2QGSA

Crystal structure of se1688 protein from staphylococcus epidermidis. northeast structural genomics consortium target ser89
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
209
Chain Sequence
MNSRMKIKKAYEYMKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVDSKLTDEILAYDQLKQFLSTLDLSSEISQQVLYIIKHMSHVKLSIDGEIVRDADRLDAIGAIGIARTFQFSGHFGEPMWTETKLSNEELHTSLVEELDNSAIKHFYEKLFKLKDLMHTPTAKKLAEERHQFMIQYLKQFMSEWNFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SE1688 protein from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords Protein SE1688
total genus 72
structure length 209
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2qgsA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qgsA02
2QGSA 5IHYA 3B57A 2PJQA 3DJBA 3DTOA 5DQVA 5DQWA
chains in the Genus database with same CATH superfamily
4UIGA 2WIPB 2H7VC 4MIMA 1YD8G 4CI2B 4H9OC 4ZXLA 4BJNA 5EK4A 5CA1E 2IC9A 5FXZA 4PNIA 3EAMA 1FINB 2BKZB 3OYXA 2W9ZA 5LBQB 4QXHB 4X20E 2BVMA 5AQPB 4EB6E 3PO3S 4H9SE 2KNDA 4IREA 3CQGB 3X24B 4AKRB 1XZYA 2HH7A 5HXHA 1OL1B 3O4XE 2ACZA 3E08A 2VL8A 4OYKA 2WQYA 1S35A 4QHOA 3SFEA 5HXEA 1BU2A 3IA3A 2VURA 1D1AA 4KUMB 2EHOB 5HEGA 4CFXB 2NTYA 5AQLB 4H9QC 1VCTA 2YINA 2MBGA 4JX5A 2WY2A 3ONLC 2X51A 3TLTA 2V5CA 1J1JA 2KR6A 2ZPFB 1H1QB 4NSTB 2ZPGB 5CGMA 2L9QA 5JTGA 3ZMVB 1VRBA 4KRCB 1VOLA 4DV3T 3P4SA 4TWHA 1VCSA 1F5QB 4IE0A 4BCMD 3OPCA 5J2UE 3A7MA 4PJMA 4AQYT 2EHOD 4EEBA 4DR1T 4EC9B 2OA5A 1LVKA 4X65T 1XMQT 4UF0A 3KVBA 4U2YA 2NTXA 3F5XB 2BG9E 2JIWA 5L2LA 4ZGDB 1D0YA 4IL4A 1FKMA 3QZ5B 1M62A 2Y6XA 4UXNB 3PUWF 2JPFA 2EUFA 2C4GB 4ROCA 4IDNA 3HKCE 4DV7T 3QK6A 5IHYA 4I50E 3QB5A 1JOWA 3FXEB 3O1IA 3VU7H 3CK6A 1LKXA 4YTMA 1GQEA 4NIQA 1UX5A 4AKGA 2QVAA 2H3RA 2ZLYA 4A98A 3S4UA 1G3NC 5L2WB 3H3MA 2CBIA 1UNGD 1MIWA 4EORB 3PDYA 4BAYB 2UZBB 1E2AA 2XTLA 4HFIA 5LCYA 1QLBA 3K7AM 4IIJE 5AQIB 5CYIB 4LF9T 4GKJT 3N9OA 5ABHA 3L3PA 4ZGJB 2PHGA 5JDMA 3NZQA 5LMKB 2BKNA 4JI5T 1FVVB 4EXTA 4F7SB 3EDUA 5JDHA 4CFNB 3GTMS 4CI1B 3KVAA 4I3ZB 3ETVA 5JR9A 3OYZA 4JX6A 3ZT7A 2H7OA 3X26B 4K0KT 3AVRA 3JAEA 4LF6T 5C3JA 3P8CD 4NPPA 2ODUA 1XWMA 3TNIB 4U7IA 3NVOA 4CI3B 3UU5A 4KBMB 4JX4A 3QOFA 2FJBA 2LRKA 3KFWX 5BMVE 5HWYA 5KDMC 5LHHB 2V1DB 2M6BA 2XUEA 4L0RA 3ZC0A 4GK0E 1W98B 2WMBB 1KK7A 2J4GA 1KNZA 4H9NC 1L0VA 4H63V 1N36T 2IN3A 3FXDB 4OGRB 2XQ6A 2X0LB 4UR9A 1GUXB 3PU8A 2BS3A 2UUCT 4TN7B 4X1IE 3J9X1 1OKVB 4DVDA 2R6GF 3U78A 5L3FB 5JRCB 4Z8XA 4LMKA 3UUMA 1GH6B 4CXAB 3ZYMA 3TW6A 2A72A 4FJOA 1Z8UA 2W2UA 2K9AA 1NWMX 3KBTA 5F5WA 3A8GB 3GN5A 3MK7C 4IE7A 3VR9A 1UUSA 2XQ8A 5FP3A 1E7PA 1UURA 2XQ3A 4YOZA 4CXYA 4IDZA 2ZMAA 4EIWA 5AQQB 4PW8A 2WAUA 2G0UA 3GA8A 2YU2A 4COFA 1UGQB 2WU2A 2C6TB 4CN6A 2ZM8A 4IE4A 3SRZA 2CHOA 3CIRA 3JC6D 2UXCT 4QWNB 2F4VT 5LYJE 4U31A 4AISA 3BLRB 1AISB 1YKHB 3MACA 1UNLD 4HNUA 3N2KE 3N2OA 4U3CA 3K1SA 1H25B 4I0UA 5CFBA 4MFRA 4JYAT 3FB2A 3BHTB 2KZ7B 2RA1A 2W61A 2X67A 2CZ0B 3AXJA 2UXDT 5ABGA 3OBVE 2C5KT 1HX8A 5IWAT 2ZPEB 1ZKEA 3WVEB 2J47A 2WBLA 4HNVA 1OEDC 3POMA 1WCRA 2LEHA 3VHLA 3ANWB 3QB5K 5LBMA 2KMFA 3AEBA 2QQ8A 3LQ5B 3ZN1B 2C5VB 1EZ3A 2A2FX 4M1PA 3QZ9B 1KF6A 4DMWA 3P4WA 5AQRB 4YHHT 4KRDB 4U33A 5CA0E 1HG2A 3I9YA 3LG7A 2X68A 3A8LB 1JSTB 2V6YB 3HHTB 2LSKA 2QGSA 3PU3A 4KHPT 4KMCA 4PK4A 5JREA 1H7CA 4XBFB 1WYBA 2Y48B 2I53A 2XAFB 1GUXA 4FM4B 4HEAA 5HBJB 4MFDA 1OIYB 4II5B 1KFYA 4PJNA 4QH4A 5L3DB 4BCMB 3SWHA 5F3JA 3AA6B 2WMAB 1E9HB 5AQSB 3B13A 3R6NA 4HFHA 2K24A 5LG4A 2MYSA 5FXVA 3QYEA 4JV5T 2VB6A 4DO0A 4UEMA 2RPAA 2Q9QC 2VVNA 1PKDB 3AE9A 1IAPA 1YQ3A 2KWIB 5FMNA 1ENWA 1JNZA 1W9RA 2ZM2A 4B3MT 2LSGA 3RRCA 1OWAA 2QYWA 2W9FA 3ANWA 1O3XA 2YU1A 4QXBB 2BS4A 5IUXA 2YOEA 4EZHA 1Z0PA 3E0ZA 1XO2A 2WDRA 5L3EB 1JKWA 4CZZB 5FKYA 3Q5DA 4K0UA 3AE5A 5HXRA 1B7TA 4AXPA 4O8SA 2BKOA 5LOVE 5H6QB 4HL4A 3RC8A 4I4TE 3RYCE 2C5NB 3AE1A 4HFBA 4QXCB 3C64A 1BR4A 5L4HA 2FBWA 3PUQA 5JDFA 2QRXA 2K48A 2GK9A 5LJNA 4NXNT 4UV8B 4EOIB 5AQFB 1US7B 4A5XA 5AQVB 5IYZE 3N9QA 1TD6A 3HL6A 5LMNT 2C5JA 3QWLA 3CX7B 2P9BA 4G2AA 1E1HB 2L3LA 4TUYE 2IW5B 2JQQA 5TAOA 3HKDE 5LGNB 1DU2A 3QC9A 3A8MB 5FL1A 2WZHA 3AE3A 4OHFA 3PURA 3UFGA 2HHHT 2IIUA 5JH7E 2V6YA 1I94T 3O0GD 5IDPB 3I0QA 3V5SA 1MIYA 5H6RB 3Q5EA 2J62A 5FYMA 3ZJ1A 2LM2A 1MIVA 2CCQA 5LXTE 4YTNA 4YSZA 2V7IA 3IHRA 4ZI7E 1VOMA 3M65A 4EOKB 4BCGB 1TFBA 2WPAB 2WSSV 2CMRA 4AKLA 4F70B 3HKBE 3QHWB 3K3QC 3LJCA 4CN4A 4ERRA 5AQJB 3EHZA 5FGKB 4CFWB 2D0UA 2W67A 4HKAA 2XQAA 5KX5E 4OB2B 1YQ4A 3CQCB 2X1NB 2MAWA 1H26B 1P5EB 2W99A 3I9WA 3N5LA 5HQ0B 2HPJA 3CKDA 3PUSA 3J7Yq 1MMGA 4QSHA 2QA7A 3WI3A 2X0HA 4UF0B 3GMIA 3TW7A 2JRKA 5JR9B 1QUUA 2H89A 5L3BB 4LMLA 4HWHA 2XZEA 4MBQA 2C5XB 4WW0A 3AAIA 3AE7A 2VKOA 3MI9B 2M67A 3PUZF 4WBOA 3T1HT 3UUBA 3K8PC 2WXVB 1MNEA 4WBNE 5EJCA 2D9DA 4GOUA 2KSRA 2W2HA 3E22E 4AKHA 3F57A 4DR5T 4HWCA 3EOCB 2LLYA 1V29B 4EOLB 2UZEB 3OTOT 1KNRA 3NWIA 3UUNA 2WDVA 2V8SV 4F7JB 5E0OA 4ZZBA 4CXWA 3AAEB 4YXDA 1R8IA 3LK2B 4DBRA 1HNXT 3KV9A 4EEDA 4U72A 4LF8T 4QX7B 3PJAA 2DXBB 4WZXA 1UGOA 1S94A 1HS7A 2PBIA 3M3ZB 3AAAB 3L39A 2CBJA 4PFPA 3ESLA 3LK3B 1N4MA 1ZHCA 5HEOA 5KXJA 4MHCA 2PTFA 1UGSB 2WMOA 1HFAA 4YLHA 2R7GA 3EUHA 5JDQA 2DD4B 4BA9A 2CJMB 2UXBT 3PTRB 3G06A 3QNUA 5HEJA 4MALA 5FXXA 4HFDA 2DCFA 3QHRB 4L9IA 5EFQB 3DJBA 2BG9C 5FY0A 4CFUB 2E9XB 3QYHB 4AQGA 4KP3C 2KXPB 4JI4T 3ZCIA 3I0OA 2HPLA 2ZPIB 5HAXA 3BLQB 1D3UB 3GWHA 2FUPA 5LNKA 2XJ7A 1BR2A 4IL9A 1UCUA 4ZI2C 5ICPB 2E9XC 2G9XB 1Y64B 5HNBB 1I6ZA 2CZ6B 2WDQA 3T8OA 2W4XA 4EAHA 3ZT6A 2IAKA 4ZOLE 4ILCA 2JJ9A 3LDQB 2XQ5A 4YSXA 4HFEA 4GK5E 4DV2T 2CCHB 4G6LB 2J1DG 4QKNA 3CWZB 3ZPOA 1H4LD 5HXCA 3BQIA 4DR6T 3EI0A 2W00A 3AE8A 4O4HE 2AHJB 3CQXC 3TKLB 4DR7T 1VINA 2X9XA 4ELLA 3AB3B 4EOPB 2V5DA 2MPKA 1D0ZA 2DLRA 3VKHA 2VASA 2W62A 3UT5E 3WAJA 5BNJB 2E5VA 3JADA 3D0TA 3PV0F 4B6XA 4EYUA 2V6XA 2BDEA 3HO8A 2WP9A 3RRWA 1OIUB 3FZHB 4DUZT 4A56A 3DTOA 1KNPA 4HWIB 4IE5A 4PAGA 4PJJA 3ZCJA 4LF5T 3X28B 1MMNA 4B3TT 3X25B 3BG5A 2CYZB 4LF4T 4WNKA 4EOJB 3AEDA 4A97A 2PK2A 4NC6A 2CE7A 4ZI3D 2E5LT 3OJAA 2JQHA 2K3WA 3AEFA 2I40B 2W66A 5L4EA 2KLQA 5M4YA 4Q25A 1SUMB 5FXWA 3BG3A 4LFCT 1XMOT 4PK5A 1Y01A 2V26A 3UQ4A 1OKWB 3VRBA 4C90A 1X79A 1UX4A 3LK42 1UNHD 1HCIA 1J5WA 3KDSE 3DOGB 5AQGB 5IF1B 4CFVB 2V7JA 4E7SA 2WIHB 1IJ6A 1XDPA 2VVSA 4CQIA 3C4ZA 4BCHB 3ZYKA 3BQLA 1LVFA 4OB3B 4GYRA 3ZT5A 1YW0A 5ACBA 2JGZB 2ZPBB 1WR6A 5HWXA 4ZGEB 2UUBT 2PMIB 4X62T 5A1LA 4O4LE 4TV8E 2NR4A 3N9PA 3RHWA 2CCIB 4DMVA 3TLSA 2CLYB 4I55E 4GYSA 3CVRA 4ILBA 3PE0A 1AJ3A 1HNWT 1UGPB 2RP4A 3UUXB 3ZYLA 2DPPB 4YOOA 4YOSA 2XPKA 4IHJE 4YFSA 1FEWA 2A3DA 2LKGA 5C8YE 2DNXA 2LJLA 4O4IE 3PUYF 2JQ9A 2XY8B 1G8XA 4HNTA 3Q9DA 2UXXB 2FJAA 4X1YE 4G63A 3BG9A 4DUYT 2IVXA 4U2ZA 2C5OB 3N9LA 4HWDA 4EYYR 4TX5A 2CXDA 2SPCA 2YN6A 3X20B 3RI5A 3RYFE 1C9BA 1V9DA 2I6HA 4JI0T 2Q9QA 2LE8A 2PG8A 5JDGA 5ABFB 4Z90A 3PUXF 2E8IA 3PUVF 4IMYB 3AEGA 1T8BA 4CFUD 4H63H 3DDQB 4C91A 3FZFB 3RF1A 4LFAT 3SOLA 5EK3A 1AD6A 3NRYA 3DP7A 3A5XA 4NUUA 3P7IA 4AKIA 3KV4A 3AEEA 1WR0A 2N9DA 1SE7A 4DV6T 2LM9A 2IW8B 2WU5A 5AQUB 3ZEFB 3N9NA 4EOZB 3PJAJ 3MKDA 4Y72B 5J2TE 1W0AA 5JDLA 4BBSM 5J0ZA 5L3GB 3BLHB 1JSUB 5HBEB 4ZS3A 2CWOA 3CMLA 4AI6A 2CM0A 5LJMA 3RLFF 4BCNB 2XM2A 3ZMTB 3ONXA 3EDVA 3LBXA 3C98B 2CXLA 4EZ4A 4TZ4C 3Q2MA 3RX6A 1MNDA 2V7KA 1UK5A 3WAKA 1XNQT 3ZLIA 3L8RA 2ACXA 1BR0A 3EABA 5FVLA 4UVBB 4ZZCA 4TNWA 1ZV4X 3HR0A 5DQVA 3RYIE 2WFYB 2X9YA 2UUAT 2VL0A 4LFBT 5FY1A 3B57A 4YJ2E 5FVKA 3DL1A 5LG3A 2LHNA 4BCFB 5ETWA 4DR3T 2FJDA 1QSDA 4X1KE 4XAXB 2KT9A 4ROEA 2LSIA 2V22B 4P09A 2OLTA 2ZM0A 4BXXX 3RIUA 2Q9QB 2WEVB 3LSVA 4HFVA 4JEUB 4YJ3E 5AQKB 2VKHA 5FNVE 3P4PA 2YDRA 2X0YA 4TTHA 5LHGB 4ASKA 4X66T 3UTKA 4QH1A 5HYAA 1M7KA 3F31A 3HA4A 4N78D 3MXZA 4O2BE 2N1GA 3PUAA 2BBHA 4JI1T 2ZM6T 2X66A 2QF7A 3BQKA 4X64T 4OB1B 2KWHA 4O2AE 1UGRB 2VQFT 2V7LA 2PK9B 1W09A 5HVYB 5DABA 4BJMA 1GY3B 1NAFA 1U5PA 4HFCA 1X9BA 1IREB 3HKEE 5AQMB 2IDOB 4GKKT 4U7YA 1T98A 4H9PC 2LSYA 4DV5T 1ZEEA 3U3IA 2CWYA 3EVYA 4NUVA 5HEHA 3AVSA 4DR4T 3DDPB 4OX9T 2LOPA 4HE8A 2BBJA 2DXCB 4ZS2A 1NEKA 3AA1B 2XSAA 5ABEA 4AIUA 4P1NA 3RC3A 2UZDB 3AA0B 2MTQA 4Z91A 4BY1X 3FHNA 5JDNA 3HB9A 2YK0A 3ZC1A 1HTJF 4J2CA 5J1GA 4UV9B 5LMUT 4EOQB 2WM9A 5ABFA 4OYJA 1H1SB 1O9KA 5ADXL 3C51A 1N34T 3FBZA 2LHRA 3NBXX 3X1DA 4F6UB 2C0SA 1XNRT 3A8YC 4EOOB 2HN2A 2B9RA 3K3NA 2LKHA 4F6WB 2WMNA 5EK2A 5LQFB 5HCJA 5I5ZB 1IZNB 4JI3T 1D0XA 4CFMB 3WVDB 4TNVA 1OL2B 1WFDA 3KINB 3VKGA 3AECA 4EV6A 1VYWB 4ADZA 3RQUA 4TV9E 2I0MA 3QYGB 2M6IA 3ABVA 4DR2T 2ZZDB 4XZCA 4F6RC 3BK9A 2XHEB 4NXMT 3ZSSA 4H9RC 4JLEA 2AE9A 5LGUB 4DBQA 4BCKB 4YTPA 4YHJA 4BBRM 3MY5B 4CRLB 2FJEA 4U74A 3HI2A 2IUBA 2WS3A 2CZ7B 3TLVA 4OB0B 3KBUA 2HN1A 5HBHB 4CXXA 3UU8A 2KINB 3OKQA 1ZOYA 3A8HB 2E9XA 1W0BA 4IDQA 5CB4E 3ETUA 3CX6B 4X5TA 4P0BA 3A8OB 1HG5A 2LW4A 1IBLT 2ZCFB 4EC8B 4UN0A 4BCQB 4PFOA 4JI2T 5C2TA 4YY3T 1HNZT 2W63A 1KXUA 2QDJA 3UULA 1ZP0A 3I1AA 2CHNA 3NRXA 4EONB 4TWDA 1ZP2A 3VR8A 2DI4A 3QYBA 3IBPA 3Q5WA 2XAGB 2XM1A 4HLQA 1CHUA 4AQFA 5AQHB 4ANJA 4MLKA 1XDOA 2DWKA 4L5GA 3JC6C 1MMAA 3UU3A 5JR9C 4BY7X 2YEVC 1IJ5A 3L09A 2NP9A 2VKJA 3H4CA 4RODA 2WCAA 3IEEA 4LOCA 1FMWA 3FZLB 2Y8DA 2WWVA 1H27B 4ZEYA 3RQWA 3RPUA 5AQOB 3P4RA 1OGUB 5F8PA 1FJGT 2AXDS 3BHUB 1KEYA 2NOXA 4LF7T 3O9XA 2CLYC 3EIDB 4TWFA 2H88A 2BZBA 2UUEB 3V5UA 4ZHQE 1J5ET 4DIDB 3F2EA 2BKPA 4LMJA 4JEHB 2XQ9A 1H1RB 3UU6A 2JQKA 1WYCA 4I43B 3AE6A 5IDNB 1D1BA 2CA5A 2YKSA 5BR8T 1H28B 1N33T 1FMVA 3Q5XA 3ZMSB 2B76A 3JCFA 2XSBA 2F2CA 3LFMA 4CN1A 4IE6A 1OEDE 2IW9B 5JQGE 2XQ7A 1HX1B 1T7SA 5HEUA 1HR0T 5L47A 2UU9T 5FY7A 5LA6E 3NKZA 4UELA 2EHOC 1H1PB 3UU4A 1IBMT 2B1EA 3MJXA 4BCPB 2BS2A 1OEDA 1O9KB 4IGUA 3FZMB 5DQWA 3T1YT 1QMZB 4KI0F 2V7MA 2XAQB 2NW8A 3JAFA 2BVLA 5AQNB 2E9XD 4BCQD 3AEAA 3TNWB 4JBWF 2MOZA 4OK0A 5DJQC 1YXRA 2DD5B 4DV1T 3QXEB 3UQ7A 3CPZA 2UXNB 3C4WA 4IDOA 2VKDA 2G77A 5GONE 3IF8B 2DMEA 1AHJB 2X9WA 3C4XA 4UVCB 2W0GA 2D0QB 3RH3A 1SHZC 2IC6A 3TNHB 2CZ1B 4E7ZA 3UFEA 1U4QA 2IMLA 2IHR1 3FBLA 3EJ1B 4JI8T 3KHIA 3RGLA 3RIAA 3RKGA 1G73A 2ES0A 3ZMUB 3RIFA 1YKEB 3M03A 2CXFA 2LT3A 2KMGA 1H24B 3RIUC 2LOSA 3HBLA 3KV6A 3PUGA 5LB7B 5LP6E 4GIWA 4ILUA 1MMDA 5CEIB 5CJ5A 2XAHB 3CX8B 4OFZA 2W96A 2YDSA 4AQFC 4ISTA 3N9MA 3NZPA 2VWAA 2VK9A 3W15B 4ILAA 1FIOA 3N2GE 4IDPA 3HZJA 4UVAB 2X9HA 5LHIB 2JMHA 2BG9A 1SA0E 3TN8B 3ONJA 4PK6A 2WJ9A 1N32T 2ZPHB 3AXJB 3BHVB 1OXZA 2CEAA 1HF8A 5AQTB 3C50A 2Z6EA 3MY1B 4OR5B 2IW6B 3SS1A 4PJLA 2Q9QD 3NDQA 3VYGB 1T72A 4JI7T 4QX8B 5EZYE 4YC3B 4BCND 3RKOA 3ZN0B 3MA9A 4MFEA 3ZKRA 2OV9A 1URCB 4M6VA 1JNRA 5L3CB 4KX6A 2NWBA 4ZI2D 4HWFA 1OEDB 5HCMA 3B5MA 4FI5A 3ZMZB 5HXSA 4F7LB 2ODVA 4HTEA 1NENA 4ISSA 2I59A 3H3AA 4ZI3C 4BCOB 2L8KA 4JI6T 3P50A 1BR1A 2BPMB 2D0TA 3H37A 4WYVA 3VYHB 4KHZF 2LRLA 3O1JA 5LGTB 3SFDA 2PJQA 4EOMB 4Z6YA 3VRAA 3KV5A 3TLWA 4HN9A 3RYHE 5JVDE 5JRCA 4B3ST 4YSYA 2XAJB 4HGAA 2N2NA 2XQYA 3GN5B 2E2AA 3AE2A 2A9UA 5AFUL 2UZLB 3LBXB 4DV0T 4IT4A 3OVUA 5KMGP 4O4JE 2D5UA 1D1CA 4QH5A 3R84B 2QFZA 2DHRA 2PFVA 3ZJ2A 2C5IT 3ZSTA 4F6SB 2DWGA 2K5BB 2WZIA 3TLUA 3FZKB 3QUJA 2LSJA 4B3RT 4YT0A 3MIAB 1OI9B 4ELJA 2JMKA 2NW9A 1CUNA 2XQ4A 2WWUA 4DNDA 3RGFB 1WLXA 4F8HA 2BG9B 1IBKT 2WB5A 5FL0A 2QDYB 2XASB 2EHOA 2VQET 4DV4T 2NW7A 4EGWA 4F7NB 2DL1A 3P4QA 4BCIB 2D2SA 4JUYA 4EOSB 2CPTA 3AE4A 3O1HA 4V1Av 3AA7B 1WRDA 3G33B 4BCJB 2WHBB 1LRZA 2YDQA 4P0AA 2CRBA 3MZKB 3K3OA 4FX3B
chains in the Genus database with same CATH topology
4UIGA 2H7VC 1OWAA 3CX6B 4CQIA 1YD8G 3C4ZA 4CI2B 4H9OC 4P0BA 3ZYKA 1HG5A 3ANWA 3BQLA 4BJNA 1O3XA 1LVFA 2YU1A 4GYRA 5EK4A 5CA1E 1YW0A 4QXBB 2IC9A 5FXZA 4PNIA 4EZHA 1Z0PA 1WR6A 3E0ZA 4PFOA 3OYXA 5HWXA 5L3EB 4CZZB 4K0UA 5HXRA 5LBQB 4QXHB 2W63A 1B7TA 5A1LA 4O4LE 4X20E 4AXPA 2BVMA 4TV8E 3UULA 4O8SA 4EB6E 3N9PA 3I1AA 5H6QB 5LOVE 4DMVA 2CLYB 2KNDA 4GYSA 4H9SE 4I55E 3CVRA 3CQGB 4I4TE 3RC8A 3NRXA 3PE0A 3RYCE 4AKRB 1AJ3A 4QXCB 3C64A 1BR4A 2HH7A 5HXHA 2DI4A 3O4XE 3E08A 2VL8A 4OYKA 3IBPA 2RP4A 3Q5WA 1S35A 3PUQA 3UUXB 4QHOA 3ZYLA 5HXEA 2XAGB 4IHJE 5JDFA 4YFSA 1FEWA 4AQFA 2K48A 2A3DA 2GK9A 1D1AA 4KUMB 4ANJA 2EHOB 4MLKA 5LJNA 2DWKA 4L5GA 3JC6C 5C8YE 2DNXA 1MMAA 2NTYA 4UV8B 2LJLA 4H9QC 4O4IE 5JR9C 1US7B 2YEVC 5IYZE 1IJ5A 3L09A 3N9QA 2NP9A 2VKJA 1G8XA 2YINA 3HL6A 2MBGA 2C5JA 2X51A 3IEEA 3Q9DA 1FMWA 2UXXB 3CX7B 2P9BA 2Y8DA 4G2AA 4X1YE 1E1HB 4G63A 2L9QA 3ZMVB 2L3LA 4TUYE 2IW5B 2JQQA 3N9LA 5TAOA 1VRBA 3HKDE 3RPUA 5LGNB 3QC9A 5F8PA 4EYYR 4TX5A 2CXDA 2SPCA 4IE0A 2NOXA 5J2UE 4OHFA 3RYFE 3PURA 4PJMA 5JH7E 3O9XA 2CLYC 1V9DA 3I0QA 2EHOD 2BZBA 2Q9QA 2LE8A 2PG8A 3V5UA 4ZHQE 3V5SA 2OA5A 1LVKA 5JDGA 1MIYA 4UF0A 3F2EA 5H6RB 4JEHB 2E8IA 3KVBA 2NTXA 1WYCA 5L2LA 1D0YA 5FYMA 4I43B 3ZJ1A 2Y6XA 4H63H 1MIVA 4UXNB 4C91A 2CCQA 5LXTE 2JPFA 1D1BA 2CA5A 2V7IA 3SOLA 3HKCE 5EK3A 3IHRA 3QK6A 3NRYA 3RRCA 3DP7A 4ZI7E 1FMVA 5IHYA 3A5XA 1VOMA 3M65A 4I50E 4NUUA 3FXEB 3O1IA 3VU7H 3Q5XA 3ZMSB 3P7IA 2WSSV 1LKXA 3KV4A 2CMRA 4AKLA 4AKIA 3LFMA 2N9DA 4IE6A 3HKBE 2LM9A 3K3QC 3LJCA 1UX5A 5JQGE 4AKGA 3ZEFB 4ERRA 3N9NA 4EOZB 2ZLYA 2H3RA 3MKDA 2D0UA 3S4UA 5J2TE 5JDLA 4HKAA 5KX5E 3CQCB 5FY7A 5LA6E 5L3GB 4UELA 2EHOC 1MIWA 2B1EA 3MJXA 3PDYA 4ZS3A 4BAYB 2CWOA 3CMLA 3I9WA 4IGUA 3N5LA 2XTLA 2CM0A 5DQWA 5LJMA 4AI6A 5LCYA 3ZMTB 4IIJE 2HPJA 3CKDA 3PUSA 3ONXA 3J7Yq 2V7MA 3EDVA 2XAQB 1MMGA 2QA7A 3LBXA 3C98B 3WI3A 2NW8A 3N9OA 2BVLA 2CXLA 3L3PA 4EZ4A 4TZ4C 3GMIA 4UF0B 3Q2MA 3RX6A 2E9XD 2JRKA 5JDMA 3NZQA 5JR9B 1QUUA 1MNDA 5L3BB 2V7KA 4MBQA 4WW0A 3AAIA 3WAKA 2MOZA 4OK0A 5DJQC 2VKOA 4EXTA 2M67A 4WBOA 3ZLIA 3CPZA 2UXNB 3C4WA 3EDUA 5JDHA 2ACXA 1MNEA 2VKDA 3K8PC 5GONE 4WBNE 4CI1B 1BR0A 4GOUA 3IF8B 4UVBB 3KVAA 3E22E 3ETVA 4AKHA 5JR9A 3OYZA 1ZV4X 3F57A 2H7OA 2X9WA 3C4XA 3HR0A 5DQVA 4UVCB 3AVRA 3RYIE 2W0GA 3P8CD 3RH3A 1SHZC 2IC6A 2ODUA 2X9YA 3UUNA 4E7ZA 3UFEA 5FY1A 1U4QA 5E0OA 4CI3B 4CXWA 3B57A 3AAEB 3FBLA 3LK2B 4KBMB 4DBRA 4YJ2E 2LHNA 3KV9A 3KFWX 4U72A 5ETWA 5BMVE 5HWYA 5KDMC 5LHHB 2V1DB 4QX7B 2XUEA 1G73A 2ES0A 4L0RA 3ZMUB 3ZC0A 4GK0E 1YKEB 1S94A 1HS7A 1KK7A 2PBIA 3AAAB 1QSDA 2CXFA 2LT3A 4H9NC 4X1KE 4XAXB 1KNZA 2KT9A 2LSIA 4P09A 4PFPA 4H63V 3ESLA 3FXDB 2LOSA 2ZM0A 3LK3B 1ZHCA 2X0LB 3KV6A 3PUGA 4MHCA 3PU8A 2WMOA 2Q9QB 5LP6E 4TN7B 4GIWA 4X1IE 4ILUA 1HFAA 3J9X1 1MMDA 4HFVA 4YLHA 3EUHA 4DVDA 5JDQA 2XAHB 3CX8B 4JEUB 4OFZA 4YJ3E 3U78A 4BA9A 2VKHA 5FNVE 4AQFC 5L3FB 4ISTA 3N9MA 3NZPA 3PTRB 2VWAA 2VK9A 5LHGB 4MALA 4ASKA 5JRCB 3W15B 5FXXA 3UTKA 4Z8XA 5HYAA 1FIOA 2DCFA 3N2GE 3UUMA 3F31A 3HA4A 4L9IA 4UVAB 3DJBA 2X9HA 4N78D 2JMHA 3MXZA 5LHIB 1SA0E 2N1GA 4O2BE 3PUAA 4PK6A 5FY0A 3ZYMA 2E9XB 2A72A 4FJOA 1OXZA 4AQGA 2CEAA 4KP3C 2KXPB 1HF8A 2X66A 2K9AA 1NWMX 3BQKA 3C50A 2Z6EA 3KBTA 3MK7C 3GN5A 4IE7A 3ZCIA 3I0OA 2KWHA 3SS1A 4PJLA 2HPLA 4O2AE 2Q9QD 5FP3A 2V7LA 4CXYA 4IDZA 5HAXA 3GWHA 2ZMAA 5DABA 4QX8B 4BJMA 4EIWA 5LNKA 1NAFA 5EZYE 1U5PA 1BR2A 4PW8A 3RKOA 1UCUA 3ZN0B 4ZI2C 2WAUA 3HKEE 2G0UA 3MA9A 3GA8A 2YU2A 1T98A 4H9PC 2E9XC 2LSYA 1Y64B 1ZEEA 2ZM8A 3U3IA 2CWYA 4IE4A 3EVYA 4NUVA 5L3CB 3SRZA 3AVSA 3JC6D 3T8OA 2NWBA 4EAHA 4ZI2D 2LOPA 2IAKA 4ZOLE 4QWNB 4HE8A 2JJ9A 4ZS2A 5LYJE 3AA1B 1YKHB 3MACA 4FI5A 3ZMZB 5HXSA 3N2KE 2ODVA 3RC3A 4GK5E 4HTEA 3AA0B 2MTQA 3N2OA 2J1DG 3FHNA 4ISSA 5JDNA 4QKNA 2I59A 3H3AA 3CWZB 4ZI3C 2L8KA 4MFRA 2YK0A 1BR1A 3FB2A 2D0TA 3H37A 3ZPOA 2KZ7B 3ZC1A 1HTJF 5HXCA 3BQIA 2RA1A 4J2CA 2W61A 2W00A 5J1GA 2X67A 4O4HE 4UV9B 2WM9A 3O1JA 5LGTB 3CQXC 2PJQA 3OBVE 3TKLB 2C5KT 4OYJA 1HX8A 3KV5A 2X9XA 4HN9A 5JVDE 3RYHE 5JRCA 5ADXL 3C51A 3FBZA 2LHRA 3NBXX 2XAJB 1ZKEA 4HGAA 3AB3B 2C0SA 2N2NA 2WBLA 3VHLA 2LEHA 2XQYA 3ANWB 5LBMA 2KMFA 3GN5B 3ZN1B 1D0ZA 1EZ3A 2DLRA 5AFUL 2A2FX 2VASA 2W62A 4M1PA 3VKHA 3LBXB 3UT5E 3K3NA 2WMNA 4DMWA 5EK2A 3WAJA 5KMGP 4O4JE 3D0TA 1IZNB 1D1CA 2D5UA 4B6XA 4EYUA 5CA0E 1HG2A 3I9YA 3R84B 2DHRA 2BDEA 2PFVA 3LG7A 2X68A 3ZJ2A 3RRWA 1D0XA 2LSKA 2QGSA 3PU3A 4A56A 2C5IT 4KMCA 3DTOA 4PK4A 5JREA 4IE5A 4PAGA 1H7CA 4PJJA 2DWGA 2K5BB 3KINB 3ZCJA 4XBFB 3VKGA 1WYBA 4ADZA 3QUJA 2LSJA 2Y48B 1MMNA 2XAFB 4HEAA 4TV9E 2JMKA 2NW9A 1CUNA 4XZCA 2WWUA 4WNKA 4DNDA 4F6RC 3BK9A 4PJNA 2XHEB 5L3DB 1WLXA 4H9RC 4JLEA 2CE7A 4ZI3D 3SWHA 5F3JA 5LGUB 4DBQA 3OJAA 3AA6B 2XASB 2EHOA 2KLQA 4YHJA 5M4YA 2NW7A 3B13A 5FXWA 3R6NA 2D2SA 4PK5A 2V26A 2K24A 4U74A 5LG4A 4JUYA 4C90A 1X79A 2MYSA 3HI2A 1UX4A 5FXVA 3LK42 2VB6A 4DO0A 3KBUA 4UEMA 1HCIA 2Q9QC 3KDSE 3O1HA 4V1Av 3AA7B 4CXXA 1WRDA 1IAPA 1LRZA 2KWIB 2KINB 4P0AA 3OKQA 3MZKB 5FMNA 2E9XA 2V7JA 2ZM2A 3K3OA 4E7SA 5CB4E 1IJ6A 2LSGA 3ETUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGS A;  5IHY A;  3B57 A;  2PJQ A;  3DJB A;  3DTO A;  5DQV A;  5DQW A; 
#chains in the Genus database with same CATH topology
 4UIG A;  2WIP B;  2H7V C;  4MIM A;  1YD8 G;  4CI2 B;  4H9O C;  4ZXL A;  4BJN A;  5EK4 A;  5CA1 E;  2IC9 A;  5FXZ A;  4PNI A;  3EAM A;  1FIN B;  2BKZ B;  3OYX A;  2W9Z A;  5LBQ B;  4QXH B;  4X20 E;  2BVM A;  5AQP B;  4EB6 E;  3PO3 S;  4H9S E;  2KND A;  4IRE A;  3CQG B;  3X24 B;  4AKR B;  1XZY A;  2HH7 A;  5HXH A;  1OL1 B;  3O4X E;  2ACZ A;  3E08 A;  2VL8 A;  4OYK A;  2WQY A;  1S35 A;  4QHO A;  3SFE A;  5HXE A;  1BU2 A;  3IA3 A;  2VUR A;  1D1A A;  4KUM B;  2EHO B;  5HEG A;  4CFX B;  2NTY A;  5AQL B;  4H9Q C;  1VCT A;  2YIN A;  2MBG A;  4JX5 A;  2WY2 A;  3ONL C;  2X51 A;  3TLT A;  2V5C A;  1J1J A;  2KR6 A;  2ZPF B;  1H1Q B;  4NST B;  2ZPG B;  5CGM A;  2L9Q A;  5JTG A;  3ZMV B;  1VRB A;  4KRC B;  1VOL A;  4DV3 T;  3P4S A;  4TWH A;  1VCS A;  1F5Q B;  4IE0 A;  4BCM D;  3OPC A;  5J2U E;  3A7M A;  4PJM A;  4AQY T;  2EHO D;  4EEB A;  4DR1 T;  4EC9 B;  2OA5 A;  1LVK A;  4X65 T;  1XMQ T;  4UF0 A;  3KVB A;  4U2Y A;  2NTX A;  3F5X B;  2BG9 E;  2JIW A;  5L2L A;  4ZGD B;  1D0Y A;  4IL4 A;  1FKM A;  3QZ5 B;  1M62 A;  2Y6X A;  4UXN B;  3PUW F;  2JPF A;  2EUF A;  2C4G B;  4ROC A;  4IDN A;  3HKC E;  4DV7 T;  3QK6 A;  5IHY A;  4I50 E;  3QB5 A;  1JOW A;  3FXE B;  3O1I A;  3VU7 H;  3CK6 A;  1LKX A;  4YTM A;  1GQE A;  4NIQ A;  1UX5 A;  4AKG A;  2QVA A;  2H3R A;  2ZLY A;  4A98 A;  3S4U A;  1G3N C;  5L2W B;  3H3M A;  2CBI A;  1UNG D;  1MIW A;  4EOR B;  3PDY A;  4BAY B;  2UZB B;  1E2A A;  2XTL A;  4HFI A;  5LCY A;  1QLB A;  3K7A M;  4IIJ E;  5AQI B;  5CYI B;  4LF9 T;  4GKJ T;  3N9O A;  5ABH A;  3L3P A;  4ZGJ B;  2PHG A;  5JDM A;  3NZQ A;  5LMK B;  2BKN A;  4JI5 T;  1FVV B;  4EXT A;  4F7S B;  3EDU A;  5JDH A;  4CFN B;  3GTM S;  4CI1 B;  3KVA A;  4I3Z B;  3ETV A;  5JR9 A;  3OYZ A;  4JX6 A;  3ZT7 A;  2H7O A;  3X26 B;  4K0K T;  3AVR A;  3JAE A;  4LF6 T;  5C3J A;  3P8C D;  4NPP A;  2ODU A;  1XWM A;  3TNI B;  4U7I A;  3NVO A;  4CI3 B;  3UU5 A;  4KBM B;  4JX4 A;  3QOF A;  2FJB A;  2LRK A;  3KFW X;  5BMV E;  5HWY A;  5KDM C;  5LHH B;  2V1D B;  2M6B A;  2XUE A;  4L0R A;  3ZC0 A;  4GK0 E;  1W98 B;  2WMB B;  1KK7 A;  2J4G A;  1KNZ A;  4H9N C;  1L0V A;  4H63 V;  1N36 T;  2IN3 A;  3FXD B;  4OGR B;  2XQ6 A;  2X0L B;  4UR9 A;  1GUX B;  3PU8 A;  2BS3 A;  2UUC T;  4TN7 B;  4X1I E;  3J9X 1;  1OKV B;  4DVD A;  2R6G F;  3U78 A;  5L3F B;  5JRC B;  4Z8X A;  4LMK A;  3UUM A;  1GH6 B;  4CXA B;  3ZYM A;  3TW6 A;  2A72 A;  4FJO A;  1Z8U A;  2W2U A;  2K9A A;  1NWM X;  3KBT A;  5F5W A;  3A8G B;  3GN5 A;  3MK7 C;  4IE7 A;  3VR9 A;  1UUS A;  2XQ8 A;  5FP3 A;  1E7P A;  1UUR A;  2XQ3 A;  4YOZ A;  4CXY A;  4IDZ A;  2ZMA A;  4EIW A;  5AQQ B;  4PW8 A;  2WAU A;  2G0U A;  3GA8 A;  2YU2 A;  4COF A;  1UGQ B;  2WU2 A;  2C6T B;  4CN6 A;  2ZM8 A;  4IE4 A;  3SRZ A;  2CHO A;  3CIR A;  3JC6 D;  2UXC T;  4QWN B;  2F4V T;  5LYJ E;  4U31 A;  4AIS A;  3BLR B;  1AIS B;  1YKH B;  3MAC A;  1UNL D;  4HNU A;  3N2K E;  3N2O A;  4U3C A;  3K1S A;  1H25 B;  4I0U A;  5CFB A;  4MFR A;  4JYA T;  3FB2 A;  3BHT B;  2KZ7 B;  2RA1 A;  2W61 A;  2X67 A;  2CZ0 B;  3AXJ A;  2UXD T;  5ABG A;  3OBV E;  2C5K T;  1HX8 A;  5IWA T;  2ZPE B;  1ZKE A;  3WVE B;  2J47 A;  2WBL A;  4HNV A;  1OED C;  3POM A;  1WCR A;  2LEH A;  3VHL A;  3ANW B;  3QB5 K;  5LBM A;  2KMF A;  3AEB A;  2QQ8 A;  3LQ5 B;  3ZN1 B;  2C5V B;  1EZ3 A;  2A2F X;  4M1P A;  3QZ9 B;  1KF6 A;  4DMW A;  3P4W A;  5AQR B;  4YHH T;  4KRD B;  4U33 A;  5CA0 E;  1HG2 A;  3I9Y A;  3LG7 A;  2X68 A;  3A8L B;  1JST B;  2V6Y B;  3HHT B;  2LSK A;  2QGS A;  3PU3 A;  4KHP T;  4KMC A;  4PK4 A;  5JRE A;  1H7C A;  4XBF B;  1WYB A;  2Y48 B;  2I53 A;  2XAF B;  1GUX A;  4FM4 B;  4HEA A;  5HBJ B;  4MFD A;  1OIY B;  4II5 B;  1KFY A;  4PJN A;  4QH4 A;  5L3D B;  4BCM B;  3SWH A;  5F3J A;  3AA6 B;  2WMA B;  1E9H B;  5AQS B;  3B13 A;  3R6N A;  4HFH A;  2K24 A;  5LG4 A;  2MYS A;  5FXV A;  3QYE A;  4JV5 T;  2VB6 A;  4DO0 A;  4UEM A;  2RPA A;  2Q9Q C;  2VVN A;  1PKD B;  3AE9 A;  1IAP A;  1YQ3 A;  2KWI B;  5FMN A;  1ENW A;  1JNZ A;  1W9R A;  2ZM2 A;  4B3M T;  2LSG A;  3RRC A;  1OWA A;  2QYW A;  2W9F A;  3ANW A;  1O3X A;  2YU1 A;  4QXB B;  2BS4 A;  5IUX A;  2YOE A;  4EZH A;  1Z0P A;  3E0Z A;  1XO2 A;  2WDR A;  5L3E B;  1JKW A;  4CZZ B;  5FKY A;  3Q5D A;  4K0U A;  3AE5 A;  5HXR A;  1B7T A;  4AXP A;  4O8S A;  2BKO A;  5LOV E;  5H6Q B;  4HL4 A;  3RC8 A;  4I4T E;  3RYC E;  2C5N B;  3AE1 A;  4HFB A;  4QXC B;  3C64 A;  1BR4 A;  5L4H A;  2FBW A;  3PUQ A;  5JDF A;  2QRX A;  2K48 A;  2GK9 A;  5LJN A;  4NXN T;  4UV8 B;  4EOI B;  5AQF B;  1US7 B;  4A5X A;  5AQV B;  5IYZ E;  3N9Q A;  1TD6 A;  3HL6 A;  5LMN T;  2C5J A;  3QWL A;  3CX7 B;  2P9B A;  4G2A A;  1E1H B;  2L3L A;  4TUY E;  2IW5 B;  2JQQ A;  5TAO A;  3HKD E;  5LGN B;  1DU2 A;  3QC9 A;  3A8M B;  5FL1 A;  2WZH A;  3AE3 A;  4OHF A;  3PUR A;  3UFG A;  2HHH T;  2IIU A;  5JH7 E;  2V6Y A;  1I94 T;  3O0G D;  5IDP B;  3I0Q A;  3V5S A;  1MIY A;  5H6R B;  3Q5E A;  2J62 A;  5FYM A;  3ZJ1 A;  2LM2 A;  1MIV A;  2CCQ A;  5LXT E;  4YTN A;  4YSZ A;  2V7I A;  3IHR A;  4ZI7 E;  1VOM A;  3M65 A;  4EOK B;  4BCG B;  1TFB A;  2WPA B;  2WSS V;  2CMR A;  4AKL A;  4F70 B;  3HKB E;  3QHW B;  3K3Q C;  3LJC A;  4CN4 A;  4ERR A;  5AQJ B;  3EHZ A;  5FGK B;  4CFW B;  2D0U A;  2W67 A;  4HKA A;  2XQA A;  5KX5 E;  4OB2 B;  1YQ4 A;  3CQC B;  2X1N B;  2MAW A;  1H26 B;  1P5E B;  2W99 A;  3I9W A;  3N5L A;  5HQ0 B;  2HPJ A;  3CKD A;  3PUS A;  3J7Y q;  1MMG A;  4QSH A;  2QA7 A;  3WI3 A;  2X0H A;  4UF0 B;  3GMI A;  3TW7 A;  2JRK A;  5JR9 B;  1QUU A;  2H89 A;  5L3B B;  4LML A;  4HWH A;  2XZE A;  4MBQ A;  2C5X B;  4WW0 A;  3AAI A;  3AE7 A;  2VKO A;  3MI9 B;  2M67 A;  3PUZ F;  4WBO A;  3T1H T;  3UUB A;  3K8P C;  2WXV B;  1MNE A;  4WBN E;  5EJC A;  2D9D A;  4GOU A;  2KSR A;  2W2H A;  3E22 E;  4AKH A;  3F57 A;  4DR5 T;  4HWC A;  3EOC B;  2LLY A;  1V29 B;  4EOL B;  2UZE B;  3OTO T;  1KNR A;  3NWI A;  3UUN A;  2WDV A;  2V8S V;  4F7J B;  5E0O A;  4ZZB A;  4CXW A;  3AAE B;  4YXD A;  1R8I A;  3LK2 B;  4DBR A;  1HNX T;  3KV9 A;  4EED A;  4U72 A;  4LF8 T;  4QX7 B;  3PJA A;  2DXB B;  4WZX A;  1UGO A;  1S94 A;  1HS7 A;  2PBI A;  3M3Z B;  3AAA B;  3L39 A;  2CBJ A;  4PFP A;  3ESL A;  3LK3 B;  1N4M A;  1ZHC A;  5HEO A;  5KXJ A;  4MHC A;  2PTF A;  1UGS B;  2WMO A;  1HFA A;  4YLH A;  2R7G A;  3EUH A;  5JDQ A;  2DD4 B;  4BA9 A;  2CJM B;  2UXB T;  3PTR B;  3G06 A;  3QNU A;  5HEJ A;  4MAL A;  5FXX A;  4HFD A;  2DCF A;  3QHR B;  4L9I A;  5EFQ B;  3DJB A;  2BG9 C;  5FY0 A;  4CFU B;  2E9X B;  3QYH B;  4AQG A;  4KP3 C;  2KXP B;  4JI4 T;  3ZCI A;  3I0O A;  2HPL A;  2ZPI B;  5HAX A;  3BLQ B;  1D3U B;  3GWH A;  2FUP A;  5LNK A;  2XJ7 A;  1BR2 A;  4IL9 A;  1UCU A;  4ZI2 C;  5ICP B;  2E9X C;  2G9X B;  1Y64 B;  5HNB B;  1I6Z A;  2CZ6 B;  2WDQ A;  3T8O A;  2W4X A;  4EAH A;  3ZT6 A;  2IAK A;  4ZOL E;  4ILC A;  2JJ9 A;  3LDQ B;  2XQ5 A;  4YSX A;  4HFE A;  4GK5 E;  4DV2 T;  2CCH B;  4G6L B;  2J1D G;  4QKN A;  3CWZ B;  3ZPO A;  1H4L D;  5HXC A;  3BQI A;  4DR6 T;  3EI0 A;  2W00 A;  3AE8 A;  4O4H E;  2AHJ B;  3CQX C;  3TKL B;  4DR7 T;  1VIN A;  2X9X A;  4ELL A;  3AB3 B;  4EOP B;  2V5D A;  2MPK A;  1D0Z A;  2DLR A;  3VKH A;  2VAS A;  2W62 A;  3UT5 E;  3WAJ A;  5BNJ B;  2E5V A;  3JAD A;  3D0T A;  3PV0 F;  4B6X A;  4EYU A;  2V6X A;  2BDE A;  3HO8 A;  2WP9 A;  3RRW A;  1OIU B;  3FZH B;  4DUZ T;  4A56 A;  3DTO A;  1KNP A;  4HWI B;  4IE5 A;  4PAG A;  4PJJ A;  3ZCJ A;  4LF5 T;  3X28 B;  1MMN A;  4B3T T;  3X25 B;  3BG5 A;  2CYZ B;  4LF4 T;  4WNK A;  4EOJ B;  3AED A;  4A97 A;  2PK2 A;  4NC6 A;  2CE7 A;  4ZI3 D;  2E5L T;  3OJA A;  2JQH A;  2K3W A;  3AEF A;  2I40 B;  2W66 A;  5L4E A;  2KLQ A;  5M4Y A;  4Q25 A;  1SUM B;  5FXW A;  3BG3 A;  4LFC T;  1XMO T;  4PK5 A;  1Y01 A;  2V26 A;  3UQ4 A;  1OKW B;  3VRB A;  4C90 A;  1X79 A;  1UX4 A;  3LK4 2;  1UNH D;  1HCI A;  1J5W A;  3KDS E;  3DOG B;  5AQG B;  5IF1 B;  4CFV B;  2V7J A;  4E7S A;  2WIH B;  1IJ6 A;  1XDP A;  2VVS A;  4CQI A;  3C4Z A;  4BCH B;  3ZYK A;  3BQL A;  1LVF A;  4OB3 B;  4GYR A;  3ZT5 A;  1YW0 A;  5ACB A;  2JGZ B;  2ZPB B;  1WR6 A;  5HWX A;  4ZGE B;  2UUB T;  2PMI B;  4X62 T;  5A1L A;  4O4L E;  4TV8 E;  2NR4 A;  3N9P A;  3RHW A;  2CCI B;  4DMV A;  3TLS A;  2CLY B;  4I55 E;  4GYS A;  3CVR A;  4ILB A;  3PE0 A;  1AJ3 A;  1HNW T;  1UGP B;  2RP4 A;  3UUX B;  3ZYL A;  2DPP B;  4YOO A;  4YOS A;  2XPK A;  4IHJ E;  4YFS A;  1FEW A;  2A3D A;  2LKG A;  5C8Y E;  2DNX A;  2LJL A;  4O4I E;  3PUY F;  2JQ9 A;  2XY8 B;  1G8X A;  4HNT A;  3Q9D A;  2UXX B;  2FJA A;  4X1Y E;  4G63 A;  3BG9 A;  4DUY T;  2IVX A;  4U2Z A;  2C5O B;  3N9L A;  4HWD A;  4EYY R;  4TX5 A;  2CXD A;  2SPC A;  2YN6 A;  3X20 B;  3RI5 A;  3RYF E;  1C9B A;  1V9D A;  2I6H A;  4JI0 T;  2Q9Q A;  2LE8 A;  2PG8 A;  5JDG A;  5ABF B;  4Z90 A;  3PUX F;  2E8I A;  3PUV F;  4IMY B;  3AEG A;  1T8B A;  4CFU D;  4H63 H;  3DDQ B;  4C91 A;  3FZF B;  3RF1 A;  4LFA T;  3SOL A;  5EK3 A;  1AD6 A;  3NRY A;  3DP7 A;  3A5X A;  4NUU A;  3P7I A;  4AKI A;  3KV4 A;  3AEE A;  1WR0 A;  2N9D A;  1SE7 A;  4DV6 T;  2LM9 A;  2IW8 B;  2WU5 A;  5AQU B;  3ZEF B;  3N9N A;  4EOZ B;  3PJA J;  3MKD A;  4Y72 B;  5J2T E;  1W0A A;  5JDL A;  4BBS M;  5J0Z A;  5L3G B;  3BLH B;  1JSU B;  5HBE B;  4ZS3 A;  2CWO A;  3CML A;  4AI6 A;  2CM0 A;  5LJM A;  3RLF F;  4BCN B;  2XM2 A;  3ZMT B;  3ONX A;  3EDV A;  3LBX A;  3C98 B;  2CXL A;  4EZ4 A;  4TZ4 C;  3Q2M A;  3RX6 A;  1MND A;  2V7K A;  1UK5 A;  3WAK A;  1XNQ T;  3ZLI A;  3L8R A;  2ACX A;  1BR0 A;  3EAB A;  5FVL A;  4UVB B;  4ZZC A;  4TNW A;  1ZV4 X;  3HR0 A;  5DQV A;  3RYI E;  2WFY B;  2X9Y A;  2UUA T;  2VL0 A;  4LFB T;  5FY1 A;  3B57 A;  4YJ2 E;  5FVK A;  3DL1 A;  5LG3 A;  2LHN A;  4BCF B;  5ETW A;  4DR3 T;  2FJD A;  1QSD A;  4X1K E;  4XAX B;  2KT9 A;  4ROE A;  2LSI A;  2V22 B;  4P09 A;  2OLT A;  2ZM0 A;  4BXX X;  3RIU A;  2Q9Q B;  2WEV B;  3LSV A;  4HFV A;  4JEU B;  4YJ3 E;  5AQK B;  2VKH A;  5FNV E;  3P4P A;  2YDR A;  2X0Y A;  4TTH A;  5LHG B;  4ASK A;  4X66 T;  3UTK A;  4QH1 A;  5HYA A;  1M7K A;  3F31 A;  3HA4 A;  4N78 D;  3MXZ A;  4O2B E;  2N1G A;  3PUA A;  2BBH A;  4JI1 T;  2ZM6 T;  2X66 A;  2QF7 A;  3BQK A;  4X64 T;  4OB1 B;  2KWH A;  4O2A E;  1UGR B;  2VQF T;  2V7L A;  2PK9 B;  1W09 A;  5HVY B;  5DAB A;  4BJM A;  1GY3 B;  1NAF A;  1U5P A;  4HFC A;  1X9B A;  1IRE B;  3HKE E;  5AQM B;  2IDO B;  4GKK T;  4U7Y A;  1T98 A;  4H9P C;  2LSY A;  4DV5 T;  1ZEE A;  3U3I A;  2CWY A;  3EVY A;  4NUV A;  5HEH A;  3AVS A;  4DR4 T;  3DDP B;  4OX9 T;  2LOP A;  4HE8 A;  2BBJ A;  2DXC B;  4ZS2 A;  1NEK A;  3AA1 B;  2XSA A;  5ABE A;  4AIU A;  4P1N A;  3RC3 A;  2UZD B;  3AA0 B;  2MTQ A;  4Z91 A;  4BY1 X;  3FHN A;  5JDN A;  3HB9 A;  2YK0 A;  3ZC1 A;  1HTJ F;  4J2C A;  5J1G A;  4UV9 B;  5LMU T;  4EOQ B;  2WM9 A;  5ABF A;  4OYJ A;  1H1S B;  1O9K A;  5ADX L;  3C51 A;  1N34 T;  3FBZ A;  2LHR A;  3NBX X;  3X1D A;  4F6U B;  2C0S A;  1XNR T;  3A8Y C;  4EOO B;  2HN2 A;  2B9R A;  3K3N A;  2LKH A;  4F6W B;  2WMN A;  5EK2 A;  5LQF B;  5HCJ A;  5I5Z B;  1IZN B;  4JI3 T;  1D0X A;  4CFM B;  3WVD B;  4TNV A;  1OL2 B;  1WFD A;  3KIN B;  3VKG A;  3AEC A;  4EV6 A;  1VYW B;  4ADZ A;  3RQU A;  4TV9 E;  2I0M A;  3QYG B;  2M6I A;  3ABV A;  4DR2 T;  2ZZD B;  4XZC A;  4F6R C;  3BK9 A;  2XHE B;  4NXM T;  3ZSS A;  4H9R C;  4JLE A;  2AE9 A;  5LGU B;  4DBQ A;  4BCK B;  4YTP A;  4YHJ A;  4BBR M;  3MY5 B;  4CRL B;  2FJE A;  4U74 A;  3HI2 A;  2IUB A;  2WS3 A;  2CZ7 B;  3TLV A;  4OB0 B;  3KBU A;  2HN1 A;  5HBH B;  4CXX A;  3UU8 A;  2KIN B;  3OKQ A;  1ZOY A;  3A8H B;  2E9X A;  1W0B A;  4IDQ A;  5CB4 E;  3ETU A;  3CX6 B;  4X5T A;  4P0B A;  3A8O B;  1HG5 A;  2LW4 A;  1IBL T;  2ZCF B;  4EC8 B;  4UN0 A;  4BCQ B;  4PFO A;  4JI2 T;  5C2T A;  4YY3 T;  1HNZ T;  2W63 A;  1KXU A;  2QDJ A;  3UUL A;  1ZP0 A;  3I1A A;  2CHN A;  3NRX A;  4EON B;  4TWD A;  1ZP2 A;  3VR8 A;  2DI4 A;  3QYB A;  3IBP A;  3Q5W A;  2XAG B;  2XM1 A;  4HLQ A;  1CHU A;  4AQF A;  5AQH B;  4ANJ A;  4MLK A;  1XDO A;  2DWK A;  4L5G A;  3JC6 C;  1MMA A;  3UU3 A;  5JR9 C;  4BY7 X;  2YEV C;  1IJ5 A;  3L09 A;  2NP9 A;  2VKJ A;  3H4C A;  4ROD A;  2WCA A;  3IEE A;  4LOC A;  1FMW A;  3FZL B;  2Y8D A;  2WWV A;  1H27 B;  4ZEY A;  3RQW A;  3RPU A;  5AQO B;  3P4R A;  1OGU B;  5F8P A;  1FJG T;  2AXD S;  3BHU B;  1KEY A;  2NOX A;  4LF7 T;  3O9X A;  2CLY C;  3EID B;  4TWF A;  2H88 A;  2BZB A;  2UUE B;  3V5U A;  4ZHQ E;  1J5E T;  4DID B;  3F2E A;  2BKP A;  4LMJ A;  4JEH B;  2XQ9 A;  1H1R B;  3UU6 A;  2JQK A;  1WYC A;  4I43 B;  3AE6 A;  5IDN B;  1D1B A;  2CA5 A;  2YKS A;  5BR8 T;  1H28 B;  1N33 T;  1FMV A;  3Q5X A;  3ZMS B;  2B76 A;  3JCF A;  2XSB A;  2F2C A;  3LFM A;  4CN1 A;  4IE6 A;  1OED E;  2IW9 B;  5JQG E;  2XQ7 A;  1HX1 B;  1T7S A;  5HEU A;  1HR0 T;  5L47 A;  2UU9 T;  5FY7 A;  5LA6 E;  3NKZ A;  4UEL A;  2EHO C;  1H1P B;  3UU4 A;  1IBM T;  2B1E A;  3MJX A;  4BCP B;  2BS2 A;  1OED A;  1O9K B;  4IGU A;  3FZM B;  5DQW A;  3T1Y T;  1QMZ B;  4KI0 F;  2V7M A;  2XAQ B;  2NW8 A;  3JAF A;  2BVL A;  5AQN B;  2E9X D;  4BCQ D;  3AEA A;  3TNW B;  4JBW F;  2MOZ A;  4OK0 A;  5DJQ C;  1YXR A;  2DD5 B;  4DV1 T;  3QXE B;  3UQ7 A;  3CPZ A;  2UXN B;  3C4W A;  4IDO A;  2VKD A;  2G77 A;  5GON E;  3IF8 B;  2DME A;  1AHJ B;  2X9W A;  3C4X A;  4UVC B;  2W0G A;  2D0Q B;  3RH3 A;  1SHZ C;  2IC6 A;  3TNH B;  2CZ1 B;  4E7Z A;  3UFE A;  1U4Q A;  2IML A;  2IHR 1;  3FBL A;  3EJ1 B;  4JI8 T;  3KHI A;  3RGL A;  3RIA A;  3RKG A;  1G73 A;  2ES0 A;  3ZMU B;  3RIF A;  1YKE B;  3M03 A;  2CXF A;  2LT3 A;  2KMG A;  1H24 B;  3RIU C;  2LOS A;  3HBL A;  3KV6 A;  3PUG A;  5LB7 B;  5LP6 E;  4GIW A;  4ILU A;  1MMD A;  5CEI B;  5CJ5 A;  2XAH B;  3CX8 B;  4OFZ A;  2W96 A;  2YDS A;  4AQF C;  4IST A;  3N9M A;  3NZP A;  2VWA A;  2VK9 A;  3W15 B;  4ILA A;  1FIO A;  3N2G E;  4IDP A;  3HZJ A;  4UVA B;  2X9H A;  5LHI B;  2JMH A;  2BG9 A;  1SA0 E;  3TN8 B;  3ONJ A;  4PK6 A;  2WJ9 A;  1N32 T;  2ZPH B;  3AXJ B;  3BHV B;  1OXZ A;  2CEA A;  1HF8 A;  5AQT B;  3C50 A;  2Z6E A;  3MY1 B;  4OR5 B;  2IW6 B;  3SS1 A;  4PJL A;  2Q9Q D;  3NDQ A;  3VYG B;  1T72 A;  4JI7 T;  4QX8 B;  5EZY E;  4YC3 B;  4BCN D;  3RKO A;  3ZN0 B;  3MA9 A;  4MFE A;  3ZKR A;  2OV9 A;  1URC B;  4M6V A;  1JNR A;  5L3C B;  4KX6 A;  2NWB A;  4ZI2 D;  4HWF A;  1OED B;  5HCM A;  3B5M A;  4FI5 A;  3ZMZ B;  5HXS A;  4F7L B;  2ODV A;  4HTE A;  1NEN A;  4ISS A;  2I59 A;  3H3A A;  4ZI3 C;  4BCO B;  2L8K A;  4JI6 T;  3P50 A;  1BR1 A;  2BPM B;  2D0T A;  3H37 A;  4WYV A;  3VYH B;  4KHZ F;  2LRL A;  3O1J A;  5LGT B;  3SFD A;  2PJQ A;  4EOM B;  4Z6Y A;  3VRA A;  3KV5 A;  3TLW A;  4HN9 A;  3RYH E;  5JVD E;  5JRC A;  4B3S T;  4YSY A;  2XAJ B;  4HGA A;  2N2N A;  2XQY A;  3GN5 B;  2E2A A;  3AE2 A;  2A9U A;  5AFU L;  2UZL B;  3LBX B;  4DV0 T;  4IT4 A;  3OVU A;  5KMG P;  4O4J E;  2D5U A;  1D1C A;  4QH5 A;  3R84 B;  2QFZ A;  2DHR A;  2PFV A;  3ZJ2 A;  2C5I T;  3ZST A;  4F6S B;  2DWG A;  2K5B B;  2WZI A;  3TLU A;  3FZK B;  3QUJ A;  2LSJ A;  4B3R T;  4YT0 A;  3MIA B;  1OI9 B;  4ELJ A;  2JMK A;  2NW9 A;  1CUN A;  2XQ4 A;  2WWU A;  4DND A;  3RGF B;  1WLX A;  4F8H A;  2BG9 B;  1IBK T;  2WB5 A;  5FL0 A;  2QDY B;  2XAS B;  2EHO A;  2VQE T;  4DV4 T;  2NW7 A;  4EGW A;  4F7N B;  2DL1 A;  3P4Q A;  4BCI B;  2D2S A;  4JUY A;  4EOS B;  2CPT A;  3AE4 A;  3O1H A;  4V1A v;  3AA7 B;  1WRD A;  3G33 B;  4BCJ B;  2WHB B;  1LRZ A;  2YDQ A;  4P0A A;  2CRB A;  3MZK B;  3K3O A;  4FX3 B; 
#chains in the Genus database with same CATH homology
 4UIG A;  2H7V C;  1OWA A;  3CX6 B;  4CQI A;  1YD8 G;  3C4Z A;  4CI2 B;  4H9O C;  4P0B A;  3ZYK A;  1HG5 A;  3ANW A;  3BQL A;  4BJN A;  1O3X A;  1LVF A;  2YU1 A;  4GYR A;  5EK4 A;  5CA1 E;  1YW0 A;  4QXB B;  2IC9 A;  5FXZ A;  4PNI A;  4EZH A;  1Z0P A;  1WR6 A;  3E0Z A;  4PFO A;  3OYX A;  5HWX A;  5L3E B;  4CZZ B;  4K0U A;  5HXR A;  5LBQ B;  4QXH B;  2W63 A;  1B7T A;  5A1L A;  4O4L E;  4X20 E;  4AXP A;  2BVM A;  4TV8 E;  3UUL A;  4O8S A;  4EB6 E;  3N9P A;  3I1A A;  5H6Q B;  5LOV E;  4DMV A;  2CLY B;  2KND A;  4GYS A;  4H9S E;  4I55 E;  3CVR A;  3CQG B;  4I4T E;  3RC8 A;  3NRX A;  3PE0 A;  3RYC E;  4AKR B;  1AJ3 A;  4QXC B;  3C64 A;  1BR4 A;  2HH7 A;  5HXH A;  2DI4 A;  3O4X E;  3E08 A;  2VL8 A;  4OYK A;  3IBP A;  2RP4 A;  3Q5W A;  1S35 A;  3PUQ A;  3UUX B;  4QHO A;  3ZYL A;  5HXE A;  2XAG B;  4IHJ E;  5JDF A;  4YFS A;  1FEW A;  4AQF A;  2K48 A;  2A3D A;  2GK9 A;  1D1A A;  4KUM B;  4ANJ A;  2EHO B;  4MLK A;  5LJN A;  2DWK A;  4L5G A;  3JC6 C;  5C8Y E;  2DNX A;  1MMA A;  2NTY A;  4UV8 B;  2LJL A;  4H9Q C;  4O4I E;  5JR9 C;  1US7 B;  2YEV C;  5IYZ E;  1IJ5 A;  3L09 A;  3N9Q A;  2NP9 A;  2VKJ A;  1G8X A;  2YIN A;  3HL6 A;  2MBG A;  2C5J A;  2X51 A;  3IEE A;  3Q9D A;  1FMW A;  2UXX B;  3CX7 B;  2P9B A;  2Y8D A;  4G2A A;  4X1Y E;  1E1H B;  4G63 A;  2L9Q A;  3ZMV B;  2L3L A;  4TUY E;  2IW5 B;  2JQQ A;  3N9L A;  5TAO A;  1VRB A;  3HKD E;  3RPU A;  5LGN B;  3QC9 A;  5F8P A;  4EYY R;  4TX5 A;  2CXD A;  2SPC A;  4IE0 A;  2NOX A;  5J2U E;  4OHF A;  3RYF E;  3PUR A;  4PJM A;  5JH7 E;  3O9X A;  2CLY C;  1V9D A;  3I0Q A;  2EHO D;  2BZB A;  2Q9Q A;  2LE8 A;  2PG8 A;  3V5U A;  4ZHQ E;  3V5S A;  2OA5 A;  1LVK A;  5JDG A;  1MIY A;  4UF0 A;  3F2E A;  5H6R B;  4JEH B;  2E8I A;  3KVB A;  2NTX A;  1WYC A;  5L2L A;  1D0Y A;  5FYM A;  4I43 B;  3ZJ1 A;  2Y6X A;  4H63 H;  1MIV A;  4UXN B;  4C91 A;  2CCQ A;  5LXT E;  2JPF A;  1D1B A;  2CA5 A;  2V7I A;  3SOL A;  3HKC E;  5EK3 A;  3IHR A;  3QK6 A;  3NRY A;  3RRC A;  3DP7 A;  4ZI7 E;  1FMV A;  5IHY A;  3A5X A;  1VOM A;  3M65 A;  4I50 E;  4NUU A;  3FXE B;  3O1I A;  3VU7 H;  3Q5X A;  3ZMS B;  3P7I A;  2WSS V;  1LKX A;  3KV4 A;  2CMR A;  4AKL A;  4AKI A;  3LFM A;  2N9D A;  4IE6 A;  3HKB E;  2LM9 A;  3K3Q C;  3LJC A;  1UX5 A;  5JQG E;  4AKG A;  3ZEF B;  4ERR A;  3N9N A;  4EOZ B;  2ZLY A;  2H3R A;  3MKD A;  2D0U A;  3S4U A;  5J2T E;  5JDL A;  4HKA A;  5KX5 E;  3CQC B;  5FY7 A;  5LA6 E;  5L3G B;  4UEL A;  2EHO C;  1MIW A;  2B1E A;  3MJX A;  3PDY A;  4ZS3 A;  4BAY B;  2CWO A;  3CML A;  3I9W A;  4IGU A;  3N5L A;  2XTL A;  2CM0 A;  5DQW A;  5LJM A;  4AI6 A;  5LCY A;  3ZMT B;  4IIJ E;  2HPJ A;  3CKD A;  3PUS A;  3ONX A;  3J7Y q;  2V7M A;  3EDV A;  2XAQ B;  1MMG A;  2QA7 A;  3LBX A;  3C98 B;  3WI3 A;  2NW8 A;  3N9O A;  2BVL A;  2CXL A;  3L3P A;  4EZ4 A;  4TZ4 C;  3GMI A;  4UF0 B;  3Q2M A;  3RX6 A;  2E9X D;  2JRK A;  5JDM A;  3NZQ A;  5JR9 B;  1QUU A;  1MND A;  5L3B B;  2V7K A;  4MBQ A;  4WW0 A;  3AAI A;  3WAK A;  2MOZ A;  4OK0 A;  5DJQ C;  2VKO A;  4EXT A;  2M67 A;  4WBO A;  3ZLI A;  3CPZ A;  2UXN B;  3C4W A;  3EDU A;  5JDH A;  2ACX A;  1MNE A;  2VKD A;  3K8P C;  5GON E;  4WBN E;  4CI1 B;  1BR0 A;  4GOU A;  3IF8 B;  4UVB B;  3KVA A;  3E22 E;  3ETV A;  4AKH A;  5JR9 A;  3OYZ A;  1ZV4 X;  3F57 A;  2H7O A;  2X9W A;  3C4X A;  3HR0 A;  5DQV A;  4UVC B;  3AVR A;  3RYI E;  2W0G A;  3P8C D;  3RH3 A;  1SHZ C;  2IC6 A;  2ODU A;  2X9Y A;  3UUN A;  4E7Z A;  3UFE A;  5FY1 A;  1U4Q A;  5E0O A;  4CI3 B;  4CXW A;  3B57 A;  3AAE B;  3FBL A;  3LK2 B;  4KBM B;  4DBR A;  4YJ2 E;  2LHN A;  3KV9 A;  3KFW X;  4U72 A;  5ETW A;  5BMV E;  5HWY A;  5KDM C;  5LHH B;  2V1D B;  4QX7 B;  2XUE A;  1G73 A;  2ES0 A;  4L0R A;  3ZMU B;  3ZC0 A;  4GK0 E;  1YKE B;  1S94 A;  1HS7 A;  1KK7 A;  2PBI A;  3AAA B;  1QSD A;  2CXF A;  2LT3 A;  4H9N C;  4X1K E;  4XAX B;  1KNZ A;  2KT9 A;  2LSI A;  4P09 A;  4PFP A;  4H63 V;  3ESL A;  3FXD B;  2LOS A;  2ZM0 A;  3LK3 B;  1ZHC A;  2X0L B;  3KV6 A;  3PUG A;  4MHC A;  3PU8 A;  2WMO A;  2Q9Q B;  5LP6 E;  4TN7 B;  4GIW A;  4X1I E;  4ILU A;  1HFA A;  3J9X 1;  1MMD A;  4HFV A;  4YLH A;  3EUH A;  4DVD A;  5JDQ A;  2XAH B;  3CX8 B;  4JEU B;  4OFZ A;  4YJ3 E;  3U78 A;  4BA9 A;  2VKH A;  5FNV E;  4AQF C;  5L3F B;  4IST A;  3N9M A;  3NZP A;  3PTR B;  2VWA A;  2VK9 A;  5LHG B;  4MAL A;  4ASK A;  5JRC B;  3W15 B;  5FXX A;  3UTK A;  4Z8X A;  5HYA A;  1FIO A;  2DCF A;  3N2G E;  3UUM A;  3F31 A;  3HA4 A;  4L9I A;  4UVA B;  3DJB A;  2X9H A;  4N78 D;  2JMH A;  3MXZ A;  5LHI B;  1SA0 E;  2N1G A;  4O2B E;  3PUA A;  4PK6 A;  5FY0 A;  3ZYM A;  2E9X B;  2A72 A;  4FJO A;  1OXZ A;  4AQG A;  2CEA A;  4KP3 C;  2KXP B;  1HF8 A;  2X66 A;  2K9A A;  1NWM X;  3BQK A;  3C50 A;  2Z6E A;  3KBT A;  3MK7 C;  3GN5 A;  4IE7 A;  3ZCI A;  3I0O A;  2KWH A;  3SS1 A;  4PJL A;  2HPL A;  4O2A E;  2Q9Q D;  5FP3 A;  2V7L A;  4CXY A;  4IDZ A;  5HAX A;  3GWH A;  2ZMA A;  5DAB A;  4QX8 B;  4BJM A;  4EIW A;  5LNK A;  1NAF A;  5EZY E;  1U5P A;  1BR2 A;  4PW8 A;  3RKO A;  1UCU A;  3ZN0 B;  4ZI2 C;  2WAU A;  3HKE E;  2G0U A;  3MA9 A;  3GA8 A;  2YU2 A;  1T98 A;  4H9P C;  2E9X C;  2LSY A;  1Y64 B;  1ZEE A;  2ZM8 A;  3U3I A;  2CWY A;  4IE4 A;  3EVY A;  4NUV A;  5L3C B;  3SRZ A;  3AVS A;  3JC6 D;  3T8O A;  2NWB A;  4EAH A;  4ZI2 D;  2LOP A;  2IAK A;  4ZOL E;  4QWN B;  4HE8 A;  2JJ9 A;  4ZS2 A;  5LYJ E;  3AA1 B;  1YKH B;  3MAC A;  4FI5 A;  3ZMZ B;  5HXS A;  3N2K E;  2ODV A;  3RC3 A;  4GK5 E;  4HTE A;  3AA0 B;  2MTQ A;  3N2O A;  2J1D G;  3FHN A;  4ISS A;  5JDN A;  4QKN A;  2I59 A;  3H3A A;  3CWZ B;  4ZI3 C;  2L8K A;  4MFR A;  2YK0 A;  1BR1 A;  3FB2 A;  2D0T A;  3H37 A;  3ZPO A;  2KZ7 B;  3ZC1 A;  1HTJ F;  5HXC A;  3BQI A;  2RA1 A;  4J2C A;  2W61 A;  2W00 A;  5J1G A;  2X67 A;  4O4H E;  4UV9 B;  2WM9 A;  3O1J A;  5LGT B;  3CQX C;  2PJQ A;  3OBV E;  3TKL B;  2C5K T;  4OYJ A;  1HX8 A;  3KV5 A;  2X9X A;  4HN9 A;  5JVD E;  3RYH E;  5JRC A;  5ADX L;  3C51 A;  3FBZ A;  2LHR A;  3NBX X;  2XAJ B;  1ZKE A;  4HGA A;  3AB3 B;  2C0S A;  2N2N A;  2WBL A;  3VHL A;  2LEH A;  2XQY A;  3ANW B;  5LBM A;  2KMF A;  3GN5 B;  3ZN1 B;  1D0Z A;  1EZ3 A;  2DLR A;  5AFU L;  2A2F X;  2VAS A;  2W62 A;  4M1P A;  3VKH A;  3LBX B;  3UT5 E;  3K3N A;  2WMN A;  4DMW A;  5EK2 A;  3WAJ A;  5KMG P;  4O4J E;  3D0T A;  1IZN B;  1D1C A;  2D5U A;  4B6X A;  4EYU A;  5CA0 E;  1HG2 A;  3I9Y A;  3R84 B;  2DHR A;  2BDE A;  2PFV A;  3LG7 A;  2X68 A;  3ZJ2 A;  3RRW A;  1D0X A;  2LSK A;  2QGS A;  3PU3 A;  4A56 A;  2C5I T;  4KMC A;  3DTO A;  4PK4 A;  5JRE A;  4IE5 A;  4PAG A;  1H7C A;  4PJJ A;  2DWG A;  2K5B B;  3KIN B;  3ZCJ A;  4XBF B;  3VKG A;  1WYB A;  4ADZ A;  3QUJ A;  2LSJ A;  2Y48 B;  1MMN A;  2XAF B;  4HEA A;  4TV9 E;  2JMK A;  2NW9 A;  1CUN A;  4XZC A;  2WWU A;  4WNK A;  4DND A;  4F6R C;  3BK9 A;  4PJN A;  2XHE B;  5L3D B;  1WLX A;  4H9R C;  4JLE A;  2CE7 A;  4ZI3 D;  3SWH A;  5F3J A;  5LGU B;  4DBQ A;  3OJA A;  3AA6 B;  2XAS B;  2EHO A;  2KLQ A;  4YHJ A;  5M4Y A;  2NW7 A;  3B13 A;  5FXW A;  3R6N A;  2D2S A;  4PK5 A;  2V26 A;  2K24 A;  4U74 A;  5LG4 A;  4JUY A;  4C90 A;  1X79 A;  2MYS A;  3HI2 A;  1UX4 A;  5FXV A;  3LK4 2;  2VB6 A;  4DO0 A;  3KBU A;  4UEM A;  1HCI A;  2Q9Q C;  3KDS E;  3O1H A;  4V1A v;  3AA7 B;  4CXX A;  1WRD A;  1IAP A;  1LRZ A;  2KWI B;  2KIN B;  4P0A A;  3OKQ A;  3MZK B;  5FMN A;  2E9X A;  2V7J A;  2ZM2 A;  3K3O A;  4E7S A;  5CB4 E;  1IJ6 A;  2LSG A;  3ETU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...