2QGSA

Crystal structure of se1688 protein from staphylococcus epidermidis. northeast structural genomics consortium target ser89
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
216
structure length
209
Chain Sequence
MNSRMKIKKAYEYMKSFHQHDTTGHDIAHVERVYNNACYIAKRENITDTLVIELSSLLHDTVDSKLTDEILAYDQLKQFLSTLDLSSEISQQVLYIIKHMSHVKLSIDGEIVRDADRLDAIGAIGIARTFQFSGHFGEPMWTETKLSNEELHTSLVEELDNSAIKHFYEKLFKLKDLMHTPTAKKLAEERHQFMIQYLKQFMSEWNFNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein SE1688
publication title Crystal structure of SE1688 protein from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
total genus 72
structure length 209
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.50 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 HD-domain/PDEase-like 2qgsA01
1.20.58.1910 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2qgsA02
2QGSA 3DJBA 3DTOA 5DQWA 2PJQA 5IHYA 3B57A 5DQVA
chains in the Genus database with same CATH superfamily
2VWAA 3K3OA 1PKDB 4YLHA 4B3RT 4LF9T 3A8LB 5GONE 3VRAA 4CQIA 5CFBA 3K1SA 4CXXA 3TW6A 2CA5A 3TLWA 3DDPB 1OKWB 2IW8B 4DR2T 3A8OB 1XDPA 3TNWB 3CWZB 2NR4A 4OGRB 2CHNA 2XSAA 1QMZB 3AE9A 4JYAT 5EZYE 4PJJA 3A8YC 2XZEA 1ZV4X 4AIUA 5AQLB 1H7CA 5LGNB 2LSGA 2XQYA 3QWLA 3P4RA 4WZXA 3DJBA 4X66T 4PAGA 3PU8A 4TZ4C 1O9KB 4COFA 1Y64B 3ZMSB 1TD6A 4QWNB 4EOSB 3AEDA 2C5KT 5FMNA 4CI3B 1KNZA 4O4JE 1XWMA 4WBOA 3FZHB 4ZHQE 2DLRA 4UIGA 3PE0A 1UX5A 1TFBA 2KT9A 3BK9A 4YXDA 3WVEB 3FZMB 3H37A 3TNHB 3AXJB 2WS3A 4AQFC 2ZM6T 4H9OC 1JKWA 4IDPA 4PJLA 2WY2A 4PK4A 4LF4T 4RODA 4ZS2A 4MFRA 3TLUA 2DHRA 2KXPB 4I43B 3AEBA 3LBXA 5JDNA 2V5CA 3ETUA 2N9DA 3VR9A 3MZKB 5JDMA 2KMGA 5LP6E 4CFMB 3GA8A 2W9FA 3QZ5B 2ZPIB 4ZZCA 2CPTA 5I5ZB 5FP3A 4JI5T 2X0LB 4AQGA 1BR2A 1D3UB 1NWMX 1OIUB 3AVSA 4IT4A 4ILBA 1MMNA 3I9YA 2NP9A 3F2EA 2WU2A 2X0HA 4E7ZA 2IW6B 1UGOA 3AE6A 4U2YA 4HEAA 1IAPA 4DIDB 4FX3B 2QF7A 4F6RC 5LMKB 3RC3A 4BCFB 2XQ3A 4CI2B 3RQWA 3L3PA 4ZEYA 4IMYB 4QSHA 5HEOA 5HEHA 2LEHA 4TWFA 3ZYLA 2FBWA 2XAHB 4ELLA 2IMLA 2ZPHB 3BLRB 4JX4A 3W15B 2VK9A 2H88A 2PK9B 2WFYB 3BLHB 1UNHD 2V6YB 1H27B 3P4PA 4DUYT 5AQFB 2X9WA 1YKEB 4DR4T 1OEDB 3T1HT 2PG8A 1W09A 2QVAA 2BZBA 4YHJA 2WQYA 4HWHA 4JX5A 4EEBA 4XZCA 5LGUB 4H63V 4EOLB 2X67A 3AE4A 2QQ8A 4QH5A 3EOCB 2WDQA 2L3LA 2C5OB 1YQ3A 3O0GD 4CZZB 5AQKB 3VR8A 4OHFA 2IC6A 1W9RA 4UVBB 2D9DA 3RF1A 3UU3A 3LQ5B 4AQYT 2KR6A 3ZJ1A 2DXCB 2W61A 3RYFE 2ES0A 5KXJA 5JVDE 4DNDA 4YC3B 4ILCA 2CBIA 2W4XA 5HXCA 2QRXA 3RLFF 5DJQC 3Q5EA 3RIUC 2QYWA 1XNRT 2Y6XA 2G77A 2C5IT 2WM9A 2BDEA 4L9IA 3LBXB 5JDQA 4AI6A 3S4UA 4P0AA 4UEMA 3KV9A 5FL0A 4EEDA 2UZEB 2WMBB 2ZM8A 5JRCA 4PK5A 2P9BA 2B1EA 3FZKB 1H4LD 2CCHB 2WMAB 4X1KE 4ZGDB 4GK5E 3ZSTA 3PJAJ 4UVCB 1N36T 3CQXC 4QXHB 3NBXX 4MHCA 3AEFA 4H9QC 1MIYA 2YDSA 4MBQA 1WYBA 2LSKA 4JI8T 2WWVA 4AQFA 2CXLA 4O2AE 4IE5A 4HWIB 4PW8A 1D0XA 1L0VA 4DV7T 3SWHA 3SFEA 4IE6A 4DR3T 1D0ZA 5LOVE 2HPLA 3P8CD 5LG3A 4FJOA 4JI3T 3VYHB 1VCTA 3IF8B 2LM9A 2CWOA 4ROCA 3NZQA 2XPKA 3Q9DA 4MFEA 1WFDA 2UXXB 5HWYA 1T8BA 4HNUA 4DV4T 4L0RA 3NRXA 4HFIA 1UUSA 4O8SA 5L3GB 3TW7A 3V5UA 1H25B 2YU2A 3Q5WA 2BBHA 4CN6A 1I6ZA 3X28B 3UUBA 5IWAT 2YDRA 2H3RA 1FEWA 3HKEE 3ONLC 2CYZB 3OYZA 4QHOA 1YD8G 4J2CA 1GY3B 2UXNB 5AQGB 2WZIA 5AQTB 3ONXA 2PHGA 2LOPA 1OEDC 2IC9A 5EK3A 4NC6A 5IDPB 2BKZB 2FUPA 2LM2A 3ZMVB 4I50E 4F7JB 2X66A 2BS3A 5DQWA 2DD4B 1UNGD 2ZPEB 3TKLB 1FIOA 3EDUA 2W96A 4BCOB 3HKBE 2XAQB 5AQUB 4ZZBA 1H24B 2YU1A 4ZI2C 2ZMAA 2MBGA 3AE1A 2IAKA 2K5BB 2HHHT 3EIDB 2V7MA 3G33B 5HBHB 1D0YA 5LYJE 1X9BA 2UZBB 4Z90A 3B5MA 4JI2T 3O1HA 5JRCB 3PUSA 5HXSA 4LMLA 1Z0PA 3N2GE 4MLKA 3FHNA 5HNBB 4YOSA 3HKDE 4KHZF 2MOZA 2W99A 4ELJA 3PUXF 4UV8B 4U33A 4F7LB 1UNLD 4CXAB 4AKHA 4Z91A 1Y01A 2WZHA 3E22E 1OL1B 2F2CA 5FNVE 4OB0B 2L8KA 2GK9A 2IHR1 5AQHB 4ZI7E 1H26B 2JQKA 4DV6T 4B6XA 4HFDA 4PFOA 3CIRA 2F4VT 1UK5A 4TWHA 4HFVA 1IBLT 1J5ET 3P4QA 1ENWA 5LXTE 4HKAA 3RIUA 2W2HA 1WR0A 4KX6A 4LOCA 2ZM0A 3WI3A 3UQ4A 4YHHT 4JI6T 3PURA 1SE7A 1J5WA 2V22B 3BQIA 4IDNA 4O4HE 3N9QA 2QFZA 3A8GB 1XNQT 3R84B 2J1DG 5HCJA 1IJ6A 3MKDA 4A98A 5DQVA 1IJ5A 5HQ0B 1CUNA 5AQSB 3CQGB 4CN4A 2LRKA 3ONJA 1BR4A 5J2UE 5LHHB 4EOIB 3N9NA 4C91A 2UZDB 1U4QA 3L09A 5C2TA 3KFWX 1O3XA 2AXDS 4EOOB 4PJMA 4DR1T 3CX6B 4DV3T 3FZFB 4BCGB 2LE8A 1H1QB 4U3CA 2VKDA 4ZI2D 1S35A 1OXZA 3QYHB 4YY3T 3CQCB 4ILUA 3QB5K 1YKHB 4EOQB 4PJNA 2W00A 5AQNB 3UQ7A 2HN2A 4GOUA 1H1RB 1MMGA 2X68A 2CM0A 2WIPB 4EC9B 2Q9QC 1AISB 4YTMA 1MNDA 3DOGB 2XSBA 1VOMA 5ETWA 1NAFA 2LOSA 1W0AA 2VL0A 2XQAA 4YOOA 2I59A 4XAXB 2WPAB 1KF6A 1FMWA 3WAKA 1SA0E 2NOXA 4U74A 2V6YA 4OB2B 3GTMS 2ZPFB 2HH7A 4O4IE 2E2AA 3ZMZB 1AJ3A 4BCJB 2QGSA 4ZS3A 1OEDA 4H9NC 3L39A 4OR5B 2D0TA 5AQQB 2WU5A 2PBIA 2BS4A 2UXCT 2C5NB 4A5XA 2N1GA 2QDYB 5KDMC 3ZCJA 4IL4A 2UXBT 4AKIA 3LG7A 4EYYR 5E0OA 3N9PA 5HXEA 5AQRB 2LKGA 4GK0E 3LFMA 4U7YA 2OV9A 2JPFA 3E0ZA 2BKPA 2ZPBB 3F5XB 2E5LT 3J7Yq 1NEKA 1E7PA 3ZLIA 2V8SV 5AQOB 4HFEA 3NVOA 2XAFB 2CLYC 2V7JA 3ZN1B 2J4GA 1HR0T 4WNKA 3EVYA 3BG5A 4I0UA 2WJ9A 3UU6A 3RH3A 3E08A 1VRBA 2YN6A 3Q2MA 3MI9B 2UZLB 5JDHA 3K3NA 1AHJB 4JI1T 3KV6A 2VVNA 2BBJA 5EK2A 3UUNA 3X25B 2VKJA 4NXNT 3RKOA 4TV9E 3LK3B 1HX1B 5FY7A 1T7SA 2Y48B 2WEVB 3HZJA 3ZC1A 5M4YA 3RI5A 4JEUB 4ZI3C 2BG9B 3C4WA 1FKMA 5FVLA 2UXDT 5JDLA 2VKOA 3RQUA 3FXEB 3RYHE 4PFPA 4EV6A 1IBKT 3GN5B 2VURA 1UGQB 2KWHA 1J1JA 4EOPB 3A5XA 3SRZA 1OWAA 4YT0A 4P1NA 4X64T 1YW0A 4NXMT 4HNVA 5L3FB 3AE3A 3BLQB 2LKHA 4X65T 1B7TA 1EZ3A 3Q5XA 5AQJB 2V5DA 1LKXA 4U2ZA 3AE5A 2XUEA 3ZSSA 4UV9B 2DI4A 2J62A 4TTHA 3JAFA 4LMJA 3HI2A 2H7OA 1XO2A 2XY8B 2NTXA 3RGFB 4BCQB 4M1PA 2IW9B 1UGRB 3ZMUB 3N9MA 3VU7H 3M65A 3G06A 2KZ7B 4HWDA 2CBJA 2X51A 4NPPA 3U3IA 5L3EB 2WSSV 4X62T 4DV0T 5JDFA 5BMVE 4TX5A 3SS1A 4H9RC 1LVFA 2CZ7B 4F6WB 4X1IE 5LA6E 4GKKT 2E9XC 3CK6A 3RYIE 4O4LE 2Q9QA 3K7AM 3ABVA 1UGPB 1XMQT 4LF5T 2Y8DA 3PUQA 1YXRA 5L3CB 3R6NA 3QC9A 3QYGB 2Z6EA 1H28B 2VVSA 5LJMA 3ESLA 3V5SA 5FXZA 4ZGJB 3QHWB 2YEVC 2LLYA 1OGUB 2C5VB 4GYRA 3SFDA 4BA9A 1AD6A 3AB3B 4OX9T 4IDQA 3N2KE 3ZPOA 2W2UA 2W66A 3K8PC 3B13A 2JMKA 4EOJB 3UT5E 1H1SB 4YJ3E 4CFWB 1ZOYA 4F6UB 3RIFA 4AKRB 3JC6C 5HCMA 4BCNB 3KBTA 5JH7E 4CFUB 3AEAA 2W62A 1N32T 3X24B 1IREB 1WYCA 5EK4A 2NW7A 3C51A 2EUFA 1XZYA 3A8HB 2MYSA 2XM2A 2BG9C 3QK6A 4YFSA 1Z8UA 4IDZA 2M6BA 2WDRA 3FXDB 2VL8A 2JMHA 4F8HA 2UUCT 4CFXB 5LCYA 3AVRA 3QYBA 4HLQA 4F6SB 3PU3A 4GYSA 2WB5A 1KXUA 1W98B 1WRDA 2K48A 3NDQA 4XBFB 1I94T 1G73A 2QDJA 4U31A 1WLXA 2I40B 5ADXL 2I53A 1FINB 1QUUA 2XJ7A 3AAAB 4EXTA 1YQ4A 3MACA 4JI0T 5FY0A 4M6VA 3RKGA 1P5EB 4UXNB 5L2LA 3OTOT 2LRLA 2VQFT 3VYGB 3HA4A 2LW4A 3LK42 5FVKA 3CMLA 3TLVA 2C0SA 3BHTB 1FVVB 1G8XA 2PFVA 2NWBA 4ADZA 4N78D 2XQ4A 2Q9QB 3A7MA 2EHOC 2I6HA 2WMOA 3UULA 4CXWA 4ANJA 4QXCB 3UFEA 1HX8A 4LFCT 5FGKB 2XQ9A 3P4SA 5TAOA 1HNXT 3IA3A 3KINB 4HWCA 4EONB 4BJNA 2VQET 3MJXA 2LT3A 4CI1B 2VASA 2JGZB 2AE9A 3RGLA 1ZEEA 2JQQA 1XDOA 3C4ZA 4EIWA 4DR5T 2IUBA 4U72A 5FL1A 2HPJA 4E7SA 4AISA 3QUJA 3JC6D 1JSUB 4BBRM 5LBMA 4V1Av 4GIWA 5L3DB 4NUVA 3UU5A 2XQ5A 4ASKA 2E9XA 2LJLA 3MIAB 4BCIB 3M3ZB 1CHUA 4P09A 3LSVA 4CN1A 4TNVA 1IZNB 3IBPA 1V9DA 2CJMB 1ZHCA 2PK2A 2CLYB 1GQEA 3PUYF 1MNEA 5CGMA 2K9AA 1HTJF 3DTOA 3AEGA 3RPUA 4JV5T 2X9YA 2H7VC 2XQ8A 5C3JA 1IBMT 3POMA 3A8MB 1SHZC 4U7IA 2A2FX 4B3MT 4I4TE 4JX6A 4QXBB 3KV4A 4KHPT 2MTQA 1XMOT 4PNIA 3ZCIA 1MMAA 4IE4A 5LB7B 3DL1A 5IDNB 2BKOA 4F7NB 5LG4A 1VCSA 2C4GB 2IW5B 5H6QB 4DMWA 1ZKEA 3JAEA 4LF7T 1T72A 3M03A 1MIVA 1H1PB 1D1CA 1E1HB 4CFNB 2XQ6A 3NRYA 4BCQD 2LSJA 4K0UA 3P7IA 1HFAA 1FMVA 4HTEA 5AQIB 2DWKA 3C4XA 2EHOD 2KWIB 3ZT5A 3TLSA 1M62A 1G3NC 4IDOA 4YSYA 3WVDB 3VHLA 2I0MA 4OK0A 2BVLA 2RPAA 2W67A 3C64A 5EJCA 2BG9A 3O9XA 2VB6A 3RIAA 4WW0A 3CKDA 4ZGEB 1DU2A 2CZ1B 4KRCB 2QA7A 2WXVB 3N9OA 4HWFA 3GN5A 3AECA 1OEDE 5LBQB 5JQGE 1UURA 3ETVA 5JR9C 3QNUA 2DWGA 3DP7A 4B3TT 2SPCA 1MMDA 2LSIA 5IUXA 2D0QB 3AA6B 5HXHA 3OYXA 4TN7B 3EUHA 2NW9A 4KUMB 1KK7A 1UGSB 4LFAT 4JI4T 3TNIB 3AAIA 4IL9A 2CE7A 4CRLB 4QKNA 2CXFA 2CCIB 3WAJA 4YOZA 2X9XA 2BS2A 3RRWA 3HL6A 4MALA 2WHBB 1LRZA 1VOLA 5L4HA 3ZKRA 2E9XB 1BU2A 2V6XA 1US7B 3FBLA 3LDQB 4HFBA 2CMRA 2EHOA 3ZMTB 4HL4A 2X1NB 1SUMB 2W63A 4JLEA 5J0ZA 3HR0A 4OYKA 4BCND 3ANWA 2XAGB 5HVYB 4CFUD 3T1YT 4X1YE 2LHRA 1U5PA 4AKLA 3CVRA 3MA9A 2V26A 2IVXA 1BR0A 4TWDA 4I55E 3ZC0A 3AE8A 4KMCA 3KVBA 1JOWA 2V7KA 2FJBA 4AXPA 4BXXX 4EC8B 1C9BA 4BCMB 3H4CA 4ZXLA 3I1AA 3PTRB 4GKJT 4NSTB 1E2AA 5CYIB 2MPKA 1HNZT 1UX4A 4F70B 5JREA 4UR9A 5ABGA 2PTFA 3UUXB 1GUXA 1T98A 3AA1B 1ZP0A 2D5UA 4HGAA 2V7IA 3ZN0B 1LVKA 3FZLB 2ACXA 3UU4A 4DMVA 4JEHB 2MAWA 5C8YE 3QHRB 3ZJ2A 1OKVB 3MXZA 1ZP2A 4O2BE 2KNDA 3PUAA 1VINA 2ZPGB 4YTPA 4X5TA 1D1AA 4ZOLE 5CA0E 4EZ4A 2Q9QD 1QSDA 2CRBA 2WP9A 4CFVB 4DV5T 1BR1A 5ABFA 3F57A 3EDVA 4AKGA 3QOFA 1KNRA 4II5B 2WBLA 2KMFA 4I3ZB 5FKYA 3OPCA 4LFBT 1WCRA 2YKSA 4NUUA 2IN3A 2CHOA 3UFGA 5HAXA 2WCAA 2WMNA 4MFDA 4QH4A 3T8OA 4HNTA 5F3JA 3J9X1 3JCFA 5JDGA 4DR7T 3IEEA 3BQKA 2ODVA 3FBZA 3GMIA 1HG2A 4H9PC 4PK6A 3N9LA 2IIUA 1N4MA 2N2NA 1JSTB 2H89A 4FM4B 4BAYB 2BPMB 1HS7A 3RX6A 3MY5B 2WWUA 3BG3A 4YTNA 2EHOB 2DL1A 3OBVE 4EZHA 4EGWA 5L2WB 3EJ1B 2XASB 5HEGA 3ANWB 5JR9A 3X20B 5ACBA 3HO8A 3PUVF 4OB1B 3ZEFB 3TN8B 1OI9B 2J47A 4EB6E 4OYJA 4NIQA 2ZLYA 4EAHA 4TNWA 4YJ2E 3X26B 2A3DA 2ODUA 3PJAA 3HB9A 2CEAA 3HKCE 2VKHA 5L3BB 3QZ9B 3OVUA 5AQPB 3PDYA 1KFYA 2E5VA 2CZ6B 2C6TB 3N5LA 1GUXB 4EORB 3KBUA 3PUWF 5IYZE 5J2TE 3P50A 1FJGT 2DD5B 5HBJB 4KI0F 4ZI3D 5ICPB 1WR6A 4BJMA 5EFQB 3EI0A 3UTKA 5ABHA 3EAMA 3BHVB 2XM1A 2KSRA 4UN0A 2JIWA 3QB5A 4H9SE 3B57A 4Z6YA 4EOZB 1UCUA 2B9RA 5LNKA 2XAJB 3U78A 4KRDB 5JTGA 2V1DB 5F8PA 2OLTA 3BQLA 5ABFB 2C5JA 3CX8B 1V29B 2RA1A 3UU8A 4DV1T 2W0GA 5FY1A 4CXYA 4ISSA 3Q5DA 2ZM2A 3EHZA 3I9WA 1W0BA 2ZZDB 5FXWA 3O4XE 4MIMA 2JJ9A 5A1LA 1JNRA 3C98B 4DR6T 4A97A 2JQ9A 2D0UA 3GWHA 4P0BA 3H3MA 2D2SA 2G0UA 3H3AA 2XQ7A 3PV0F 5HXRA 1D1BA 4UF0A 5F5WA 3AAEB 2NTYA 4YSXA 3UUMA 4G63A 3VRBA 2CZ0B 1KEYA 5HEUA 1X79A 3RHWA 5AQMB 4LMKA 4ROEA 3BHUB 5LGTB 4BCPB 1HG5A 2L9QA 5BR8T 3AA0B 2E9XD 5L47A 3CPZA 3KV5A 4Q25A 5BNJB 1KNPA 5JR9B 2XTLA 4WBNE 3ZYMA 4BCKB 4BY1X 2OA5A 5HWXA 2R6GF 5J1GA 2YDQA 2R7GA 5AFUL 3OKQA 2K24A 3AE2A 1GH6B 3HHTB 5CEIB 2NW8A 3AE7A 5H6RB 4DV2T 4BCMD 4JI7T 4IGUA 5IHYA 2CXDA 1F5QB 3QXEB 3N2OA 2W9ZA 3ZT6A 3D0TA 2DXBB 4LF8T 4UELA 2A9UA 4JBWF 3RC8A 3LJCA 4ILAA 2UU9T 1N33T 4EOKB 2CWYA 2C5XB 2A72A 2UUEB 3VKGA 3MK7C 4BCHB 4EOMB 4TUYE 3KVAA 5LQFB 3C50A 5KMGP 2AHJB 2UUAT 2BKNA 4ERRA 4X20E 3CX7B 3LK2B 2DPPB 3BG9A 2X9HA 2BVMA 1NENA 2CCQA 3P4WA 3AEEA 5LMNT 2WAUA 4IHJE 4EYUA 4H63H 2G9XB 3PO3S 2DMEA 4IIJE 2WIHB 2FJEA 2YK0A 3NZPA 2YOEA 3FB2A 3OJAA 4L5GA 3TLTA 5L4EA 3RYCE 3X1DA 5FXXA 2JQHA 4UVAB 2JRKA 4OFZA 3NKZA 1URCB 2LHNA 4WYVA 1HF8A 3NWIA 2WDVA 2DCFA 2X0YA 1VYWB 2UUBT 2YINA 4IREA 4BBSM 2FJDA 4C90A 3I0QA 1OIYB 1JNZA 1O9KA 4LF6T 3I0OA 4F7SB 2HN1A 3AA7B 4DVDA 2BG9E 2M6IA 2IDOB 4KBMB 5CB4E 4ISTA 5AQVB 4UF0B 2XHEB 3F31A 3L8RA 4HN9A 3ZT7A 3ZYKA 3EABA 3O1JA 3PUZF 5FYMA 3K3QC 2B76A 2ACZA 5IF1B 4G2AA 4DUZT 4QX7B 4HFHA 4IE7A 2KLQA 3AXJA 4G6LB 4JUYA 5LMUT 2V7LA 3KDSE 1OL2B 2LSYA 3O1IA 3DDQB 3QYEA 5LHGB 2RP4A 3SOLA 2FJAA 4FI5A 5CJ5A 1HCIA 4BY7X 1HNWT 4DBRA 4TV8E 2PMIB 4Z8XA 4IE0A 4HFCA 4HE8A 4OB3B 5ABEA 1N34T 3JADA 2PJQA 2M67A 5LHIB 4QX8B 5FXVA 3HBLA 4Y72B 3PUGA 5DABA 5CA1E 1R8IA 1MIWA 4B3ST 2DNXA 3VKHA 5KX5E 2E8IA 4YSZA 5HEJA 1S94A 4K0KT 5HYAA 4DO0A 3MY1B 4A56A 4QH1A 1M7KA 1QLBA 4DBQA 3RRCA 1E9HB 3KHIA 2K3WA 4KP3C 2ZCFB 5HBEB 3IHRA 2KINB 5LJNA
chains in the Genus database with same CATH topology
3JC6C 2VWAA 3N2GE 3K3OA 4MLKA 3FHNA 4NUUA 4YLHA 3KBTA 5JH7E 3HKDE 2MOZA 5GONE 4CQIA 5HAXA 2WMNA 2W62A 4UV8B 4CXXA 1WYCA 5EK4A 2NW7A 2CA5A 3T8OA 5F3JA 3C51A 3J9X1 4AKHA 5JDGA 2MYSA 3IEEA 3BQKA 2ODVA 3FBZA 3GMIA 3QK6A 1HG2A 4YFSA 3E22E 4H9PC 3CWZB 5FNVE 4IDZA 2L8KA 3FXDB 4PK6A 2VL8A 3N9LA 2GK9A 2JMHA 4ZI7E 2N2NA 5LCYA 4B6XA 4BAYB 3AVRA 4PFOA 5EZYE 3RX6A 1HS7A 4PJJA 3PU3A 4GYSA 1ZV4X 1WRDA 4XBFB 2K48A 2WWUA 4HFVA 1G73A 2EHOB 3OBVE 4EZHA 1H7CA 1WLXA 5LXTE 5ADXL 2LSGA 2XQYA 4HKAA 5LGNB 1QUUA 3DJBA 2XASB 3AAAB 4EXTA 2ZM0A 3MACA 3ANWB 5FY0A 5JR9A 4PAGA 3PU8A 4TZ4C 3WI3A 4UXNB 1Y64B 5L2LA 3PURA 3ZMSB 4QWNB 3ZEFB 2C5KT 5FMNA 3BQIA 4O4HE 3N9QA 4CI3B 1KNZA 3HA4A 4O4JE 3R84B 2J1DG 4WBOA 1IJ6A 4ZHQE 2DLRA 4OYJA 4EB6E 4UIGA 2ZLYA 3PE0A 3MKDA 1UX5A 4EAHA 5DQVA 4YJ2E 3LK42 1IJ5A 2KT9A 3BK9A 3CMLA 2A3DA 2ODUA 2C0SA 3H37A 1G8XA 1CUNA 2CEAA 4AQFC 2PFVA 3HKCE 4H9OC 2VKHA 2NWBA 4ADZA 5L3BB 3CQGB 4N78D 3PDYA 4PJLA 2Q9QB 1BR4A 5J2UE 4PK4A 5LHHB 2EHOC 2WMOA 3N9NA 3UULA 3N5LA 4CXWA 4ANJA 3L09A 1U4QA 3KBUA 4C91A 4ZS2A 3KFWX 4QXCB 3UFEA 5IYZE 4MFRA 1HX8A 1O3XA 5J2TE 2DHRA 2KXPB 4I43B 3LBXA 5JDNA 4PJMA 4ZI3D 5TAOA 1WR6A 3CX6B 4BJMA 3KINB 2LE8A 4BJNA 3MJXA 3ETUA 2LT3A 2N9DA 3MZKB 3UTKA 4CI1B 5JDMA 2VKDA 2VASA 4ZI2D 1S35A 1OXZA 5LP6E 3GA8A 1ZEEA 2JQQA 3CQCB 4ILUA 3C4ZA 4EIWA 4H9SE 1YKHB 4U72A 3B57A 5FP3A 4PJNA 4EOZB 1UCUA 2X0LB 2W00A 2HPJA 4E7SA 5LNKA 4AQGA 1BR2A 4GOUA 2XAJB 1MMGA 2X68A 1NWMX 2CM0A 3JC6D 3QUJA 3AVSA 3U78A 1MMNA 5LBMA 4V1Av 3I9YA 4GIWA 2NP9A 2Q9QC 3F2EA 2V1DB 4E7ZA 5L3DB 4NUVA 5F8PA 1MNDA 1VOMA 5ETWA 1NAFA 2LOSA 3BQLA 4ASKA 2C5JA 2I59A 2E9XA 2LJLA 3CX8B 1IAPA 4HEAA 4XAXB 1FMWA 2RA1A 3WAKA 1SA0E 4P09A 2NOXA 2W0GA 5FY1A 4U74A 1IZNB 4F6RC 3RC3A 3IBPA 4ISSA 4CXYA 1V9DA 1ZHCA 2HH7A 4CI2B 2ZM2A 2CLYB 3I9WA 4O4IE 5FXWA 3O4XE 3L3PA 3ZMZB 1AJ3A 1MNEA 2K9AA 1HTJF 2JJ9A 5A1LA 2QGSA 3C98B 2LEHA 4ZS3A 3DTOA 3ZYLA 2XAHB 4H9NC 2D0UA 3GWHA 4P0BA 3W15B 2D0TA 2D2SA 2G0UA 2VK9A 3RPUA 3H3AA 5HXRA 1D1BA 2PBIA 4UF0A 2X9YA 2H7VC 3AAEB 2NTYA 1SHZC 3UUMA 2N1GA 4G63A 5KDMC 2A2FX 3ZCJA 2X9WA 3LG7A 4EYYR 1X79A 5E0OA 4AKIA 1YKEB 3N9PA 5HXEA 4I4TE 5LGTB 4QXBB 1HG5A 2L9QA 2PG8A 3KV4A 3AA0B 2E9XD 4GK0E 2MTQA 3LFMA 2JPFA 3E0ZA 4PNIA 3ZCIA 1MMAA 3CPZA 2BZBA 4IE4A 4YHJA 3J7Yq 3KV5A 3ZLIA 5LG4A 2IW5B 5H6QB 4DMWA 4XZCA 5LGUB 1ZKEA 4H63V 2XAFB 2CLYC 2X67A 2V7JA 3ZN1B 1MIVA 1D1CA 1E1HB 5JR9B 2L3LA 3NRYA 2XTLA 4WNKA 5LJNA 2LSJA 3EVYA 3ZYMA 4K0UA 4CZZB 4WBNE 3P7IA 1HFAA 4OHFA 2OA5A 2IC6A 1FMVA 4HTEA 5HWXA 4UVBB 5J1GA 3RH3A 2DWKA 3C4XA 2EHOD 2KWIB 5AFUL 3E08A 3OKQA 2K24A 1VRBA 3ZJ1A 3Q2MA 2W61A 3VHLA 3RYFE 5JDHA 2NW8A 5H6RB 4OK0A 2ES0A 2BVLA 3K3NA 3C64A 5JVDE 4DNDA 3KV6A 3O9XA 5HXCA 2VB6A 4IGUA 5IHYA 5EK2A 3UUNA 5DJQC 2VKJA 2CXDA 4WW0A 3CKDA 3RKOA 4TV9E 2QA7A 3LK3B 3N2OA 3D0TA 3N9OA 3GN5A 2Y6XA 5FY7A 2C5IT 2WM9A 5LBQB 2BDEA 4UELA 5JQGE 4L9IA 2Y48B 3LBXB 3ZC1A 5JDQA 5M4YA 3RC8A 3ETVA 4JEUB 5JR9C 4AI6A 3LJCA 2DWGA 4ZI3C 3S4UA 2CWYA 3DP7A 3C4WA 2A72A 4P0AA 4UEMA 2SPCA 3KV9A 1MMDA 2LSIA 3MK7C 2ZM8A 5JRCA 3VKGA 4PK5A 3AA6B 5JDLA 2VKOA 4TUYE 3FXEB 2P9BA 3RYHE 2B1EA 3KVAA 4PFPA 5HXHA 3OYXA 3C50A 4TN7B 3EUHA 2NW9A 4KUMB 3GN5B 4X1KE 5KMGP 1KK7A 4ERRA 4GK5E 4X20E 3CX7B 3LK2B 2KWHA 4UVCB 2X9HA 2BVMA 3SRZA 2CCQA 3A5XA 1OWAA 3AAIA 3CQXC 4QXHB 2WAUA 3NBXX 4MHCA 1YW0A 2CE7A 4IHJE 4EYUA 4H63H 4H9QC 4QKNA 5L3FB 1MIYA 2CXFA 4MBQA 4IIJE 1WYBA 2YK0A 2LSKA 3NZPA 3WAJA 3FB2A 3OJAA 4L5GA 2X9XA 3RYCE 3RRWA 3HL6A 4MALA 5FXXA 4AQFA 1LRZA 4UVAB 1B7TA 2CXLA 2JRKA 1EZ3A 4O2AE 4IE5A 2E9XB 4OFZA 2LHNA 3Q5XA 1US7B 1LKXA 3FBLA 1HF8A 4PW8A 2CMRA 2EHOA 3ZMTB 2DCFA 1D0XA 2XUEA 2YINA 4UV9B 3SWHA 4IE6A 1D0ZA 2DI4A 5LOVE 2HPLA 3P8CD 2W63A 4FJOA 4C90A 4JLEA 3I0QA 3HR0A 3HI2A 2H7OA 4OYKA 2NTXA 3ANWA 2XAGB 3IF8B 4M1PA 4X1YE 2LHRA 2LM9A 1U5PA 3ZMUB 4AKLA 3CVRA 3AA7B 3I0OA 3MA9A 2V26A 3N9MA 3VU7H 4DVDA 1BR0A 3M65A 2KZ7B 4KBMB 5CB4E 2CWOA 2X51A 4I55E 4ISTA 3NZQA 3ZC0A 3U3IA 5L3EB 4KMCA 4UF0B 2XHEB 3KVBA 3Q9DA 2WSSV 2UXXB 3F31A 5HWYA 2V7KA 4HN9A 5JDFA 3ZYKA 5BMVE 3O1JA 4L0RA 3NRXA 5FYMA 3K3QC 4TX5A 3SS1A 4O8SA 4H9RC 4AXPA 5L3GB 1LVFA 3V5UA 2YU2A 4G2AA 3Q5WA 4X1IE 4QX7B 4IE7A 5LA6E 2KLQA 4JUYA 3I1AA 3PTRB 2V7LA 2E9XC 3RYIE 3KDSE 4O4LE 2H3RA 1UX4A 2Q9QA 5JREA 1FEWA 3HKEE 3OYZA 1YD8G 2LSYA 3O1IA 4J2CA 4QHOA 1T98A 3AA1B 3UUXB 5LHGB 2UXNB 2RP4A 2Y8DA 3SOLA 4FI5A 3PUQA 1HCIA 2D5UA 4HGAA 5L3CB 2V7IA 3ZN0B 3R6NA 3QC9A 4DBRA 4TV8E 1LVKA 2Z6EA 3ONXA 4Z8XA 2LOPA 4IE0A 2IC9A 5EK3A 3ZMVB 2ACXA 4HE8A 4I50E 4DMVA 4JEHB 5LJMA 2X66A 5C8YE 3ESLA 3V5SA 5FXZA 2PJQA 3ZJ2A 2M67A 5DQWA 5LHIB 4QX8B 5FXVA 2YEVC 3MXZA 3TKLB 1FIOA 3EDUA 4O2BE 2KNDA 3PUGA 4GYRA 3PUAA 3HKBE 5DABA 5CA1E 2XAQB 4BA9A 1MIWA 3AB3B 2DNXA 1D1AA 4ZOLE 3VKHA 3N2KE 5CA0E 4EZ4A 3ZPOA 5KX5E 2YU1A 2E8IA 2Q9QD 4ZI2C 1QSDA 3K8PC 3B13A 2JMKA 2ZMAA 3UT5E 1S94A 2MBGA 2IAKA 2K5BB 1BR1A 3F57A 2V7MA 3EDVA 4AKGA 2WBLA 5HYAA 1D0YA 4DO0A 5LYJE 4A56A 4DBQA 2KMFA 4YJ3E 3RRCA 4KP3C 3O1HA 3IHRA 3PUSA 2KINB 4AKRB 5HXSA 5JRCB 1Z0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGS A;  3DJB A;  3DTO A;  5DQW A;  2PJQ A;  5IHY A;  3B57 A;  5DQV A; 
#chains in the Genus database with same CATH topology
 2VWA A;  3K3O A;  1PKD B;  4YLH A;  4B3R T;  4LF9 T;  3A8L B;  5GON E;  3VRA A;  4CQI A;  5CFB A;  3K1S A;  4CXX A;  3TW6 A;  2CA5 A;  3TLW A;  3DDP B;  1OKW B;  2IW8 B;  4DR2 T;  3A8O B;  1XDP A;  3TNW B;  3CWZ B;  2NR4 A;  4OGR B;  2CHN A;  2XSA A;  1QMZ B;  3AE9 A;  4JYA T;  5EZY E;  4PJJ A;  3A8Y C;  2XZE A;  1ZV4 X;  4AIU A;  5AQL B;  1H7C A;  5LGN B;  2LSG A;  2XQY A;  3QWL A;  3P4R A;  4WZX A;  3DJB A;  4X66 T;  4PAG A;  3PU8 A;  4TZ4 C;  1O9K B;  4COF A;  1Y64 B;  3ZMS B;  1TD6 A;  4QWN B;  4EOS B;  3AED A;  2C5K T;  5FMN A;  4CI3 B;  1KNZ A;  4O4J E;  1XWM A;  4WBO A;  3FZH B;  4ZHQ E;  2DLR A;  4UIG A;  3PE0 A;  1UX5 A;  1TFB A;  2KT9 A;  3BK9 A;  4YXD A;  3WVE B;  3FZM B;  3H37 A;  3TNH B;  3AXJ B;  2WS3 A;  4AQF C;  2ZM6 T;  4H9O C;  1JKW A;  4IDP A;  4PJL A;  2WY2 A;  4PK4 A;  4LF4 T;  4ROD A;  4ZS2 A;  4MFR A;  3TLU A;  2DHR A;  2KXP B;  4I43 B;  3AEB A;  3LBX A;  5JDN A;  2V5C A;  3ETU A;  2N9D A;  3VR9 A;  3MZK B;  5JDM A;  2KMG A;  5LP6 E;  4CFM B;  3GA8 A;  2W9F A;  3QZ5 B;  2ZPI B;  4ZZC A;  2CPT A;  5I5Z B;  5FP3 A;  4JI5 T;  2X0L B;  4AQG A;  1BR2 A;  1D3U B;  1NWM X;  1OIU B;  3AVS A;  4IT4 A;  4ILB A;  1MMN A;  3I9Y A;  2NP9 A;  3F2E A;  2WU2 A;  2X0H A;  4E7Z A;  2IW6 B;  1UGO A;  3AE6 A;  4U2Y A;  4HEA A;  1IAP A;  4DID B;  4FX3 B;  2QF7 A;  4F6R C;  5LMK B;  3RC3 A;  4BCF B;  2XQ3 A;  4CI2 B;  3RQW A;  3L3P A;  4ZEY A;  4IMY B;  4QSH A;  5HEO A;  5HEH A;  2LEH A;  4TWF A;  3ZYL A;  2FBW A;  2XAH B;  4ELL A;  2IML A;  2ZPH B;  3BLR B;  4JX4 A;  3W15 B;  2VK9 A;  2H88 A;  2PK9 B;  2WFY B;  3BLH B;  1UNH D;  2V6Y B;  1H27 B;  3P4P A;  4DUY T;  5AQF B;  2X9W A;  1YKE B;  4DR4 T;  1OED B;  3T1H T;  2PG8 A;  1W09 A;  2QVA A;  2BZB A;  4YHJ A;  2WQY A;  4HWH A;  4JX5 A;  4EEB A;  4XZC A;  5LGU B;  4H63 V;  4EOL B;  2X67 A;  3AE4 A;  2QQ8 A;  4QH5 A;  3EOC B;  2WDQ A;  2L3L A;  2C5O B;  1YQ3 A;  3O0G D;  4CZZ B;  5AQK B;  3VR8 A;  4OHF A;  2IC6 A;  1W9R A;  4UVB B;  2D9D A;  3RF1 A;  3UU3 A;  3LQ5 B;  4AQY T;  2KR6 A;  3ZJ1 A;  2DXC B;  2W61 A;  3RYF E;  2ES0 A;  5KXJ A;  5JVD E;  4DND A;  4YC3 B;  4ILC A;  2CBI A;  2W4X A;  5HXC A;  2QRX A;  3RLF F;  5DJQ C;  3Q5E A;  3RIU C;  2QYW A;  1XNR T;  2Y6X A;  2G77 A;  2C5I T;  2WM9 A;  2BDE A;  4L9I A;  3LBX B;  5JDQ A;  4AI6 A;  3S4U A;  4P0A A;  4UEM A;  3KV9 A;  5FL0 A;  4EED A;  2UZE B;  2WMB B;  2ZM8 A;  5JRC A;  4PK5 A;  2P9B A;  2B1E A;  3FZK B;  1H4L D;  2CCH B;  2WMA B;  4X1K E;  4ZGD B;  4GK5 E;  3ZST A;  3PJA J;  4UVC B;  1N36 T;  3CQX C;  4QXH B;  3NBX X;  4MHC A;  3AEF A;  4H9Q C;  1MIY A;  2YDS A;  4MBQ A;  1WYB A;  2LSK A;  4JI8 T;  2WWV A;  4AQF A;  2CXL A;  4O2A E;  4IE5 A;  4HWI B;  4PW8 A;  1D0X A;  1L0V A;  4DV7 T;  3SWH A;  3SFE A;  4IE6 A;  4DR3 T;  1D0Z A;  5LOV E;  2HPL A;  3P8C D;  5LG3 A;  4FJO A;  4JI3 T;  3VYH B;  1VCT A;  3IF8 B;  2LM9 A;  2CWO A;  4ROC A;  3NZQ A;  2XPK A;  3Q9D A;  4MFE A;  1WFD A;  2UXX B;  5HWY A;  1T8B A;  4HNU A;  4DV4 T;  4L0R A;  3NRX A;  4HFI A;  1UUS A;  4O8S A;  5L3G B;  3TW7 A;  3V5U A;  1H25 B;  2YU2 A;  3Q5W A;  2BBH A;  4CN6 A;  1I6Z A;  3X28 B;  3UUB A;  5IWA T;  2YDR A;  2H3R A;  1FEW A;  3HKE E;  3ONL C;  2CYZ B;  3OYZ A;  4QHO A;  1YD8 G;  4J2C A;  1GY3 B;  2UXN B;  5AQG B;  2WZI A;  5AQT B;  3ONX A;  2PHG A;  2LOP A;  1OED C;  2IC9 A;  5EK3 A;  4NC6 A;  5IDP B;  2BKZ B;  2FUP A;  2LM2 A;  3ZMV B;  4I50 E;  4F7J B;  2X66 A;  2BS3 A;  5DQW A;  2DD4 B;  1UNG D;  2ZPE B;  3TKL B;  1FIO A;  3EDU A;  2W96 A;  4BCO B;  3HKB E;  2XAQ B;  5AQU B;  4ZZB A;  1H24 B;  2YU1 A;  4ZI2 C;  2ZMA A;  2MBG A;  3AE1 A;  2IAK A;  2K5B B;  2HHH T;  3EID B;  2V7M A;  3G33 B;  5HBH B;  1D0Y A;  5LYJ E;  1X9B A;  2UZB B;  4Z90 A;  3B5M A;  4JI2 T;  3O1H A;  5JRC B;  3PUS A;  5HXS A;  4LML A;  1Z0P A;  3N2G E;  4MLK A;  3FHN A;  5HNB B;  4YOS A;  3HKD E;  4KHZ F;  2MOZ A;  2W99 A;  4ELJ A;  3PUX F;  4UV8 B;  4U33 A;  4F7L B;  1UNL D;  4CXA B;  4AKH A;  4Z91 A;  1Y01 A;  2WZH A;  3E22 E;  1OL1 B;  2F2C A;  5FNV E;  4OB0 B;  2L8K A;  2GK9 A;  2IHR 1;  5AQH B;  4ZI7 E;  1H26 B;  2JQK A;  4DV6 T;  4B6X A;  4HFD A;  4PFO A;  3CIR A;  2F4V T;  1UK5 A;  4TWH A;  4HFV A;  1IBL T;  1J5E T;  3P4Q A;  1ENW A;  5LXT E;  4HKA A;  3RIU A;  2W2H A;  1WR0 A;  4KX6 A;  4LOC A;  2ZM0 A;  3WI3 A;  3UQ4 A;  4YHH T;  4JI6 T;  3PUR A;  1SE7 A;  1J5W A;  2V22 B;  3BQI A;  4IDN A;  4O4H E;  3N9Q A;  2QFZ A;  3A8G B;  1XNQ T;  3R84 B;  2J1D G;  5HCJ A;  1IJ6 A;  3MKD A;  4A98 A;  5DQV A;  1IJ5 A;  5HQ0 B;  1CUN A;  5AQS B;  3CQG B;  4CN4 A;  2LRK A;  3ONJ A;  1BR4 A;  5J2U E;  5LHH B;  4EOI B;  3N9N A;  4C91 A;  2UZD B;  1U4Q A;  3L09 A;  5C2T A;  3KFW X;  1O3X A;  2AXD S;  4EOO B;  4PJM A;  4DR1 T;  3CX6 B;  4DV3 T;  3FZF B;  4BCG B;  2LE8 A;  1H1Q B;  4U3C A;  2VKD A;  4ZI2 D;  1S35 A;  1OXZ A;  3QYH B;  4YY3 T;  3CQC B;  4ILU A;  3QB5 K;  1YKH B;  4EOQ B;  4PJN A;  2W00 A;  5AQN B;  3UQ7 A;  2HN2 A;  4GOU A;  1H1R B;  1MMG A;  2X68 A;  2CM0 A;  2WIP B;  4EC9 B;  2Q9Q C;  1AIS B;  4YTM A;  1MND A;  3DOG B;  2XSB A;  1VOM A;  5ETW A;  1NAF A;  2LOS A;  1W0A A;  2VL0 A;  2XQA A;  4YOO A;  2I59 A;  4XAX B;  2WPA B;  1KF6 A;  1FMW A;  3WAK A;  1SA0 E;  2NOX A;  4U74 A;  2V6Y A;  4OB2 B;  3GTM S;  2ZPF B;  2HH7 A;  4O4I E;  2E2A A;  3ZMZ B;  1AJ3 A;  4BCJ B;  2QGS A;  4ZS3 A;  1OED A;  4H9N C;  3L39 A;  4OR5 B;  2D0T A;  5AQQ B;  2WU5 A;  2PBI A;  2BS4 A;  2UXC T;  2C5N B;  4A5X A;  2N1G A;  2QDY B;  5KDM C;  3ZCJ A;  4IL4 A;  2UXB T;  4AKI A;  3LG7 A;  4EYY R;  5E0O A;  3N9P A;  5HXE A;  5AQR B;  2LKG A;  4GK0 E;  3LFM A;  4U7Y A;  2OV9 A;  2JPF A;  3E0Z A;  2BKP A;  2ZPB B;  3F5X B;  2E5L T;  3J7Y q;  1NEK A;  1E7P A;  3ZLI A;  2V8S V;  5AQO B;  4HFE A;  3NVO A;  2XAF B;  2CLY C;  2V7J A;  3ZN1 B;  2J4G A;  1HR0 T;  4WNK A;  3EVY A;  3BG5 A;  4I0U A;  2WJ9 A;  3UU6 A;  3RH3 A;  3E08 A;  1VRB A;  2YN6 A;  3Q2M A;  3MI9 B;  2UZL B;  5JDH A;  3K3N A;  1AHJ B;  4JI1 T;  3KV6 A;  2VVN A;  2BBJ A;  5EK2 A;  3UUN A;  3X25 B;  2VKJ A;  4NXN T;  3RKO A;  4TV9 E;  3LK3 B;  1HX1 B;  5FY7 A;  1T7S A;  2Y48 B;  2WEV B;  3HZJ A;  3ZC1 A;  5M4Y A;  3RI5 A;  4JEU B;  4ZI3 C;  2BG9 B;  3C4W A;  1FKM A;  5FVL A;  2UXD T;  5JDL A;  2VKO A;  3RQU A;  3FXE B;  3RYH E;  4PFP A;  4EV6 A;  1IBK T;  3GN5 B;  2VUR A;  1UGQ B;  2KWH A;  1J1J A;  4EOP B;  3A5X A;  3SRZ A;  1OWA A;  4YT0 A;  4P1N A;  4X64 T;  1YW0 A;  4NXM T;  4HNV A;  5L3F B;  3AE3 A;  3BLQ B;  2LKH A;  4X65 T;  1B7T A;  1EZ3 A;  3Q5X A;  5AQJ B;  2V5D A;  1LKX A;  4U2Z A;  3AE5 A;  2XUE A;  3ZSS A;  4UV9 B;  2DI4 A;  2J62 A;  4TTH A;  3JAF A;  4LMJ A;  3HI2 A;  2H7O A;  1XO2 A;  2XY8 B;  2NTX A;  3RGF B;  4BCQ B;  4M1P A;  2IW9 B;  1UGR B;  3ZMU B;  3N9M A;  3VU7 H;  3M65 A;  3G06 A;  2KZ7 B;  4HWD A;  2CBJ A;  2X51 A;  4NPP A;  3U3I A;  5L3E B;  2WSS V;  4X62 T;  4DV0 T;  5JDF A;  5BMV E;  4TX5 A;  3SS1 A;  4H9R C;  1LVF A;  2CZ7 B;  4F6W B;  4X1I E;  5LA6 E;  4GKK T;  2E9X C;  3CK6 A;  3RYI E;  4O4L E;  2Q9Q A;  3K7A M;  3ABV A;  1UGP B;  1XMQ T;  4LF5 T;  2Y8D A;  3PUQ A;  1YXR A;  5L3C B;  3R6N A;  3QC9 A;  3QYG B;  2Z6E A;  1H28 B;  2VVS A;  5LJM A;  3ESL A;  3V5S A;  5FXZ A;  4ZGJ B;  3QHW B;  2YEV C;  2LLY A;  1OGU B;  2C5V B;  4GYR A;  3SFD A;  4BA9 A;  1AD6 A;  3AB3 B;  4OX9 T;  4IDQ A;  3N2K E;  3ZPO A;  2W2U A;  2W66 A;  3K8P C;  3B13 A;  2JMK A;  4EOJ B;  3UT5 E;  1H1S B;  4YJ3 E;  4CFW B;  1ZOY A;  4F6U B;  3RIF A;  4AKR B;  3JC6 C;  5HCM A;  4BCN B;  3KBT A;  5JH7 E;  4CFU B;  3AEA A;  2W62 A;  1N32 T;  3X24 B;  1IRE B;  1WYC A;  5EK4 A;  2NW7 A;  3C51 A;  2EUF A;  1XZY A;  3A8H B;  2MYS A;  2XM2 A;  2BG9 C;  3QK6 A;  4YFS A;  1Z8U A;  4IDZ A;  2M6B A;  2WDR A;  3FXD B;  2VL8 A;  2JMH A;  4F8H A;  2UUC T;  4CFX B;  5LCY A;  3AVR A;  3QYB A;  4HLQ A;  4F6S B;  3PU3 A;  4GYS A;  2WB5 A;  1KXU A;  1W98 B;  1WRD A;  2K48 A;  3NDQ A;  4XBF B;  1I94 T;  1G73 A;  2QDJ A;  4U31 A;  1WLX A;  2I40 B;  5ADX L;  2I53 A;  1FIN B;  1QUU A;  2XJ7 A;  3AAA B;  4EXT A;  1YQ4 A;  3MAC A;  4JI0 T;  5FY0 A;  4M6V A;  3RKG A;  1P5E B;  4UXN B;  5L2L A;  3OTO T;  2LRL A;  2VQF T;  3VYG B;  3HA4 A;  2LW4 A;  3LK4 2;  5FVK A;  3CML A;  3TLV A;  2C0S A;  3BHT B;  1FVV B;  1G8X A;  2PFV A;  2NWB A;  4ADZ A;  4N78 D;  2XQ4 A;  2Q9Q B;  3A7M A;  2EHO C;  2I6H A;  2WMO A;  3UUL A;  4CXW A;  4ANJ A;  4QXC B;  3UFE A;  1HX8 A;  4LFC T;  5FGK B;  2XQ9 A;  3P4S A;  5TAO A;  1HNX T;  3IA3 A;  3KIN B;  4HWC A;  4EON B;  4BJN A;  2VQE T;  3MJX A;  2LT3 A;  4CI1 B;  2VAS A;  2JGZ B;  2AE9 A;  3RGL A;  1ZEE A;  2JQQ A;  1XDO A;  3C4Z A;  4EIW A;  4DR5 T;  2IUB A;  4U72 A;  5FL1 A;  2HPJ A;  4E7S A;  4AIS A;  3QUJ A;  3JC6 D;  1JSU B;  4BBR M;  5LBM A;  4V1A v;  4GIW A;  5L3D B;  4NUV A;  3UU5 A;  2XQ5 A;  4ASK A;  2E9X A;  2LJL A;  3MIA B;  4BCI B;  3M3Z B;  1CHU A;  4P09 A;  3LSV A;  4CN1 A;  4TNV A;  1IZN B;  3IBP A;  1V9D A;  2CJM B;  1ZHC A;  2PK2 A;  2CLY B;  1GQE A;  3PUY F;  1MNE A;  5CGM A;  2K9A A;  1HTJ F;  3DTO A;  3AEG A;  3RPU A;  4JV5 T;  2X9Y A;  2H7V C;  2XQ8 A;  5C3J A;  1IBM T;  3POM A;  3A8M B;  1SHZ C;  4U7I A;  2A2F X;  4B3M T;  4I4T E;  4JX6 A;  4QXB B;  3KV4 A;  4KHP T;  2MTQ A;  1XMO T;  4PNI A;  3ZCI A;  1MMA A;  4IE4 A;  5LB7 B;  3DL1 A;  5IDN B;  2BKO A;  4F7N B;  5LG4 A;  1VCS A;  2C4G B;  2IW5 B;  5H6Q B;  4DMW A;  1ZKE A;  3JAE A;  4LF7 T;  1T72 A;  3M03 A;  1MIV A;  1H1P B;  1D1C A;  1E1H B;  4CFN B;  2XQ6 A;  3NRY A;  4BCQ D;  2LSJ A;  4K0U A;  3P7I A;  1HFA A;  1FMV A;  4HTE A;  5AQI B;  2DWK A;  3C4X A;  2EHO D;  2KWI B;  3ZT5 A;  3TLS A;  1M62 A;  1G3N C;  4IDO A;  4YSY A;  3WVD B;  3VHL A;  2I0M A;  4OK0 A;  2BVL A;  2RPA A;  2W67 A;  3C64 A;  5EJC A;  2BG9 A;  3O9X A;  2VB6 A;  3RIA A;  4WW0 A;  3CKD A;  4ZGE B;  1DU2 A;  2CZ1 B;  4KRC B;  2QA7 A;  2WXV B;  3N9O A;  4HWF A;  3GN5 A;  3AEC A;  1OED E;  5LBQ B;  5JQG E;  1UUR A;  3ETV A;  5JR9 C;  3QNU A;  2DWG A;  3DP7 A;  4B3T T;  2SPC A;  1MMD A;  2LSI A;  5IUX A;  2D0Q B;  3AA6 B;  5HXH A;  3OYX A;  4TN7 B;  3EUH A;  2NW9 A;  4KUM B;  1KK7 A;  1UGS B;  4LFA T;  4JI4 T;  3TNI B;  3AAI A;  4IL9 A;  2CE7 A;  4CRL B;  4QKN A;  2CXF A;  2CCI B;  3WAJ A;  4YOZ A;  2X9X A;  2BS2 A;  3RRW A;  3HL6 A;  4MAL A;  2WHB B;  1LRZ A;  1VOL A;  5L4H A;  3ZKR A;  2E9X B;  1BU2 A;  2V6X A;  1US7 B;  3FBL A;  3LDQ B;  4HFB A;  2CMR A;  2EHO A;  3ZMT B;  4HL4 A;  2X1N B;  1SUM B;  2W63 A;  4JLE A;  5J0Z A;  3HR0 A;  4OYK A;  4BCN D;  3ANW A;  2XAG B;  5HVY B;  4CFU D;  3T1Y T;  4X1Y E;  2LHR A;  1U5P A;  4AKL A;  3CVR A;  3MA9 A;  2V26 A;  2IVX A;  1BR0 A;  4TWD A;  4I55 E;  3ZC0 A;  3AE8 A;  4KMC A;  3KVB A;  1JOW A;  2V7K A;  2FJB A;  4AXP A;  4BXX X;  4EC8 B;  1C9B A;  4BCM B;  3H4C A;  4ZXL A;  3I1A A;  3PTR B;  4GKJ T;  4NST B;  1E2A A;  5CYI B;  2MPK A;  1HNZ T;  1UX4 A;  4F70 B;  5JRE A;  4UR9 A;  5ABG A;  2PTF A;  3UUX B;  1GUX A;  1T98 A;  3AA1 B;  1ZP0 A;  2D5U A;  4HGA A;  2V7I A;  3ZN0 B;  1LVK A;  3FZL B;  2ACX A;  3UU4 A;  4DMV A;  4JEH B;  2MAW A;  5C8Y E;  3QHR B;  3ZJ2 A;  1OKV B;  3MXZ A;  1ZP2 A;  4O2B E;  2KND A;  3PUA A;  1VIN A;  2ZPG B;  4YTP A;  4X5T A;  1D1A A;  4ZOL E;  5CA0 E;  4EZ4 A;  2Q9Q D;  1QSD A;  2CRB A;  2WP9 A;  4CFV B;  4DV5 T;  1BR1 A;  5ABF A;  3F57 A;  3EDV A;  4AKG A;  3QOF A;  1KNR A;  4II5 B;  2WBL A;  2KMF A;  4I3Z B;  5FKY A;  3OPC A;  4LFB T;  1WCR A;  2YKS A;  4NUU A;  2IN3 A;  2CHO A;  3UFG A;  5HAX A;  2WCA A;  2WMN A;  4MFD A;  4QH4 A;  3T8O A;  4HNT A;  5F3J A;  3J9X 1;  3JCF A;  5JDG A;  4DR7 T;  3IEE A;  3BQK A;  2ODV A;  3FBZ A;  3GMI A;  1HG2 A;  4H9P C;  4PK6 A;  3N9L A;  2IIU A;  1N4M A;  2N2N A;  1JST B;  2H89 A;  4FM4 B;  4BAY B;  2BPM B;  1HS7 A;  3RX6 A;  3MY5 B;  2WWU A;  3BG3 A;  4YTN A;  2EHO B;  2DL1 A;  3OBV E;  4EZH A;  4EGW A;  5L2W B;  3EJ1 B;  2XAS B;  5HEG A;  3ANW B;  5JR9 A;  3X20 B;  5ACB A;  3HO8 A;  3PUV F;  4OB1 B;  3ZEF B;  3TN8 B;  1OI9 B;  2J47 A;  4EB6 E;  4OYJ A;  4NIQ A;  2ZLY A;  4EAH A;  4TNW A;  4YJ2 E;  3X26 B;  2A3D A;  2ODU A;  3PJA A;  3HB9 A;  2CEA A;  3HKC E;  2VKH A;  5L3B B;  3QZ9 B;  3OVU A;  5AQP B;  3PDY A;  1KFY A;  2E5V A;  2CZ6 B;  2C6T B;  3N5L A;  1GUX B;  4EOR B;  3KBU A;  3PUW F;  5IYZ E;  5J2T E;  3P50 A;  1FJG T;  2DD5 B;  5HBJ B;  4KI0 F;  4ZI3 D;  5ICP B;  1WR6 A;  4BJM A;  5EFQ B;  3EI0 A;  3UTK A;  5ABH A;  3EAM A;  3BHV B;  2XM1 A;  2KSR A;  4UN0 A;  2JIW A;  3QB5 A;  4H9S E;  3B57 A;  4Z6Y A;  4EOZ B;  1UCU A;  2B9R A;  5LNK A;  2XAJ B;  3U78 A;  4KRD B;  5JTG A;  2V1D B;  5F8P A;  2OLT A;  3BQL A;  5ABF B;  2C5J A;  3CX8 B;  1V29 B;  2RA1 A;  3UU8 A;  4DV1 T;  2W0G A;  5FY1 A;  4CXY A;  4ISS A;  3Q5D A;  2ZM2 A;  3EHZ A;  3I9W A;  1W0B A;  2ZZD B;  5FXW A;  3O4X E;  4MIM A;  2JJ9 A;  5A1L A;  1JNR A;  3C98 B;  4DR6 T;  4A97 A;  2JQ9 A;  2D0U A;  3GWH A;  4P0B A;  3H3M A;  2D2S A;  2G0U A;  3H3A A;  2XQ7 A;  3PV0 F;  5HXR A;  1D1B A;  4UF0 A;  5F5W A;  3AAE B;  2NTY A;  4YSX A;  3UUM A;  4G63 A;  3VRB A;  2CZ0 B;  1KEY A;  5HEU A;  1X79 A;  3RHW A;  5AQM B;  4LMK A;  4ROE A;  3BHU B;  5LGT B;  4BCP B;  1HG5 A;  2L9Q A;  5BR8 T;  3AA0 B;  2E9X D;  5L47 A;  3CPZ A;  3KV5 A;  4Q25 A;  5BNJ B;  1KNP A;  5JR9 B;  2XTL A;  4WBN E;  3ZYM A;  4BCK B;  4BY1 X;  2OA5 A;  5HWX A;  2R6G F;  5J1G A;  2YDQ A;  2R7G A;  5AFU L;  3OKQ A;  2K24 A;  3AE2 A;  1GH6 B;  3HHT B;  5CEI B;  2NW8 A;  3AE7 A;  5H6R B;  4DV2 T;  4BCM D;  4JI7 T;  4IGU A;  5IHY A;  2CXD A;  1F5Q B;  3QXE B;  3N2O A;  2W9Z A;  3ZT6 A;  3D0T A;  2DXB B;  4LF8 T;  4UEL A;  2A9U A;  4JBW F;  3RC8 A;  3LJC A;  4ILA A;  2UU9 T;  1N33 T;  4EOK B;  2CWY A;  2C5X B;  2A72 A;  2UUE B;  3VKG A;  3MK7 C;  4BCH B;  4EOM B;  4TUY E;  3KVA A;  5LQF B;  3C50 A;  5KMG P;  2AHJ B;  2UUA T;  2BKN A;  4ERR A;  4X20 E;  3CX7 B;  3LK2 B;  2DPP B;  3BG9 A;  2X9H A;  2BVM A;  1NEN A;  2CCQ A;  3P4W A;  3AEE A;  5LMN T;  2WAU A;  4IHJ E;  4EYU A;  4H63 H;  2G9X B;  3PO3 S;  2DME A;  4IIJ E;  2WIH B;  2FJE A;  2YK0 A;  3NZP A;  2YOE A;  3FB2 A;  3OJA A;  4L5G A;  3TLT A;  5L4E A;  3RYC E;  3X1D A;  5FXX A;  2JQH A;  4UVA B;  2JRK A;  4OFZ A;  3NKZ A;  1URC B;  2LHN A;  4WYV A;  1HF8 A;  3NWI A;  2WDV A;  2DCF A;  2X0Y A;  1VYW B;  2UUB T;  2YIN A;  4IRE A;  4BBS M;  2FJD A;  4C90 A;  3I0Q A;  1OIY B;  1JNZ A;  1O9K A;  4LF6 T;  3I0O A;  4F7S B;  2HN1 A;  3AA7 B;  4DVD A;  2BG9 E;  2M6I A;  2IDO B;  4KBM B;  5CB4 E;  4IST A;  5AQV B;  4UF0 B;  2XHE B;  3F31 A;  3L8R A;  4HN9 A;  3ZT7 A;  3ZYK A;  3EAB A;  3O1J A;  3PUZ F;  5FYM A;  3K3Q C;  2B76 A;  2ACZ A;  5IF1 B;  4G2A A;  4DUZ T;  4QX7 B;  4HFH A;  4IE7 A;  2KLQ A;  3AXJ A;  4G6L B;  4JUY A;  5LMU T;  2V7L A;  3KDS E;  1OL2 B;  2LSY A;  3O1I A;  3DDQ B;  3QYE A;  5LHG B;  2RP4 A;  3SOL A;  2FJA A;  4FI5 A;  5CJ5 A;  1HCI A;  4BY7 X;  1HNW T;  4DBR A;  4TV8 E;  2PMI B;  4Z8X A;  4IE0 A;  4HFC A;  4HE8 A;  4OB3 B;  5ABE A;  1N34 T;  3JAD A;  2PJQ A;  2M67 A;  5LHI B;  4QX8 B;  5FXV A;  3HBL A;  4Y72 B;  3PUG A;  5DAB A;  5CA1 E;  1R8I A;  1MIW A;  4B3S T;  2DNX A;  3VKH A;  5KX5 E;  2E8I A;  4YSZ A;  5HEJ A;  1S94 A;  4K0K T;  5HYA A;  4DO0 A;  3MY1 B;  4A56 A;  4QH1 A;  1M7K A;  1QLB A;  4DBQ A;  3RRC A;  1E9H B;  3KHI A;  2K3W A;  4KP3 C;  2ZCF B;  5HBE B;  3IHR A;  2KIN B;  5LJN A; 
#chains in the Genus database with same CATH homology
 3JC6 C;  2VWA A;  3N2G E;  3K3O A;  4MLK A;  3FHN A;  4NUU A;  4YLH A;  3KBT A;  5JH7 E;  3HKD E;  2MOZ A;  5GON E;  4CQI A;  5HAX A;  2WMN A;  2W62 A;  4UV8 B;  4CXX A;  1WYC A;  5EK4 A;  2NW7 A;  2CA5 A;  3T8O A;  5F3J A;  3C51 A;  3J9X 1;  4AKH A;  5JDG A;  2MYS A;  3IEE A;  3BQK A;  2ODV A;  3FBZ A;  3GMI A;  3QK6 A;  1HG2 A;  4YFS A;  3E22 E;  4H9P C;  3CWZ B;  5FNV E;  4IDZ A;  2L8K A;  3FXD B;  4PK6 A;  2VL8 A;  3N9L A;  2GK9 A;  2JMH A;  4ZI7 E;  2N2N A;  5LCY A;  4B6X A;  4BAY B;  3AVR A;  4PFO A;  5EZY E;  3RX6 A;  1HS7 A;  4PJJ A;  3PU3 A;  4GYS A;  1ZV4 X;  1WRD A;  4XBF B;  2K48 A;  2WWU A;  4HFV A;  1G73 A;  2EHO B;  3OBV E;  4EZH A;  1H7C A;  1WLX A;  5LXT E;  5ADX L;  2LSG A;  2XQY A;  4HKA A;  5LGN B;  1QUU A;  3DJB A;  2XAS B;  3AAA B;  4EXT A;  2ZM0 A;  3MAC A;  3ANW B;  5FY0 A;  5JR9 A;  4PAG A;  3PU8 A;  4TZ4 C;  3WI3 A;  4UXN B;  1Y64 B;  5L2L A;  3PUR A;  3ZMS B;  4QWN B;  3ZEF B;  2C5K T;  5FMN A;  3BQI A;  4O4H E;  3N9Q A;  4CI3 B;  1KNZ A;  3HA4 A;  4O4J E;  3R84 B;  2J1D G;  4WBO A;  1IJ6 A;  4ZHQ E;  2DLR A;  4OYJ A;  4EB6 E;  4UIG A;  2ZLY A;  3PE0 A;  3MKD A;  1UX5 A;  4EAH A;  5DQV A;  4YJ2 E;  3LK4 2;  1IJ5 A;  2KT9 A;  3BK9 A;  3CML A;  2A3D A;  2ODU A;  2C0S A;  3H37 A;  1G8X A;  1CUN A;  2CEA A;  4AQF C;  2PFV A;  3HKC E;  4H9O C;  2VKH A;  2NWB A;  4ADZ A;  5L3B B;  3CQG B;  4N78 D;  3PDY A;  4PJL A;  2Q9Q B;  1BR4 A;  5J2U E;  4PK4 A;  5LHH B;  2EHO C;  2WMO A;  3N9N A;  3UUL A;  3N5L A;  4CXW A;  4ANJ A;  3L09 A;  1U4Q A;  3KBU A;  4C91 A;  4ZS2 A;  3KFW X;  4QXC B;  3UFE A;  5IYZ E;  4MFR A;  1HX8 A;  1O3X A;  5J2T E;  2DHR A;  2KXP B;  4I43 B;  3LBX A;  5JDN A;  4PJM A;  4ZI3 D;  5TAO A;  1WR6 A;  3CX6 B;  4BJM A;  3KIN B;  2LE8 A;  4BJN A;  3MJX A;  3ETU A;  2LT3 A;  2N9D A;  3MZK B;  3UTK A;  4CI1 B;  5JDM A;  2VKD A;  2VAS A;  4ZI2 D;  1S35 A;  1OXZ A;  5LP6 E;  3GA8 A;  1ZEE A;  2JQQ A;  3CQC B;  4ILU A;  3C4Z A;  4EIW A;  4H9S E;  1YKH B;  4U72 A;  3B57 A;  5FP3 A;  4PJN A;  4EOZ B;  1UCU A;  2X0L B;  2W00 A;  2HPJ A;  4E7S A;  5LNK A;  4AQG A;  1BR2 A;  4GOU A;  2XAJ B;  1MMG A;  2X68 A;  1NWM X;  2CM0 A;  3JC6 D;  3QUJ A;  3AVS A;  3U78 A;  1MMN A;  5LBM A;  4V1A v;  3I9Y A;  4GIW A;  2NP9 A;  2Q9Q C;  3F2E A;  2V1D B;  4E7Z A;  5L3D B;  4NUV A;  5F8P A;  1MND A;  1VOM A;  5ETW A;  1NAF A;  2LOS A;  3BQL A;  4ASK A;  2C5J A;  2I59 A;  2E9X A;  2LJL A;  3CX8 B;  1IAP A;  4HEA A;  4XAX B;  1FMW A;  2RA1 A;  3WAK A;  1SA0 E;  4P09 A;  2NOX A;  2W0G A;  5FY1 A;  4U74 A;  1IZN B;  4F6R C;  3RC3 A;  3IBP A;  4ISS A;  4CXY A;  1V9D A;  1ZHC A;  2HH7 A;  4CI2 B;  2ZM2 A;  2CLY B;  3I9W A;  4O4I E;  5FXW A;  3O4X E;  3L3P A;  3ZMZ B;  1AJ3 A;  1MNE A;  2K9A A;  1HTJ F;  2JJ9 A;  5A1L A;  2QGS A;  3C98 B;  2LEH A;  4ZS3 A;  3DTO A;  3ZYL A;  2XAH B;  4H9N C;  2D0U A;  3GWH A;  4P0B A;  3W15 B;  2D0T A;  2D2S A;  2G0U A;  2VK9 A;  3RPU A;  3H3A A;  5HXR A;  1D1B A;  2PBI A;  4UF0 A;  2X9Y A;  2H7V C;  3AAE B;  2NTY A;  1SHZ C;  3UUM A;  2N1G A;  4G63 A;  5KDM C;  2A2F X;  3ZCJ A;  2X9W A;  3LG7 A;  4EYY R;  1X79 A;  5E0O A;  4AKI A;  1YKE B;  3N9P A;  5HXE A;  4I4T E;  5LGT B;  4QXB B;  1HG5 A;  2L9Q A;  2PG8 A;  3KV4 A;  3AA0 B;  2E9X D;  4GK0 E;  2MTQ A;  3LFM A;  2JPF A;  3E0Z A;  4PNI A;  3ZCI A;  1MMA A;  3CPZ A;  2BZB A;  4IE4 A;  4YHJ A;  3J7Y q;  3KV5 A;  3ZLI A;  5LG4 A;  2IW5 B;  5H6Q B;  4DMW A;  4XZC A;  5LGU B;  1ZKE A;  4H63 V;  2XAF B;  2CLY C;  2X67 A;  2V7J A;  3ZN1 B;  1MIV A;  1D1C A;  1E1H B;  5JR9 B;  2L3L A;  3NRY A;  2XTL A;  4WNK A;  5LJN A;  2LSJ A;  3EVY A;  3ZYM A;  4K0U A;  4CZZ B;  4WBN E;  3P7I A;  1HFA A;  4OHF A;  2OA5 A;  2IC6 A;  1FMV A;  4HTE A;  5HWX A;  4UVB B;  5J1G A;  3RH3 A;  2DWK A;  3C4X A;  2EHO D;  2KWI B;  5AFU L;  3E08 A;  3OKQ A;  2K24 A;  1VRB A;  3ZJ1 A;  3Q2M A;  2W61 A;  3VHL A;  3RYF E;  5JDH A;  2NW8 A;  5H6R B;  4OK0 A;  2ES0 A;  2BVL A;  3K3N A;  3C64 A;  5JVD E;  4DND A;  3KV6 A;  3O9X A;  5HXC A;  2VB6 A;  4IGU A;  5IHY A;  5EK2 A;  3UUN A;  5DJQ C;  2VKJ A;  2CXD A;  4WW0 A;  3CKD A;  3RKO A;  4TV9 E;  2QA7 A;  3LK3 B;  3N2O A;  3D0T A;  3N9O A;  3GN5 A;  2Y6X A;  5FY7 A;  2C5I T;  2WM9 A;  5LBQ B;  2BDE A;  4UEL A;  5JQG E;  4L9I A;  2Y48 B;  3LBX B;  3ZC1 A;  5JDQ A;  5M4Y A;  3RC8 A;  3ETV A;  4JEU B;  5JR9 C;  4AI6 A;  3LJC A;  2DWG A;  4ZI3 C;  3S4U A;  2CWY A;  3DP7 A;  3C4W A;  2A72 A;  4P0A A;  4UEM A;  2SPC A;  3KV9 A;  1MMD A;  2LSI A;  3MK7 C;  2ZM8 A;  5JRC A;  3VKG A;  4PK5 A;  3AA6 B;  5JDL A;  2VKO A;  4TUY E;  3FXE B;  2P9B A;  3RYH E;  2B1E A;  3KVA A;  4PFP A;  5HXH A;  3OYX A;  3C50 A;  4TN7 B;  3EUH A;  2NW9 A;  4KUM B;  3GN5 B;  4X1K E;  5KMG P;  1KK7 A;  4ERR A;  4GK5 E;  4X20 E;  3CX7 B;  3LK2 B;  2KWH A;  4UVC B;  2X9H A;  2BVM A;  3SRZ A;  2CCQ A;  3A5X A;  1OWA A;  3AAI A;  3CQX C;  4QXH B;  2WAU A;  3NBX X;  4MHC A;  1YW0 A;  2CE7 A;  4IHJ E;  4EYU A;  4H63 H;  4H9Q C;  4QKN A;  5L3F B;  1MIY A;  2CXF A;  4MBQ A;  4IIJ E;  1WYB A;  2YK0 A;  2LSK A;  3NZP A;  3WAJ A;  3FB2 A;  3OJA A;  4L5G A;  2X9X A;  3RYC E;  3RRW A;  3HL6 A;  4MAL A;  5FXX A;  4AQF A;  1LRZ A;  4UVA B;  1B7T A;  2CXL A;  2JRK A;  1EZ3 A;  4O2A E;  4IE5 A;  2E9X B;  4OFZ A;  2LHN A;  3Q5X A;  1US7 B;  1LKX A;  3FBL A;  1HF8 A;  4PW8 A;  2CMR A;  2EHO A;  3ZMT B;  2DCF A;  1D0X A;  2XUE A;  2YIN A;  4UV9 B;  3SWH A;  4IE6 A;  1D0Z A;  2DI4 A;  5LOV E;  2HPL A;  3P8C D;  2W63 A;  4FJO A;  4C90 A;  4JLE A;  3I0Q A;  3HR0 A;  3HI2 A;  2H7O A;  4OYK A;  2NTX A;  3ANW A;  2XAG B;  3IF8 B;  4M1P A;  4X1Y E;  2LHR A;  2LM9 A;  1U5P A;  3ZMU B;  4AKL A;  3CVR A;  3AA7 B;  3I0O A;  3MA9 A;  2V26 A;  3N9M A;  3VU7 H;  4DVD A;  1BR0 A;  3M65 A;  2KZ7 B;  4KBM B;  5CB4 E;  2CWO A;  2X51 A;  4I55 E;  4IST A;  3NZQ A;  3ZC0 A;  3U3I A;  5L3E B;  4KMC A;  4UF0 B;  2XHE B;  3KVB A;  3Q9D A;  2WSS V;  2UXX B;  3F31 A;  5HWY A;  2V7K A;  4HN9 A;  5JDF A;  3ZYK A;  5BMV E;  3O1J A;  4L0R A;  3NRX A;  5FYM A;  3K3Q C;  4TX5 A;  3SS1 A;  4O8S A;  4H9R C;  4AXP A;  5L3G B;  1LVF A;  3V5U A;  2YU2 A;  4G2A A;  3Q5W A;  4X1I E;  4QX7 B;  4IE7 A;  5LA6 E;  2KLQ A;  4JUY A;  3I1A A;  3PTR B;  2V7L A;  2E9X C;  3RYI E;  3KDS E;  4O4L E;  2H3R A;  1UX4 A;  2Q9Q A;  5JRE A;  1FEW A;  3HKE E;  3OYZ A;  1YD8 G;  2LSY A;  3O1I A;  4J2C A;  4QHO A;  1T98 A;  3AA1 B;  3UUX B;  5LHG B;  2UXN B;  2RP4 A;  2Y8D A;  3SOL A;  4FI5 A;  3PUQ A;  1HCI A;  2D5U A;  4HGA A;  5L3C B;  2V7I A;  3ZN0 B;  3R6N A;  3QC9 A;  4DBR A;  4TV8 E;  1LVK A;  2Z6E A;  3ONX A;  4Z8X A;  2LOP A;  4IE0 A;  2IC9 A;  5EK3 A;  3ZMV B;  2ACX A;  4HE8 A;  4I50 E;  4DMV A;  4JEH B;  5LJM A;  2X66 A;  5C8Y E;  3ESL A;  3V5S A;  5FXZ A;  2PJQ A;  3ZJ2 A;  2M67 A;  5DQW A;  5LHI B;  4QX8 B;  5FXV A;  2YEV C;  3MXZ A;  3TKL B;  1FIO A;  3EDU A;  4O2B E;  2KND A;  3PUG A;  4GYR A;  3PUA A;  3HKB E;  5DAB A;  5CA1 E;  2XAQ B;  4BA9 A;  1MIW A;  3AB3 B;  2DNX A;  1D1A A;  4ZOL E;  3VKH A;  3N2K E;  5CA0 E;  4EZ4 A;  3ZPO A;  5KX5 E;  2YU1 A;  2E8I A;  2Q9Q D;  4ZI2 C;  1QSD A;  3K8P C;  3B13 A;  2JMK A;  2ZMA A;  3UT5 E;  1S94 A;  2MBG A;  2IAK A;  2K5B B;  1BR1 A;  3F57 A;  2V7M A;  3EDV A;  4AKG A;  2WBL A;  5HYA A;  1D0Y A;  4DO0 A;  5LYJ E;  4A56 A;  4DBQ A;  2KMF A;  4YJ3 E;  3RRC A;  4KP3 C;  3O1H A;  3IHR A;  3PUS A;  2KIN B;  4AKR B;  5HXS A;  5JRC B;  1Z0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...