC A;  1KQS S;  2JTM A;  4JRI A;  1VQ5 A;  2QDJ A;  1HXD A;  1OZ2 A;  1BIB A;  2CS7 A;  3CMA A;  4M7D A;  3X26 B;  2O01 E;  1Q7Y U;  2RK1 A;  4O6J A;  5GAO n;  2CZ6 B;  2BIV A;  4LDU A;  3I56 A;  4BE1 A;  3G7Z A;  2YHT A;  5C6S A;  3VYG B;  1U1S A;  3GLX A;  3N5B B;  4C8Q F;  1BI1 A;  4RG8 A;  2FYK A;  5LJ5 h;  4M7D C;  3QHS A;  5CR2 A;  4ZN3 A;  3SB2 A;  4M7A E;  4E7L A;  4C92 D;  3CCE T;  2KAF A;  5GMK m;  4BDZ A;  3PNW C;  3QXE B;  3OYM A;  1YJW T;  1K8A U;  5GAN e;  1FKM A;  3VYG A;  4BBS M;  3VUB A;  1QVG S;  1LNX A;  5KH6 A;  3FC3 A;  4M6V A;  3H6Z A;  3UPU A;  2HQX A;  4JUV A;  1E7P A;  4PLI A;  3CCM A;  2E64 A;  3JB9 F;  1VUB A;  2DZC A;  4J6Y A;  1YCY A;  3RMS A;  1M9S A;  3TU4 K;  1VQP A;  4ZN1 A;  2LQ8 A;  5GAO r;  3HPW A;  1VQ6 T;  3TW6 A;  2K5L A;  3EFS A;  3OBW A;  3GNG A;  4J6W A;  4L5G A;  1QVP A;  1Y7X A;  2FVU A;  4RKU E;  3JCM g;  5KE2 A;  3OYI A;  2QA4 A;  1YJ9 A;  3CC2 A;  2OTL A;  2X4W A;  4BB7 A;  1VQ9 T;  4PJO A;  2JVV A;  3NTI A;  4M7D D;  1XQH A;  5GAM g;  4JS4 A;  2R5M A;  5GAN 4;  4Y28 E;  3AHU A;  1LOJ A;  4QSH A;  2XG8 D;  4HA8 A;  3PMI A;  1BIA A;  3QJY A;  4XU3 A;  3I55 A;  4E7H A;  1N27 A;  4Y91 A;  2V8I A;  3JCM b;  4N4H A;  2K57 A;  1VIF A;  3A5Z B;  4PJO C;  4J7I A;  3LLR A;  1WQW A;  4M77 G;  1K9M C;  2MAM A;  5FLX E;  5KCO A;  1YHQ A;  1FWZ A;  4YTL A;  3T9N A;  2DXU A;  1WQ7 A;  4M77 F;  3FRN A;  3LH0 A;  3CCL A;  3MEW A;  3M9Q A;  1M1K U;  3HB9 A;  2DD5 A;  5A0G A;  4IUV A;  4TVR A;  4JRK A;  3JCM h;  3J81 E;  3OS1 A;  2KSS A;  5CKB A;  4JX5 A;  2OTJ T;  1JRI A;  3MP6 A;  1V29 B;  4M78 E;  4C8Q C;  3RUX A;  1YBY A;  2KR6 A;  2RJE A;  5GAM h;  4A4G A;  3KHI A;  4XU1 A;  3OYB A;  2CZ0 B;  1WJQ A;  3X24 B;  4P5N A;  4BE2 A;  5EG2 A;  4C8Q E;  3CC7 T;  1NPP A;  4MFE A;  3KUF A;  2EJF A;  3HRS A;  3MEA A;  4HCZ A;  4PNO A;  1M5Q 1;  2EIF A;  1G3S A;  4FU6 A;  2RHY A;  2JZ2 A;  4N4I A;  1KHC A;  3L2R A;  4PJO D;  3OYY A;  3MO8 A;  4BUG A;  1K73 C;  2LT4 A;  4A4K A;  2K4Y A;  3LGF A;  4X9D A;  5LJ5 d;  3J80 E;  5IT9 E;  3S3M A;  5L8R E;  4XQ3 A;  3JB9 H;  3CCE A;  2QQR A;  3S6W A;  2QFZ A;  3QII A;  2EJ9 A;  1DJ7 B;  2KY9 A;  2LNV A;  4HKE A;  2PUK B;  1YJW A;  4L59 A;  4QVC A;  3HBL A;  3M56 A;  3OYK A;  2MF2 A;  1WNL A;  4BI8 B;  1B34 A;  4UC4 A;  4Z6Y A;  1TH7 A;  3CBP A;  3OS5 A;  4C5I A;  3JB9 I;  3CCS T;  2GFU A;  5GAN g;  1M1G A;  3G71 T;  3VKG A;  1VQ4 T;  2M1H A;  5CKD A;  3OYA A;  1YJN T;  2DZ9 A;  2K3Y A;  2VUB A;  4XAX B;  5LJ3 g;  1VQ6 A;  2A7Y A;  3QYH B;  5A0L A;  2QQB A;  3GPL A;  2QEX T;  3QPH A;  1I4K 1;  3CBO A;  5GAM e;  4XTU A;  5FRN A;  1R8O B;  2VC8 A;  3RKY A;  2DPP B;  3PGG A;  4B9X A;  4EMH A;  2LQK A;  3MP8 A;  1Q82 C;  3QSU A;  1VQ9 A;  4MZP A;  3C95 A;  3F70 A;  3MHX A;  2P0K A;  4NOY A;  4QQ6 A;  2YRV A;  3E9F A;  1H64 1;  4MDW A;  3OYD A;  1JB0 E;  1RL2 A;  2MWO A;  4M77 C;  3RKW A;  2EQU A;  1D3B B;  2M9U A;  5A2Q E;  2FB7 A;  3JB9 D;  2LCC A;  4C0G A;  4AKH A;  4J5Y A;  2HNI A;  1BI3 A;  2D9T A;  4GY5 A;  4IUQ A;  3FEO A;  3V8K A;  2WSF E;  3CME T;  1KQ2 A;  2PVG B;  4IUU A;  5GAN h;  4HCC A;  2ZZD B;  2JTF A;  4XK8 E;  5HK3 A;  2WAC A;  5GMK j;  1AHJ B;  2CYZ B;  2JNG A;  4DA4 A;  3X20 B;  2QTX A;  5LJ3 h;  4D6W A;  4X34 A;  2RA2 A;  3JSC A;  3OS0 A;  5EJC A;  4C92 E;  3GOX A;  1VQL T;  2PU9 B;  4M75 A;  4A4H A;  2HD0 A;  1WJS A;  2JUF A;  3JCM d; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...