4YOSA

P107 pocket domain complexed with lin52 peptide
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
363
structure length
340
Chain Sequence
EFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSEERGDLIKFYNTIYVGRVKSFALKYDPLSPFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Retinoblastoma-like protein 1,Retinoblastoma-like protein 1
publication title Structural mechanisms of DREAM complex assembly and regulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 125
structure length 340
sequence length 363
ec nomenclature
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4yosA01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4yosA02
2CCHB 3TNIB 5HQ0B 2PHGA 4BCMD 2B9RA 4YOSA 4YOZA 2CCIB 4BCFB 3LQ5B 1AD6A 4TTHA 2BPMB 1VOLA 1H27B 4BCOB 4F7SB 2I53A 3TN8B 5EFQB 4EOOB 1OGUB 5ACBA 3QHWB 1XO2A 1JKWA 1OI9B 3BLRB 4CXAB 3K7AM 4UN0A 2F2CA 2V22B 2R7GA 2EUFA 5IDPB 1VYWB 1H4LD 4BCPB 2UZDB 4RODA 4I3ZB 5FGKB 4NSTB 2G9XB 4ELLA 3BHVB 2WMBB 5LMKB 3MI9B 1F5QB 2JGZB 4FX3B 3EOCB 5HBEB 1JSUB 4EOSB 2IW8B 2UZBB 1H26B 5LQFB 2I40B 1C9BA 5CYIB 2C5NB 4CFVB 4EOKB 4CFUB 4BCKB 4EC9B 1UNGD 3O0GD 4F6WB 3BHTB 3MY1B 2C5VB 1PKDB 2PK2A 1N4MA 4II5B 4KRDB 4CFNB 4EOIB 4F7LB 4EOMB 1P5EB 1GUXB 1GUXA 2WIHB 1GH6B 1H1PB 1H1SB 2WIPB 2WEVB 1H1QB 3POMA 2C6TB 5HVYB 2C4GB 4EC8B 4BCNB 5HBJB 2WXVB 3EIDB 1JSTB 4IMYB 1H24B 3TNHB 3DDQB 1OKVB 4EOLB 1JOWA 2UZEB 3MIAB 1O9KB 1URCB 2W99A 1O9KA 1OIYB 4EONB 4F7JB 4F6UB 1OIUB 5HNBB 4BCHB 2WFYB 1UNLD 5CEIB 2PMIB 3BHUB 3G33B 1OKWB 3F5XB 1KXUA 4BCQB 2BKZB 2QDJA 4EOPB 2CJMB 4EOQB 4ROEA 4CFUD 4F70B 4F7NB 4EORB 4BCMB 5ICPB 4G6LB 2WPAB 4ELJA 3M03A 1E9HB 1QMZB 4YOOA 4EOJB 2WMAB 4OGRB 4Y72B 2IW6B 4YC3B 3TNWB 2IVXA 1H28B 1FINB 1G3NC 5IF1B 5IDNB 3DDPB 3RGFB 5BNJB 4BCIB 1VINA 2X1NB 5HBHB 4CFMB 1W98B 5I5ZB 4BCJB 1OL1B 1BU2A 1FVVB 2C5XB 4BCND 2WHBB 2W96A 3QHRB 3BLHB 3MY5B 3H4CA 4KRCB 4CFXB 1AISB 2UUEB 3EJ1B 1OL2B 2W9ZA 2IW9B 4CRLB 1D3UB 2W2HA 3DOGB 4BCGB 2C5OB 4F6SB 1UNHD 1TFBA 2PK9B 1H25B 2UZLB 4CFWB 5L2WB 1H1RB 3BLQB 4OR5B 4ROCA 2W9FA 4BCQD 1ZP2A 1GY3B
chains in the Genus database with same CATH superfamily
2CCHB 1AHJB 2AHJB 4BCMD 3B57A 4YOSA 3NDQA 3X25B 4YOZA 2ZPFB 1AD6A 4TTHA 2BS4A 2ZCFB 2D0QB 3TN8B 5EFQB 2ZPIB 4JX5A 4CXAB 2F2CA 2EUFA 5IDPB 1UGPB 2UZDB 4RODA 4I3ZB 4ZGDB 2QDYB 2G9XB 3BHVB 2WMBB 1F5QB 2JGZB 3EOCB 1IREB 2I40B 4CFVB 1TD6A 3BHTB 2DMEA 2WIPB 1JSTB 5IHYA 3DDQB 4EOLB 1JOWA 2CZ0B 1O9KA 4BBSM 2WFYB 3A8LB 3HO8A 4HNTA 1KXUA 4BCQB 2QDJA 4EOPB 4ROEA 4CFUD 4F7NB 5ICPB 1UGQB 5EJCA 4ELJA 4QSHA 1QMZB 4Y72B 2IW6B 1H28B 5IF1B 5BNJB 1W98B 5I5ZB 1OL1B 5DQWA 4KRCB 1AISB 3EJ1B 4BCGB 2C5OB 2PK9B 1TFBA 2UZLB 1H25B 3BLQB 2W9FA 1ZP2A 1GY3B 4AI6A 3VKGA 3GTMS 3X20B 2G77A 3DL1A 4MFEA 1VOLA 4F7SB 1E7PA 2ZPEB 4EOOB 1OGUB 3BLRB 4UN0A 2R7GA 1H4LD 3X26B 3HZJA 4Z6YA 3MI9B 4FX3B 2IW8B 2UZBB 1C9BA 4JX4A 4EOKB 4BCKB 4F6WB 1FKMA 3MY1B 2C5VB 2PK2A 3VKHA 3QZ5B 1P5EB 2ZPGB 3BG9A 1H1SB 2WEVB 2C6TB 2WXVB 3EIDB 4IMYB 3A8HB 1OKVB 3TW7A 2DD4B 1O9KB 1URCB 1OIYB 5HNBB 4BCHB 5CEIB 3BHUB 3QYHB 3WVDB 2BKZB 4EOQB 4BCMB 4ZGJB 3TNWB 2WMAB 4OGRB 3X28B 4ROCA 2CZ1B 4AKIA 4BCIB 4BCJB 3A8GB 4BCND 2W96A 3QHRB 3BLHB 3MY5B 3H4CA 4CFXB 2DXCB 2UUEB 2W9ZA 4JX6A 2QF7A 2KR6A 1H1RB 4OB3B 5HQ0B 2PHGA 2B9RA 1ENWA 3LQ5B 4HLQA 4BCOB 3QWLA 2CZ7B 3A8OB 5ACBA 2ZZDB 3QHWB 1OI9B 2CYZB 3BG3A 4BCPB 4AKHA 4NC6A 5FGKB 3QXEB 4LOCA 1JSUB 4EOSB 4OB2B 1H26B 5LQFB 4CFUB 4EC9B 1UNGD 3O0GD 2LW4A 1N4MA 4CFNB 1GUXA 2WIHB 4BY1X 3PO3S 1H1PB 2C4GB 2CZ6B 4EC8B 2ZPHB 4OB0B 5HBJB 1UGRB 3DTOA 4HNUA 3HBLA 3QYEA 3MIAB 4F7JB 4EONB 4F6UB 2PMIB 3QZ9B 1OKWB 4F70B 4OB1B 4G6LB 3M03A 1E9HB 4YOOA 2DPPB 4YC3B 2IVXA 1G3NC 1VINA 2ZPBB 4CFMB 1BU2A 1FVVB 3WVEB 2WHBB 3HB9A 1OL2B 4CRLB 2IW9B 1D3UB 2W2HA 3DOGB 5L2WB 4CFWB 4M6VA 4OR5B 4HNVA 2WJ9A 3DJBA 4BCQD 3A8MB 3TNIB 4ZGEB 1QLBA 2PJQA 2IN3A 3VYHB 2CCIB 4BCFB 2BPMB 1H27B 2I53A 1XO2A 1JKWA 2QQ8A 3BG5A 3K7AM 2V22B 1VYWB 4AKGA 4NSTB 4ELLA 5LMKB 5HBEB 2C5NB 3TW6A 4HL4A 3VYGB 2QFZA 5DQVA 1PKDB 3QYBA 4II5B 4KRDB 4EOIB 4F7LB 2QGSA 4EOMB 1GUXB 1GH6B 4BY7X 3POMA 1H1QB 2BS2A 5HVYB 4BCNB 1H24B 3TNHB 4BBRM 2UZEB 2W99A 1OIUB 1UNLD 3G33B 4MFDA 1UGSB 3F5XB 2BS3A 4MIMA 2CJMB 4BXXX 4EORB 3HHTB 3QYGB 2WPAB 2DD5B 4EOJB 1FINB 5IDNB 3DDPB 3RGFB 2KMGA 2X1NB 4FM4B 5HBHB 2C5XB 3X24B 1V29B 3KHIA 4F6SB 1UNHD 2DXBB 5CYIB
chains in the Genus database with same CATH topology
2CCHB 3TNIB 5HQ0B 2PHGA 4BCMD 2B9RA 4YOSA 4YOZA 2CCIB 4BCFB 3LQ5B 1AD6A 4TTHA 2BPMB 1VOLA 1H27B 4BCOB 4F7SB 2I53A 3TN8B 5EFQB 4EOOB 1OGUB 5ACBA 3QHWB 1XO2A 1JKWA 1OI9B 3BLRB 4CXAB 3K7AM 4UN0A 2F2CA 2V22B 2R7GA 2EUFA 5IDPB 1VYWB 1H4LD 4BCPB 2UZDB 4RODA 4I3ZB 5FGKB 4NSTB 2G9XB 4ELLA 3BHVB 2WMBB 5LMKB 3MI9B 1F5QB 2JGZB 4FX3B 3EOCB 5HBEB 1JSUB 4EOSB 2IW8B 2UZBB 1H26B 5LQFB 2I40B 1C9BA 5CYIB 2C5NB 4CFVB 4EOKB 4CFUB 4BCKB 4EC9B 1UNGD 3O0GD 4F6WB 3BHTB 3MY1B 2C5VB 1PKDB 2PK2A 1N4MA 4II5B 4KRDB 4CFNB 4EOIB 4F7LB 4EOMB 1P5EB 1GUXB 1GUXA 2WIHB 1GH6B 1H1PB 1H1SB 2WIPB 2WEVB 1H1QB 3POMA 2C6TB 5HVYB 2C4GB 4EC8B 4BCNB 5HBJB 2WXVB 3EIDB 1JSTB 4IMYB 1H24B 3TNHB 3DDQB 1OKVB 4EOLB 1JOWA 2UZEB 3MIAB 1O9KB 1URCB 2W99A 1O9KA 1OIYB 4EONB 4F7JB 4F6UB 1OIUB 5HNBB 4BCHB 2WFYB 1UNLD 5CEIB 2PMIB 3BHUB 3G33B 1OKWB 3F5XB 1KXUA 4BCQB 2BKZB 2QDJA 4EOPB 2CJMB 4EOQB 4ROEA 4CFUD 4F70B 4F7NB 4EORB 4BCMB 5ICPB 4G6LB 2WPAB 4ELJA 3M03A 1E9HB 1QMZB 4YOOA 4EOJB 2WMAB 4OGRB 4Y72B 2IW6B 4YC3B 3TNWB 2IVXA 1H28B 1FINB 1G3NC 5IF1B 5IDNB 3DDPB 3RGFB 5BNJB 4BCIB 1VINA 2X1NB 5HBHB 4CFMB 1W98B 5I5ZB 4BCJB 1OL1B 1BU2A 1FVVB 2C5XB 4BCND 2WHBB 2W96A 3QHRB 3BLHB 3MY5B 3H4CA 4KRCB 4CFXB 1AISB 2UUEB 3EJ1B 1OL2B 2W9ZA 2IW9B 4CRLB 1D3UB 2W2HA 3DOGB 4BCGB 2C5OB 4F6SB 1UNHD 1TFBA 2PK9B 1H25B 2UZLB 4CFWB 5L2WB 1H1RB 3BLQB 4OR5B 4ROCA 2W9FA 4BCQD 1ZP2A 1GY3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCH B;  3TNI B;  5HQ0 B;  2PHG A;  4BCM D;  2B9R A;  4YOS A;  4YOZ A;  2CCI B;  4BCF B;  3LQ5 B;  1AD6 A;  4TTH A;  2BPM B;  1VOL A;  1H27 B;  4BCO B;  4F7S B;  2I53 A;  3TN8 B;  5EFQ B;  4EOO B;  1OGU B;  5ACB A;  3QHW B;  1XO2 A;  1JKW A;  1OI9 B;  3BLR B;  4CXA B;  3K7A M;  4UN0 A;  2F2C A;  2V22 B;  2R7G A;  2EUF A;  5IDP B;  1VYW B;  1H4L D;  4BCP B;  2UZD B;  4ROD A;  4I3Z B;  5FGK B;  4NST B;  2G9X B;  4ELL A;  3BHV B;  2WMB B;  5LMK B;  3MI9 B;  1F5Q B;  2JGZ B;  4FX3 B;  3EOC B;  5HBE B;  1JSU B;  4EOS B;  2IW8 B;  2UZB B;  1H26 B;  5LQF B;  2I40 B;  1C9B A;  5CYI B;  2C5N B;  4CFV B;  4EOK B;  4CFU B;  4BCK B;  4EC9 B;  1UNG D;  3O0G D;  4F6W B;  3BHT B;  3MY1 B;  2C5V B;  1PKD B;  2PK2 A;  1N4M A;  4II5 B;  4KRD B;  4CFN B;  4EOI B;  4F7L B;  4EOM B;  1P5E B;  1GUX B;  1GUX A;  2WIH B;  1GH6 B;  1H1P B;  1H1S B;  2WIP B;  2WEV B;  1H1Q B;  3POM A;  2C6T B;  5HVY B;  2C4G B;  4EC8 B;  4BCN B;  5HBJ B;  2WXV B;  3EID B;  1JST B;  4IMY B;  1H24 B;  3TNH B;  3DDQ B;  1OKV B;  4EOL B;  1JOW A;  2UZE B;  3MIA B;  1O9K B;  1URC B;  2W99 A;  1O9K A;  1OIY B;  4EON B;  4F7J B;  4F6U B;  1OIU B;  5HNB B;  4BCH B;  2WFY B;  1UNL D;  5CEI B;  2PMI B;  3BHU B;  3G33 B;  1OKW B;  3F5X B;  1KXU A;  4BCQ B;  2BKZ B;  2QDJ A;  4EOP B;  2CJM B;  4EOQ B;  4ROE A;  4CFU D;  4F70 B;  4F7N B;  4EOR B;  4BCM B;  5ICP B;  4G6L B;  2WPA B;  4ELJ A;  3M03 A;  1E9H B;  1QMZ B;  4YOO A;  4EOJ B;  2WMA B;  4OGR B;  4Y72 B;  2IW6 B;  4YC3 B;  3TNW B;  2IVX A;  1H28 B;  1FIN B;  1G3N C;  5IF1 B;  5IDN B;  3DDP B;  3RGF B;  5BNJ B;  4BCI B;  1VIN A;  2X1N B;  5HBH B;  4CFM B;  1W98 B;  5I5Z B;  4BCJ B;  1OL1 B;  1BU2 A;  1FVV B;  2C5X B;  4BCN D;  2WHB B;  2W96 A;  3QHR B;  3BLH B;  3MY5 B;  3H4C A;  4KRC B;  4CFX B;  1AIS B;  2UUE B;  3EJ1 B;  1OL2 B;  2W9Z A;  2IW9 B;  4CRL B;  1D3U B;  2W2H A;  3DOG B;  4BCG B;  2C5O B;  4F6S B;  1UNH D;  1TFB A;  2PK9 B;  1H25 B;  2UZL B;  4CFW B;  5L2W B;  1H1R B;  3BLQ B;  4OR5 B;  4ROC A;  2W9F A;  4BCQ D;  1ZP2 A;  1GY3 B; 
#chains in the Genus database with same CATH topology
 2CCH B;  1AHJ B;  2AHJ B;  4BCM D;  3B57 A;  4YOS A;  3NDQ A;  3X25 B;  4YOZ A;  2ZPF B;  1AD6 A;  4TTH A;  2BS4 A;  2ZCF B;  2D0Q B;  3TN8 B;  5EFQ B;  2ZPI B;  4JX5 A;  4CXA B;  2F2C A;  2EUF A;  5IDP B;  1UGP B;  2UZD B;  4ROD A;  4I3Z B;  4ZGD B;  2QDY B;  2G9X B;  3BHV B;  2WMB B;  1F5Q B;  2JGZ B;  3EOC B;  1IRE B;  2I40 B;  4CFV B;  1TD6 A;  3BHT B;  2DME A;  2WIP B;  1JST B;  5IHY A;  3DDQ B;  4EOL B;  1JOW A;  2CZ0 B;  1O9K A;  4BBS M;  2WFY B;  3A8L B;  3HO8 A;  4HNT A;  1KXU A;  4BCQ B;  2QDJ A;  4EOP B;  4ROE A;  4CFU D;  4F7N B;  5ICP B;  1UGQ B;  5EJC A;  4ELJ A;  4QSH A;  1QMZ B;  4Y72 B;  2IW6 B;  1H28 B;  5IF1 B;  5BNJ B;  1W98 B;  5I5Z B;  1OL1 B;  5DQW A;  4KRC B;  1AIS B;  3EJ1 B;  4BCG B;  2C5O B;  2PK9 B;  1TFB A;  2UZL B;  1H25 B;  3BLQ B;  2W9F A;  1ZP2 A;  1GY3 B;  4AI6 A;  3VKG A;  3GTM S;  3X20 B;  2G77 A;  3DL1 A;  4MFE A;  1VOL A;  4F7S B;  1E7P A;  2ZPE B;  4EOO B;  1OGU B;  3BLR B;  4UN0 A;  2R7G A;  1H4L D;  3X26 B;  3HZJ A;  4Z6Y A;  3MI9 B;  4FX3 B;  2IW8 B;  2UZB B;  1C9B A;  4JX4 A;  4EOK B;  4BCK B;  4F6W B;  1FKM A;  3MY1 B;  2C5V B;  2PK2 A;  3VKH A;  3QZ5 B;  1P5E B;  2ZPG B;  3BG9 A;  1H1S B;  2WEV B;  2C6T B;  2WXV B;  3EID B;  4IMY B;  3A8H B;  1OKV B;  3TW7 A;  2DD4 B;  1O9K B;  1URC B;  1OIY B;  5HNB B;  4BCH B;  5CEI B;  3BHU B;  3QYH B;  3WVD B;  2BKZ B;  4EOQ B;  4BCM B;  4ZGJ B;  3TNW B;  2WMA B;  4OGR B;  3X28 B;  4ROC A;  2CZ1 B;  4AKI A;  4BCI B;  4BCJ B;  3A8G B;  4BCN D;  2W96 A;  3QHR B;  3BLH B;  3MY5 B;  3H4C A;  4CFX B;  2DXC B;  2UUE B;  2W9Z A;  4JX6 A;  2QF7 A;  2KR6 A;  1H1R B;  4OB3 B;  5HQ0 B;  2PHG A;  2B9R A;  1ENW A;  3LQ5 B;  4HLQ A;  4BCO B;  3QWL A;  2CZ7 B;  3A8O B;  5ACB A;  2ZZD B;  3QHW B;  1OI9 B;  2CYZ B;  3BG3 A;  4BCP B;  4AKH A;  4NC6 A;  5FGK B;  3QXE B;  4LOC A;  1JSU B;  4EOS B;  4OB2 B;  1H26 B;  5LQF B;  4CFU B;  4EC9 B;  1UNG D;  3O0G D;  2LW4 A;  1N4M A;  4CFN B;  1GUX A;  2WIH B;  4BY1 X;  3PO3 S;  1H1P B;  2C4G B;  2CZ6 B;  4EC8 B;  2ZPH B;  4OB0 B;  5HBJ B;  1UGR B;  3DTO A;  4HNU A;  3HBL A;  3QYE A;  3MIA B;  4F7J B;  4EON B;  4F6U B;  2PMI B;  3QZ9 B;  1OKW B;  4F70 B;  4OB1 B;  4G6L B;  3M03 A;  1E9H B;  4YOO A;  2DPP B;  4YC3 B;  2IVX A;  1G3N C;  1VIN A;  2ZPB B;  4CFM B;  1BU2 A;  1FVV B;  3WVE B;  2WHB B;  3HB9 A;  1OL2 B;  4CRL B;  2IW9 B;  1D3U B;  2W2H A;  3DOG B;  5L2W B;  4CFW B;  4M6V A;  4OR5 B;  4HNV A;  2WJ9 A;  3DJB A;  4BCQ D;  3A8M B;  3TNI B;  4ZGE B;  1QLB A;  2PJQ A;  2IN3 A;  3VYH B;  2CCI B;  4BCF B;  2BPM B;  1H27 B;  2I53 A;  1XO2 A;  1JKW A;  2QQ8 A;  3BG5 A;  3K7A M;  2V22 B;  1VYW B;  4AKG A;  4NST B;  4ELL A;  5LMK B;  5HBE B;  2C5N B;  3TW6 A;  4HL4 A;  3VYG B;  2QFZ A;  5DQV A;  1PKD B;  3QYB A;  4II5 B;  4KRD B;  4EOI B;  4F7L B;  2QGS A;  4EOM B;  1GUX B;  1GH6 B;  4BY7 X;  3POM A;  1H1Q B;  2BS2 A;  5HVY B;  4BCN B;  1H24 B;  3TNH B;  4BBR M;  2UZE B;  2W99 A;  1OIU B;  1UNL D;  3G33 B;  4MFD A;  1UGS B;  3F5X B;  2BS3 A;  4MIM A;  2CJM B;  4BXX X;  4EOR B;  3HHT B;  3QYG B;  2WPA B;  2DD5 B;  4EOJ B;  1FIN B;  5IDN B;  3DDP B;  3RGF B;  2KMG A;  2X1N B;  4FM4 B;  5HBH B;  2C5X B;  3X24 B;  1V29 B;  3KHI A;  4F6S B;  1UNH D;  2DXB B;  5CYI B; 
#chains in the Genus database with same CATH homology
 2CCH B;  3TNI B;  5HQ0 B;  2PHG A;  4BCM D;  2B9R A;  4YOS A;  4YOZ A;  2CCI B;  4BCF B;  3LQ5 B;  1AD6 A;  4TTH A;  2BPM B;  1VOL A;  1H27 B;  4BCO B;  4F7S B;  2I53 A;  3TN8 B;  5EFQ B;  4EOO B;  1OGU B;  5ACB A;  3QHW B;  1XO2 A;  1JKW A;  1OI9 B;  3BLR B;  4CXA B;  3K7A M;  4UN0 A;  2F2C A;  2V22 B;  2R7G A;  2EUF A;  5IDP B;  1VYW B;  1H4L D;  4BCP B;  2UZD B;  4ROD A;  4I3Z B;  5FGK B;  4NST B;  2G9X B;  4ELL A;  3BHV B;  2WMB B;  5LMK B;  3MI9 B;  1F5Q B;  2JGZ B;  4FX3 B;  3EOC B;  5HBE B;  1JSU B;  4EOS B;  2IW8 B;  2UZB B;  1H26 B;  5LQF B;  2I40 B;  1C9B A;  5CYI B;  2C5N B;  4CFV B;  4EOK B;  4CFU B;  4BCK B;  4EC9 B;  1UNG D;  3O0G D;  4F6W B;  3BHT B;  3MY1 B;  2C5V B;  1PKD B;  2PK2 A;  1N4M A;  4II5 B;  4KRD B;  4CFN B;  4EOI B;  4F7L B;  4EOM B;  1P5E B;  1GUX B;  1GUX A;  2WIH B;  1GH6 B;  1H1P B;  1H1S B;  2WIP B;  2WEV B;  1H1Q B;  3POM A;  2C6T B;  5HVY B;  2C4G B;  4EC8 B;  4BCN B;  5HBJ B;  2WXV B;  3EID B;  1JST B;  4IMY B;  1H24 B;  3TNH B;  3DDQ B;  1OKV B;  4EOL B;  1JOW A;  2UZE B;  3MIA B;  1O9K B;  1URC B;  2W99 A;  1O9K A;  1OIY B;  4EON B;  4F7J B;  4F6U B;  1OIU B;  5HNB B;  4BCH B;  2WFY B;  1UNL D;  5CEI B;  2PMI B;  3BHU B;  3G33 B;  1OKW B;  3F5X B;  1KXU A;  4BCQ B;  2BKZ B;  2QDJ A;  4EOP B;  2CJM B;  4EOQ B;  4ROE A;  4CFU D;  4F70 B;  4F7N B;  4EOR B;  4BCM B;  5ICP B;  4G6L B;  2WPA B;  4ELJ A;  3M03 A;  1E9H B;  1QMZ B;  4YOO A;  4EOJ B;  2WMA B;  4OGR B;  4Y72 B;  2IW6 B;  4YC3 B;  3TNW B;  2IVX A;  1H28 B;  1FIN B;  1G3N C;  5IF1 B;  5IDN B;  3DDP B;  3RGF B;  5BNJ B;  4BCI B;  1VIN A;  2X1N B;  5HBH B;  4CFM B;  1W98 B;  5I5Z B;  4BCJ B;  1OL1 B;  1BU2 A;  1FVV B;  2C5X B;  4BCN D;  2WHB B;  2W96 A;  3QHR B;  3BLH B;  3MY5 B;  3H4C A;  4KRC B;  4CFX B;  1AIS B;  2UUE B;  3EJ1 B;  1OL2 B;  2W9Z A;  2IW9 B;  4CRL B;  1D3U B;  2W2H A;  3DOG B;  4BCG B;  2C5O B;  4F6S B;  1UNH D;  1TFB A;  2PK9 B;  1H25 B;  2UZL B;  4CFW B;  5L2W B;  1H1R B;  3BLQ B;  4OR5 B;  4ROC A;  2W9F A;  4BCQ D;  1ZP2 A;  1GY3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...