2KMGA

The structure of the klca and ardb proteins show a novel fold and antirestriction activity against type i dna restriction systems in vivo but not in vitro
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFALGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KlcA
publication title The structure of the KlcA and ArdB proteins reveals a novel fold and antirestriction activity against Type I DNA restriction systems in vivo but not in vitro
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Gene regulation
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03230 Antirestrict Antirestriction protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.120 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2kmgA00
2WJ9A 2KMGA
chains in the Genus database with same CATH superfamily
4BCHB 5IF1B 1H27B 2DD4B 1GUXB 3EOCB 3KHIA 4KRDB 1PKDB 3QZ9B 2PMIB 5CEIB 2W99A 2ZPGB 4AKIA 4FM4B 2ZPFB 4YC3B 1H1QB 2EUFA 3QHWB 4BCKB 1JSUB 3X20B 4BCQD 2IVXA 2ZPIB 4F70B 4EONB 5HQ0B 3HZJA 3BHTB 3BLHB 4CFUD 5EFQB 2W2HA 5L2WB 1GY3B 2PJQA 4HNTA 4CRLB 4ZGEB 4OB1B 2G9XB 4KRCB 3BG5A 2WFYB 2UZDB 4BXXX 1UGRB 5ICPB 1JKWA 1H28B 4CFUB 3VYHB 5I5ZB 1UNGD 3K7AM 3A8LB 3LQ5B 5CYIB 5IDNB 1IREB 1OIUB 4BBSM 2PHGA 2IW9B 3BG3A 4BCNB 1UGQB 3F5XB 3EJ1B 2I53A 1OI9B 1OKWB 1O9KB 4OB3B 2X1NB 2DMEA 4TTHA 1E9HB 3MY5B 3DL1A 1H1RB 3G33B 1AHJB 4AKGA 1D3UB 4BCPB 1QMZB 1H25B 3GTMS 3TNHB 4BY7X 2UUEB 4CFMB 1VINA 2WMAB 2QF7A 4OB2B 4CFWB 4CXAB 5HBEB 1AISB 5LMKB 4EOOB 4F7NB 4JX4A 2QDJA 3MI9B 2QGSA 4EOJB 2WIPB 2KR6A 4M6VA 3MIAB 1E7PA 1UNHD 3QYBA 2IW6B 2CZ6B 1P5EB 1H26B 3A8OB 2UZBB 4UN0A 3QXEB 2QDYB 1OL2B 2C4GB 3TW6A 3QHRB 3A8MB 3DDPB 1FINB 1URCB 2WMBB 1AD6A 5IHYA 1QLBA 2UZEB 4OR5B 4CFNB 3EIDB 4RODA 1W98B 4YOSA 2ZPHB 4F7JB 4QSHA 2AHJB 1UGPB 4YOZA 2I40B 3RGFB 1BU2A 1VOLA 4EOPB 3O0GD 3HO8A 4II5B 4IMYB 2C5NB 1V29B 3NDQA 2IW8B 1H1SB 4BCND 3TNWB 1UNLD 4NSTB 4EOLB 4MFEA 4BCMB 3QYHB 2ZCFB 3PO3S 2WJ9A 4AKHA 2CZ1B 2ZPBB 1GUXA 1GH6B 3H4CA 5FGKB 2W9FA 4HNVA 4HL4A 3X25B 3HHTB 3HB9A 4EC8B 1VYWB 1JOWA 2BKZB 4JX5A 4BCIB 1ZP2A 2WHBB 3QYGB 1H24B 3HBLA 4EOIB 2F2CA 2ZPEB 2DXBB 3A8GB 3A8HB 2CZ7B 2V22B 3VKHA 4BCGB 4OGRB 2JGZB 2KMGA 4I3ZB 1ENWA 1F5QB 2UZLB 3X28B 5HNBB 3BG9A 3QYEA 3TW7A 2C5OB 2W9ZA 3BLQB 1H4LD 2WEVB 4AI6A 3VKGA 2D0QB 2G77A 3M03A 2WXVB 1FKMA 4BCJB 1C9BA 4LOCA 3QZ5B 4ELLA 4F7LB 1OIYB 3DDQB 1XO2A 4EORB 3X24B 4BBRM 2CCHB 3POMA 2BS4A 1O9KA 2PK9B 3TNIB 4F6UB 4HNUA 1OL1B 3VYGB 1OGUB 4ELJA 5HBHB 4HLQA 5HVYB 4BCMD 4BCOB 2C5VB 3BLRB 4FX3B 4EOQB 4NC6A 1KXUA 2WIHB 3TN8B 4CFXB 4F6SB 4EOMB 5EJCA 4MIMA 4ZGDB 4EOSB 5IDPB 2DPPB 2CYZB 5HBJB 4BCQB 1G3NC 1OKVB 2BPMB 1N4MA 4EC9B 5DQVA 4ROCA 5ACBA 2DXCB 4MFDA 4F7SB 4Z6YA 1FVVB 2W96A 2WPAB 2PK2A 3DTOA 4JX6A 4Y72B 1JSTB 1TFBA 3DOGB 5DQWA 1UGSB 4G6LB 2BS2A 2R7GA 3QWLA 4OB0B 4ROEA 2CCIB 4CFVB 3WVDB 2BS3A 3WVEB 4BY1X 2LW4A 2C6TB 3BHUB 4EOKB 3BHVB 5LQFB 4F6WB 2DD5B 4YOOA 2QFZA 1TD6A 2ZZDB 3X26B 2IN3A 4BCFB 3B57A 2CZ0B 3DJBA 2QQ8A 5BNJB 2C5XB 1H1PB 3MY1B 4ZGJB 2B9RA 2CJMB
chains in the Genus database with same CATH topology
4HNVA 4HL4A 4NC6A 2DD4B 3HHTB 3X25B 3HB9A 2QF7A 4OB2B 4JX5A 3KHIA 5EJCA 3QYGB 3QZ9B 4MIMA 3HBLA 4ZGDB 2ZPGB 4JX4A 4AKIA 2QDJA 4FM4B 2DPPB 2ZPFB 2CYZB 2ZPEB 2DXBB 3A8GB 4M6VA 2KR6A 3A8HB 2CZ7B 1E7PA 3VKHA 3QYBA 2CZ6B 2KMGA 3X20B 3A8OB 2ZPIB 2DXCB 3X28B 4MFDA 3BG9A 3HZJA 3QXEB 3QYEA 4Z6YA 2QDYB 3TW7A 4JX6A 3TW6A 3A8MB 4AI6A 3VKGA 2D0QB 4HNTA 4ZGEB 4OB1B 2G77A 1UGSB 2BS2A 3BG5A 1FKMA 1QLBA 1UGRB 3QWLA 4LOCA 4OB0B 3VYHB 3QZ5B 2ZPHB 3WVDB 3A8LB 2BS3A 3WVEB 4QSHA 2AHJB 1IREB 1UGPB 4BBSM 3X24B 3BG3A 2DD5B 3HO8A 2QFZA 1UGQB 4BBRM 1V29B 2BS4A 2ZZDB 3X26B 4HNUA 4OB3B 3VYGB 4MFEA 2CZ0B 3QYHB 2ZCFB 3DL1A 4ELJA 2WJ9A 4AKHA 2QQ8A 2CZ1B 1AHJB 4AKGA 2ZPBB 4HLQA 4ZGJB 3H4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJ9 A;  2KMG A; 
#chains in the Genus database with same CATH topology
 4BCH B;  5IF1 B;  1H27 B;  2DD4 B;  1GUX B;  3EOC B;  3KHI A;  4KRD B;  1PKD B;  3QZ9 B;  2PMI B;  5CEI B;  2W99 A;  2ZPG B;  4AKI A;  4FM4 B;  2ZPF B;  4YC3 B;  1H1Q B;  2EUF A;  3QHW B;  4BCK B;  1JSU B;  3X20 B;  4BCQ D;  2IVX A;  2ZPI B;  4F70 B;  4EON B;  5HQ0 B;  3HZJ A;  3BHT B;  3BLH B;  4CFU D;  5EFQ B;  2W2H A;  5L2W B;  1GY3 B;  2PJQ A;  4HNT A;  4CRL B;  4ZGE B;  4OB1 B;  2G9X B;  4KRC B;  3BG5 A;  2WFY B;  2UZD B;  4BXX X;  1UGR B;  5ICP B;  1JKW A;  1H28 B;  4CFU B;  3VYH B;  5I5Z B;  1UNG D;  3K7A M;  3A8L B;  3LQ5 B;  5CYI B;  5IDN B;  1IRE B;  1OIU B;  4BBS M;  2PHG A;  2IW9 B;  3BG3 A;  4BCN B;  1UGQ B;  3F5X B;  3EJ1 B;  2I53 A;  1OI9 B;  1OKW B;  1O9K B;  4OB3 B;  2X1N B;  2DME A;  4TTH A;  1E9H B;  3MY5 B;  3DL1 A;  1H1R B;  3G33 B;  1AHJ B;  4AKG A;  1D3U B;  4BCP B;  1QMZ B;  1H25 B;  3GTM S;  3TNH B;  4BY7 X;  2UUE B;  4CFM B;  1VIN A;  2WMA B;  2QF7 A;  4OB2 B;  4CFW B;  4CXA B;  5HBE B;  1AIS B;  5LMK B;  4EOO B;  4F7N B;  4JX4 A;  2QDJ A;  3MI9 B;  2QGS A;  4EOJ B;  2WIP B;  2KR6 A;  4M6V A;  3MIA B;  1E7P A;  1UNH D;  3QYB A;  2IW6 B;  2CZ6 B;  1P5E B;  1H26 B;  3A8O B;  2UZB B;  4UN0 A;  3QXE B;  2QDY B;  1OL2 B;  2C4G B;  3TW6 A;  3QHR B;  3A8M B;  3DDP B;  1FIN B;  1URC B;  2WMB B;  1AD6 A;  5IHY A;  1QLB A;  2UZE B;  4OR5 B;  4CFN B;  3EID B;  4ROD A;  1W98 B;  4YOS A;  2ZPH B;  4F7J B;  4QSH A;  2AHJ B;  1UGP B;  4YOZ A;  2I40 B;  3RGF B;  1BU2 A;  1VOL A;  4EOP B;  3O0G D;  3HO8 A;  4II5 B;  4IMY B;  2C5N B;  1V29 B;  3NDQ A;  2IW8 B;  1H1S B;  4BCN D;  3TNW B;  1UNL D;  4NST B;  4EOL B;  4MFE A;  4BCM B;  3QYH B;  2ZCF B;  3PO3 S;  2WJ9 A;  4AKH A;  2CZ1 B;  2ZPB B;  1GUX A;  1GH6 B;  3H4C A;  5FGK B;  2W9F A;  4HNV A;  4HL4 A;  3X25 B;  3HHT B;  3HB9 A;  4EC8 B;  1VYW B;  1JOW A;  2BKZ B;  4JX5 A;  4BCI B;  1ZP2 A;  2WHB B;  3QYG B;  1H24 B;  3HBL A;  4EOI B;  2F2C A;  2ZPE B;  2DXB B;  3A8G B;  3A8H B;  2CZ7 B;  2V22 B;  3VKH A;  4BCG B;  4OGR B;  2JGZ B;  2KMG A;  4I3Z B;  1ENW A;  1F5Q B;  2UZL B;  3X28 B;  5HNB B;  3BG9 A;  3QYE A;  3TW7 A;  2C5O B;  2W9Z A;  3BLQ B;  1H4L D;  2WEV B;  4AI6 A;  3VKG A;  2D0Q B;  2G77 A;  3M03 A;  2WXV B;  1FKM A;  4BCJ B;  1C9B A;  4LOC A;  3QZ5 B;  4ELL A;  4F7L B;  1OIY B;  3DDQ B;  1XO2 A;  4EOR B;  3X24 B;  4BBR M;  2CCH B;  3POM A;  2BS4 A;  1O9K A;  2PK9 B;  3TNI B;  4F6U B;  4HNU A;  1OL1 B;  3VYG B;  1OGU B;  4ELJ A;  5HBH B;  4HLQ A;  5HVY B;  4BCM D;  4BCO B;  2C5V B;  3BLR B;  4FX3 B;  4EOQ B;  4NC6 A;  1KXU A;  2WIH B;  3TN8 B;  4CFX B;  4F6S B;  4EOM B;  5EJC A;  4MIM A;  4ZGD B;  4EOS B;  5IDP B;  2DPP B;  2CYZ B;  5HBJ B;  4BCQ B;  1G3N C;  1OKV B;  2BPM B;  1N4M A;  4EC9 B;  5DQV A;  4ROC A;  5ACB A;  2DXC B;  4MFD A;  4F7S B;  4Z6Y A;  1FVV B;  2W96 A;  2WPA B;  2PK2 A;  3DTO A;  4JX6 A;  4Y72 B;  1JST B;  1TFB A;  3DOG B;  5DQW A;  1UGS B;  4G6L B;  2BS2 A;  2R7G A;  3QWL A;  4OB0 B;  4ROE A;  2CCI B;  4CFV B;  3WVD B;  2BS3 A;  3WVE B;  4BY1 X;  2LW4 A;  2C6T B;  3BHU B;  4EOK B;  3BHV B;  5LQF B;  4F6W B;  2DD5 B;  4YOO A;  2QFZ A;  1TD6 A;  2ZZD B;  3X26 B;  2IN3 A;  4BCF B;  3B57 A;  2CZ0 B;  3DJB A;  2QQ8 A;  5BNJ B;  2C5X B;  1H1P B;  3MY1 B;  4ZGJ B;  2B9R A;  2CJM B; 
#chains in the Genus database with same CATH homology
 4HNV A;  4HL4 A;  4NC6 A;  2DD4 B;  3HHT B;  3X25 B;  3HB9 A;  2QF7 A;  4OB2 B;  4JX5 A;  3KHI A;  5EJC A;  3QYG B;  3QZ9 B;  4MIM A;  3HBL A;  4ZGD B;  2ZPG B;  4JX4 A;  4AKI A;  2QDJ A;  4FM4 B;  2DPP B;  2ZPF B;  2CYZ B;  2ZPE B;  2DXB B;  3A8G B;  4M6V A;  2KR6 A;  3A8H B;  2CZ7 B;  1E7P A;  3VKH A;  3QYB A;  2CZ6 B;  2KMG A;  3X20 B;  3A8O B;  2ZPI B;  2DXC B;  3X28 B;  4MFD A;  3BG9 A;  3HZJ A;  3QXE B;  3QYE A;  4Z6Y A;  2QDY B;  3TW7 A;  4JX6 A;  3TW6 A;  3A8M B;  4AI6 A;  3VKG A;  2D0Q B;  4HNT A;  4ZGE B;  4OB1 B;  2G77 A;  1UGS B;  2BS2 A;  3BG5 A;  1FKM A;  1QLB A;  1UGR B;  3QWL A;  4LOC A;  4OB0 B;  3VYH B;  3QZ5 B;  2ZPH B;  3WVD B;  3A8L B;  2BS3 A;  3WVE B;  4QSH A;  2AHJ B;  1IRE B;  1UGP B;  4BBS M;  3X24 B;  3BG3 A;  2DD5 B;  3HO8 A;  2QFZ A;  1UGQ B;  4BBR M;  1V29 B;  2BS4 A;  2ZZD B;  3X26 B;  4HNU A;  4OB3 B;  3VYG B;  4MFE A;  2CZ0 B;  3QYH B;  2ZCF B;  3DL1 A;  4ELJ A;  2WJ9 A;  4AKH A;  2QQ8 A;  2CZ1 B;  1AHJ B;  4AKG A;  2ZPB B;  4HLQ A;  4ZGJ B;  3H4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...