2KMGA

The structure of the klca and ardb proteins show a novel fold and antirestriction activity against type i dna restriction systems in vivo but not in vitro
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
142
structure length
142
Chain Sequence
b'MNTEEQPVTASLVAEAQRLDFLPTYFGPRLMMRGEALVYAWMRRLCERYNGAYWHYYALSDGGFYMAPDLAGRLEIEVNGNGFRGELSADAAGIVATLFALGQLAAEIADTDAADALIDRYHFLRGFAAGHPEAAAIYRAID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KlcA
publication title The structure of the KlcA and ArdB proteins reveals a novel fold and antirestriction activity against Type I DNA restriction systems in vivo but not in vitro
pubmed doi rcsb
source organism Bordetella pertussis
molecule tags Gene regulation
total genus 31
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03230 Antirestrict Antirestriction protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.120 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin A; domain 1 2kmgA00
2KMGA 2WJ9A
chains in the Genus database with same CATH superfamily
4OB1B 2ZPIB 3MY1B 1H27B 4BCOB 2KMGA 1QLBA 1UGRB 2W99A 2ZPHB 1ENWA 1AHJB 2BPMB 1V29B 2WMAB 1O9KB 4EC8B 4BCJB 3A8HB 4MFDA 2W96A 3QWLA 2C5OB 4QSHA 3BHVB 4BY1X 4ZGJB 2I53A 2PK2A 1H28B 3BG3A 4HNUA 3MIAB 2ZPGB 1UNGD 4HNVA 4JX6A 4YOZA 4OB3B 3HHTB 3VYHB 4BCQD 2CZ1B 2WEVB 3KHIA 4CFVB 4ZGDB 3DJBA 1FVVB 2CYZB 1QMZB 4AKGA 2W9FA 4G6LB 3TW6A 3A8MB 4BBRM 1E9HB 2QDYB 1KXUA 1IREB 4F6WB 1ZP2A 3TNHB 3HB9A 4OB0B 4ROEA 2JGZB 5DQVA 3DOGB 3X25B 4HLQA 2WJ9A 2UZEB 3TW7A 4JX5A 4YOOA 2CZ6B 4CFMB 2ZZDB 4AI6A 2ZPEB 2WHBB 4BXXX 1OKVB 2CCIB 4OR5B 4F6UB 5HQ0B 3NDQA 5LQFB 2C6TB 2LW4A 5HBEB 1C9BA 2DD5B 2C4GB 3MY5B 2QFZA 5BNJB 3QYHB 4MIMA 2PK9B 1H1QB 3X24B 4EOIB 1AISB 5FGKB 4Z6YA 3X28B 1JKWA 4HL4A 1BU2A 4OGRB 2G9XB 3HO8A 2DD4B 3QYEA 1H24B 4EOKB 1OGUB 3H4CA 5HNBB 2R7GA 4AKIA 5ICPB 2QGSA 5L2WB 1OIYB 2G77A 1H1PB 2C5VB 4RODA 1XO2A 2UZBB 2C5NB 2IW6B 3GTMS 2D0QB 3TN8B 2QDJA 5HVYB 4CFUD 4BCHB 2DPPB 4F7LB 4F70B 4CFUB 3QZ9B 2QQ8A 1OKWB 1H1RB 3M03A 5HBJB 2BS3A 2BS4A 4BCGB 4BCQB 4ELJA 4YOSA 4CXAB 4F7SB 3QZ5B 2AHJB 4YC3B 2WFYB 3DTOA 3WVEB 4OB2B 4EOMB 4BY7X 1TFBA 2PMIB 2DXCB 1VYWB 3HZJA 1H26B 5IHYA 2CZ0B 4EONB 4BBSM 4BCMD 2C5XB 1JOWA 2WPAB 4EOSB 1TD6A 2IW9B 3QHWB 3QHRB 4BCMB 4II5B 5LMKB 1GUXA 2ZPFB 1OL2B 3QYBA 1UNLD 4I3ZB 3VKGA 4NSTB 2WIPB 4CFNB 5EJCA 2UUEB 2CJMB 3BLQB 2DXBB 3BHUB 1UNHD 2PJQA 3DDPB 4ELLA 3TNIB 1OL1B 1UGQB 1VINA 1FINB 1UGPB 5CYIB 3VKHA 3BG5A 1FKMA 1JSTB 1GH6B 3F5XB 4UN0A 4F7JB 2BKZB 1AD6A 1N4MA 5I5ZB 1H25B 4JX4A 4EOPB 2EUFA 3B57A 2V22B 4AKHA 1E7PA 1JSUB 4F6SB 2W9ZA 5EFQB 4CFWB 4EOQB 3O0GD 1PKDB 2CCHB 1G3NC 3A8OB 2IN3A 4Y72B 3X26B 3MI9B 1GUXB 1OIUB 3DDQB 1GY3B 4F7NB 4ROCA 3A8GB 5IDPB 2X1NB 2BS2A 5IF1B 2ZPBB 3TNWB 3HBLA 3POMA 3RGFB 4IMYB 2WMBB 2W2HA 1H4LD 3VYGB 3EOCB 4NC6A 4EOLB 2PHGA 3BHTB 3BG9A 2WXVB 2CZ7B 5CEIB 4EC9B 5HBHB 1H1SB 4MFEA 2IW8B 5DQWA 4EOJB 3PO3S 4EORB 1P5EB 1VOLA 1O9KA 3EJ1B 2QF7A 3G33B 1OI9B 3BLRB 3LQ5B 1URCB 2UZDB 4CRLB 2IVXA 4HNTA 2I40B 4ZGEB 3BLHB 3K7AM 1F5QB 4TTHA 5IDNB 3QXEB 4KRDB 4EOOB 2F2CA 4FM4B 2KR6A 4BCFB 4BCKB 1UGSB 2B9RA 3X20B 4M6VA 4BCND 2ZCFB 3QYGB 5ACBA 2UZLB 3DL1A 4BCPB 1D3UB 4CFXB 4LOCA 3EIDB 4FX3B 2WIHB 3WVDB 4BCIB 2DMEA 3A8LB 1W98B 4KRCB 4BCNB
chains in the Genus database with same CATH topology
4OB1B 2ZPIB 2DXCB 3HZJA 2KMGA 1QLBA 1UGRB 3A8GB 2CZ0B 2BS2A 2ZPHB 4BBSM 2DD5B 1AHJB 1V29B 2QFZA 2ZPBB 3HBLA 3QYHB 3A8HB 4MFDA 4MIMA 3VYGB 2ZPFB 3QYBA 3QWLA 4NC6A 3VKGA 4QSHA 3X24B 5EJCA 4ZGJB 4Z6YA 3BG9A 3BG3A 3X28B 2DXBB 4HNUA 4HL4A 2ZPGB 2CZ7B 3WVEB 1UGQB 2DD4B 3HO8A 4HNVA 4JX6A 3QYEA 1UGPB 4MFEA 4OB3B 3VKHA 3BG5A 3HHTB 3VYHB 1FKMA 3H4CA 2CZ1B 4AKIA 2QF7A 3KHIA 4ZGDB 2G77A 2CYZB 4HNTA 4AKGA 4ZGEB 3TW6A 3A8MB 2D0QB 4BBRM 2QDYB 2QDJA 4JX4A 1IREB 4AKHA 1E7PA 3QXEB 3HB9A 2DPPB 4FM4B 2KR6A 4OB0B 1UGSB 3QZ9B 2QQ8A 3X25B 3X20B 4M6VA 4HLQA 2ZCFB 2BS4A 2BS3A 2WJ9A 3QYGB 3DL1A 3TW7A 4ELJA 4JX5A 2CZ6B 4LOCA 2ZZDB 3WVDB 4AI6A 3QZ5B 2AHJB 2ZPEB 3A8OB 3A8LB 3X26B 4OB2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMG A;  2WJ9 A; 
#chains in the Genus database with same CATH topology
 4OB1 B;  2ZPI B;  3MY1 B;  1H27 B;  4BCO B;  2KMG A;  1QLB A;  1UGR B;  2W99 A;  2ZPH B;  1ENW A;  1AHJ B;  2BPM B;  1V29 B;  2WMA B;  1O9K B;  4EC8 B;  4BCJ B;  3A8H B;  4MFD A;  2W96 A;  3QWL A;  2C5O B;  4QSH A;  3BHV B;  4BY1 X;  4ZGJ B;  2I53 A;  2PK2 A;  1H28 B;  3BG3 A;  4HNU A;  3MIA B;  2ZPG B;  1UNG D;  4HNV A;  4JX6 A;  4YOZ A;  4OB3 B;  3HHT B;  3VYH B;  4BCQ D;  2CZ1 B;  2WEV B;  3KHI A;  4CFV B;  4ZGD B;  3DJB A;  1FVV B;  2CYZ B;  1QMZ B;  4AKG A;  2W9F A;  4G6L B;  3TW6 A;  3A8M B;  4BBR M;  1E9H B;  2QDY B;  1KXU A;  1IRE B;  4F6W B;  1ZP2 A;  3TNH B;  3HB9 A;  4OB0 B;  4ROE A;  2JGZ B;  5DQV A;  3DOG B;  3X25 B;  4HLQ A;  2WJ9 A;  2UZE B;  3TW7 A;  4JX5 A;  4YOO A;  2CZ6 B;  4CFM B;  2ZZD B;  4AI6 A;  2ZPE B;  2WHB B;  4BXX X;  1OKV B;  2CCI B;  4OR5 B;  4F6U B;  5HQ0 B;  3NDQ A;  5LQF B;  2C6T B;  2LW4 A;  5HBE B;  1C9B A;  2DD5 B;  2C4G B;  3MY5 B;  2QFZ A;  5BNJ B;  3QYH B;  4MIM A;  2PK9 B;  1H1Q B;  3X24 B;  4EOI B;  1AIS B;  5FGK B;  4Z6Y A;  3X28 B;  1JKW A;  4HL4 A;  1BU2 A;  4OGR B;  2G9X B;  3HO8 A;  2DD4 B;  3QYE A;  1H24 B;  4EOK B;  1OGU B;  3H4C A;  5HNB B;  2R7G A;  4AKI A;  5ICP B;  2QGS A;  5L2W B;  1OIY B;  2G77 A;  1H1P B;  2C5V B;  4ROD A;  1XO2 A;  2UZB B;  2C5N B;  2IW6 B;  3GTM S;  2D0Q B;  3TN8 B;  2QDJ A;  5HVY B;  4CFU D;  4BCH B;  2DPP B;  4F7L B;  4F70 B;  4CFU B;  3QZ9 B;  2QQ8 A;  1OKW B;  1H1R B;  3M03 A;  5HBJ B;  2BS3 A;  2BS4 A;  4BCG B;  4BCQ B;  4ELJ A;  4YOS A;  4CXA B;  4F7S B;  3QZ5 B;  2AHJ B;  4YC3 B;  2WFY B;  3DTO A;  3WVE B;  4OB2 B;  4EOM B;  4BY7 X;  1TFB A;  2PMI B;  2DXC B;  1VYW B;  3HZJ A;  1H26 B;  5IHY A;  2CZ0 B;  4EON B;  4BBS M;  4BCM D;  2C5X B;  1JOW A;  2WPA B;  4EOS B;  1TD6 A;  2IW9 B;  3QHW B;  3QHR B;  4BCM B;  4II5 B;  5LMK B;  1GUX A;  2ZPF B;  1OL2 B;  3QYB A;  1UNL D;  4I3Z B;  3VKG A;  4NST B;  2WIP B;  4CFN B;  5EJC A;  2UUE B;  2CJM B;  3BLQ B;  2DXB B;  3BHU B;  1UNH D;  2PJQ A;  3DDP B;  4ELL A;  3TNI B;  1OL1 B;  1UGQ B;  1VIN A;  1FIN B;  1UGP B;  5CYI B;  3VKH A;  3BG5 A;  1FKM A;  1JST B;  1GH6 B;  3F5X B;  4UN0 A;  4F7J B;  2BKZ B;  1AD6 A;  1N4M A;  5I5Z B;  1H25 B;  4JX4 A;  4EOP B;  2EUF A;  3B57 A;  2V22 B;  4AKH A;  1E7P A;  1JSU B;  4F6S B;  2W9Z A;  5EFQ B;  4CFW B;  4EOQ B;  3O0G D;  1PKD B;  2CCH B;  1G3N C;  3A8O B;  2IN3 A;  4Y72 B;  3X26 B;  3MI9 B;  1GUX B;  1OIU B;  3DDQ B;  1GY3 B;  4F7N B;  4ROC A;  3A8G B;  5IDP B;  2X1N B;  2BS2 A;  5IF1 B;  2ZPB B;  3TNW B;  3HBL A;  3POM A;  3RGF B;  4IMY B;  2WMB B;  2W2H A;  1H4L D;  3VYG B;  3EOC B;  4NC6 A;  4EOL B;  2PHG A;  3BHT B;  3BG9 A;  2WXV B;  2CZ7 B;  5CEI B;  4EC9 B;  5HBH B;  1H1S B;  4MFE A;  2IW8 B;  5DQW A;  4EOJ B;  3PO3 S;  4EOR B;  1P5E B;  1VOL A;  1O9K A;  3EJ1 B;  2QF7 A;  3G33 B;  1OI9 B;  3BLR B;  3LQ5 B;  1URC B;  2UZD B;  4CRL B;  2IVX A;  4HNT A;  2I40 B;  4ZGE B;  3BLH B;  3K7A M;  1F5Q B;  4TTH A;  5IDN B;  3QXE B;  4KRD B;  4EOO B;  2F2C A;  4FM4 B;  2KR6 A;  4BCF B;  4BCK B;  1UGS B;  2B9R A;  3X20 B;  4M6V A;  4BCN D;  2ZCF B;  3QYG B;  5ACB A;  2UZL B;  3DL1 A;  4BCP B;  1D3U B;  4CFX B;  4LOC A;  3EID B;  4FX3 B;  2WIH B;  3WVD B;  4BCI B;  2DME A;  3A8L B;  1W98 B;  4KRC B;  4BCN B; 
#chains in the Genus database with same CATH homology
 4OB1 B;  2ZPI B;  2DXC B;  3HZJ A;  2KMG A;  1QLB A;  1UGR B;  3A8G B;  2CZ0 B;  2BS2 A;  2ZPH B;  4BBS M;  2DD5 B;  1AHJ B;  1V29 B;  2QFZ A;  2ZPB B;  3HBL A;  3QYH B;  3A8H B;  4MFD A;  4MIM A;  3VYG B;  2ZPF B;  3QYB A;  3QWL A;  4NC6 A;  3VKG A;  4QSH A;  3X24 B;  5EJC A;  4ZGJ B;  4Z6Y A;  3BG9 A;  3BG3 A;  3X28 B;  2DXB B;  4HNU A;  4HL4 A;  2ZPG B;  2CZ7 B;  3WVE B;  1UGQ B;  2DD4 B;  3HO8 A;  4HNV A;  4JX6 A;  3QYE A;  1UGP B;  4MFE A;  4OB3 B;  3VKH A;  3BG5 A;  3HHT B;  3VYH B;  1FKM A;  3H4C A;  2CZ1 B;  4AKI A;  2QF7 A;  3KHI A;  4ZGD B;  2G77 A;  2CYZ B;  4HNT A;  4AKG A;  4ZGE B;  3TW6 A;  3A8M B;  2D0Q B;  4BBR M;  2QDY B;  2QDJ A;  4JX4 A;  1IRE B;  4AKH A;  1E7P A;  3QXE B;  3HB9 A;  2DPP B;  4FM4 B;  2KR6 A;  4OB0 B;  1UGS B;  3QZ9 B;  2QQ8 A;  3X25 B;  3X20 B;  4M6V A;  4HLQ A;  2ZCF B;  2BS4 A;  2BS3 A;  2WJ9 A;  3QYG B;  3DL1 A;  3TW7 A;  4ELJ A;  4JX5 A;  2CZ6 B;  4LOC A;  2ZZD B;  3WVD B;  4AI6 A;  3QZ5 B;  2AHJ B;  2ZPE B;  3A8O B;  3A8L B;  3X26 B;  4OB2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...