1AHJB

Nitrile hydratase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
MDGVHDLAGVQGFGKVPHTVDADIGPTFHAEWEHLPYSLMFAGVAELGAFSVDEVRYVVERMEPRHYMMTPYYERYVIGVATLMVEKGILTQDELESLAGGPFPLSRPSESEGRPAPVETTTFEVGQRVRVRDEYVPGHIRMPAYCRGRVGTISHRTTEKWPFPDAIGHGRNDAGEEPTYHVKFAAEELFGSDTDGGSVVVDLFEGYLEPAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of nitrile hydratase reveals a novel iron centre in a novel fold.
pubmed doi rcsb
molecule tags Lyase
molecule keywords NITRILE HYDRATASE (SUBUNIT ALPHA)
total genus 53
structure length 212
sequence length 212
chains with identical sequence D, F, H
ec nomenclature ec 4.2.1.84: Nitrile hydratase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.20 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 1ahjB01
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1ahjB02
2DXBA 3QYGB 3VYGA 1UGRB 3LW5E 1DJ7B 4KT0E 4ZGJB 1QP3A 1PSFA 3VYGB 2CYZB 3WVEB 2DD4A 3VYHB 1IREB 2DD4B 4OB3B 4FM4B 1JB0E 2WSEE 3HHTB 2CZ1B 2O01E 2QDYB 1AHJB 2DXCA 3X28B 2ZPIB 2DXCB 2WSFE 2ZPGB 3QYHB 4ZGEB 2ZCFB 3QZ5B 2WSCE 3A8OB 3A8HB 3QXEB 3A8MB 3X24B 2CZ6B 4L6V5 2PVDB 2PVOB 4RKUE 3A8GB 2ZPBB 4OB2B 2PUKB 3X26B 2CZ7B 4OB1B 3QZ9B 3WVDB 2PUOB 2CZ0B 2PVGB 1QP2A 1GXIE 1PSEA 3X20B 2D0QB 2AHJB 4OB0B 1UGQB 2ZPFB 1UGSB 2DPPB 1V29B 2PU9B 1UGPB 2DD5B 2ZZDB 4Y28E 2ZPHB 2DD5A 2ZZDA 2DXBB 4XK8E 3X25B 2ZPEB 5L8RE 3A8LB 4ZGDB
chains in the Genus database with same CATH superfamily
2DXBA 4C92G 3GF5A 2B9RA 3JCMX 1VYVA 1N9SA 4M78C 1Q7YR 3JRZA 1NJIU 2P4RA 1KG1A 4BCMD 1VOMA 3LH0A 2HMAA 1JB0E 4HL4A 1K8AU 3TCJA 2UZLB 1U5SA 2DZ9A 3CPFA 5GAN5 4BCGB 4QQ6A 4CI0C 3HP9A 5LJ3g 3DB4A 1Q7YC 3OBWA 3I56T 2OAWA 2QYZA 4A4FA 2WJ9A 3H9NA 4P5NA 1QCNA 3ZEHA 2VWFA 3BLRB 2HKQB 3EJ1B 2LRQA 4J9EA 3VS5A 1KD1R 4M75E 3M0TA 6AT1B 3ASKA 1ABOA 4PL6A 1LVKA 2QAZA 1CKAA 3CC7T 3CD6T 1Q86R 1X69A 3JCMW 4WF2A 2DL8A 3EOCB 3HBLA 1NE8A 2JMCA 5FWCA 2ED0A 2CJMB 3QDRB 1QKWA 3VUZA 4UC4A 3GNFB 3GTMS 3M53A 1WZOA 4PJLA 2D9TA 1YP5A 1QLYA 2YDLA 4R56A 4C8QA 1RI9A 4TVRA 4OB1B 1OKWB 4PJMA 3KFVA 1I8FA 4JJBA 3HO8A 2X1NB 4M75D 5KE2A 3H41A 3CD6Q 3X20B 2RPNA 3EFRA 1VQKT 1PHTA 4ROCA 1M90U 2W9ZA 4JRQA 3CCLT 2L3RA 4HXJA 3OYEA 1B34A 3UA7A 1TOVA 3CC7A 2UUEB 4Y72B 4RTXA 3JV3A 1JSUB 3CCSA 4M7DB 4F6SB 3ZFJA 1GUXA 1GCPA 2RJEA 3QJYA 1OU8A 2RH2A 4MZPA 4QVCA 1XOVA 1VQOA 1PCXA 3PE0A 1TUCA 3NFCA 1ZUUA 4B9XA 1VQPT 3FEOA 4EOSB 1U3OA 3QYGB 4M75C 4N4HA 3J7AF 4KT0E 4M75B 1RAAB 2FVUA 1JSTB 3QBYA 2YRCA 1I5LA 3JCMe 2R5MA 2E6NA 3CCMT 2RD1A 2NUPA 2LDMA 3VKHA 2P0KA 2RK2A 1MMDA 5LJ3j 2L89A 1KFZA 4WCIA 1XTDA 2F2CA 2KR6A 4XTWA 3SD4A 2C5NB 2D8JA 2XDPA 2K3BA 4NL2A 5KYWB 3BDUA 1KIKA 1WHKA 1M2OA 2C0TA 3OY9A 3EFOA 4GLMA 2M0OA 3BHTB 1Q81C 5C0MA 4HNVA 2LQ8A 2QGGA 3A8OB 2ED1A 1Q81U 4M7AB 2CH4A 5LJ3h 4XTXA 5IHYA 1IHWA 4BI4A 3META 4R0KA 3NTHA 2JXBA 4JJNK 1M4ZA 3VS7A 4EOPB 2HKNA 4X9CA 3OBYA 1K0XA 2WEVB 1Q81R 3QIIA 2F2WA 2LX9A 3GIBA 5IDPB 1H1QB 1M5Q1 2W96A 3NHNA 4D6WA 3AT1B 1JXMA 4J9IA 5D6XA 2EIFA 1AD5A 2GTOA 4WTOB 2PMIB 1K73U 2FEIA 4KH0B 4F7UB 1PSEA 1D1AA 3GNGA 1S72T 2RMOA 1Y57A 3RMQA 5GAMg 2JNGA 5DM7R 2AHJB 4OB0B 2QG9B 3REAB 5J3BA 3G71A 1D3BA 3RESA 5A0GA 1N8RU 3PIPA 1JJ2P 1AZGB 3RMSA 1ARKA 2JGZB 4ZNXA 1BYMA 3CC4A 2PJQA 1PD1A 2DAQA 4BDYA 2DEUA 1UJYA 2HL3A 3NTKA 3HKSA 2IPOB 4IURA 1MMGA 1K9MC 4OP0A 1BK2A 3JCMh 1JJ2S 3RBBB 2RQWA 2XIDA 4BUGA 4KH1B 3L2VA 3QO3A 1BKBA 1VQ7Q 5I2SA 1UE9A 1VQ6T 2DL3A 1B07A 4M77D 2XD0A 2GNCA 2VKNA 1PC0A 3S3NA 1K9MR 2G9XB 1KD1U 2RF0A 3M0QA 2K57A 4F70B 1LPLA 1EIFA 3QWLA 4RTZA 2O4XB 4C92B 5KYUA 2A36A 5ECAA 3O8VA 4PK4A 3TU4K 1K8AR 2WACA 1G2BA 1MV0B 5CKBA 5KYWA 2ZPGB 1WLPB 4BY1X 3QYHB 1YJ9A 4YTLA 1URCB 1Q7YU 4CC7A 3CCET 2H3EB 2DETA 3JB9H 2I40B 3HB9A 1O9SA 1NYGA 4KULA 1K8AC 2X4JA 4M4ZA 4ZN1A 4CXAB 1ABQA 4DOWA 3UF4A 1AOJA 2PVDB 5FWBA 5D6YA 2FRWA 2LT1A 4BXXX 1ACMB 2XICA 4XTVA 3L2RA 1YITT 1X27A 3R6NA 3OYLA 1OL1B 4XU3A 1VYWB 4BDZA 1U1SA 2Y90A 3RERA 3CMAQ 2C0OA 1B7TA 4YOZA 2C5XB 4BI3A 2K9GA 4Z8AA 2K3XA 2I2LA 4JLIA 3EGDA 2YT6A 3A1PA 1OZ2A 3F70A 1UGQB 3ZL7C 1UGSB 4AFUC 2O2OA 4PFZA 3DB3A 1G83A 3D7SB 3M54A 1OIYB 1R77A 3G7ZA 4HVWA 3G33B 4F7LB 3KUFA 2L2PA 4QVZA 2DJQA 3PT9A 4IUTA 2ZPEB 4FCYA 2BUDA 4M75G 1OQKA 1UNHD 4Y92A 3I56Q 1D3UB 1Y0MA 1RI0A 5LQFB 1WHMA 2DD4A 1ZA1B 3OS0A 3OQ5A 2MIOA 5I2MA 4FM4B 4OR5B 1VUBA 2VYTA 3HHTB 4AT1B 1VQMT 1RLQC 2GBQA 3ULRB 2BPMB 3EFOB 2DXCB 1KJWA 5GANf 5GAOr 2XKOC 4HNUA 1T3LA 5CVIA 2WFYB 4LXCA 5FROA 3DLLA 1TD6A 2ZCFB 4LDWA 2IW8B 4M75F 2H8HA 2YRVA 1M1KU 2DYIA 1C0MA 1E6HA 4MDWA 1RADB 1K9AA 2E65A 4BCJB 3I9QA 3VUBA 1XJWB 3INZA 5FLXE 2J05A 1M2VB 1PM3A 3JB9D 3UWNA 5AYFA 1WI7A 3A8GB 2F2VA 2LJ0A 2XMFA 2C5OB 2RO0A 3J80E 3BG3A 1UGVA 4E7LA 1GY3B 1MMNA 3PVLA 3MCAB 3PIOA 3RKYA 4BCKB 3OYAA 1TSFA 2V8KA 4HT8A 3QZ9B 4OGCA 4XU1A 2EGCA 2CZ0B 2EWNA 4NC6A 2CP5A 5AT1B 4M7AE 4QW2A 4A4HA 1RAFB 5BNJB 1BI3A 4J9BA 1H25B 2J6FA 2LNHB 2JS0A 4OMOA 3CPWP 2DBMA 3QUIA 2L5QA 3UA6A 4C5GA 4EORB 3MO8A 2E64A 2ROLA 5CAIA 3QKJA 4FU6A 3FB9A 2DFUA 2EYXA 4LNPA 2LVMA 3MY5B 5HY6A 3O0GD 3VRZA 1GCQA 2QQSA 4J9CA 2YUQA 4JS5A 1MUZA 1V76A 5HQ0B 3DOGB 2UZEB 2YHTA 1XQHA 2M51A 2CT3A 1YWOA 2NUPB 2FZKB 3M4YA 4F6WB 2YUOA 5GAOm 4XTYA 1YN8A 3IQLA 1KHCA 4ORZA 4M7AG 1G3SA 1VIEA 2B8AA 2DA9A 3C0CA 5HK0A 4M77E 2LCCA 2I53A 2HBWA 2VXEA 1BU1A 2CP0A 1YI2A 3CMAT 3CCJQ 4M6VA 2EYQA 4XU0A 5GAMj 3M0RA 2E1HA 5A2QE 2C4GB 1VQ6A 2CDTA 2QA4A 4BY7X 1SPKA 5IXFA 1PKDB 4MDXA 1M3BA 4UN0A 1D0ZA 1RAEB 2KBTA 2DL5A 4IMYB 1GCQC 2ECZA 1BB9A 2DX1A 1K76A 2MCNA 2V1QA 5GAN6 1ZQ1A 3OYHA 1YIJT 4CFMB 5DQWA 1O75A 1QVFA 3CCEQ 2K5IA 3PVQA 4TTHA 3QWYA 2PUKB 3P8HA 1QWFA 2KRSA 3M0PA 5GAN3 4KUDK 4HCBA 1D1BA 3QG1A 2LW4A 2QK0A 3QYBA 3LGFA 3NMZC 1AWXA 2FZGB 2L3QA 1KHIA 1GFDA 2QA4T 5CKHA 1TH7A 1FKMA 1TUGB 2OJ2A 2CUBA 4X34A 2DLPA 3L2UA 2R7GA 5LJ3e 2CS7A 1GH6B 3E9GA 1Y07A 2K79A 4M7DA 9ATCB 1U1TA 1KQSA 2XU8A 3PO3S 4MZMA 2SRCA 3URGA 4BCQD 4LD9K 3EFSA 4PJOB 1LCKA 1SEMA 1YCYA 1ZLMA 2VV5A 4M78D 4CFXB 3CCRQ 3KBGA 5FW9A 4JJCA 1VQ4A 4GLKA 2M02A 5D7UA 2L3PA 3OYGA 4RODA 2KYBA 5L23A 4ELJA 4PJOF 4HCCA 1G3YA 1QW1A 4PJJA 2QA4Q 4G6LB 4RG2A 4CRLB 4JX4A 4EOKB 4II1A 2X35A 4EMHA 5GMKe 1Q86C 4A63B 3CCQA 2M0YA 2FG0A 4JS4A 3QPHA 5CK9A 4ESRA 3SWNA 5FRMA 1RAHB 1GFCA 4DQ2A 3MEWA 2OTLQ 2K2MA 5GAMe 4RTTA 1RUWA 4JRKA 2VGNA 2RM4A 2DM1A 2DMEA 3SB2A 4EC9B 4KGXB 2IIMA 1EX4A 4IUUA 1M30A 2MAMA 2FHDA 4M77F 5CIUA 5KCOA 1UDLA 2JN0A 4PKCC 4X1VA 5IT9E 2DF6A 2JTFA 1C1AA 2DXUA 4MFDA 3CMET 2DERA 1WHLA 2QQ8A 4PJOE 2KXCA 4FYYB 1WNLA 1EFNA 1BCOA 4EONB 3AHUA 4PLLA 2UZBB 2NYSA 3VS3A 2FL7A 1B34B 4LUEA 2DL7A 3JCMV 4J9DA 2K5FA 4C8QE 2RI3A 5DQVA 4RTYA 2G6FX 4DEYA 3CMAA 1YI2T 4Y28E 1G3NC 4MFEA 2LT4A 5KH6A 2JMAA 2OX7A 1S72Q 1D09B 3ME9A 5LJ5f 2DXBB 3X25B 5GANe 1W6XA 1JQQA 2DXTA 2V22B 3RDVA 2DTOA 1KQ1A 1T0JA 3OS1A 2LQWA 3CCUQ 2BKZB 3QDFA 2ENMA 3VS0A 4EOOB 4JPBW 2PNIA 2PQWA 4E2FB 3GLXA 3OMCA 2KXDA 2OTJQ 3JCMf 3PMIA 1W4SA 2QEXA 4C0FA 3M0SA 2EQMA 4IIOA 4O6JA 2JOYA 2XG8D 2C0IA 3TREA 2CP2A 3SDZA 3P8BB 3V8KA 2F69A 4XQ3A 1SG5A 3BG9A 1MNDA 2PTKA 4NSTB 1QMZB 1VQ5Q 4BCND 3BLHB 1H641 1VQ8T 4C8QG 4FSXA 1ZBJA 5KYYA 4N0AA 1WIEA 1PRMC 3JB9J 1WFWA 2DE0X 1H24B 3TSWA 4J6YA 4ATOA 5EG2A 1I0CA 3E9FA 2YUNA 2K3YA 2PVOB 1QLBA 1VQ9T 3HRSA 2BE7D 4KUIA 5GJVB 5GAOn 1AT1B 4J5YA 4BCNB 2M9UA 5GAN2 3G71T 3X26B 3QYEA 2ROTA 1FMVA 1U06A 3FJ5A 4QVDA 1R0BG 4EMKA 2IN3A 1PD0A 4AMCA 1WJRA 2A3LA 1RAGB 2QF7A 1QCFA 4QQGA 3CCUA 3H8ZA 3EGXB 4OGEA 1JOWA 2GQVA 4E7IA 3SWNC 5L2WB 1WHGA 2OTJA 2YSQA 4OGRB 2COZA 1KQ2A 2RHIA 4PFOA 1N27A 1MNEA 4F7SB 2HDAA 1YHQQ 4RCCA 1NG2A 4PLIA 5GANj 2LQNA 2LJ3A 2OTLT 4BBSM 2WHBB 3RIRA 4AG2C 3JB9F 4C92E 4D8KA 3TNHB 4ZGDB 1LNXA 1YCSB 1AD6A 5C6SA 4XTZA 1UGRB 1WXBA 4C8QF 2KY9A 3LW5E 4ZTFA 3HRTA 4E7HA 4F17A 4FX3B 2CCHB 4LUDA 1M1KR 3EG9B 3EHRA 4C0DB 4M7AD 1OYXA 3CCVQ 4JUVA 2AZVA 1WGSA 1Y7XA 2CUDA 2A0FB 2O9VA 1G3TA 4OMLA 4BE1A 2CSIA 3L2ZA 1X6GA 3M0UA 3G6ET 2AZSA 2ZPIB 1M1KC 1UFFA 1JXOA 1OEBA 1VQ4Q 1TFBA 3I55T 1OU9A 1KQSS 1M8VA 2PK2A 3KHIA 1SHGA 2KT8A 1GBQA 1WXUA 1GBRA 2YUPA 1UEBA 2FPDA 4V2SA 4B9WA 5CKDA 3CCQQ 2BTTA 2FPEA 2EVRA 1OV3A 4M78E 5KYNA 3FDRA 1YFNA 4RMOA 4RCBA 4J9HA 1I4K1 4K11A 2IG0A 5CYIB 1WXTA 2D0NA 1YJ9T 4J8OA 3JCMJ 1W1FA 4BCHB 1YJWT 5GAOp 3CCJA 4BE0A 2CZ7B 5GMKm 8AT1B 1ZSZC 4M7DD 4M7DE 1ZSZB 3WVDB 2AKLA 2E5KA 1FXXA 3MKDA 1VINA 4EMKB 1ZA2B 1Q82R 2DIQA 4GBQA 1BI1A 4C0GA 4JX6A 1NBEB 2QEXT 2D0QB 2DVEA 3QHSA 1TUDA 3MJXA 4M78B 1Q95G 4PJOD 1V29B 3L42A 4BCQB 2PU9B 2WMBB 1I81A 4BI8B 1JBMA 1H3HA 1Q82C 1IGQA 2RA2A 2ZGWA 4OMNA 2JUFA 4C8QC 2C6TB 2ZZDB 2HSEB 2GFUA 3PTAA 3REBB 2HSPA 1UTIA 4CC2A 2DD5A 3CXCP 2E5QA 2GF7A 3DLMA 2DL4A 1UG1A 2PZ1A 1H1SB 2KE9A 3M9QA 3P8DA 2HD0A 2RHUA 1DJ7B 4MMKA 4Z88A 3WXMB 2E41A 1E6GA 3L1AA 5IHKA 3VYGB 3PGGA 1R8OB 5FU6B 2IVXA 1QWEA 2JS2A 3M55A 1VQ8Q 4HKEA 4E47A 3CXCS 4BD3A 3K7AM 3EG3A 1S72A 4BCOB 2IW9B 2E3HA 4IIMA 3T9NA 2CZ1B 3CXCA 4OF1A 2O01E 4Q5WA 2QTXA 4ZTJA 1M27C 3PMTA 2KRMA 1YI2Q 2K5LA 5HCKA 3OYKA 3NTIA 3GOXA 3ER0A 2A28A 1HXDA 2W99A 4RTWA 3CCUT 4F04B 4C5EA 1VQNA 1X6BA 2BS3A 1NLOC 4FL6A 4C0ZA 1QVFS 3OS2A 1I5OB 2ESWA 4ROEA 4AI6A 3X24B 1D0YA 4M78F 1M2VA 2BIVA 1NPRA 2W2HA 4C5HA 3OYDA 1WPYA 4L5GA 2MOXA 3H0IA 3HL8A 1PWTA 2EQIA 4JLGA 5GMKh 1N8RR 2PVGB 1N9RA 2RI2A 2COWA 1TWBA 3QHWB 1KC8C 4F7UA 1SRLA 2C06A 1K9MU 1QKXA 2GCXA 1M1FA 4CC3A 2ZPFB 5KYXA 2H3JA 1V1CA 1N8RC 4EDUA 3CC7Q 5FU7B 3JCMc 4MIMA 1H1PB 1YIJQ 5GMKj 2C5VB 1AWWA 2DJZA 1KC8R 2MWPA 4J7IA 3CC2Q 4BCFB 2P0PA 1MV3A 2DTHA 2HQXA 3FIFA 1AWJA 5IDNB 4XU2A 1VQPQ 8ATCB 2ZZDA 1MHNA 3J81E 2UZDB 1B3QA 2DNUA 2VXFA 3MI9B 1VQOQ 3BLQB 2MWOA 2QTVA 1NYFA 3CCRA 1SSFA 2JM8A 4ZGJB 4C5IA 1OPKA 1PSFA 1W70A 2KVQG 3SFMA 3VJPA 5GMKl 5FGKB 2EBPA 2Z0WA 3CC2T 2JJ9A 2KQWA 1YBYA 2RHYA 3EH1A 1RAIB 1BIBA 5IH2A 1K73R 3RGFB 3O5ZA 2MK5A 4IUPA 5FRNA 3R6OA 2BKDN 4OMMA 3HPWA 1TS9A 4HT9A 1K1ZA 2GTJA 1NEBA 3C4SA 1T0HA 5J39A 1VQOT 4C0DC 2EJGA 3SWNB 3JCMg 1X2KA 3JSCA 4LOCA 3H4CA 4F7UF 2EYWA 1MGQA 5GAN8 2YLCA 3G4SQ 3HTRA 2VGMA 4AKGA 3BHUB 3C95A 5LJ5g 2QEXQ 3A8MB 3EHQA 3LYIA 2J7IA 2QFZA 1NZ9A 2K6DA 1OI1A 2X4YA 2P4TA 2CREA 2IW6B 2RJDA 1UJ0A 3TNIB 4EOLB 1ZSGA 1ZSZA 2E3IA 2DVJA 1G8XA 3OYJA 4I3ZB 2W0ZA 5DLQE 1WX6A 1A0NB 1LOJA 1M90R 4E7SA 3RKXA 2P0QA 3OYYA 2PHGA 3EGXA 2RNAA 1NPPA 2D8HA 3EGDB 2B86A 2FYKA 4J9GA 3RNJA 2F1LA 1H27B 3G71Q 3FRNA 4PJOG 4EMKC 2YRDA 1KXUA 2QDLA 4J6WA 1M90C 2EPDA 3DL1A 3TSZA 3JCMd 1AEYA 4EOIB 2O31A 3OSSC 2YWWA 3EH2A 4AFSC 1IXDA 3BFMA 1FINB 1LJOA 1KC8U 1VQ7A 3MIAB 3VYGA 3CCEA 1VQ5T 3QJ6A 3EG9A 3QHRB 3MHXA 4LE9A 1ZHIA 2F2XA 1RABB 1WQWA 4A54A 2LCSA 2W9FA 5HBHB 2KK4A 5IAYA 3JB9G 3VYHB 1MMAA 2ATCB 5GAMf 3DDQB 2DD4B 4A4KA 4PJNA 4E7KA 1U8RA 1PG5B 3A98A 4QT7A 1O9KA 4HCZA 3CC4T 1KK7A 2JT4A 2QDYB 4CFNB 5LL6S 1J3TA 4FT4A 5CO7A 1TG0A 5KE3A 4OVAA 2W10A 4A4GA 2CGHA 3HZJA 4ZGEB 2D6FA 2EQUA 3SEMA 3I35A 3TVTA 3MP6A 4OMQA 1I1JA 4KGZB 1W2BS 5HBJB 4F7JB 2OAUA 3VS6A 2WPAB 1Z9ZA 1UB4A 1Z9QA 3EG2A 4D8DA 2JTEA 4YOOA 2CZ6B 4JX5A 4RUGA 4L6V5 2DK3A 3MEAA 5IF1B 5HVYB 3LLRA 3CBOA 2HQHA 5LJ5h 1NJIC 4VUBA 4FIBA 3E19A 4PFPA 2EW3A 3S3OA 3JCMQ 2MMPA 1VQ9Q 2AIRB 3I55Q 4YOSA 1S1NA 5LJ5j 3S6WA 2DBKA 1BI0A 1IZ6A 1M9SA 2MPXC 1HYOA 2E70A 4F16A 3FJPA 1OX9A 4DBFA 3OW2P 1UGPB 2QQAA 4Z89A 2DD5B 2V8JA 1Y96B 1I07A 3EAEA 2LZ6B 4ELZC 1PKSA 3C12A 3VV0A 2CP7A 4KRCB 4PJOA 1PNJA 4OMPA 2HQEA 2EYYA 1VQ4T 1E9HB 3V7RA 4CFWB 1G5VA 4AG1C 4HA8A 1WJSA 3LWHA 1QP3A 4EC8B 3I56A 3EG1A 4JRPA 5HNBB 4M75A 4GY5A 2EQJA 5I21A 3TW7A 1WYXA 1AWOA 2LMJA 1FX7A 5GAN7 2WSEE 2JVVA 1WQ7A 1OGUB 3LGLA 1VYTA 1JKWA 3CD6A 4X9DA 1QVPA 2BS2A 2WIPB 2NUTA 3M5AA 3OB9A 4M7AF 5FU7C 3NDQA 3A5ZB 4AFQC 4EPCA 3CCRT 3QZ5B 1WA7A 3A8HB 3CBPA 2LTOA 2X4WA 1TTHB 3CCSQ 2BZXA 4F14A 1JRIA 4F7UE 1JO8A 2RQRA 1YJNQ 2CSQA 2LCLA 3L2WA 1FWZA 4J6XA 2HBPA 2DEQA 1X43A 3F5XB 3OW2A 1SHFA 3CCLA 1KD1C 1VYUA 2RJFA 3I5RA 3BG5A 3OS5A 4M78G 1QVGP 4JJDA 2RHXA 5HKCA 3MP8A 3MP1A 3VRYA 5CKFA 1GXIE 4IUQA 4ELLA 2G77A 2E6ZA 2EGAA 2VASA 1YJ9Q 2RQVA 1KQSP 3RR6A 2E12A 1D3BB 2X51A 2EJFA 2DRMA 1EZZB 3VS2A 2DO3A 5CQYA 2RQUA 4KRTA 5LJ5e 1H3ZA 2EAYA 2QXFA 4PNOA 2O88A 4AKHA 2PK9B 4FSSA 1W98B 3I5SA 4C8QD 5I22A 4AKIA 1OKVB 2EGEA 2RB6A 1FYNA 2SEMA 2YXYA 4BY6B 4EIKA 4ELYC 4AFZC 2QGFB 2HL5C 1FMWA 1IGUA 1W2BP 1G3WA 1HK9A 5FU6C 5IHNA 1VOLA 2P84A 1GRIA 1XO2A 2KR3A 1YIJA 1YHQT 3LH5A 1O9KB 1NLPC 4OB3B 3MEVA 1QMCA 4HNTA 1VQPA 2O9SA 4FYVB 3GPLA 3M58A 4QSHA 1C6VX 2O4XA 2VB6A 4C92A 1K4US 2RJCA 1BI2A 2JM9A 2J6OA 1UHCA 3HRUA 1RACB 2ABLA 1UUEA 4BACA 4M7DC 1JEGA 2R57A 2EFIA 4F7NB 4FYWB 3OYNA 3TQ7P 1VQ6Q 3CCJT 2CP6A 1HD3A 4EOMB 1TXQA 3PFSA 4E6RA 5ACBA 4CFVB 2Y4XA 2HCKA 3U23A 1UHFA 3I55A 4F7UG 3H0FA 1N6AA 4RKUE 3M57A 4BCPB 4C8QB 1ZX6A 3DKMA 1H26B 4KRDB 5GAMd 5ICPB 4IKFA 2V1RA 3CCVA 2X4XA 4NL3A 1VQKQ 2RN8A 1AISB 2BZ8A 4MMLA 4BCMB 2XHCA 1K0SA 2KEAA 3OYBA 2FRYA 5M9OA 3DTOA 2DMOA 2QDJA 3B57A 4ME7A 4J9FA 4M78A 2HNIA 2F5KA 1WHJA 1OZ3A 3HFNA 2KNBB 2A7YA 1VQ5A 1VQMQ 4XTUA 4DBRA 2CT4A 5KYXB 3GP8A 5GAMh 2MYSA 1VQ9A 2NWMA 3MPUB 3ZBDA 5A0DA 2OI3A 2V26A 1N5ZA 4M7DF 2LJ1A 2R5AA 3BW1A 5J26A 2XDBA 1QQJA 2KT1A 5L8RE 4HCKA 4C92C 4BE2A 2GFAA 4CRIA 2ZAEA 3EG0A 3CCVT 4DOVA 4FW1A 2E4HA 3JCMb 2YLBA 3NGPA 1PKTA 3WVEB 1D1CA 2GQIA 1QVFP 1UNLD 2XI9A 4M77C 5IHIA 3SHWA 1VQNT 2X9HA 1X2QA 5HBEB 4RTVA 1P92A 4N4GA 2JTMA 3X28B 1H8KA 5GANg 4LN2A 3E2UA 2RHZA 5LJ3f 3OYCA 1IO6A 1YJNA 5EC7A 2DTIA 2WSFE 2BS4A 3CCMQ 4M7DG 1D0XA 4L59A 1P5EB 3UPUA 2OTLA 1VA7A 3G4SA 3E1SA 3CMEQ 3CCLQ 1VQLQ 3RUXA 1Q86U 2J6KA 3G6EQ 2KDSA 5DLOA 1YJWQ 1BIAA 4IUVA 2CH4W 3LX7A 2EQKA 2EKHA 1IRXA 3HFOA 2X3XD 2JW4A 1VQMA 2V8IA 3CCQT 2ZPBB 4DEXA 4LDUA 3NPFA 1YJNT 2XK0A 1IB8A 2D1XA 4MZTA 2E10A 4KBMB 2KRNA 4LD6A 2IVWA 4HVVA 4KGVB 1GL5A 3DDPB 3CCST 2DRKA 4DBHA 1M3CA 4M7AC 3BDLA 7AT1B 1AZEA 2VVKA 2FZCB 1ZUYA 2BE9B 5IXBA 2EUFA 1CKBA 1NEGA 2F5TX 1R0CB 4ANJA 2AKKA 2FO0A 2KSSA 3RKWA 4BB7A 5GAN4 1YITQ 1OL2B 5GANd 1X01A 4XAXB 4OMFB 2RK1A 4FYXB 2KAFA 4Z02A 2CCIB 1OX8A 4O5VA 5KCHA 3JB9I 3M56A 1RLPC 1UECA 3CBMA 2KMTA 3VS1A 4J7FA 3UDCA 2QQBA 2Y4YA 4LDXA 4HLQA 2LP5A 1K73C 3BY7A 2R58A 3A8LB 1TU0B 2KROA 5CEIB 5CQXA 3OYMA 2I0NA 1WJQA 4FT2A 4EOQB 3V8JA 5I11A 2CYZB 3CMEA 2EJ9A 1SRMA 3N5BB 1SSHA 3MY1B 2LC4A 1QCOA 3TN8B 4CFUB 1IREB 4CC4B 3JCMP 2KI7A 4YC3B 2K7AA 2COYA 2J06A 4DA4A 1OIUB 1Y71A 1ZP2A 2G3RA 2QGSA 2L0AA 1AHJB 3UT1A 2FB7A 1UNGD 4BY6C 5D6WA 3VKGA 5CCAA 2FPFA 2DZCA 4PJOC 3V8LA 5LMKB 3Q1JA 2BZYA 3CC2A 2QI2A 3TEEA 2WSCE 3OSVA 5CR2A 3QWXX 5GANh 4JDSA 1OPLA 3MEUA 4E7JA 1KSWA 3OYFA 1VQKA 4M7AA 5IN1A 3VKIA 3VU3C 3PNWC 1X75C 4ZN3A 4B6MA 2CKKA 2K4YA 4N0AC 3CEYA 1YITA 2OTJT 3M03A 4JZ3A 2JZ2A 2RI5A 2AK5A 4OB2B 3CC4Q 2A37A 2VUBA 5LJ5d 3CPWA 1ZBXA 1OOTA 1X6OA 2MI6A 1VQ8A 1BU2A 4NS5A 4J83A 1M1GA 3LWIA 4Y91A 1SKUB 4CFUD 1HJDA 3EIDB 2VC8A 1T3SA 2L3SA 4QQDA 3M4GA 1QVGS 4E7ZA 4M77G 5GJWB 3V7CA 4II5B 1H4LD 3VS4A 3QSUA 1VQNQ 3TW6A 1YHQA 4JZ4A 2LX7A 2RQTA 1Y96A 3DJBA 1YWPA 4XK8E 1PRLC 3UATA 5EJCA 2HZYA 3M59A 2QQ9A 4EOJB 2LQKA 4FW2A 2K2VA 2QQRA 4Z6YA 1FVVB 1XNIA 2AT1B 3CPWS 2EYZA 5CKEA 1JJ2A 2HAXA 2DKGA 1WDXA 2QASA 2NLUA 3EGUA 2M1HA 1N4MA 2KYMA 1OI9B 1BCMA 1VQLT 4LDVA 3GBQA 3S3MA 5A0LA 1NM7A 2A08A 4RG8A 2DXCA 1YJWA 5GAOl 1E7PA 3POMA 3C94A 1OULA 5KYUB 1WHHA 2CP3A 2DIGA 4QKUA 1CSKA 5KYYB 4N4IA 1QVGA 1ENWA 4C92F 1NJIR 3OMGA 1AVZC 2NUTB 1F1BB 1HSQA 2MF2A 4A53A 1SF9A 5HK3A 3THKA 1H92A 1IHVA 3CQTA 1H1RB 3QXEB 4LDYA 3BE3A 2DILA 2HEQA 1C9BA 3FLGA 3G1JA 4BCIB 3HSBA 2DYBA 3FC3A 3V7SA 3JAME 4C92D 3CCMA 3KXTA 1YNZA 1JU5C 4F6UB 1E7OA 5GMKi 2EKOA 5EFQB 1VQLA 2WMAB 2M16A 3H0HA 3G6EA 4M77B 2PUOB 2KGTA 4EMGA 2XDDA 2GGRA 5LJ3d 3G4ST 1M8MA 4M77A 1QP2A 1F5QB 5I5ZB 4DBQA 2KMGA 4NOYA 1M3AA 2LNVA 1Q82U 1W2BA 3BHVB 1VIFA 5DY9A 4A4EA 2DPPB 1FMKA 1ZUKA 2WXVB 2WIHB 3LQ5B 1GUXB 2NUZA 4JRIA 1BBZA 4HVUA 1RL2A 3L2QA 2L8DA 4RTUA 2X3WD 2ZPHB 3OYIA 3OA6A 4BBRM 3OW2S 4R55A 1H28B 5GAOq 1VQ7T 3TNWB 3H6ZA
chains in the Genus database with same CATH topology
2QQSA 2DXBA 2RB6A 3M9QA 3P8DA 2HD0A 4JS5A 4C92G 2RHUA 3GF5A 1DJ7B 4MMKA 4BY6B 3WXMB 4ELYC 3JCMX 2E41A 1K8AU 2YHTA 1XQHA 3L1AA 3VYGB 1G3WA 1HK9A 3PGGA 1N9SA 1R8OB 5FU6C 5FU6B 3M4YA 4M78C 3M55A 4HKEA 4E47A 5GAOm 3JRZA 4BD3A 3CXCS 4XTYA 1YHQT 1YIJA 1S72A 1NJIU 4OB3B 1KHCA 1KG1A 4M7AG 3MEVA 3LH0A 1JB0E 1G3SA 4HL4A 3T9NA 2CZ1B 4HNTA 1VIEA 2B8AA 4OF1A 3CXCA 2O01E 4QSHA 3M58A 2DZ9A 3TCJA 3GPLA 3CPFA 4M77E 2LCCA 2QTXA 4Q5WA 5HK0A 5GAN5 2VXEA 4QQ6A 4CI0C 4ZTJA 3HP9A 5LJ3g 2O4XA 4C92A 3DB4A 3PMTA 2RJCA 1BI2A 1Q7YC 3OBWA 3I56T 2K5LA 3HRUA 4A4FA 3OYKA 2WJ9A 4BACA 4M7DC 3NTIA 3GOXA 1YI2A 4M6VA 4P5NA 2EYQA 4XU0A 5GAMj 3ER0A 3CMAT 3ZEHA 2R57A 1HXDA 2EFIA 2LRQA 3OYNA 2E1HA 5A2QE 3CCUT 4C5EA 4M75E 1VQNA 3CCJT 2BS3A 4FL6A 4C0ZA 1VQ6A 1QVFS 3ASKA 3OS2A 4PL6A 1VQPA 2QA4A 3PFSA 4AI6A 3CC7T 3X24B 3CD6T 4MDXA 2Y4XA 3JCMW 4M78F 4WF2A 3HBLA 1NE8A 2BIVA 3I55A 4F7UG 1NPRA 3QDRB 1N6AA 5GAN6 4RKUE 1ZQ1A 3M57A 4UC4A 3GNFB 3VUZA 4C5HA 3OYHA 4C8QB 1YIJT 1QVFA 1O75A 3M53A 2K5IA 3DKMA 2D9TA 5GAMd 3OYDA 2PUKB 3P8HA 1WPYA 4C8QA 4R56A 4L5GA 4TVRA 4IKFA 5GAN3 4KUDK 4OB1B 4HCBA 3CCVA 2X4XA 3HL8A 3QG1A 4NL3A 1VQ9T 3QYBA 1I8FA 4JLGA 3LGFA 4MMLA 2XHCA 5GMKh 2PVGB 1N9RA 3HO8A 2RI2A 4M75D 5KE2A 1KHIA 3OYBA 5M9OA 3X20B 2QDJA 4ME7A 1KC8C 4F7UA 2C06A 3EFRA 4M78A 2HNIA 1K9MU 1VQKT 2QA4T 2F5KA 1M90U 2GCXA 1M1FA 5CKHA 4JRQA 2ZPFB 1OZ3A 1TH7A 1FKMA 2H3JA 2L3RA 3HFNA 3CCLT 3OYEA 2A7YA 1N8RC 4EDUA 1VQ5A 4XTUA 4X34A 5FU7B 1B34A 3L2UA 3JCMc 4MIMA 5LJ3e 3GP8A 2CS7A 5GMKj 3CC7A 3E9GA 2DJZA 1Y07A 2MWPA 4J7IA 5GAMh 3CCSA 4M7DB 2P0PA 3ZFJA 1VQ9A 2DTHA 2HQXA 3ZBDA 3FIFA 5A0DA 4XU2A 2RJEA 4M7DA 1U1TA 3QJYA 1KQSA 4M7DF 2ZZDA 2R5AA 3BW1A 5J26A 1MHNA 3J81E 2RH2A 4MZPA 2XDBA 2XU8A 5L8RE 4QVCA 1XOVA 1VQOA 2VXFA 4MZMA 4C92C 3NFCA 3URGA 4BE2A 2GFAA 4B9XA 4CRIA 3EFSA 3FEOA 1VQPT 4LD9K 2MWOA 4PJOB 3QYGB 4M75C 3CCRA 4N4HA 3CCVT 1YCYA 3J7AF 2VV5A 4M78D 4DOVA 4KT0E 1SSFA 3KBGA 4M75B 4ZGJB 3JCMb 4C5IA 1VQ4A 1PSFA 4GLKA 2FVUA 2YLBA 2KVQG 3QBYA 3WVEB 1I5LA 3JCMe 2R5MA 3SFMA 3VJPA 2E6NA 3OYGA 3CCMT 5GMKl 4ELJA 2RD1A 2XI9A 4PJOF 2LDMA 3CC2T 4HCCA 1G3YA 1QW1A 2KQWA 3VKHA 2P0KA 4M77C 1YBYA 4RG2A 2RHYA 1VQNT 4JX4A 2RK2A 1P92A 1BIBA 4N4GA 5LJ3j 2L89A 4II1A 2X35A 4EMHA 5GMKe 1XTDA 2JTMA 4IUPA 1Q86C 5FRNA 2KR6A 4XTWA 3R6OA 3X28B 2BKDN 5GANg 3HPWA 3SD4A 3CCQA 4HT9A 4JS4A 2XDPA 3QPHA 5CK9A 2RHZA 5LJ3f 4NL2A 3OYCA 3BDUA 1YJNA 3C4SA 3SWNA 5FRMA 2DTIA 5J39A 4DQ2A 2WSFE 2BS4A 1VQOT 3OY9A 4M7DG 4C0DC 3MEWA 2EJGA 4L59A 3SWNB 3JCMg 3UPUA 2M0OA 3JSCA 4LOCA 1Q81C 5C0MA 4HNVA 2OTLA 3H4CA 5GAMe 3G4SA 2LQ8A 3E1SA 4F7UF 3A8OB 1Q81U 1MGQA 4M7AB 5GAN8 2YLCA 5LJ3h 3RUXA 2VGMA 4AKGA 4JRKA 4XTXA 2VGNA 1Q86U 3C95A 3META 4BI4A 3NTHA 2RM4A 3L2QA 4JJNK 1M4ZA 2KDSA 5LJ5g 3A8MB 3SB2A 3LYIA 5DLOA 4X9CA 2QFZA 1BIAA 1NZ9A 3OBYA 4IUVA 3LX7A 2EQKA 1OI1A 3QIIA 4IUUA 2X4YA 3HFOA 2MAMA 2FHDA 4M77F 5CIUA 2LX9A 3GIBA 5KCOA 2P4TA 1VQMA 2V8IA 1M5Q1 2JN0A 4PKCC 3CCQT 2ZPBB 4D6WA 5IT9E 2RJDA 4LDUA 2JTFA 1YJNT 5D6XA 2XK0A 2EIFA 2DXUA 4MZTA 2E10A 4KBMB 4LD6A 2IVWA 3OYJA 4MFDA 5DLQE 3CCST 3CMET 1K73U 2QQ8A 4PJOE 4M7AC 3BDLA 1LOJA 4F7UB 1WNLA 1PSEA 3RKXA 2P0QA 3GNGA 1S72T 3OYYA 2F5TX 3RMQA 5GAMg 2JNGA 3AHUA 4PLLA 5DM7R 2KSSA 1NPPA 2AHJB 4OB0B 2FYKA 3RKWA 4BB7A 5GAN4 5J3BA 2FL7A 1B34B 3G71A 1D3BA 3RESA 1X01A 5A0GA 5GANd 1N8RU 4XAXB 3PIPA 4OMFB 2RK1A 3FRNA 2KAFA 4PJOG 4EMKC 4Z02A 1M90C 4O5VA 4J6WA 3RMSA 3JCMV 5KCHA 3JB9I 2K5FA 3M56A 3CC4A 1BYMA 4C8QE 2RI3A 3DL1A 2DAQA 3CBMA 2KMTA 3JCMd 3CMAA 4Y28E 4BDYA 1YI2T 4J7FA 4MFEA 2QQBA 2LT4A 3UDCA 2Y4YA 3HKSA 3NTKA 5KH6A 3OSSC 4IURA 3ME9A 4LDXA 4HLQA 5LJ5f 2DXBB 3BY7A 1K73C 3X25B 3BFMA 5GANe 1K9MC 4OP0A 1LJOA 2R58A 3A8LB 1KC8U 2DXTA 3JCMh 2DTOA 1JJ2S 1VQ7A 2XIDA 5CQXA 4BUGA 3OYMA 3VYGA 3L2VA 3CCEA 1KQ1A 3QO3A 1VQ5T 1BKBA 3QJ6A 5I2SA 1WJQA 3OS1A 1VQ6T 4FT2A 3V8JA 3MHXA 1ZHIA 2CYZB 2PQWA 1WQWA 2EJ9A 4M77D 3N5BB 4A54A 3CMEA 2XD0A 3S3NA 2LC4A 2KK4A 3GLXA 5IAYA 3JB9G 3VYHB 3JCMP 1IREB 3OMCA 5GAMf 1KD1U 3JCMf 3PMIA 2DD4B 1W4SA 2QEXA 2K57A 4A4KA 4C0FA 4E7KA 2EQMA 4O6JA 4DA4A 2JOYA 1EIFA 3QWLA 1Y71A 2XG8D 3CC4T 4HCZA 2G3RA 1U8RA 3TREA 2O4XB 4C92B 2QDYB 3SDZA 1AHJB 3UT1A 3P8BB 5LL6S 3V8KA 2FB7A 4FT4A 4BY6C 2F69A 3O8VA 4XQ3A 5CO7A 5D6WA 3VKGA 5CCAA 5KE3A 2DZCA 3BG9A 3TU4K 4PJOC 4OVAA 2WACA 5CKBA 3V8LA 2ZPGB 1H641 3Q1JA 1VQ8T 4A4GA 3QYHB 2CGHA 4YTLA 1YJ9A 3HZJA 4ZGEB 4FSXA 4C8QG 2D6FA 3CC2A 2EQUA 1Q7YU 2QI2A 4N0AA 3TEEA 2WSCE 3CCET 3OSVA 5CR2A 5GANh 3MP6A 4JDSA 1W2BS 3JB9H 2OAUA 3HB9A 3MEUA 1O9SA 4E7JA 4KULA 3JB9J 1K8AC 3OYFA 1UB4A 2X4JA 1VQKA 4M7AA 4ZN1A 5IN1A 3VKIA 4J6YA 4DOWA 5EG2A 4ATOA 2CZ6B 4JX5A 3VU3C 3E9FA 2PVDB 4L6V5 2DK3A 3PNWC 1X75C 3MEAA 2K3YA 2PVOB 1QLBA 5D6YA 2CKKA 3HRSA 2K4YA 4N0AC 2LT1A 3CEYA 4KUIA 5GAOn 1YITA 2OTJT 3LLRA 3CBOA 4J5YA 2XICA 4XTVA 2JZ2A 2RI5A 3L2RA 2M9UA 5GAN2 1YITT 5LJ5h 4OB2B 3OYLA 4XU3A 3G71T 1NJIC 3X26B 2VUBA 1U1SA 4BDZA 2Y90A 3RERA 4VUBA 4FIBA 5LJ5d 3CPWA 3QYEA 3E19A 1ZBXA 1X6OA 2MI6A 4BI3A 1VQ8A 4QVDA 4EMKA 3S3OA 3JCMQ 4NS5A 2MMPA 1M1GA 4J83A 3LWIA 2K3XA 2I2LA 4JLIA 4Y91A 1WJRA 2A3LA 2VC8A 2QF7A 5LJ5j 3S6WA 4QQGA 1OZ2A 3F70A 4QQDA 3CCUA 3H8ZA 1BI0A 1IZ6A 1UGQB 1UGSB 1M9SA 4OGEA 3M4GA 2GQVA 2E70A 4E7IA 3SWNC 3DB3A 3FJPA 1QVGS 3M54A 2OTJA 4M77G 3V7CA 3G7ZA 1UGPB 1KQ2A 2RHIA 2QQAA 4ZN3A 3QSUA 1N27A 2DD5B 2V8JA 1Y96B 3EAEA 4RCCA 3TW6A 3KUFA 4PLIA 5GANj 4ELZC 1YHQA 2OTLT 3C12A 4QVZA 1Y96A 4BBSM 3VV0A 4IUTA 3PT9A 4XK8E 3RIRA 4PJOA 2ZPEB 3JB9F 4C92E 4ZGDB 5EJCA 2BUDA 2HQEA 3M59A 4M75G 1LNXA 2QQ9A 5C6SA 4XTZA 1UGRB 1VQ4T 3V7RA 4C8QF 2KY9A 3LW5E 1G5VA 2LQKA 4ZTFA 4HA8A 1WJSA 3HRTA 2K2VA 1QP3A 3LWHA 2QQRA 4E7HA 1RI0A 3I56A 4Z6YA 1XNIA 1JJ2A 3CPWS 2HAXA 5CKEA 4JRPA 2DKGA 2DD4A 4GY5A 4M75A 2EQJA 5I21A 3OS0A 3OQ5A 3TW7A 2NLUA 4C0DB 4M7AD 2M1HA 1OYXA 4JUVA 5I2MA 1WGSA 1Y7XA 1FX7A 4FM4B 5GAN7 1VQLT 1VUBA 1G3TA 2VYTA 4LDVA 4BE1A 2WSEE 3HHTB 2JVVA 1WQ7A 1VQMT 3L2ZA 3S3MA 3LGLA 5A0LA 4RG8A 2DXCA 3G6ET 1YJWA 5GAOl 1E7PA 3C94A 2ZPIB 1M1KC 3CD6A 4X9DA 2DXCB 5GANf 5GAOr 1QVPA 2XKOC 2BS2A 4HNUA 2DIGA 3I55T 4N4IA 5CVIA 3M5AA 5FROA 1QVGA 3DLLA 3OB9A 1KQSS 5FU7C 4M7AF 1M8VA 3A5ZB 4C92F 3KHIA 3OMGA 4EPCA 2ZCFB 3CCRT 4LDWA 3QZ5B 2MF2A 4M75F 4A53A 2YRVA 1M1KU 3A8HB 3CBPA 5HK3A 1UEBA 2LTOA 2X4WA 4V2SA 4MDWA 4B9WA 5CKDA 3QXEB 2E65A 4LDYA 3FLGA 1JRIA 4F7UE 3VUBA 3HSBA 4M78E 3FDRA 3INZA 3FC3A 5FLXE 4RCBA 4RMOA 3V7SA 1I4K1 2LCLA 1FWZA 2IG0A 3JAME 3L2WA 4C92D 3CCMA 3JB9D 1YJ9T 4J6XA 2HBPA 2DEQA 5AYFA 4J8OA 3UWNA 3A8GB 3KXTA 3OW2A 3JCMJ 1YJWT 2RO0A 5GAOp 5GMKi 3J80E 3BG3A 4E7LA 2EKOA 3CCJA 4BE0A 2RJFA 2CZ7B 1KD1C 1VQLA 3CCLA 3MCAB 2M16A 3BG5A 3OS5A 4M78G 3RKYA 5GMKm 3PIOA 2RHXA 4M7DD 5HKCA 3OYAA 2V8KA 3G6EA 3QZ9B 4HT8A 4M7DE 4M77B 3MP8A 4OGCA 4XU1A 3WVDB 2PUOB 3MP1A 2CZ0B 4EMGA 2XDDA 1FXXA 2EWNA 5LJ3d 3G4ST 5CKFA 4M77A 4NC6A 1QP2A 4EMKB 4M7AE 1GXIE 4QW2A 2KMGA 2DIQA 1BI1A 4NOYA 4A4HA 4JX6A 4C0GA 2QEXT 4IUQA 2D0QB 2DVEA 2LNVA 1Q82U 3QHSA 1W2BA 1BI3A 2G77A 1VIFA 5DY9A 2E6ZA 4A4EA 4M78B 2DPPB 3QUIA 4PJOD 2L5QA 1V29B 2E12A 1D3BB 2PU9B 3L42A 4C5GA 2EJFA 1I81A 4BI8B 1JBMA 3MO8A 4JRIA 1Q82C 1RL2A 2DO3A 2L8DA 2JUFA 2RA2A 2ZGWA 5CQYA 4C8QC 2E64A 5CAIA 2ZZDB 5LJ5e 3QKJA 2ZPHB 2GFUA 4FU6A 3FB9A 3PTAA 3OYIA 3OA6A 1H3ZA 2EAYA 2QXFA 4PNOA 4BBRM 2DD5A 2LVMA 4AKHA 2E5QA 5HY6A 3OW2S 4R55A 5GAOq 4C8QD 2GF7A 1VQ7T 3H6ZA 4AKIA 3DLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DXB A;  3QYG B;  3VYG A;  1UGR B;  3LW5 E;  1DJ7 B;  4KT0 E;  4ZGJ B;  1QP3 A;  1PSF A;  3VYG B;  2CYZ B;  3WVE B;  2DD4 A;  3VYH B;  1IRE B;  2DD4 B;  4OB3 B;  4FM4 B;  1JB0 E;  2WSE E;  3HHT B;  2CZ1 B;  2O01 E;  2QDY B;  1AHJ B;  2DXC A;  3X28 B;  2ZPI B;  2DXC B;  2WSF E;  2ZPG B;  3QYH B;  4ZGE B;  2ZCF B;  3QZ5 B;  2WSC E;  3A8O B;  3A8H B;  3QXE B;  3A8M B;  3X24 B;  2CZ6 B;  4L6V 5;  2PVD B;  2PVO B;  4RKU E;  3A8G B;  2ZPB B;  4OB2 B;  2PUK B;  3X26 B;  2CZ7 B;  4OB1 B;  3QZ9 B;  3WVD B;  2PUO B;  2CZ0 B;  2PVG B;  1QP2 A;  1GXI E;  1PSE A;  3X20 B;  2D0Q B;  2AHJ B;  4OB0 B;  1UGQ B;  2ZPF B;  1UGS B;  2DPP B;  1V29 B;  2PU9 B;  1UGP B;  2DD5 B;  2ZZD B;  4Y28 E;  2ZPH B;  2DD5 A;  2ZZD A;  2DXB B;  4XK8 E;  3X25 B;  2ZPE B;  5L8R E;  3A8L B;  4ZGD B; 
#chains in the Genus database with same CATH topology
 2DXB A;  4C92 G;  3GF5 A;  2B9R A;  3JCM X;  1VYV A;  1N9S A;  4M78 C;  1Q7Y R;  3JRZ A;  1NJI U;  2P4R A;  1KG1 A;  4BCM D;  1VOM A;  3LH0 A;  2HMA A;  1JB0 E;  4HL4 A;  1K8A U;  3TCJ A;  2UZL B;  1U5S A;  2DZ9 A;  3CPF A;  5GAN 5;  4BCG B;  4QQ6 A;  4CI0 C;  3HP9 A;  5LJ3 g;  3DB4 A;  1Q7Y C;  3OBW A;  3I56 T;  2OAW A;  2QYZ A;  4A4F A;  2WJ9 A;  3H9N A;  4P5N A;  1QCN A;  3ZEH A;  2VWF A;  3BLR B;  2HKQ B;  3EJ1 B;  2LRQ A;  4J9E A;  3VS5 A;  1KD1 R;  4M75 E;  3M0T A;  6AT1 B;  3ASK A;  1ABO A;  4PL6 A;  1LVK A;  2QAZ A;  1CKA A;  3CC7 T;  3CD6 T;  1Q86 R;  1X69 A;  3JCM W;  4WF2 A;  2DL8 A;  3EOC B;  3HBL A;  1NE8 A;  2JMC A;  5FWC A;  2ED0 A;  2CJM B;  3QDR B;  1QKW A;  3VUZ A;  4UC4 A;  3GNF B;  3GTM S;  3M53 A;  1WZO A;  4PJL A;  2D9T A;  1YP5 A;  1QLY A;  2YDL A;  4R56 A;  4C8Q A;  1RI9 A;  4TVR A;  4OB1 B;  1OKW B;  4PJM A;  3KFV A;  1I8F A;  4JJB A;  3HO8 A;  2X1N B;  4M75 D;  5KE2 A;  3H41 A;  3CD6 Q;  3X20 B;  2RPN A;  3EFR A;  1VQK T;  1PHT A;  4ROC A;  1M90 U;  2W9Z A;  4JRQ A;  3CCL T;  2L3R A;  4HXJ A;  3OYE A;  1B34 A;  3UA7 A;  1TOV A;  3CC7 A;  2UUE B;  4Y72 B;  4RTX A;  3JV3 A;  1JSU B;  3CCS A;  4M7D B;  4F6S B;  3ZFJ A;  1GUX A;  1GCP A;  2RJE A;  3QJY A;  1OU8 A;  2RH2 A;  4MZP A;  4QVC A;  1XOV A;  1VQO A;  1PCX A;  3PE0 A;  1TUC A;  3NFC A;  1ZUU A;  4B9X A;  1VQP T;  3FEO A;  4EOS B;  1U3O A;  3QYG B;  4M75 C;  4N4H A;  3J7A F;  4KT0 E;  4M75 B;  1RAA B;  2FVU A;  1JST B;  3QBY A;  2YRC A;  1I5L A;  3JCM e;  2R5M A;  2E6N A;  3CCM T;  2RD1 A;  2NUP A;  2LDM A;  3VKH A;  2P0K A;  2RK2 A;  1MMD A;  5LJ3 j;  2L89 A;  1KFZ A;  4WCI A;  1XTD A;  2F2C A;  2KR6 A;  4XTW A;  3SD4 A;  2C5N B;  2D8J A;  2XDP A;  2K3B A;  4NL2 A;  5KYW B;  3BDU A;  1KIK A;  1WHK A;  1M2O A;  2C0T A;  3OY9 A;  3EFO A;  4GLM A;  2M0O A;  3BHT B;  1Q81 C;  5C0M A;  4HNV A;  2LQ8 A;  2QGG A;  3A8O B;  2ED1 A;  1Q81 U;  4M7A B;  2CH4 A;  5LJ3 h;  4XTX A;  5IHY A;  1IHW A;  4BI4 A;  3MET A;  4R0K A;  3NTH A;  2JXB A;  4JJN K;  1M4Z A;  3VS7 A;  4EOP B;  2HKN A;  4X9C A;  3OBY A;  1K0X A;  2WEV B;  1Q81 R;  3QII A;  2F2W A;  2LX9 A;  3GIB A;  5IDP B;  1H1Q B;  1M5Q 1;  2W96 A;  3NHN A;  4D6W A;  3AT1 B;  1JXM A;  4J9I A;  5D6X A;  2EIF A;  1AD5 A;  2GTO A;  4WTO B;  2PMI B;  1K73 U;  2FEI A;  4KH0 B;  4F7U B;  1PSE A;  1D1A A;  3GNG A;  1S72 T;  2RMO A;  1Y57 A;  3RMQ A;  5GAM g;  2JNG A;  5DM7 R;  2AHJ B;  4OB0 B;  2QG9 B;  3REA B;  5J3B A;  3G71 A;  1D3B A;  3RES A;  5A0G A;  1N8R U;  3PIP A;  1JJ2 P;  1AZG B;  3RMS A;  1ARK A;  2JGZ B;  4ZNX A;  1BYM A;  3CC4 A;  2PJQ A;  1PD1 A;  2DAQ A;  4BDY A;  2DEU A;  1UJY A;  2HL3 A;  3NTK A;  3HKS A;  2IPO B;  4IUR A;  1MMG A;  1K9M C;  4OP0 A;  1BK2 A;  3JCM h;  1JJ2 S;  3RBB B;  2RQW A;  2XID A;  4BUG A;  4KH1 B;  3L2V A;  3QO3 A;  1BKB A;  1VQ7 Q;  5I2S A;  1UE9 A;  1VQ6 T;  2DL3 A;  1B07 A;  4M77 D;  2XD0 A;  2GNC A;  2VKN A;  1PC0 A;  3S3N A;  1K9M R;  2G9X B;  1KD1 U;  2RF0 A;  3M0Q A;  2K57 A;  4F70 B;  1LPL A;  1EIF A;  3QWL A;  4RTZ A;  2O4X B;  4C92 B;  5KYU A;  2A36 A;  5ECA A;  3O8V A;  4PK4 A;  3TU4 K;  1K8A R;  2WAC A;  1G2B A;  1MV0 B;  5CKB A;  5KYW A;  2ZPG B;  1WLP B;  4BY1 X;  3QYH B;  1YJ9 A;  4YTL A;  1URC B;  1Q7Y U;  4CC7 A;  3CCE T;  2H3E B;  2DET A;  3JB9 H;  2I40 B;  3HB9 A;  1O9S A;  1NYG A;  4KUL A;  1K8A C;  2X4J A;  4M4Z A;  4ZN1 A;  4CXA B;  1ABQ A;  4DOW A;  3UF4 A;  1AOJ A;  2PVD B;  5FWB A;  5D6Y A;  2FRW A;  2LT1 A;  4BXX X;  1ACM B;  2XIC A;  4XTV A;  3L2R A;  1YIT T;  1X27 A;  3R6N A;  3OYL A;  1OL1 B;  4XU3 A;  1VYW B;  4BDZ A;  1U1S A;  2Y90 A;  3RER A;  3CMA Q;  2C0O A;  1B7T A;  4YOZ A;  2C5X B;  4BI3 A;  2K9G A;  4Z8A A;  2K3X A;  2I2L A;  4JLI A;  3EGD A;  2YT6 A;  3A1P A;  1OZ2 A;  3F70 A;  1UGQ B;  3ZL7 C;  1UGS B;  4AFU C;  2O2O A;  4PFZ A;  3DB3 A;  1G83 A;  3D7S B;  3M54 A;  1OIY B;  1R77 A;  3G7Z A;  4HVW A;  3G33 B;  4F7L B;  3KUF A;  2L2P A;  4QVZ A;  2DJQ A;  3PT9 A;  4IUT A;  2ZPE B;  4FCY A;  2BUD A;  4M75 G;  1OQK A;  1UNH D;  4Y92 A;  3I56 Q;  1D3U B;  1Y0M A;  1RI0 A;  5LQF B;  1WHM A;  2DD4 A;  1ZA1 B;  3OS0 A;  3OQ5 A;  2MIO A;  5I2M A;  4FM4 B;  4OR5 B;  1VUB A;  2VYT A;  3HHT B;  4AT1 B;  1VQM T;  1RLQ C;  2GBQ A;  3ULR B;  2BPM B;  3EFO B;  2DXC B;  1KJW A;  5GAN f;  5GAO r;  2XKO C;  4HNU A;  1T3L A;  5CVI A;  2WFY B;  4LXC A;  5FRO A;  3DLL A;  1TD6 A;  2ZCF B;  4LDW A;  2IW8 B;  4M75 F;  2H8H A;  2YRV A;  1M1K U;  2DYI A;  1C0M A;  1E6H A;  4MDW A;  1RAD B;  1K9A A;  2E65 A;  4BCJ B;  3I9Q A;  3VUB A;  1XJW B;  3INZ A;  5FLX E;  2J05 A;  1M2V B;  1PM3 A;  3JB9 D;  3UWN A;  5AYF A;  1WI7 A;  3A8G B;  2F2V A;  2LJ0 A;  2XMF A;  2C5O B;  2RO0 A;  3J80 E;  3BG3 A;  1UGV A;  4E7L A;  1GY3 B;  1MMN A;  3PVL A;  3MCA B;  3PIO A;  3RKY A;  4BCK B;  3OYA A;  1TSF A;  2V8K A;  4HT8 A;  3QZ9 B;  4OGC A;  4XU1 A;  2EGC A;  2CZ0 B;  2EWN A;  4NC6 A;  2CP5 A;  5AT1 B;  4M7A E;  4QW2 A;  4A4H A;  1RAF B;  5BNJ B;  1BI3 A;  4J9B A;  1H25 B;  2J6F A;  2LNH B;  2JS0 A;  4OMO A;  3CPW P;  2DBM A;  3QUI A;  2L5Q A;  3UA6 A;  4C5G A;  4EOR B;  3MO8 A;  2E64 A;  2ROL A;  5CAI A;  3QKJ A;  4FU6 A;  3FB9 A;  2DFU A;  2EYX A;  4LNP A;  2LVM A;  3MY5 B;  5HY6 A;  3O0G D;  3VRZ A;  1GCQ A;  2QQS A;  4J9C A;  2YUQ A;  4JS5 A;  1MUZ A;  1V76 A;  5HQ0 B;  3DOG B;  2UZE B;  2YHT A;  1XQH A;  2M51 A;  2CT3 A;  1YWO A;  2NUP B;  2FZK B;  3M4Y A;  4F6W B;  2YUO A;  5GAO m;  4XTY A;  1YN8 A;  3IQL A;  1KHC A;  4ORZ A;  4M7A G;  1G3S A;  1VIE A;  2B8A A;  2DA9 A;  3C0C A;  5HK0 A;  4M77 E;  2LCC A;  2I53 A;  2HBW A;  2VXE A;  1BU1 A;  2CP0 A;  1YI2 A;  3CMA T;  3CCJ Q;  4M6V A;  2EYQ A;  4XU0 A;  5GAM j;  3M0R A;  2E1H A;  5A2Q E;  2C4G B;  1VQ6 A;  2CDT A;  2QA4 A;  4BY7 X;  1SPK A;  5IXF A;  1PKD B;  4MDX A;  1M3B A;  4UN0 A;  1D0Z A;  1RAE B;  2KBT A;  2DL5 A;  4IMY B;  1GCQ C;  2ECZ A;  1BB9 A;  2DX1 A;  1K76 A;  2MCN A;  2V1Q A;  5GAN 6;  1ZQ1 A;  3OYH A;  1YIJ T;  4CFM B;  5DQW A;  1O75 A;  1QVF A;  3CCE Q;  2K5I A;  3PVQ A;  4TTH A;  3QWY A;  2PUK B;  3P8H A;  1QWF A;  2KRS A;  3M0P A;  5GAN 3;  4KUD K;  4HCB A;  1D1B A;  3QG1 A;  2LW4 A;  2QK0 A;  3QYB A;  3LGF A;  3NMZ C;  1AWX A;  2FZG B;  2L3Q A;  1KHI A;  1GFD A;  2QA4 T;  5CKH A;  1TH7 A;  1FKM A;  1TUG B;  2OJ2 A;  2CUB A;  4X34 A;  2DLP A;  3L2U A;  2R7G A;  5LJ3 e;  2CS7 A;  1GH6 B;  3E9G A;  1Y07 A;  2K79 A;  4M7D A;  9ATC B;  1U1T A;  1KQS A;  2XU8 A;  3PO3 S;  4MZM A;  2SRC A;  3URG A;  4BCQ D;  4LD9 K;  3EFS A;  4PJO B;  1LCK A;  1SEM A;  1YCY A;  1ZLM A;  2VV5 A;  4M78 D;  4CFX B;  3CCR Q;  3KBG A;  5FW9 A;  4JJC A;  1VQ4 A;  4GLK A;  2M02 A;  5D7U A;  2L3P A;  3OYG A;  4ROD A;  2KYB A;  5L23 A;  4ELJ A;  4PJO F;  4HCC A;  1G3Y A;  1QW1 A;  4PJJ A;  2QA4 Q;  4G6L B;  4RG2 A;  4CRL B;  4JX4 A;  4EOK B;  4II1 A;  2X35 A;  4EMH A;  5GMK e;  1Q86 C;  4A63 B;  3CCQ A;  2M0Y A;  2FG0 A;  4JS4 A;  3QPH A;  5CK9 A;  4ESR A;  3SWN A;  5FRM A;  1RAH B;  1GFC A;  4DQ2 A;  3MEW A;  2OTL Q;  2K2M A;  5GAM e;  4RTT A;  1RUW A;  4JRK A;  2VGN A;  2RM4 A;  2DM1 A;  2DME A;  3SB2 A;  4EC9 B;  4KGX B;  2IIM A;  1EX4 A;  4IUU A;  1M30 A;  2MAM A;  2FHD A;  4M77 F;  5CIU A;  5KCO A;  1UDL A;  2JN0 A;  4PKC C;  4X1V A;  5IT9 E;  2DF6 A;  2JTF A;  1C1A A;  2DXU A;  4MFD A;  3CME T;  2DER A;  1WHL A;  2QQ8 A;  4PJO E;  2KXC A;  4FYY B;  1WNL A;  1EFN A;  1BCO A;  4EON B;  3AHU A;  4PLL A;  2UZB B;  2NYS A;  3VS3 A;  2FL7 A;  1B34 B;  4LUE A;  2DL7 A;  3JCM V;  4J9D A;  2K5F A;  4C8Q E;  2RI3 A;  5DQV A;  4RTY A;  2G6F X;  4DEY A;  3CMA A;  1YI2 T;  4Y28 E;  1G3N C;  4MFE A;  2LT4 A;  5KH6 A;  2JMA A;  2OX7 A;  1S72 Q;  1D09 B;  3ME9 A;  5LJ5 f;  2DXB B;  3X25 B;  5GAN e;  1W6X A;  1JQQ A;  2DXT A;  2V22 B;  3RDV A;  2DTO A;  1KQ1 A;  1T0J A;  3OS1 A;  2LQW A;  3CCU Q;  2BKZ B;  3QDF A;  2ENM A;  3VS0 A;  4EOO B;  4JPB W;  2PNI A;  2PQW A;  4E2F B;  3GLX A;  3OMC A;  2KXD A;  2OTJ Q;  3JCM f;  3PMI A;  1W4S A;  2QEX A;  4C0F A;  3M0S A;  2EQM A;  4IIO A;  4O6J A;  2JOY A;  2XG8 D;  2C0I A;  3TRE A;  2CP2 A;  3SDZ A;  3P8B B;  3V8K A;  2F69 A;  4XQ3 A;  1SG5 A;  3BG9 A;  1MND A;  2PTK A;  4NST B;  1QMZ B;  1VQ5 Q;  4BCN D;  3BLH B;  1H64 1;  1VQ8 T;  4C8Q G;  4FSX A;  1ZBJ A;  5KYY A;  4N0A A;  1WIE A;  1PRM C;  3JB9 J;  1WFW A;  2DE0 X;  1H24 B;  3TSW A;  4J6Y A;  4ATO A;  5EG2 A;  1I0C A;  3E9F A;  2YUN A;  2K3Y A;  2PVO B;  1QLB A;  1VQ9 T;  3HRS A;  2BE7 D;  4KUI A;  5GJV B;  5GAO n;  1AT1 B;  4J5Y A;  4BCN B;  2M9U A;  5GAN 2;  3G71 T;  3X26 B;  3QYE A;  2ROT A;  1FMV A;  1U06 A;  3FJ5 A;  4QVD A;  1R0B G;  4EMK A;  2IN3 A;  1PD0 A;  4AMC A;  1WJR A;  2A3L A;  1RAG B;  2QF7 A;  1QCF A;  4QQG A;  3CCU A;  3H8Z A;  3EGX B;  4OGE A;  1JOW A;  2GQV A;  4E7I A;  3SWN C;  5L2W B;  1WHG A;  2OTJ A;  2YSQ A;  4OGR B;  2COZ A;  1KQ2 A;  2RHI A;  4PFO A;  1N27 A;  1MNE A;  4F7S B;  2HDA A;  1YHQ Q;  4RCC A;  1NG2 A;  4PLI A;  5GAN j;  2LQN A;  2LJ3 A;  2OTL T;  4BBS M;  2WHB B;  3RIR A;  4AG2 C;  3JB9 F;  4C92 E;  4D8K A;  3TNH B;  4ZGD B;  1LNX A;  1YCS B;  1AD6 A;  5C6S A;  4XTZ A;  1UGR B;  1WXB A;  4C8Q F;  2KY9 A;  3LW5 E;  4ZTF A;  3HRT A;  4E7H A;  4F17 A;  4FX3 B;  2CCH B;  4LUD A;  1M1K R;  3EG9 B;  3EHR A;  4C0D B;  4M7A D;  1OYX A;  3CCV Q;  4JUV A;  2AZV A;  1WGS A;  1Y7X A;  2CUD A;  2A0F B;  2O9V A;  1G3T A;  4OML A;  4BE1 A;  2CSI A;  3L2Z A;  1X6G A;  3M0U A;  3G6E T;  2AZS A;  2ZPI B;  1M1K C;  1UFF A;  1JXO A;  1OEB A;  1VQ4 Q;  1TFB A;  3I55 T;  1OU9 A;  1KQS S;  1M8V A;  2PK2 A;  3KHI A;  1SHG A;  2KT8 A;  1GBQ A;  1WXU A;  1GBR A;  2YUP A;  1UEB A;  2FPD A;  4V2S A;  4B9W A;  5CKD A;  3CCQ Q;  2BTT A;  2FPE A;  2EVR A;  1OV3 A;  4M78 E;  5KYN A;  3FDR A;  1YFN A;  4RMO A;  4RCB A;  4J9H A;  1I4K 1;  4K11 A;  2IG0 A;  5CYI B;  1WXT A;  2D0N A;  1YJ9 T;  4J8O A;  3JCM J;  1W1F A;  4BCH B;  1YJW T;  5GAO p;  3CCJ A;  4BE0 A;  2CZ7 B;  5GMK m;  8AT1 B;  1ZSZ C;  4M7D D;  4M7D E;  1ZSZ B;  3WVD B;  2AKL A;  2E5K A;  1FXX A;  3MKD A;  1VIN A;  4EMK B;  1ZA2 B;  1Q82 R;  2DIQ A;  4GBQ A;  1BI1 A;  4C0G A;  4JX6 A;  1NBE B;  2QEX T;  2D0Q B;  2DVE A;  3QHS A;  1TUD A;  3MJX A;  4M78 B;  1Q95 G;  4PJO D;  1V29 B;  3L42 A;  4BCQ B;  2PU9 B;  2WMB B;  1I81 A;  4BI8 B;  1JBM A;  1H3H A;  1Q82 C;  1IGQ A;  2RA2 A;  2ZGW A;  4OMN A;  2JUF A;  4C8Q C;  2C6T B;  2ZZD B;  2HSE B;  2GFU A;  3PTA A;  3REB B;  2HSP A;  1UTI A;  4CC2 A;  2DD5 A;  3CXC P;  2E5Q A;  2GF7 A;  3DLM A;  2DL4 A;  1UG1 A;  2PZ1 A;  1H1S B;  2KE9 A;  3M9Q A;  3P8D A;  2HD0 A;  2RHU A;  1DJ7 B;  4MMK A;  4Z88 A;  3WXM B;  2E41 A;  1E6G A;  3L1A A;  5IHK A;  3VYG B;  3PGG A;  1R8O B;  5FU6 B;  2IVX A;  1QWE A;  2JS2 A;  3M55 A;  1VQ8 Q;  4HKE A;  4E47 A;  3CXC S;  4BD3 A;  3K7A M;  3EG3 A;  1S72 A;  4BCO B;  2IW9 B;  2E3H A;  4IIM A;  3T9N A;  2CZ1 B;  3CXC A;  4OF1 A;  2O01 E;  4Q5W A;  2QTX A;  4ZTJ A;  1M27 C;  3PMT A;  2KRM A;  1YI2 Q;  2K5L A;  5HCK A;  3OYK A;  3NTI A;  3GOX A;  3ER0 A;  2A28 A;  1HXD A;  2W99 A;  4RTW A;  3CCU T;  4F04 B;  4C5E A;  1VQN A;  1X6B A;  2BS3 A;  1NLO C;  4FL6 A;  4C0Z A;  1QVF S;  3OS2 A;  1I5O B;  2ESW A;  4ROE A;  4AI6 A;  3X24 B;  1D0Y A;  4M78 F;  1M2V A;  2BIV A;  1NPR A;  2W2H A;  4C5H A;  3OYD A;  1WPY A;  4L5G A;  2MOX A;  3H0I A;  3HL8 A;  1PWT A;  2EQI A;  4JLG A;  5GMK h;  1N8R R;  2PVG B;  1N9R A;  2RI2 A;  2COW A;  1TWB A;  3QHW B;  1KC8 C;  4F7U A;  1SRL A;  2C06 A;  1K9M U;  1QKX A;  2GCX A;  1M1F A;  4CC3 A;  2ZPF B;  5KYX A;  2H3J A;  1V1C A;  1N8R C;  4EDU A;  3CC7 Q;  5FU7 B;  3JCM c;  4MIM A;  1H1P B;  1YIJ Q;  5GMK j;  2C5V B;  1AWW A;  2DJZ A;  1KC8 R;  2MWP A;  4J7I A;  3CC2 Q;  4BCF B;  2P0P A;  1MV3 A;  2DTH A;  2HQX A;  3FIF A;  1AWJ A;  5IDN B;  4XU2 A;  1VQP Q;  8ATC B;  2ZZD A;  1MHN A;  3J81 E;  2UZD B;  1B3Q A;  2DNU A;  2VXF A;  3MI9 B;  1VQO Q;  3BLQ B;  2MWO A;  2QTV A;  1NYF A;  3CCR A;  1SSF A;  2JM8 A;  4ZGJ B;  4C5I A;  1OPK A;  1PSF A;  1W70 A;  2KVQ G;  3SFM A;  3VJP A;  5GMK l;  5FGK B;  2EBP A;  2Z0W A;  3CC2 T;  2JJ9 A;  2KQW A;  1YBY A;  2RHY A;  3EH1 A;  1RAI B;  1BIB A;  5IH2 A;  1K73 R;  3RGF B;  3O5Z A;  2MK5 A;  4IUP A;  5FRN A;  3R6O A;  2BKD N;  4OMM A;  3HPW A;  1TS9 A;  4HT9 A;  1K1Z A;  2GTJ A;  1NEB A;  3C4S A;  1T0H A;  5J39 A;  1VQO T;  4C0D C;  2EJG A;  3SWN B;  3JCM g;  1X2K A;  3JSC A;  4LOC A;  3H4C A;  4F7U F;  2EYW A;  1MGQ A;  5GAN 8;  2YLC A;  3G4S Q;  3HTR A;  2VGM A;  4AKG A;  3BHU B;  3C95 A;  5LJ5 g;  2QEX Q;  3A8M B;  3EHQ A;  3LYI A;  2J7I A;  2QFZ A;  1NZ9 A;  2K6D A;  1OI1 A;  2X4Y A;  2P4T A;  2CRE A;  2IW6 B;  2RJD A;  1UJ0 A;  3TNI B;  4EOL B;  1ZSG A;  1ZSZ A;  2E3I A;  2DVJ A;  1G8X A;  3OYJ A;  4I3Z B;  2W0Z A;  5DLQ E;  1WX6 A;  1A0N B;  1LOJ A;  1M90 R;  4E7S A;  3RKX A;  2P0Q A;  3OYY A;  2PHG A;  3EGX A;  2RNA A;  1NPP A;  2D8H A;  3EGD B;  2B86 A;  2FYK A;  4J9G A;  3RNJ A;  2F1L A;  1H27 B;  3G71 Q;  3FRN A;  4PJO G;  4EMK C;  2YRD A;  1KXU A;  2QDL A;  4J6W A;  1M90 C;  2EPD A;  3DL1 A;  3TSZ A;  3JCM d;  1AEY A;  4EOI B;  2O31 A;  3OSS C;  2YWW A;  3EH2 A;  4AFS C;  1IXD A;  3BFM A;  1FIN B;  1LJO A;  1KC8 U;  1VQ7 A;  3MIA B;  3VYG A;  3CCE A;  1VQ5 T;  3QJ6 A;  3EG9 A;  3QHR B;  3MHX A;  4LE9 A;  1ZHI A;  2F2X A;  1RAB B;  1WQW A;  4A54 A;  2LCS A;  2W9F A;  5HBH B;  2KK4 A;  5IAY A;  3JB9 G;  3VYH B;  1MMA A;  2ATC B;  5GAM f;  3DDQ B;  2DD4 B;  4A4K A;  4PJN A;  4E7K A;  1U8R A;  1PG5 B;  3A98 A;  4QT7 A;  1O9K A;  4HCZ A;  3CC4 T;  1KK7 A;  2JT4 A;  2QDY B;  4CFN B;  5LL6 S;  1J3T A;  4FT4 A;  5CO7 A;  1TG0 A;  5KE3 A;  4OVA A;  2W10 A;  4A4G A;  2CGH A;  3HZJ A;  4ZGE B;  2D6F A;  2EQU A;  3SEM A;  3I35 A;  3TVT A;  3MP6 A;  4OMQ A;  1I1J A;  4KGZ B;  1W2B S;  5HBJ B;  4F7J B;  2OAU A;  3VS6 A;  2WPA B;  1Z9Z A;  1UB4 A;  1Z9Q A;  3EG2 A;  4D8D A;  2JTE A;  4YOO A;  2CZ6 B;  4JX5 A;  4RUG A;  4L6V 5;  2DK3 A;  3MEA A;  5IF1 B;  5HVY B;  3LLR A;  3CBO A;  2HQH A;  5LJ5 h;  1NJI C;  4VUB A;  4FIB A;  3E19 A;  4PFP A;  2EW3 A;  3S3O A;  3JCM Q;  2MMP A;  1VQ9 Q;  2AIR B;  3I55 Q;  4YOS A;  1S1N A;  5LJ5 j;  3S6W A;  2DBK A;  1BI0 A;  1IZ6 A;  1M9S A;  2MPX C;  1HYO A;  2E70 A;  4F16 A;  3FJP A;  1OX9 A;  4DBF A;  3OW2 P;  1UGP B;  2QQA A;  4Z89 A;  2DD5 B;  2V8J A;  1Y96 B;  1I07 A;  3EAE A;  2LZ6 B;  4ELZ C;  1PKS A;  3C12 A;  3VV0 A;  2CP7 A;  4KRC B;  4PJO A;  1PNJ A;  4OMP A;  2HQE A;  2EYY A;  1VQ4 T;  1E9H B;  3V7R A;  4CFW B;  1G5V A;  4AG1 C;  4HA8 A;  1WJS A;  3LWH A;  1QP3 A;  4EC8 B;  3I56 A;  3EG1 A;  4JRP A;  5HNB B;  4M75 A;  4GY5 A;  2EQJ A;  5I21 A;  3TW7 A;  1WYX A;  1AWO A;  2LMJ A;  1FX7 A;  5GAN 7;  2WSE E;  2JVV A;  1WQ7 A;  1OGU B;  3LGL A;  1VYT A;  1JKW A;  3CD6 A;  4X9D A;  1QVP A;  2BS2 A;  2WIP B;  2NUT A;  3M5A A;  3OB9 A;  4M7A F;  5FU7 C;  3NDQ A;  3A5Z B;  4AFQ C;  4EPC A;  3CCR T;  3QZ5 B;  1WA7 A;  3A8H B;  3CBP A;  2LTO A;  2X4W A;  1TTH B;  3CCS Q;  2BZX A;  4F14 A;  1JRI A;  4F7U E;  1JO8 A;  2RQR A;  1YJN Q;  2CSQ A;  2LCL A;  3L2W A;  1FWZ A;  4J6X A;  2HBP A;  2DEQ A;  1X43 A;  3F5X B;  3OW2 A;  1SHF A;  3CCL A;  1KD1 C;  1VYU A;  2RJF A;  3I5R A;  3BG5 A;  3OS5 A;  4M78 G;  1QVG P;  4JJD A;  2RHX A;  5HKC A;  3MP8 A;  3MP1 A;  3VRY A;  5CKF A;  1GXI E;  4IUQ A;  4ELL A;  2G77 A;  2E6Z A;  2EGA A;  2VAS A;  1YJ9 Q;  2RQV A;  1KQS P;  3RR6 A;  2E12 A;  1D3B B;  2X51 A;  2EJF A;  2DRM A;  1EZZ B;  3VS2 A;  2DO3 A;  5CQY A;  2RQU A;  4KRT A;  5LJ5 e;  1H3Z A;  2EAY A;  2QXF A;  4PNO A;  2O88 A;  4AKH A;  2PK9 B;  4FSS A;  1W98 B;  3I5S A;  4C8Q D;  5I22 A;  4AKI A;  1OKV B;  2EGE A;  2RB6 A;  1FYN A;  2SEM A;  2YXY A;  4BY6 B;  4EIK A;  4ELY C;  4AFZ C;  2QGF B;  2HL5 C;  1FMW A;  1IGU A;  1W2B P;  1G3W A;  1HK9 A;  5FU6 C;  5IHN A;  1VOL A;  2P84 A;  1GRI A;  1XO2 A;  2KR3 A;  1YIJ A;  1YHQ T;  3LH5 A;  1O9K B;  1NLP C;  4OB3 B;  3MEV A;  1QMC A;  4HNT A;  1VQP A;  2O9S A;  4FYV B;  3GPL A;  3M58 A;  4QSH A;  1C6V X;  2O4X A;  2VB6 A;  4C92 A;  1K4U S;  2RJC A;  1BI2 A;  2JM9 A;  2J6O A;  1UHC A;  3HRU A;  1RAC B;  2ABL A;  1UUE A;  4BAC A;  4M7D C;  1JEG A;  2R57 A;  2EFI A;  4F7N B;  4FYW B;  3OYN A;  3TQ7 P;  1VQ6 Q;  3CCJ T;  2CP6 A;  1HD3 A;  4EOM B;  1TXQ A;  3PFS A;  4E6R A;  5ACB A;  4CFV B;  2Y4X A;  2HCK A;  3U23 A;  1UHF A;  3I55 A;  4F7U G;  3H0F A;  1N6A A;  4RKU E;  3M57 A;  4BCP B;  4C8Q B;  1ZX6 A;  3DKM A;  1H26 B;  4KRD B;  5GAM d;  5ICP B;  4IKF A;  2V1R A;  3CCV A;  2X4X A;  4NL3 A;  1VQK Q;  2RN8 A;  1AIS B;  2BZ8 A;  4MML A;  4BCM B;  2XHC A;  1K0S A;  2KEA A;  3OYB A;  2FRY A;  5M9O A;  3DTO A;  2DMO A;  2QDJ A;  3B57 A;  4ME7 A;  4J9F A;  4M78 A;  2HNI A;  2F5K A;  1WHJ A;  1OZ3 A;  3HFN A;  2KNB B;  2A7Y A;  1VQ5 A;  1VQM Q;  4XTU A;  4DBR A;  2CT4 A;  5KYX B;  3GP8 A;  5GAM h;  2MYS A;  1VQ9 A;  2NWM A;  3MPU B;  3ZBD A;  5A0D A;  2OI3 A;  2V26 A;  1N5Z A;  4M7D F;  2LJ1 A;  2R5A A;  3BW1 A;  5J26 A;  2XDB A;  1QQJ A;  2KT1 A;  5L8R E;  4HCK A;  4C92 C;  4BE2 A;  2GFA A;  4CRI A;  2ZAE A;  3EG0 A;  3CCV T;  4DOV A;  4FW1 A;  2E4H A;  3JCM b;  2YLB A;  3NGP A;  1PKT A;  3WVE B;  1D1C A;  2GQI A;  1QVF P;  1UNL D;  2XI9 A;  4M77 C;  5IHI A;  3SHW A;  1VQN T;  2X9H A;  1X2Q A;  5HBE B;  4RTV A;  1P92 A;  4N4G A;  2JTM A;  3X28 B;  1H8K A;  5GAN g;  4LN2 A;  3E2U A;  2RHZ A;  5LJ3 f;  3OYC A;  1IO6 A;  1YJN A;  5EC7 A;  2DTI A;  2WSF E;  2BS4 A;  3CCM Q;  4M7D G;  1D0X A;  4L59 A;  1P5E B;  3UPU A;  2OTL A;  1VA7 A;  3G4S A;  3E1S A;  3CME Q;  3CCL Q;  1VQL Q;  3RUX A;  1Q86 U;  2J6K A;  3G6E Q;  2KDS A;  5DLO A;  1YJW Q;  1BIA A;  4IUV A;  2CH4 W;  3LX7 A;  2EQK A;  2EKH A;  1IRX A;  3HFO A;  2X3X D;  2JW4 A;  1VQM A;  2V8I A;  3CCQ T;  2ZPB B;  4DEX A;  4LDU A;  3NPF A;  1YJN T;  2XK0 A;  1IB8 A;  2D1X A;  4MZT A;  2E10 A;  4KBM B;  2KRN A;  4LD6 A;  2IVW A;  4HVV A;  4KGV B;  1GL5 A;  3DDP B;  3CCS T;  2DRK A;  4DBH A;  1M3C A;  4M7A C;  3BDL A;  7AT1 B;  1AZE A;  2VVK A;  2FZC B;  1ZUY A;  2BE9 B;  5IXB A;  2EUF A;  1CKB A;  1NEG A;  2F5T X;  1R0C B;  4ANJ A;  2AKK A;  2FO0 A;  2KSS A;  3RKW A;  4BB7 A;  5GAN 4;  1YIT Q;  1OL2 B;  5GAN d;  1X01 A;  4XAX B;  4OMF B;  2RK1 A;  4FYX B;  2KAF A;  4Z02 A;  2CCI B;  1OX8 A;  4O5V A;  5KCH A;  3JB9 I;  3M56 A;  1RLP C;  1UEC A;  3CBM A;  2KMT A;  3VS1 A;  4J7F A;  3UDC A;  2QQB A;  2Y4Y A;  4LDX A;  4HLQ A;  2LP5 A;  1K73 C;  3BY7 A;  2R58 A;  3A8L B;  1TU0 B;  2KRO A;  5CEI B;  5CQX A;  3OYM A;  2I0N A;  1WJQ A;  4FT2 A;  4EOQ B;  3V8J A;  5I11 A;  2CYZ B;  3CME A;  2EJ9 A;  1SRM A;  3N5B B;  1SSH A;  3MY1 B;  2LC4 A;  1QCO A;  3TN8 B;  4CFU B;  1IRE B;  4CC4 B;  3JCM P;  2KI7 A;  4YC3 B;  2K7A A;  2COY A;  2J06 A;  4DA4 A;  1OIU B;  1Y71 A;  1ZP2 A;  2G3R A;  2QGS A;  2L0A A;  1AHJ B;  3UT1 A;  2FB7 A;  1UNG D;  4BY6 C;  5D6W A;  3VKG A;  5CCA A;  2FPF A;  2DZC A;  4PJO C;  3V8L A;  5LMK B;  3Q1J A;  2BZY A;  3CC2 A;  2QI2 A;  3TEE A;  2WSC E;  3OSV A;  5CR2 A;  3QWX X;  5GAN h;  4JDS A;  1OPL A;  3MEU A;  4E7J A;  1KSW A;  3OYF A;  1VQK A;  4M7A A;  5IN1 A;  3VKI A;  3VU3 C;  3PNW C;  1X75 C;  4ZN3 A;  4B6M A;  2CKK A;  2K4Y A;  4N0A C;  3CEY A;  1YIT A;  2OTJ T;  3M03 A;  4JZ3 A;  2JZ2 A;  2RI5 A;  2AK5 A;  4OB2 B;  3CC4 Q;  2A37 A;  2VUB A;  5LJ5 d;  3CPW A;  1ZBX A;  1OOT A;  1X6O A;  2MI6 A;  1VQ8 A;  1BU2 A;  4NS5 A;  4J83 A;  1M1G A;  3LWI A;  4Y91 A;  1SKU B;  4CFU D;  1HJD A;  3EID B;  2VC8 A;  1T3S A;  2L3S A;  4QQD A;  3M4G A;  1QVG S;  4E7Z A;  4M77 G;  5GJW B;  3V7C A;  4II5 B;  1H4L D;  3VS4 A;  3QSU A;  1VQN Q;  3TW6 A;  1YHQ A;  4JZ4 A;  2LX7 A;  2RQT A;  1Y96 A;  3DJB A;  1YWP A;  4XK8 E;  1PRL C;  3UAT A;  5EJC A;  2HZY A;  3M59 A;  2QQ9 A;  4EOJ B;  2LQK A;  4FW2 A;  2K2V A;  2QQR A;  4Z6Y A;  1FVV B;  1XNI A;  2AT1 B;  3CPW S;  2EYZ A;  5CKE A;  1JJ2 A;  2HAX A;  2DKG A;  1WDX A;  2QAS A;  2NLU A;  3EGU A;  2M1H A;  1N4M A;  2KYM A;  1OI9 B;  1BCM A;  1VQL T;  4LDV A;  3GBQ A;  3S3M A;  5A0L A;  1NM7 A;  2A08 A;  4RG8 A;  2DXC A;  1YJW A;  5GAO l;  1E7P A;  3POM A;  3C94 A;  1OUL A;  5KYU B;  1WHH A;  2CP3 A;  2DIG A;  4QKU A;  1CSK A;  5KYY B;  4N4I A;  1QVG A;  1ENW A;  4C92 F;  1NJI R;  3OMG A;  1AVZ C;  2NUT B;  1F1B B;  1HSQ A;  2MF2 A;  4A53 A;  1SF9 A;  5HK3 A;  3THK A;  1H92 A;  1IHV A;  3CQT A;  1H1R B;  3QXE B;  4LDY A;  3BE3 A;  2DIL A;  2HEQ A;  1C9B A;  3FLG A;  3G1J A;  4BCI B;  3HSB A;  2DYB A;  3FC3 A;  3V7S A;  3JAM E;  4C92 D;  3CCM A;  3KXT A;  1YNZ A;  1JU5 C;  4F6U B;  1E7O A;  5GMK i;  2EKO A;  5EFQ B;  1VQL A;  2WMA B;  2M16 A;  3H0H A;  3G6E A;  4M77 B;  2PUO B;  2KGT A;  4EMG A;  2XDD A;  2GGR A;  5LJ3 d;  3G4S T;  1M8M A;  4M77 A;  1QP2 A;  1F5Q B;  5I5Z B;  4DBQ A;  2KMG A;  4NOY A;  1M3A A;  2LNV A;  1Q82 U;  1W2B A;  3BHV B;  1VIF A;  5DY9 A;  4A4E A;  2DPP B;  1FMK A;  1ZUK A;  2WXV B;  2WIH B;  3LQ5 B;  1GUX B;  2NUZ A;  4JRI A;  1BBZ A;  4HVU A;  1RL2 A;  3L2Q A;  2L8D A;  4RTU A;  2X3W D;  2ZPH B;  3OYI A;  3OA6 A;  4BBR M;  3OW2 S;  4R55 A;  1H28 B;  5GAO q;  1VQ7 T;  3TNW B;  3H6Z A; 
#chains in the Genus database with same CATH homology
 2QQS A;  2DXB A;  2RB6 A;  3M9Q A;  3P8D A;  2HD0 A;  4JS5 A;  4C92 G;  2RHU A;  3GF5 A;  1DJ7 B;  4MMK A;  4BY6 B;  3WXM B;  4ELY C;  3JCM X;  2E41 A;  1K8A U;  2YHT A;  1XQH A;  3L1A A;  3VYG B;  1G3W A;  1HK9 A;  3PGG A;  1N9S A;  1R8O B;  5FU6 C;  5FU6 B;  3M4Y A;  4M78 C;  3M55 A;  4HKE A;  4E47 A;  5GAO m;  3JRZ A;  4BD3 A;  3CXC S;  4XTY A;  1YHQ T;  1YIJ A;  1S72 A;  1NJI U;  4OB3 B;  1KHC A;  1KG1 A;  4M7A G;  3MEV A;  3LH0 A;  1JB0 E;  1G3S A;  4HL4 A;  3T9N A;  2CZ1 B;  4HNT A;  1VIE A;  2B8A A;  4OF1 A;  3CXC A;  2O01 E;  4QSH A;  3M58 A;  2DZ9 A;  3TCJ A;  3GPL A;  3CPF A;  4M77 E;  2LCC A;  2QTX A;  4Q5W A;  5HK0 A;  5GAN 5;  2VXE A;  4QQ6 A;  4CI0 C;  4ZTJ A;  3HP9 A;  5LJ3 g;  2O4X A;  4C92 A;  3DB4 A;  3PMT A;  2RJC A;  1BI2 A;  1Q7Y C;  3OBW A;  3I56 T;  2K5L A;  3HRU A;  4A4F A;  3OYK A;  2WJ9 A;  4BAC A;  4M7D C;  3NTI A;  3GOX A;  1YI2 A;  4M6V A;  4P5N A;  2EYQ A;  4XU0 A;  5GAM j;  3ER0 A;  3CMA T;  3ZEH A;  2R57 A;  1HXD A;  2EFI A;  2LRQ A;  3OYN A;  2E1H A;  5A2Q E;  3CCU T;  4C5E A;  4M75 E;  1VQN A;  3CCJ T;  2BS3 A;  4FL6 A;  4C0Z A;  1VQ6 A;  1QVF S;  3ASK A;  3OS2 A;  4PL6 A;  1VQP A;  2QA4 A;  3PFS A;  4AI6 A;  3CC7 T;  3X24 B;  3CD6 T;  4MDX A;  2Y4X A;  3JCM W;  4M78 F;  4WF2 A;  3HBL A;  1NE8 A;  2BIV A;  3I55 A;  4F7U G;  1NPR A;  3QDR B;  1N6A A;  5GAN 6;  4RKU E;  1ZQ1 A;  3M57 A;  4UC4 A;  3GNF B;  3VUZ A;  4C5H A;  3OYH A;  4C8Q B;  1YIJ T;  1QVF A;  1O75 A;  3M53 A;  2K5I A;  3DKM A;  2D9T A;  5GAM d;  3OYD A;  2PUK B;  3P8H A;  1WPY A;  4C8Q A;  4R56 A;  4L5G A;  4TVR A;  4IKF A;  5GAN 3;  4KUD K;  4OB1 B;  4HCB A;  3CCV A;  2X4X A;  3HL8 A;  3QG1 A;  4NL3 A;  1VQ9 T;  3QYB A;  1I8F A;  4JLG A;  3LGF A;  4MML A;  2XHC A;  5GMK h;  2PVG B;  1N9R A;  3HO8 A;  2RI2 A;  4M75 D;  5KE2 A;  1KHI A;  3OYB A;  5M9O A;  3X20 B;  2QDJ A;  4ME7 A;  1KC8 C;  4F7U A;  2C06 A;  3EFR A;  4M78 A;  2HNI A;  1K9M U;  1VQK T;  2QA4 T;  2F5K A;  1M90 U;  2GCX A;  1M1F A;  5CKH A;  4JRQ A;  2ZPF B;  1OZ3 A;  1TH7 A;  1FKM A;  2H3J A;  2L3R A;  3HFN A;  3CCL T;  3OYE A;  2A7Y A;  1N8R C;  4EDU A;  1VQ5 A;  4XTU A;  4X34 A;  5FU7 B;  1B34 A;  3L2U A;  3JCM c;  4MIM A;  5LJ3 e;  3GP8 A;  2CS7 A;  5GMK j;  3CC7 A;  3E9G A;  2DJZ A;  1Y07 A;  2MWP A;  4J7I A;  5GAM h;  3CCS A;  4M7D B;  2P0P A;  3ZFJ A;  1VQ9 A;  2DTH A;  2HQX A;  3ZBD A;  3FIF A;  5A0D A;  4XU2 A;  2RJE A;  4M7D A;  1U1T A;  3QJY A;  1KQS A;  4M7D F;  2ZZD A;  2R5A A;  3BW1 A;  5J26 A;  1MHN A;  3J81 E;  2RH2 A;  4MZP A;  2XDB A;  2XU8 A;  5L8R E;  4QVC A;  1XOV A;  1VQO A;  2VXF A;  4MZM A;  4C92 C;  3NFC A;  3URG A;  4BE2 A;  2GFA A;  4B9X A;  4CRI A;  3EFS A;  3FEO A;  1VQP T;  4LD9 K;  2MWO A;  4PJO B;  3QYG B;  4M75 C;  3CCR A;  4N4H A;  3CCV T;  1YCY A;  3J7A F;  2VV5 A;  4M78 D;  4DOV A;  4KT0 E;  1SSF A;  3KBG A;  4M75 B;  4ZGJ B;  3JCM b;  4C5I A;  1VQ4 A;  1PSF A;  4GLK A;  2FVU A;  2YLB A;  2KVQ G;  3QBY A;  3WVE B;  1I5L A;  3JCM e;  2R5M A;  3SFM A;  3VJP A;  2E6N A;  3OYG A;  3CCM T;  5GMK l;  4ELJ A;  2RD1 A;  2XI9 A;  4PJO F;  2LDM A;  3CC2 T;  4HCC A;  1G3Y A;  1QW1 A;  2KQW A;  3VKH A;  2P0K A;  4M77 C;  1YBY A;  4RG2 A;  2RHY A;  1VQN T;  4JX4 A;  2RK2 A;  1P92 A;  1BIB A;  4N4G A;  5LJ3 j;  2L89 A;  4II1 A;  2X35 A;  4EMH A;  5GMK e;  1XTD A;  2JTM A;  4IUP A;  1Q86 C;  5FRN A;  2KR6 A;  4XTW A;  3R6O A;  3X28 B;  2BKD N;  5GAN g;  3HPW A;  3SD4 A;  3CCQ A;  4HT9 A;  4JS4 A;  2XDP A;  3QPH A;  5CK9 A;  2RHZ A;  5LJ3 f;  4NL2 A;  3OYC A;  3BDU A;  1YJN A;  3C4S A;  3SWN A;  5FRM A;  2DTI A;  5J39 A;  4DQ2 A;  2WSF E;  2BS4 A;  1VQO T;  3OY9 A;  4M7D G;  4C0D C;  3MEW A;  2EJG A;  4L59 A;  3SWN B;  3JCM g;  3UPU A;  2M0O A;  3JSC A;  4LOC A;  1Q81 C;  5C0M A;  4HNV A;  2OTL A;  3H4C A;  5GAM e;  3G4S A;  2LQ8 A;  3E1S A;  4F7U F;  3A8O B;  1Q81 U;  1MGQ A;  4M7A B;  5GAN 8;  2YLC A;  5LJ3 h;  3RUX A;  2VGM A;  4AKG A;  4JRK A;  4XTX A;  2VGN A;  1Q86 U;  3C95 A;  3MET A;  4BI4 A;  3NTH A;  2RM4 A;  3L2Q A;  4JJN K;  1M4Z A;  2KDS A;  5LJ5 g;  3A8M B;  3SB2 A;  3LYI A;  5DLO A;  4X9C A;  2QFZ A;  1BIA A;  1NZ9 A;  3OBY A;  4IUV A;  3LX7 A;  2EQK A;  1OI1 A;  3QII A;  4IUU A;  2X4Y A;  3HFO A;  2MAM A;  2FHD A;  4M77 F;  5CIU A;  2LX9 A;  3GIB A;  5KCO A;  2P4T A;  1VQM A;  2V8I A;  1M5Q 1;  2JN0 A;  4PKC C;  3CCQ T;  2ZPB B;  4D6W A;  5IT9 E;  2RJD A;  4LDU A;  2JTF A;  1YJN T;  5D6X A;  2XK0 A;  2EIF A;  2DXU A;  4MZT A;  2E10 A;  4KBM B;  4LD6 A;  2IVW A;  3OYJ A;  4MFD A;  5DLQ E;  3CCS T;  3CME T;  1K73 U;  2QQ8 A;  4PJO E;  4M7A C;  3BDL A;  1LOJ A;  4F7U B;  1WNL A;  1PSE A;  3RKX A;  2P0Q A;  3GNG A;  1S72 T;  3OYY A;  2F5T X;  3RMQ A;  5GAM g;  2JNG A;  3AHU A;  4PLL A;  5DM7 R;  2KSS A;  1NPP A;  2AHJ B;  4OB0 B;  2FYK A;  3RKW A;  4BB7 A;  5GAN 4;  5J3B A;  2FL7 A;  1B34 B;  3G71 A;  1D3B A;  3RES A;  1X01 A;  5A0G A;  5GAN d;  1N8R U;  4XAX B;  3PIP A;  4OMF B;  2RK1 A;  3FRN A;  2KAF A;  4PJO G;  4EMK C;  4Z02 A;  1M90 C;  4O5V A;  4J6W A;  3RMS A;  3JCM V;  5KCH A;  3JB9 I;  2K5F A;  3M56 A;  3CC4 A;  1BYM A;  4C8Q E;  2RI3 A;  3DL1 A;  2DAQ A;  3CBM A;  2KMT A;  3JCM d;  3CMA A;  4Y28 E;  4BDY A;  1YI2 T;  4J7F A;  4MFE A;  2QQB A;  2LT4 A;  3UDC A;  2Y4Y A;  3HKS A;  3NTK A;  5KH6 A;  3OSS C;  4IUR A;  3ME9 A;  4LDX A;  4HLQ A;  5LJ5 f;  2DXB B;  3BY7 A;  1K73 C;  3X25 B;  3BFM A;  5GAN e;  1K9M C;  4OP0 A;  1LJO A;  2R58 A;  3A8L B;  1KC8 U;  2DXT A;  3JCM h;  2DTO A;  1JJ2 S;  1VQ7 A;  2XID A;  5CQX A;  4BUG A;  3OYM A;  3VYG A;  3L2V A;  3CCE A;  1KQ1 A;  3QO3 A;  1VQ5 T;  1BKB A;  3QJ6 A;  5I2S A;  1WJQ A;  3OS1 A;  1VQ6 T;  4FT2 A;  3V8J A;  3MHX A;  1ZHI A;  2CYZ B;  2PQW A;  1WQW A;  2EJ9 A;  4M77 D;  3N5B B;  4A54 A;  3CME A;  2XD0 A;  3S3N A;  2LC4 A;  2KK4 A;  3GLX A;  5IAY A;  3JB9 G;  3VYH B;  3JCM P;  1IRE B;  3OMC A;  5GAM f;  1KD1 U;  3JCM f;  3PMI A;  2DD4 B;  1W4S A;  2QEX A;  2K57 A;  4A4K A;  4C0F A;  4E7K A;  2EQM A;  4O6J A;  4DA4 A;  2JOY A;  1EIF A;  3QWL A;  1Y71 A;  2XG8 D;  3CC4 T;  4HCZ A;  2G3R A;  1U8R A;  3TRE A;  2O4X B;  4C92 B;  2QDY B;  3SDZ A;  1AHJ B;  3UT1 A;  3P8B B;  5LL6 S;  3V8K A;  2FB7 A;  4FT4 A;  4BY6 C;  2F69 A;  3O8V A;  4XQ3 A;  5CO7 A;  5D6W A;  3VKG A;  5CCA A;  5KE3 A;  2DZC A;  3BG9 A;  3TU4 K;  4PJO C;  4OVA A;  2WAC A;  5CKB A;  3V8L A;  2ZPG B;  1H64 1;  3Q1J A;  1VQ8 T;  4A4G A;  3QYH B;  2CGH A;  4YTL A;  1YJ9 A;  3HZJ A;  4ZGE B;  4FSX A;  4C8Q G;  2D6F A;  3CC2 A;  2EQU A;  1Q7Y U;  2QI2 A;  4N0A A;  3TEE A;  2WSC E;  3CCE T;  3OSV A;  5CR2 A;  5GAN h;  3MP6 A;  4JDS A;  1W2B S;  3JB9 H;  2OAU A;  3HB9 A;  3MEU A;  1O9S A;  4E7J A;  4KUL A;  3JB9 J;  1K8A C;  3OYF A;  1UB4 A;  2X4J A;  1VQK A;  4M7A A;  4ZN1 A;  5IN1 A;  3VKI A;  4J6Y A;  4DOW A;  5EG2 A;  4ATO A;  2CZ6 B;  4JX5 A;  3VU3 C;  3E9F A;  2PVD B;  4L6V 5;  2DK3 A;  3PNW C;  1X75 C;  3MEA A;  2K3Y A;  2PVO B;  1QLB A;  5D6Y A;  2CKK A;  3HRS A;  2K4Y A;  4N0A C;  2LT1 A;  3CEY A;  4KUI A;  5GAO n;  1YIT A;  2OTJ T;  3LLR A;  3CBO A;  4J5Y A;  2XIC A;  4XTV A;  2JZ2 A;  2RI5 A;  3L2R A;  2M9U A;  5GAN 2;  1YIT T;  5LJ5 h;  4OB2 B;  3OYL A;  4XU3 A;  3G71 T;  1NJI C;  3X26 B;  2VUB A;  1U1S A;  4BDZ A;  2Y90 A;  3RER A;  4VUB A;  4FIB A;  5LJ5 d;  3CPW A;  3QYE A;  3E19 A;  1ZBX A;  1X6O A;  2MI6 A;  4BI3 A;  1VQ8 A;  4QVD A;  4EMK A;  3S3O A;  3JCM Q;  4NS5 A;  2MMP A;  1M1G A;  4J83 A;  3LWI A;  2K3X A;  2I2L A;  4JLI A;  4Y91 A;  1WJR A;  2A3L A;  2VC8 A;  2QF7 A;  5LJ5 j;  3S6W A;  4QQG A;  1OZ2 A;  3F70 A;  4QQD A;  3CCU A;  3H8Z A;  1BI0 A;  1IZ6 A;  1UGQ B;  1UGS B;  1M9S A;  4OGE A;  3M4G A;  2GQV A;  2E70 A;  4E7I A;  3SWN C;  3DB3 A;  3FJP A;  1QVG S;  3M54 A;  2OTJ A;  4M77 G;  3V7C A;  3G7Z A;  1UGP B;  1KQ2 A;  2RHI A;  2QQA A;  4ZN3 A;  3QSU A;  1N27 A;  2DD5 B;  2V8J A;  1Y96 B;  3EAE A;  4RCC A;  3TW6 A;  3KUF A;  4PLI A;  5GAN j;  4ELZ C;  1YHQ A;  2OTL T;  3C12 A;  4QVZ A;  1Y96 A;  4BBS M;  3VV0 A;  4IUT A;  3PT9 A;  4XK8 E;  3RIR A;  4PJO A;  2ZPE B;  3JB9 F;  4C92 E;  4ZGD B;  5EJC A;  2BUD A;  2HQE A;  3M59 A;  4M75 G;  1LNX A;  2QQ9 A;  5C6S A;  4XTZ A;  1UGR B;  1VQ4 T;  3V7R A;  4C8Q F;  2KY9 A;  3LW5 E;  1G5V A;  2LQK A;  4ZTF A;  4HA8 A;  1WJS A;  3HRT A;  2K2V A;  1QP3 A;  3LWH A;  2QQR A;  4E7H A;  1RI0 A;  3I56 A;  4Z6Y A;  1XNI A;  1JJ2 A;  3CPW S;  2HAX A;  5CKE A;  4JRP A;  2DKG A;  2DD4 A;  4GY5 A;  4M75 A;  2EQJ A;  5I21 A;  3OS0 A;  3OQ5 A;  3TW7 A;  2NLU A;  4C0D B;  4M7A D;  2M1H A;  1OYX A;  4JUV A;  5I2M A;  1WGS A;  1Y7X A;  1FX7 A;  4FM4 B;  5GAN 7;  1VQL T;  1VUB A;  1G3T A;  2VYT A;  4LDV A;  4BE1 A;  2WSE E;  3HHT B;  2JVV A;  1WQ7 A;  1VQM T;  3L2Z A;  3S3M A;  3LGL A;  5A0L A;  4RG8 A;  2DXC A;  3G6E T;  1YJW A;  5GAO l;  1E7P A;  3C94 A;  2ZPI B;  1M1K C;  3CD6 A;  4X9D A;  2DXC B;  5GAN f;  5GAO r;  1QVP A;  2XKO C;  2BS2 A;  4HNU A;  2DIG A;  3I55 T;  4N4I A;  5CVI A;  3M5A A;  5FRO A;  1QVG A;  3DLL A;  3OB9 A;  1KQS S;  5FU7 C;  4M7A F;  1M8V A;  3A5Z B;  4C92 F;  3KHI A;  3OMG A;  4EPC A;  2ZCF B;  3CCR T;  4LDW A;  3QZ5 B;  2MF2 A;  4M75 F;  4A53 A;  2YRV A;  1M1K U;  3A8H B;  3CBP A;  5HK3 A;  1UEB A;  2LTO A;  2X4W A;  4V2S A;  4MDW A;  4B9W A;  5CKD A;  3QXE B;  2E65 A;  4LDY A;  3FLG A;  1JRI A;  4F7U E;  3VUB A;  3HSB A;  4M78 E;  3FDR A;  3INZ A;  3FC3 A;  5FLX E;  4RCB A;  4RMO A;  3V7S A;  1I4K 1;  2LCL A;  1FWZ A;  2IG0 A;  3JAM E;  3L2W A;  4C92 D;  3CCM A;  3JB9 D;  1YJ9 T;  4J6X A;  2HBP A;  2DEQ A;  5AYF A;  4J8O A;  3UWN A;  3A8G B;  3KXT A;  3OW2 A;  3JCM J;  1YJW T;  2RO0 A;  5GAO p;  5GMK i;  3J80 E;  3BG3 A;  4E7L A;  2EKO A;  3CCJ A;  4BE0 A;  2RJF A;  2CZ7 B;  1KD1 C;  1VQL A;  3CCL A;  3MCA B;  2M16 A;  3BG5 A;  3OS5 A;  4M78 G;  3RKY A;  5GMK m;  3PIO A;  2RHX A;  4M7D D;  5HKC A;  3OYA A;  2V8K A;  3G6E A;  3QZ9 B;  4HT8 A;  4M7D E;  4M77 B;  3MP8 A;  4OGC A;  4XU1 A;  3WVD B;  2PUO B;  3MP1 A;  2CZ0 B;  4EMG A;  2XDD A;  1FXX A;  2EWN A;  5LJ3 d;  3G4S T;  5CKF A;  4M77 A;  4NC6 A;  1QP2 A;  4EMK B;  4M7A E;  1GXI E;  4QW2 A;  2KMG A;  2DIQ A;  1BI1 A;  4NOY A;  4A4H A;  4JX6 A;  4C0G A;  2QEX T;  4IUQ A;  2D0Q B;  2DVE A;  2LNV A;  1Q82 U;  3QHS A;  1W2B A;  1BI3 A;  2G77 A;  1VIF A;  5DY9 A;  2E6Z A;  4A4E A;  4M78 B;  2DPP B;  3QUI A;  4PJO D;  2L5Q A;  1V29 B;  2E12 A;  1D3B B;  2PU9 B;  3L42 A;  4C5G A;  2EJF A;  1I81 A;  4BI8 B;  1JBM A;  3MO8 A;  4JRI A;  1Q82 C;  1RL2 A;  2DO3 A;  2L8D A;  2JUF A;  2RA2 A;  2ZGW A;  5CQY A;  4C8Q C;  2E64 A;  5CAI A;  2ZZD B;  5LJ5 e;  3QKJ A;  2ZPH B;  2GFU A;  4FU6 A;  3FB9 A;  3PTA A;  3OYI A;  3OA6 A;  1H3Z A;  2EAY A;  2QXF A;  4PNO A;  4BBR M;  2DD5 A;  2LVM A;  4AKH A;  2E5Q A;  5HY6 A;  3OW2 S;  4R55 A;  5GAO q;  4C8Q D;  2GF7 A;  1VQ7 T;  3H6Z A;  4AKI A;  3DLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...