2QGSA

Crystal structure of se1688 protein from staphylococcus epidermidis. northeast structural genomics consortium target ser89
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
209
Chain Sequence
b'MNSRMKIKKAYEYMKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVDSKLTDEILAYDQLKQFLSTLDLSSEISQQVLYIIKHMSHVKLSIDGEIVRDADRLDAIGAIGIARTFQFSGHFGEPMWTETKLSNEELHTSLVEELDNSAIKHFYEKLFKLKDLMHTPTAKKLAEERHQFMIQYLKQFMSEWNFNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SE1688
publication title Crystal structure of SE1688 protein from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 72
structure length 209
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2qgsA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qgsA02
5DQWA 3DTOA 3DJBA 2QGSA 5IHYA 3B57A 5DQVA 2PJQA
chains in the Genus database with same CATH superfamily
3WI3A 2LSGA 4CI3B 1YKHB 3ZCJA 2C4GB 1UGOA 3AE4A 2W96A 2LKHA 2X0HA 3QC9A 4AQGA 5IDNB 4EEBA 3LQ5B 3CKDA 3BG3A 3TLTA 4EAHA 4HFHA 4NXNT 4AISA 1D1BA 4AKRB 5DQVA 5I5ZB 2WIHB 3AB3B 3UUNA 1KNPA 2A72A 4HGAA 3K3QC 3POMA 2ZM0A 3Q5XA 4JUYA 2PMIB 3NVOA 3MI9B 4Z91A 3LBXB 3PUAA 2HHHT 3AECA 4TTHA 4P0BA 1N4MA 2LW4A 5LJNA 3C4WA 3O1JA 2ZPGB 2K9AA 4DR6T 2HPLA 1H1PB 2E2AA 2W00A 3OJAA 4ROCA 4LF7T 2X66A 3K3OA 4L5GA 2D0TA 4HFBA 5AQUB 4MFEA 5J1GA 3TW6A 2UXNB 3FZKB 3N2OA 4X66T 5CJ5A 2UXXB 3RYIE 1ZOYA 1W09A 5AQHB 3ZMUB 3EDUA 3R6NA 2FJDA 4IDNA 3TNIB 5HEUA 2D9DA 1Z8UA 3FZHB 4PJJA 1IBKT 3ZYMA 1FMWA 4JI0T 5J2UE 4HNUA 4XZCA 4ZOLE 5FL1A 3NWIA 3RC8A 2ZMAA 2OV9A 4KI0F 2KZ7B 4F6RC 3KV6A 4MIMA 2XQ8A 2KT9A 3I0OA 2XQ7A 5AQNB 5L3EB 3N2GE 2G77A 2C6TB 3ZYLA 2YK0A 3TLSA 4YY3T 2HH7A 2W61A 1O9KB 4HE8A 4AXPA 2WCAA 3WAKA 1GUXA 3BK9A 2N9DA 4ZI3C 3TNHB 3UQ7A 1H26B 4CXYA 4ISSA 3TNWB 5M4YA 4ASKA 1H1QB 3RIFA 1KNRA 2V6YB 2ZM8A 3I9WA 2H89A 2HN2A 2YEVC 4HWHA 4EYUA 4CXWA 1MIVA 5CFBA 2PFVA 1W9RA 3FHNA 2WMBB 5L3BB 3O4XE 3MKDA 2JJ9A 4PJMA 2EHOA 5ABFA 3CMLA 4DBRA 2X9XA 2WFYB 2C5NB 1UCUA 1IBLT 4DV1T 2V26A 4ZZBA 3GMIA 4O2BE 1W0BA 4GK0E 2LSIA 3CX6B 3E0ZA 1J5ET 1YW0A 5ICPB 3EAMA 3C4ZA 3F5XB 1AISB 4IDQA 2XAFB 4O4HE 3I1AA 4CFWB 2JIWA 4X1KE 2WPAB 2UZDB 1MNDA 4TZ4C 5A1LA 3KINB 4FM4B 2B9RA 4KRCB 3X28B 2A2FX 2W66A 1HX8A 2V6YA 2H88A 2I0MA 4UXNB 1KK7A 1XO2A 5KDMC 4B3MT 5JR9B 4JI6T 4EC9B 4X65T 4DV7T 3IF8B 2BS4A 3KDSE 3MY5B 4YXDA 2QGSA 2LM2A 2FJAA 2BKNA 3HO8A 2V22B 1FKMA 5HBEB 4JX4A 3VR9A 2ZLYA 4F6SB 2X0YA 2CLYC 3CX7B 1VOLA 4BCFB 3OYZA 2V7KA 4YJ3E 2N2NA 2XPKA 2WJ9A 2C0SA 3P7IA 1ENWA 4MALA 5C8YE 1UGRB 2ES0A 2UXCT 3UTKA 4Q25A 1J1JA 4X5TA 2XAHB 4CFNB 5FNVE 4OYJA 4JEHB 3RX6A 5KXJA 3KV4A 5JR9A 2LKGA 4IL4A 5EZYE 5IWAT 1YKEB 1GH6B 3UUMA 3ZCIA 2C5XB 2JQ9A 2BKPA 4DV2T 1WCRA 5LMNT 1ZV4X 4TN7B 3UU8A 1HS7A 4WZXA 4G2AA 2KWIB 4PW8A 1VINA 3DL1A 2Q9QB 3PJAA 4BJNA 4XBFB 4EEDA 1LVKA 2K3WA 1X79A 5C3JA 2P9BA 4NPPA 2ZCFB 4E7ZA 4F70B 3ZPOA 3M3ZB 3RIUC 5HAXA 4A97A 4IMYB 4JI2T 3O9XA 2KSRA 5IHYA 2L9QA 2JRKA 5KMGP 2FUPA 3PTRB 4HNVA 4ILAA 3X20B 2XQYA 4H9QC 5LG4A 4DR1T 2JMKA 1SE7A 2G9XB 2LRLA 2XAQB 4HFDA 2VL8A 5EK2A 4YC3B 3QWLA 3EABA 4LFCT 3UQ4A 1UGSB 3N9NA 3RYFE 4Z90A 3W15B 5L3GB 2ZPHB 2YOEA 3Q5WA 2IW5B 4P1NA 5L3FB 4ZI2C 1E1HB 2RA1A 1WYBA 2K24A 3C51A 4JI5T 2KINB 5H6QB 5LHHB 4EORB 2LHRA 2UUAT 2D0QB 3RF1A 4BJMA 1JNZA 2WWVA 5ABGA 3MK7C 4H9SE 3VRAA 4DUZT 3N9MA 2E9XC 2CBIA 4B3ST 3AA1B 3L09A 4EOIB 4ZI3D 1LVFA 4OB3B 4BCPB 4EOJB 4BCJB 4UVCB 5ACBA 2X9YA 3AAIA 2WU2A 5TAOA 2IUBA 2CPTA 4JEUB 2OLTA 5HQ0B 4ZXLA 2D5UA 1NENA 3HL6A 3LK2B 1C9BA 4BA9A 3K3NA 4HWIB 4ZGDB 3D0TA 5AQFB 3PO3S 3HKCE 2WHBB 2RPAA 2UUCT 4C90A 3SWHA 4U7YA 3QYBA 4RODA 4LFBT 4KRDB 1AD6A 4LMLA 3ZMZB 4X1IE 2DL1A 3BHVB 1R8IA 2KWHA 4GOUA 2W99A 4X62T 4YTMA 5F8PA 5FL0A 3Q5DA 1JKWA 3CQXC 2MPKA 1QMZB 3FZLB 3O1HA 4YLHA 3M65A 2VQFT 3T1YT 4LFAT 2PJQA 3R84B 4OFZA 5HEGA 4H63V 1O3XA 4IGUA 5FVKA 1H28B 5JDFA 3ZN0B 4YOSA 2FJEA 1QUUA 3IBPA 2W0GA 2LSKA 2F4VT 4YOZA 3P4QA 2K48A 2HPJA 1N32T 5AQIB 1BR2A 2QVAA 1IJ5A 1HNZT 5L2WB 2XQ3A 3WVDB 3U78A 2BS2A 2A3DA 4U31A 2DHRA 4FJOA 2MAWA 4BCIB 4YT0A 3ZJ2A 2ZM6T 3FXEB 4EZ4A 4CQIA 5HWYA 2WXVB 1LRZA 4EOKB 2WMAB 5L47A 2BG9C 1F5QB 3HKEE 5HWXA 3KBTA 5H6RB 3BG5A 4PAGA 3AEAA 3L8RA 3NBXX 2WMNA 4BCQD 4BCMB 1GY3B 4AKHA 2NR4A 2Y48B 4LOCA 2CZ7B 2DMEA 4IDZA 4N78D 4DR7T 2X9WA 1JNRA 3P4RA 3QNUA 4OX9T 1Z0PA 3AA6B 2DWKA 3AE5A 4EIWA 2VKOA 2XQAA 3HB9A 3V5SA 3A5XA 1OEDC 4OR5B 4OYKA 1YQ4A 1GQEA 1WR6A 4EV6A 4ZI7E 5FY0A 3NRYA 1MIWA 4PJLA 5FXZA 3AE1A 1OGUB 1T72A 4ILBA 2WMOA 5JQGE 2CCHB 4Z8XA 5HEOA 4EONB 4JI1T 1UNGD 2DLRA 5LG3A 5JDHA 4EYYR 1FVVB 3GTMS 1HCIA 4YTPA 1SHZC 3RGLA 4J2CA 3LK3B 1IAPA 2WP9A 2IN3A 2QYWA 4AI6A 2C5JA 3BHUB 1FINB 4JI8T 4OB2B 1KEYA 4QH5A 2DNXA 5L4EA 1D1AA 4CFUD 1MMAA 2FBWA 1E2AA 3PUZF 3QB5A 1GUXB 4QH1A 3TKLB 4WYVA 3T8OA 2V6XA 4BCND 4M1PA 4ZI2D 3NDQA 3NRXA 3N9PA 4NUVA 1XZYA 2Y6XA 2CWYA 3O0GD 2V7JA 3L39A 4B3RT 3BLRB 2E9XD 1Y01A 4AQYT 2IHR1 3LDQB 2EHOB 5ABFB 3N9OA 3AEFA 4KMCA 1XMOT 3K1SA 1JSTB 3KFWX 2D0UA 3TLVA 4LMJA 2XY8B 2YKSA 3WAJA 2UZBB 1U5PA 3MIAB 3AAEB 2SPCA 2VQET 2YDQA 4TV8E 5ADXL 2NOXA 4U72A 1UK5A 2ZZDB 2CCIB 4HFEA 1ZEEA 2A9UA 4ZS2A 4F7JB 2W67A 4ZGEB 5LGTB 5JDNA 2CEAA 2X51A 1MNEA 3AVSA 4IE4A 2CA5A 3VRBA 4M6VA 2LOSA 3TLWA 3G06A 2JPFA 2JMHA 1MMGA 4HWFA 2ACXA 2V1DB 4UELA 5LNKA 2CXLA 4EOSB 4EOZB 4EB6E 4ILCA 1VOMA 4IDPA 4PJNA 1QLBA 2V8SV 3ESLA 4MHCA 4BY1X 4ISTA 3ABVA 3PDYA 4X64T 1H1RB 1N33T 4EOQB 2AE9A 5AQOB 2WU5A 3HKDE 1M62A 2BKOA 1H24B 4AQFA 4GYSA 3H4CA 5HEJA 5HYAA 4ILUA 3H3MA 5LCYA 4QWNB 3MA9A 5HNBB 2NW9A 4Y72B 4NC6A 2KNDA 5JRCA 1HTJF 4IHJE 4O8SA 2R7GA 4YSZA 3ZSTA 3BQLA 3ZKRA 1FJGT 3CVRA 4CRLB 5AQLB 3ZC1A 4A98A 2XSAA 2UZEB 3UFEA 3ZMSB 3QZ9B 3LG7A 3ZMTB 3HR0A 4DV0T 2CM0A 1BR0A 4DR5T 1LKXA 4O4JE 1OKWB 5IDPB 4BCNB 3KV9A 3G33B 2XZEA 3WVEB 2YDRA 4DR2T 2CHOA 5HEHA 3RIUA 4PK5A 4Z6YA 2WY2A 1IZNB 2M6IA 2CE7A 5J2TE 1BU2A 2QA7A 5HXRA 3A8OB 2YN6A 3IA3A 2E9XB 5LBMA 2C5VB 2VKDA 3UU4A 2R6GF 3JCFA 3BLHB 2LRKA 1MIYA 4HEAA 4CI2B 2VB6A 3BQKA 4DMVA 2YDSA 3UUXB 4NIQA 5EJCA 1E7PA 3QHWB 2WDRA 3TN8B 3FXDB 5EK3A 1MMNA 1XDPA 2VURA 3QUJA 3UFGA 3NKZA 5CYIB 4H9PC 3AE2A 3P4PA 1XDOA 4HWDA 3FZMB 2NTYA 4QX7B 3DOGB 2MYSA 3I0QA 2XQ9A 2IW9B 4TWHA 4TNVA 4DIDB 3NZQA 3PUVF 4QXCB 3M03A 1HF8A 1YD8G 3AE6A 3ZSSA 3EHZA 2DXCB 1HG2A 3KVBA 4QKNA 1NAFA 2WDQA 5AQPB 5LMKB 3VKGA 3VR8A 2E9XA 5FGKB 3AVRA 4YOOA 1AHJB 4HLQA 2X9HA 2I6HA 4EOLB 1MMDA 1OXZA 2UU9T 1V29B 4QX8B 3LSVA 2WSSV 2ZPIB 5JTGA 5HCMA 1XMQT 2IC9A 2X67A 5HBJB 1G3NC 2JQQA 3UU5A 5ABHA 4GKJT 5CEIB 2OA5A 5LHGB 3QYEA 2PK9B 3RC3A 1XNRT 4II5B 2YINA 4LF6T 3BHTB 3EI0A 2L8KA 4QXHB 1AJ3A 3ZLIA 2IW6B 1W0AA 4FI5A 5HXSA 5JR9C 2XQ4A 5FYMA 2UZLB 4EGWA 2HN1A 3TLUA 2X0LB 2LSYA 3AEDA 4GIWA 5DABA 4C91A 2WQYA 3NZPA 5LJMA 1OIYB 1YQ3A 3AA7B 2VL0A 2WIPB 2WBLA 4HFIA 4A56A 1T8BA 3DDPB 1CUNA 1OIUB 2DPPB 1WR0A 1ZP0A 4BCKB 4PNIA 2QDYB 3ZN1B 5AQKB 4UN0A 4EOPB 5BMVE 3KBUA 5FKYA 3RLFF 2LLYA 4NSTB 2VKJA 3AE7A 3EUHA 2NTXA 2XAJB 4IDOA 2W2UA 4NXMT 2LSJA 2MOZA 4ROEA 3KVAA 5IYZE 1EZ3A 4MBQA 4X20E 3P50A 3ONJA 3N5LA 3P4WA 3SOLA 3HBLA 4AKGA 4CN4A 3RKGA 1DU2A 2E5VA 3PUXF 4O2AE 2BPMB 4KHPT 5FXVA 2LJLA 2CMRA 3AXJB 1KNZA 2Z6EA 4IL9A 5AQJB 2X68A 5HCJA 4KBMB 3B57A 1D0ZA 1WLXA 4UV9B 2KR6A 3GA8A 3P4SA 1US7B 4JBWF 3QYGB 5AQMB 3GWHA 3AEBA 4PK4A 4DBQA 3RQUA 2NW7A 3RYCE 3UT5E 2Q9QC 2H7VC 3B5MA 3QYHB 1D3UB 2K5BB 4IE0A 1IREB 2ACZA 5LGUB 3JAFA 2ZPFB 4U74A 2XSBA 2W2HA 3E22E 3QXEB 4G6LB 1T7SA 4ADZA 4F7NB 3SRZA 5L3CB 3VYHB 2XM1A 2XUEA 3BLQB 1E9HB 3PU8A 2VVNA 4DR4T 2MBGA 3VHLA 4U2YA 1OEDA 3ZYKA 4DMWA 4ZZCA 3AXJA 1UGQB 4OB0B 3CQGB 3QHRB 2IMLA 4G63A 2XM2A 2W63A 1G8XA 2J62A 2W4XA 4YHJA 4LF9T 1QSDA 3DDQB 3PUGA 5L4HA 3Q2MA 5EK4A 3UUBA 4HN9A 4K0UA 2C5OB 4OHFA 2BBJA 2E5LT 3X24B 2IW8B 3ZT6A 4IT4A 5LGNB 4LF5T 5LHIB 3UU3A 5LMUT 3SFDA 3AAAB 4F6UB 4WBNE 3RRWA 1UUSA 4F7LB 1HG5A 1HR0T 2AHJB 3A8LB 2RP4A 3SS1A 4L0RA 3L3PA 1N36T 4FX3B 4QXBB 3A8MB 3ZT7A 3RPUA 5LBQB 5DJQC 4IREA 3OVUA 2BVLA 4XAXB 4DV3T 3RYHE 2CZ0B 4HNTA 1XNQT 1OKVB 1HNWT 3PUWF 1HX1B 2QRXA 2N1GA 2CZ6B 4I3ZB 1KXUA 5HBHB 2I59A 2DD4B 3QB5K 2XASB 2UUBT 3QOFA 4DR3T 4KX6A 4ZGJB 1WRDA 2KMGA 3MY1B 2JGZB 2V5CA 3JADA 4CFMB 3AE3A 2W9FA 2DWGA 5ETWA 2YU1A 2AXDS 4LF4T 5AQGB 3HKBE 2M6BA 3QZ5B 5JREA 2BVMA 2V7IA 4E7SA 4YSXA 1G73A 2VVSA 2BBHA 2J4GA 3AE9A 2WEVB 3FBLA 4YJ2E 3PV0F 4CXXA 4UF0A 3OKQA 2B76A 4TUYE 4UVAB 1I6ZA 3P8CD 2UXDT 3ANWA 5LYJE 3EIDB 2LHNA 2CXDA 1BR4A 5FXXA 4BCOB 1UNLD 4UV8B 3ONXA 5CB4E 4TV9E 2QDJA 4ANJA 4WBOA 3H3AA 1NWMX 4O4LE 2IDOB 5FY1A 2DXBB 3C4XA 2E8IA 4WNKA 5JDMA 1UURA 4L9IA 3ZT5A 1UNHD 2CLYB 4H63H 2UXBT 4CFVB 2BG9E 4YTNA 1KFYA 4I43B 3X25B 3RHWA 4AIUA 5C2TA 2V7LA 3CPZA 2J1DG 3LBXA 4X1YE 3ZEFB 3C98B 3EJ1B 5CA0E 4KUMB 5JDQA 2CZ1B 2CYZB 4JX5A 3IEEA 4I0UA 3A8HB 2V5DA 4WW0A 4F6WB 3OBVE 4MFRA 1KF6A 1OEDE 4F7SB 2IVXA 4BCQB 5JRCB 1ZP2A 2LM9A 3CX8B 1OL2B 4CN6A 4JX6A 5DQWA 2BDEA 3QK6A 2W9ZA 1S35A 5LB7B 3ETVA 5JVDE 2WS3A 3I9YA 3JAEA 3S4UA 2YU2A 1UX5A 2Q9QD 4JI7T 1B7TA 4QSHA 2WAUA 1OL1B 1D0XA 4P09A 4DVDA 5FP3A 4CZZB 5AFUL 4QH4A 5IUXA 4HL4A 4H9RC 3J9X1 2IAKA 3JC6C 1H27B 4CXAB 5AQQB 5ABEA 2Y8DA 3C64A 5LQFB 5HXCA 2CWOA 1H7CA 4EOOB 2ODUA 2H3RA 4ZHQE 1O9KA 4DO0A 2F2CA 4HTEA 2PG8A 4DNDA 2J47A 2VWAA 2C5IT 4BBSM 2KMFA 4U7IA 3K7AM 3DTOA 3PU3A 2WM9A 3PE0A 5AQSB 4UIGA 4TNWA 1H25B 3RQWA 2XHEB 1ZHCA 4CFUB 3HHTB 3RKOA 3ETUA 4B3TT 2CBJA 2V7MA 2DD5B 4DV4T 1W98B 2PK2A 4TWFA 1U4QA 5FXWA 3FZFB 1BR1A 4CN1A 3CIRA 5E0OA 4TWDA 3A8YC 4HKAA 5L2LA 4I4TE 3F57A 3X26B 3GN5B 3EDVA 2EHOC 2NP9A 5FY7A 2ZPEB 4F8HA 4BCHB 2D2SA 2QFZA 2H7OA 2KLQA 2W62A 4OGRB 3PUYF 2PBIA 3LFMA 4UVBB 1TFBA 5LOVE 2PTFA 3VYGB 4AQFC 1D1CA 1D0YA 3N2KE 3K8PC 3CK6A 2QQ8A 3DJBA 5J0ZA 4IE5A 2CHNA 5LA6E 2QF7A 3ZMVB 2EUFA 4CFXB 4DV6T 5BNJB 4KP3C 4LF8T 4MFDA 2ZPBB 1FIOA 3GN5A 2G0UA 2JQKA 2WDVA 1YXRA 5JDGA 4JV5T 4UR9A 2CXFA 3V5UA 3PUQA 5JDLA 2ZM2A 1ZKEA 3VKHA 4GKKT 2PHGA 3A8GB 4ELLA 3HA4A 2JQHA 3AE8A 4MLKA 3MJXA 4YHHT 4OK0A 3SFEA 4BY7X 5HVYB 2IIUA 3UULA 1H4LD 2UUEB 1FMVA 2LE8A 4KHZF 1VYWB 4ZS3A 2LEHA 2BS3A 5AQVB 3OPCA 1IBMT 3N9QA 5AQTB 3ZJ1A 5GONE 4P0AA 4GYRA 2X1NB 4PFOA 1UGPB 1HFAA 2KXPB 3TW7A 1V9DA 4PK6A 3OTOT 3ZC0A 4BBRM 3B13A 1FEWA 1URCB 2Q9QA 4EXTA 3U3IA 4HWCA 1L0VA 3AA0B 2VK9A 4AKLA 5LP6E 4EOMB 2WWUA 4BXXX 3MZKB 5LXTE 3RI5A 3CWZB 4ERRA 2BG9B 2XQ6A 1VRBA 5BR8T 5IF1B 3T1HT 3Q9DA 3MACA 3A7MA 3LK42 1J5WA 1JOWA 4BCMD 3VU7H 4H9OC 2WB5A 3HI2A 3KHIA 4GK5E 4CI1B 2BZBA 1PKDB 3FBZA 1VCSA 4JLEA 2NW8A 2XTLA 2I53A 2M67A 1P5EB 4U3CA 3IHRA 1N34T 3RGFB 1OEDB 2ODVA 4ELJA 1WFDA 1I94T 4PFPA 5HXHA 5CGMA 1Y64B 5JH7E 4I55E 1UX4A 4AKIA 2XAGB 2B1EA 3ONLC 3JC6D 4IIJE 4BAYB 4EC8B 2BG9A 3LJCA 3OYXA 4COFA 3RRCA 3EVYA 5F3JA 4JI4T 2XQ5A 1CHUA 4U2ZA 3H37A 3UU6A 3AEEA 5CA1E 3FB2A 1SUMB 4UEMA 2NWBA 4IE6A 4V1Av 4O4IE 5FVLA 4LMKA 4K0KT 5L3DB 1X9BA 1WYCA 2CJMB 5HXEA 3RH3A 1T98A 3EOCB 3C50A 2DI4A 1TD6A 5AQRB 3DP7A 4TX5A 4OB1B 4B6XA 4ZEYA 1HNXT 2C5KT 5KX5E 5EFQB 3BQIA 1IJ6A 1M7KA 2VASA 4NUUA 1XWMA 2XJ7A 3F2EA 4YFSA 2EHOD 2BKZB 4BCGB 3Q5EA 4I50E 2L3LA 3PURA 2LOPA 2MTQA 2I40B 4DUYT 4A5XA 3MXZA 2DCFA 3PUSA 4H9NC 1JSUB 3E08A 2IC6A 3J7Yq 4QHOA 4YSYA 2GK9A 3RIAA 4HFCA 1OWAA 4EZHA 3X1DA 2WZHA 4JI3T 4HFVA 4DV5T 2FJBA 3KV5A 2CCQA 1NEKA 1S94A 3PJAJ 2VKHA 4JYAT 3BG9A 1VCTA 4U33A 4IE7A 3N9LA 3F31A 2LT3A 1H1SB 4UF0B 1OI9B 3CQCB 3O1IA 3HZJA 1SA0E 5F5WA 3ANWB 2WZIA 5FMNA 2CRBA 3AEGA
chains in the Genus database with same CATH topology
3QK6A 5DQWA 2BDEA 3HL6A 3LK2B 1S35A 3WI3A 3ETVA 4BA9A 2LSGA 5JVDE 3K3NA 2NTYA 4QX7B 4CI3B 1YKHB 2MYSA 3D0TA 3I0QA 3I9YA 3ZCJA 3S4UA 3NZQA 4QXCB 2YU2A 1UX5A 1HF8A 3HKCE 2Q9QD 3QC9A 4AQGA 1B7TA 3CKDA 4EAHA 2WAUA 1YD8G 4C90A 1D0XA 3SWHA 1HG2A 3KVBA 4P09A 1D1BA 4QKNA 4DVDA 5FP3A 1NAFA 4AKRB 4CZZB 5DQVA 5AFUL 3AB3B 3VKGA 3UUNA 2E9XA 2A72A 4H9RC 3ZMZB 3J9X1 4HGAA 3AVRA 3K3QC 2IAKA 3JC6C 4X1IE 2ZM0A 3Q5XA 4JUYA 4GOUA 2KWHA 2Y8DA 3C64A 2X9HA 5HXCA 3LBXB 3PUAA 5F8PA 2CWOA 1MMDA 1OXZA 1H7CA 3CQXC 4QX8B 4P0BA 3O1HA 4YLHA 3M65A 2WSSV 2ODUA 2PJQA 5LJNA 2H3RA 3R84B 3C4WA 4ZHQE 4OFZA 3O1JA 2IC9A 2K9AA 2X67A 4H63V 2HPLA 1O3XA 2W00A 4IGUA 4DO0A 3OJAA 5JDFA 2JQQA 4HTEA 2PG8A 4DNDA 2X66A 3K3OA 3ZN0B 2OA5A 4L5GA 2VWAA 2C5IT 1QUUA 3IBPA 2KMFA 2D0TA 5LHGB 3DTOA 3PU3A 2W0GA 3RC3A 2WM9A 3PE0A 2LSKA 4UIGA 2K48A 2HPJA 2XHEB 1ZHCA 2YINA 3RKOA 1BR2A 2L8KA 3ETUA 5J1GA 1IJ5A 2UXNB 4QXHB 1AJ3A 3ZLIA 5HXSA 4FI5A 5JR9C 3N2OA 2V7MA 2UXXB 3RYIE 5FYMA 3U78A 3ZMUB 3EDUA 1U4QA 2LSYA 2X0LB 4GIWA 5DABA 5FXWA 4C91A 3NZPA 5LJMA 2A3DA 3R6NA 1BR1A 2DHRA 3AA7B 4FJOA 4PJJA 5E0OA 3ZYMA 1FMWA 2WBLA 5J2UE 4HKAA 5L2LA 4I4TE 3ZJ2A 4XZCA 4ZOLE 4A56A 3F57A 1CUNA 3FXEB 3GN5B 3EDVA 2EHOC 4PNIA 4EZ4A 3RC8A 2NP9A 2ZMAA 4CQIA 5HWYA 5FY7A 1LRZA 3ZN1B 2KZ7B 4F6RC 3KV6A 3KBUA 5BMVE 2KT9A 2D2SA 3HKEE 5HWXA 3KBTA 5H6RB 3I0OA 2VKJA 2H7OA 4PAGA 2KLQA 2W62A 3EUHA 3NBXX 2NTXA 2XAJB 2WMNA 4AKHA 2Y48B 2PBIA 3LFMA 4UVBB 2LSJA 2MOZA 5L3EB 3N2GE 5LOVE 3KVAA 3ZYLA 4IDZA 5IYZE 1EZ3A 2YK0A 4MBQA 4N78D 2X9WA 4X20E 2HH7A 2W61A 4HE8A 4AQFC 4AXPA 3WAKA 1D1CA 1D0YA 3N5LA 3N2KE 1Z0PA 3AA6B 3SOLA 2DWKA 2N9DA 3BK9A 3K8PC 4EIWA 4ZI3C 4AKGA 2VKOA 3DJBA 4CXYA 4IE5A 4ISSA 5M4YA 4O2AE 4ASKA 3V5SA 3A5XA 2ZM8A 3I9WA 4OYKA 2LJLA 2YEVC 5FXVA 2CMRA 4EYUA 5LA6E 1KNZA 2Z6EA 3ZMVB 1WR6A 2X68A 4CXWA 1MIVA 4ZI7E 4KBMB 5FY0A 3B57A 2PFVA 1D0ZA 3FHNA 1WLXA 3NRYA 1MIWA 4UV9B 4PJLA 4KP3C 5L3BB 5FXZA 3O4XE 3GA8A 1FIOA 3MKDA 1US7B 3GN5A 2JJ9A 4PJMA 2EHOA 5JQGE 2WMOA 3CMLA 2G0UA 3GWHA 4PK4A 4DBRA 4DBQA 4Z8XA 2NW7A 3RYCE 3UT5E 2X9XA 2Q9QC 2H7VC 1UCUA 5JDGA 2DLRA 2V26A 2K5BB 4IE0A 5JDHA 4EYYR 2CXFA 5LGUB 3V5UA 3GMIA 3PUQA 4O2BE 4GK0E 1HCIA 2LSIA 3CX6B 3E0ZA 5JDLA 2ZM2A 1SHZC 1YW0A 1ZKEA 4U74A 3VKHA 4J2CA 3LK3B 3E22E 1IAPA 3HA4A 4ADZA 3C4ZA 3SRZA 5L3CB 4MLKA 3MJXA 4AI6A 2C5JA 2XAFB 2XUEA 4O4HE 4OK0A 3I1AA 4X1KE 4TZ4C 3UULA 1MNDA 3PU8A 5A1LA 3KINB 1FMVA 2LE8A 2MBGA 3VHLA 2A2FX 1HX8A 2DNXA 1D1AA 1MMAA 3ZYKA 4ZS3A 2LEHA 4DMWA 4UXNB 1KK7A 3TKLB 3CQGB 5KDMC 3N9QA 3T8OA 4G63A 5JR9B 3ZJ1A 5GONE 4P0AA 4GYRA 4M1PA 4ZI2D 2W63A 3NRXA 1G8XA 4PFOA 3N9PA 4NUVA 3IF8B 1HFAA 2KXPB 1V9DA 3KDSE 4PK6A 2Y6XA 3ZC0A 2QGSA 2CWYA 4YHJA 3B13A 1FEWA 2V7JA 2Q9QA 4EXTA 1QSDA 3U3IA 3AA0B 2VK9A 3PUGA 2E9XD 4AKLA 5LP6E 3Q2MA 2ZLYA 2WWUA 5EK4A 2CLYC 2EHOB 3MZKB 3CX7B 5LXTE 3N9OA 4KMCA 3KFWX 4HN9A 3CWZB 3OYZA 4K0UA 4ERRA 2V7KA 4YJ3E 1VRBA 4OHFA 2N2NA 2D0UA 3Q9DA 3MACA 2C0SA 3P7IA 5LGNB 3LK42 5LHIB 4MALA 5C8YE 2ES0A 3WAJA 3AAAB 3UTKA 4H9OC 3VU7H 3HI2A 4WBNE 3RRWA 1U5PA 1HG5A 2XAHB 3AAEB 5FNVE 4OYJA 4GK5E 2RP4A 4CI1B 4JEHB 2BZBA 2SPCA 3SS1A 3FBZA 4L0RA 3RX6A 3L3PA 4TV8E 4QXBB 4JLEA 5ADXL 2NW8A 2NOXA 4U72A 3RPUA 2XTLA 2M67A 3KV4A 5DJQC 5JR9A 5LBQB 2BVLA 4XAXB 3IHRA 3RYHE 5EZYE 2ODVA 1ZEEA 1YKEB 4ZS2A 2N1GA 4PFPA 5HXHA 3UUMA 3ZCIA 1Y64B 5LGTB 5JH7E 2I59A 5JDNA 2CEAA 4I55E 2X51A 1MNEA 1UX4A 1ZV4X 4TN7B 3AVSA 4IE4A 2CA5A 4AKIA 2XASB 2LOSA 2XAGB 2JPFA 2B1EA 2JMHA 1MMGA 1HS7A 3JC6D 4IIJE 2ACXA 1WRDA 2V1DB 4UELA 5LNKA 4BAYB 2CXLA 4G2AA 2KWIB 4PW8A 4EOZB 2Q9QB 3LJCA 3OYXA 4EB6E 4BJNA 4XBFB 1LVKA 3RRCA 1VOMA 1X79A 3EVYA 2DWGA 4PJNA 5ETWA 5F3JA 2YU1A 3ESLA 2P9BA 4MHCA 4E7ZA 3HKBE 3ZPOA 4ISTA 5JREA 3PDYA 5HAXA 3H37A 2BVMA 2V7IA 4E7SA 1G73A 3O9XA 3HKDE 5CA1E 5IHYA 2L9QA 4AQFA 4GYSA 2JRKA 3FB2A 5KMGP 3FBLA 5HYAA 4UEMA 4YJ2E 4ILUA 2NWBA 4CXXA 4IE6A 4UF0A 4V1Av 4O4IE 3PTRB 5LCYA 3OKQA 4QWNB 3MA9A 5L3DB 2NW9A 4TUYE 4UVAB 2KNDA 2XQYA 1WYCA 3P8CD 1HTJF 5JRCA 4IHJE 3ANWA 4O8SA 5HXEA 3RH3A 4H9QC 5LG4A 1T98A 3BQLA 5LYJE 2LHNA 3C50A 2CXDA 2JMKA 2DI4A 1BR4A 5FXXA 3CVRA 3ZC1A 3DP7A 2XAQB 4UV8B 4TX5A 3ONXA 2VL8A 4B6XA 5CB4E 3UFEA 3ZMSB 4TV9E 5EK2A 3LG7A 4ANJA 2C5KT 4WBOA 3ZMTB 3H3AA 5KX5E 1NWMX 3BQIA 3HR0A 1IJ6A 2CM0A 1BR0A 4O4LE 3N9NA 3RYFE 5FY1A 3C4XA 1LKXA 4O4JE 2E8IA 4WNKA 3W15B 5JDMA 5L3GB 4L9IA 2VASA 4NUUA 3Q5WA 2IW5B 3F2EA 4YFSA 2EHOD 2CLYB 3KV9A 5L3FB 4H63H 4ZI2C 4I50E 1E1HB 2L3LA 2RA1A 4PK5A 4I43B 1WYBA 2K24A 3C51A 3PURA 1IZNB 2LOPA 2KINB 2MTQA 5H6QB 5LHHB 2LHRA 3MXZA 2V7LA 2DCFA 3PUSA 4H9NC 3CPZA 2CE7A 5J2TE 3E08A 4BJMA 2IC6A 2J1DG 2QA7A 3LBXA 4X1YE 5HXRA 4QHOA 3J7Yq 3ZEFB 3C98B 3MK7C 4H9SE 2GK9A 3N9MA 5CA0E 2E9XB 4KUMB 5LBMA 2E9XC 2VKDA 1OWAA 5JDQA 4EZHA 3IEEA 3AA1B 3L09A 4HFVA 1MIYA 4HEAA 4CI2B 3KV5A 4ZI3D 2CCQA 1S94A 2VB6A 1LVFA 2VKHA 4IE7A 4WW0A 3N9LA 3BQKA 3F31A 3OBVE 2LT3A 4UVCB 4UF0B 4MFRA 4DMVA 2X9YA 3CQCB 3O1IA 1SA0E 3AAIA 3UUXB 5TAOA 4JEUB 3FXDB 2D5UA 5EK3A 5JRCB 1MMNA 3ANWB 3QUJA 2LM9A 3CX8B 5FMNA 4H9PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQW A;  3DTO A;  3DJB A;  2QGS A;  5IHY A;  3B57 A;  5DQV A;  2PJQ A; 
#chains in the Genus database with same CATH topology
 3WI3 A;  2LSG A;  4CI3 B;  1YKH B;  3ZCJ A;  2C4G B;  1UGO A;  3AE4 A;  2W96 A;  2LKH A;  2X0H A;  3QC9 A;  4AQG A;  5IDN B;  4EEB A;  3LQ5 B;  3CKD A;  3BG3 A;  3TLT A;  4EAH A;  4HFH A;  4NXN T;  4AIS A;  1D1B A;  4AKR B;  5DQV A;  5I5Z B;  2WIH B;  3AB3 B;  3UUN A;  1KNP A;  2A72 A;  4HGA A;  3K3Q C;  3POM A;  2ZM0 A;  3Q5X A;  4JUY A;  2PMI B;  3NVO A;  3MI9 B;  4Z91 A;  3LBX B;  3PUA A;  2HHH T;  3AEC A;  4TTH A;  4P0B A;  1N4M A;  2LW4 A;  5LJN A;  3C4W A;  3O1J A;  2ZPG B;  2K9A A;  4DR6 T;  2HPL A;  1H1P B;  2E2A A;  2W00 A;  3OJA A;  4ROC A;  4LF7 T;  2X66 A;  3K3O A;  4L5G A;  2D0T A;  4HFB A;  5AQU B;  4MFE A;  5J1G A;  3TW6 A;  2UXN B;  3FZK B;  3N2O A;  4X66 T;  5CJ5 A;  2UXX B;  3RYI E;  1ZOY A;  1W09 A;  5AQH B;  3ZMU B;  3EDU A;  3R6N A;  2FJD A;  4IDN A;  3TNI B;  5HEU A;  2D9D A;  1Z8U A;  3FZH B;  4PJJ A;  1IBK T;  3ZYM A;  1FMW A;  4JI0 T;  5J2U E;  4HNU A;  4XZC A;  4ZOL E;  5FL1 A;  3NWI A;  3RC8 A;  2ZMA A;  2OV9 A;  4KI0 F;  2KZ7 B;  4F6R C;  3KV6 A;  4MIM A;  2XQ8 A;  2KT9 A;  3I0O A;  2XQ7 A;  5AQN B;  5L3E B;  3N2G E;  2G77 A;  2C6T B;  3ZYL A;  2YK0 A;  3TLS A;  4YY3 T;  2HH7 A;  2W61 A;  1O9K B;  4HE8 A;  4AXP A;  2WCA A;  3WAK A;  1GUX A;  3BK9 A;  2N9D A;  4ZI3 C;  3TNH B;  3UQ7 A;  1H26 B;  4CXY A;  4ISS A;  3TNW B;  5M4Y A;  4ASK A;  1H1Q B;  3RIF A;  1KNR A;  2V6Y B;  2ZM8 A;  3I9W A;  2H89 A;  2HN2 A;  2YEV C;  4HWH A;  4EYU A;  4CXW A;  1MIV A;  5CFB A;  2PFV A;  1W9R A;  3FHN A;  2WMB B;  5L3B B;  3O4X E;  3MKD A;  2JJ9 A;  4PJM A;  2EHO A;  5ABF A;  3CML A;  4DBR A;  2X9X A;  2WFY B;  2C5N B;  1UCU A;  1IBL T;  4DV1 T;  2V26 A;  4ZZB A;  3GMI A;  4O2B E;  1W0B A;  4GK0 E;  2LSI A;  3CX6 B;  3E0Z A;  1J5E T;  1YW0 A;  5ICP B;  3EAM A;  3C4Z A;  3F5X B;  1AIS B;  4IDQ A;  2XAF B;  4O4H E;  3I1A A;  4CFW B;  2JIW A;  4X1K E;  2WPA B;  2UZD B;  1MND A;  4TZ4 C;  5A1L A;  3KIN B;  4FM4 B;  2B9R A;  4KRC B;  3X28 B;  2A2F X;  2W66 A;  1HX8 A;  2V6Y A;  2H88 A;  2I0M A;  4UXN B;  1KK7 A;  1XO2 A;  5KDM C;  4B3M T;  5JR9 B;  4JI6 T;  4EC9 B;  4X65 T;  4DV7 T;  3IF8 B;  2BS4 A;  3KDS E;  3MY5 B;  4YXD A;  2QGS A;  2LM2 A;  2FJA A;  2BKN A;  3HO8 A;  2V22 B;  1FKM A;  5HBE B;  4JX4 A;  3VR9 A;  2ZLY A;  4F6S B;  2X0Y A;  2CLY C;  3CX7 B;  1VOL A;  4BCF B;  3OYZ A;  2V7K A;  4YJ3 E;  2N2N A;  2XPK A;  2WJ9 A;  2C0S A;  3P7I A;  1ENW A;  4MAL A;  5C8Y E;  1UGR B;  2ES0 A;  2UXC T;  3UTK A;  4Q25 A;  1J1J A;  4X5T A;  2XAH B;  4CFN B;  5FNV E;  4OYJ A;  4JEH B;  3RX6 A;  5KXJ A;  3KV4 A;  5JR9 A;  2LKG A;  4IL4 A;  5EZY E;  5IWA T;  1YKE B;  1GH6 B;  3UUM A;  3ZCI A;  2C5X B;  2JQ9 A;  2BKP A;  4DV2 T;  1WCR A;  5LMN T;  1ZV4 X;  4TN7 B;  3UU8 A;  1HS7 A;  4WZX A;  4G2A A;  2KWI B;  4PW8 A;  1VIN A;  3DL1 A;  2Q9Q B;  3PJA A;  4BJN A;  4XBF B;  4EED A;  1LVK A;  2K3W A;  1X79 A;  5C3J A;  2P9B A;  4NPP A;  2ZCF B;  4E7Z A;  4F70 B;  3ZPO A;  3M3Z B;  3RIU C;  5HAX A;  4A97 A;  4IMY B;  4JI2 T;  3O9X A;  2KSR A;  5IHY A;  2L9Q A;  2JRK A;  5KMG P;  2FUP A;  3PTR B;  4HNV A;  4ILA A;  3X20 B;  2XQY A;  4H9Q C;  5LG4 A;  4DR1 T;  2JMK A;  1SE7 A;  2G9X B;  2LRL A;  2XAQ B;  4HFD A;  2VL8 A;  5EK2 A;  4YC3 B;  3QWL A;  3EAB A;  4LFC T;  3UQ4 A;  1UGS B;  3N9N A;  3RYF E;  4Z90 A;  3W15 B;  5L3G B;  2ZPH B;  2YOE A;  3Q5W A;  2IW5 B;  4P1N A;  5L3F B;  4ZI2 C;  1E1H B;  2RA1 A;  1WYB A;  2K24 A;  3C51 A;  4JI5 T;  2KIN B;  5H6Q B;  5LHH B;  4EOR B;  2LHR A;  2UUA T;  2D0Q B;  3RF1 A;  4BJM A;  1JNZ A;  2WWV A;  5ABG A;  3MK7 C;  4H9S E;  3VRA A;  4DUZ T;  3N9M A;  2E9X C;  2CBI A;  4B3S T;  3AA1 B;  3L09 A;  4EOI B;  4ZI3 D;  1LVF A;  4OB3 B;  4BCP B;  4EOJ B;  4BCJ B;  4UVC B;  5ACB A;  2X9Y A;  3AAI A;  2WU2 A;  5TAO A;  2IUB A;  2CPT A;  4JEU B;  2OLT A;  5HQ0 B;  4ZXL A;  2D5U A;  1NEN A;  3HL6 A;  3LK2 B;  1C9B A;  4BA9 A;  3K3N A;  4HWI B;  4ZGD B;  3D0T A;  5AQF B;  3PO3 S;  3HKC E;  2WHB B;  2RPA A;  2UUC T;  4C90 A;  3SWH A;  4U7Y A;  3QYB A;  4ROD A;  4LFB T;  4KRD B;  1AD6 A;  4LML A;  3ZMZ B;  4X1I E;  2DL1 A;  3BHV B;  1R8I A;  2KWH A;  4GOU A;  2W99 A;  4X62 T;  4YTM A;  5F8P A;  5FL0 A;  3Q5D A;  1JKW A;  3CQX C;  2MPK A;  1QMZ B;  3FZL B;  3O1H A;  4YLH A;  3M65 A;  2VQF T;  3T1Y T;  4LFA T;  2PJQ A;  3R84 B;  4OFZ A;  5HEG A;  4H63 V;  1O3X A;  4IGU A;  5FVK A;  1H28 B;  5JDF A;  3ZN0 B;  4YOS A;  2FJE A;  1QUU A;  3IBP A;  2W0G A;  2LSK A;  2F4V T;  4YOZ A;  3P4Q A;  2K48 A;  2HPJ A;  1N32 T;  5AQI B;  1BR2 A;  2QVA A;  1IJ5 A;  1HNZ T;  5L2W B;  2XQ3 A;  3WVD B;  3U78 A;  2BS2 A;  2A3D A;  4U31 A;  2DHR A;  4FJO A;  2MAW A;  4BCI B;  4YT0 A;  3ZJ2 A;  2ZM6 T;  3FXE B;  4EZ4 A;  4CQI A;  5HWY A;  2WXV B;  1LRZ A;  4EOK B;  2WMA B;  5L47 A;  2BG9 C;  1F5Q B;  3HKE E;  5HWX A;  3KBT A;  5H6R B;  3BG5 A;  4PAG A;  3AEA A;  3L8R A;  3NBX X;  2WMN A;  4BCQ D;  4BCM B;  1GY3 B;  4AKH A;  2NR4 A;  2Y48 B;  4LOC A;  2CZ7 B;  2DME A;  4IDZ A;  4N78 D;  4DR7 T;  2X9W A;  1JNR A;  3P4R A;  3QNU A;  4OX9 T;  1Z0P A;  3AA6 B;  2DWK A;  3AE5 A;  4EIW A;  2VKO A;  2XQA A;  3HB9 A;  3V5S A;  3A5X A;  1OED C;  4OR5 B;  4OYK A;  1YQ4 A;  1GQE A;  1WR6 A;  4EV6 A;  4ZI7 E;  5FY0 A;  3NRY A;  1MIW A;  4PJL A;  5FXZ A;  3AE1 A;  1OGU B;  1T72 A;  4ILB A;  2WMO A;  5JQG E;  2CCH B;  4Z8X A;  5HEO A;  4EON B;  4JI1 T;  1UNG D;  2DLR A;  5LG3 A;  5JDH A;  4EYY R;  1FVV B;  3GTM S;  1HCI A;  4YTP A;  1SHZ C;  3RGL A;  4J2C A;  3LK3 B;  1IAP A;  2WP9 A;  2IN3 A;  2QYW A;  4AI6 A;  2C5J A;  3BHU B;  1FIN B;  4JI8 T;  4OB2 B;  1KEY A;  4QH5 A;  2DNX A;  5L4E A;  1D1A A;  4CFU D;  1MMA A;  2FBW A;  1E2A A;  3PUZ F;  3QB5 A;  1GUX B;  4QH1 A;  3TKL B;  4WYV A;  3T8O A;  2V6X A;  4BCN D;  4M1P A;  4ZI2 D;  3NDQ A;  3NRX A;  3N9P A;  4NUV A;  1XZY A;  2Y6X A;  2CWY A;  3O0G D;  2V7J A;  3L39 A;  4B3R T;  3BLR B;  2E9X D;  1Y01 A;  4AQY T;  2IHR 1;  3LDQ B;  2EHO B;  5ABF B;  3N9O A;  3AEF A;  4KMC A;  1XMO T;  3K1S A;  1JST B;  3KFW X;  2D0U A;  3TLV A;  4LMJ A;  2XY8 B;  2YKS A;  3WAJ A;  2UZB B;  1U5P A;  3MIA B;  3AAE B;  2SPC A;  2VQE T;  2YDQ A;  4TV8 E;  5ADX L;  2NOX A;  4U72 A;  1UK5 A;  2ZZD B;  2CCI B;  4HFE A;  1ZEE A;  2A9U A;  4ZS2 A;  4F7J B;  2W67 A;  4ZGE B;  5LGT B;  5JDN A;  2CEA A;  2X51 A;  1MNE A;  3AVS A;  4IE4 A;  2CA5 A;  3VRB A;  4M6V A;  2LOS A;  3TLW A;  3G06 A;  2JPF A;  2JMH A;  1MMG A;  4HWF A;  2ACX A;  2V1D B;  4UEL A;  5LNK A;  2CXL A;  4EOS B;  4EOZ B;  4EB6 E;  4ILC A;  1VOM A;  4IDP A;  4PJN A;  1QLB A;  2V8S V;  3ESL A;  4MHC A;  4BY1 X;  4IST A;  3ABV A;  3PDY A;  4X64 T;  1H1R B;  1N33 T;  4EOQ B;  2AE9 A;  5AQO B;  2WU5 A;  3HKD E;  1M62 A;  2BKO A;  1H24 B;  4AQF A;  4GYS A;  3H4C A;  5HEJ A;  5HYA A;  4ILU A;  3H3M A;  5LCY A;  4QWN B;  3MA9 A;  5HNB B;  2NW9 A;  4Y72 B;  4NC6 A;  2KND A;  5JRC A;  1HTJ F;  4IHJ E;  4O8S A;  2R7G A;  4YSZ A;  3ZST A;  3BQL A;  3ZKR A;  1FJG T;  3CVR A;  4CRL B;  5AQL B;  3ZC1 A;  4A98 A;  2XSA A;  2UZE B;  3UFE A;  3ZMS B;  3QZ9 B;  3LG7 A;  3ZMT B;  3HR0 A;  4DV0 T;  2CM0 A;  1BR0 A;  4DR5 T;  1LKX A;  4O4J E;  1OKW B;  5IDP B;  4BCN B;  3KV9 A;  3G33 B;  2XZE A;  3WVE B;  2YDR A;  4DR2 T;  2CHO A;  5HEH A;  3RIU A;  4PK5 A;  4Z6Y A;  2WY2 A;  1IZN B;  2M6I A;  2CE7 A;  5J2T E;  1BU2 A;  2QA7 A;  5HXR A;  3A8O B;  2YN6 A;  3IA3 A;  2E9X B;  5LBM A;  2C5V B;  2VKD A;  3UU4 A;  2R6G F;  3JCF A;  3BLH B;  2LRK A;  1MIY A;  4HEA A;  4CI2 B;  2VB6 A;  3BQK A;  4DMV A;  2YDS A;  3UUX B;  4NIQ A;  5EJC A;  1E7P A;  3QHW B;  2WDR A;  3TN8 B;  3FXD B;  5EK3 A;  1MMN A;  1XDP A;  2VUR A;  3QUJ A;  3UFG A;  3NKZ A;  5CYI B;  4H9P C;  3AE2 A;  3P4P A;  1XDO A;  4HWD A;  3FZM B;  2NTY A;  4QX7 B;  3DOG B;  2MYS A;  3I0Q A;  2XQ9 A;  2IW9 B;  4TWH A;  4TNV A;  4DID B;  3NZQ A;  3PUV F;  4QXC B;  3M03 A;  1HF8 A;  1YD8 G;  3AE6 A;  3ZSS A;  3EHZ A;  2DXC B;  1HG2 A;  3KVB A;  4QKN A;  1NAF A;  2WDQ A;  5AQP B;  5LMK B;  3VKG A;  3VR8 A;  2E9X A;  5FGK B;  3AVR A;  4YOO A;  1AHJ B;  4HLQ A;  2X9H A;  2I6H A;  4EOL B;  1MMD A;  1OXZ A;  2UU9 T;  1V29 B;  4QX8 B;  3LSV A;  2WSS V;  2ZPI B;  5JTG A;  5HCM A;  1XMQ T;  2IC9 A;  2X67 A;  5HBJ B;  1G3N C;  2JQQ A;  3UU5 A;  5ABH A;  4GKJ T;  5CEI B;  2OA5 A;  5LHG B;  3QYE A;  2PK9 B;  3RC3 A;  1XNR T;  4II5 B;  2YIN A;  4LF6 T;  3BHT B;  3EI0 A;  2L8K A;  4QXH B;  1AJ3 A;  3ZLI A;  2IW6 B;  1W0A A;  4FI5 A;  5HXS A;  5JR9 C;  2XQ4 A;  5FYM A;  2UZL B;  4EGW A;  2HN1 A;  3TLU A;  2X0L B;  2LSY A;  3AED A;  4GIW A;  5DAB A;  4C91 A;  2WQY A;  3NZP A;  5LJM A;  1OIY B;  1YQ3 A;  3AA7 B;  2VL0 A;  2WIP B;  2WBL A;  4HFI A;  4A56 A;  1T8B A;  3DDP B;  1CUN A;  1OIU B;  2DPP B;  1WR0 A;  1ZP0 A;  4BCK B;  4PNI A;  2QDY B;  3ZN1 B;  5AQK B;  4UN0 A;  4EOP B;  5BMV E;  3KBU A;  5FKY A;  3RLF F;  2LLY A;  4NST B;  2VKJ A;  3AE7 A;  3EUH A;  2NTX A;  2XAJ B;  4IDO A;  2W2U A;  4NXM T;  2LSJ A;  2MOZ A;  4ROE A;  3KVA A;  5IYZ E;  1EZ3 A;  4MBQ A;  4X20 E;  3P50 A;  3ONJ A;  3N5L A;  3P4W A;  3SOL A;  3HBL A;  4AKG A;  4CN4 A;  3RKG A;  1DU2 A;  2E5V A;  3PUX F;  4O2A E;  2BPM B;  4KHP T;  5FXV A;  2LJL A;  2CMR A;  3AXJ B;  1KNZ A;  2Z6E A;  4IL9 A;  5AQJ B;  2X68 A;  5HCJ A;  4KBM B;  3B57 A;  1D0Z A;  1WLX A;  4UV9 B;  2KR6 A;  3GA8 A;  3P4S A;  1US7 B;  4JBW F;  3QYG B;  5AQM B;  3GWH A;  3AEB A;  4PK4 A;  4DBQ A;  3RQU A;  2NW7 A;  3RYC E;  3UT5 E;  2Q9Q C;  2H7V C;  3B5M A;  3QYH B;  1D3U B;  2K5B B;  4IE0 A;  1IRE B;  2ACZ A;  5LGU B;  3JAF A;  2ZPF B;  4U74 A;  2XSB A;  2W2H A;  3E22 E;  3QXE B;  4G6L B;  1T7S A;  4ADZ A;  4F7N B;  3SRZ A;  5L3C B;  3VYH B;  2XM1 A;  2XUE A;  3BLQ B;  1E9H B;  3PU8 A;  2VVN A;  4DR4 T;  2MBG A;  3VHL A;  4U2Y A;  1OED A;  3ZYK A;  4DMW A;  4ZZC A;  3AXJ A;  1UGQ B;  4OB0 B;  3CQG B;  3QHR B;  2IML A;  4G63 A;  2XM2 A;  2W63 A;  1G8X A;  2J62 A;  2W4X A;  4YHJ A;  4LF9 T;  1QSD A;  3DDQ B;  3PUG A;  5L4H A;  3Q2M A;  5EK4 A;  3UUB A;  4HN9 A;  4K0U A;  2C5O B;  4OHF A;  2BBJ A;  2E5L T;  3X24 B;  2IW8 B;  3ZT6 A;  4IT4 A;  5LGN B;  4LF5 T;  5LHI B;  3UU3 A;  5LMU T;  3SFD A;  3AAA B;  4F6U B;  4WBN E;  3RRW A;  1UUS A;  4F7L B;  1HG5 A;  1HR0 T;  2AHJ B;  3A8L B;  2RP4 A;  3SS1 A;  4L0R A;  3L3P A;  1N36 T;  4FX3 B;  4QXB B;  3A8M B;  3ZT7 A;  3RPU A;  5LBQ B;  5DJQ C;  4IRE A;  3OVU A;  2BVL A;  4XAX B;  4DV3 T;  3RYH E;  2CZ0 B;  4HNT A;  1XNQ T;  1OKV B;  1HNW T;  3PUW F;  1HX1 B;  2QRX A;  2N1G A;  2CZ6 B;  4I3Z B;  1KXU A;  5HBH B;  2I59 A;  2DD4 B;  3QB5 K;  2XAS B;  2UUB T;  3QOF A;  4DR3 T;  4KX6 A;  4ZGJ B;  1WRD A;  2KMG A;  3MY1 B;  2JGZ B;  2V5C A;  3JAD A;  4CFM B;  3AE3 A;  2W9F A;  2DWG A;  5ETW A;  2YU1 A;  2AXD S;  4LF4 T;  5AQG B;  3HKB E;  2M6B A;  3QZ5 B;  5JRE A;  2BVM A;  2V7I A;  4E7S A;  4YSX A;  1G73 A;  2VVS A;  2BBH A;  2J4G A;  3AE9 A;  2WEV B;  3FBL A;  4YJ2 E;  3PV0 F;  4CXX A;  4UF0 A;  3OKQ A;  2B76 A;  4TUY E;  4UVA B;  1I6Z A;  3P8C D;  2UXD T;  3ANW A;  5LYJ E;  3EID B;  2LHN A;  2CXD A;  1BR4 A;  5FXX A;  4BCO B;  1UNL D;  4UV8 B;  3ONX A;  5CB4 E;  4TV9 E;  2QDJ A;  4ANJ A;  4WBO A;  3H3A A;  1NWM X;  4O4L E;  2IDO B;  5FY1 A;  2DXB B;  3C4X A;  2E8I A;  4WNK A;  5JDM A;  1UUR A;  4L9I A;  3ZT5 A;  1UNH D;  2CLY B;  4H63 H;  2UXB T;  4CFV B;  2BG9 E;  4YTN A;  1KFY A;  4I43 B;  3X25 B;  3RHW A;  4AIU A;  5C2T A;  2V7L A;  3CPZ A;  2J1D G;  3LBX A;  4X1Y E;  3ZEF B;  3C98 B;  3EJ1 B;  5CA0 E;  4KUM B;  5JDQ A;  2CZ1 B;  2CYZ B;  4JX5 A;  3IEE A;  4I0U A;  3A8H B;  2V5D A;  4WW0 A;  4F6W B;  3OBV E;  4MFR A;  1KF6 A;  1OED E;  4F7S B;  2IVX A;  4BCQ B;  5JRC B;  1ZP2 A;  2LM9 A;  3CX8 B;  1OL2 B;  4CN6 A;  4JX6 A;  5DQW A;  2BDE A;  3QK6 A;  2W9Z A;  1S35 A;  5LB7 B;  3ETV A;  5JVD E;  2WS3 A;  3I9Y A;  3JAE A;  3S4U A;  2YU2 A;  1UX5 A;  2Q9Q D;  4JI7 T;  1B7T A;  4QSH A;  2WAU A;  1OL1 B;  1D0X A;  4P09 A;  4DVD A;  5FP3 A;  4CZZ B;  5AFU L;  4QH4 A;  5IUX A;  4HL4 A;  4H9R C;  3J9X 1;  2IAK A;  3JC6 C;  1H27 B;  4CXA B;  5AQQ B;  5ABE A;  2Y8D A;  3C64 A;  5LQF B;  5HXC A;  2CWO A;  1H7C A;  4EOO B;  2ODU A;  2H3R A;  4ZHQ E;  1O9K A;  4DO0 A;  2F2C A;  4HTE A;  2PG8 A;  4DND A;  2J47 A;  2VWA A;  2C5I T;  4BBS M;  2KMF A;  4U7I A;  3K7A M;  3DTO A;  3PU3 A;  2WM9 A;  3PE0 A;  5AQS B;  4UIG A;  4TNW A;  1H25 B;  3RQW A;  2XHE B;  1ZHC A;  4CFU B;  3HHT B;  3RKO A;  3ETU A;  4B3T T;  2CBJ A;  2V7M A;  2DD5 B;  4DV4 T;  1W98 B;  2PK2 A;  4TWF A;  1U4Q A;  5FXW A;  3FZF B;  1BR1 A;  4CN1 A;  3CIR A;  5E0O A;  4TWD A;  3A8Y C;  4HKA A;  5L2L A;  4I4T E;  3F57 A;  3X26 B;  3GN5 B;  3EDV A;  2EHO C;  2NP9 A;  5FY7 A;  2ZPE B;  4F8H A;  4BCH B;  2D2S A;  2QFZ A;  2H7O A;  2KLQ A;  2W62 A;  4OGR B;  3PUY F;  2PBI A;  3LFM A;  4UVB B;  1TFB A;  5LOV E;  2PTF A;  3VYG B;  4AQF C;  1D1C A;  1D0Y A;  3N2K E;  3K8P C;  3CK6 A;  2QQ8 A;  3DJB A;  5J0Z A;  4IE5 A;  2CHN A;  5LA6 E;  2QF7 A;  3ZMV B;  2EUF A;  4CFX B;  4DV6 T;  5BNJ B;  4KP3 C;  4LF8 T;  4MFD A;  2ZPB B;  1FIO A;  3GN5 A;  2G0U A;  2JQK A;  2WDV A;  1YXR A;  5JDG A;  4JV5 T;  4UR9 A;  2CXF A;  3V5U A;  3PUQ A;  5JDL A;  2ZM2 A;  1ZKE A;  3VKH A;  4GKK T;  2PHG A;  3A8G B;  4ELL A;  3HA4 A;  2JQH A;  3AE8 A;  4MLK A;  3MJX A;  4YHH T;  4OK0 A;  3SFE A;  4BY7 X;  5HVY B;  2IIU A;  3UUL A;  1H4L D;  2UUE B;  1FMV A;  2LE8 A;  4KHZ F;  1VYW B;  4ZS3 A;  2LEH A;  2BS3 A;  5AQV B;  3OPC A;  1IBM T;  3N9Q A;  5AQT B;  3ZJ1 A;  5GON E;  4P0A A;  4GYR A;  2X1N B;  4PFO A;  1UGP B;  1HFA A;  2KXP B;  3TW7 A;  1V9D A;  4PK6 A;  3OTO T;  3ZC0 A;  4BBR M;  3B13 A;  1FEW A;  1URC B;  2Q9Q A;  4EXT A;  3U3I A;  4HWC A;  1L0V A;  3AA0 B;  2VK9 A;  4AKL A;  5LP6 E;  4EOM B;  2WWU A;  4BXX X;  3MZK B;  5LXT E;  3RI5 A;  3CWZ B;  4ERR A;  2BG9 B;  2XQ6 A;  1VRB A;  5BR8 T;  5IF1 B;  3T1H T;  3Q9D A;  3MAC A;  3A7M A;  3LK4 2;  1J5W A;  1JOW A;  4BCM D;  3VU7 H;  4H9O C;  2WB5 A;  3HI2 A;  3KHI A;  4GK5 E;  4CI1 B;  2BZB A;  1PKD B;  3FBZ A;  1VCS A;  4JLE A;  2NW8 A;  2XTL A;  2I53 A;  2M67 A;  1P5E B;  4U3C A;  3IHR A;  1N34 T;  3RGF B;  1OED B;  2ODV A;  4ELJ A;  1WFD A;  1I94 T;  4PFP A;  5HXH A;  5CGM A;  1Y64 B;  5JH7 E;  4I55 E;  1UX4 A;  4AKI A;  2XAG B;  2B1E A;  3ONL C;  3JC6 D;  4IIJ E;  4BAY B;  4EC8 B;  2BG9 A;  3LJC A;  3OYX A;  4COF A;  3RRC A;  3EVY A;  5F3J A;  4JI4 T;  2XQ5 A;  1CHU A;  4U2Z A;  3H37 A;  3UU6 A;  3AEE A;  5CA1 E;  3FB2 A;  1SUM B;  4UEM A;  2NWB A;  4IE6 A;  4V1A v;  4O4I E;  5FVL A;  4LMK A;  4K0K T;  5L3D B;  1X9B A;  1WYC A;  2CJM B;  5HXE A;  3RH3 A;  1T98 A;  3EOC B;  3C50 A;  2DI4 A;  1TD6 A;  5AQR B;  3DP7 A;  4TX5 A;  4OB1 B;  4B6X A;  4ZEY A;  1HNX T;  2C5K T;  5KX5 E;  5EFQ B;  3BQI A;  1IJ6 A;  1M7K A;  2VAS A;  4NUU A;  1XWM A;  2XJ7 A;  3F2E A;  4YFS A;  2EHO D;  2BKZ B;  4BCG B;  3Q5E A;  4I50 E;  2L3L A;  3PUR A;  2LOP A;  2MTQ A;  2I40 B;  4DUY T;  4A5X A;  3MXZ A;  2DCF A;  3PUS A;  4H9N C;  1JSU B;  3E08 A;  2IC6 A;  3J7Y q;  4QHO A;  4YSY A;  2GK9 A;  3RIA A;  4HFC A;  1OWA A;  4EZH A;  3X1D A;  2WZH A;  4JI3 T;  4HFV A;  4DV5 T;  2FJB A;  3KV5 A;  2CCQ A;  1NEK A;  1S94 A;  3PJA J;  2VKH A;  4JYA T;  3BG9 A;  1VCT A;  4U33 A;  4IE7 A;  3N9L A;  3F31 A;  2LT3 A;  1H1S B;  4UF0 B;  1OI9 B;  3CQC B;  3O1I A;  3HZJ A;  1SA0 E;  5F5W A;  3ANW B;  2WZI A;  5FMN A;  2CRB A;  3AEG A; 
#chains in the Genus database with same CATH homology
 3QK6 A;  5DQW A;  2BDE A;  3HL6 A;  3LK2 B;  1S35 A;  3WI3 A;  3ETV A;  4BA9 A;  2LSG A;  5JVD E;  3K3N A;  2NTY A;  4QX7 B;  4CI3 B;  1YKH B;  2MYS A;  3D0T A;  3I0Q A;  3I9Y A;  3ZCJ A;  3S4U A;  3NZQ A;  4QXC B;  2YU2 A;  1UX5 A;  1HF8 A;  3HKC E;  2Q9Q D;  3QC9 A;  4AQG A;  1B7T A;  3CKD A;  4EAH A;  2WAU A;  1YD8 G;  4C90 A;  1D0X A;  3SWH A;  1HG2 A;  3KVB A;  4P09 A;  1D1B A;  4QKN A;  4DVD A;  5FP3 A;  1NAF A;  4AKR B;  4CZZ B;  5DQV A;  5AFU L;  3AB3 B;  3VKG A;  3UUN A;  2E9X A;  2A72 A;  4H9R C;  3ZMZ B;  3J9X 1;  4HGA A;  3AVR A;  3K3Q C;  2IAK A;  3JC6 C;  4X1I E;  2ZM0 A;  3Q5X A;  4JUY A;  4GOU A;  2KWH A;  2Y8D A;  3C64 A;  2X9H A;  5HXC A;  3LBX B;  3PUA A;  5F8P A;  2CWO A;  1MMD A;  1OXZ A;  1H7C A;  3CQX C;  4QX8 B;  4P0B A;  3O1H A;  4YLH A;  3M65 A;  2WSS V;  2ODU A;  2PJQ A;  5LJN A;  2H3R A;  3R84 B;  3C4W A;  4ZHQ E;  4OFZ A;  3O1J A;  2IC9 A;  2K9A A;  2X67 A;  4H63 V;  2HPL A;  1O3X A;  2W00 A;  4IGU A;  4DO0 A;  3OJA A;  5JDF A;  2JQQ A;  4HTE A;  2PG8 A;  4DND A;  2X66 A;  3K3O A;  3ZN0 B;  2OA5 A;  4L5G A;  2VWA A;  2C5I T;  1QUU A;  3IBP A;  2KMF A;  2D0T A;  5LHG B;  3DTO A;  3PU3 A;  2W0G A;  3RC3 A;  2WM9 A;  3PE0 A;  2LSK A;  4UIG A;  2K48 A;  2HPJ A;  2XHE B;  1ZHC A;  2YIN A;  3RKO A;  1BR2 A;  2L8K A;  3ETU A;  5J1G A;  1IJ5 A;  2UXN B;  4QXH B;  1AJ3 A;  3ZLI A;  5HXS A;  4FI5 A;  5JR9 C;  3N2O A;  2V7M A;  2UXX B;  3RYI E;  5FYM A;  3U78 A;  3ZMU B;  3EDU A;  1U4Q A;  2LSY A;  2X0L B;  4GIW A;  5DAB A;  5FXW A;  4C91 A;  3NZP A;  5LJM A;  2A3D A;  3R6N A;  1BR1 A;  2DHR A;  3AA7 B;  4FJO A;  4PJJ A;  5E0O A;  3ZYM A;  1FMW A;  2WBL A;  5J2U E;  4HKA A;  5L2L A;  4I4T E;  3ZJ2 A;  4XZC A;  4ZOL E;  4A56 A;  3F57 A;  1CUN A;  3FXE B;  3GN5 B;  3EDV A;  2EHO C;  4PNI A;  4EZ4 A;  3RC8 A;  2NP9 A;  2ZMA A;  4CQI A;  5HWY A;  5FY7 A;  1LRZ A;  3ZN1 B;  2KZ7 B;  4F6R C;  3KV6 A;  3KBU A;  5BMV E;  2KT9 A;  2D2S A;  3HKE E;  5HWX A;  3KBT A;  5H6R B;  3I0O A;  2VKJ A;  2H7O A;  4PAG A;  2KLQ A;  2W62 A;  3EUH A;  3NBX X;  2NTX A;  2XAJ B;  2WMN A;  4AKH A;  2Y48 B;  2PBI A;  3LFM A;  4UVB B;  2LSJ A;  2MOZ A;  5L3E B;  3N2G E;  5LOV E;  3KVA A;  3ZYL A;  4IDZ A;  5IYZ E;  1EZ3 A;  2YK0 A;  4MBQ A;  4N78 D;  2X9W A;  4X20 E;  2HH7 A;  2W61 A;  4HE8 A;  4AQF C;  4AXP A;  3WAK A;  1D1C A;  1D0Y A;  3N5L A;  3N2K E;  1Z0P A;  3AA6 B;  3SOL A;  2DWK A;  2N9D A;  3BK9 A;  3K8P C;  4EIW A;  4ZI3 C;  4AKG A;  2VKO A;  3DJB A;  4CXY A;  4IE5 A;  4ISS A;  5M4Y A;  4O2A E;  4ASK A;  3V5S A;  3A5X A;  2ZM8 A;  3I9W A;  4OYK A;  2LJL A;  2YEV C;  5FXV A;  2CMR A;  4EYU A;  5LA6 E;  1KNZ A;  2Z6E A;  3ZMV B;  1WR6 A;  2X68 A;  4CXW A;  1MIV A;  4ZI7 E;  4KBM B;  5FY0 A;  3B57 A;  2PFV A;  1D0Z A;  3FHN A;  1WLX A;  3NRY A;  1MIW A;  4UV9 B;  4PJL A;  4KP3 C;  5L3B B;  5FXZ A;  3O4X E;  3GA8 A;  1FIO A;  3MKD A;  1US7 B;  3GN5 A;  2JJ9 A;  4PJM A;  2EHO A;  5JQG E;  2WMO A;  3CML A;  2G0U A;  3GWH A;  4PK4 A;  4DBR A;  4DBQ A;  4Z8X A;  2NW7 A;  3RYC E;  3UT5 E;  2X9X A;  2Q9Q C;  2H7V C;  1UCU A;  5JDG A;  2DLR A;  2V26 A;  2K5B B;  4IE0 A;  5JDH A;  4EYY R;  2CXF A;  5LGU B;  3V5U A;  3GMI A;  3PUQ A;  4O2B E;  4GK0 E;  1HCI A;  2LSI A;  3CX6 B;  3E0Z A;  5JDL A;  2ZM2 A;  1SHZ C;  1YW0 A;  1ZKE A;  4U74 A;  3VKH A;  4J2C A;  3LK3 B;  3E22 E;  1IAP A;  3HA4 A;  4ADZ A;  3C4Z A;  3SRZ A;  5L3C B;  4MLK A;  3MJX A;  4AI6 A;  2C5J A;  2XAF B;  2XUE A;  4O4H E;  4OK0 A;  3I1A A;  4X1K E;  4TZ4 C;  3UUL A;  1MND A;  3PU8 A;  5A1L A;  3KIN B;  1FMV A;  2LE8 A;  2MBG A;  3VHL A;  2A2F X;  1HX8 A;  2DNX A;  1D1A A;  1MMA A;  3ZYK A;  4ZS3 A;  2LEH A;  4DMW A;  4UXN B;  1KK7 A;  3TKL B;  3CQG B;  5KDM C;  3N9Q A;  3T8O A;  4G63 A;  5JR9 B;  3ZJ1 A;  5GON E;  4P0A A;  4GYR A;  4M1P A;  4ZI2 D;  2W63 A;  3NRX A;  1G8X A;  4PFO A;  3N9P A;  4NUV A;  3IF8 B;  1HFA A;  2KXP B;  1V9D A;  3KDS E;  4PK6 A;  2Y6X A;  3ZC0 A;  2QGS A;  2CWY A;  4YHJ A;  3B13 A;  1FEW A;  2V7J A;  2Q9Q A;  4EXT A;  1QSD A;  3U3I A;  3AA0 B;  2VK9 A;  3PUG A;  2E9X D;  4AKL A;  5LP6 E;  3Q2M A;  2ZLY A;  2WWU A;  5EK4 A;  2CLY C;  2EHO B;  3MZK B;  3CX7 B;  5LXT E;  3N9O A;  4KMC A;  3KFW X;  4HN9 A;  3CWZ B;  3OYZ A;  4K0U A;  4ERR A;  2V7K A;  4YJ3 E;  1VRB A;  4OHF A;  2N2N A;  2D0U A;  3Q9D A;  3MAC A;  2C0S A;  3P7I A;  5LGN B;  3LK4 2;  5LHI B;  4MAL A;  5C8Y E;  2ES0 A;  3WAJ A;  3AAA B;  3UTK A;  4H9O C;  3VU7 H;  3HI2 A;  4WBN E;  3RRW A;  1U5P A;  1HG5 A;  2XAH B;  3AAE B;  5FNV E;  4OYJ A;  4GK5 E;  2RP4 A;  4CI1 B;  4JEH B;  2BZB A;  2SPC A;  3SS1 A;  3FBZ A;  4L0R A;  3RX6 A;  3L3P A;  4TV8 E;  4QXB B;  4JLE A;  5ADX L;  2NW8 A;  2NOX A;  4U72 A;  3RPU A;  2XTL A;  2M67 A;  3KV4 A;  5DJQ C;  5JR9 A;  5LBQ B;  2BVL A;  4XAX B;  3IHR A;  3RYH E;  5EZY E;  2ODV A;  1ZEE A;  1YKE B;  4ZS2 A;  2N1G A;  4PFP A;  5HXH A;  3UUM A;  3ZCI A;  1Y64 B;  5LGT B;  5JH7 E;  2I59 A;  5JDN A;  2CEA A;  4I55 E;  2X51 A;  1MNE A;  1UX4 A;  1ZV4 X;  4TN7 B;  3AVS A;  4IE4 A;  2CA5 A;  4AKI A;  2XAS B;  2LOS A;  2XAG B;  2JPF A;  2B1E A;  2JMH A;  1MMG A;  1HS7 A;  3JC6 D;  4IIJ E;  2ACX A;  1WRD A;  2V1D B;  4UEL A;  5LNK A;  4BAY B;  2CXL A;  4G2A A;  2KWI B;  4PW8 A;  4EOZ B;  2Q9Q B;  3LJC A;  3OYX A;  4EB6 E;  4BJN A;  4XBF B;  1LVK A;  3RRC A;  1VOM A;  1X79 A;  3EVY A;  2DWG A;  4PJN A;  5ETW A;  5F3J A;  2YU1 A;  3ESL A;  2P9B A;  4MHC A;  4E7Z A;  3HKB E;  3ZPO A;  4IST A;  5JRE A;  3PDY A;  5HAX A;  3H37 A;  2BVM A;  2V7I A;  4E7S A;  1G73 A;  3O9X A;  3HKD E;  5CA1 E;  5IHY A;  2L9Q A;  4AQF A;  4GYS A;  2JRK A;  3FB2 A;  5KMG P;  3FBL A;  5HYA A;  4UEM A;  4YJ2 E;  4ILU A;  2NWB A;  4CXX A;  4IE6 A;  4UF0 A;  4V1A v;  4O4I E;  3PTR B;  5LCY A;  3OKQ A;  4QWN B;  3MA9 A;  5L3D B;  2NW9 A;  4TUY E;  4UVA B;  2KND A;  2XQY A;  1WYC A;  3P8C D;  1HTJ F;  5JRC A;  4IHJ E;  3ANW A;  4O8S A;  5HXE A;  3RH3 A;  4H9Q C;  5LG4 A;  1T98 A;  3BQL A;  5LYJ E;  2LHN A;  3C50 A;  2CXD A;  2JMK A;  2DI4 A;  1BR4 A;  5FXX A;  3CVR A;  3ZC1 A;  3DP7 A;  2XAQ B;  4UV8 B;  4TX5 A;  3ONX A;  2VL8 A;  4B6X A;  5CB4 E;  3UFE A;  3ZMS B;  4TV9 E;  5EK2 A;  3LG7 A;  4ANJ A;  2C5K T;  4WBO A;  3ZMT B;  3H3A A;  5KX5 E;  1NWM X;  3BQI A;  3HR0 A;  1IJ6 A;  2CM0 A;  1BR0 A;  4O4L E;  3N9N A;  3RYF E;  5FY1 A;  3C4X A;  1LKX A;  4O4J E;  2E8I A;  4WNK A;  3W15 B;  5JDM A;  5L3G B;  4L9I A;  2VAS A;  4NUU A;  3Q5W A;  2IW5 B;  3F2E A;  4YFS A;  2EHO D;  2CLY B;  3KV9 A;  5L3F B;  4H63 H;  4ZI2 C;  4I50 E;  1E1H B;  2L3L A;  2RA1 A;  4PK5 A;  4I43 B;  1WYB A;  2K24 A;  3C51 A;  3PUR A;  1IZN B;  2LOP A;  2KIN B;  2MTQ A;  5H6Q B;  5LHH B;  2LHR A;  3MXZ A;  2V7L A;  2DCF A;  3PUS A;  4H9N C;  3CPZ A;  2CE7 A;  5J2T E;  3E08 A;  4BJM A;  2IC6 A;  2J1D G;  2QA7 A;  3LBX A;  4X1Y E;  5HXR A;  4QHO A;  3J7Y q;  3ZEF B;  3C98 B;  3MK7 C;  4H9S E;  2GK9 A;  3N9M A;  5CA0 E;  2E9X B;  4KUM B;  5LBM A;  2E9X C;  2VKD A;  1OWA A;  5JDQ A;  4EZH A;  3IEE A;  3AA1 B;  3L09 A;  4HFV A;  1MIY A;  4HEA A;  4CI2 B;  3KV5 A;  4ZI3 D;  2CCQ A;  1S94 A;  2VB6 A;  1LVF A;  2VKH A;  4IE7 A;  4WW0 A;  3N9L A;  3BQK A;  3F31 A;  3OBV E;  2LT3 A;  4UVC B;  4UF0 B;  4MFR A;  4DMV A;  2X9Y A;  3CQC B;  3O1I A;  1SA0 E;  3AAI A;  3UUX B;  5TAO A;  4JEU B;  3FXD B;  2D5U A;  5EK3 A;  5JRC B;  1MMN A;  3ANW B;  3QUJ A;  2LM9 A;  3CX8 B;  5FMN A;  4H9P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...