2CCHB

The crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
260
structure length
260
Chain Sequence
NEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title The Role of the Phospho-Cdk2/Cyclin a Recruitment Site in Substrate Recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 260
sequence length 260
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cchB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 2cchB02
4CFMB 1OGUB 3DDQB 4BCQD 1OIYB 1H26B 2I40B 4EOQB 2CCHB 2W9ZA 4CFUB 4YC3B 4CFWB 4BCJB 4YOSA 5I5ZB 5HBHB 1F5QB 2UZLB 3TNWB 3H4CA 2CCIB 4KRCB 1OL1B 1W98B 1H4LD 4EONB 4BCHB 1VYWB 1OI9B 2C4GB 2CJMB 1H24B 2C6TB 2PHGA 4IMYB 1H1QB 1G3NC 1OL2B 2PMIB 1AD6A 4EOOB 3BLRB 4CFXB 1UNLD 3MY5B 3MI9B 5LMKB 2UZDB 2UZBB 4EOSB 4ELJA 4F7SB 4EOIB 4ELLA 4BCMD 4BCQB 2I53A 1ZP2A 4OR5B 5HNBB 2IW9B 3TN8B 2BPMB 4F7JB 3F5XB 3QHRB 2IW8B 2F2CA 1QMZB 1P5EB 2C5NB 1GH6B 2WPAB 4Y72B 2BKZB 2WIPB 2PK9B 2X1NB 1H1RB 5EFQB 5FGKB 4BCND 2WMBB 2QDJA 2IW6B 1H1PB 4UN0A 3TNHB 4TTHA 2C5VB 1JSTB 2UZEB 2WIHB 5L2WB 1UNGD 2WMAB 4YOOA 3BLQB 3QHWB 5HBEB 2C5XB 1KXUA 4EC8B 1GUXB 4EOKB 1VINA 4OGRB 4EOLB 3TNIB 5ICPB 2W99A 2WXVB 4CFVB 1H27B 2WHBB 3MY1B 1O9KB 4FX3B 2W2HA 5IDNB 4BCMB 4RODA 4EORB 4F70B 4CRLB 4II5B 4BCFB 1H28B 4CXAB 2V22B 1GY3B 5HQ0B 4ROCA 5CEIB 3BLHB 4F7LB 1VOLA 2B9RA 1H25B 4YOZA 1OKWB 5IF1B 1H1SB 3POMA 1D3UB 4BCNB 1C9BA 4BCKB 1OKVB 1AISB 2W96A 1XO2A 3O0GD 1TFBA 2WFYB 4NSTB 3BHTB 1FINB 4BCIB 1JSUB 2UUEB 4G6LB 1BU2A 1PKDB 4KRDB 4BCGB 5BNJB 5CYIB 3M03A 3BHVB 3RGFB 1FVVB 1UNHD 4F7NB 2WEVB 2C5OB 4ROEA 4CFUD 1JKWA 1E9HB 1OIUB 3DDPB 1GUXA 2W9FA 5IDPB 2R7GA 4BCPB 2PK2A 3BHUB 4F6UB 4BCOB 1O9KA 3LQ5B 3MIAB 3EIDB 1N4MA 4I3ZB 5LQFB 3EOCB 2JGZB 2IVXA 1URCB 2G9XB 5ACBA 2EUFA 3K7AM 5HVYB 4EC9B 4EOPB 5HBJB 3EJ1B 4EOJB 4F6WB 3G33B 3DOGB 4CFNB 4EOMB 1JOWA 4F6SB
chains in the Genus database with same CATH superfamily
2DXBB 2W9ZA 4YOSA 2ZPHB 3H4CA 2CCIB 4HLQA 4KRCB 1W98B 2DPPB 4EONB 1IREB 2CJMB 2C6TB 2PHGA 4IMYB 4MFDA 1OL2B 4HL4A 4EOOB 3BLRB 4CFXB 5LMKB 3X20B 4EOSB 3BG9A 4F7SB 2DD4B 4ELLA 2ZZDB 2IW9B 1QMZB 2G77A 2PK9B 5FGKB 2QF7A 2WMBB 3DTOA 2WMAB 5EJCA 5ICPB 4EOKB 4EOLB 3TNIB 2ZPEB 1H27B 3MY1B 4AI6A 5IHYA 2DD5B 4BCFB 4BBSM 4F7LB 1OKVB 1AISB 2W96A 1XO2A 4AKGA 1TFBA 2WFYB 2BS3A 5CYIB 4MIMA 4FM4B 2DMEA 3QXEB 2W9FA 5IDPB 3A8LB 3EIDB 1N4MA 5LQFB 2IVXA 2G9XB 5HVYB 4EC9B 4EOPB 2ZCFB 1GH6B 4AKHA 4CFMB 2BS2A 2I40B 4NC6A 4YC3B 4CFWB 4BCJB 3GTMS 1F5QB 3TNWB 3A8GB 1ENWA 1VYWB 1H24B 4BY1X 2PMIB 1G3NC 1UNLD 3WVDB 4ELJA 3HZJA 2I53A 2BPMB 4F7JB 2F2CA 1UGQB 1P5EB 2WPAB 2BS4A 1TD6A 3TW7A 5EFQB 4BCND 4ZGEB 2IW6B 1H1PB 4UN0A 2ZPGB 2UZEB 2CYZB 2WIHB 5L2WB 1UNGD 3QHWB 5HBEB 1VINA 4OB3B 4CFVB 4Z6YA 3HO8A 2PJQA 5IDNB 2WJ9A 4EORB 4F70B 4CRLB 4JX4A 1FKMA 1GY3B 5HQ0B 3BLHB 3HBLA 3BG5A 4YOZA 4JX5A 3POMA 4BCNB 4BCKB 3O0GD 3VKGA 4NSTB 3QYGB 3BHTB 1FINB 3NDQA 4G6LB 1PKDB 4BCGB 1V29B 1FVVB 4F7NB 2WEVB 2C5OB 4ROEA 4CFUD 3WVEB 3BHUB 4F6UB 4BCOB 1O9KA 3X26B 1UGSB 3MIAB 3QWLA 3VKHA 4I3ZB 2CZ6B 2JGZB 2ZPFB 3DJBA 5ACBA 2EUFA 5HBJB 4EOJB 3G33B 3DOGB 3HB9A 2ZPIB 4CFNB 4EOMB 4F6SB 1UGPB 3X28B 1OGUB 3DDQB 4BCQD 4ZGDB 2CZ0B 1H26B 4EOQB 2CCHB 4CFUB 3PO3S 3A8OB 5HBHB 2UZLB 1UGRB 4OB0B 2CZ1B 3A8HB 1H4LD 4BCHB 4BBRM 1H1QB 1AD6A 3MY5B 3MI9B 3QYBA 2QGSA 4BCMD 4BXXX 4BCQB 1ZP2A 4OR5B 5HNBB 3F5XB 4QSHA 2C5NB 3HHTB 4Y72B 2LW4A 2X1NB 1H1RB 4ZGJB 3KHIA 2QDJA 3TNHB 4TTHA 4M6VA 2KR6A 2C5XB 1KXUA 4OGRB 2W99A 1O9KB 4FX3B 4BCMB 4RODA 1H28B 4CXAB 2V22B 3QZ9B 2IN3A 5CEIB 1VOLA 2B9RA 3QYHB 1OKWB 5IF1B 1D3UB 1C9BA 4AKIA 4BCIB 1JSUB 4KRDB 1BU2A 5BNJB 3BHVB 4HNVA 3VYGB 1JKWA 1E9HB 3DDPB 1GUXA 1E7PA 2R7GA 4JX6A 4LOCA 4BCPB 2PK2A 3X24B 3EOCB 1URCB 4F6WB 2DXCB 1JOWA 2KMGA 1OIYB 3B57A 4OB1B 5I5ZB 2D0QB 4BY7X 1OL1B 2AHJB 1OI9B 1QLBA 2C4GB 2UZDB 2UZBB 3BG3A 4EOIB 2QDYB 3QYEA 3TN8B 3QHRB 2IW8B 2BKZB 3TW6A 2WIPB 4OB2B 2C5VB 1JSTB 4YOOA 3BLQB 4EC8B 1GUXB 2WXVB 5DQVA 2WHBB 1AHJB 2W2HA 3VYHB 2ZPBB 4MFEA 4II5B 4HNUA 4ROCA 1H25B 1H1SB 2UUEB 3A8MB 3M03A 2QFZA 3RGFB 2QQ8A 3X25B 1UNHD 3DL1A 5DQWA 3QZ5B 1OIUB 3LQ5B 4HNTA 3K7AM 3EJ1B 2CZ7B
chains in the Genus database with same CATH topology
4CFMB 1OGUB 3DDQB 4BCQD 1OIYB 1H26B 2I40B 4EOQB 2CCHB 2W9ZA 4CFUB 4YC3B 4CFWB 4BCJB 4YOSA 5I5ZB 5HBHB 1F5QB 2UZLB 3TNWB 3H4CA 2CCIB 4KRCB 1OL1B 1W98B 1H4LD 4EONB 4BCHB 1VYWB 1OI9B 2C4GB 2CJMB 1H24B 2C6TB 2PHGA 4IMYB 1H1QB 1G3NC 1OL2B 2PMIB 1AD6A 4EOOB 3BLRB 4CFXB 1UNLD 3MY5B 3MI9B 5LMKB 2UZDB 2UZBB 4EOSB 4ELJA 4F7SB 4EOIB 4ELLA 4BCMD 4BCQB 2I53A 1ZP2A 4OR5B 5HNBB 2IW9B 3TN8B 2BPMB 4F7JB 3F5XB 3QHRB 2IW8B 2F2CA 1QMZB 1P5EB 2C5NB 1GH6B 2WPAB 4Y72B 2BKZB 2WIPB 2PK9B 2X1NB 1H1RB 5EFQB 5FGKB 4BCND 2WMBB 2QDJA 2IW6B 1H1PB 4UN0A 3TNHB 4TTHA 2C5VB 1JSTB 2UZEB 2WIHB 5L2WB 1UNGD 2WMAB 4YOOA 3BLQB 3QHWB 5HBEB 2C5XB 1KXUA 4EC8B 1GUXB 4EOKB 1VINA 4OGRB 4EOLB 3TNIB 5ICPB 2W99A 2WXVB 4CFVB 1H27B 2WHBB 3MY1B 1O9KB 4FX3B 2W2HA 5IDNB 4BCMB 4RODA 4EORB 4F70B 4CRLB 4II5B 4BCFB 1H28B 4CXAB 2V22B 1GY3B 5HQ0B 4ROCA 5CEIB 3BLHB 4F7LB 1VOLA 2B9RA 1H25B 4YOZA 1OKWB 5IF1B 1H1SB 3POMA 1D3UB 4BCNB 1C9BA 4BCKB 1OKVB 1AISB 2W96A 1XO2A 3O0GD 1TFBA 2WFYB 4NSTB 3BHTB 1FINB 4BCIB 1JSUB 2UUEB 4G6LB 1BU2A 1PKDB 4KRDB 4BCGB 5BNJB 5CYIB 3M03A 3BHVB 3RGFB 1FVVB 1UNHD 4F7NB 2WEVB 2C5OB 4ROEA 4CFUD 1JKWA 1E9HB 1OIUB 3DDPB 1GUXA 2W9FA 5IDPB 2R7GA 4BCPB 2PK2A 3BHUB 4F6UB 4BCOB 1O9KA 3LQ5B 3MIAB 3EIDB 1N4MA 4I3ZB 5LQFB 3EOCB 2JGZB 2IVXA 1URCB 2G9XB 5ACBA 2EUFA 3K7AM 5HVYB 4EC9B 4EOPB 5HBJB 3EJ1B 4EOJB 4F6WB 3G33B 3DOGB 4CFNB 4EOMB 1JOWA 4F6SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CFM B;  1OGU B;  3DDQ B;  4BCQ D;  1OIY B;  1H26 B;  2I40 B;  4EOQ B;  2CCH B;  2W9Z A;  4CFU B;  4YC3 B;  4CFW B;  4BCJ B;  4YOS A;  5I5Z B;  5HBH B;  1F5Q B;  2UZL B;  3TNW B;  3H4C A;  2CCI B;  4KRC B;  1OL1 B;  1W98 B;  1H4L D;  4EON B;  4BCH B;  1VYW B;  1OI9 B;  2C4G B;  2CJM B;  1H24 B;  2C6T B;  2PHG A;  4IMY B;  1H1Q B;  1G3N C;  1OL2 B;  2PMI B;  1AD6 A;  4EOO B;  3BLR B;  4CFX B;  1UNL D;  3MY5 B;  3MI9 B;  5LMK B;  2UZD B;  2UZB B;  4EOS B;  4ELJ A;  4F7S B;  4EOI B;  4ELL A;  4BCM D;  4BCQ B;  2I53 A;  1ZP2 A;  4OR5 B;  5HNB B;  2IW9 B;  3TN8 B;  2BPM B;  4F7J B;  3F5X B;  3QHR B;  2IW8 B;  2F2C A;  1QMZ B;  1P5E B;  2C5N B;  1GH6 B;  2WPA B;  4Y72 B;  2BKZ B;  2WIP B;  2PK9 B;  2X1N B;  1H1R B;  5EFQ B;  5FGK B;  4BCN D;  2WMB B;  2QDJ A;  2IW6 B;  1H1P B;  4UN0 A;  3TNH B;  4TTH A;  2C5V B;  1JST B;  2UZE B;  2WIH B;  5L2W B;  1UNG D;  2WMA B;  4YOO A;  3BLQ B;  3QHW B;  5HBE B;  2C5X B;  1KXU A;  4EC8 B;  1GUX B;  4EOK B;  1VIN A;  4OGR B;  4EOL B;  3TNI B;  5ICP B;  2W99 A;  2WXV B;  4CFV B;  1H27 B;  2WHB B;  3MY1 B;  1O9K B;  4FX3 B;  2W2H A;  5IDN B;  4BCM B;  4ROD A;  4EOR B;  4F70 B;  4CRL B;  4II5 B;  4BCF B;  1H28 B;  4CXA B;  2V22 B;  1GY3 B;  5HQ0 B;  4ROC A;  5CEI B;  3BLH B;  4F7L B;  1VOL A;  2B9R A;  1H25 B;  4YOZ A;  1OKW B;  5IF1 B;  1H1S B;  3POM A;  1D3U B;  4BCN B;  1C9B A;  4BCK B;  1OKV B;  1AIS B;  2W96 A;  1XO2 A;  3O0G D;  1TFB A;  2WFY B;  4NST B;  3BHT B;  1FIN B;  4BCI B;  1JSU B;  2UUE B;  4G6L B;  1BU2 A;  1PKD B;  4KRD B;  4BCG B;  5BNJ B;  5CYI B;  3M03 A;  3BHV B;  3RGF B;  1FVV B;  1UNH D;  4F7N B;  2WEV B;  2C5O B;  4ROE A;  4CFU D;  1JKW A;  1E9H B;  1OIU B;  3DDP B;  1GUX A;  2W9F A;  5IDP B;  2R7G A;  4BCP B;  2PK2 A;  3BHU B;  4F6U B;  4BCO B;  1O9K A;  3LQ5 B;  3MIA B;  3EID B;  1N4M A;  4I3Z B;  5LQF B;  3EOC B;  2JGZ B;  2IVX A;  1URC B;  2G9X B;  5ACB A;  2EUF A;  3K7A M;  5HVY B;  4EC9 B;  4EOP B;  5HBJ B;  3EJ1 B;  4EOJ B;  4F6W B;  3G33 B;  3DOG B;  4CFN B;  4EOM B;  1JOW A;  4F6S B; 
#chains in the Genus database with same CATH topology
 2DXB B;  2W9Z A;  4YOS A;  2ZPH B;  3H4C A;  2CCI B;  4HLQ A;  4KRC B;  1W98 B;  2DPP B;  4EON B;  1IRE B;  2CJM B;  2C6T B;  2PHG A;  4IMY B;  4MFD A;  1OL2 B;  4HL4 A;  4EOO B;  3BLR B;  4CFX B;  5LMK B;  3X20 B;  4EOS B;  3BG9 A;  4F7S B;  2DD4 B;  4ELL A;  2ZZD B;  2IW9 B;  1QMZ B;  2G77 A;  2PK9 B;  5FGK B;  2QF7 A;  2WMB B;  3DTO A;  2WMA B;  5EJC A;  5ICP B;  4EOK B;  4EOL B;  3TNI B;  2ZPE B;  1H27 B;  3MY1 B;  4AI6 A;  5IHY A;  2DD5 B;  4BCF B;  4BBS M;  4F7L B;  1OKV B;  1AIS B;  2W96 A;  1XO2 A;  4AKG A;  1TFB A;  2WFY B;  2BS3 A;  5CYI B;  4MIM A;  4FM4 B;  2DME A;  3QXE B;  2W9F A;  5IDP B;  3A8L B;  3EID B;  1N4M A;  5LQF B;  2IVX A;  2G9X B;  5HVY B;  4EC9 B;  4EOP B;  2ZCF B;  1GH6 B;  4AKH A;  4CFM B;  2BS2 A;  2I40 B;  4NC6 A;  4YC3 B;  4CFW B;  4BCJ B;  3GTM S;  1F5Q B;  3TNW B;  3A8G B;  1ENW A;  1VYW B;  1H24 B;  4BY1 X;  2PMI B;  1G3N C;  1UNL D;  3WVD B;  4ELJ A;  3HZJ A;  2I53 A;  2BPM B;  4F7J B;  2F2C A;  1UGQ B;  1P5E B;  2WPA B;  2BS4 A;  1TD6 A;  3TW7 A;  5EFQ B;  4BCN D;  4ZGE B;  2IW6 B;  1H1P B;  4UN0 A;  2ZPG B;  2UZE B;  2CYZ B;  2WIH B;  5L2W B;  1UNG D;  3QHW B;  5HBE B;  1VIN A;  4OB3 B;  4CFV B;  4Z6Y A;  3HO8 A;  2PJQ A;  5IDN B;  2WJ9 A;  4EOR B;  4F70 B;  4CRL B;  4JX4 A;  1FKM A;  1GY3 B;  5HQ0 B;  3BLH B;  3HBL A;  3BG5 A;  4YOZ A;  4JX5 A;  3POM A;  4BCN B;  4BCK B;  3O0G D;  3VKG A;  4NST B;  3QYG B;  3BHT B;  1FIN B;  3NDQ A;  4G6L B;  1PKD B;  4BCG B;  1V29 B;  1FVV B;  4F7N B;  2WEV B;  2C5O B;  4ROE A;  4CFU D;  3WVE B;  3BHU B;  4F6U B;  4BCO B;  1O9K A;  3X26 B;  1UGS B;  3MIA B;  3QWL A;  3VKH A;  4I3Z B;  2CZ6 B;  2JGZ B;  2ZPF B;  3DJB A;  5ACB A;  2EUF A;  5HBJ B;  4EOJ B;  3G33 B;  3DOG B;  3HB9 A;  2ZPI B;  4CFN B;  4EOM B;  4F6S B;  1UGP B;  3X28 B;  1OGU B;  3DDQ B;  4BCQ D;  4ZGD B;  2CZ0 B;  1H26 B;  4EOQ B;  2CCH B;  4CFU B;  3PO3 S;  3A8O B;  5HBH B;  2UZL B;  1UGR B;  4OB0 B;  2CZ1 B;  3A8H B;  1H4L D;  4BCH B;  4BBR M;  1H1Q B;  1AD6 A;  3MY5 B;  3MI9 B;  3QYB A;  2QGS A;  4BCM D;  4BXX X;  4BCQ B;  1ZP2 A;  4OR5 B;  5HNB B;  3F5X B;  4QSH A;  2C5N B;  3HHT B;  4Y72 B;  2LW4 A;  2X1N B;  1H1R B;  4ZGJ B;  3KHI A;  2QDJ A;  3TNH B;  4TTH A;  4M6V A;  2KR6 A;  2C5X B;  1KXU A;  4OGR B;  2W99 A;  1O9K B;  4FX3 B;  4BCM B;  4ROD A;  1H28 B;  4CXA B;  2V22 B;  3QZ9 B;  2IN3 A;  5CEI B;  1VOL A;  2B9R A;  3QYH B;  1OKW B;  5IF1 B;  1D3U B;  1C9B A;  4AKI A;  4BCI B;  1JSU B;  4KRD B;  1BU2 A;  5BNJ B;  3BHV B;  4HNV A;  3VYG B;  1JKW A;  1E9H B;  3DDP B;  1GUX A;  1E7P A;  2R7G A;  4JX6 A;  4LOC A;  4BCP B;  2PK2 A;  3X24 B;  3EOC B;  1URC B;  4F6W B;  2DXC B;  1JOW A;  2KMG A;  1OIY B;  3B57 A;  4OB1 B;  5I5Z B;  2D0Q B;  4BY7 X;  1OL1 B;  2AHJ B;  1OI9 B;  1QLB A;  2C4G B;  2UZD B;  2UZB B;  3BG3 A;  4EOI B;  2QDY B;  3QYE A;  3TN8 B;  3QHR B;  2IW8 B;  2BKZ B;  3TW6 A;  2WIP B;  4OB2 B;  2C5V B;  1JST B;  4YOO A;  3BLQ B;  4EC8 B;  1GUX B;  2WXV B;  5DQV A;  2WHB B;  1AHJ B;  2W2H A;  3VYH B;  2ZPB B;  4MFE A;  4II5 B;  4HNU A;  4ROC A;  1H25 B;  1H1S B;  2UUE B;  3A8M B;  3M03 A;  2QFZ A;  3RGF B;  2QQ8 A;  3X25 B;  1UNH D;  3DL1 A;  5DQW A;  3QZ5 B;  1OIU B;  3LQ5 B;  4HNT A;  3K7A M;  3EJ1 B;  2CZ7 B; 
#chains in the Genus database with same CATH homology
 4CFM B;  1OGU B;  3DDQ B;  4BCQ D;  1OIY B;  1H26 B;  2I40 B;  4EOQ B;  2CCH B;  2W9Z A;  4CFU B;  4YC3 B;  4CFW B;  4BCJ B;  4YOS A;  5I5Z B;  5HBH B;  1F5Q B;  2UZL B;  3TNW B;  3H4C A;  2CCI B;  4KRC B;  1OL1 B;  1W98 B;  1H4L D;  4EON B;  4BCH B;  1VYW B;  1OI9 B;  2C4G B;  2CJM B;  1H24 B;  2C6T B;  2PHG A;  4IMY B;  1H1Q B;  1G3N C;  1OL2 B;  2PMI B;  1AD6 A;  4EOO B;  3BLR B;  4CFX B;  1UNL D;  3MY5 B;  3MI9 B;  5LMK B;  2UZD B;  2UZB B;  4EOS B;  4ELJ A;  4F7S B;  4EOI B;  4ELL A;  4BCM D;  4BCQ B;  2I53 A;  1ZP2 A;  4OR5 B;  5HNB B;  2IW9 B;  3TN8 B;  2BPM B;  4F7J B;  3F5X B;  3QHR B;  2IW8 B;  2F2C A;  1QMZ B;  1P5E B;  2C5N B;  1GH6 B;  2WPA B;  4Y72 B;  2BKZ B;  2WIP B;  2PK9 B;  2X1N B;  1H1R B;  5EFQ B;  5FGK B;  4BCN D;  2WMB B;  2QDJ A;  2IW6 B;  1H1P B;  4UN0 A;  3TNH B;  4TTH A;  2C5V B;  1JST B;  2UZE B;  2WIH B;  5L2W B;  1UNG D;  2WMA B;  4YOO A;  3BLQ B;  3QHW B;  5HBE B;  2C5X B;  1KXU A;  4EC8 B;  1GUX B;  4EOK B;  1VIN A;  4OGR B;  4EOL B;  3TNI B;  5ICP B;  2W99 A;  2WXV B;  4CFV B;  1H27 B;  2WHB B;  3MY1 B;  1O9K B;  4FX3 B;  2W2H A;  5IDN B;  4BCM B;  4ROD A;  4EOR B;  4F70 B;  4CRL B;  4II5 B;  4BCF B;  1H28 B;  4CXA B;  2V22 B;  1GY3 B;  5HQ0 B;  4ROC A;  5CEI B;  3BLH B;  4F7L B;  1VOL A;  2B9R A;  1H25 B;  4YOZ A;  1OKW B;  5IF1 B;  1H1S B;  3POM A;  1D3U B;  4BCN B;  1C9B A;  4BCK B;  1OKV B;  1AIS B;  2W96 A;  1XO2 A;  3O0G D;  1TFB A;  2WFY B;  4NST B;  3BHT B;  1FIN B;  4BCI B;  1JSU B;  2UUE B;  4G6L B;  1BU2 A;  1PKD B;  4KRD B;  4BCG B;  5BNJ B;  5CYI B;  3M03 A;  3BHV B;  3RGF B;  1FVV B;  1UNH D;  4F7N B;  2WEV B;  2C5O B;  4ROE A;  4CFU D;  1JKW A;  1E9H B;  1OIU B;  3DDP B;  1GUX A;  2W9F A;  5IDP B;  2R7G A;  4BCP B;  2PK2 A;  3BHU B;  4F6U B;  4BCO B;  1O9K A;  3LQ5 B;  3MIA B;  3EID B;  1N4M A;  4I3Z B;  5LQF B;  3EOC B;  2JGZ B;  2IVX A;  1URC B;  2G9X B;  5ACB A;  2EUF A;  3K7A M;  5HVY B;  4EC9 B;  4EOP B;  5HBJ B;  3EJ1 B;  4EOJ B;  4F6W B;  3G33 B;  3DOG B;  4CFN B;  4EOM B;  1JOW A;  4F6S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...