2QGSA

Crystal structure of se1688 protein from staphylococcus epidermidis. northeast structural genomics consortium target ser89
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
209
Chain Sequence
MNSRMKIKKAYEYMKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVDSKLTDEILAYDQLKQFLSTLDLSSEISQQVLYIIKHMSHVKLSIDGEIVRDADRLDAIGAIGIARTFQFSGHFGEPMWTETKLSNEELHTSLVEELDNSAIKHFYEKLFKLKDLMHTPTAKKLAEERHQFMIQYLKQFMSEWNFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of SE1688 protein from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
molecule keywords Protein SE1688
total genus 72
structure length 209
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2qgsA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qgsA02
3B57A 5DQWA 3DTOA 5IHYA 2PJQA 2QGSA 5DQVA 3DJBA
chains in the Genus database with same CATH superfamily
4QX8B 4HNUA 5ABFB 2QDJA 4CFNB 3ZPOA 2QQ8A 1U4QA 3N9OA 2A3DA 3QK6A 5JH7E 5BMVE 5HXEA 5JVDE 3QWLA 1JSUB 1URCB 2JRKA 3Q5DA 3HKDE 3OPCA 1H1PB 1UGOA 2PFVA 1BR0A 2ZPHB 5JDGA 3A8GB 2XAQB 3DP7A 1ZHCA 2BS4A 5CA0E 2KWIB 1BU2A 3GMIA 4EOIB 4UVAB 2AHJB 2QRXA 3N2OA 3CVRA 1X9BA 3M03A 4JEUB 3MIAB 4FJOA 4DNDA 3RQUA 2C5VB 3C50A 2UZBB 2B1EA 3UUNA 4HGAA 3LBXA 4LF9T 1E7PA 4DVDA 3BLHB 2H7OA 4DR6T 1LRZA 4OR5B 4AQGA 3AAIA 1YW0A 1UX5A 1OKWB 4ZOLE 1ZKEA 2V5CA 5AQKB 2IIUA 4U2ZA 3D0TA 3EOCB 3ZEFB 3SFEA 3PUSA 4IDOA 1SE7A 4YXDA 4EOQB 2N2NA 1H1QB 3O1HA 2DHRA 2XHEB 1XNRT 1UGRB 4EV6A 4P0BA 1XMOT 2BG9E 4PJJA 4EGWA 3C4ZA 1W9RA 2XQ9A 1DU2A 1H7CA 1IREB 2R7GA 1OWAA 5JDQA 2KR6A 3FZFB 4HKAA 4YSYA 4X66T 3EUHA 4X1KE 2ZZDB 1KXUA 4UIGA 4ZI3D 3P4PA 5AQFB 3LBXB 4LMJA 1OEDA 4ZI3C 1VRBA 4JI6T 5L4HA 2ZPGB 1HNWT 3MY1B 2IW8B 2NOXA 2XQ8A 2LSIA 3H37A 3RQWA 4U33A 5LGTB 3CX6B 3PUAA 1GUXA 2WIPB 2CRBA 4B3MT 2MBGA 4GOUA 5ACBA 4I4TE 1VCTA 2CHOA 3OKQA 2XQAA 2IUBA 3UU4A 4CN4A 5LHGB 1IBLT 3HKCE 2MYSA 2W9FA 1D0XA 3LQ5B 1T7SA 4E7SA 3T1HT 3EABA 4ELJA 1WR6A 3PE0A 3RIFA 4U72A 3MK7C 2QVAA 2DLRA 5AQGB 4CI3B 2FJBA 4B3RT 4ISTA 3V5UA 4X64T 2WJ9A 4MBQA 3BG9A 2HN1A 2YK0A 2ES0A 3AEGA 4DV2T 2YU1A 1Z8UA 5LNKA 3CX8B 2C5KT 3NVOA 5HXSA 2YDRA 3CIRA 2WMNA 2F4VT 5LP6E 2XQ3A 4QH5A 4J2CA 4HFIA 1XO2A 2G0UA 5L3BB 4HFVA 3RYCE 1G3NC 3FHNA 4X62T 4YTPA 5JDFA 3NZQA 4M1PA 5AQUB 3I0OA 3ZJ2A 1U5PA 5H6RB 4MHCA 4GIWA 2BKOA 3P7IA 4HWDA 3AVRA 2DD4B 4X20E 2CMRA 3MKDA 2J1DG 2LM2A 1L0VA 3VR9A 4KHZF 3AE5A 4KBMB 4BA9A 3QZ9B 2ZMAA 3Q5EA 4YOZA 1VINA 4AKLA 2FUPA 2V26A 2CLYB 3HI2A 4MLKA 2E8IA 3GTMS 3BHUB 5FXZA 3RH3A 3N2KE 4DV5T 3QYBA 3RYHE 4H9RC 2DMEA 1D3UB 3ZCJA 3QC9A 3BLRB 4CFWB 2BVLA 2IDOB 2LW4A 3F5XB 4DBRA 3TKLB 2WB5A 5J1GA 1D1BA 2JQQA 2V6YA 4YTMA 4Y72B 4AKGA 4BXXX 5LMUT 4OFZA 3DJBA 3EDUA 4FX3B 5LMKB 2EHOA 3VR8A 2V7KA 2GK9A 4WBNE 4GYRA 3Q9DA 2XUEA 3OTOT 4AXPA 5IWAT 2X67A 2MPKA 3A5XA 4F6WB 2IAKA 5JR9B 3UU3A 4EONB 2NWBA 4CFMB 4Z6YA 2WZHA 5FXVA 4UF0A 1US7B 5FY7A 3N9NA 3SRZA 4MFRA 3HBLA 3EI0A 2KMGA 5LA6E 2NW9A 1KFYA 5LBMA 3PUWF 4A98A 5ICPB 1ENWA 4IE7A 2UU9T 4HFEA 3PU8A 4DUYT 1XNQT 2KWHA 2DWGA 3PUVF 2V6YB 4O2BE 1S35A 3ETVA 4QX7B 1KF6A 3BLQB 2IHR1 4N78D 1M62A 4HFCA 3NKZA 3Q2MA 4PK5A 3BHTB 5I5ZB 1JKWA 2WP9A 2D5UA 4P0AA 1HNXT 2P9BA 4ROEA 4A5XA 3QHWB 4CXXA 5LGNB 2W96A 1LVFA 2WM9A 3F31A 3TN8B 2WS3A 4IT4A 5IYZE 2LKGA 5HCJA 5C3JA 4AIUA 1H26B 2C5OB 1HG2A 1H25B 5BNJB 4ILUA 3I0QA 2X0HA 4GK5E 2XPKA 3AB3B 4QH1A 4PNIA 4QXCB 1I94T 5F5WA 3ESLA 4M6VA 4MALA 4GKJT 2LJLA 4K0UA 1X79A 5LG3A 3KINB 3MXZA 3ZN1B 4X65T 1HTJF 1WCRA 5LCYA 1F5QB 2M6BA 2CM0A 4DV1T 2X9XA 2VWAA 2WDRA 3AE8A 3AECA 1V9DA 3DDQB 1UNHD 5IDNB 4JI8T 5GONE 3SWHA 2QFZA 2LM9A 5AQVB 1UX4A 2QF7A 4F6UB 4JEHB 4ILAA 4PJMA 2JMHA 3U78A 2Q9QC 1YKHB 5L2WB 4GKKT 4EC8B 1UGQB 3QB5K 5LHIB 1YKEB 1UNLD 5L3DB 2BG9A 2XQ4A 1LVKA 4DR1T 2YN6A 5A1LA 2Q9QD 2BPMB 3E0ZA 3ZMVB 4AQFA 2XSBA 4EOSB 2ODVA 2LRKA 1NWMX 1HFAA 3RX6A 5EJCA 4EZHA 3JADA 3NWIA 3WI3A 4ZS3A 2CLYC 4EOZB 4JUYA 4H9OC 4DR2T 2C5IT 2RPAA 2J47A 4PW8A 1W0AA 1HX8A 3RKOA 4F8HA 3RC8A 2UXBT 2V7IA 5ADXL 2CA5A 3HZJA 4F7SB 1ZP0A 2VL0A 3A8OB 4TV8E 3H4CA 5FP3A 2K48A 4EOJB 2CBIA 2OLTA 2Z6EA 3GA8A 3ZC1A 5HEUA 4O4LE 1YQ4A 4HNTA 2XSAA 4HFHA 2BKZB 4F7JB 2X51A 4H63V 1MIYA 5EFQB 4AKIA 1CUNA 4UELA 5F3JA 3RHWA 5EK3A 2FBWA 3ZMSB 3IA3A 1MIVA 2WU5A 4QXBB 3RIUA 2E9XC 1EZ3A 5M4YA 3P50A 4HWCA 3U3IA 4F7NB 4ROCA 2XM2A 2XASB 5ETWA 3PU3A 3NDQA 3LFMA 4H63H 3CQGB 4XZCA 2YOEA 5CA1E 3O1IA 1KNZA 2PMIB 4OB2B 5AQLB 3KHIA 2V7LA 4HWIB 4DV6T 4ZZCA 4IE5A 2L8KA 2E9XA 5H6QB 2IN3A 3L3PA 4JI7T 3K3OA 4TWFA 5FXWA 4BCND 4MIMA 3F57A 2AXDS 4AKRB 2J62A 5JR9C 4QXHB 3T8OA 5AQHB 3UQ4A 5JQGE 4BCPB 1G73A 2D9DA 4DR5T 2W67A 3E22E 3X25B 5L3EB 2DXBB 3I9WA 5JTGA 1IAPA 3I9YA 3AA6B 4ZI7E 4QKNA 3P4RA 5HBJB 5FY1A 4CN6A 1E9HB 3X24B 3HB9A 2E9XD 4PAGA 3HO8A 3KV4A 4KRDB 4BJNA 1FVVB 5JREA 5F8PA 3C4WA 4CXAB 4TTHA 2VKDA 5HEGA 3N9MA 3AA1B 2WMOA 3UQ7A 2I53A 4IE6A 2BKPA 1OIYB 4EYYR 1AD6A 2IC6A 2H3RA 1XZYA 2CZ1B 3WAKA 3QHRB 4I0UA 3ZYMA 3TW7A 1KNRA 2UXNB 3DL1A 3AEDA 3TLWA 1MMAA 3DTOA 2JPFA 4KRCB 4GYSA 3NRXA 4G2AA 2ACZA 3R84B 3X26B 2QDYB 2CJMB 4BCJB 3DDPB 2OA5A 4YFSA 2CZ7B 4ZHQE 1H28B 1G8XA 4F70B 4PK4A 2XY8B 2WIHB 2LRLA 2LKHA 3WVEB 2X66A 2BS3A 1FKMA 3ANWA 2WFYB 3NBXX 4HN9A 2VASA 3ONXA 4L0RA 4DV4T 5CFBA 5HYAA 5JDHA 3PTRB 3FBLA 2W99A 1PKDB 2DD5B 2UXXB 2XZEA 3L09A 3PUGA 3QXEB 2QA7A 4JI5T 1ZP2A 4CN1A 2XQ5A 2X9WA 5ABGA 3PV0F 4Z90A 5L2LA 1J5WA 4X1IE 4XAXB 1IBKT 4IE0A 1J1JA 2CWYA 3RI5A 2C0SA 2H88A 1HR0T 2W2HA 2C5NB 2JQHA 2WY2A 4BAYB 2UZLB 1N4MA 5IDPB 2PG8A 5HQ0B 2WMBB 2VQFT 3CK6A 3LDQB 2CXLA 3VYGB 5DJQC 4O4IE 4EOPB 2BVMA 1I6ZA 1SUMB 2WWUA 4ZI2C 5L3FB 1FMWA 2WEVB 5HXRA 3HKEE 5EK4A 2BG9C 1ZOYA 4CFUD 3ZCIA 1N34T 2FJAA 3AE9A 3FZKB 5L4EA 2W66A 3UU8A 2UZDB 5C2TA 2E5LT 3ZSSA 3C51A 1OKVB 4II5B 2CPTA 4ZXLA 4PFOA 3C64A 5FYMA 4JV5T 2WDQA 3AAAB 3O1JA 4TNVA 3QYHB 3UT5E 2IMLA 4HNVA 5HBHB 3AXJB 1QLBA 2YEVC 3LK42 3RRCA 2CZ0B 1XDOA 2EHOB 2IW6B 4U7YA 3UULA 3FBZA 2NW8A 4JLEA 2ZM6T 5CEIB 3BG3A 4IGUA 2KZ7B 3EHZA 3W15B 4AKHA 4EOKB 2C6TB 4NPPA 5HNBB 3VYHB 2WBLA 1O9KA 3M65A 2F2CA 4UVCB 4LF6T 2PK2A 2N1GA 3VU7H 3NRYA 3CMLA 3QUJA 4TN7B 1WR0A 5KXJA 2LLYA 1YQ3A 1FJGT 1FIOA 3M3ZB 1BR2A 4IDQA 2ZM0A 5FVKA 3CPZA 5AQIB 5L3CB 3P4SA 4HWFA 3PUXF 3QOFA 3RIUC 4IREA 4F7LB 5KX5E 4BY7X 5FL0A 3BQKA 2K9AA 4LOCA 5LOVE 2DL1A 2DCFA 2W61A 5HWXA 3UTKA 4ILBA 2UXDT 3FZMB 3AA0B 3VKGA 4BCFB 3RIAA 2EUFA 3FXEB 3K7AM 3JAFA 4HL4A 2OV9A 5C8YE 2LHRA 1W98B 3MI9B 3T1YT 3MZKB 5JR9A 5JDLA 4UVBB 1UGSB 2Y8DA 4ZGDB 1YXRA 4UF0B 3KVBA 2X1NB 4OHFA 2UUAT 4CQIA 1LKXA 2NP9A 4AQYT 2E9XB 4NC6A 3LG7A 2KXPB 5AFUL 4OB0B 2RA1A 4WW0A 1SHZC 2HH7A 5DQVA 4K0KT 4UXNB 3BHVB 4EEDA 3RRWA 3NZPA 4P1NA 3UFEA 4WBOA 3A8YC 4BBSM 5FXXA 4QH4A 5AQTB 3ETUA 3OYXA 4KHPT 5J2TE 3ZYLA 4UV9B 4DBQA 2M6IA 4F6SB 3KFWX 4PK6A 4YY3T 2LSJA 4YJ2E 4YOSA 1XDPA 4EIWA 1WLXA 2IW9B 2XM1A 3RYFE 4NIQA 2ZM2A 1QMZB 4PJLA 3VRAA 4EAHA 5AQRB 2IC9A 2PK9B 4F6RC 3L8RA 3O0GD 4QHOA 2FJDA 5HAXA 4I3ZB 4C91A 3BQIA 4OGRB 2CWOA 3LK3B 3DOGB 3P4WA 3RKGA 4BCQD 3P4QA 3UUMA 1NEKA 4HFDA 1KK7A 2W2UA 2FJEA 2VK9A 4BCIB 1T98A 3RGLA 3AE2A 2VURA 2CEAA 3C4XA 3KBUA 1R8IA 3K1SA 3TNHB 4JI1T 2ZCFB 1GQEA 4TWDA 2H7VC 2WCAA 3RYIE 1FMVA 3ONJA 1W0BA 1IZNB 4DIDB 3MA9A 4AI6A 4BY1X 5LYJE 1HCIA 4ZZBA 2VQET 1WFDA 2CZ6B 1AISB 3ONLC 4TWHA 3ZLIA 4MFEA 2K5BB 3PDYA 1MNDA 2CHNA 2LSGA 3A8LB 4L5GA 1OEDC 2W0GA 5ABFA 5LJNA 2WDVA 1OXZA 5JDMA 3KVAA 3EAMA 2E5VA 4O2AE 2V6XA 3ZMUB 2UUBT 2BG9B 2EHOC 4DUZT 2ZPFB 4IDPA 4LFCT 1HS7A 3N9PA 3MACA 4LF7T 4ZS2A 2X9YA 3AXJA 2D0TA 2BKNA 5JDNA 3AE7A 4YSZA 4LMLA 3ZN0B 1NENA 5DABA 4TV9E 2KMFA 4Z91A 5HVYB 2A2FX 3ZT7A 4L9IA 4CI1B 1YD8G 3C98B 2XQ6A 3B57A 1KNPA 2V5DA 4AQFC 5HCMA 2JMKA 4BCMB 3QB5A 1HNZT 4IL4A 4I50E 3AEBA 4BCGB 3O4XE 1UURA 4UR9A 3PUQA 2XAHB 5LXTE 1QSDA 1H27B 3HR0A 1N33T 4HWHA 2BS2A 1Z0PA 2WWVA 4JI2T 3AAEB 4IDZA 3S4UA 5HEJA 3TLSA 2ACXA 4CFXB 4QWNB 3UFGA 4DR3T 1ZV4X 1HX1B 4GK0E 2CCQA 4IE4A 2XQ7A 5LMNT 5E0OA 2I59A 4CZZB 2XJ7A 4EZ4A 5KMGP 4ZI2D 5AQSB 1B7TA 3ANWB 4KMCA 5HBEB 5ABEA 4XBFB 4OB1B 4BCQB 1C9BA 5EK2A 1AHJB 2DNXA 3E08A 3CKDA 4BCHB 3EVYA 2IW5B 5CB4E 2MAWA 1MMGA 2HHHT 5FL1A 2IVXA 3QNUA 2X0LB 2A72A 2M67A 5IHYA 1OIUB 2CXDA 5KDMC 2NTXA 5AQNB 1Y64B 3SS1A 3WVDB 4AISA 2LT3A 2D0UA 2RP4A 4UEMA 3KBTA 5FGKB 2KSRA 1J5ET 4CI2B 4UN0A 1VYWB 3Q5WA 4MFDA 1T72A 4OX9T 4BCNB 1MMNA 4EOLB 2VKHA 4ZGJB 5LGUB 1JSTB 3ZKRA 4YT0A 2DWKA 3FZHB 4JBWF 3O9XA 1O9KB 2SPCA 1Y01A 2VB6A 2V7MA 4EORB 4TZ4C 3LJCA 4ZEYA 4HE8A 2ZPBB 4BCMD 4RODA 1UK5A 3HKBE 4O4JE 5JRCA 2I6HA 1VCSA 1AJ3A 3ZMZB 3G06A 4I43B 1OL1B 3IBPA 2VVNA 3J9X1 2PJQA 3POMA 3A7MA 1HF8A 4FM4B 4UV8B 2UUCT 2N9DA 4DR4T 3GN5A 1UUSA 2HPJA 2LSKA 2YDSA 2L9QA 2E2AA 2CCHB 2MOZA 5AQQB 4U2YA 2ZLYA 4DV7T 4H9QC 2KT9A 2ZPIB 4DO0A 2I40B 5AQOB 5J0ZA 5AQJB 3AE4A 4B3TT 2PTFA 4HFBA 3UUBA 5DQWA 4COFA 5AQMB 5CGMA 2KLQA 2QYWA 1T8BA 3QZ5B 4TX5A 2JJ9A 2B9RA 4LFBT 3KDSE 4YLHA 4JYAT 4YC3B 3FXDB 3ZSTA 2JQKA 4CXWA 3ZC0A 4DMWA 3AEEA 2DXCB 1UNGD 3K8PC 4BJMA 2VKOA 2HN2A 2V7JA 3AA7B 4U74A 4A56A 4IMYB 1UGPB 1UCUA 5FKYA 3PJAJ 3RPUA 4ERRA 3PURA 4ASKA 4E7ZA 2WQYA 4X1YE 3TLTA 3AVSA 3PO3S 2C5JA 3UUXB 2K24A 2D0QB 2WXVB 4HEAA 4YOOA 1IJ6A 3J7Yq 3CX7B 3HHTB 3QYEA 4IDNA 3Q5XA 4A97A 2W00A 3MY5B 1E1HB 4ANJA 1H24B 4LMKA 1D1AA 4EOMB 1JOWA 3RC3A 1GUXB 2XTLA 3K3NA 3OBVE 3OYZA 4FI5A 1H1SB 2XQYA 2HPLA 1OI9B 5AQPB 1VOLA 2X0YA 4OYKA 5CJ5A 1V29B 1XWMA 2NTYA 4LFAT 3QYGB 2A9UA 2EHOD 4EC9B 3TW6A 3TLUA 3H3MA 3N9LA 4NUVA 4CFVB 2Q9QA 4WNKA 1P5EB 4OK0A 2ODUA 1VOMA 5LB7B 4EXTA 5FMNA 1HG5A 1TFBA 3X28B 2YU2A 4G6LB 2W4XA 2UXCT 1S94A 5TAOA 1GY3B 3BG5A 1XMQT 2WAUA 3EIDB 4O4HE 2LOSA 2G9XB 2Y6XA 2WPAB 4IIJE 1WYCA 3ZT5A 3IEEA 3JCFA 4CRLB 4EYUA 4Q25A 3PUYF 4WZXA 4LF8T 4KX6A 1H1RB 4IL9A 4NUUA 3LSVA 4NSTB 5HXCA 2CXFA 4CXYA 4YSXA 2V22B 2LHNA 3VRBA 4U7IA 4O8SA 3PJAA 3GWHA 5JRCB 3AEFA 1O3XA 2XAJB 4ADZA 3TNWB 4DMVA 3X20B 2NR4A 4WYVA 2BBJA 3UU5A 3IF8B 4NXNT 4TNWA 1BR4A 1N36T 3N9QA 3B13A 2WSSV 5J2UE 3OVUA 4JI3T 3P8CD 5LHHB 2WZIA 1GH6B 2ZPEB 2JQ9A 4G63A 2LEHA 2LSYA 4H9PC 2NW7A 4ZGEB 2DPPB 2WMAB 1OL2B 1SA0E 4C90A 2L3LA 2X68A 3CQXC 1M7KA 2YKSA 5FY0A 5LJMA 5LQFB 4NXMT 2WHBB 5BR8T 4H9NC 4JX6A 2Y48B 2JIWA 3ZYKA 1E2AA 3AE6A 2V8SV 3I1AA 3HL6A 1MIWA 4YHJA 2H89A 1IBMT 3L39A 2CE7A 4BCOB 3KV5A 3TLVA 2K3WA 3B5MA 4U3CA 3JAEA 1FINB 4YTNA 2DI4A 4B3ST 2C5XB 3BK9A 1MNEA 2VL8A 3JC6C 5FVLA 3LK2B 4P09A 5CYIB 4ISSA 4LF5T 4TUYE 2JGZB 1KEYA 1QUUA 2YDQA 1OEDB 3CQCB 2QGSA 4JX5A 1NAFA 3CWZB 2X9HA 2BZBA 2LE8A 3V5SA 2CCIB 3VKHA 2XAGB 4I55E 4ILCA 2AE9A 3KV6A 2BDEA 1TD6A 3VHLA 5FNVE 4EB6E 2C4GB 4DR7T 4V1Av 2G77A 3TNIB 5HEHA 3IHRA 2VVSA 3N2GE 3EDVA 3WAJA 2XAFB 1BR1A 4IHJE 3UU6A 3ZT6A 4LF4T 2BBHA 2B76A 4X5TA 3HA4A 3BQLA 1H4LD 1D0YA 4HLQA 4OB3B 3FB2A 1OEDE 3ABVA 5IF1B 3R6NA 4EEBA 4YJ3E 5L47A 3G33B 2J4GA 5HWYA 2CYZB 2V1DB 5L3GB 1JNRA 4DV0T 1WRDA 4H9SE 5LBQB 2KINB 3PUZF 4KI0F 1IJ5A 3AE1A 2WU2A 5EZYE 3F2EA 2D2SA 4BCKB 3RGFB 1W09A 3ZMTB 1JNZA 5HXHA 4OYJA 3RF1A 4B6XA 4Z8XA 3A8HB 1OGUB 3SOLA 4CFUB 2R6GF 2VKJA 3FZLB 2YINA 4JI4T 3KV9A 2MTQA 5HEOA 3EJ1B 1MMDA 3X1DA 5ABHA 3H3AA 4HTEA 3ZJ1A 5IUXA 3AE3A 4YHHT 2W63A 4QSHA 3N5LA 4PFPA 3MJXA 2KNDA 2Q9QB 2PBIA 2CBJA 3AEAA 5LG4A 4DV3T 3GN5B 4PJNA 1FEWA 2W62A 2UZEB 2I0MA 3RLFF 3K3QC 4EOOB 3SFDA 3OJAA 2PHGA 3JC6D 2LOPA 1ZEEA 4KUMB 1D0ZA 4KP3C 2W9ZA 4JX4A 4BBRM 2ZM8A 4ELLA 4JI0T 2UUEB 4U31A 1D1CA 1WYBA 1CHUA 3A8MB 1N32T
chains in the Genus database with same CATH topology
4QX8B 3ZPOA 2HPJA 2LSKA 1FIOA 1HTJF 1U4QA 3N9OA 1BR2A 2A3DA 2L9QA 2ZM0A 2MOZA 5LCYA 3QK6A 5JH7E 3CPZA 5BMVE 5HXEA 2ZLYA 5JVDE 5L3CB 4H9QC 2CM0A 2KT9A 2X9XA 2VWAA 2JRKA 3HKDE 4DO0A 5KX5E 2PFVA 1V9DA 3BQKA 1BR0A 5GONE 2K9AA 2XAQB 3DP7A 3SWHA 5JDGA 1ZHCA 5LOVE 2DCFA 2W61A 5DQWA 5CA0E 2LM9A 2KWIB 2KLQA 5HWXA 1UX4A 3GMIA 3UTKA 4JEHB 4TX5A 4UVAB 2JJ9A 3AA0B 4PJMA 3VKGA 2JMHA 3U78A 2Q9QC 1YKHB 3KDSE 3FXEB 4YLHA 3N2OA 3FXDB 3CVRA 5LHIB 5C8YE 4JEUB 2LHRA 4CXWA 3ZC0A 4DMWA 1YKEB 5L3DB 3MZKB 4FJOA 4DNDA 3K8PC 4BJMA 5JR9A 5JDLA 1LVKA 3C50A 2B1EA 4UVBB 3UUNA 4HGAA 3LBXA 2Y8DA 2VKOA 4DVDA 2H7OA 5A1LA 4UF0B 3KVBA 2Q9QD 2V7JA 3AA7B 1LRZA 3E0ZA 4U74A 3ZMVB 4A56A 4AQFA 4OHFA 1UCUA 2ODVA 1NWMX 1HFAA 4AQGA 4CQIA 3AAIA 1YW0A 1UX5A 1LKXA 1ZKEA 2NP9A 4ZOLE 3RPUA 3RX6A 2E9XB 4EZHA 4ERRA 3PURA 4ASKA 3LG7A 2KXPB 3WI3A 4ZS3A 5AFUL 2CLYC 4EOZB 2RA1A 3D0TA 4WW0A 4E7ZA 4X1YE 3ZEFB 4JUYA 1SHZC 2HH7A 4H9OC 3PUSA 5DQVA 2C5IT 3AVSA 4UXNB 2C5JA 3UUXB 2K24A 4PW8A 2N2NA 4HEAA 1HX8A 3RKOA 3O1HA 2DHRA 3RRWA 3RC8A 1IJ6A 2V7IA 3NZPA 2XHEB 3UFEA 3J7Yq 4WBOA 3CX7B 4P0BA 5ADXL 5FXXA 2CA5A 4PJJA 3C4ZA 3Q5XA 3ETUA 2W00A 3OYXA 1E1HB 4ANJA 5J2TE 1H7CA 3ZYLA 1D1AA 4UV9B 4DBQA 3RC3A 4TV8E 1OWAA 2XTLA 3K3NA 3KFWX 3OBVE 3OYZA 4FI5A 4HKAA 4PK6A 5JDQA 2XQYA 2HPLA 2LSJA 3EUHA 4YJ2E 5FP3A 2K48A 4EIWA 1WLXA 4X1KE 2Z6EA 3GA8A 3ZC1A 4OYKA 2NTYA 4O4LE 4UIGA 3RYFE 4ZI3D 2EHOD 3LBXB 4ZI3C 1VRBA 2ZM2A 2X51A 4H63V 4PJLA 4EAHA 3N9LA 2IC9A 4NUVA 1MIYA 4F6RC 4AKIA 1CUNA 2Q9QA 4QHOA 4WNKA 2NOXA 5HAXA 2LSIA 4C91A 3H37A 3BQIA 4OK0A 4UELA 2ODUA 1VOMA 2CWOA 3LK3B 5F3JA 3CX6B 5LGTB 4EXTA 5FMNA 3PUAA 1HG5A 2YU2A 3UUMA 5EK3A 3ZMSB 1S94A 5TAOA 1MIVA 2MBGA 1KK7A 2WAUA 4QXBB 4GOUA 4I4TE 2E9XC 4O4HE 2VK9A 1EZ3A 1T98A 5M4YA 3OKQA 2CEAA 3U3IA 3C4XA 3KBUA 2XASB 5ETWA 2LOSA 5LHGB 3PU3A 3LFMA 3HKCE 2MYSA 3CQGB 4H63H 4XZCA 1D0XA 3O1IA 2Y6XA 5CA1E 1KNZA 4IIJE 1WYCA 2H7VC 3IEEA 2V7LA 3RYIE 1FMVA 4E7SA 4EYUA 4IE5A 2L8KA 2E9XA 5H6QB 1IZNB 3L3PA 3K3OA 4NUUA 1WR6A 3PE0A 5HXCA 2CXFA 4U72A 4CXYA 3MK7C 5FXWA 3F57A 2DLRA 2LHNA 3MA9A 4AI6A 4AKRB 4CI3B 5JR9C 4QXHB 3T8OA 4ISTA 3V5UA 5LYJE 1HCIA 4O8SA 5JQGE 3GWHA 1G73A 5JRCB 1O3XA 2XAJB 4MBQA 3E22E 2YK0A 4ADZA 2ES0A 2YU1A 5L3EB 5LNKA 4DMVA 3ZLIA 2K5BB 3PDYA 3CX8B 3I9WA 1MNDA 2C5KT 5HXSA 2LSGA 2WMNA 3IF8B 1IAPA 4L5GA 2W0GA 5LJNA 3I9YA 1OXZA 1BR4A 3KVAA 5JDMA 5LP6E 4J2CA 3AA6B 3N9QA 3B13A 4ZI7E 4QKNA 4O2AE 3ZMUB 2EHOC 2WSSV 2G0UA 5L3BB 5J2UE 5FY1A 4HFVA 3RYCE 2E9XD 3P8CD 4PAGA 5LHHB 3FHNA 1HS7A 3N9PA 3MACA 4G63A 2LEHA 2LSYA 4H9PC 2X9YA 4ZS2A 5JDFA 3NZQA 2NW7A 3KV4A 4M1PA 4BJNA 2D0TA 3I0OA 3ZJ2A 1U5PA 1SA0E 4MHCA 5H6RB 5JREA 4GIWA 5JDNA 3P7IA 2L3LA 4C90A 5F8PA 2X68A 3AVRA 3C4WA 3CQXC 3ZN0B 2VKDA 4X20E 2CMRA 3N9MA 3AA1B 5DABA 4TV9E 2WMOA 3MKDA 2KMFA 2J1DG 5FY0A 5LJMA 4IE6A 4EYYR 2IC6A 2A2FX 4H9NC 2H3RA 4KBMB 2Y48B 4BA9A 4L9IA 3ZYKA 4CI1B 1YD8G 3I1AA 2ZMAA 3WAKA 3HL6A 3C98B 1MIWA 4YHJA 3B57A 2CE7A 3ZYMA 4AKLA 3KV5A 2UXNB 1MMAA 3DTOA 2JPFA 2CLYB 2JMKA 2V26A 4AQFC 3HI2A 2DI4A 4GYSA 4MLKA 2E8IA 3NRXA 4G2AA 3R84B 5FXZA 3RH3A 3N2KE 4I50E 3BK9A 1MNEA 2VL8A 3O4XE 3PUQA 2XAHB 2OA5A 5LXTE 4YFSA 1QSDA 3JC6C 4ZHQE 1G8XA 3RYHE 4PK4A 4H9RC 3HR0A 3LK2B 4P09A 4ISSA 4TUYE 3ZCJA 3QC9A 1QUUA 3CQCB 2X66A 2QGSA 1Z0PA 2BVLA 1NAFA 3CWZB 3AAEB 2X9HA 2BZBA 4IDZA 3ANWA 2LE8A 4DBRA 3TKLB 3V5SA 3NBXX 5J1GA 1D1BA 2XAGB 3VKHA 4HN9A 2JQQA 3KV6A 4I55E 3S4UA 2BDEA 3VHLA 2VASA 2ACXA 5FNVE 4EB6E 4AKGA 3ONXA 4L0RA 4OFZA 4V1Av 3DJBA 4QWNB 5HYAA 5JDHA 3EDUA 3IHRA 3PTRB 1ZV4X 2EHOA 3FBLA 4GK0E 3N2GE 2V7KA 2CCQA 2GK9A 3EDVA 2UXXB 4IE4A 4WBNE 3WAJA 3L09A 4GYRA 3Q9DA 2XUEA 5E0OA 4AXPA 2XAFB 3PUGA 1BR1A 4IHJE 2I59A 2QA7A 4CZZB 4EZ4A 2X9WA 2X67A 5KMGP 4ZI2D 1B7TA 3A5XA 3ANWB 3HA4A 3BQLA 2IAKA 4KMCA 5JR9B 2NWBA 1D0YA 3FB2A 5L2LA 4XBFB 4X1IE 4XAXB 3R6NA 5FXVA 4IE0A 2CWYA 2C0SA 4UF0A 4YJ3E 5EK2A 1US7B 2DNXA 3E08A 3CKDA 4BAYB 5FY7A 2PG8A 3EVYA 3N9NA 2IW5B 3SRZA 4MFRA 5HWYA 2CXLA 5CB4E 2V1DB 5L3GB 1MMGA 5LA6E 2NW9A 1WRDA 5LBMA 4H9SE 5LBQB 2X0LB 2A72A 4O4IE 2BVMA 4IE7A 5DJQC 2M67A 3PU8A 2KINB 2WWUA 4ZI2C 5IHYA 5L3FB 2CXDA 5KDMC 1FMWA 2NTXA 2KWHA 1Y64B 1IJ5A 2DWGA 3HKEE 5HXRA 4O2BE 5EK4A 5EZYE 2LT3A 3SS1A 1S35A 3F2EA 3ETVA 2D2SA 4QX7B 3ZCIA 4N78D 2D0UA 3Q2MA 4PK5A 3ZMTB 5HXHA 4OYJA 4B6XA 4Z8XA 3SOLA 2RP4A 2D5UA 4UEMA 3KBTA 4CI2B 2VKJA 4P0AA 2YINA 3C51A 3Q5WA 2P9BA 3KV9A 2MTQA 4PFOA 3C64A 5FYMA 1MMDA 1MMNA 3AAAB 3O1JA 2VKHA 5LGUB 4CXXA 5LGNB 1LVFA 2DWKA 3H3AA 4HTEA 3ZJ1A 2WM9A 3F31A 3UT5E 3O9XA 2W63A 5IYZE 2YEVC 3LK42 3N5LA 3RRCA 2SPCA 4PFPA 3MJXA 2KNDA 2Q9QB 2VB6A 2PBIA 2EHOB 1HG2A 2V7MA 5LG4A 3GN5B 4TZ4C 4PJNA 3LJCA 3UULA 1FEWA 4ILUA 3I0QA 3FBZA 2NW8A 2W62A 4GK5E 4JLEA 4HE8A 3AB3B 4IGUA 2KZ7B 4PNIA 3W15B 3K3QC 4QXCB 4AKHA 3HKBE 4O4JE 3OJAA 5JRCA 1AJ3A 3JC6D 2LOPA 1ZEEA 3ZMZB 3ESLA 4MALA 4KUMB 1D0ZA 4KP3C 4I43B 3IBPA 2WBLA 2ZM8A 2LJLA 3M65A 4K0UA 4UVCB 1X79A 3J9X1 2N1GA 1D1CA 3NRYA 1WYBA 3VU7H 2PJQA 3CMLA 3KINB 3QUJA 1HF8A 4TN7B 4UV8B 2N9DA 3MXZA 3GN5A 3ZN1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B57 A;  5DQW A;  3DTO A;  5IHY A;  2PJQ A;  2QGS A;  5DQV A;  3DJB A; 
#chains in the Genus database with same CATH topology
 4QX8 B;  4HNU A;  5ABF B;  2QDJ A;  4CFN B;  3ZPO A;  2QQ8 A;  1U4Q A;  3N9O A;  2A3D A;  3QK6 A;  5JH7 E;  5BMV E;  5HXE A;  5JVD E;  3QWL A;  1JSU B;  1URC B;  2JRK A;  3Q5D A;  3HKD E;  3OPC A;  1H1P B;  1UGO A;  2PFV A;  1BR0 A;  2ZPH B;  5JDG A;  3A8G B;  2XAQ B;  3DP7 A;  1ZHC A;  2BS4 A;  5CA0 E;  2KWI B;  1BU2 A;  3GMI A;  4EOI B;  4UVA B;  2AHJ B;  2QRX A;  3N2O A;  3CVR A;  1X9B A;  3M03 A;  4JEU B;  3MIA B;  4FJO A;  4DND A;  3RQU A;  2C5V B;  3C50 A;  2UZB B;  2B1E A;  3UUN A;  4HGA A;  3LBX A;  4LF9 T;  1E7P A;  4DVD A;  3BLH B;  2H7O A;  4DR6 T;  1LRZ A;  4OR5 B;  4AQG A;  3AAI A;  1YW0 A;  1UX5 A;  1OKW B;  4ZOL E;  1ZKE A;  2V5C A;  5AQK B;  2IIU A;  4U2Z A;  3D0T A;  3EOC B;  3ZEF B;  3SFE A;  3PUS A;  4IDO A;  1SE7 A;  4YXD A;  4EOQ B;  2N2N A;  1H1Q B;  3O1H A;  2DHR A;  2XHE B;  1XNR T;  1UGR B;  4EV6 A;  4P0B A;  1XMO T;  2BG9 E;  4PJJ A;  4EGW A;  3C4Z A;  1W9R A;  2XQ9 A;  1DU2 A;  1H7C A;  1IRE B;  2R7G A;  1OWA A;  5JDQ A;  2KR6 A;  3FZF B;  4HKA A;  4YSY A;  4X66 T;  3EUH A;  4X1K E;  2ZZD B;  1KXU A;  4UIG A;  4ZI3 D;  3P4P A;  5AQF B;  3LBX B;  4LMJ A;  1OED A;  4ZI3 C;  1VRB A;  4JI6 T;  5L4H A;  2ZPG B;  1HNW T;  3MY1 B;  2IW8 B;  2NOX A;  2XQ8 A;  2LSI A;  3H37 A;  3RQW A;  4U33 A;  5LGT B;  3CX6 B;  3PUA A;  1GUX A;  2WIP B;  2CRB A;  4B3M T;  2MBG A;  4GOU A;  5ACB A;  4I4T E;  1VCT A;  2CHO A;  3OKQ A;  2XQA A;  2IUB A;  3UU4 A;  4CN4 A;  5LHG B;  1IBL T;  3HKC E;  2MYS A;  2W9F A;  1D0X A;  3LQ5 B;  1T7S A;  4E7S A;  3T1H T;  3EAB A;  4ELJ A;  1WR6 A;  3PE0 A;  3RIF A;  4U72 A;  3MK7 C;  2QVA A;  2DLR A;  5AQG B;  4CI3 B;  2FJB A;  4B3R T;  4IST A;  3V5U A;  4X64 T;  2WJ9 A;  4MBQ A;  3BG9 A;  2HN1 A;  2YK0 A;  2ES0 A;  3AEG A;  4DV2 T;  2YU1 A;  1Z8U A;  5LNK A;  3CX8 B;  2C5K T;  3NVO A;  5HXS A;  2YDR A;  3CIR A;  2WMN A;  2F4V T;  5LP6 E;  2XQ3 A;  4QH5 A;  4J2C A;  4HFI A;  1XO2 A;  2G0U A;  5L3B B;  4HFV A;  3RYC E;  1G3N C;  3FHN A;  4X62 T;  4YTP A;  5JDF A;  3NZQ A;  4M1P A;  5AQU B;  3I0O A;  3ZJ2 A;  1U5P A;  5H6R B;  4MHC A;  4GIW A;  2BKO A;  3P7I A;  4HWD A;  3AVR A;  2DD4 B;  4X20 E;  2CMR A;  3MKD A;  2J1D G;  2LM2 A;  1L0V A;  3VR9 A;  4KHZ F;  3AE5 A;  4KBM B;  4BA9 A;  3QZ9 B;  2ZMA A;  3Q5E A;  4YOZ A;  1VIN A;  4AKL A;  2FUP A;  2V26 A;  2CLY B;  3HI2 A;  4MLK A;  2E8I A;  3GTM S;  3BHU B;  5FXZ A;  3RH3 A;  3N2K E;  4DV5 T;  3QYB A;  3RYH E;  4H9R C;  2DME A;  1D3U B;  3ZCJ A;  3QC9 A;  3BLR B;  4CFW B;  2BVL A;  2IDO B;  2LW4 A;  3F5X B;  4DBR A;  3TKL B;  2WB5 A;  5J1G A;  1D1B A;  2JQQ A;  2V6Y A;  4YTM A;  4Y72 B;  4AKG A;  4BXX X;  5LMU T;  4OFZ A;  3DJB A;  3EDU A;  4FX3 B;  5LMK B;  2EHO A;  3VR8 A;  2V7K A;  2GK9 A;  4WBN E;  4GYR A;  3Q9D A;  2XUE A;  3OTO T;  4AXP A;  5IWA T;  2X67 A;  2MPK A;  3A5X A;  4F6W B;  2IAK A;  5JR9 B;  3UU3 A;  4EON B;  2NWB A;  4CFM B;  4Z6Y A;  2WZH A;  5FXV A;  4UF0 A;  1US7 B;  5FY7 A;  3N9N A;  3SRZ A;  4MFR A;  3HBL A;  3EI0 A;  2KMG A;  5LA6 E;  2NW9 A;  1KFY A;  5LBM A;  3PUW F;  4A98 A;  5ICP B;  1ENW A;  4IE7 A;  2UU9 T;  4HFE A;  3PU8 A;  4DUY T;  1XNQ T;  2KWH A;  2DWG A;  3PUV F;  2V6Y B;  4O2B E;  1S35 A;  3ETV A;  4QX7 B;  1KF6 A;  3BLQ B;  2IHR 1;  4N78 D;  1M62 A;  4HFC A;  3NKZ A;  3Q2M A;  4PK5 A;  3BHT B;  5I5Z B;  1JKW A;  2WP9 A;  2D5U A;  4P0A A;  1HNX T;  2P9B A;  4ROE A;  4A5X A;  3QHW B;  4CXX A;  5LGN B;  2W96 A;  1LVF A;  2WM9 A;  3F31 A;  3TN8 B;  2WS3 A;  4IT4 A;  5IYZ E;  2LKG A;  5HCJ A;  5C3J A;  4AIU A;  1H26 B;  2C5O B;  1HG2 A;  1H25 B;  5BNJ B;  4ILU A;  3I0Q A;  2X0H A;  4GK5 E;  2XPK A;  3AB3 B;  4QH1 A;  4PNI A;  4QXC B;  1I94 T;  5F5W A;  3ESL A;  4M6V A;  4MAL A;  4GKJ T;  2LJL A;  4K0U A;  1X79 A;  5LG3 A;  3KIN B;  3MXZ A;  3ZN1 B;  4X65 T;  1HTJ F;  1WCR A;  5LCY A;  1F5Q B;  2M6B A;  2CM0 A;  4DV1 T;  2X9X A;  2VWA A;  2WDR A;  3AE8 A;  3AEC A;  1V9D A;  3DDQ B;  1UNH D;  5IDN B;  4JI8 T;  5GON E;  3SWH A;  2QFZ A;  2LM9 A;  5AQV B;  1UX4 A;  2QF7 A;  4F6U B;  4JEH B;  4ILA A;  4PJM A;  2JMH A;  3U78 A;  2Q9Q C;  1YKH B;  5L2W B;  4GKK T;  4EC8 B;  1UGQ B;  3QB5 K;  5LHI B;  1YKE B;  1UNL D;  5L3D B;  2BG9 A;  2XQ4 A;  1LVK A;  4DR1 T;  2YN6 A;  5A1L A;  2Q9Q D;  2BPM B;  3E0Z A;  3ZMV B;  4AQF A;  2XSB A;  4EOS B;  2ODV A;  2LRK A;  1NWM X;  1HFA A;  3RX6 A;  5EJC A;  4EZH A;  3JAD A;  3NWI A;  3WI3 A;  4ZS3 A;  2CLY C;  4EOZ B;  4JUY A;  4H9O C;  4DR2 T;  2C5I T;  2RPA A;  2J47 A;  4PW8 A;  1W0A A;  1HX8 A;  3RKO A;  4F8H A;  3RC8 A;  2UXB T;  2V7I A;  5ADX L;  2CA5 A;  3HZJ A;  4F7S B;  1ZP0 A;  2VL0 A;  3A8O B;  4TV8 E;  3H4C A;  5FP3 A;  2K48 A;  4EOJ B;  2CBI A;  2OLT A;  2Z6E A;  3GA8 A;  3ZC1 A;  5HEU A;  4O4L E;  1YQ4 A;  4HNT A;  2XSA A;  4HFH A;  2BKZ B;  4F7J B;  2X51 A;  4H63 V;  1MIY A;  5EFQ B;  4AKI A;  1CUN A;  4UEL A;  5F3J A;  3RHW A;  5EK3 A;  2FBW A;  3ZMS B;  3IA3 A;  1MIV A;  2WU5 A;  4QXB B;  3RIU A;  2E9X C;  1EZ3 A;  5M4Y A;  3P50 A;  4HWC A;  3U3I A;  4F7N B;  4ROC A;  2XM2 A;  2XAS B;  5ETW A;  3PU3 A;  3NDQ A;  3LFM A;  4H63 H;  3CQG B;  4XZC A;  2YOE A;  5CA1 E;  3O1I A;  1KNZ A;  2PMI B;  4OB2 B;  5AQL B;  3KHI A;  2V7L A;  4HWI B;  4DV6 T;  4ZZC A;  4IE5 A;  2L8K A;  2E9X A;  5H6Q B;  2IN3 A;  3L3P A;  4JI7 T;  3K3O A;  4TWF A;  5FXW A;  4BCN D;  4MIM A;  3F57 A;  2AXD S;  4AKR B;  2J62 A;  5JR9 C;  4QXH B;  3T8O A;  5AQH B;  3UQ4 A;  5JQG E;  4BCP B;  1G73 A;  2D9D A;  4DR5 T;  2W67 A;  3E22 E;  3X25 B;  5L3E B;  2DXB B;  3I9W A;  5JTG A;  1IAP A;  3I9Y A;  3AA6 B;  4ZI7 E;  4QKN A;  3P4R A;  5HBJ B;  5FY1 A;  4CN6 A;  1E9H B;  3X24 B;  3HB9 A;  2E9X D;  4PAG A;  3HO8 A;  3KV4 A;  4KRD B;  4BJN A;  1FVV B;  5JRE A;  5F8P A;  3C4W A;  4CXA B;  4TTH A;  2VKD A;  5HEG A;  3N9M A;  3AA1 B;  2WMO A;  3UQ7 A;  2I53 A;  4IE6 A;  2BKP A;  1OIY B;  4EYY R;  1AD6 A;  2IC6 A;  2H3R A;  1XZY A;  2CZ1 B;  3WAK A;  3QHR B;  4I0U A;  3ZYM A;  3TW7 A;  1KNR A;  2UXN B;  3DL1 A;  3AED A;  3TLW A;  1MMA A;  3DTO A;  2JPF A;  4KRC B;  4GYS A;  3NRX A;  4G2A A;  2ACZ A;  3R84 B;  3X26 B;  2QDY B;  2CJM B;  4BCJ B;  3DDP B;  2OA5 A;  4YFS A;  2CZ7 B;  4ZHQ E;  1H28 B;  1G8X A;  4F70 B;  4PK4 A;  2XY8 B;  2WIH B;  2LRL A;  2LKH A;  3WVE B;  2X66 A;  2BS3 A;  1FKM A;  3ANW A;  2WFY B;  3NBX X;  4HN9 A;  2VAS A;  3ONX A;  4L0R A;  4DV4 T;  5CFB A;  5HYA A;  5JDH A;  3PTR B;  3FBL A;  2W99 A;  1PKD B;  2DD5 B;  2UXX B;  2XZE A;  3L09 A;  3PUG A;  3QXE B;  2QA7 A;  4JI5 T;  1ZP2 A;  4CN1 A;  2XQ5 A;  2X9W A;  5ABG A;  3PV0 F;  4Z90 A;  5L2L A;  1J5W A;  4X1I E;  4XAX B;  1IBK T;  4IE0 A;  1J1J A;  2CWY A;  3RI5 A;  2C0S A;  2H88 A;  1HR0 T;  2W2H A;  2C5N B;  2JQH A;  2WY2 A;  4BAY B;  2UZL B;  1N4M A;  5IDP B;  2PG8 A;  5HQ0 B;  2WMB B;  2VQF T;  3CK6 A;  3LDQ B;  2CXL A;  3VYG B;  5DJQ C;  4O4I E;  4EOP B;  2BVM A;  1I6Z A;  1SUM B;  2WWU A;  4ZI2 C;  5L3F B;  1FMW A;  2WEV B;  5HXR A;  3HKE E;  5EK4 A;  2BG9 C;  1ZOY A;  4CFU D;  3ZCI A;  1N34 T;  2FJA A;  3AE9 A;  3FZK B;  5L4E A;  2W66 A;  3UU8 A;  2UZD B;  5C2T A;  2E5L T;  3ZSS A;  3C51 A;  1OKV B;  4II5 B;  2CPT A;  4ZXL A;  4PFO A;  3C64 A;  5FYM A;  4JV5 T;  2WDQ A;  3AAA B;  3O1J A;  4TNV A;  3QYH B;  3UT5 E;  2IML A;  4HNV A;  5HBH B;  3AXJ B;  1QLB A;  2YEV C;  3LK4 2;  3RRC A;  2CZ0 B;  1XDO A;  2EHO B;  2IW6 B;  4U7Y A;  3UUL A;  3FBZ A;  2NW8 A;  4JLE A;  2ZM6 T;  5CEI B;  3BG3 A;  4IGU A;  2KZ7 B;  3EHZ A;  3W15 B;  4AKH A;  4EOK B;  2C6T B;  4NPP A;  5HNB B;  3VYH B;  2WBL A;  1O9K A;  3M65 A;  2F2C A;  4UVC B;  4LF6 T;  2PK2 A;  2N1G A;  3VU7 H;  3NRY A;  3CML A;  3QUJ A;  4TN7 B;  1WR0 A;  5KXJ A;  2LLY A;  1YQ3 A;  1FJG T;  1FIO A;  3M3Z B;  1BR2 A;  4IDQ A;  2ZM0 A;  5FVK A;  3CPZ A;  5AQI B;  5L3C B;  3P4S A;  4HWF A;  3PUX F;  3QOF A;  3RIU C;  4IRE A;  4F7L B;  5KX5 E;  4BY7 X;  5FL0 A;  3BQK A;  2K9A A;  4LOC A;  5LOV E;  2DL1 A;  2DCF A;  2W61 A;  5HWX A;  3UTK A;  4ILB A;  2UXD T;  3FZM B;  3AA0 B;  3VKG A;  4BCF B;  3RIA A;  2EUF A;  3FXE B;  3K7A M;  3JAF A;  4HL4 A;  2OV9 A;  5C8Y E;  2LHR A;  1W98 B;  3MI9 B;  3T1Y T;  3MZK B;  5JR9 A;  5JDL A;  4UVB B;  1UGS B;  2Y8D A;  4ZGD B;  1YXR A;  4UF0 B;  3KVB A;  2X1N B;  4OHF A;  2UUA T;  4CQI A;  1LKX A;  2NP9 A;  4AQY T;  2E9X B;  4NC6 A;  3LG7 A;  2KXP B;  5AFU L;  4OB0 B;  2RA1 A;  4WW0 A;  1SHZ C;  2HH7 A;  5DQV A;  4K0K T;  4UXN B;  3BHV B;  4EED A;  3RRW A;  3NZP A;  4P1N A;  3UFE A;  4WBO A;  3A8Y C;  4BBS M;  5FXX A;  4QH4 A;  5AQT B;  3ETU A;  3OYX A;  4KHP T;  5J2T E;  3ZYL A;  4UV9 B;  4DBQ A;  2M6I A;  4F6S B;  3KFW X;  4PK6 A;  4YY3 T;  2LSJ A;  4YJ2 E;  4YOS A;  1XDP A;  4EIW A;  1WLX A;  2IW9 B;  2XM1 A;  3RYF E;  4NIQ A;  2ZM2 A;  1QMZ B;  4PJL A;  3VRA A;  4EAH A;  5AQR B;  2IC9 A;  2PK9 B;  4F6R C;  3L8R A;  3O0G D;  4QHO A;  2FJD A;  5HAX A;  4I3Z B;  4C91 A;  3BQI A;  4OGR B;  2CWO A;  3LK3 B;  3DOG B;  3P4W A;  3RKG A;  4BCQ D;  3P4Q A;  3UUM A;  1NEK A;  4HFD A;  1KK7 A;  2W2U A;  2FJE A;  2VK9 A;  4BCI B;  1T98 A;  3RGL A;  3AE2 A;  2VUR A;  2CEA A;  3C4X A;  3KBU A;  1R8I A;  3K1S A;  3TNH B;  4JI1 T;  2ZCF B;  1GQE A;  4TWD A;  2H7V C;  2WCA A;  3RYI E;  1FMV A;  3ONJ A;  1W0B A;  1IZN B;  4DID B;  3MA9 A;  4AI6 A;  4BY1 X;  5LYJ E;  1HCI A;  4ZZB A;  2VQE T;  1WFD A;  2CZ6 B;  1AIS B;  3ONL C;  4TWH A;  3ZLI A;  4MFE A;  2K5B B;  3PDY A;  1MND A;  2CHN A;  2LSG A;  3A8L B;  4L5G A;  1OED C;  2W0G A;  5ABF A;  5LJN A;  2WDV A;  1OXZ A;  5JDM A;  3KVA A;  3EAM A;  2E5V A;  4O2A E;  2V6X A;  3ZMU B;  2UUB T;  2BG9 B;  2EHO C;  4DUZ T;  2ZPF B;  4IDP A;  4LFC T;  1HS7 A;  3N9P A;  3MAC A;  4LF7 T;  4ZS2 A;  2X9Y A;  3AXJ A;  2D0T A;  2BKN A;  5JDN A;  3AE7 A;  4YSZ A;  4LML A;  3ZN0 B;  1NEN A;  5DAB A;  4TV9 E;  2KMF A;  4Z91 A;  5HVY B;  2A2F X;  3ZT7 A;  4L9I A;  4CI1 B;  1YD8 G;  3C98 B;  2XQ6 A;  3B57 A;  1KNP A;  2V5D A;  4AQF C;  5HCM A;  2JMK A;  4BCM B;  3QB5 A;  1HNZ T;  4IL4 A;  4I50 E;  3AEB A;  4BCG B;  3O4X E;  1UUR A;  4UR9 A;  3PUQ A;  2XAH B;  5LXT E;  1QSD A;  1H27 B;  3HR0 A;  1N33 T;  4HWH A;  2BS2 A;  1Z0P A;  2WWV A;  4JI2 T;  3AAE B;  4IDZ A;  3S4U A;  5HEJ A;  3TLS A;  2ACX A;  4CFX B;  4QWN B;  3UFG A;  4DR3 T;  1ZV4 X;  1HX1 B;  4GK0 E;  2CCQ A;  4IE4 A;  2XQ7 A;  5LMN T;  5E0O A;  2I59 A;  4CZZ B;  2XJ7 A;  4EZ4 A;  5KMG P;  4ZI2 D;  5AQS B;  1B7T A;  3ANW B;  4KMC A;  5HBE B;  5ABE A;  4XBF B;  4OB1 B;  4BCQ B;  1C9B A;  5EK2 A;  1AHJ B;  2DNX A;  3E08 A;  3CKD A;  4BCH B;  3EVY A;  2IW5 B;  5CB4 E;  2MAW A;  1MMG A;  2HHH T;  5FL1 A;  2IVX A;  3QNU A;  2X0L B;  2A72 A;  2M67 A;  5IHY A;  1OIU B;  2CXD A;  5KDM C;  2NTX A;  5AQN B;  1Y64 B;  3SS1 A;  3WVD B;  4AIS A;  2LT3 A;  2D0U A;  2RP4 A;  4UEM A;  3KBT A;  5FGK B;  2KSR A;  1J5E T;  4CI2 B;  4UN0 A;  1VYW B;  3Q5W A;  4MFD A;  1T72 A;  4OX9 T;  4BCN B;  1MMN A;  4EOL B;  2VKH A;  4ZGJ B;  5LGU B;  1JST B;  3ZKR A;  4YT0 A;  2DWK A;  3FZH B;  4JBW F;  3O9X A;  1O9K B;  2SPC A;  1Y01 A;  2VB6 A;  2V7M A;  4EOR B;  4TZ4 C;  3LJC A;  4ZEY A;  4HE8 A;  2ZPB B;  4BCM D;  4ROD A;  1UK5 A;  3HKB E;  4O4J E;  5JRC A;  2I6H A;  1VCS A;  1AJ3 A;  3ZMZ B;  3G06 A;  4I43 B;  1OL1 B;  3IBP A;  2VVN A;  3J9X 1;  2PJQ A;  3POM A;  3A7M A;  1HF8 A;  4FM4 B;  4UV8 B;  2UUC T;  2N9D A;  4DR4 T;  3GN5 A;  1UUS A;  2HPJ A;  2LSK A;  2YDS A;  2L9Q A;  2E2A A;  2CCH B;  2MOZ A;  5AQQ B;  4U2Y A;  2ZLY A;  4DV7 T;  4H9Q C;  2KT9 A;  2ZPI B;  4DO0 A;  2I40 B;  5AQO B;  5J0Z A;  5AQJ B;  3AE4 A;  4B3T T;  2PTF A;  4HFB A;  3UUB A;  5DQW A;  4COF A;  5AQM B;  5CGM A;  2KLQ A;  2QYW A;  1T8B A;  3QZ5 B;  4TX5 A;  2JJ9 A;  2B9R A;  4LFB T;  3KDS E;  4YLH A;  4JYA T;  4YC3 B;  3FXD B;  3ZST A;  2JQK A;  4CXW A;  3ZC0 A;  4DMW A;  3AEE A;  2DXC B;  1UNG D;  3K8P C;  4BJM A;  2VKO A;  2HN2 A;  2V7J A;  3AA7 B;  4U74 A;  4A56 A;  4IMY B;  1UGP B;  1UCU A;  5FKY A;  3PJA J;  3RPU A;  4ERR A;  3PUR A;  4ASK A;  4E7Z A;  2WQY A;  4X1Y E;  3TLT A;  3AVS A;  3PO3 S;  2C5J A;  3UUX B;  2K24 A;  2D0Q B;  2WXV B;  4HEA A;  4YOO A;  1IJ6 A;  3J7Y q;  3CX7 B;  3HHT B;  3QYE A;  4IDN A;  3Q5X A;  4A97 A;  2W00 A;  3MY5 B;  1E1H B;  4ANJ A;  1H24 B;  4LMK A;  1D1A A;  4EOM B;  1JOW A;  3RC3 A;  1GUX B;  2XTL A;  3K3N A;  3OBV E;  3OYZ A;  4FI5 A;  1H1S B;  2XQY A;  2HPL A;  1OI9 B;  5AQP B;  1VOL A;  2X0Y A;  4OYK A;  5CJ5 A;  1V29 B;  1XWM A;  2NTY A;  4LFA T;  3QYG B;  2A9U A;  2EHO D;  4EC9 B;  3TW6 A;  3TLU A;  3H3M A;  3N9L A;  4NUV A;  4CFV B;  2Q9Q A;  4WNK A;  1P5E B;  4OK0 A;  2ODU A;  1VOM A;  5LB7 B;  4EXT A;  5FMN A;  1HG5 A;  1TFB A;  3X28 B;  2YU2 A;  4G6L B;  2W4X A;  2UXC T;  1S94 A;  5TAO A;  1GY3 B;  3BG5 A;  1XMQ T;  2WAU A;  3EID B;  4O4H E;  2LOS A;  2G9X B;  2Y6X A;  2WPA B;  4IIJ E;  1WYC A;  3ZT5 A;  3IEE A;  3JCF A;  4CRL B;  4EYU A;  4Q25 A;  3PUY F;  4WZX A;  4LF8 T;  4KX6 A;  1H1R B;  4IL9 A;  4NUU A;  3LSV A;  4NST B;  5HXC A;  2CXF A;  4CXY A;  4YSX A;  2V22 B;  2LHN A;  3VRB A;  4U7I A;  4O8S A;  3PJA A;  3GWH A;  5JRC B;  3AEF A;  1O3X A;  2XAJ B;  4ADZ A;  3TNW B;  4DMV A;  3X20 B;  2NR4 A;  4WYV A;  2BBJ A;  3UU5 A;  3IF8 B;  4NXN T;  4TNW A;  1BR4 A;  1N36 T;  3N9Q A;  3B13 A;  2WSS V;  5J2U E;  3OVU A;  4JI3 T;  3P8C D;  5LHH B;  2WZI A;  1GH6 B;  2ZPE B;  2JQ9 A;  4G63 A;  2LEH A;  2LSY A;  4H9P C;  2NW7 A;  4ZGE B;  2DPP B;  2WMA B;  1OL2 B;  1SA0 E;  4C90 A;  2L3L A;  2X68 A;  3CQX C;  1M7K A;  2YKS A;  5FY0 A;  5LJM A;  5LQF B;  4NXM T;  2WHB B;  5BR8 T;  4H9N C;  4JX6 A;  2Y48 B;  2JIW A;  3ZYK A;  1E2A A;  3AE6 A;  2V8S V;  3I1A A;  3HL6 A;  1MIW A;  4YHJ A;  2H89 A;  1IBM T;  3L39 A;  2CE7 A;  4BCO B;  3KV5 A;  3TLV A;  2K3W A;  3B5M A;  4U3C A;  3JAE A;  1FIN B;  4YTN A;  2DI4 A;  4B3S T;  2C5X B;  3BK9 A;  1MNE A;  2VL8 A;  3JC6 C;  5FVL A;  3LK2 B;  4P09 A;  5CYI B;  4ISS A;  4LF5 T;  4TUY E;  2JGZ B;  1KEY A;  1QUU A;  2YDQ A;  1OED B;  3CQC B;  2QGS A;  4JX5 A;  1NAF A;  3CWZ B;  2X9H A;  2BZB A;  2LE8 A;  3V5S A;  2CCI B;  3VKH A;  2XAG B;  4I55 E;  4ILC A;  2AE9 A;  3KV6 A;  2BDE A;  1TD6 A;  3VHL A;  5FNV E;  4EB6 E;  2C4G B;  4DR7 T;  4V1A v;  2G77 A;  3TNI B;  5HEH A;  3IHR A;  2VVS A;  3N2G E;  3EDV A;  3WAJ A;  2XAF B;  1BR1 A;  4IHJ E;  3UU6 A;  3ZT6 A;  4LF4 T;  2BBH A;  2B76 A;  4X5T A;  3HA4 A;  3BQL A;  1H4L D;  1D0Y A;  4HLQ A;  4OB3 B;  3FB2 A;  1OED E;  3ABV A;  5IF1 B;  3R6N A;  4EEB A;  4YJ3 E;  5L47 A;  3G33 B;  2J4G A;  5HWY A;  2CYZ B;  2V1D B;  5L3G B;  1JNR A;  4DV0 T;  1WRD A;  4H9S E;  5LBQ B;  2KIN B;  3PUZ F;  4KI0 F;  1IJ5 A;  3AE1 A;  2WU2 A;  5EZY E;  3F2E A;  2D2S A;  4BCK B;  3RGF B;  1W09 A;  3ZMT B;  1JNZ A;  5HXH A;  4OYJ A;  3RF1 A;  4B6X A;  4Z8X A;  3A8H B;  1OGU B;  3SOL A;  4CFU B;  2R6G F;  2VKJ A;  3FZL B;  2YIN A;  4JI4 T;  3KV9 A;  2MTQ A;  5HEO A;  3EJ1 B;  1MMD A;  3X1D A;  5ABH A;  3H3A A;  4HTE A;  3ZJ1 A;  5IUX A;  3AE3 A;  4YHH T;  2W63 A;  4QSH A;  3N5L A;  4PFP A;  3MJX A;  2KND A;  2Q9Q B;  2PBI A;  2CBJ A;  3AEA A;  5LG4 A;  4DV3 T;  3GN5 B;  4PJN A;  1FEW A;  2W62 A;  2UZE B;  2I0M A;  3RLF F;  3K3Q C;  4EOO B;  3SFD A;  3OJA A;  2PHG A;  3JC6 D;  2LOP A;  1ZEE A;  4KUM B;  1D0Z A;  4KP3 C;  2W9Z A;  4JX4 A;  4BBR M;  2ZM8 A;  4ELL A;  4JI0 T;  2UUE B;  4U31 A;  1D1C A;  1WYB A;  1CHU A;  3A8M B;  1N32 T; 
#chains in the Genus database with same CATH homology
 4QX8 B;  3ZPO A;  2HPJ A;  2LSK A;  1FIO A;  1HTJ F;  1U4Q A;  3N9O A;  1BR2 A;  2A3D A;  2L9Q A;  2ZM0 A;  2MOZ A;  5LCY A;  3QK6 A;  5JH7 E;  3CPZ A;  5BMV E;  5HXE A;  2ZLY A;  5JVD E;  5L3C B;  4H9Q C;  2CM0 A;  2KT9 A;  2X9X A;  2VWA A;  2JRK A;  3HKD E;  4DO0 A;  5KX5 E;  2PFV A;  1V9D A;  3BQK A;  1BR0 A;  5GON E;  2K9A A;  2XAQ B;  3DP7 A;  3SWH A;  5JDG A;  1ZHC A;  5LOV E;  2DCF A;  2W61 A;  5DQW A;  5CA0 E;  2LM9 A;  2KWI B;  2KLQ A;  5HWX A;  1UX4 A;  3GMI A;  3UTK A;  4JEH B;  4TX5 A;  4UVA B;  2JJ9 A;  3AA0 B;  4PJM A;  3VKG A;  2JMH A;  3U78 A;  2Q9Q C;  1YKH B;  3KDS E;  3FXE B;  4YLH A;  3N2O A;  3FXD B;  3CVR A;  5LHI B;  5C8Y E;  4JEU B;  2LHR A;  4CXW A;  3ZC0 A;  4DMW A;  1YKE B;  5L3D B;  3MZK B;  4FJO A;  4DND A;  3K8P C;  4BJM A;  5JR9 A;  5JDL A;  1LVK A;  3C50 A;  2B1E A;  4UVB B;  3UUN A;  4HGA A;  3LBX A;  2Y8D A;  2VKO A;  4DVD A;  2H7O A;  5A1L A;  4UF0 B;  3KVB A;  2Q9Q D;  2V7J A;  3AA7 B;  1LRZ A;  3E0Z A;  4U74 A;  3ZMV B;  4A56 A;  4AQF A;  4OHF A;  1UCU A;  2ODV A;  1NWM X;  1HFA A;  4AQG A;  4CQI A;  3AAI A;  1YW0 A;  1UX5 A;  1LKX A;  1ZKE A;  2NP9 A;  4ZOL E;  3RPU A;  3RX6 A;  2E9X B;  4EZH A;  4ERR A;  3PUR A;  4ASK A;  3LG7 A;  2KXP B;  3WI3 A;  4ZS3 A;  5AFU L;  2CLY C;  4EOZ B;  2RA1 A;  3D0T A;  4WW0 A;  4E7Z A;  4X1Y E;  3ZEF B;  4JUY A;  1SHZ C;  2HH7 A;  4H9O C;  3PUS A;  5DQV A;  2C5I T;  3AVS A;  4UXN B;  2C5J A;  3UUX B;  2K24 A;  4PW8 A;  2N2N A;  4HEA A;  1HX8 A;  3RKO A;  3O1H A;  2DHR A;  3RRW A;  3RC8 A;  1IJ6 A;  2V7I A;  3NZP A;  2XHE B;  3UFE A;  3J7Y q;  4WBO A;  3CX7 B;  4P0B A;  5ADX L;  5FXX A;  2CA5 A;  4PJJ A;  3C4Z A;  3Q5X A;  3ETU A;  2W00 A;  3OYX A;  1E1H B;  4ANJ A;  5J2T E;  1H7C A;  3ZYL A;  1D1A A;  4UV9 B;  4DBQ A;  3RC3 A;  4TV8 E;  1OWA A;  2XTL A;  3K3N A;  3KFW X;  3OBV E;  3OYZ A;  4FI5 A;  4HKA A;  4PK6 A;  5JDQ A;  2XQY A;  2HPL A;  2LSJ A;  3EUH A;  4YJ2 E;  5FP3 A;  2K48 A;  4EIW A;  1WLX A;  4X1K E;  2Z6E A;  3GA8 A;  3ZC1 A;  4OYK A;  2NTY A;  4O4L E;  4UIG A;  3RYF E;  4ZI3 D;  2EHO D;  3LBX B;  4ZI3 C;  1VRB A;  2ZM2 A;  2X51 A;  4H63 V;  4PJL A;  4EAH A;  3N9L A;  2IC9 A;  4NUV A;  1MIY A;  4F6R C;  4AKI A;  1CUN A;  2Q9Q A;  4QHO A;  4WNK A;  2NOX A;  5HAX A;  2LSI A;  4C91 A;  3H37 A;  3BQI A;  4OK0 A;  4UEL A;  2ODU A;  1VOM A;  2CWO A;  3LK3 B;  5F3J A;  3CX6 B;  5LGT B;  4EXT A;  5FMN A;  3PUA A;  1HG5 A;  2YU2 A;  3UUM A;  5EK3 A;  3ZMS B;  1S94 A;  5TAO A;  1MIV A;  2MBG A;  1KK7 A;  2WAU A;  4QXB B;  4GOU A;  4I4T E;  2E9X C;  4O4H E;  2VK9 A;  1EZ3 A;  1T98 A;  5M4Y A;  3OKQ A;  2CEA A;  3U3I A;  3C4X A;  3KBU A;  2XAS B;  5ETW A;  2LOS A;  5LHG B;  3PU3 A;  3LFM A;  3HKC E;  2MYS A;  3CQG B;  4H63 H;  4XZC A;  1D0X A;  3O1I A;  2Y6X A;  5CA1 E;  1KNZ A;  4IIJ E;  1WYC A;  2H7V C;  3IEE A;  2V7L A;  3RYI E;  1FMV A;  4E7S A;  4EYU A;  4IE5 A;  2L8K A;  2E9X A;  5H6Q B;  1IZN B;  3L3P A;  3K3O A;  4NUU A;  1WR6 A;  3PE0 A;  5HXC A;  2CXF A;  4U72 A;  4CXY A;  3MK7 C;  5FXW A;  3F57 A;  2DLR A;  2LHN A;  3MA9 A;  4AI6 A;  4AKR B;  4CI3 B;  5JR9 C;  4QXH B;  3T8O A;  4IST A;  3V5U A;  5LYJ E;  1HCI A;  4O8S A;  5JQG E;  3GWH A;  1G73 A;  5JRC B;  1O3X A;  2XAJ B;  4MBQ A;  3E22 E;  2YK0 A;  4ADZ A;  2ES0 A;  2YU1 A;  5L3E B;  5LNK A;  4DMV A;  3ZLI A;  2K5B B;  3PDY A;  3CX8 B;  3I9W A;  1MND A;  2C5K T;  5HXS A;  2LSG A;  2WMN A;  3IF8 B;  1IAP A;  4L5G A;  2W0G A;  5LJN A;  3I9Y A;  1OXZ A;  1BR4 A;  3KVA A;  5JDM A;  5LP6 E;  4J2C A;  3AA6 B;  3N9Q A;  3B13 A;  4ZI7 E;  4QKN A;  4O2A E;  3ZMU B;  2EHO C;  2WSS V;  2G0U A;  5L3B B;  5J2U E;  5FY1 A;  4HFV A;  3RYC E;  2E9X D;  3P8C D;  4PAG A;  5LHH B;  3FHN A;  1HS7 A;  3N9P A;  3MAC A;  4G63 A;  2LEH A;  2LSY A;  4H9P C;  2X9Y A;  4ZS2 A;  5JDF A;  3NZQ A;  2NW7 A;  3KV4 A;  4M1P A;  4BJN A;  2D0T A;  3I0O A;  3ZJ2 A;  1U5P A;  1SA0 E;  4MHC A;  5H6R B;  5JRE A;  4GIW A;  5JDN A;  3P7I A;  2L3L A;  4C90 A;  5F8P A;  2X68 A;  3AVR A;  3C4W A;  3CQX C;  3ZN0 B;  2VKD A;  4X20 E;  2CMR A;  3N9M A;  3AA1 B;  5DAB A;  4TV9 E;  2WMO A;  3MKD A;  2KMF A;  2J1D G;  5FY0 A;  5LJM A;  4IE6 A;  4EYY R;  2IC6 A;  2A2F X;  4H9N C;  2H3R A;  4KBM B;  2Y48 B;  4BA9 A;  4L9I A;  3ZYK A;  4CI1 B;  1YD8 G;  3I1A A;  2ZMA A;  3WAK A;  3HL6 A;  3C98 B;  1MIW A;  4YHJ A;  3B57 A;  2CE7 A;  3ZYM A;  4AKL A;  3KV5 A;  2UXN B;  1MMA A;  3DTO A;  2JPF A;  2CLY B;  2JMK A;  2V26 A;  4AQF C;  3HI2 A;  2DI4 A;  4GYS A;  4MLK A;  2E8I A;  3NRX A;  4G2A A;  3R84 B;  5FXZ A;  3RH3 A;  3N2K E;  4I50 E;  3BK9 A;  1MNE A;  2VL8 A;  3O4X E;  3PUQ A;  2XAH B;  2OA5 A;  5LXT E;  4YFS A;  1QSD A;  3JC6 C;  4ZHQ E;  1G8X A;  3RYH E;  4PK4 A;  4H9R C;  3HR0 A;  3LK2 B;  4P09 A;  4ISS A;  4TUY E;  3ZCJ A;  3QC9 A;  1QUU A;  3CQC B;  2X66 A;  2QGS A;  1Z0P A;  2BVL A;  1NAF A;  3CWZ B;  3AAE B;  2X9H A;  2BZB A;  4IDZ A;  3ANW A;  2LE8 A;  4DBR A;  3TKL B;  3V5S A;  3NBX X;  5J1G A;  1D1B A;  2XAG B;  3VKH A;  4HN9 A;  2JQQ A;  3KV6 A;  4I55 E;  3S4U A;  2BDE A;  3VHL A;  2VAS A;  2ACX A;  5FNV E;  4EB6 E;  4AKG A;  3ONX A;  4L0R A;  4OFZ A;  4V1A v;  3DJB A;  4QWN B;  5HYA A;  5JDH A;  3EDU A;  3IHR A;  3PTR B;  1ZV4 X;  2EHO A;  3FBL A;  4GK0 E;  3N2G E;  2V7K A;  2CCQ A;  2GK9 A;  3EDV A;  2UXX B;  4IE4 A;  4WBN E;  3WAJ A;  3L09 A;  4GYR A;  3Q9D A;  2XUE A;  5E0O A;  4AXP A;  2XAF B;  3PUG A;  1BR1 A;  4IHJ E;  2I59 A;  2QA7 A;  4CZZ B;  4EZ4 A;  2X9W A;  2X67 A;  5KMG P;  4ZI2 D;  1B7T A;  3A5X A;  3ANW B;  3HA4 A;  3BQL A;  2IAK A;  4KMC A;  5JR9 B;  2NWB A;  1D0Y A;  3FB2 A;  5L2L A;  4XBF B;  4X1I E;  4XAX B;  3R6N A;  5FXV A;  4IE0 A;  2CWY A;  2C0S A;  4UF0 A;  4YJ3 E;  5EK2 A;  1US7 B;  2DNX A;  3E08 A;  3CKD A;  4BAY B;  5FY7 A;  2PG8 A;  3EVY A;  3N9N A;  2IW5 B;  3SRZ A;  4MFR A;  5HWY A;  2CXL A;  5CB4 E;  2V1D B;  5L3G B;  1MMG A;  5LA6 E;  2NW9 A;  1WRD A;  5LBM A;  4H9S E;  5LBQ B;  2X0L B;  2A72 A;  4O4I E;  2BVM A;  4IE7 A;  5DJQ C;  2M67 A;  3PU8 A;  2KIN B;  2WWU A;  4ZI2 C;  5IHY A;  5L3F B;  2CXD A;  5KDM C;  1FMW A;  2NTX A;  2KWH A;  1Y64 B;  1IJ5 A;  2DWG A;  3HKE E;  5HXR A;  4O2B E;  5EK4 A;  5EZY E;  2LT3 A;  3SS1 A;  1S35 A;  3F2E A;  3ETV A;  2D2S A;  4QX7 B;  3ZCI A;  4N78 D;  2D0U A;  3Q2M A;  4PK5 A;  3ZMT B;  5HXH A;  4OYJ A;  4B6X A;  4Z8X A;  3SOL A;  2RP4 A;  2D5U A;  4UEM A;  3KBT A;  4CI2 B;  2VKJ A;  4P0A A;  2YIN A;  3C51 A;  3Q5W A;  2P9B A;  3KV9 A;  2MTQ A;  4PFO A;  3C64 A;  5FYM A;  1MMD A;  1MMN A;  3AAA B;  3O1J A;  2VKH A;  5LGU B;  4CXX A;  5LGN B;  1LVF A;  2DWK A;  3H3A A;  4HTE A;  3ZJ1 A;  2WM9 A;  3F31 A;  3UT5 E;  3O9X A;  2W63 A;  5IYZ E;  2YEV C;  3LK4 2;  3N5L A;  3RRC A;  2SPC A;  4PFP A;  3MJX A;  2KND A;  2Q9Q B;  2VB6 A;  2PBI A;  2EHO B;  1HG2 A;  2V7M A;  5LG4 A;  3GN5 B;  4TZ4 C;  4PJN A;  3LJC A;  3UUL A;  1FEW A;  4ILU A;  3I0Q A;  3FBZ A;  2NW8 A;  2W62 A;  4GK5 E;  4JLE A;  4HE8 A;  3AB3 B;  4IGU A;  2KZ7 B;  4PNI A;  3W15 B;  3K3Q C;  4QXC B;  4AKH A;  3HKB E;  4O4J E;  3OJA A;  5JRC A;  1AJ3 A;  3JC6 D;  2LOP A;  1ZEE A;  3ZMZ B;  3ESL A;  4MAL A;  4KUM B;  1D0Z A;  4KP3 C;  4I43 B;  3IBP A;  2WBL A;  2ZM8 A;  2LJL A;  3M65 A;  4K0U A;  4UVC B;  1X79 A;  3J9X 1;  2N1G A;  1D1C A;  3NRY A;  1WYB A;  3VU7 H;  2PJQ A;  3CML A;  3KIN B;  3QUJ A;  1HF8 A;  4TN7 B;  4UV8 B;  2N9D A;  3MXZ A;  3GN5 A;  3ZN1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...