4ROEA

Human tfiib-related factor 2 (brf2) and tbp bound to rpph1 promoter
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
307
Chain Sequence
QVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDLLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 102
structure length 307
sequence length 348
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4roeA01
1KXUA 1JKWA 1H28B 3K7AM 4CFUD 2C5OB 1H1PB 2BKZB 4CFXB 1URCB 3DDPB 4YOSA 3BLQB 4YC3B 2C5NB 4IMYB 4Y72B 4G6LB 2UZBB 3O0GD 3EJ1B 2C5XB 2QDJA 1E9HB 5L2WB 2G9XB 4ELLA 2W9ZA 4EORB 5HBEB 1H26B 2UZEB 3BHVB 4BCOB 1UNHD 4NSTB 2IW9B 1AD6A 5HBHB 4CFWB 2JGZB 2IW8B 2W9FA 4F6SB 3MY5B 4KRCB 4YOZA 1GUXB 3LQ5B 1QMZB 2W99A 1VYWB 3TNWB 2UZDB 4F7LB 5LMKB 4EC8B 3TNIB 2WIHB 5I5ZB 3BLHB 2WFYB 1GY3B 4EOPB 1UNLD 2CCHB 2WMBB 2WHBB 4I3ZB 2CCIB 1H1RB 4EOMB 4EOOB 5ICPB 4BCPB 2UUEB 1G3NC 3H4CA 3M03A 4UN0A 2WPAB 5HNBB 4EOSB 4CFUB 4EOKB 3BHTB 2PK2A 2IW6B 3TNHB 4CFVB 2X1NB 3MY1B 5HQ0B 1H25B 1OIUB 1H24B 2CJMB 1AISB 5HVYB 4BCND 3DDQB 4EOIB 3MIAB 1OL2B 4F7SB 4CRLB 5LQFB 1BU2A 1FINB 2EUFA 1H1SB 4BCHB 1OL1B 4ROCA 2F2CA 2C5VB 2WMAB 4BCKB 4II5B 5HBJB 5FGKB 4BCFB 1O9KB 4EOLB 4TTHA 4BCIB 4F7NB 1GH6B 2PMIB 1JSUB 3EIDB 4YOOA 3EOCB 3POMA 1VINA 3G33B 1F5QB 3RGFB 4BCMD 3QHRB 4F6WB 2W2HA 1OGUB 1D3UB 1TFBA 2PK9B 5EFQB 1H27B 4F6UB 1GUXA 2PHGA 3F5XB 1JOWA 4BCQD 1P5EB 2WXVB 3DOGB 4OR5B 4BCNB 2C4GB 1OI9B 1JSTB 1OIYB 4EOJB 4F70B 1W98B 4OGRB 4BCGB 4CFNB 4F7JB 1VOLA 1PKDB 4BCJB 3BLRB 4EOQB 2WIPB 2UZLB 2I53A 2R7GA 4ELJA 5ACBA 1H1QB 2WEVB 2W96A 2V22B 4FX3B 4EC9B 5IDNB 1ZP2A 1OKWB 2C6TB 4CXAB 1UNGD 5IF1B 3MI9B 4RODA 4BCMB 2BPMB 1C9BA 1XO2A 4CFMB 4EONB 4ROEA 3TN8B 3QHWB 1H4LD 2B9RA 3BHUB 1O9KA 1FVVB 2I40B 5BNJB 1N4MA 2IVXA 5CEIB 5IDPB 1OKVB 4BCQB 4KRDB 5CYIB
chains in the Genus database with same CATH superfamily
2DPPB 2ZPBB 4CFUD 4LOCA 4OB2B 1H1PB 4Z6YA 3BLQB 4YC3B 1ENWA 2UZBB 3EJ1B 3X24B 2C5XB 2QDJA 4EORB 4BBRM 2JGZB 3MY5B 4KRCB 3LQ5B 5IHYA 1VYWB 3TNWB 3WVEB 4EC8B 2WIHB 4EOMB 1UNLD 3TW6A 1H1RB 3GTMS 3X26B 3HHTB 5HNBB 2WPAB 2BS4A 1AISB 4CFVB 5HVYB 2AHJB 4CRLB 1FKMA 1H1SB 4ROCA 2F2CA 5FGKB 4BCFB 1O9KB 4TTHA 2ZZDB 4HNTA 3EOCB 3DJBA 1F5QB 4F6WB 5DQVA 3QZ9B 1GUXA 4BCQD 1P5EB 3DOGB 3QYGB 2C4GB 2ZPEB 3VKHA 4BCGB 3A8HB 4CFNB 2WIPB 1H1QB 2W96A 2V22B 1OKWB 3QWLA 2C6TB 5IF1B 3VYHB 2ZPHB 1C9BA 1XO2A 3TN8B 1H4LD 2B9RA 2ZCFB 1E7PA 1H28B 4BXXX 3K7AM 4CFXB 1V29B 4AKGA 4BY7X 4BBSM 4Y72B 2BS2A 5L2WB 1E9HB 2G9XB 4AKIA 1H26B 2UZEB 1UNHD 4NSTB 2IW9B 4MFDA 1AHJB 2CZ6B 4FM4B 4YOZA 1QMZB 3VYGB 3X20B 2WFYB 4EOPB 2CCHB 2WMBB 4I3ZB 3PO3S 2CCIB 4EOOB 2CZ7B 2UUEB 4CFUB 4EOSB 2DXCB 3HBLA 4EOKB 2PK2A 3MY1B 5HQ0B 1OIUB 4BCND 3QYBA 4EOIB 1OL2B 4BY1X 1OL1B 2WMAB 4F7NB 4ZGJB 3EIDB 1VINA 3RGFB 4BCMD 2W2HA 1D3UB 1H27B 3X28B 1JOWA 3HB9A 2WXVB 2LW4A 4OGRB 2QFZA 4ZGDB 1PKDB 3X25B 3HO8A 2UZLB 4ELJA 2WEVB 3WVDB 4JX6A 4FX3B 4RODA 1UNGD 2DXBB 3BG9A 2QGSA 1TD6A 1O9KA 1FVVB 5CEIB 2IVXA 3QXEB 4BCQB 3VKGA 2DD5B 1UGPB 4NC6A 2C5OB 2BKZB 1URCB 4YOSA 4G6LB 3O0GD 2CZ0B 3DL1A 3NDQA 1QLBA 5HBHB 4CFWB 4F6SB 2IW8B 3A8GB 3QYHB 2UZDB 1UGSB 3TNIB 4JX4A 5I5ZB 1GY3B 4MFEA 4BCPB 4UN0A 1G3NC 3M03A 3BHTB 2IW6B 4QSHA 2X1NB 2CJMB 2ZPFB 3DDQB 4MIMA 4F7SB 2CZ1B 1FINB 2C5VB 2ZPIB 2DD4B 4II5B 4BCKB 4BCIB 1GH6B 2ZPGB 3G33B 2G77A 4ZGEB 1TFBA 2PK9B 5EFQB 2PHGA 5DQWA 4BCNB 3BG5A 1JSTB 2QDYB 4EOJB 3DTOA 1VOLA 4EOQB 3QYEA 2I53A 5ACBA 4EC9B 5IDNB 1ZP2A 2WJ9A 4BCMB 2BPMB 4EONB 4ROEA 5BNJB 5IDPB 1OKVB 4KRDB 1KXUA 1JKWA 2KMGA 1IREB 3DDPB 2C5NB 4IMYB 3BG3A 2IN3A 4ELLA 2W9ZA 5HBEB 3BHVB 4BCOB 2DMEA 1AD6A 1UGRB 2QQ8A 5EJCA 2W9FA 1GUXB 2W99A 4F7LB 5LMKB 3TW7A 3BLHB 5ICPB 2WHBB 4OB1B 3H4CA 3TNHB 3B57A 1H25B 1H24B 3MIAB 3A8MB 5LQFB 1BU2A 2EUFA 4BCHB 3A8LB 5HBJB 4EOLB 3KHIA 3A8OB 2PMIB 3QZ5B 2KR6A 1JSUB 4YOOA 3POMA 2QF7A 3QHRB 1OGUB 1UGQB 4F6UB 3F5XB 2CYZB 4OR5B 1OI9B 4OB0B 1OIYB 4F70B 1W98B 4AKHA 4HNUA 4HLQA 4F7JB 4AI6A 4BCJB 3BLRB 2R7GA 2BS3A 4HNVA 3HZJA 4CXAB 3MI9B 2PJQA 4OB3B 4HL4A 4CFMB 3QHWB 4M6VA 3BHUB 2I40B 1N4MA 5CYIB 2D0QB 4JX5A
chains in the Genus database with same CATH topology
1KXUA 1JKWA 1H28B 3K7AM 4CFUD 2C5OB 1H1PB 2BKZB 4CFXB 1URCB 3DDPB 4YOSA 3BLQB 4YC3B 2C5NB 4IMYB 4Y72B 4G6LB 2UZBB 3O0GD 3EJ1B 2C5XB 2QDJA 1E9HB 5L2WB 2G9XB 4ELLA 2W9ZA 4EORB 5HBEB 1H26B 2UZEB 3BHVB 4BCOB 1UNHD 4NSTB 2IW9B 1AD6A 5HBHB 4CFWB 2JGZB 2IW8B 2W9FA 4F6SB 3MY5B 4KRCB 4YOZA 1GUXB 3LQ5B 1QMZB 2W99A 1VYWB 3TNWB 2UZDB 4F7LB 5LMKB 4EC8B 3TNIB 2WIHB 5I5ZB 3BLHB 2WFYB 1GY3B 4EOPB 1UNLD 2CCHB 2WMBB 2WHBB 4I3ZB 2CCIB 1H1RB 4EOMB 4EOOB 5ICPB 4BCPB 2UUEB 1G3NC 3H4CA 3M03A 4UN0A 2WPAB 5HNBB 4EOSB 4CFUB 4EOKB 3BHTB 2PK2A 2IW6B 3TNHB 4CFVB 2X1NB 3MY1B 5HQ0B 1H25B 1OIUB 1H24B 2CJMB 1AISB 5HVYB 4BCND 3DDQB 4EOIB 3MIAB 1OL2B 4F7SB 4CRLB 5LQFB 1BU2A 1FINB 2EUFA 1H1SB 4BCHB 1OL1B 4ROCA 2F2CA 2C5VB 2WMAB 4BCKB 4II5B 5HBJB 5FGKB 4BCFB 1O9KB 4EOLB 4TTHA 4BCIB 4F7NB 1GH6B 2PMIB 1JSUB 3EIDB 4YOOA 3EOCB 3POMA 1VINA 3G33B 1F5QB 3RGFB 4BCMD 3QHRB 4F6WB 2W2HA 1OGUB 1D3UB 1TFBA 2PK9B 5EFQB 1H27B 4F6UB 1GUXA 2PHGA 3F5XB 1JOWA 4BCQD 1P5EB 2WXVB 3DOGB 4OR5B 4BCNB 2C4GB 1OI9B 1JSTB 1OIYB 4EOJB 4F70B 1W98B 4OGRB 4BCGB 4CFNB 4F7JB 1VOLA 1PKDB 4BCJB 3BLRB 4EOQB 2WIPB 2UZLB 2I53A 2R7GA 4ELJA 5ACBA 1H1QB 2WEVB 2W96A 2V22B 4FX3B 4EC9B 5IDNB 1ZP2A 1OKWB 2C6TB 4CXAB 1UNGD 5IF1B 3MI9B 4RODA 4BCMB 2BPMB 1C9BA 1XO2A 4CFMB 4EONB 4ROEA 3TN8B 3QHWB 1H4LD 2B9RA 3BHUB 1O9KA 1FVVB 2I40B 5BNJB 1N4MA 2IVXA 5CEIB 5IDPB 1OKVB 4BCQB 4KRDB 5CYIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KXU A;  1JKW A;  1H28 B;  3K7A M;  4CFU D;  2C5O B;  1H1P B;  2BKZ B;  4CFX B;  1URC B;  3DDP B;  4YOS A;  3BLQ B;  4YC3 B;  2C5N B;  4IMY B;  4Y72 B;  4G6L B;  2UZB B;  3O0G D;  3EJ1 B;  2C5X B;  2QDJ A;  1E9H B;  5L2W B;  2G9X B;  4ELL A;  2W9Z A;  4EOR B;  5HBE B;  1H26 B;  2UZE B;  3BHV B;  4BCO B;  1UNH D;  4NST B;  2IW9 B;  1AD6 A;  5HBH B;  4CFW B;  2JGZ B;  2IW8 B;  2W9F A;  4F6S B;  3MY5 B;  4KRC B;  4YOZ A;  1GUX B;  3LQ5 B;  1QMZ B;  2W99 A;  1VYW B;  3TNW B;  2UZD B;  4F7L B;  5LMK B;  4EC8 B;  3TNI B;  2WIH B;  5I5Z B;  3BLH B;  2WFY B;  1GY3 B;  4EOP B;  1UNL D;  2CCH B;  2WMB B;  2WHB B;  4I3Z B;  2CCI B;  1H1R B;  4EOM B;  4EOO B;  5ICP B;  4BCP B;  2UUE B;  1G3N C;  3H4C A;  3M03 A;  4UN0 A;  2WPA B;  5HNB B;  4EOS B;  4CFU B;  4EOK B;  3BHT B;  2PK2 A;  2IW6 B;  3TNH B;  4CFV B;  2X1N B;  3MY1 B;  5HQ0 B;  1H25 B;  1OIU B;  1H24 B;  2CJM B;  1AIS B;  5HVY B;  4BCN D;  3DDQ B;  4EOI B;  3MIA B;  1OL2 B;  4F7S B;  4CRL B;  5LQF B;  1BU2 A;  1FIN B;  2EUF A;  1H1S B;  4BCH B;  1OL1 B;  4ROC A;  2F2C A;  2C5V B;  2WMA B;  4BCK B;  4II5 B;  5HBJ B;  5FGK B;  4BCF B;  1O9K B;  4EOL B;  4TTH A;  4BCI B;  4F7N B;  1GH6 B;  2PMI B;  1JSU B;  3EID B;  4YOO A;  3EOC B;  3POM A;  1VIN A;  3G33 B;  1F5Q B;  3RGF B;  4BCM D;  3QHR B;  4F6W B;  2W2H A;  1OGU B;  1D3U B;  1TFB A;  2PK9 B;  5EFQ B;  1H27 B;  4F6U B;  1GUX A;  2PHG A;  3F5X B;  1JOW A;  4BCQ D;  1P5E B;  2WXV B;  3DOG B;  4OR5 B;  4BCN B;  2C4G B;  1OI9 B;  1JST B;  1OIY B;  4EOJ B;  4F70 B;  1W98 B;  4OGR B;  4BCG B;  4CFN B;  4F7J B;  1VOL A;  1PKD B;  4BCJ B;  3BLR B;  4EOQ B;  2WIP B;  2UZL B;  2I53 A;  2R7G A;  4ELJ A;  5ACB A;  1H1Q B;  2WEV B;  2W96 A;  2V22 B;  4FX3 B;  4EC9 B;  5IDN B;  1ZP2 A;  1OKW B;  2C6T B;  4CXA B;  1UNG D;  5IF1 B;  3MI9 B;  4ROD A;  4BCM B;  2BPM B;  1C9B A;  1XO2 A;  4CFM B;  4EON B;  4ROE A;  3TN8 B;  3QHW B;  1H4L D;  2B9R A;  3BHU B;  1O9K A;  1FVV B;  2I40 B;  5BNJ B;  1N4M A;  2IVX A;  5CEI B;  5IDP B;  1OKV B;  4BCQ B;  4KRD B;  5CYI B; 
#chains in the Genus database with same CATH topology
 2DPP B;  2ZPB B;  4CFU D;  4LOC A;  4OB2 B;  1H1P B;  4Z6Y A;  3BLQ B;  4YC3 B;  1ENW A;  2UZB B;  3EJ1 B;  3X24 B;  2C5X B;  2QDJ A;  4EOR B;  4BBR M;  2JGZ B;  3MY5 B;  4KRC B;  3LQ5 B;  5IHY A;  1VYW B;  3TNW B;  3WVE B;  4EC8 B;  2WIH B;  4EOM B;  1UNL D;  3TW6 A;  1H1R B;  3GTM S;  3X26 B;  3HHT B;  5HNB B;  2WPA B;  2BS4 A;  1AIS B;  4CFV B;  5HVY B;  2AHJ B;  4CRL B;  1FKM A;  1H1S B;  4ROC A;  2F2C A;  5FGK B;  4BCF B;  1O9K B;  4TTH A;  2ZZD B;  4HNT A;  3EOC B;  3DJB A;  1F5Q B;  4F6W B;  5DQV A;  3QZ9 B;  1GUX A;  4BCQ D;  1P5E B;  3DOG B;  3QYG B;  2C4G B;  2ZPE B;  3VKH A;  4BCG B;  3A8H B;  4CFN B;  2WIP B;  1H1Q B;  2W96 A;  2V22 B;  1OKW B;  3QWL A;  2C6T B;  5IF1 B;  3VYH B;  2ZPH B;  1C9B A;  1XO2 A;  3TN8 B;  1H4L D;  2B9R A;  2ZCF B;  1E7P A;  1H28 B;  4BXX X;  3K7A M;  4CFX B;  1V29 B;  4AKG A;  4BY7 X;  4BBS M;  4Y72 B;  2BS2 A;  5L2W B;  1E9H B;  2G9X B;  4AKI A;  1H26 B;  2UZE B;  1UNH D;  4NST B;  2IW9 B;  4MFD A;  1AHJ B;  2CZ6 B;  4FM4 B;  4YOZ A;  1QMZ B;  3VYG B;  3X20 B;  2WFY B;  4EOP B;  2CCH B;  2WMB B;  4I3Z B;  3PO3 S;  2CCI B;  4EOO B;  2CZ7 B;  2UUE B;  4CFU B;  4EOS B;  2DXC B;  3HBL A;  4EOK B;  2PK2 A;  3MY1 B;  5HQ0 B;  1OIU B;  4BCN D;  3QYB A;  4EOI B;  1OL2 B;  4BY1 X;  1OL1 B;  2WMA B;  4F7N B;  4ZGJ B;  3EID B;  1VIN A;  3RGF B;  4BCM D;  2W2H A;  1D3U B;  1H27 B;  3X28 B;  1JOW A;  3HB9 A;  2WXV B;  2LW4 A;  4OGR B;  2QFZ A;  4ZGD B;  1PKD B;  3X25 B;  3HO8 A;  2UZL B;  4ELJ A;  2WEV B;  3WVD B;  4JX6 A;  4FX3 B;  4ROD A;  1UNG D;  2DXB B;  3BG9 A;  2QGS A;  1TD6 A;  1O9K A;  1FVV B;  5CEI B;  2IVX A;  3QXE B;  4BCQ B;  3VKG A;  2DD5 B;  1UGP B;  4NC6 A;  2C5O B;  2BKZ B;  1URC B;  4YOS A;  4G6L B;  3O0G D;  2CZ0 B;  3DL1 A;  3NDQ A;  1QLB A;  5HBH B;  4CFW B;  4F6S B;  2IW8 B;  3A8G B;  3QYH B;  2UZD B;  1UGS B;  3TNI B;  4JX4 A;  5I5Z B;  1GY3 B;  4MFE A;  4BCP B;  4UN0 A;  1G3N C;  3M03 A;  3BHT B;  2IW6 B;  4QSH A;  2X1N B;  2CJM B;  2ZPF B;  3DDQ B;  4MIM A;  4F7S B;  2CZ1 B;  1FIN B;  2C5V B;  2ZPI B;  2DD4 B;  4II5 B;  4BCK B;  4BCI B;  1GH6 B;  2ZPG B;  3G33 B;  2G77 A;  4ZGE B;  1TFB A;  2PK9 B;  5EFQ B;  2PHG A;  5DQW A;  4BCN B;  3BG5 A;  1JST B;  2QDY B;  4EOJ B;  3DTO A;  1VOL A;  4EOQ B;  3QYE A;  2I53 A;  5ACB A;  4EC9 B;  5IDN B;  1ZP2 A;  2WJ9 A;  4BCM B;  2BPM B;  4EON B;  4ROE A;  5BNJ B;  5IDP B;  1OKV B;  4KRD B;  1KXU A;  1JKW A;  2KMG A;  1IRE B;  3DDP B;  2C5N B;  4IMY B;  3BG3 A;  2IN3 A;  4ELL A;  2W9Z A;  5HBE B;  3BHV B;  4BCO B;  2DME A;  1AD6 A;  1UGR B;  2QQ8 A;  5EJC A;  2W9F A;  1GUX B;  2W99 A;  4F7L B;  5LMK B;  3TW7 A;  3BLH B;  5ICP B;  2WHB B;  4OB1 B;  3H4C A;  3TNH B;  3B57 A;  1H25 B;  1H24 B;  3MIA B;  3A8M B;  5LQF B;  1BU2 A;  2EUF A;  4BCH B;  3A8L B;  5HBJ B;  4EOL B;  3KHI A;  3A8O B;  2PMI B;  3QZ5 B;  2KR6 A;  1JSU B;  4YOO A;  3POM A;  2QF7 A;  3QHR B;  1OGU B;  1UGQ B;  4F6U B;  3F5X B;  2CYZ B;  4OR5 B;  1OI9 B;  4OB0 B;  1OIY B;  4F70 B;  1W98 B;  4AKH A;  4HNU A;  4HLQ A;  4F7J B;  4AI6 A;  4BCJ B;  3BLR B;  2R7G A;  2BS3 A;  4HNV A;  3HZJ A;  4CXA B;  3MI9 B;  2PJQ A;  4OB3 B;  4HL4 A;  4CFM B;  3QHW B;  4M6V A;  3BHU B;  2I40 B;  1N4M A;  5CYI B;  2D0Q B;  4JX5 A; 
#chains in the Genus database with same CATH homology
 1KXU A;  1JKW A;  1H28 B;  3K7A M;  4CFU D;  2C5O B;  1H1P B;  2BKZ B;  4CFX B;  1URC B;  3DDP B;  4YOS A;  3BLQ B;  4YC3 B;  2C5N B;  4IMY B;  4Y72 B;  4G6L B;  2UZB B;  3O0G D;  3EJ1 B;  2C5X B;  2QDJ A;  1E9H B;  5L2W B;  2G9X B;  4ELL A;  2W9Z A;  4EOR B;  5HBE B;  1H26 B;  2UZE B;  3BHV B;  4BCO B;  1UNH D;  4NST B;  2IW9 B;  1AD6 A;  5HBH B;  4CFW B;  2JGZ B;  2IW8 B;  2W9F A;  4F6S B;  3MY5 B;  4KRC B;  4YOZ A;  1GUX B;  3LQ5 B;  1QMZ B;  2W99 A;  1VYW B;  3TNW B;  2UZD B;  4F7L B;  5LMK B;  4EC8 B;  3TNI B;  2WIH B;  5I5Z B;  3BLH B;  2WFY B;  1GY3 B;  4EOP B;  1UNL D;  2CCH B;  2WMB B;  2WHB B;  4I3Z B;  2CCI B;  1H1R B;  4EOM B;  4EOO B;  5ICP B;  4BCP B;  2UUE B;  1G3N C;  3H4C A;  3M03 A;  4UN0 A;  2WPA B;  5HNB B;  4EOS B;  4CFU B;  4EOK B;  3BHT B;  2PK2 A;  2IW6 B;  3TNH B;  4CFV B;  2X1N B;  3MY1 B;  5HQ0 B;  1H25 B;  1OIU B;  1H24 B;  2CJM B;  1AIS B;  5HVY B;  4BCN D;  3DDQ B;  4EOI B;  3MIA B;  1OL2 B;  4F7S B;  4CRL B;  5LQF B;  1BU2 A;  1FIN B;  2EUF A;  1H1S B;  4BCH B;  1OL1 B;  4ROC A;  2F2C A;  2C5V B;  2WMA B;  4BCK B;  4II5 B;  5HBJ B;  5FGK B;  4BCF B;  1O9K B;  4EOL B;  4TTH A;  4BCI B;  4F7N B;  1GH6 B;  2PMI B;  1JSU B;  3EID B;  4YOO A;  3EOC B;  3POM A;  1VIN A;  3G33 B;  1F5Q B;  3RGF B;  4BCM D;  3QHR B;  4F6W B;  2W2H A;  1OGU B;  1D3U B;  1TFB A;  2PK9 B;  5EFQ B;  1H27 B;  4F6U B;  1GUX A;  2PHG A;  3F5X B;  1JOW A;  4BCQ D;  1P5E B;  2WXV B;  3DOG B;  4OR5 B;  4BCN B;  2C4G B;  1OI9 B;  1JST B;  1OIY B;  4EOJ B;  4F70 B;  1W98 B;  4OGR B;  4BCG B;  4CFN B;  4F7J B;  1VOL A;  1PKD B;  4BCJ B;  3BLR B;  4EOQ B;  2WIP B;  2UZL B;  2I53 A;  2R7G A;  4ELJ A;  5ACB A;  1H1Q B;  2WEV B;  2W96 A;  2V22 B;  4FX3 B;  4EC9 B;  5IDN B;  1ZP2 A;  1OKW B;  2C6T B;  4CXA B;  1UNG D;  5IF1 B;  3MI9 B;  4ROD A;  4BCM B;  2BPM B;  1C9B A;  1XO2 A;  4CFM B;  4EON B;  4ROE A;  3TN8 B;  3QHW B;  1H4L D;  2B9R A;  3BHU B;  1O9K A;  1FVV B;  2I40 B;  5BNJ B;  1N4M A;  2IVX A;  5CEI B;  5IDP B;  1OKV B;  4BCQ B;  4KRD B;  5CYI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...