4ROEA

Human tfiib-related factor 2 (brf2) and tbp bound to rpph1 promoter
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
307
Chain Sequence
QVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGCCVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSFKLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPADRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDLLQHRQSLVRSAFRDLLLPPCMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor IIIB 50 kDa subunit
publication title Redox Signaling by the RNA Polymerase III TFIIB-Related Factor Brf2.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 307
sequence length 348
ec nomenclature
pdb deposition date 2014-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4roeA01
2I40B 4TTHA 1URCB 5BNJB 4NSTB 1O9KA 4BCGB 2W2HA 1H27B 2C5VB 2UZEB 4BCMD 5LMKB 4EONB 1OL1B 2WMAB 1E9HB 3EOCB 1OKWB 2WIPB 4EORB 2V22B 4BCOB 1F5QB 4I3ZB 1H1PB 2IW9B 1UNGD 2IW8B 4BCHB 1TFBA 4UN0A 2PK9B 3BLHB 4F6SB 1OKVB 3DDQB 3LQ5B 3TNHB 4EC8B 2F2CA 4IMYB 3BHUB 1H1QB 1OIYB 4F7LB 1C9BA 3MI9B 5CEIB 2W9ZA 4EOMB 3M03A 3G33B 4YOOA 1GUXA 2B9RA 4BCFB 2WHBB 3F5XB 4RODA 1JOWA 4KRCB 3DDPB 2WMBB 5HNBB 4BCIB 4BCMB 1QMZB 3RGFB 2WXVB 2C5XB 1OL2B 3TN8B 4CXAB 2CJMB 1G3NC 1BU2A 3MY5B 3BHVB 1GH6B 3POMA 3QHWB 1H1RB 2BPMB 2WIHB 1P5EB 4EOIB 4BCKB 5ICPB 1W98B 2QDJA 3EIDB 3EJ1B 5HVYB 2EUFA 4CFVB 1ZP2A 1JSTB 2I53A 3MY1B 1PKDB 5I5ZB 1H24B 4EOOB 2JGZB 1H25B 2G9XB 1OIUB 2W96A 4ELLA 1O9KB 4F70B 2W9FA 4YOZA 5LQFB 1VOLA 3QHRB 4CFWB 5HBEB 1AISB 1H26B 4BCJB 4ELJA 2PMIB 5EFQB 1KXUA 4EOPB 5IDPB 1H1SB 3DOGB 3O0GD 1D3UB 2X1NB 3K7AM 4Y72B 4YOSA 4BCND 4F7NB 3MIAB 1FINB 2UUEB 2C6TB 4F6UB 1VINA 1N4MA 1XO2A 5FGKB 5ACBA 1H28B 4CRLB 4KRDB 2W99A 4CFMB 1JSUB 4EOJB 4FX3B 4F7JB 4F7SB 1GUXB 2PHGA 5CYIB 5IDNB 3H4CA 4BCQD 5IF1B 4ROCA 3BLRB 2UZLB 5HBHB 3TNIB 3TNWB 1OI9B 4CFUD 2C5OB 2IW6B 4ROEA 1OGUB 4YC3B 1JKWA 4EOSB 2PK2A 1GY3B 5HBJB 5L2WB 1AD6A 4CFXB 1H4LD 2IVXA 2CCIB 2CCHB 2UZDB 4BCNB 4F6WB 2WFYB 4II5B 4CFNB 2R7GA 4OR5B 4EC9B 2C4GB 1UNHD 4EOLB 5HQ0B 4EOKB 2UZBB 1FVVB 4EOQB 1UNLD 2C5NB 4G6LB 2BKZB 2WEVB 2WPAB 4BCQB 3BLQB 1VYWB 4OGRB 4CFUB 4BCPB 3BHTB
chains in the Genus database with same CATH superfamily
4BY7X 4NSTB 2UZEB 3VKHA 4OB3B 4BCMD 4EONB 2WMAB 2WIPB 1F5QB 2ZPGB 1H1PB 2IW9B 4BY1X 2IW8B 4AKIA 3QWLA 1OKVB 3TNHB 4EC8B 3QYEA 2F2CA 2DD5B 2DPPB 3X26B 1C9BA 3MI9B 5CEIB 2W9ZA 3VYHB 4EOMB 3HZJA 4YOOA 2WHBB 1JOWA 3DDPB 5HNBB 1QMZB 1FKMA 1G3NC 3MY5B 3POMA 3WVEB 2BPMB 1V29B 3EIDB 5HVYB 2EUFA 4CFVB 3MY1B 3A8MB 4ELLA 1VOLA 1O9KB 4BCJB 5EFQB 4EOPB 1H1SB 3O0GD 4HNVA 2X1NB 4YOSA 3MIAB 2UUEB 2C6TB 3HBLA 4F6UB 1VINA 1UGRB 4KRDB 4CFMB 2ZCFB 3BG3A 4AI6A 2PHGA 4ZGEB 3QYGB 5HBHB 3TNIB 1JKWA 2PK2A 5HBJB 1AHJB 1H4LD 2UZDB 2CCIB 4CFNB 2R7GA 4OR5B 4BBRM 1UNHD 4EOLB 4EOKB 3DL1A 4G6LB 2BKZB 4BCQB 4M6VA 4TTHA 2W2HA 2D0QB 2ZPEB 5LMKB 1E9HB 1OKWB 3DJBA 4F6SB 3GTMS 3LQ5B 1OIYB 2CZ7B 3A8LB 3G33B 2ZZDB 3VYGB 2QQ8A 2KR6A 3QYBA 1UGQB 1UGPB 2WXVB 3B57A 3TN8B 4CXAB 2BS3A 1QLBA 3X24B 2WIHB 1P5EB 1ENWA 5DQVA 4EOIB 2QDJA 3QYHB 2BS2A 1ZP2A 2IN3A 2ZPIB 1PKDB 2G9XB 2W9FA 4YOZA 1H26B 2PMIB 2QFZA 1D3UB 3K7AM 2KMGA 1FINB 1N4MA 5FGKB 5ACBA 4JX6A 5CYIB 3WVDB 3H4CA 2CZ0B 3TNWB 4CFUD 1OGUB 1GY3B 4MFEA 4CFXB 2IVXA 4BCNB 2CCHB 3A8HB 3QZ9B 2QF7A 2CZ1B 5HQ0B 4HNUA 1FVVB 1UNLD 2WPAB 3BLQB 1VYWB 4BCPB 3BHTB 2I40B 1IREB 1URCB 5BNJB 2DXBB 4AKGA 1OL1B 3EOCB 4EORB 4HLQA 4I3ZB 4FM4B 4BCHB 3TW7A 2PK9B 2PJQA 4IMYB 4F7LB 4OB0B 4MIMA 3M03A 2CZ6B 4Z6YA 1GUXA 2B9RA 3F5XB 2WMBB 4BCMB 4BCIB 3VKGA 3A8GB 2WJ9A 1TD6A 4BCKB 1W98B 4JX4A 2I53A 2DD4B 4EOOB 5LQFB 1OIUB 4CFWB 2ZPHB 3DOGB 3NDQA 4ZGJB 3QZ5B 3HHTB 1XO2A 1H28B 4CRLB 4EOJB 1JSUB 2QGSA 4FX3B 4F7SB 4BCQD 4ROCA 3BLRB 1OI9B 4ROEA 4YC3B 4EOSB 5L2WB 2ZPBB 3DTOA 4ZGDB 1AD6A 4F6WB 3HB9A 2UZBB 4EOQB 3A8OB 2QDYB 5DQWA 2DXCB 1O9KA 4BCGB 1H27B 2C5VB 3TW6A 2ZPFB 2V22B 4BCOB 4AKHA 1UGSB 2AHJB 3PO3S 4LOCA 1UNGD 1TFBA 4UN0A 4JX5A 3BLHB 3DDQB 3QXEB 3BHUB 1H1QB 5IHYA 4HL4A 3KHIA 4BCFB 4RODA 4KRCB 3HO8A 3RGFB 5EJCA 2C5XB 1OL2B 2BS4A 2CJMB 1BU2A 4BXXX 3BHVB 1E7PA 1GH6B 4NC6A 3QHWB 1H1RB 5ICPB 4OB1B 3EJ1B 2G77A 3X28B 1JSTB 5I5ZB 1H24B 2JGZB 1H25B 2W96A 4F70B 2CYZB 3QHRB 5HBEB 1AISB 2DMEA 4ELJA 1KXUA 5IDPB 2LW4A 4Y72B 4BCND 4F7NB 4OB2B 4BBSM 2W99A 3BG9A 4F7JB 1GUXB 3BG5A 5IDNB 4QSHA 5IF1B 2UZLB 2C5OB 2IW6B 2WFYB 4II5B 3X20B 4EC9B 2C4GB 4HNTA 4MFDA 2C5NB 2WEVB 4OGRB 3X25B 4CFUB
chains in the Genus database with same CATH topology
2I40B 4TTHA 1URCB 5BNJB 4NSTB 1O9KA 4BCGB 2W2HA 1H27B 2C5VB 2UZEB 4BCMD 5LMKB 4EONB 1OL1B 2WMAB 1E9HB 3EOCB 1OKWB 2WIPB 4EORB 2V22B 4BCOB 1F5QB 4I3ZB 1H1PB 2IW9B 1UNGD 2IW8B 4BCHB 1TFBA 4UN0A 2PK9B 3BLHB 4F6SB 1OKVB 3DDQB 3LQ5B 3TNHB 4EC8B 2F2CA 4IMYB 3BHUB 1H1QB 1OIYB 4F7LB 1C9BA 3MI9B 5CEIB 2W9ZA 4EOMB 3M03A 3G33B 4YOOA 1GUXA 2B9RA 4BCFB 2WHBB 3F5XB 4RODA 1JOWA 4KRCB 3DDPB 2WMBB 5HNBB 4BCIB 4BCMB 1QMZB 3RGFB 2WXVB 2C5XB 1OL2B 3TN8B 4CXAB 2CJMB 1G3NC 1BU2A 3MY5B 3BHVB 1GH6B 3POMA 3QHWB 1H1RB 2BPMB 2WIHB 1P5EB 4EOIB 4BCKB 5ICPB 1W98B 2QDJA 3EIDB 3EJ1B 5HVYB 2EUFA 4CFVB 1ZP2A 1JSTB 2I53A 3MY1B 1PKDB 5I5ZB 1H24B 4EOOB 2JGZB 1H25B 2G9XB 1OIUB 2W96A 4ELLA 1O9KB 4F70B 2W9FA 4YOZA 5LQFB 1VOLA 3QHRB 4CFWB 5HBEB 1AISB 1H26B 4BCJB 4ELJA 2PMIB 5EFQB 1KXUA 4EOPB 5IDPB 1H1SB 3DOGB 3O0GD 1D3UB 2X1NB 3K7AM 4Y72B 4YOSA 4BCND 4F7NB 3MIAB 1FINB 2UUEB 2C6TB 4F6UB 1VINA 1N4MA 1XO2A 5FGKB 5ACBA 1H28B 4CRLB 4KRDB 2W99A 4CFMB 1JSUB 4EOJB 4FX3B 4F7JB 4F7SB 1GUXB 2PHGA 5CYIB 5IDNB 3H4CA 4BCQD 5IF1B 4ROCA 3BLRB 2UZLB 5HBHB 3TNIB 3TNWB 1OI9B 4CFUD 2C5OB 2IW6B 4ROEA 1OGUB 4YC3B 1JKWA 4EOSB 2PK2A 1GY3B 5HBJB 5L2WB 1AD6A 4CFXB 1H4LD 2IVXA 2CCIB 2CCHB 2UZDB 4BCNB 4F6WB 2WFYB 4II5B 4CFNB 2R7GA 4OR5B 4EC9B 2C4GB 1UNHD 4EOLB 5HQ0B 4EOKB 2UZBB 1FVVB 4EOQB 1UNLD 2C5NB 4G6LB 2BKZB 2WEVB 2WPAB 4BCQB 3BLQB 1VYWB 4OGRB 4CFUB 4BCPB 3BHTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I40 B;  4TTH A;  1URC B;  5BNJ B;  4NST B;  1O9K A;  4BCG B;  2W2H A;  1H27 B;  2C5V B;  2UZE B;  4BCM D;  5LMK B;  4EON B;  1OL1 B;  2WMA B;  1E9H B;  3EOC B;  1OKW B;  2WIP B;  4EOR B;  2V22 B;  4BCO B;  1F5Q B;  4I3Z B;  1H1P B;  2IW9 B;  1UNG D;  2IW8 B;  4BCH B;  1TFB A;  4UN0 A;  2PK9 B;  3BLH B;  4F6S B;  1OKV B;  3DDQ B;  3LQ5 B;  3TNH B;  4EC8 B;  2F2C A;  4IMY B;  3BHU B;  1H1Q B;  1OIY B;  4F7L B;  1C9B A;  3MI9 B;  5CEI B;  2W9Z A;  4EOM B;  3M03 A;  3G33 B;  4YOO A;  1GUX A;  2B9R A;  4BCF B;  2WHB B;  3F5X B;  4ROD A;  1JOW A;  4KRC B;  3DDP B;  2WMB B;  5HNB B;  4BCI B;  4BCM B;  1QMZ B;  3RGF B;  2WXV B;  2C5X B;  1OL2 B;  3TN8 B;  4CXA B;  2CJM B;  1G3N C;  1BU2 A;  3MY5 B;  3BHV B;  1GH6 B;  3POM A;  3QHW B;  1H1R B;  2BPM B;  2WIH B;  1P5E B;  4EOI B;  4BCK B;  5ICP B;  1W98 B;  2QDJ A;  3EID B;  3EJ1 B;  5HVY B;  2EUF A;  4CFV B;  1ZP2 A;  1JST B;  2I53 A;  3MY1 B;  1PKD B;  5I5Z B;  1H24 B;  4EOO B;  2JGZ B;  1H25 B;  2G9X B;  1OIU B;  2W96 A;  4ELL A;  1O9K B;  4F70 B;  2W9F A;  4YOZ A;  5LQF B;  1VOL A;  3QHR B;  4CFW B;  5HBE B;  1AIS B;  1H26 B;  4BCJ B;  4ELJ A;  2PMI B;  5EFQ B;  1KXU A;  4EOP B;  5IDP B;  1H1S B;  3DOG B;  3O0G D;  1D3U B;  2X1N B;  3K7A M;  4Y72 B;  4YOS A;  4BCN D;  4F7N B;  3MIA B;  1FIN B;  2UUE B;  2C6T B;  4F6U B;  1VIN A;  1N4M A;  1XO2 A;  5FGK B;  5ACB A;  1H28 B;  4CRL B;  4KRD B;  2W99 A;  4CFM B;  1JSU B;  4EOJ B;  4FX3 B;  4F7J B;  4F7S B;  1GUX B;  2PHG A;  5CYI B;  5IDN B;  3H4C A;  4BCQ D;  5IF1 B;  4ROC A;  3BLR B;  2UZL B;  5HBH B;  3TNI B;  3TNW B;  1OI9 B;  4CFU D;  2C5O B;  2IW6 B;  4ROE A;  1OGU B;  4YC3 B;  1JKW A;  4EOS B;  2PK2 A;  1GY3 B;  5HBJ B;  5L2W B;  1AD6 A;  4CFX B;  1H4L D;  2IVX A;  2CCI B;  2CCH B;  2UZD B;  4BCN B;  4F6W B;  2WFY B;  4II5 B;  4CFN B;  2R7G A;  4OR5 B;  4EC9 B;  2C4G B;  1UNH D;  4EOL B;  5HQ0 B;  4EOK B;  2UZB B;  1FVV B;  4EOQ B;  1UNL D;  2C5N B;  4G6L B;  2BKZ B;  2WEV B;  2WPA B;  4BCQ B;  3BLQ B;  1VYW B;  4OGR B;  4CFU B;  4BCP B;  3BHT B; 
#chains in the Genus database with same CATH topology
 4BY7 X;  4NST B;  2UZE B;  3VKH A;  4OB3 B;  4BCM D;  4EON B;  2WMA B;  2WIP B;  1F5Q B;  2ZPG B;  1H1P B;  2IW9 B;  4BY1 X;  2IW8 B;  4AKI A;  3QWL A;  1OKV B;  3TNH B;  4EC8 B;  3QYE A;  2F2C A;  2DD5 B;  2DPP B;  3X26 B;  1C9B A;  3MI9 B;  5CEI B;  2W9Z A;  3VYH B;  4EOM B;  3HZJ A;  4YOO A;  2WHB B;  1JOW A;  3DDP B;  5HNB B;  1QMZ B;  1FKM A;  1G3N C;  3MY5 B;  3POM A;  3WVE B;  2BPM B;  1V29 B;  3EID B;  5HVY B;  2EUF A;  4CFV B;  3MY1 B;  3A8M B;  4ELL A;  1VOL A;  1O9K B;  4BCJ B;  5EFQ B;  4EOP B;  1H1S B;  3O0G D;  4HNV A;  2X1N B;  4YOS A;  3MIA B;  2UUE B;  2C6T B;  3HBL A;  4F6U B;  1VIN A;  1UGR B;  4KRD B;  4CFM B;  2ZCF B;  3BG3 A;  4AI6 A;  2PHG A;  4ZGE B;  3QYG B;  5HBH B;  3TNI B;  1JKW A;  2PK2 A;  5HBJ B;  1AHJ B;  1H4L D;  2UZD B;  2CCI B;  4CFN B;  2R7G A;  4OR5 B;  4BBR M;  1UNH D;  4EOL B;  4EOK B;  3DL1 A;  4G6L B;  2BKZ B;  4BCQ B;  4M6V A;  4TTH A;  2W2H A;  2D0Q B;  2ZPE B;  5LMK B;  1E9H B;  1OKW B;  3DJB A;  4F6S B;  3GTM S;  3LQ5 B;  1OIY B;  2CZ7 B;  3A8L B;  3G33 B;  2ZZD B;  3VYG B;  2QQ8 A;  2KR6 A;  3QYB A;  1UGQ B;  1UGP B;  2WXV B;  3B57 A;  3TN8 B;  4CXA B;  2BS3 A;  1QLB A;  3X24 B;  2WIH B;  1P5E B;  1ENW A;  5DQV A;  4EOI B;  2QDJ A;  3QYH B;  2BS2 A;  1ZP2 A;  2IN3 A;  2ZPI B;  1PKD B;  2G9X B;  2W9F A;  4YOZ A;  1H26 B;  2PMI B;  2QFZ A;  1D3U B;  3K7A M;  2KMG A;  1FIN B;  1N4M A;  5FGK B;  5ACB A;  4JX6 A;  5CYI B;  3WVD B;  3H4C A;  2CZ0 B;  3TNW B;  4CFU D;  1OGU B;  1GY3 B;  4MFE A;  4CFX B;  2IVX A;  4BCN B;  2CCH B;  3A8H B;  3QZ9 B;  2QF7 A;  2CZ1 B;  5HQ0 B;  4HNU A;  1FVV B;  1UNL D;  2WPA B;  3BLQ B;  1VYW B;  4BCP B;  3BHT B;  2I40 B;  1IRE B;  1URC B;  5BNJ B;  2DXB B;  4AKG A;  1OL1 B;  3EOC B;  4EOR B;  4HLQ A;  4I3Z B;  4FM4 B;  4BCH B;  3TW7 A;  2PK9 B;  2PJQ A;  4IMY B;  4F7L B;  4OB0 B;  4MIM A;  3M03 A;  2CZ6 B;  4Z6Y A;  1GUX A;  2B9R A;  3F5X B;  2WMB B;  4BCM B;  4BCI B;  3VKG A;  3A8G B;  2WJ9 A;  1TD6 A;  4BCK B;  1W98 B;  4JX4 A;  2I53 A;  2DD4 B;  4EOO B;  5LQF B;  1OIU B;  4CFW B;  2ZPH B;  3DOG B;  3NDQ A;  4ZGJ B;  3QZ5 B;  3HHT B;  1XO2 A;  1H28 B;  4CRL B;  4EOJ B;  1JSU B;  2QGS A;  4FX3 B;  4F7S B;  4BCQ D;  4ROC A;  3BLR B;  1OI9 B;  4ROE A;  4YC3 B;  4EOS B;  5L2W B;  2ZPB B;  3DTO A;  4ZGD B;  1AD6 A;  4F6W B;  3HB9 A;  2UZB B;  4EOQ B;  3A8O B;  2QDY B;  5DQW A;  2DXC B;  1O9K A;  4BCG B;  1H27 B;  2C5V B;  3TW6 A;  2ZPF B;  2V22 B;  4BCO B;  4AKH A;  1UGS B;  2AHJ B;  3PO3 S;  4LOC A;  1UNG D;  1TFB A;  4UN0 A;  4JX5 A;  3BLH B;  3DDQ B;  3QXE B;  3BHU B;  1H1Q B;  5IHY A;  4HL4 A;  3KHI A;  4BCF B;  4ROD A;  4KRC B;  3HO8 A;  3RGF B;  5EJC A;  2C5X B;  1OL2 B;  2BS4 A;  2CJM B;  1BU2 A;  4BXX X;  3BHV B;  1E7P A;  1GH6 B;  4NC6 A;  3QHW B;  1H1R B;  5ICP B;  4OB1 B;  3EJ1 B;  2G77 A;  3X28 B;  1JST B;  5I5Z B;  1H24 B;  2JGZ B;  1H25 B;  2W96 A;  4F70 B;  2CYZ B;  3QHR B;  5HBE B;  1AIS B;  2DME A;  4ELJ A;  1KXU A;  5IDP B;  2LW4 A;  4Y72 B;  4BCN D;  4F7N B;  4OB2 B;  4BBS M;  2W99 A;  3BG9 A;  4F7J B;  1GUX B;  3BG5 A;  5IDN B;  4QSH A;  5IF1 B;  2UZL B;  2C5O B;  2IW6 B;  2WFY B;  4II5 B;  3X20 B;  4EC9 B;  2C4G B;  4HNT A;  4MFD A;  2C5N B;  2WEV B;  4OGR B;  3X25 B;  4CFU B; 
#chains in the Genus database with same CATH homology
 2I40 B;  4TTH A;  1URC B;  5BNJ B;  4NST B;  1O9K A;  4BCG B;  2W2H A;  1H27 B;  2C5V B;  2UZE B;  4BCM D;  5LMK B;  4EON B;  1OL1 B;  2WMA B;  1E9H B;  3EOC B;  1OKW B;  2WIP B;  4EOR B;  2V22 B;  4BCO B;  1F5Q B;  4I3Z B;  1H1P B;  2IW9 B;  1UNG D;  2IW8 B;  4BCH B;  1TFB A;  4UN0 A;  2PK9 B;  3BLH B;  4F6S B;  1OKV B;  3DDQ B;  3LQ5 B;  3TNH B;  4EC8 B;  2F2C A;  4IMY B;  3BHU B;  1H1Q B;  1OIY B;  4F7L B;  1C9B A;  3MI9 B;  5CEI B;  2W9Z A;  4EOM B;  3M03 A;  3G33 B;  4YOO A;  1GUX A;  2B9R A;  4BCF B;  2WHB B;  3F5X B;  4ROD A;  1JOW A;  4KRC B;  3DDP B;  2WMB B;  5HNB B;  4BCI B;  4BCM B;  1QMZ B;  3RGF B;  2WXV B;  2C5X B;  1OL2 B;  3TN8 B;  4CXA B;  2CJM B;  1G3N C;  1BU2 A;  3MY5 B;  3BHV B;  1GH6 B;  3POM A;  3QHW B;  1H1R B;  2BPM B;  2WIH B;  1P5E B;  4EOI B;  4BCK B;  5ICP B;  1W98 B;  2QDJ A;  3EID B;  3EJ1 B;  5HVY B;  2EUF A;  4CFV B;  1ZP2 A;  1JST B;  2I53 A;  3MY1 B;  1PKD B;  5I5Z B;  1H24 B;  4EOO B;  2JGZ B;  1H25 B;  2G9X B;  1OIU B;  2W96 A;  4ELL A;  1O9K B;  4F70 B;  2W9F A;  4YOZ A;  5LQF B;  1VOL A;  3QHR B;  4CFW B;  5HBE B;  1AIS B;  1H26 B;  4BCJ B;  4ELJ A;  2PMI B;  5EFQ B;  1KXU A;  4EOP B;  5IDP B;  1H1S B;  3DOG B;  3O0G D;  1D3U B;  2X1N B;  3K7A M;  4Y72 B;  4YOS A;  4BCN D;  4F7N B;  3MIA B;  1FIN B;  2UUE B;  2C6T B;  4F6U B;  1VIN A;  1N4M A;  1XO2 A;  5FGK B;  5ACB A;  1H28 B;  4CRL B;  4KRD B;  2W99 A;  4CFM B;  1JSU B;  4EOJ B;  4FX3 B;  4F7J B;  4F7S B;  1GUX B;  2PHG A;  5CYI B;  5IDN B;  3H4C A;  4BCQ D;  5IF1 B;  4ROC A;  3BLR B;  2UZL B;  5HBH B;  3TNI B;  3TNW B;  1OI9 B;  4CFU D;  2C5O B;  2IW6 B;  4ROE A;  1OGU B;  4YC3 B;  1JKW A;  4EOS B;  2PK2 A;  1GY3 B;  5HBJ B;  5L2W B;  1AD6 A;  4CFX B;  1H4L D;  2IVX A;  2CCI B;  2CCH B;  2UZD B;  4BCN B;  4F6W B;  2WFY B;  4II5 B;  4CFN B;  2R7G A;  4OR5 B;  4EC9 B;  2C4G B;  1UNH D;  4EOL B;  5HQ0 B;  4EOK B;  2UZB B;  1FVV B;  4EOQ B;  1UNL D;  2C5N B;  4G6L B;  2BKZ B;  2WEV B;  2WPA B;  4BCQ B;  3BLQ B;  1VYW B;  4OGR B;  4CFU B;  4BCP B;  3BHT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...