2KMGA

The structure of the klca and ardb proteins show a novel fold and antirestriction activity against type i dna restriction systems in vivo but not in vitro
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFALGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords KlcA
publication title The structure of the KlcA and ArdB proteins reveals a novel fold and antirestriction activity against Type I DNA restriction systems in vivo but not in vitro
pubmed doi rcsb
source organism Bordetella pertussis
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03230 Antirestrict Antirestriction protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.120 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2kmgA00
2WJ9A 2KMGA
chains in the Genus database with same CATH superfamily
4FX3B 4BXXX 3TNHB 4CFMB 1OI9B 2PK2A 2W9ZA 3HB9A 2IW6B 2G77A 5HBHB 4BCND 1VOLA 3DDPB 4KRDB 3BG3A 3VKGA 3QZ9B 2C4GB 3TNIB 4Z6YA 4EOQB 2B9RA 2W2HA 3EIDB 1GUXB 4EOLB 4BY7X 5IF1B 1AISB 2KMGA 5BNJB 3TW7A 1E9HB 3X24B 1JSUB 1VINA 2UZEB 4BCQD 3K7AM 3HBLA 3QHRB 5LMKB 1IREB 4EOKB 3VKHA 2UUEB 5I5ZB 3BG5A 4BCJB 1C9BA 2I40B 2I53A 3HHTB 4F7NB 4OB3B 2ZPBB 3EOCB 4OB2B 2AHJB 1FKMA 5CEIB 1VYWB 2LW4A 4F6SB 2PMIB 4ELJA 2R7GA 3MI9B 3TNWB 3BHVB 3EJ1B 4F6WB 4YOZA 1P5EB 2DD4B 3NDQA 2W99A 1TFBA 4F70B 4CFUB 5IDNB 4EOMB 3A8OB 1TD6A 2ZPIB 5HVYB 4F7JB 3QWLA 3BLRB 1UNGD 2IVXA 4BCQB 1UNHD 1H1PB 3B57A 4HNVA 2QFZA 4G6LB 4EOJB 2QGSA 2WXVB 1ZP2A 3QXEB 1N4MA 2BS3A 4AI6A 4BCFB 4ROCA 3MY1B 2WIHB 4CFNB 4EONB 4ZGDB 1H4LD 1FINB 5ACBA 3TN8B 3HZJA 3DJBA 2BS4A 2CCIB 3VYHB 3A8HB 1UGRB 4Y72B 3MIAB 2PK9B 3TW6A 1AHJB 4KRCB 5HNBB 5HBJB 4CFWB 4EOSB 2CZ1B 2X1NB 1URCB 4UN0A 3BLQB 5HQ0B 4BCGB 3G33B 4BCMD 4EOPB 3F5XB 2QQ8A 3VYGB 4CRLB 1BU2A 2IW8B 5EJCA 2C5OB 1AD6A 2WFYB 2BKZB 4YOOA 1OL2B 4JX5A 2DXBB 4BBSM 2PHGA 1QLBA 1JOWA 4EORB 4OB0B 1OIYB 3X26B 1QMZB 4BCNB 3BLHB 2IW9B 4AKHA 4BCPB 2QDYB 3QHWB 4YOSA 4F6UB 4RODA 5IDPB 3BHTB 2BS2A 2DPPB 3KHIA 2CCHB 1H26B 4F7SB 5HBEB 3WVDB 5FGKB 2JGZB 2KR6A 2G9XB 2QDJA 3DL1A 1GY3B 3QYBA 1W98B 5CYIB 3X25B 5IHYA 1UNLD 4CFXB 1V29B 1GH6B 4ZGEB 3A8GB 4CFVB 1E7PA 1H27B 2ZZDB 4BCMB 4FM4B 1O9KB 1UGPB 1OKVB 4BY1X 1XO2A 4IMYB 2IN3A 1H1QB 4TTHA 2WMAB 3DOGB 1OIUB 3M03A 4LOCA 4I3ZB 3DTOA 3H4CA 2EUFA 1KXUA 2W96A 2V22B 3A8LB 1ENWA 4MIMA 3QZ5B 2C5VB 4MFEA 5L2WB 2ZPEB 1H28B 2ZPHB 2ZPGB 3QYEA 4MFDA 2ZPFB 2QF7A 4YC3B 5ICPB 4OGRB 2BPMB 3X20B 2DXCB 4CXAB 4EOIB 3A8MB 4NC6A 4BCKB 4AKIA 2UZLB 1F5QB 2PJQA 3HO8A 4CFUD 5EFQB 2WIPB 2W9FA 4HL4A 4M6VA 2WMBB 2DD5B 3O0GD 1G3NC 3PO3S 2UZDB 3RGFB 4ROEA 2ZCFB 3MY5B 3WVEB 4AKGA 3X28B 1H1RB 2CYZB 2CZ7B 5DQVA 1H1SB 4EOOB 3GTMS 4HNTA 4II5B 1OKWB 1OL1B 1O9KA 4QSHA 4HLQA 5LQFB 1D3UB 4OR5B 1H24B 3POMA 1OGUB 3BG9A 1H25B 4BCIB 4ELLA 4BBRM 4EC9B 4ZGJB 2D0QB 2UZBB 1UGQB 1FVVB 2C6TB 4F7LB 3DDQB 2C5NB 2WEVB 5DQWA 4HNUA 2WHBB 4JX4A 4BCOB 1UGSB 2DMEA 3QYGB 3LQ5B 4EC8B 3QYHB 1JSTB 4JX6A 1JKWA 2CZ0B 4OB1B 2WJ9A 2WPAB 3BHUB 4BCHB 1PKDB 2CZ6B 1GUXA 4NSTB 2C5XB 2F2CA 2CJMB
chains in the Genus database with same CATH topology
2DXCB 2DXBB 4ELJA 3A8MB 4NC6A 4AKIA 3HB9A 3HO8A 4BBSM 1QLBA 2G77A 2DD4B 4OB0B 4HL4A 4M6VA 3X26B 3BG3A 2DD5B 4AKHA 3A8OB 3VKGA 3QZ9B 2ZPIB 2QDYB 4Z6YA 2BS2A 2DPPB 3KHIA 3QWLA 3WVDB 2ZCFB 4HNVA 3WVEB 4AKGA 2QFZA 3X28B 2KR6A 2CYZB 2CZ7B 2KMGA 2QDJA 3QXEB 2BS3A 4AI6A 4HNTA 3DL1A 3QYBA 3TW7A 3X24B 4ZGDB 3X25B 4QSHA 4HLQA 1V29B 4ZGEB 3A8GB 1E7PA 3BG9A 3HBLA 2ZZDB 3HZJA 4FM4B 4BBRM 2BS4A 1UGPB 3VYHB 3A8HB 1IREB 1UGRB 4ZGJB 2D0QB 3TW6A 3VKHA 1AHJB 1UGQB 2CZ1B 3BG5A 4LOCA 4HNUA 3H4CA 4JX4A 1UGSB 3QYGB 3A8LB 3QYHB 4MIMA 3QZ5B 2QQ8A 3HHTB 4MFEA 4JX6A 4OB3B 2ZPEB 2ZPBB 3VYGB 2ZPHB 4OB2B 2AHJB 1FKMA 2ZPGB 2CZ0B 4OB1B 2WJ9A 3QYEA 4MFDA 2ZPFB 5EJCA 2QF7A 2CZ6B 4JX5A 3X20B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WJ9 A;  2KMG A; 
#chains in the Genus database with same CATH topology
 4FX3 B;  4BXX X;  3TNH B;  4CFM B;  1OI9 B;  2PK2 A;  2W9Z A;  3HB9 A;  2IW6 B;  2G77 A;  5HBH B;  4BCN D;  1VOL A;  3DDP B;  4KRD B;  3BG3 A;  3VKG A;  3QZ9 B;  2C4G B;  3TNI B;  4Z6Y A;  4EOQ B;  2B9R A;  2W2H A;  3EID B;  1GUX B;  4EOL B;  4BY7 X;  5IF1 B;  1AIS B;  2KMG A;  5BNJ B;  3TW7 A;  1E9H B;  3X24 B;  1JSU B;  1VIN A;  2UZE B;  4BCQ D;  3K7A M;  3HBL A;  3QHR B;  5LMK B;  1IRE B;  4EOK B;  3VKH A;  2UUE B;  5I5Z B;  3BG5 A;  4BCJ B;  1C9B A;  2I40 B;  2I53 A;  3HHT B;  4F7N B;  4OB3 B;  2ZPB B;  3EOC B;  4OB2 B;  2AHJ B;  1FKM A;  5CEI B;  1VYW B;  2LW4 A;  4F6S B;  2PMI B;  4ELJ A;  2R7G A;  3MI9 B;  3TNW B;  3BHV B;  3EJ1 B;  4F6W B;  4YOZ A;  1P5E B;  2DD4 B;  3NDQ A;  2W99 A;  1TFB A;  4F70 B;  4CFU B;  5IDN B;  4EOM B;  3A8O B;  1TD6 A;  2ZPI B;  5HVY B;  4F7J B;  3QWL A;  3BLR B;  1UNG D;  2IVX A;  4BCQ B;  1UNH D;  1H1P B;  3B57 A;  4HNV A;  2QFZ A;  4G6L B;  4EOJ B;  2QGS A;  2WXV B;  1ZP2 A;  3QXE B;  1N4M A;  2BS3 A;  4AI6 A;  4BCF B;  4ROC A;  3MY1 B;  2WIH B;  4CFN B;  4EON B;  4ZGD B;  1H4L D;  1FIN B;  5ACB A;  3TN8 B;  3HZJ A;  3DJB A;  2BS4 A;  2CCI B;  3VYH B;  3A8H B;  1UGR B;  4Y72 B;  3MIA B;  2PK9 B;  3TW6 A;  1AHJ B;  4KRC B;  5HNB B;  5HBJ B;  4CFW B;  4EOS B;  2CZ1 B;  2X1N B;  1URC B;  4UN0 A;  3BLQ B;  5HQ0 B;  4BCG B;  3G33 B;  4BCM D;  4EOP B;  3F5X B;  2QQ8 A;  3VYG B;  4CRL B;  1BU2 A;  2IW8 B;  5EJC A;  2C5O B;  1AD6 A;  2WFY B;  2BKZ B;  4YOO A;  1OL2 B;  4JX5 A;  2DXB B;  4BBS M;  2PHG A;  1QLB A;  1JOW A;  4EOR B;  4OB0 B;  1OIY B;  3X26 B;  1QMZ B;  4BCN B;  3BLH B;  2IW9 B;  4AKH A;  4BCP B;  2QDY B;  3QHW B;  4YOS A;  4F6U B;  4ROD A;  5IDP B;  3BHT B;  2BS2 A;  2DPP B;  3KHI A;  2CCH B;  1H26 B;  4F7S B;  5HBE B;  3WVD B;  5FGK B;  2JGZ B;  2KR6 A;  2G9X B;  2QDJ A;  3DL1 A;  1GY3 B;  3QYB A;  1W98 B;  5CYI B;  3X25 B;  5IHY A;  1UNL D;  4CFX B;  1V29 B;  1GH6 B;  4ZGE B;  3A8G B;  4CFV B;  1E7P A;  1H27 B;  2ZZD B;  4BCM B;  4FM4 B;  1O9K B;  1UGP B;  1OKV B;  4BY1 X;  1XO2 A;  4IMY B;  2IN3 A;  1H1Q B;  4TTH A;  2WMA B;  3DOG B;  1OIU B;  3M03 A;  4LOC A;  4I3Z B;  3DTO A;  3H4C A;  2EUF A;  1KXU A;  2W96 A;  2V22 B;  3A8L B;  1ENW A;  4MIM A;  3QZ5 B;  2C5V B;  4MFE A;  5L2W B;  2ZPE B;  1H28 B;  2ZPH B;  2ZPG B;  3QYE A;  4MFD A;  2ZPF B;  2QF7 A;  4YC3 B;  5ICP B;  4OGR B;  2BPM B;  3X20 B;  2DXC B;  4CXA B;  4EOI B;  3A8M B;  4NC6 A;  4BCK B;  4AKI A;  2UZL B;  1F5Q B;  2PJQ A;  3HO8 A;  4CFU D;  5EFQ B;  2WIP B;  2W9F A;  4HL4 A;  4M6V A;  2WMB B;  2DD5 B;  3O0G D;  1G3N C;  3PO3 S;  2UZD B;  3RGF B;  4ROE A;  2ZCF B;  3MY5 B;  3WVE B;  4AKG A;  3X28 B;  1H1R B;  2CYZ B;  2CZ7 B;  5DQV A;  1H1S B;  4EOO B;  3GTM S;  4HNT A;  4II5 B;  1OKW B;  1OL1 B;  1O9K A;  4QSH A;  4HLQ A;  5LQF B;  1D3U B;  4OR5 B;  1H24 B;  3POM A;  1OGU B;  3BG9 A;  1H25 B;  4BCI B;  4ELL A;  4BBR M;  4EC9 B;  4ZGJ B;  2D0Q B;  2UZB B;  1UGQ B;  1FVV B;  2C6T B;  4F7L B;  3DDQ B;  2C5N B;  2WEV B;  5DQW A;  4HNU A;  2WHB B;  4JX4 A;  4BCO B;  1UGS B;  2DME A;  3QYG B;  3LQ5 B;  4EC8 B;  3QYH B;  1JST B;  4JX6 A;  1JKW A;  2CZ0 B;  4OB1 B;  2WJ9 A;  2WPA B;  3BHU B;  4BCH B;  1PKD B;  2CZ6 B;  1GUX A;  4NST B;  2C5X B;  2F2C A;  2CJM B; 
#chains in the Genus database with same CATH homology
 2DXC B;  2DXB B;  4ELJ A;  3A8M B;  4NC6 A;  4AKI A;  3HB9 A;  3HO8 A;  4BBS M;  1QLB A;  2G77 A;  2DD4 B;  4OB0 B;  4HL4 A;  4M6V A;  3X26 B;  3BG3 A;  2DD5 B;  4AKH A;  3A8O B;  3VKG A;  3QZ9 B;  2ZPI B;  2QDY B;  4Z6Y A;  2BS2 A;  2DPP B;  3KHI A;  3QWL A;  3WVD B;  2ZCF B;  4HNV A;  3WVE B;  4AKG A;  2QFZ A;  3X28 B;  2KR6 A;  2CYZ B;  2CZ7 B;  2KMG A;  2QDJ A;  3QXE B;  2BS3 A;  4AI6 A;  4HNT A;  3DL1 A;  3QYB A;  3TW7 A;  3X24 B;  4ZGD B;  3X25 B;  4QSH A;  4HLQ A;  1V29 B;  4ZGE B;  3A8G B;  1E7P A;  3BG9 A;  3HBL A;  2ZZD B;  3HZJ A;  4FM4 B;  4BBR M;  2BS4 A;  1UGP B;  3VYH B;  3A8H B;  1IRE B;  1UGR B;  4ZGJ B;  2D0Q B;  3TW6 A;  3VKH A;  1AHJ B;  1UGQ B;  2CZ1 B;  3BG5 A;  4LOC A;  4HNU A;  3H4C A;  4JX4 A;  1UGS B;  3QYG B;  3A8L B;  3QYH B;  4MIM A;  3QZ5 B;  2QQ8 A;  3HHT B;  4MFE A;  4JX6 A;  4OB3 B;  2ZPE B;  2ZPB B;  3VYG B;  2ZPH B;  4OB2 B;  2AHJ B;  1FKM A;  2ZPG B;  2CZ0 B;  4OB1 B;  2WJ9 A;  3QYE A;  4MFD A;  2ZPF B;  5EJC A;  2QF7 A;  2CZ6 B;  4JX5 A;  3X20 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...