1AHJB

Nitrile hydratase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold.
pubmed doi rcsb
molecule tags Lyase
molecule keywords NITRILE HYDRATASE (SUBUNIT ALPHA)
total genus 53
structure length 212
sequence length 212
chains with identical sequence D, F, H
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ahjB02
3LW5E 2DD4A 2PVDB 2PVOB 4ZGDB 3QXEB 3WVDB 2PU9B 2CZ1B 4ZGEB 1IREB 1GXIE 2PVGB 2ZPFB 1AHJB 2WSEE 2DXBB 2ZPEB 3A8LB 2CZ6B 3A8HB 1UGQB 4FM4B 2CZ7B 1UGRB 3VYGB 3VYHB 2ZPBB 2QDYB 3A8GB 1JB0E 3X25B 4Y28E 4ZGJB 2D0QB 2ZPGB 1QP3A 2DXBA 2DXCA 4OB3B 3A8MB 1PSFA 5L8RE 1UGPB 1QP2A 2DD4B 4OB1B 1PSEA 3VYGA 2DD5A 3HHTB 3QYHB 1UGSB 2ZPIB 4L6V5 3A8OB 3WVEB 2PUOB 4RKUE 2CYZB 2DD5B 3X26B 2PUKB 1DJ7B 4XK8E 2DXCB 2WSFE 3X24B 2DPPB 2AHJB 3QYGB 1V29B 2ZCFB 4OB0B 4KT0E 2WSCE 3QZ5B 2ZZDB 3QZ9B 4OB2B 2ZPHB 3X28B 2O01E 3X20B 2ZZDA 2CZ0B
chains in the Genus database with same CATH superfamily
2K7AA 2SEMA 1KQSA 2A08A 4X34A 2KBTA 1Y57A 1P92A 2DEUA 3R6NA 4YOSA 2IVWA 3CXCP 1QVGP 4CFUD 4OVAA 4Y91A 1UNLD 4AFSC 3C0CA 4EC8B 3OMGA 2EVRA 2C0TA 3REAB 5GAN8 1T0HA 1WNLA 1ZSGA 3OYYA 4MIMA 3QWLA 2CCHB 2WFYB 3X25B 3SFMA 2YUQA 2R5MA 5CR2A 1TU0B 4DBFA 3V7SA 2W96A 2F2WA 2K2VA 3PVQA 4PL6A 3O5ZA 3M0PA 4OB3B 2BTTA 4J6WA 2HMAA 3POMA 4Y92A 2BZXA 3DL1A 1QP2A 5IXBA 2QAZA 2EYZA 3C94A 4OF1A 4EOMB 1H8KA 1PSEA 5LJ5g 4ROEA 4PJOA 4IUTA 2G9XB 1UE9A 5DY9A 4M4ZA 1GUXA 1X75C 1AD6A 3OS1A 5LJ3h 3LX7A 2RHUA 2QEXT 2RJDA 3U23A 1QVPA 1VUBA 2DL8A 2K2MA 2XDPA 4X9DA 2CYZB 1UJ0A 3CC4T 2EPDA 3JSCA 3E1SA 3VS1A 1YI2T 5KYNA 4K11A 2CP3A 1MMNA 1BYMA 3MY1B 3KUFA 3QPHA 2V8KA 4C92E 1LCKA 5A2QE 4HLQA 1FMVA 4BCNB 2M51A 3QZ9B 5IN1A 1FINB 2ZPHB 2EBPA 4QQDA 4ZTJA 2YUNA 4NOYA 4IUVA 4ELYC 2FL7A 3AT1B 3O0GD 2GQIA 2RQRA 4XTZA 3G71Q 2LX7A 2AT1B 1UHCA 2ED1A 4FCYA 1YHQQ 3M59A 1RI9A 3RNJA 4C5HA 3SDZA 2DFUA 3QIIA 3EGUA 4ZNXA 1HJDA 4FW2A 4F7UE 2DXTA 2YSQA 1Q7YC 4HCKA 1G3TA 1JQQA 3MP1A 2DA9A 1LNXA 2EKOA 3CD6Q 1YJNT 4DBRA 3RKWA 3EG3A 3VS5A 2VASA 4Y72B 1OEBA 4CRIA 2HAXA 2X9HA 1TUCA 1KC8R 4B9XA 4JJDA 4FSSA 3A8GB 4FYXB 4C92D 4C8QA 2WXVB 1Z9ZA 2DL3A 2E4HA 1B34B 2ENMA 4KH0B 2FZKB 3EFRA 2HQEA 5LJ3j 1NM7A 3OSSC 5IHIA 3LH0A 4BBSM 1V76A 4KULA 1YWPA 2A0FB 3GLXA 4JZ3A 4PFPA 2RHZA 2LJ1A 3KBGA 4M7DB 3FC3A 8AT1B 3VUBA 4BDYA 5FWBA 1X01A 1VQ4Q 4O6JA 4B6MA 2NUTA 2MIOA 4RMOA 3BLQB 2HQXA 1OI1A 1JXOA 1GFDA 4L5GA 1IHVA 4JJCA 3L2RA 1Q7YR 1ZA1B 3CCMA 5A0GA 1HSQA 1KC8U 1VQMA 5LJ3e 1WJQA 3E9FA 3OYKA 2JTFA 2KQWA 1DJ7B 1GCPA 4CC2A 1MGQA 1B07A 1JO8A 5LJ5f 1M2VA 2OTJQ 1QLYA 3NHNA 3P8HA 2OTLQ 1VQ7T 4BY7X 1G3YA 2WJ9A 1ZUUA 3CBMA 4BCIB 2BZYA 4L59A 1BBZA 2O9VA 2WSCE 3VV0A 2RF0A 4BCQD 4AKIA 4AFZC 4TVRA 3OYEA 4AKHA 2YLBA 4M75C 1J3TA 3RIRA 4LNPA 3L2UA 2O88A 3HRTA 4CFWB 1M4ZA 1M5Q1 4M7DE 3DJBA 2VUBA 4F16A 3SEMA 1D3BA 3M0SA 4FIBA 4FT4A 1JJ2A 2P84A 1K0XA 1JU5C 1O9KB 2DL5A 3OYNA 1M3BA 2RH2A 2WEVB 5LQFB 3EH1A 4EONB 4E7IA 2KE9A 1WHGA 1ZBXA 2EYXA 1TWBA 2KGTA 4R0KA 3OS5A 4XTWA 1VQ9Q 2CZ7B 1PRLC 2R58A 4Z89A 5FGKB 1FX7A 2UZBB 2FO0A 3QWYA 3TNIB 1NJIR 3CMET 2W9FA 4J6XA 5D6WA 5D6XA 3VKHA 1KQ1A 4IIMA 3UDCA 1D1CA 4E7HA 4C5IA 1W2BP 1PKSA 3CCUQ 2O4XA 1TD6A 4F7UB 3CCJQ 2L3SA 2RI5A 3OW2S 2FRYA 1H4LD 1H1SB 2RJEA 3QHSA 1H3ZA 3BLRB 2YUPA 5I2MA 1YBYA 4FYVB 5FLXE 2DBKA 1ZP2A 2NUPB 5M9OA 2LT1A 4N4HA 3RUXA 4A63B 1BI1A 1SF9A 3CPFA 4EIKA 5CEIB 3CMAT 2HBPA 1YJWA 2J06A 5CIUA 2FRWA 3VS3A 2FZGB 1M90C 2W10A 5GAN4 1AWXA 2IIMA 5CQXA 1OZ3A 1E9HB 2RK2A 2L8DA 4QVZA 1VQPT 5HK0A 2HZYA 1UDLA 3QHWB 1WXUA 4LDYA 1F1BB 3EIDB 2JVVA 2JM9A 2DJQA 4LDWA 1UG1A 4A54A 4EMHA 2JM8A 2QK0A 1PD1A 2OTLA 3QZ5B 3MEVA 2EGAA 1YFNA 1P5EB 2K9GA 4N0AC 1SSFA 2X4WA 4M7AA 2E1HA 3X28B 2V8IA 1B34A 2CUBA 1RLQC 3E19A 4E2FB 1JSUB 4RG8A 3QXEB 1IB8A 2QQAA 3EOCB 1M1FA 3MIAB 1IREB 4XU1A 1MHNA 5I2SA 1K4US 2JTMA 4DEXA 1K73R 2WSEE 5KCHA 4J9CA 1N8RU 2UZLB 3I35A 4PJMA 4BY6C 2J05A 3B57A 1JOWA 2JGZB 2RPNA 1FKMA 5IT9E 2EQUA 2RD1A 3BFMA 1X6GA 2BUDA 3PIOA 2HKQB 1XNIA 1C9BA 3E9GA 4RUGA 5FRMA 3M03A 2P0PA 5IAYA 3JCMW 5GAMf 1YJNA 1W2BA 5GAMj 4CFMB 3ER0A 1T3SA 1MUZA 2ECZA 3OA6A 3KXTA 4CI0C 3BDUA 2L3QA 2KI7A 4ROCA 2Y4XA 3NGPA 3HSBA 3DB3A 3NTIA 2KDSA 3CCLQ 2DILA 1JJ2P 4BCOB 3DDPB 2J6OA 1TSFA 3L42A 2EGCA 4HCZA 3VS2A 2KMTA 2CP5A 2KT1A 2JT4A 4LD9K 4M75E 3EAEA 4PLIA 2CT4A 3CCLT 3M55A 1W6XA 5IHYA 4BCKB 2K5FA 3T9NA 2O31A 2CSQA 5EFQB 2VWFA 1X6OA 4BE1A 1WX6A 2ROLA 4LXCA 2GFAA 3FJ5A 3RDVA 2D1XA 2BPMB 1V29B 1VQKQ 2DERA 5KYWA 2VKNA 3QKJA 3M53A 2AZVA 1MNEA 1OIYB 1WJSA 2OAWA 4J83A 4XTYA 1K73C 3J80E 1D0YA 4RTZA 3NTKA 2E65A 1UB4A 3JCMQ 1H27B 1CKAA 4J7FA 1ZQ1A 2AKLA 2C0IA 3MP6A 4FL6A 2DX1A 3JCMJ 4EOSB 4AFQC 2KMGA 1Y0MA 2YHTA 1YI2Q 3PFSA 2DNUA 2PVOB 1I5OB 5CK9A 3JB9D 4M78D 1RLPC 4F7NB 3CC7Q 3LWIA 2FHDA 2KRMA 3PMIA 2J6KA 4Z8AA 1E6HA 3UWNA 4M75G 4KGXB 2F2CA 1VOMA 2MI6A 5HKCA 1YHQT 4ATOA 4PNOA 1EZZB 3MKDA 2KT8A 4AI6A 1R77A 1QCOA 1Q86R 3HZJA 4BBRM 4C0GA 2XU8A 1VQLQ 3OMCA 3PGGA 3G4ST 1K9AA 2CCIB 4QT7A 4KGVB 2DJZA 3VKGA 2P4TA 2E5QA 2LT4A 3JCMX 4HVWA 5GANf 1BIBA 3QO3A 5GAN5 2K6DA 4HA8A 1NYGA 5AT1B 2RNAA 3VS4A 3CCQA 2JJ9A 4M75B 2QDJA 4G6LB 3SHWA 5GAOp 1VQLT 4EOPB 3HHTB 2LW4A 4E7SA 1UGSB 1VQNT 2CJMB 2MYSA 2CS7A 2NUZA 3GF5A 4IMYB 2BZ8A 1IO6A 4M78F 2M9UA 3M4YA 1WIEA 3H4CA 2QF7A 2YT6A 3A5ZB 4HCCA 2DYIA 1QLBA 2DRMA 4HVUA 4MDXA 2KK4A 3E2UA 3OYFA 3PTAA 2D8JA 4PJNA 2R7GA 4F7UF 4MFDA 3CCMT 4KRCB 2LCLA 4YC3B 4HNVA 4C5EA 3HPWA 4F6UB 2F2VA 4WF2A 4BE2A 1LOJA 1MMAA 2XKOC 4J5YA 4KT0E 3M54A 4M7AD 2LRQA 1YCYA 2E12A 1F5QB 3I5SA 2K79A 2I0NA 5FWCA 5J3BA 1U3OA 4KRTA 1M90R 4A4EA 2LTOA 3MP8A 3S3MA 2EW3A 4C92F 1U5SA 1OGUB 2M02A 4A53A 5LJ5e 3OW2A 4YTLA 1GY3B 2DMEA 2EUFA 5GAMe 5CCAA 2RI2A 5GMKh 4F70B 3JB9J 4WCIA 3HKSA 1WLPB 4AG1C 3A8HB 2PK2A 2DVJA 1ZUKA 1UGRB 4EMKA 1UUEA 4BCGB 2VB6A 3M0QA 3BE3A 1KD1U 2JMAA 2MAMA 4JPBW 1M1GA 4E7LA 1Y96B 5KYYB 1UGVA 4M78A 1WHJA 3EGXA 1SEMA 2FG0A 2WPAB 4C8QC 4CC7A 4F17A 2C5XB 2QQBA 2DYBA 2KXDA 3CBOA 3CCRT 2QEXQ 2RN8A 5IHKA 4OMQA 3CCSQ 1E6GA 5KYUA 2HL3A 3ZFJA 1JXMA 4PK4A 1Y71A 3C95A 1N9RA 3QYHB 4N0AA 1N6AA 4QVCA 2ZAEA 4E7ZA 4A4GA 4ZN3A 3VU3C 4J8OA 3RR6A 3G6EA 1XJWB 2GFUA 2XDBA 3CCST 2WIPB 1KD1R 4RKUE 3OBYA 2QYZA 2X4YA 2PUKB 3JCMh 1XQHA 1ARKA 1H1PB 1GH6B 5GMKi 2AHJB 2CP7A 3OY9A 3G71T 2EJ9A 2P0KA 2D9TA 4IUQA 3VS6A 2GGRA 3ZBDA 4ANJA 1KIKA 4NC6A 2K5LA 3V8JA 4M75F 2CGHA 3ZL7C 1RAFB 5I21A 3J7AF 4CFVB 1GBRA 2EIFA 4PJOF 5LJ5h 2DIQA 1YJNQ 2LJ0A 2DD4A 2EQIA 3Q1JA 4C0ZA 4QW2A 2PU9B 1OPLA 2PHGA 4BCJB 1Q82C 3M4GA 1GCQC 1X2KA 3L2WA 2DXBB 4J9DA 3G6EQ 1SSHA 4LDXA 2XMFA 2RK1A 2QASA 3HB9A 2HSEB 3TQ7P 1E7PA 5BNJB 2R5AA 4B9WA 2DO3A 2V22B 4EOOB 4IUUA 2CUDA 1JSTB 5IF1B 2RMOA 3EG2A 1VYTA 5GAN2 1K9MR 1S1NA 2ZPBB 4QQ6A 4XQ3A 2AK5A 3H0HA 4RTTA 3CCSA 2FVUA 2C5OB 4XU0A 1I81A 5GANd 2V1RA 1QVFS 3SD4A 2A28A 1ABQA 2GQVA 4FYYB 3MJXA 3CC2T 5LJ3d 1JEGA 1SRLA 4JRKA 4EOLB 4ELJA 1X69A 3SWNB 4JJNK 2SRCA 4DBQA 2LMJA 3JB9F 2X4JA 4F7LB 3OSVA 1R0CB 4CFUB 4II1A 2JTEA 1U8RA 3NFCA 4BDZA 3ULRB 1RABB 2K3BA 1YJWQ 1EX4A 4F7JB 4AMCA 3A1PA 4RTYA 3S6WA 3UATA 4BI4A 4EOJB 1C0MA 3TW7A 2PK9B 4J9HA 4AG2C 3RGFB 1OKVB 3INZA 4M77B 1BCOA 2LNVA 4RTXA 1GL5A 4TTHA 2V26A 1YJWT 3HFOA 3JCMe 1AEYA 2IW9B 1OKWB 4C92G 5KYXB 4JLGA 3EH2A 2PMIB 2LQ8A 4BXXX 5DLQE 1QW1A 1QCNA 3EGXB 1KG1A 4PFOA 3GNFB 2WHBB 4BB7A 5HY6A 3DTOA 4JZ4A 5GAMh 1LPLA 2EYWA 1KD1C 2NWMA 4A4HA 2Y4YA 3PIPA 3CCRA 1BK2A 3FIFA 4C0FA 4M7AE 3EFSA 1M2OA 4J9EA 4ZTFA 4DOVA 4MDWA 1VQ5T 3LYIA 5HBJB 2Y90A 1X27A 2A36A 3CCUT 1WZOA 3EFOA 4J9IA 2EAYA 1I5LA 5LL6S 2WIHB 3CCUA 2QQRA 2UUEB 2JOYA 2EKHA 2L0AA 1NEBA 2CH4W 3CXCS 1PCXA 1PKDB 2KSSA 1QCFA 4RTWA 4C92C 4RODA 4M77D 4E6RA 3MEUA 2ZPGB 3EJ1B 1QVGA 5I22A 3KHIA 2DK3A 4QQGA 3CCET 4JX4A 3QYEA 1FYNA 1VQLA 1W2BS 2E6NA 2RJCA 2NUTB 5IDNB 1UFFA 1NLOC 4IKFA 3G4SA 2CP0A 4M78C 3TSWA 5GJWB 4R56A 2O9SA 4MZPA 1M1KC 4BCHB 2EQMA 2YWWA 2RHYA 2HD0A 3QWXX 5GAMg 1CKBA 1T0JA 3VRYA 3OYLA 4JX6A 2NUPA 1VQ6T 2MPXC 2JS0A 2DBMA 1H26B 3BG9A 1TG0A 1U1TA 4M75A 4XK8E 1QMZB 2QA4Q 1Q81C 2ESWA 3OYGA 4LDVA 3JB9I 4BD3A 1UECA 2FPDA 4HNUA 2AZSA 3QBYA 3L2VA 3DOGB 2Z0WA 1UHFA 3TNHB 2COYA 5A0DA 1W70A 1YNZA 5GAOq 3OB9A 2C06A 2X3WD 3JCMb 3M58A 4NL2A 2QA4T 3M5AA 1FVVB 3MPUB 4EOIB 4M7DD 2XK0A 1OU8A 1ZLMA 2QG9B 3UA6A 2HCKA 3RMSA 2YLCA 5LJ5j 4M7DA 3S3OA 1X2QA 2L89A 3KFVA 2B9RA 2UZDB 1YI2A 1WQWA 2V8JA 4JJBA 2ZPFB 4BCMB 4NL3A 3BG5A 2HNIA 3EG0A 3QG1A 4ORZA 4BCMD 4J9GA 2PTKA 2FPEA 4FM4B 2FZCB 1KSWA 2KY9A 3VYGB 4OMOA 2DF6A 2D0NA 1HD3A 3JB9G 4M78G 2XHCA 1NPPA 4OMPA 1NYFA 1OZ2A 2G6FX 4OMMA 3LWHA 4IIOA 3CCLA 1EFNA 1Q95G 2KEAA 3M0UA 3VUZA 1Z9QA 2KR6A 4NS5A 1M90U 5LJ3f 1YJ9A 3QJ6A 3CPWS 2DLPA 1I1JA 4J9FA 2DXUA 1X43A 2YRDA 1G2BA 1BCMA 2VV5A 2YXYA 4PJOD 1SHGA 4OGCA 1C1AA 3QDFA 1U06A 4FT2A 5HCKA 2CSIA 5EJCA 3M57A 3OYDA 4LUEA 2QGFB 2G3RA 1Y96A 5KYYA 2COZA 2F2XA 2JN0A 1OL1B 2C6TB 1VOLA 2KVQG 4FU6A 3JB9H 4CRLB 3G71A 1M8MA 2DE0X 3F5XB 1TFBA 2H3EB 2FEIA 4F6WB 4OR5B 3V7CA 2IVXA 1PKTA 2GF7A 1FMKA 3MHXA 1NEGA 1C6VX 1TS9A 1H28B 3JAME 2E70A 1AD5A 3G1JA 3URGA 3JV3A 5A0LA 5FRNA 2LC4A 1UNHD 4QVDA 1N8RR 2QFZA 3CC4Q 2QGSA 2G77A 2QXFA 1WYXA 2QA4A 5KE2A 1AWOA 5HQ0B 1UTIA 1PC0A 2DTIA 1S72Q 3CPWP 5GANj 2XICA 2NYSA 3MO8A 2LDMA 2PVDB 3QSUA 2DIGA 3WVDB 3WXMB 5DM7R 3FJPA 2JNGA 1VYWB 2PVGB 1K8AU 1I4K1 3JCMd 3VJPA 2BS4A 3OW2P 4M7DG 3FEOA 3G4SQ 3MEWA 1T3LA 1VYVA 3OYCA 3MI9B 3MCAB 2QQ9A 3BHUB 1AT1B 2F5KA 1AZGB 2QDYB 4Z6YA 2BS2A 4XU2A 4Y28E 3H9NA 2JW4A 2LX9A 3EG9B 5C6SA 4AFUC 3G6ET 1XOVA 2DXBA 3TSZA 1VQNQ 5C0MA 3CCJA 3CD6T 2H8HA 3TEEA 1KC8C 1M3CA 2W99A 1PSFA 3SB2A 1UGPB 2HL5C 5GAN7 4FW1A 1K9MC 3ASKA 5CVIA 3V8LA 3QUIA 2WMBB 5J26A 2QTVA 3P8BB 3EGDA 5GJVB 5DQWA 6AT1B 4PJOE 1PM3A 2IPOB 1VQ9A 5D7UA 4HCBA 3H41A 3META 1S72A 4PJOG 3CC2Q 3F70A 4DA4A 2K57A 1N27A 1G8XA 4P5NA 4C0DC 4KH1B 3I55A 1RAIB 2DD5B 1VQ4T 5GANg 1BU2A 1G5VA 1KK7A 3JRZA 1RAHB 3GBQA 3DLMA 4J6YA 3QYGB 5GANh 1JBMA 2JMCA 3RKYA 1OOTA 1PG5B 2CKKA 2ZCFB 2DRKA 1RI0A 3H6ZA 1SHFA 3QJYA 2EYYA 1V1CA 3RBBB 2WACA 2E3IA 1ACMB 3ZEHA 3HRUA 3BG3A 1PRMC 3I56T 2JXBA 1G3SA 1SRMA 2QQSA 4KUDK 4PJOC 2OTJT 4RTVA 1VQOQ 2H3JA 3I9QA 1VQ7Q 3LW5E 4C8QE 1XO2A 2IN3A 4EPCA 1Q86U 3TCJA 2F1LA 2B8AA 5KYWB 2EGEA 2EJGA 4OMFB 3PT9A 1RL2A 2KR3A 3I56Q 3QDRB 2E10A 5HBHB 1D0ZA 4ESRA 1NG2A 5FU6C 1OI9B 2L3RA 3M56A 5D6YA 4C92B 4F7UA 3MY5B 4J7IA 1R0BG 4YOZA 2LQNA 4J9BA 3FDRA 2OAUA 3JCMV 1VQ5Q 4MZMA 1KFZA 1MV3A 2FPFA 1WJRA 3A8MB 4EC9B 1VQKA 1AWWA 1NJIC 1MNDA 1W1FA 1X6BA 4OB1B 1RAAB 2D8HA 2DMOA 1SKUB 1H3HA 1A0NB 3GNGA 3CMEQ 5CKFA 4I3ZB 1K0SA 3GPLA 3A98A 1NZ9A 3FLGA 3I56A 2YUOA 1VQPQ 1PD0A 2GNCA 4C8QD 3PE0A 2M16A 1VIEA 1W4SA 2IG0A 2P4RA 4D6WA 2VC8A 4EMKC 1LJOA 2J7IA 1YCSB 1VQOA 3TVTA 2C5NB 1VYUA 3M9QA 3VS0A 3ME9A 1OQKA 3FRNA 3X24B 2MMPA 3NMZC 4UN0A 2KAFA 2I2LA 3PNWC 1WI7A 2D6FA 1N8RC 4EOKB 3TU4K 1G3NC 4M78E 5FROA 3J81E 5CKBA 1M1KU 3PO3S 3JCMg 3GTMS 1NBEB 1BB9A 5HBEB 4PJLA 5ACBA 5J39A 2ZZDA 2C0OA 2CZ0B 5KCOA 4F7SB 1NE8A 5CYIB 1M9SA 2RHXA 4CC3A 4CXAB 5CKHA 4PFZA 2QQ8A 5I5ZB 4JLIA 1QKXA 5LJ3g 2K5IA 2I40B 5GANe 2HQHA 1H25B 2KYMA 2CDTA 2JUFA 2K3XA 2YRCA 2C4GB 2PQWA 2L3PA 2BE7D 2QEXA 1HXDA 1I0CA 1QVGS 3BLHB 3VKIA 1MMGA 4XTUA 5CKDA 4ZGJB 2XIDA 5ICPB 3OS0A 5CAIA 3CQTA 5L8RE 5HK3A 4LE9A 3LGFA 3H0FA 4EMGA 4OMNA 2LCCA 4OGEA 1WXBA 7AT1B 2GTJA 5CQYA 5GAN3 3QHRB 5IDPB 4XTXA 3THKA 2F69A 3R6OA 2MOXA 2QTXA 4XAXB 4BCQB 1YJ9T 4C8QG 3C12A 4GBQA 2DTHA 1QWFA 1BI2A 1WPYA 5IXFA 2LQKA 5GMKe 4WTOB 4AT1B 3HTRA 4JS4A 4LOCA 3TNWB 2CP6A 3UT1A 1PHTA 1NJIU 5GMKm 2GTOA 1IRXA 5KH6A 2BIVA 5KYXA 2DETA 3NTHA 3GIBA 4PLLA 4EMKB 3CMAA 1OX9A 3UPUA 1GFCA 5LJ5d 4OB0B 2X35A 1XTDA 4X9CA 2RHIA 3VRZA 1N5ZA 1TTHB 4N4GA 1VQ8A 2OI3A 2DL7A 2VGNA 3G33B 4HVVA 2COWA 1ZBJA 1Y07A 1BU1A 3VS7A 3L1AA 2E3HA 2X1NB 2LVMA 2YRVA 1BI0A 1MMDA 4M7AG 4RG2A 3RMQA 3UA7A 4JRIA 5GAN6 3G7ZA 4BCFB 2UZEB 1O9KA 3OYBA 1UNGD 1ZUYA 2CREA 3PMTA 1AZEA 4QSHA 4FSXA 4X1VA 3CCQQ 1WQ7A 1UGQB 1RUWA 3CCEQ 5FU7C 1QVFA 5FU7B 3LH5A 1Q81R 3VYHB 3CXCA 3CC7T 2BKDN 5I11A 1RACB 2M1HA 2DAQA 2ZGWA 4E47A 1YIJT 1KXUA 5DLOA 2K3YA 4Q5WA 2GBQA 5GMKj 4JX5A 1KQ2A 2B86A 4Z88A 4JRQA 1WHMA 1H1QB 3DDQB 1H24B 4RTUA 1FMWA 1ZSZA 3DB4A 1OV3A 2EFIA 1UJYA 1U1SA 2OTJA 2RB6A 1O75A 3P8DA 1AWJA 3I5RA 4GY5A 4D8KA 4C8QB 4LD6A 1YIJQ 5IHNA 1VQ6Q 2DKGA 1KHIA 4AKGA 2A37A 4F7UG 1JJ2S 2M0OA 3OYIA 4ME7A 1G3WA 2RM4A 2ZPIB 2HKNA 1AISB 1GBQA 2MCNA 5GAOn 4FX3B 3BW1A 1TXQA 3BDLA 2RO0A 3CCMQ 3CC7A 1IGQA 2GCXA 1URCB 2E41A 2JZ2A 3V7RA 2LQWA 3HO8A 4O5VA 3TN8B 3OYAA 1KQSP 4M77E 3N5BB 5GAOl 2PUOB 5GAOr 1K9MU 1RADB 1VQ4A 2DXCB 2WSFE 1I8FA 3EGDB 1RAEB 2X51A 2ROTA 1Q82U 1WHLA 4FYWB 3L2QA 2CP2A 2VGMA 1VQ6A 2WMAB 1S72T 2HBWA 4M77F 3NPFA 5GAMd 1H1RB 2CH4A 4CC4B 3LLRA 2ZZDB 5LMKB 1K1ZA 2LJ3A 4PJJA 2ATCB 2PZ1A 4LDUA 2DZCA 4PJOB 2DZ9A 3BY7A 2HEQA 4ZGDB 3SWNC 2JS2A 2CZ1B 4ZGEB 2X3XD 1TH7A 3HL8A 4HXJA 2MWOA 3CCEA 2KROA 2XG8D 1VIFA 2KNBB 2QI2A 2RJFA 4DQ2A 1VQ7A 1SG5A 5ECAA 2AIRB 2QDLA 4BY1X 2L5QA 4PKCC 3LQ5B 4EDUA 4EORB 3HFNA 3D7SB 4ELLA 1WA7A 1D0XA 1YWOA 5L23A 4ELZC 4BE0A 2VXEA 1WHKA 5GMKl 3I55T 4HT9A 1GUXB 1UEBA 2J6FA 1OULA 1E7OA 2RA2A 4M77A 3O8VA 3RERA 2DTOA 1KJWA 1VQ8Q 1BKBA 4F14A 1VQ9T 2RI3A 4XU3A 1ZSZB 1VINA 3I55Q 4M7DC 4M7DF 2OJ2A 4N4IA 3K7AM 3CC2A 4R55A 4M7AC 5KE3A 2L2PA 3NDQA 2O4XB 2CT3A 1VQ8T 3CCJT 3CCRQ 5HNBB 5KYUB 5HVYB 1W98B 2V1QA 3CEYA 9ATCB 2QGGA 2W0ZA 2LNHB 2BKZB 1GRIA 1WGSA 2DL4A 3X26B 2RQVA 1AVZC 3CCVA 1EIFA 1H641 4JUVA 4BACA 2O2OA 3BHTB 3HBLA 3CMAQ 4HKEA 4E7KA 1OU9A 3OS2A 1VA7A 3M0RA 4OB2B 1WHHA 4IUPA 1ABOA 2LP5A 1I07A 2A7YA 3QYBA 2XD0A 1M30A 3OYJA 4OMLA 3REBB 3V8KA 2AKKA 4M6VA 4CFXB 1GXIE 4A4FA 3DLLA 1ZSZC 3PVLA 3S3NA 4M77C 1YP5A 5EG2A 1IGUA 1IZ6A 2OX7A 3IQLA 1M1KR 3A8LB 2CZ6B 3EG9A 3CCVT 1O9SA 1WXTA 3L2ZA 4BCPB 1M3AA 4A4KA 4GLMA 1TOVA 4RCBA 1N9SA 3CPWA 2NLUA 2W9ZA 2MK5A 3CC4A 2VVKA 1FWZA 1K76A 4II5B 4VUBA 1HYOA 4KRDB 2D0QB 2BS3A 2VXFA 5AYFA 3CCVQ 4ZN1A 2LZ6B 2MF2A 2DXCA 1OX8A 1B3QA 4BY6B 2XDDA 4MFEA 2EWNA 2YDLA 2RQWA 2KXCA 4DOWA 4QKUA 3HP9A 4MMKA 3VYGA 4M77G 2C5VB 1M27C 3C4SA 2F5TX 2DD5A 1G83A 2M0YA 4M75D 2DVEA 2X4XA 2E5KA 4KBMB 4BI3A 3H8ZA 2OTLT 4CFNB 4L6V5 1OPKA 1ENWA 3EHQA 3SWNA 3OYMA 1NPRA 2HSPA 3JCMf 1WDXA 2PJQA 1KQSS 1VQPA 4F6SB 3OBWA 3JCMP 2DPPB 3AHUA 3UF4A 1YJ9Q 4M7AF 1GCQA 2LCSA 1VQOT 4OP0A 1RAGB 1Q7YU 4F04B 1YITQ 2KYBA 1OL2B 8ATCB 3LGLA 4EOQB 1QKWA 3GOXA 1ZA2B 2DM1A 4DBHA 4V2SA 4OGRB 1M8VA 3X20B 1D3UB 2A3LA 3RKXA 1QVFP 1HK9A 1VQKT 1VQMQ 1ZHIA 4C5GA 1YN8A 3EFOB 1YITT 4BCND 3M0TA 2PNIA 3MEAA 2FB7A 4D8DA 2E64A 1IHWA 4MZTA 2W2HA 1D3BB 3CMEA 1AHJB 4KGZB 1H92A 2ZPEB 1PNJA 3OQ5A 5CO7A 4KUIA 3OYHA 1AOJA 3GP8A 2IW8B 2KRSA 2EQKA 1N4MA 3FB9A 1VQMT 1Q86C 1TUGB 4UC4A 1QMCA 2FYKA 1VQ5A 1QWEA 3RESA 4MMLA 1JB0E 1KHCA 3TW6A 5L2WB 4IURA 5CKEA 4HL4A 1FXXA 1QP3A 5FU6B 1IXDA 1BI3A 1NLPC 4DEYA 3EG1A 4C92A 1K8AC 4M78B 1YITA 2IW6B 3CCQT 3TREA 4LUDA 2HDAA 4M7AB 2RQUA 1LVKA 5FW9A 1R8OB 4E7JA 2ED0A 1OYXA 2VYTA 4NSTB 1Q81U 1QQJA 2DD4B 1JRIA 1D1BA 4C8QF 3DKMA 1K8AR 3CD6A 1ZX6A 4HT8A 3JCMc 1Q82R 4GLKA 2RQTA 1YIJA 1Y7XA 4JDSA 2MWPA 5DQVA 3A8OB 2R57A 1TUDA 1YHQA 4BUGA 3WVEB 2BE9B 1K73U 4BI8B 4JS5A 1CSKA 4XTVA 1PWTA 5GAOm 1OIUB 2EQJA 2XI9A 1JKWA 4HNTA 4JRPA 2EJFA 3HRSA 5EC7A 4LN2A 4Z02A 1M2VB 1D09B 3EHRA 1BIAA 2P0QA 3BHVB 3H0IA 4C0DB 4RCCA 2DEQA 1WFWA 4YOOA 5IH2A 2I53A 2K4YA 2ABLA 3CBPA 1D1AA 2KRNA 1SPKA 1VQNA 2E6ZA 2O01E 1B7TA 2EYQA 1MV0B
chains in the Genus database with same CATH topology
2YLCA 5LJ5j 4M7DA 3S3OA 2PVOB 2L89A 3L1AA 2LVMA 2YRVA 5CK9A 3JB9D 1KQSA 4M78D 1BI0A 4M7AG 4X34A 1YI2A 4RG2A 3RMQA 1P92A 1WQWA 2FHDA 2V8JA 3LWIA 3PMIA 4JRIA 2IVWA 5GAN6 3G7ZA 4Y91A 4OVAA 2ZPFB 4NL3A 3OYBA 3BG5A 3OMGA 3PMTA 2HNIA 3UWNA 3QG1A 4M75G 5GAN8 4QSHA 4FSXA 1WNLA 1WQ7A 2MI6A 3OYYA 1UGQB 4FM4B 5FU7C 4MIMA 2KY9A 5FU7B 5HKCA 1YHQT 3VYGB 4PNOA 3VYHB 3CXCA 1QVFA 4ATOA 3QWLA 4AI6A 3JB9G 3CC7T 4M78G 2XHCA 1NPPA 2BKDN 2M1HA 2DAQA 3HZJA 4BBRM 1OZ2A 2ZGWA 4E47A 3X25B 3SFMA 3LWHA 1YIJT 5DLOA 3CCLA 2K3YA 4Q5WA 4C0GA 5GMKj 2R5MA 2XU8A 4JX5A 3OMCA 3PGGA 3G4ST 5CR2A 3VUZA 1KQ2A 3V7SA 4JRQA 2KR6A 2K2VA 4NS5A 4PL6A 1M90U 5LJ3f 1YJ9A 2DJZA 3QJ6A 3VKGA 2P4TA 3CPWS 4OB3B 3DB4A 4J6WA 2DXUA 2EFIA 2E5QA 2LT4A 3JCMX 1U1SA 2VV5A 3DL1A 1QP2A 5GANf 2OTJA 2RB6A 1BIBA 1O75A 3P8DA 4PJOD 3C94A 3QO3A 4OF1A 4GY5A 4OGCA 1PSEA 4HA8A 4C8QB 5GAN5 4FT2A 4LD6A 3CCQA 5LJ5g 5EJCA 3M57A 4M75B 2QDJA 5GAOp 3OYDA 2DKGA 4PJOA 1KHIA 4AKGA 4IUTA 4F7UG 1VQLT 1JJ2S 2M0OA 3HHTB 1Y96A 2G3RA 4ME7A 1G3WA 3OYIA 1UGSB 1VQNT 2RM4A 2ZPIB 5DY9A 2JN0A 2KVQG 4FU6A 1X75C 5GAOn 2CS7A 3JB9H 3BW1A 3GF5A 3OS1A 3BDLA 2RO0A 3LX7A 5LJ3h 3G71A 3CC7A 2RHUA 4M78F 2GCXA 2QEXT 2E41A 2M9UA 2RJDA 2JZ2A 3V7RA 3M4YA 3HO8A 1QVPA 4O5VA 3H4CA 2QF7A 3OYAA 4M77E 1VUBA 3N5BB 5GAOl 2PUOB 5GAOr 3A5ZB 3V7CA 1K9MU 2XDPA 4X9DA 4HCCA 2CYZB 1QLBA 4MDXA 2KK4A 1VQ4A 3CC4T 2DXCB 2WSFE 1I8FA 2GF7A 3OYFA 3PTAA 1Q82U 3L2QA 3MHXA 4F7UF 3JSCA 3E1SA 4MFDA 2VGMA 3CCMT 1YI2T 2LCLA 1VQ6A 1S72T 4HNVA 4C5EA 3JAME 2E70A 3URGA 3HPWA 4M77F 4WF2A 4BE2A 1LOJA 2XKOC 3KUFA 2V8KA 3QPHA 4J5YA 4KT0E 3M54A 4C92E 5A0LA 2LC4A 5A2QE 5FRNA 5GAMd 4HLQA 4M7AD 2LRQA 1YCYA 4QVDA 2E12A 2QFZA 3LLRA 2G77A 2QXFA 2ZZDB 3QZ9B 5IN1A 5J3BA 2QA4A 5KE2A 2ZPHB 4QQDA 4ZTJA 4LDUA 2DZCA 4NOYA 2DTIA 4IUVA 2FL7A 4ELYC 4A4EA 4PJOB 2DZ9A 5GANj 2LTOA 3MP8A 3S3MA 2XICA 3MO8A 3BY7A 2LDMA 4XTZA 4C92F 2PVDB 3QSUA 4ZGDB 2DIGA 3SWNC 3WVDB 3M59A 3WXMB 5DM7R 4A53A 5LJ5e 3FJPA 4C5HA 3SDZA 2CZ1B 3QIIA 4ZGEB 2JNGA 1TH7A 3HL8A 3OW2A 4F7UE 4YTLA 2PVGB 2DXTA 1K8AU 2MWOA 3CCEA 1I4K1 3JCMd 1Q7YC 2XG8D 3VJPA 2BS4A 1VIFA 2RI2A 5GAMe 3FEOA 5CCAA 5GMKh 4M7DG 1G3TA 2QI2A 2RJFA 4DQ2A 3JB9J 1VQ7A 3MP1A 1LNXA 2EKOA 2L5QA 4PKCC 3HKSA 1YJNT 3MEWA 4EDUA 3A8HB 3RKWA 3HFNA 3OYCA 3MCAB 1UGRB 2QQ9A 4CRIA 4EMKA 2HAXA 4ELZC 4BE0A 2VXEA 2F5KA 4B9XA 1KD1U 5GMKl 3I55T 2MAMA 2QDYB 4Z6YA 3A8GB 2BS2A 4HT9A 1M1GA 4XU2A 4Y28E 4C8QA 4C92D 4E7LA 1Y96B 1UEBA 5C6SA 2LX9A 3G6ET 4M78A 1XOVA 2DXBA 1B34B 5C0MA 3CCJA 4C8QC 3EFRA 3CD6T 2HQEA 3TEEA 2RA2A 1KC8C 5LJ3j 4M77A 3O8VA 3OSSC 2DTOA 3RERA 2QQBA 1BKBA 3LH0A 1PSFA 4BBSM 1VQ9T 3CBOA 2RI3A 3CCRT 4KULA 3SB2A 1UGPB 3GLXA 5GAN7 4XU3A 2RHZA 1K9MC 3ASKA 3KBGA 4M7DB 4M7DC 4M7DF 5CVIA 3FC3A 3VUBA 3V8LA 3QUIA 3ZFJA 4BDYA 1X01A 4N4IA 5J26A 1Y71A 3C95A 4O6JA 1N9RA 3P8BB 4R55A 3CC2A 4M7AC 4PJOE 4RMOA 3QYHB 4N0AA 5KE3A 2HQXA 1N6AA 4QVCA 1VQ9A 1OI1A 2O4XB 4HCBA 4A4GA 4ZN3A 4L5GA 1VQ8T 3META 3L2RA 3CCJT 3VU3C 1S72A 4J8OA 3CCMA 4PJOG 3G6EA 5A0GA 3F70A 2GFUA 4DA4A 2XDBA 2K57A 1N27A 3CEYA 1KC8U 3CCST 1VQMA 4P5NA 4C0DC 4RKUE 3OBYA 5LJ3e 1WGSA 2X4YA 3I55A 2DD5B 1WJQA 3X26B 3E9FA 2PUKB 2JTFA 2KQWA 5GANg 3OYKA 1DJ7B 3CCVA 1VQ4T 1EIFA 3JCMh 1H641 1XQHA 1MGQA 4JUVA 1G5VA 3JRZA 4BACA 5LJ5f 1BYMA 3DLMA 2AHJB 3QYGB 4J6YA 5GMKi 5GANh 1JBMA 3P8HA 3RKYA 3OY9A 3G71T 2EJ9A 3HBLA 2D9TA 1G3YA 2CKKA 2WJ9A 2ZCFB 2P0KA 1RI0A 3CBMA 3H6ZA 4IUQA 3QJYA 4HKEA 4E7KA 3ZBDA 4NC6A 2WACA 2K5LA 4L59A 2WSCE 3V8JA 3VV0A 3OS2A 4M75F 4AKIA 2CGHA 3ZEHA 4TVRA 3OYEA 3HRUA 3BG3A 4AKHA 4OB2B 2YLBA 4M75C 4IUPA 5I21A 3I56T 3J7AF 1G3SA 2QQSA 2EIFA 4PJOF 4KUDK 4PJOC 2OTJT 5LJ5h 2DIQA 3RIRA 2A7YA 2H3JA 3L2UA 3QYBA 3LW5E 2XD0A 2DD4A 3OYJA 3HRTA 4C8QE 3Q1JA 1M4ZA 1M5Q1 3V8KA 4C0ZA 4QW2A 2VUBA 4M7DE 2PU9B 4EPCA 1Q86U 4M6VA 1D3BA 4FIBA 4FT4A 3TCJA 1GXIE 2B8AA 4A4FA 1JJ2A 3DLLA 3S3NA 2EJGA 4M77C 5EG2A 4OMFB 3OYNA 3M4GA 1Q82C 3L2WA 3PT9A 1IZ6A 2RH2A 2DXBB 1RL2A 3A8LB 4E7IA 2CZ6B 3QDRB 4LDXA 1ZBXA 2E10A 3CCVT 2RK1A 1O9SA 3HB9A 3L2ZA 1E7PA 4A4KA 4RCBA 2R5AA 1N9SA 3OS5A 5FU6C 4XTWA 4B9WA 2CZ7B 2DO3A 3CPWA 2NLUA 2L3RA 3M56A 2R58A 4IUUA 5D6YA 4C92B 4F7UA 3CC4A 1FX7A 1FWZA 4J7IA 5GAN2 2ZPBB 4QQ6A 4XQ3A 3CCSA 4VUBA 3CMET 2D0QB 3FDRA 2BS3A 2OAUA 2VXFA 4J6XA 2FVUA 5D6WA 5AYFA 3JCMV 4XU0A 5D6XA 3VKHA 1KQ1A 3UDCA 4MZMA 4ZN1A 2MF2A 4E7HA 1I81A 4C5IA 2DXCA 5GANd 1QVFS 3SD4A 1WJRA 4BY6B 3A8MB 2O4XA 4F7UB 2XDDA 4MFEA 2GQVA 1VQKA 2EWNA 1NJIC 2RI5A 3OW2S 3CC2T 5LJ3d 4DOWA 4JRKA 4OB1B 3HP9A 2RJEA 3QHSA 1H3ZA 4MMKA 4ELJA 3VYGA 4M77G 3GNGA 5CKFA 3SWNB 4JJNK 5I2MA 3C4SA 2F5TX 1YBYA 3GPLA 3JB9F 2DD5A 1NZ9A 2X4JA 5FLXE 3FLGA 3I56A 4M75D 2DVEA 5M9OA 2LT1A 2X4XA 3OSVA 4N4HA 4II1A 4KBMB 1BI1A 3RUXA 4BI3A 4C8QD 3H8ZA 1VQ7T 2OTLT 3CPFA 1U8RA 4L6V5 3CMAT 3NFCA 2M16A 1VIEA 1W4SA 2HBPA 3SWNA 4BDZA 1YJWA 5CIUA 3OYMA 1NPRA 2IG0A 4D6WA 2VC8A 4EMKC 1M90C 1LJOA 3JCMf 5GAN4 1KQSS 1VQOA 5CQXA 3M9QA 1VQPA 1OZ3A 3S6WA 3ME9A 4BI4A 2RK2A 3OBWA 3FRNA 2DPPB 3TW7A 3X24B 3JCMP 3AHUA 2L8DA 2MMPA 4QVZA 1VQPT 5HK0A 2KAFA 4M7AF 2I2LA 1VQOT 4OP0A 3PNWC 4LDYA 1Q7YU 2D6FA 3INZA 4M77B 1N8RC 2JVVA 2LNVA 3TU4K 4LDWA 3LGLA 1YJWT 3HFOA 3JCMe 4A54A 4M78E 4EMHA 3GOXA 5FROA 4C92G 2OTLA 3QZ5B 3J81E 3MEVA 4JLGA 5CKBA 1M1KU 4V2SA 2LQ8A 3JCMg 4N0AC 1SSFA 2X4WA 5DLQE 4M7AA 2E1HA 3X28B 1M8VA 5J39A 3X20B 2A3LA 2V8IA 3RKXA 2ZZDA 1HK9A 1QW1A 1B34A 1VQKT 2CZ0B 1ZHIA 1KG1A 5KCOA 3GNFB 4C5GA 3E19A 4BB7A 5HY6A 4RG8A 1NE8A 3QXEB 1YITT 2QQAA 5GAMh 1M1FA 3MEAA 1KD1C 2FB7A 1M9SA 2RHXA 2E64A 1IREB 4XU1A 1MHNA 2Y4YA 4MZTA 5CKHA 4A4HA 2QQ8A 5I2SA 3PIPA 1D3BB 3CCRA 3FIFA 4JLIA 2JTMA 4C0FA 4M7AE 3CMEA 3EFSA 1AHJB 2WSEE 5KCHA 5LJ3g 4ZTFA 1N8RU 4DOVA 2ZPEB 4MDWA 2K5IA 3OQ5A 5CO7A 4BY6C 5GANe 1VQ5T 3LYIA 4KUIA 2Y90A 3OYHA 2JUFA 2K3XA 3GP8A 1FKMA 2EQKA 3CCUT 3FB9A 1VQMT 1YJNA 5IT9E 2EQUA 2RD1A 2EAYA 1I5LA 3BFMA 5LL6S 3CCUA 1Q86C 2QQRA 2BUDA 2PQWA 3PIOA 2JOYA 4UC4A 2QEXA 1XNIA 1HXDA 2FYKA 3E9GA 1VQ5A 1QVGS 3CXCS 3RESA 4MMLA 3VKIA 5FRMA 5IAYA 2P0PA 1JB0E 4XTUA 5CKDA 1KHCA 2KSSA 3TW6A 4ZGJB 4IURA 4C92C 3JCMW 5CKEA 5GAMf 4M77D 4HL4A 1FXXA 2ZPGB 3MEUA 1QP3A 5FU6B 3ER0A 1BI3A 2XIDA 5GAMj 1QVGA 3KHIA 4C92A 3OA6A 2DK3A 5CAIA 3BDUA 4CI0C 4M78B 4QQGA 3OS0A 3KXTA 3CCQT 1YITA 1K8AC 3TREA 2Y4XA 4M7AB 3CCET 5L8RE 5HK3A 4JX4A 1R8OB 4E7JA 3QYEA 3LGFA 4EMGA 1OYXA 3DB3A 1VQLA 1W2BS 3NTIA 3HSBA 2E6NA 2VYTA 1Q81U 2LCCA 4OGEA 2DD4B 1JRIA 2KDSA 4C8QF 2RJCA 3DKMA 5CQYA 5GAN3 3CD6A 4HT8A 3L42A 4XTXA 4IKFA 2F69A 3G4SA 3R6OA 4M78C 3JCMc 4HCZA 2QTXA 4XAXB 2KMTA 4R56A 4GLKA 1YIJA 4MZPA 1Y7XA 1YJ9T 4C8QG 1M1KC 4JDSA 3C12A 2DTHA 2EQMA 2MWPA 4M75E 4LD9K 1BI2A 1WPYA 3EAEA 3A8OB 2R57A 4PLIA 1YHQA 2LQKA 4BUGA 5GMKe 2RHYA 3WVEB 3M55A 3CCLT 2HD0A 4JS4A 4LOCA 5GAMg 2K5FA 3OYLA 3T9NA 3UT1A 1K73U 4JX6A 4BI8B 4JS5A 1W2BA 1NJIU 4XTVA 1VQ6T 5GMKm 3BG9A 1U1TA 4M75A 4XK8E 5GAOm 5KH6A 2BIVA 2EQJA 1X6OA 1Q81C 2XI9A 3OYGA 4BE1A 2GFAA 3NTHA 3GIBA 4LDVA 3JB9I 4PLLA 4BD3A 4EMKB 4HNTA 4JRPA 3CMAA 1V29B 2EJFA 4HNUA 3HRSA 3UPUA 3QBYA 5LJ5d 4Z02A 3L2VA 3QKJA 4OB0B 3M53A 2X35A 1XTDA 1BIAA 4X9CA 1WJSA 2P0QA 4J83A 4XTYA 4C0DB 4RCCA 1K73C 2DEQA 3J80E 5A0DA 2RHIA 3NTKA 2E65A 5GAOq 3OB9A 2C06A 1UB4A 4N4GA 3JCMb 3JCMQ 1VQ8A 3M58A 4NL2A 2QA4T 2K4YA 4J7FA 1ZQ1A 3CBPA 3M5AA 3MP6A 4FL6A 4M7DD 2XK0A 2VGNA 1VQNA 2E6ZA 2O01E 3JCMJ 2KMGA 2EYQA 2YHTA 3RMSA 3PFSA 1Y07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 E;  2DD4 A;  2PVD B;  2PVO B;  4ZGD B;  3QXE B;  3WVD B;  2PU9 B;  2CZ1 B;  4ZGE B;  1IRE B;  1GXI E;  2PVG B;  2ZPF B;  1AHJ B;  2WSE E;  2DXB B;  2ZPE B;  3A8L B;  2CZ6 B;  3A8H B;  1UGQ B;  4FM4 B;  2CZ7 B;  1UGR B;  3VYG B;  3VYH B;  2ZPB B;  2QDY B;  3A8G B;  1JB0 E;  3X25 B;  4Y28 E;  4ZGJ B;  2D0Q B;  2ZPG B;  1QP3 A;  2DXB A;  2DXC A;  4OB3 B;  3A8M B;  1PSF A;  5L8R E;  1UGP B;  1QP2 A;  2DD4 B;  4OB1 B;  1PSE A;  3VYG A;  2DD5 A;  3HHT B;  3QYH B;  1UGS B;  2ZPI B;  4L6V 5;  3A8O B;  3WVE B;  2PUO B;  4RKU E;  2CYZ B;  2DD5 B;  3X26 B;  2PUK B;  1DJ7 B;  4XK8 E;  2DXC B;  2WSF E;  3X24 B;  2DPP B;  2AHJ B;  3QYG B;  1V29 B;  2ZCF B;  4OB0 B;  4KT0 E;  2WSC E;  3QZ5 B;  2ZZD B;  3QZ9 B;  4OB2 B;  2ZPH B;  3X28 B;  2O01 E;  3X20 B;  2ZZD A;  2CZ0 B; 
#chains in the Genus database with same CATH topology
 2K7A A;  2SEM A;  1KQS A;  2A08 A;  4X34 A;  2KBT A;  1Y57 A;  1P92 A;  2DEU A;  3R6N A;  4YOS A;  2IVW A;  3CXC P;  1QVG P;  4CFU D;  4OVA A;  4Y91 A;  1UNL D;  4AFS C;  3C0C A;  4EC8 B;  3OMG A;  2EVR A;  2C0T A;  3REA B;  5GAN 8;  1T0H A;  1WNL A;  1ZSG A;  3OYY A;  4MIM A;  3QWL A;  2CCH B;  2WFY B;  3X25 B;  3SFM A;  2YUQ A;  2R5M A;  5CR2 A;  1TU0 B;  4DBF A;  3V7S A;  2W96 A;  2F2W A;  2K2V A;  3PVQ A;  4PL6 A;  3O5Z A;  3M0P A;  4OB3 B;  2BTT A;  4J6W A;  2HMA A;  3POM A;  4Y92 A;  2BZX A;  3DL1 A;  1QP2 A;  5IXB A;  2QAZ A;  2EYZ A;  3C94 A;  4OF1 A;  4EOM B;  1H8K A;  1PSE A;  5LJ5 g;  4ROE A;  4PJO A;  4IUT A;  2G9X B;  1UE9 A;  5DY9 A;  4M4Z A;  1GUX A;  1X75 C;  1AD6 A;  3OS1 A;  5LJ3 h;  3LX7 A;  2RHU A;  2QEX T;  2RJD A;  3U23 A;  1QVP A;  1VUB A;  2DL8 A;  2K2M A;  2XDP A;  4X9D A;  2CYZ B;  1UJ0 A;  3CC4 T;  2EPD A;  3JSC A;  3E1S A;  3VS1 A;  1YI2 T;  5KYN A;  4K11 A;  2CP3 A;  1MMN A;  1BYM A;  3MY1 B;  3KUF A;  3QPH A;  2V8K A;  4C92 E;  1LCK A;  5A2Q E;  4HLQ A;  1FMV A;  4BCN B;  2M51 A;  3QZ9 B;  5IN1 A;  1FIN B;  2ZPH B;  2EBP A;  4QQD A;  4ZTJ A;  2YUN A;  4NOY A;  4IUV A;  4ELY C;  2FL7 A;  3AT1 B;  3O0G D;  2GQI A;  2RQR A;  4XTZ A;  3G71 Q;  2LX7 A;  2AT1 B;  1UHC A;  2ED1 A;  4FCY A;  1YHQ Q;  3M59 A;  1RI9 A;  3RNJ A;  4C5H A;  3SDZ A;  2DFU A;  3QII A;  3EGU A;  4ZNX A;  1HJD A;  4FW2 A;  4F7U E;  2DXT A;  2YSQ A;  1Q7Y C;  4HCK A;  1G3T A;  1JQQ A;  3MP1 A;  2DA9 A;  1LNX A;  2EKO A;  3CD6 Q;  1YJN T;  4DBR A;  3RKW A;  3EG3 A;  3VS5 A;  2VAS A;  4Y72 B;  1OEB A;  4CRI A;  2HAX A;  2X9H A;  1TUC A;  1KC8 R;  4B9X A;  4JJD A;  4FSS A;  3A8G B;  4FYX B;  4C92 D;  4C8Q A;  2WXV B;  1Z9Z A;  2DL3 A;  2E4H A;  1B34 B;  2ENM A;  4KH0 B;  2FZK B;  3EFR A;  2HQE A;  5LJ3 j;  1NM7 A;  3OSS C;  5IHI A;  3LH0 A;  4BBS M;  1V76 A;  4KUL A;  1YWP A;  2A0F B;  3GLX A;  4JZ3 A;  4PFP A;  2RHZ A;  2LJ1 A;  3KBG A;  4M7D B;  3FC3 A;  8AT1 B;  3VUB A;  4BDY A;  5FWB A;  1X01 A;  1VQ4 Q;  4O6J A;  4B6M A;  2NUT A;  2MIO A;  4RMO A;  3BLQ B;  2HQX A;  1OI1 A;  1JXO A;  1GFD A;  4L5G A;  1IHV A;  4JJC A;  3L2R A;  1Q7Y R;  1ZA1 B;  3CCM A;  5A0G A;  1HSQ A;  1KC8 U;  1VQM A;  5LJ3 e;  1WJQ A;  3E9F A;  3OYK A;  2JTF A;  2KQW A;  1DJ7 B;  1GCP A;  4CC2 A;  1MGQ A;  1B07 A;  1JO8 A;  5LJ5 f;  1M2V A;  2OTJ Q;  1QLY A;  3NHN A;  3P8H A;  2OTL Q;  1VQ7 T;  4BY7 X;  1G3Y A;  2WJ9 A;  1ZUU A;  3CBM A;  4BCI B;  2BZY A;  4L59 A;  1BBZ A;  2O9V A;  2WSC E;  3VV0 A;  2RF0 A;  4BCQ D;  4AKI A;  4AFZ C;  4TVR A;  3OYE A;  4AKH A;  2YLB A;  4M75 C;  1J3T A;  3RIR A;  4LNP A;  3L2U A;  2O88 A;  3HRT A;  4CFW B;  1M4Z A;  1M5Q 1;  4M7D E;  3DJB A;  2VUB A;  4F16 A;  3SEM A;  1D3B A;  3M0S A;  4FIB A;  4FT4 A;  1JJ2 A;  2P84 A;  1K0X A;  1JU5 C;  1O9K B;  2DL5 A;  3OYN A;  1M3B A;  2RH2 A;  2WEV B;  5LQF B;  3EH1 A;  4EON B;  4E7I A;  2KE9 A;  1WHG A;  1ZBX A;  2EYX A;  1TWB A;  2KGT A;  4R0K A;  3OS5 A;  4XTW A;  1VQ9 Q;  2CZ7 B;  1PRL C;  2R58 A;  4Z89 A;  5FGK B;  1FX7 A;  2UZB B;  2FO0 A;  3QWY A;  3TNI B;  1NJI R;  3CME T;  2W9F A;  4J6X A;  5D6W A;  5D6X A;  3VKH A;  1KQ1 A;  4IIM A;  3UDC A;  1D1C A;  4E7H A;  4C5I A;  1W2B P;  1PKS A;  3CCU Q;  2O4X A;  1TD6 A;  4F7U B;  3CCJ Q;  2L3S A;  2RI5 A;  3OW2 S;  2FRY A;  1H4L D;  1H1S B;  2RJE A;  3QHS A;  1H3Z A;  3BLR B;  2YUP A;  5I2M A;  1YBY A;  4FYV B;  5FLX E;  2DBK A;  1ZP2 A;  2NUP B;  5M9O A;  2LT1 A;  4N4H A;  3RUX A;  4A63 B;  1BI1 A;  1SF9 A;  3CPF A;  4EIK A;  5CEI B;  3CMA T;  2HBP A;  1YJW A;  2J06 A;  5CIU A;  2FRW A;  3VS3 A;  2FZG B;  1M90 C;  2W10 A;  5GAN 4;  1AWX A;  2IIM A;  5CQX A;  1OZ3 A;  1E9H B;  2RK2 A;  2L8D A;  4QVZ A;  1VQP T;  5HK0 A;  2HZY A;  1UDL A;  3QHW B;  1WXU A;  4LDY A;  1F1B B;  3EID B;  2JVV A;  2JM9 A;  2DJQ A;  4LDW A;  1UG1 A;  4A54 A;  4EMH A;  2JM8 A;  2QK0 A;  1PD1 A;  2OTL A;  3QZ5 B;  3MEV A;  2EGA A;  1YFN A;  1P5E B;  2K9G A;  4N0A C;  1SSF A;  2X4W A;  4M7A A;  2E1H A;  3X28 B;  2V8I A;  1B34 A;  2CUB A;  1RLQ C;  3E19 A;  4E2F B;  1JSU B;  4RG8 A;  3QXE B;  1IB8 A;  2QQA A;  3EOC B;  1M1F A;  3MIA B;  1IRE B;  4XU1 A;  1MHN A;  5I2S A;  1K4U S;  2JTM A;  4DEX A;  1K73 R;  2WSE E;  5KCH A;  4J9C A;  1N8R U;  2UZL B;  3I35 A;  4PJM A;  4BY6 C;  2J05 A;  3B57 A;  1JOW A;  2JGZ B;  2RPN A;  1FKM A;  5IT9 E;  2EQU A;  2RD1 A;  3BFM A;  1X6G A;  2BUD A;  3PIO A;  2HKQ B;  1XNI A;  1C9B A;  3E9G A;  4RUG A;  5FRM A;  3M03 A;  2P0P A;  5IAY A;  3JCM W;  5GAM f;  1YJN A;  1W2B A;  5GAM j;  4CFM B;  3ER0 A;  1T3S A;  1MUZ A;  2ECZ A;  3OA6 A;  3KXT A;  4CI0 C;  3BDU A;  2L3Q A;  2KI7 A;  4ROC A;  2Y4X A;  3NGP A;  3HSB A;  3DB3 A;  3NTI A;  2KDS A;  3CCL Q;  2DIL A;  1JJ2 P;  4BCO B;  3DDP B;  2J6O A;  1TSF A;  3L42 A;  2EGC A;  4HCZ A;  3VS2 A;  2KMT A;  2CP5 A;  2KT1 A;  2JT4 A;  4LD9 K;  4M75 E;  3EAE A;  4PLI A;  2CT4 A;  3CCL T;  3M55 A;  1W6X A;  5IHY A;  4BCK B;  2K5F A;  3T9N A;  2O31 A;  2CSQ A;  5EFQ B;  2VWF A;  1X6O A;  4BE1 A;  1WX6 A;  2ROL A;  4LXC A;  2GFA A;  3FJ5 A;  3RDV A;  2D1X A;  2BPM B;  1V29 B;  1VQK Q;  2DER A;  5KYW A;  2VKN A;  3QKJ A;  3M53 A;  2AZV A;  1MNE A;  1OIY B;  1WJS A;  2OAW A;  4J83 A;  4XTY A;  1K73 C;  3J80 E;  1D0Y A;  4RTZ A;  3NTK A;  2E65 A;  1UB4 A;  3JCM Q;  1H27 B;  1CKA A;  4J7F A;  1ZQ1 A;  2AKL A;  2C0I A;  3MP6 A;  4FL6 A;  2DX1 A;  3JCM J;  4EOS B;  4AFQ C;  2KMG A;  1Y0M A;  2YHT A;  1YI2 Q;  3PFS A;  2DNU A;  2PVO B;  1I5O B;  5CK9 A;  3JB9 D;  4M78 D;  1RLP C;  4F7N B;  3CC7 Q;  3LWI A;  2FHD A;  2KRM A;  3PMI A;  2J6K A;  4Z8A A;  1E6H A;  3UWN A;  4M75 G;  4KGX B;  2F2C A;  1VOM A;  2MI6 A;  5HKC A;  1YHQ T;  4ATO A;  4PNO A;  1EZZ B;  3MKD A;  2KT8 A;  4AI6 A;  1R77 A;  1QCO A;  1Q86 R;  3HZJ A;  4BBR M;  4C0G A;  2XU8 A;  1VQL Q;  3OMC A;  3PGG A;  3G4S T;  1K9A A;  2CCI B;  4QT7 A;  4KGV B;  2DJZ A;  3VKG A;  2P4T A;  2E5Q A;  2LT4 A;  3JCM X;  4HVW A;  5GAN f;  1BIB A;  3QO3 A;  5GAN 5;  2K6D A;  4HA8 A;  1NYG A;  5AT1 B;  2RNA A;  3VS4 A;  3CCQ A;  2JJ9 A;  4M75 B;  2QDJ A;  4G6L B;  3SHW A;  5GAO p;  1VQL T;  4EOP B;  3HHT B;  2LW4 A;  4E7S A;  1UGS B;  1VQN T;  2CJM B;  2MYS A;  2CS7 A;  2NUZ A;  3GF5 A;  4IMY B;  2BZ8 A;  1IO6 A;  4M78 F;  2M9U A;  3M4Y A;  1WIE A;  3H4C A;  2QF7 A;  2YT6 A;  3A5Z B;  4HCC A;  2DYI A;  1QLB A;  2DRM A;  4HVU A;  4MDX A;  2KK4 A;  3E2U A;  3OYF A;  3PTA A;  2D8J A;  4PJN A;  2R7G A;  4F7U F;  4MFD A;  3CCM T;  4KRC B;  2LCL A;  4YC3 B;  4HNV A;  4C5E A;  3HPW A;  4F6U B;  2F2V A;  4WF2 A;  4BE2 A;  1LOJ A;  1MMA A;  2XKO C;  4J5Y A;  4KT0 E;  3M54 A;  4M7A D;  2LRQ A;  1YCY A;  2E12 A;  1F5Q B;  3I5S A;  2K79 A;  2I0N A;  5FWC A;  5J3B A;  1U3O A;  4KRT A;  1M90 R;  4A4E A;  2LTO A;  3MP8 A;  3S3M A;  2EW3 A;  4C92 F;  1U5S A;  1OGU B;  2M02 A;  4A53 A;  5LJ5 e;  3OW2 A;  4YTL A;  1GY3 B;  2DME A;  2EUF A;  5GAM e;  5CCA A;  2RI2 A;  5GMK h;  4F70 B;  3JB9 J;  4WCI A;  3HKS A;  1WLP B;  4AG1 C;  3A8H B;  2PK2 A;  2DVJ A;  1ZUK A;  1UGR B;  4EMK A;  1UUE A;  4BCG B;  2VB6 A;  3M0Q A;  3BE3 A;  1KD1 U;  2JMA A;  2MAM A;  4JPB W;  1M1G A;  4E7L A;  1Y96 B;  5KYY B;  1UGV A;  4M78 A;  1WHJ A;  3EGX A;  1SEM A;  2FG0 A;  2WPA B;  4C8Q C;  4CC7 A;  4F17 A;  2C5X B;  2QQB A;  2DYB A;  2KXD A;  3CBO A;  3CCR T;  2QEX Q;  2RN8 A;  5IHK A;  4OMQ A;  3CCS Q;  1E6G A;  5KYU A;  2HL3 A;  3ZFJ A;  1JXM A;  4PK4 A;  1Y71 A;  3C95 A;  1N9R A;  3QYH B;  4N0A A;  1N6A A;  4QVC A;  2ZAE A;  4E7Z A;  4A4G A;  4ZN3 A;  3VU3 C;  4J8O A;  3RR6 A;  3G6E A;  1XJW B;  2GFU A;  2XDB A;  3CCS T;  2WIP B;  1KD1 R;  4RKU E;  3OBY A;  2QYZ A;  2X4Y A;  2PUK B;  3JCM h;  1XQH A;  1ARK A;  1H1P B;  1GH6 B;  5GMK i;  2AHJ B;  2CP7 A;  3OY9 A;  3G71 T;  2EJ9 A;  2P0K A;  2D9T A;  4IUQ A;  3VS6 A;  2GGR A;  3ZBD A;  4ANJ A;  1KIK A;  4NC6 A;  2K5L A;  3V8J A;  4M75 F;  2CGH A;  3ZL7 C;  1RAF B;  5I21 A;  3J7A F;  4CFV B;  1GBR A;  2EIF A;  4PJO F;  5LJ5 h;  2DIQ A;  1YJN Q;  2LJ0 A;  2DD4 A;  2EQI A;  3Q1J A;  4C0Z A;  4QW2 A;  2PU9 B;  1OPL A;  2PHG A;  4BCJ B;  1Q82 C;  3M4G A;  1GCQ C;  1X2K A;  3L2W A;  2DXB B;  4J9D A;  3G6E Q;  1SSH A;  4LDX A;  2XMF A;  2RK1 A;  2QAS A;  3HB9 A;  2HSE B;  3TQ7 P;  1E7P A;  5BNJ B;  2R5A A;  4B9W A;  2DO3 A;  2V22 B;  4EOO B;  4IUU A;  2CUD A;  1JST B;  5IF1 B;  2RMO A;  3EG2 A;  1VYT A;  5GAN 2;  1K9M R;  1S1N A;  2ZPB B;  4QQ6 A;  4XQ3 A;  2AK5 A;  3H0H A;  4RTT A;  3CCS A;  2FVU A;  2C5O B;  4XU0 A;  1I81 A;  5GAN d;  2V1R A;  1QVF S;  3SD4 A;  2A28 A;  1ABQ A;  2GQV A;  4FYY B;  3MJX A;  3CC2 T;  5LJ3 d;  1JEG A;  1SRL A;  4JRK A;  4EOL B;  4ELJ A;  1X69 A;  3SWN B;  4JJN K;  2SRC A;  4DBQ A;  2LMJ A;  3JB9 F;  2X4J A;  4F7L B;  3OSV A;  1R0C B;  4CFU B;  4II1 A;  2JTE A;  1U8R A;  3NFC A;  4BDZ A;  3ULR B;  1RAB B;  2K3B A;  1YJW Q;  1EX4 A;  4F7J B;  4AMC A;  3A1P A;  4RTY A;  3S6W A;  3UAT A;  4BI4 A;  4EOJ B;  1C0M A;  3TW7 A;  2PK9 B;  4J9H A;  4AG2 C;  3RGF B;  1OKV B;  3INZ A;  4M77 B;  1BCO A;  2LNV A;  4RTX A;  1GL5 A;  4TTH A;  2V26 A;  1YJW T;  3HFO A;  3JCM e;  1AEY A;  2IW9 B;  1OKW B;  4C92 G;  5KYX B;  4JLG A;  3EH2 A;  2PMI B;  2LQ8 A;  4BXX X;  5DLQ E;  1QW1 A;  1QCN A;  3EGX B;  1KG1 A;  4PFO A;  3GNF B;  2WHB B;  4BB7 A;  5HY6 A;  3DTO A;  4JZ4 A;  5GAM h;  1LPL A;  2EYW A;  1KD1 C;  2NWM A;  4A4H A;  2Y4Y A;  3PIP A;  3CCR A;  1BK2 A;  3FIF A;  4C0F A;  4M7A E;  3EFS A;  1M2O A;  4J9E A;  4ZTF A;  4DOV A;  4MDW A;  1VQ5 T;  3LYI A;  5HBJ B;  2Y90 A;  1X27 A;  2A36 A;  3CCU T;  1WZO A;  3EFO A;  4J9I A;  2EAY A;  1I5L A;  5LL6 S;  2WIH B;  3CCU A;  2QQR A;  2UUE B;  2JOY A;  2EKH A;  2L0A A;  1NEB A;  2CH4 W;  3CXC S;  1PCX A;  1PKD B;  2KSS A;  1QCF A;  4RTW A;  4C92 C;  4ROD A;  4M77 D;  4E6R A;  3MEU A;  2ZPG B;  3EJ1 B;  1QVG A;  5I22 A;  3KHI A;  2DK3 A;  4QQG A;  3CCE T;  4JX4 A;  3QYE A;  1FYN A;  1VQL A;  1W2B S;  2E6N A;  2RJC A;  2NUT B;  5IDN B;  1UFF A;  1NLO C;  4IKF A;  3G4S A;  2CP0 A;  4M78 C;  3TSW A;  5GJW B;  4R56 A;  2O9S A;  4MZP A;  1M1K C;  4BCH B;  2EQM A;  2YWW A;  2RHY A;  2HD0 A;  3QWX X;  5GAM g;  1CKB A;  1T0J A;  3VRY A;  3OYL A;  4JX6 A;  2NUP A;  1VQ6 T;  2MPX C;  2JS0 A;  2DBM A;  1H26 B;  3BG9 A;  1TG0 A;  1U1T A;  4M75 A;  4XK8 E;  1QMZ B;  2QA4 Q;  1Q81 C;  2ESW A;  3OYG A;  4LDV A;  3JB9 I;  4BD3 A;  1UEC A;  2FPD A;  4HNU A;  2AZS A;  3QBY A;  3L2V A;  3DOG B;  2Z0W A;  1UHF A;  3TNH B;  2COY A;  5A0D A;  1W70 A;  1YNZ A;  5GAO q;  3OB9 A;  2C06 A;  2X3W D;  3JCM b;  3M58 A;  4NL2 A;  2QA4 T;  3M5A A;  1FVV B;  3MPU B;  4EOI B;  4M7D D;  2XK0 A;  1OU8 A;  1ZLM A;  2QG9 B;  3UA6 A;  2HCK A;  3RMS A;  2YLC A;  5LJ5 j;  4M7D A;  3S3O A;  1X2Q A;  2L89 A;  3KFV A;  2B9R A;  2UZD B;  1YI2 A;  1WQW A;  2V8J A;  4JJB A;  2ZPF B;  4BCM B;  4NL3 A;  3BG5 A;  2HNI A;  3EG0 A;  3QG1 A;  4ORZ A;  4BCM D;  4J9G A;  2PTK A;  2FPE A;  4FM4 B;  2FZC B;  1KSW A;  2KY9 A;  3VYG B;  4OMO A;  2DF6 A;  2D0N A;  1HD3 A;  3JB9 G;  4M78 G;  2XHC A;  1NPP A;  4OMP A;  1NYF A;  1OZ2 A;  2G6F X;  4OMM A;  3LWH A;  4IIO A;  3CCL A;  1EFN A;  1Q95 G;  2KEA A;  3M0U A;  3VUZ A;  1Z9Q A;  2KR6 A;  4NS5 A;  1M90 U;  5LJ3 f;  1YJ9 A;  3QJ6 A;  3CPW S;  2DLP A;  1I1J A;  4J9F A;  2DXU A;  1X43 A;  2YRD A;  1G2B A;  1BCM A;  2VV5 A;  2YXY A;  4PJO D;  1SHG A;  4OGC A;  1C1A A;  3QDF A;  1U06 A;  4FT2 A;  5HCK A;  2CSI A;  5EJC A;  3M57 A;  3OYD A;  4LUE A;  2QGF B;  2G3R A;  1Y96 A;  5KYY A;  2COZ A;  2F2X A;  2JN0 A;  1OL1 B;  2C6T B;  1VOL A;  2KVQ G;  4FU6 A;  3JB9 H;  4CRL B;  3G71 A;  1M8M A;  2DE0 X;  3F5X B;  1TFB A;  2H3E B;  2FEI A;  4F6W B;  4OR5 B;  3V7C A;  2IVX A;  1PKT A;  2GF7 A;  1FMK A;  3MHX A;  1NEG A;  1C6V X;  1TS9 A;  1H28 B;  3JAM E;  2E70 A;  1AD5 A;  3G1J A;  3URG A;  3JV3 A;  5A0L A;  5FRN A;  2LC4 A;  1UNH D;  4QVD A;  1N8R R;  2QFZ A;  3CC4 Q;  2QGS A;  2G77 A;  2QXF A;  1WYX A;  2QA4 A;  5KE2 A;  1AWO A;  5HQ0 B;  1UTI A;  1PC0 A;  2DTI A;  1S72 Q;  3CPW P;  5GAN j;  2XIC A;  2NYS A;  3MO8 A;  2LDM A;  2PVD B;  3QSU A;  2DIG A;  3WVD B;  3WXM B;  5DM7 R;  3FJP A;  2JNG A;  1VYW B;  2PVG B;  1K8A U;  1I4K 1;  3JCM d;  3VJP A;  2BS4 A;  3OW2 P;  4M7D G;  3FEO A;  3G4S Q;  3MEW A;  1T3L A;  1VYV A;  3OYC A;  3MI9 B;  3MCA B;  2QQ9 A;  3BHU B;  1AT1 B;  2F5K A;  1AZG B;  2QDY B;  4Z6Y A;  2BS2 A;  4XU2 A;  4Y28 E;  3H9N A;  2JW4 A;  2LX9 A;  3EG9 B;  5C6S A;  4AFU C;  3G6E T;  1XOV A;  2DXB A;  3TSZ A;  1VQN Q;  5C0M A;  3CCJ A;  3CD6 T;  2H8H A;  3TEE A;  1KC8 C;  1M3C A;  2W99 A;  1PSF A;  3SB2 A;  1UGP B;  2HL5 C;  5GAN 7;  4FW1 A;  1K9M C;  3ASK A;  5CVI A;  3V8L A;  3QUI A;  2WMB B;  5J26 A;  2QTV A;  3P8B B;  3EGD A;  5GJV B;  5DQW A;  6AT1 B;  4PJO E;  1PM3 A;  2IPO B;  1VQ9 A;  5D7U A;  4HCB A;  3H41 A;  3MET A;  1S72 A;  4PJO G;  3CC2 Q;  3F70 A;  4DA4 A;  2K57 A;  1N27 A;  1G8X A;  4P5N A;  4C0D C;  4KH1 B;  3I55 A;  1RAI B;  2DD5 B;  1VQ4 T;  5GAN g;  1BU2 A;  1G5V A;  1KK7 A;  3JRZ A;  1RAH B;  3GBQ A;  3DLM A;  4J6Y A;  3QYG B;  5GAN h;  1JBM A;  2JMC A;  3RKY A;  1OOT A;  1PG5 B;  2CKK A;  2ZCF B;  2DRK A;  1RI0 A;  3H6Z A;  1SHF A;  3QJY A;  2EYY A;  1V1C A;  3RBB B;  2WAC A;  2E3I A;  1ACM B;  3ZEH A;  3HRU A;  3BG3 A;  1PRM C;  3I56 T;  2JXB A;  1G3S A;  1SRM A;  2QQS A;  4KUD K;  4PJO C;  2OTJ T;  4RTV A;  1VQO Q;  2H3J A;  3I9Q A;  1VQ7 Q;  3LW5 E;  4C8Q E;  1XO2 A;  2IN3 A;  4EPC A;  1Q86 U;  3TCJ A;  2F1L A;  2B8A A;  5KYW B;  2EGE A;  2EJG A;  4OMF B;  3PT9 A;  1RL2 A;  2KR3 A;  3I56 Q;  3QDR B;  2E10 A;  5HBH B;  1D0Z A;  4ESR A;  1NG2 A;  5FU6 C;  1OI9 B;  2L3R A;  3M56 A;  5D6Y A;  4C92 B;  4F7U A;  3MY5 B;  4J7I A;  1R0B G;  4YOZ A;  2LQN A;  4J9B A;  3FDR A;  2OAU A;  3JCM V;  1VQ5 Q;  4MZM A;  1KFZ A;  1MV3 A;  2FPF A;  1WJR A;  3A8M B;  4EC9 B;  1VQK A;  1AWW A;  1NJI C;  1MND A;  1W1F A;  1X6B A;  4OB1 B;  1RAA B;  2D8H A;  2DMO A;  1SKU B;  1H3H A;  1A0N B;  3GNG A;  3CME Q;  5CKF A;  4I3Z B;  1K0S A;  3GPL A;  3A98 A;  1NZ9 A;  3FLG A;  3I56 A;  2YUO A;  1VQP Q;  1PD0 A;  2GNC A;  4C8Q D;  3PE0 A;  2M16 A;  1VIE A;  1W4S A;  2IG0 A;  2P4R A;  4D6W A;  2VC8 A;  4EMK C;  1LJO A;  2J7I A;  1YCS B;  1VQO A;  3TVT A;  2C5N B;  1VYU A;  3M9Q A;  3VS0 A;  3ME9 A;  1OQK A;  3FRN A;  3X24 B;  2MMP A;  3NMZ C;  4UN0 A;  2KAF A;  2I2L A;  3PNW C;  1WI7 A;  2D6F A;  1N8R C;  4EOK B;  3TU4 K;  1G3N C;  4M78 E;  5FRO A;  3J81 E;  5CKB A;  1M1K U;  3PO3 S;  3JCM g;  3GTM S;  1NBE B;  1BB9 A;  5HBE B;  4PJL A;  5ACB A;  5J39 A;  2ZZD A;  2C0O A;  2CZ0 B;  5KCO A;  4F7S B;  1NE8 A;  5CYI B;  1M9S A;  2RHX A;  4CC3 A;  4CXA B;  5CKH A;  4PFZ A;  2QQ8 A;  5I5Z B;  4JLI A;  1QKX A;  5LJ3 g;  2K5I A;  2I40 B;  5GAN e;  2HQH A;  1H25 B;  2KYM A;  2CDT A;  2JUF A;  2K3X A;  2YRC A;  2C4G B;  2PQW A;  2L3P A;  2BE7 D;  2QEX A;  1HXD A;  1I0C A;  1QVG S;  3BLH B;  3VKI A;  1MMG A;  4XTU A;  5CKD A;  4ZGJ B;  2XID A;  5ICP B;  3OS0 A;  5CAI A;  3CQT A;  5L8R E;  5HK3 A;  4LE9 A;  3LGF A;  3H0F A;  4EMG A;  4OMN A;  2LCC A;  4OGE A;  1WXB A;  7AT1 B;  2GTJ A;  5CQY A;  5GAN 3;  3QHR B;  5IDP B;  4XTX A;  3THK A;  2F69 A;  3R6O A;  2MOX A;  2QTX A;  4XAX B;  4BCQ B;  1YJ9 T;  4C8Q G;  3C12 A;  4GBQ A;  2DTH A;  1QWF A;  1BI2 A;  1WPY A;  5IXF A;  2LQK A;  5GMK e;  4WTO B;  4AT1 B;  3HTR A;  4JS4 A;  4LOC A;  3TNW B;  2CP6 A;  3UT1 A;  1PHT A;  1NJI U;  5GMK m;  2GTO A;  1IRX A;  5KH6 A;  2BIV A;  5KYX A;  2DET A;  3NTH A;  3GIB A;  4PLL A;  4EMK B;  3CMA A;  1OX9 A;  3UPU A;  1GFC A;  5LJ5 d;  4OB0 B;  2X35 A;  1XTD A;  4X9C A;  2RHI A;  3VRZ A;  1N5Z A;  1TTH B;  4N4G A;  1VQ8 A;  2OI3 A;  2DL7 A;  2VGN A;  3G33 B;  4HVV A;  2COW A;  1ZBJ A;  1Y07 A;  1BU1 A;  3VS7 A;  3L1A A;  2E3H A;  2X1N B;  2LVM A;  2YRV A;  1BI0 A;  1MMD A;  4M7A G;  4RG2 A;  3RMQ A;  3UA7 A;  4JRI A;  5GAN 6;  3G7Z A;  4BCF B;  2UZE B;  1O9K A;  3OYB A;  1UNG D;  1ZUY A;  2CRE A;  3PMT A;  1AZE A;  4QSH A;  4FSX A;  4X1V A;  3CCQ Q;  1WQ7 A;  1UGQ B;  1RUW A;  3CCE Q;  5FU7 C;  1QVF A;  5FU7 B;  3LH5 A;  1Q81 R;  3VYH B;  3CXC A;  3CC7 T;  2BKD N;  5I11 A;  1RAC B;  2M1H A;  2DAQ A;  2ZGW A;  4E47 A;  1YIJ T;  1KXU A;  5DLO A;  2K3Y A;  4Q5W A;  2GBQ A;  5GMK j;  4JX5 A;  1KQ2 A;  2B86 A;  4Z88 A;  4JRQ A;  1WHM A;  1H1Q B;  3DDQ B;  1H24 B;  4RTU A;  1FMW A;  1ZSZ A;  3DB4 A;  1OV3 A;  2EFI A;  1UJY A;  1U1S A;  2OTJ A;  2RB6 A;  1O75 A;  3P8D A;  1AWJ A;  3I5R A;  4GY5 A;  4D8K A;  4C8Q B;  4LD6 A;  1YIJ Q;  5IHN A;  1VQ6 Q;  2DKG A;  1KHI A;  4AKG A;  2A37 A;  4F7U G;  1JJ2 S;  2M0O A;  3OYI A;  4ME7 A;  1G3W A;  2RM4 A;  2ZPI B;  2HKN A;  1AIS B;  1GBQ A;  2MCN A;  5GAO n;  4FX3 B;  3BW1 A;  1TXQ A;  3BDL A;  2RO0 A;  3CCM Q;  3CC7 A;  1IGQ A;  2GCX A;  1URC B;  2E41 A;  2JZ2 A;  3V7R A;  2LQW A;  3HO8 A;  4O5V A;  3TN8 B;  3OYA A;  1KQS P;  4M77 E;  3N5B B;  5GAO l;  2PUO B;  5GAO r;  1K9M U;  1RAD B;  1VQ4 A;  2DXC B;  2WSF E;  1I8F A;  3EGD B;  1RAE B;  2X51 A;  2ROT A;  1Q82 U;  1WHL A;  4FYW B;  3L2Q A;  2CP2 A;  2VGM A;  1VQ6 A;  2WMA B;  1S72 T;  2HBW A;  4M77 F;  3NPF A;  5GAM d;  1H1R B;  2CH4 A;  4CC4 B;  3LLR A;  2ZZD B;  5LMK B;  1K1Z A;  2LJ3 A;  4PJJ A;  2ATC B;  2PZ1 A;  4LDU A;  2DZC A;  4PJO B;  2DZ9 A;  3BY7 A;  2HEQ A;  4ZGD B;  3SWN C;  2JS2 A;  2CZ1 B;  4ZGE B;  2X3X D;  1TH7 A;  3HL8 A;  4HXJ A;  2MWO A;  3CCE A;  2KRO A;  2XG8 D;  1VIF A;  2KNB B;  2QI2 A;  2RJF A;  4DQ2 A;  1VQ7 A;  1SG5 A;  5ECA A;  2AIR B;  2QDL A;  4BY1 X;  2L5Q A;  4PKC C;  3LQ5 B;  4EDU A;  4EOR B;  3HFN A;  3D7S B;  4ELL A;  1WA7 A;  1D0X A;  1YWO A;  5L23 A;  4ELZ C;  4BE0 A;  2VXE A;  1WHK A;  5GMK l;  3I55 T;  4HT9 A;  1GUX B;  1UEB A;  2J6F A;  1OUL A;  1E7O A;  2RA2 A;  4M77 A;  3O8V A;  3RER A;  2DTO A;  1KJW A;  1VQ8 Q;  1BKB A;  4F14 A;  1VQ9 T;  2RI3 A;  4XU3 A;  1ZSZ B;  1VIN A;  3I55 Q;  4M7D C;  4M7D F;  2OJ2 A;  4N4I A;  3K7A M;  3CC2 A;  4R55 A;  4M7A C;  5KE3 A;  2L2P A;  3NDQ A;  2O4X B;  2CT3 A;  1VQ8 T;  3CCJ T;  3CCR Q;  5HNB B;  5KYU B;  5HVY B;  1W98 B;  2V1Q A;  3CEY A;  9ATC B;  2QGG A;  2W0Z A;  2LNH B;  2BKZ B;  1GRI A;  1WGS A;  2DL4 A;  3X26 B;  2RQV A;  1AVZ C;  3CCV A;  1EIF A;  1H64 1;  4JUV A;  4BAC A;  2O2O A;  3BHT B;  3HBL A;  3CMA Q;  4HKE A;  4E7K A;  1OU9 A;  3OS2 A;  1VA7 A;  3M0R A;  4OB2 B;  1WHH A;  4IUP A;  1ABO A;  2LP5 A;  1I07 A;  2A7Y A;  3QYB A;  2XD0 A;  1M30 A;  3OYJ A;  4OML A;  3REB B;  3V8K A;  2AKK A;  4M6V A;  4CFX B;  1GXI E;  4A4F A;  3DLL A;  1ZSZ C;  3PVL A;  3S3N A;  4M77 C;  1YP5 A;  5EG2 A;  1IGU A;  1IZ6 A;  2OX7 A;  3IQL A;  1M1K R;  3A8L B;  2CZ6 B;  3EG9 A;  3CCV T;  1O9S A;  1WXT A;  3L2Z A;  4BCP B;  1M3A A;  4A4K A;  4GLM A;  1TOV A;  4RCB A;  1N9S A;  3CPW A;  2NLU A;  2W9Z A;  2MK5 A;  3CC4 A;  2VVK A;  1FWZ A;  1K76 A;  4II5 B;  4VUB A;  1HYO A;  4KRD B;  2D0Q B;  2BS3 A;  2VXF A;  5AYF A;  3CCV Q;  4ZN1 A;  2LZ6 B;  2MF2 A;  2DXC A;  1OX8 A;  1B3Q A;  4BY6 B;  2XDD A;  4MFE A;  2EWN A;  2YDL A;  2RQW A;  2KXC A;  4DOW A;  4QKU A;  3HP9 A;  4MMK A;  3VYG A;  4M77 G;  2C5V B;  1M27 C;  3C4S A;  2F5T X;  2DD5 A;  1G83 A;  2M0Y A;  4M75 D;  2DVE A;  2X4X A;  2E5K A;  4KBM B;  4BI3 A;  3H8Z A;  2OTL T;  4CFN B;  4L6V 5;  1OPK A;  1ENW A;  3EHQ A;  3SWN A;  3OYM A;  1NPR A;  2HSP A;  3JCM f;  1WDX A;  2PJQ A;  1KQS S;  1VQP A;  4F6S B;  3OBW A;  3JCM P;  2DPP B;  3AHU A;  3UF4 A;  1YJ9 Q;  4M7A F;  1GCQ A;  2LCS A;  1VQO T;  4OP0 A;  1RAG B;  1Q7Y U;  4F04 B;  1YIT Q;  2KYB A;  1OL2 B;  8ATC B;  3LGL A;  4EOQ B;  1QKW A;  3GOX A;  1ZA2 B;  2DM1 A;  4DBH A;  4V2S A;  4OGR B;  1M8V A;  3X20 B;  1D3U B;  2A3L A;  3RKX A;  1QVF P;  1HK9 A;  1VQK T;  1VQM Q;  1ZHI A;  4C5G A;  1YN8 A;  3EFO B;  1YIT T;  4BCN D;  3M0T A;  2PNI A;  3MEA A;  2FB7 A;  4D8D A;  2E64 A;  1IHW A;  4MZT A;  2W2H A;  1D3B B;  3CME A;  1AHJ B;  4KGZ B;  1H92 A;  2ZPE B;  1PNJ A;  3OQ5 A;  5CO7 A;  4KUI A;  3OYH A;  1AOJ A;  3GP8 A;  2IW8 B;  2KRS A;  2EQK A;  1N4M A;  3FB9 A;  1VQM T;  1Q86 C;  1TUG B;  4UC4 A;  1QMC A;  2FYK A;  1VQ5 A;  1QWE A;  3RES A;  4MML A;  1JB0 E;  1KHC A;  3TW6 A;  5L2W B;  4IUR A;  5CKE A;  4HL4 A;  1FXX A;  1QP3 A;  5FU6 B;  1IXD A;  1BI3 A;  1NLP C;  4DEY A;  3EG1 A;  4C92 A;  1K8A C;  4M78 B;  1YIT A;  2IW6 B;  3CCQ T;  3TRE A;  4LUD A;  2HDA A;  4M7A B;  2RQU A;  1LVK A;  5FW9 A;  1R8O B;  4E7J A;  2ED0 A;  1OYX A;  2VYT A;  4NST B;  1Q81 U;  1QQJ A;  2DD4 B;  1JRI A;  1D1B A;  4C8Q F;  3DKM A;  1K8A R;  3CD6 A;  1ZX6 A;  4HT8 A;  3JCM c;  1Q82 R;  4GLK A;  2RQT A;  1YIJ A;  1Y7X A;  4JDS A;  2MWP A;  5DQV A;  3A8O B;  2R57 A;  1TUD A;  1YHQ A;  4BUG A;  3WVE B;  2BE9 B;  1K73 U;  4BI8 B;  4JS5 A;  1CSK A;  4XTV A;  1PWT A;  5GAO m;  1OIU B;  2EQJ A;  2XI9 A;  1JKW A;  4HNT A;  4JRP A;  2EJF A;  3HRS A;  5EC7 A;  4LN2 A;  4Z02 A;  1M2V B;  1D09 B;  3EHR A;  1BIA A;  2P0Q A;  3BHV B;  3H0I A;  4C0D B;  4RCC A;  2DEQ A;  1WFW A;  4YOO A;  5IH2 A;  2I53 A;  2K4Y A;  2ABL A;  3CBP A;  1D1A A;  2KRN A;  1SPK A;  1VQN A;  2E6Z A;  2O01 E;  1B7T A;  2EYQ A;  1MV0 B; 
#chains in the Genus database with same CATH homology
 2YLC A;  5LJ5 j;  4M7D A;  3S3O A;  2PVO B;  2L89 A;  3L1A A;  2LVM A;  2YRV A;  5CK9 A;  3JB9 D;  1KQS A;  4M78 D;  1BI0 A;  4M7A G;  4X34 A;  1YI2 A;  4RG2 A;  3RMQ A;  1P92 A;  1WQW A;  2FHD A;  2V8J A;  3LWI A;  3PMI A;  4JRI A;  2IVW A;  5GAN 6;  3G7Z A;  4Y91 A;  4OVA A;  2ZPF B;  4NL3 A;  3OYB A;  3BG5 A;  3OMG A;  3PMT A;  2HNI A;  3UWN A;  3QG1 A;  4M75 G;  5GAN 8;  4QSH A;  4FSX A;  1WNL A;  1WQ7 A;  2MI6 A;  3OYY A;  1UGQ B;  4FM4 B;  5FU7 C;  4MIM A;  2KY9 A;  5FU7 B;  5HKC A;  1YHQ T;  3VYG B;  4PNO A;  3VYH B;  3CXC A;  1QVF A;  4ATO A;  3QWL A;  4AI6 A;  3JB9 G;  3CC7 T;  4M78 G;  2XHC A;  1NPP A;  2BKD N;  2M1H A;  2DAQ A;  3HZJ A;  4BBR M;  1OZ2 A;  2ZGW A;  4E47 A;  3X25 B;  3SFM A;  3LWH A;  1YIJ T;  5DLO A;  3CCL A;  2K3Y A;  4Q5W A;  4C0G A;  5GMK j;  2R5M A;  2XU8 A;  4JX5 A;  3OMC A;  3PGG A;  3G4S T;  5CR2 A;  3VUZ A;  1KQ2 A;  3V7S A;  4JRQ A;  2KR6 A;  2K2V A;  4NS5 A;  4PL6 A;  1M90 U;  5LJ3 f;  1YJ9 A;  2DJZ A;  3QJ6 A;  3VKG A;  2P4T A;  3CPW S;  4OB3 B;  3DB4 A;  4J6W A;  2DXU A;  2EFI A;  2E5Q A;  2LT4 A;  3JCM X;  1U1S A;  2VV5 A;  3DL1 A;  1QP2 A;  5GAN f;  2OTJ A;  2RB6 A;  1BIB A;  1O75 A;  3P8D A;  4PJO D;  3C94 A;  3QO3 A;  4OF1 A;  4GY5 A;  4OGC A;  1PSE A;  4HA8 A;  4C8Q B;  5GAN 5;  4FT2 A;  4LD6 A;  3CCQ A;  5LJ5 g;  5EJC A;  3M57 A;  4M75 B;  2QDJ A;  5GAO p;  3OYD A;  2DKG A;  4PJO A;  1KHI A;  4AKG A;  4IUT A;  4F7U G;  1VQL T;  1JJ2 S;  2M0O A;  3HHT B;  1Y96 A;  2G3R A;  4ME7 A;  1G3W A;  3OYI A;  1UGS B;  1VQN T;  2RM4 A;  2ZPI B;  5DY9 A;  2JN0 A;  2KVQ G;  4FU6 A;  1X75 C;  5GAO n;  2CS7 A;  3JB9 H;  3BW1 A;  3GF5 A;  3OS1 A;  3BDL A;  2RO0 A;  3LX7 A;  5LJ3 h;  3G71 A;  3CC7 A;  2RHU A;  4M78 F;  2GCX A;  2QEX T;  2E41 A;  2M9U A;  2RJD A;  2JZ2 A;  3V7R A;  3M4Y A;  3HO8 A;  1QVP A;  4O5V A;  3H4C A;  2QF7 A;  3OYA A;  4M77 E;  1VUB A;  3N5B B;  5GAO l;  2PUO B;  5GAO r;  3A5Z B;  3V7C A;  1K9M U;  2XDP A;  4X9D A;  4HCC A;  2CYZ B;  1QLB A;  4MDX A;  2KK4 A;  1VQ4 A;  3CC4 T;  2DXC B;  2WSF E;  1I8F A;  2GF7 A;  3OYF A;  3PTA A;  1Q82 U;  3L2Q A;  3MHX A;  4F7U F;  3JSC A;  3E1S A;  4MFD A;  2VGM A;  3CCM T;  1YI2 T;  2LCL A;  1VQ6 A;  1S72 T;  4HNV A;  4C5E A;  3JAM E;  2E70 A;  3URG A;  3HPW A;  4M77 F;  4WF2 A;  4BE2 A;  1LOJ A;  2XKO C;  3KUF A;  2V8K A;  3QPH A;  4J5Y A;  4KT0 E;  3M54 A;  4C92 E;  5A0L A;  2LC4 A;  5A2Q E;  5FRN A;  5GAM d;  4HLQ A;  4M7A D;  2LRQ A;  1YCY A;  4QVD A;  2E12 A;  2QFZ A;  3LLR A;  2G77 A;  2QXF A;  2ZZD B;  3QZ9 B;  5IN1 A;  5J3B A;  2QA4 A;  5KE2 A;  2ZPH B;  4QQD A;  4ZTJ A;  4LDU A;  2DZC A;  4NOY A;  2DTI A;  4IUV A;  2FL7 A;  4ELY C;  4A4E A;  4PJO B;  2DZ9 A;  5GAN j;  2LTO A;  3MP8 A;  3S3M A;  2XIC A;  3MO8 A;  3BY7 A;  2LDM A;  4XTZ A;  4C92 F;  2PVD B;  3QSU A;  4ZGD B;  2DIG A;  3SWN C;  3WVD B;  3M59 A;  3WXM B;  5DM7 R;  4A53 A;  5LJ5 e;  3FJP A;  4C5H A;  3SDZ A;  2CZ1 B;  3QII A;  4ZGE B;  2JNG A;  1TH7 A;  3HL8 A;  3OW2 A;  4F7U E;  4YTL A;  2PVG B;  2DXT A;  1K8A U;  2MWO A;  3CCE A;  1I4K 1;  3JCM d;  1Q7Y C;  2XG8 D;  3VJP A;  2BS4 A;  1VIF A;  2RI2 A;  5GAM e;  3FEO A;  5CCA A;  5GMK h;  4M7D G;  1G3T A;  2QI2 A;  2RJF A;  4DQ2 A;  3JB9 J;  1VQ7 A;  3MP1 A;  1LNX A;  2EKO A;  2L5Q A;  4PKC C;  3HKS A;  1YJN T;  3MEW A;  4EDU A;  3A8H B;  3RKW A;  3HFN A;  3OYC A;  3MCA B;  1UGR B;  2QQ9 A;  4CRI A;  4EMK A;  2HAX A;  4ELZ C;  4BE0 A;  2VXE A;  2F5K A;  4B9X A;  1KD1 U;  5GMK l;  3I55 T;  2MAM A;  2QDY B;  4Z6Y A;  3A8G B;  2BS2 A;  4HT9 A;  1M1G A;  4XU2 A;  4Y28 E;  4C8Q A;  4C92 D;  4E7L A;  1Y96 B;  1UEB A;  5C6S A;  2LX9 A;  3G6E T;  4M78 A;  1XOV A;  2DXB A;  1B34 B;  5C0M A;  3CCJ A;  4C8Q C;  3EFR A;  3CD6 T;  2HQE A;  3TEE A;  2RA2 A;  1KC8 C;  5LJ3 j;  4M77 A;  3O8V A;  3OSS C;  2DTO A;  3RER A;  2QQB A;  1BKB A;  3LH0 A;  1PSF A;  4BBS M;  1VQ9 T;  3CBO A;  2RI3 A;  3CCR T;  4KUL A;  3SB2 A;  1UGP B;  3GLX A;  5GAN 7;  4XU3 A;  2RHZ A;  1K9M C;  3ASK A;  3KBG A;  4M7D B;  4M7D C;  4M7D F;  5CVI A;  3FC3 A;  3VUB A;  3V8L A;  3QUI A;  3ZFJ A;  4BDY A;  1X01 A;  4N4I A;  5J26 A;  1Y71 A;  3C95 A;  4O6J A;  1N9R A;  3P8B B;  4R55 A;  3CC2 A;  4M7A C;  4PJO E;  4RMO A;  3QYH B;  4N0A A;  5KE3 A;  2HQX A;  1N6A A;  4QVC A;  1VQ9 A;  1OI1 A;  2O4X B;  4HCB A;  4A4G A;  4ZN3 A;  4L5G A;  1VQ8 T;  3MET A;  3L2R A;  3CCJ T;  3VU3 C;  1S72 A;  4J8O A;  3CCM A;  4PJO G;  3G6E A;  5A0G A;  3F70 A;  2GFU A;  4DA4 A;  2XDB A;  2K57 A;  1N27 A;  3CEY A;  1KC8 U;  3CCS T;  1VQM A;  4P5N A;  4C0D C;  4RKU E;  3OBY A;  5LJ3 e;  1WGS A;  2X4Y A;  3I55 A;  2DD5 B;  1WJQ A;  3X26 B;  3E9F A;  2PUK B;  2JTF A;  2KQW A;  5GAN g;  3OYK A;  1DJ7 B;  3CCV A;  1VQ4 T;  1EIF A;  3JCM h;  1H64 1;  1XQH A;  1MGQ A;  4JUV A;  1G5V A;  3JRZ A;  4BAC A;  5LJ5 f;  1BYM A;  3DLM A;  2AHJ B;  3QYG B;  4J6Y A;  5GMK i;  5GAN h;  1JBM A;  3P8H A;  3RKY A;  3OY9 A;  3G71 T;  2EJ9 A;  3HBL A;  2D9T A;  1G3Y A;  2CKK A;  2WJ9 A;  2ZCF B;  2P0K A;  1RI0 A;  3CBM A;  3H6Z A;  4IUQ A;  3QJY A;  4HKE A;  4E7K A;  3ZBD A;  4NC6 A;  2WAC A;  2K5L A;  4L59 A;  2WSC E;  3V8J A;  3VV0 A;  3OS2 A;  4M75 F;  4AKI A;  2CGH A;  3ZEH A;  4TVR A;  3OYE A;  3HRU A;  3BG3 A;  4AKH A;  4OB2 B;  2YLB A;  4M75 C;  4IUP A;  5I21 A;  3I56 T;  3J7A F;  1G3S A;  2QQS A;  2EIF A;  4PJO F;  4KUD K;  4PJO C;  2OTJ T;  5LJ5 h;  2DIQ A;  3RIR A;  2A7Y A;  2H3J A;  3L2U A;  3QYB A;  3LW5 E;  2XD0 A;  2DD4 A;  3OYJ A;  3HRT A;  4C8Q E;  3Q1J A;  1M4Z A;  1M5Q 1;  3V8K A;  4C0Z A;  4QW2 A;  2VUB A;  4M7D E;  2PU9 B;  4EPC A;  1Q86 U;  4M6V A;  1D3B A;  4FIB A;  4FT4 A;  3TCJ A;  1GXI E;  2B8A A;  4A4F A;  1JJ2 A;  3DLL A;  3S3N A;  2EJG A;  4M77 C;  5EG2 A;  4OMF B;  3OYN A;  3M4G A;  1Q82 C;  3L2W A;  3PT9 A;  1IZ6 A;  2RH2 A;  2DXB B;  1RL2 A;  3A8L B;  4E7I A;  2CZ6 B;  3QDR B;  4LDX A;  1ZBX A;  2E10 A;  3CCV T;  2RK1 A;  1O9S A;  3HB9 A;  3L2Z A;  1E7P A;  4A4K A;  4RCB A;  2R5A A;  1N9S A;  3OS5 A;  5FU6 C;  4XTW A;  4B9W A;  2CZ7 B;  2DO3 A;  3CPW A;  2NLU A;  2L3R A;  3M56 A;  2R58 A;  4IUU A;  5D6Y A;  4C92 B;  4F7U A;  3CC4 A;  1FX7 A;  1FWZ A;  4J7I A;  5GAN 2;  2ZPB B;  4QQ6 A;  4XQ3 A;  3CCS A;  4VUB A;  3CME T;  2D0Q B;  3FDR A;  2BS3 A;  2OAU A;  2VXF A;  4J6X A;  2FVU A;  5D6W A;  5AYF A;  3JCM V;  4XU0 A;  5D6X A;  3VKH A;  1KQ1 A;  3UDC A;  4MZM A;  4ZN1 A;  2MF2 A;  4E7H A;  1I81 A;  4C5I A;  2DXC A;  5GAN d;  1QVF S;  3SD4 A;  1WJR A;  4BY6 B;  3A8M B;  2O4X A;  4F7U B;  2XDD A;  4MFE A;  2GQV A;  1VQK A;  2EWN A;  1NJI C;  2RI5 A;  3OW2 S;  3CC2 T;  5LJ3 d;  4DOW A;  4JRK A;  4OB1 B;  3HP9 A;  2RJE A;  3QHS A;  1H3Z A;  4MMK A;  4ELJ A;  3VYG A;  4M77 G;  3GNG A;  5CKF A;  3SWN B;  4JJN K;  5I2M A;  3C4S A;  2F5T X;  1YBY A;  3GPL A;  3JB9 F;  2DD5 A;  1NZ9 A;  2X4J A;  5FLX E;  3FLG A;  3I56 A;  4M75 D;  2DVE A;  5M9O A;  2LT1 A;  2X4X A;  3OSV A;  4N4H A;  4II1 A;  4KBM B;  1BI1 A;  3RUX A;  4BI3 A;  4C8Q D;  3H8Z A;  1VQ7 T;  2OTL T;  3CPF A;  1U8R A;  4L6V 5;  3CMA T;  3NFC A;  2M16 A;  1VIE A;  1W4S A;  2HBP A;  3SWN A;  4BDZ A;  1YJW A;  5CIU A;  3OYM A;  1NPR A;  2IG0 A;  4D6W A;  2VC8 A;  4EMK C;  1M90 C;  1LJO A;  3JCM f;  5GAN 4;  1KQS S;  1VQO A;  5CQX A;  3M9Q A;  1VQP A;  1OZ3 A;  3S6W A;  3ME9 A;  4BI4 A;  2RK2 A;  3OBW A;  3FRN A;  2DPP B;  3TW7 A;  3X24 B;  3JCM P;  3AHU A;  2L8D A;  2MMP A;  4QVZ A;  1VQP T;  5HK0 A;  2KAF A;  4M7A F;  2I2L A;  1VQO T;  4OP0 A;  3PNW C;  4LDY A;  1Q7Y U;  2D6F A;  3INZ A;  4M77 B;  1N8R C;  2JVV A;  2LNV A;  3TU4 K;  4LDW A;  3LGL A;  1YJW T;  3HFO A;  3JCM e;  4A54 A;  4M78 E;  4EMH A;  3GOX A;  5FRO A;  4C92 G;  2OTL A;  3QZ5 B;  3J81 E;  3MEV A;  4JLG A;  5CKB A;  1M1K U;  4V2S A;  2LQ8 A;  3JCM g;  4N0A C;  1SSF A;  2X4W A;  5DLQ E;  4M7A A;  2E1H A;  3X28 B;  1M8V A;  5J39 A;  3X20 B;  2A3L A;  2V8I A;  3RKX A;  2ZZD A;  1HK9 A;  1QW1 A;  1B34 A;  1VQK T;  2CZ0 B;  1ZHI A;  1KG1 A;  5KCO A;  3GNF B;  4C5G A;  3E19 A;  4BB7 A;  5HY6 A;  4RG8 A;  1NE8 A;  3QXE B;  1YIT T;  2QQA A;  5GAM h;  1M1F A;  3MEA A;  1KD1 C;  2FB7 A;  1M9S A;  2RHX A;  2E64 A;  1IRE B;  4XU1 A;  1MHN A;  2Y4Y A;  4MZT A;  5CKH A;  4A4H A;  2QQ8 A;  5I2S A;  3PIP A;  1D3B B;  3CCR A;  3FIF A;  4JLI A;  2JTM A;  4C0F A;  4M7A E;  3CME A;  3EFS A;  1AHJ B;  2WSE E;  5KCH A;  5LJ3 g;  4ZTF A;  1N8R U;  4DOV A;  2ZPE B;  4MDW A;  2K5I A;  3OQ5 A;  5CO7 A;  4BY6 C;  5GAN e;  1VQ5 T;  3LYI A;  4KUI A;  2Y90 A;  3OYH A;  2JUF A;  2K3X A;  3GP8 A;  1FKM A;  2EQK A;  3CCU T;  3FB9 A;  1VQM T;  1YJN A;  5IT9 E;  2EQU A;  2RD1 A;  2EAY A;  1I5L A;  3BFM A;  5LL6 S;  3CCU A;  1Q86 C;  2QQR A;  2BUD A;  2PQW A;  3PIO A;  2JOY A;  4UC4 A;  2QEX A;  1XNI A;  1HXD A;  2FYK A;  3E9G A;  1VQ5 A;  1QVG S;  3CXC S;  3RES A;  4MML A;  3VKI A;  5FRM A;  5IAY A;  2P0P A;  1JB0 E;  4XTU A;  5CKD A;  1KHC A;  2KSS A;  3TW6 A;  4ZGJ B;  4IUR A;  4C92 C;  3JCM W;  5CKE A;  5GAM f;  4M77 D;  4HL4 A;  1FXX A;  2ZPG B;  3MEU A;  1QP3 A;  5FU6 B;  3ER0 A;  1BI3 A;  2XID A;  5GAM j;  1QVG A;  3KHI A;  4C92 A;  3OA6 A;  2DK3 A;  5CAI A;  3BDU A;  4CI0 C;  4M78 B;  4QQG A;  3OS0 A;  3KXT A;  3CCQ T;  1YIT A;  1K8A C;  3TRE A;  2Y4X A;  4M7A B;  3CCE T;  5L8R E;  5HK3 A;  4JX4 A;  1R8O B;  4E7J A;  3QYE A;  3LGF A;  4EMG A;  1OYX A;  3DB3 A;  1VQL A;  1W2B S;  3NTI A;  3HSB A;  2E6N A;  2VYT A;  1Q81 U;  2LCC A;  4OGE A;  2DD4 B;  1JRI A;  2KDS A;  4C8Q F;  2RJC A;  3DKM A;  5CQY A;  5GAN 3;  3CD6 A;  4HT8 A;  3L42 A;  4XTX A;  4IKF A;  2F69 A;  3G4S A;  3R6O A;  4M78 C;  3JCM c;  4HCZ A;  2QTX A;  4XAX B;  2KMT A;  4R56 A;  4GLK A;  1YIJ A;  4MZP A;  1Y7X A;  1YJ9 T;  4C8Q G;  1M1K C;  4JDS A;  3C12 A;  2DTH A;  2EQM A;  2MWP A;  4M75 E;  4LD9 K;  1BI2 A;  1WPY A;  3EAE A;  3A8O B;  2R57 A;  4PLI A;  1YHQ A;  2LQK A;  4BUG A;  5GMK e;  2RHY A;  3WVE B;  3M55 A;  3CCL T;  2HD0 A;  4JS4 A;  4LOC A;  5GAM g;  2K5F A;  3OYL A;  3T9N A;  3UT1 A;  1K73 U;  4JX6 A;  4BI8 B;  4JS5 A;  1W2B A;  1NJI U;  4XTV A;  1VQ6 T;  5GMK m;  3BG9 A;  1U1T A;  4M75 A;  4XK8 E;  5GAO m;  5KH6 A;  2BIV A;  2EQJ A;  1X6O A;  1Q81 C;  2XI9 A;  3OYG A;  4BE1 A;  2GFA A;  3NTH A;  3GIB A;  4LDV A;  3JB9 I;  4PLL A;  4BD3 A;  4EMK B;  4HNT A;  4JRP A;  3CMA A;  1V29 B;  2EJF A;  4HNU A;  3HRS A;  3UPU A;  3QBY A;  5LJ5 d;  4Z02 A;  3L2V A;  3QKJ A;  4OB0 B;  3M53 A;  2X35 A;  1XTD A;  1BIA A;  4X9C A;  1WJS A;  2P0Q A;  4J83 A;  4XTY A;  4C0D B;  4RCC A;  1K73 C;  2DEQ A;  3J80 E;  5A0D A;  2RHI A;  3NTK A;  2E65 A;  5GAO q;  3OB9 A;  2C06 A;  1UB4 A;  4N4G A;  3JCM b;  3JCM Q;  1VQ8 A;  3M58 A;  4NL2 A;  2QA4 T;  2K4Y A;  4J7F A;  1ZQ1 A;  3CBP A;  3M5A A;  3MP6 A;  4FL6 A;  4M7D D;  2XK0 A;  2VGN A;  1VQN A;  2E6Z A;  2O01 E;  3JCM J;  2KMG A;  2EYQ A;  2YHT A;  3RMS A;  3PFS A;  1Y07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...