1W98B

The structural basis of cdk2 activation by cyclin e
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title The Structure of Cyclin E1/Cdk2: Implications for Cdk2 Activation and Cdk2-Independent Roles
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2004-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1w98B02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1w98B01
1N4MA 1F5QB 3EIDB 5LMKB 1FINB 1H1PB 4NSTB 3RGFB 2C5NB 4BCQD 4BCNB 5IF1B 1VOLA 1H26B 1H27B 4CFUB 1JOWA 1XO2A 2W9ZA 2PMIB 1UNLD 2W99A 1OL1B 3M03A 4I3ZB 5CEIB 4F6UB 1PKDB 3BHVB 3BLQB 3BHUB 4EOJB 5FGKB 4IMYB 2UZBB 5I5ZB 2UZDB 3QHWB 5HQ0B 4EC8B 4EOIB 1VINA 4EC9B 4BCOB 2WIHB 1H4LD 5BNJB 4BCPB 2UUEB 2IVXA 2WFYB 3TN8B 5L2WB 5LQFB 1H25B 1G3NC 2I40B 5HVYB 1D3UB 4Y72B 4F70B 4EOKB 1JKWA 4CFMB 4F6SB 4CFXB 2C5VB 1H28B 5HBJB 1P5EB 5EFQB 2W2HA 2W96A 4F7NB 1OI9B 3EOCB 4F7LB 3MY1B 3POMA 4BCMD 5CYIB 2PHGA 1E9HB 2PK2A 4KRCB 3DOGB 1C9BA 5ICPB 2W9FA 1OGUB 3BLRB 4EOQB 3BHTB 4II5B 3EJ1B 2WHBB 2C5OB 2IW9B 3MI9B 4BCND 2WMAB 3BLHB 2IW8B 1GUXA 1QMZB 1H24B 4CFUD 4EOMB 3DDPB 3MIAB 4CXAB 4BCGB 4YOZA 4YOSA 3TNHB 2C6TB 5HBHB 1OKVB 3LQ5B 4YOOA 4EOPB 1O9KA 4UN0A 4BCHB 1TFBA 4BCQB 4ELLA 1ZP2A 4EORB 2PK9B 2WPAB 2R7GA 2CJMB 4F7JB 2WEVB 1URCB 2UZLB 1OIYB 3DDQB 3TNWB 1OKWB 4F6WB 3H4CA 4G6LB 3MY5B 4BCIB 4CRLB 1GUXB 3F5XB 4F7SB 4KRDB 1AISB 3K7AM 4BCJB 4CFVB 2I53A 5IDNB 2F2CA 4EOOB 4CFWB 3G33B 2IW6B 4CFNB 2UZEB 1H1SB 1VYWB 4ROCA 2B9RA 1O9KB 2CCIB 2G9XB 2CCHB 3TNIB 5HNBB 1KXUA 3O0GD 2JGZB 4RODA 2X1NB 4YC3B 1AD6A 1UNHD 4BCFB 4BCKB 5ACBA 1JSTB 2WIPB 1UNGD 2WXVB 4EOSB 1H1QB 1BU2A 4FX3B 1JSUB 2C5XB 2QDJA 4ROEA 1OIUB 2EUFA 4ELJA 4OGRB 1W98B 1GY3B 1H1RB 1GH6B 3QHRB 2WMBB 2V22B 4BCMB 4EONB 5IDPB 4EOLB 4TTHA 1OL2B 2BKZB 2BPMB 2C4GB 1FVVB 5HBEB 4OR5B
chains in the Genus database with same CATH superfamily
1F5QB 2DXCB 1UGRB 1VOLA 3M03A 4AI6A 5FGKB 3WVEB 4IMYB 5I5ZB 3HZJA 3DL1A 1H4LD 4BCPB 5LQFB 2I40B 3BG9A 4F6SB 2QFZA 5HBJB 5EFQB 4F7NB 1OI9B 4OB1B 3EOCB 4BBSM 2CZ7B 2WJ9A 2PK2A 1E9HB 2ZPFB 3BLRB 2C5OB 3A8LB 4BCND 3BLHB 1GUXA 1H24B 4CFUD 3DDPB 1UGQB 1IREB 2ZPGB 2C6TB 1OKVB 4EOPB 4ZGDB 4BCHB 4HLQA 4ELLA 1ZP2A 2PK9B 3TW7A 2WEVB 1URCB 2UZLB 3PO3S 1OIYB 3WVDB 3DDQB 5DQVA 4F6WB 3VKHA 1QLBA 1AISB 4F7SB 4ZGJB 4EOOB 5IDNB 2F2CA 2B9RA 2CCIB 2JGZB 4YC3B 1AD6A 1UNHD 2BS4A 3B57A 1JSUB 1OIUB 1W98B 1GY3B 1H1RB 1GH6B 2LW4A 2PJQA 2WMBB 4JX6A 4BCMB 5IDPB 3TW6A 2BKZB 4OR5B 3EIDB 4NSTB 3RGFB 5IF1B 2C5NB 2BS3A 4MIMA 4HNUA 2G77A 2IN3A 5CEIB 1PKDB 4JX4A 2ZPIB 3QYBA 1VINA 4BCOB 3X20B 2UUEB 3TN8B 5L2WB 3X24B 1G3NC 1D3UB 4Y72B 4MFDA 4EOKB 1JKWA 4CFMB 2CZ6B 2PHGA 3QWLA 4KRCB 3BHTB 3EJ1B 3A8HB 2WHBB 3QZ9B 2IW9B 2DMEA 2WMAB 2IW8B 2ZCFB 3NDQA 1E7PA 3MIAB 4BCGB 4AKHA 3VKGA 4YOSA 1TFBA 4BCQB 4Z6YA 2R7GA 2CJMB 4F7JB 3VYHB 1OKWB 4G6LB 3MY5B 3F5XB 4KRDB 2ZZDB 2IW6B 4CFNB 1H1SB 2ZPEB 4ROCA 2CCHB 3O0GD 2WXVB 4FX3B 2C4GB 4ROEA 2EUFA 3QHRB 2CZ1B 1UGPB 1V29B 2V22B 4OB2B 2AHJB 1FVVB 5HBEB 4JX5A 1N4MA 4QSHA 1H1PB 2KMGA 1H26B 3X28B 1XO2A 2W99A 2DPPB 4F6UB 4OB0B 3BLQB 3BHUB 4EOJB 2UZBB 3QHWB 5HQ0B 4EC8B 4EOIB 2CYZB 3X25B 3HB9A 2IVXA 2WFYB 3QYEA 3X26B 2QQ8A 3BG5A 2KR6A 2C5VB 1H28B 2W2HA 3A8OB 3MY1B 2DXBB 4BCMD 5ICPB 1OGUB 4II5B 4BXXX 4AKGA 4EOMB 3QXEB 4CXAB 4YOZA 4OB3B 3LQ5B 4YOOA 3HHTB 2CZ0B 5IHYA 4EORB 4AKIA 4FM4B 3H4CA 4CRLB 4HNVA 4CFVB 3QZ5B 4NC6A 1FKMA 1VYWB 4HL4A 1O9KB 3TNIB 5HNBB 4RODA 2WIPB 1UNGD 2ZPBB 4HNTA 4BY7X 2C5XB 2QDJA 4EOLB 4TTHA 3VYGB 1H25B 5EJCA 3DJBA 5LMKB 1FINB 4BCQD 4BCNB 2QDYB 1H27B 2D0QB 4CFUB 1JOWA 2W9ZA 2PMIB 1UNLD 3GTMS 2QGSA 1OL1B 3BG3A 4I3ZB 1AHJB 3BHVB 2UZDB 4EC9B 2WIHB 2BS2A 5BNJB 1ENWA 5HVYB 3QYGB 4F70B 4CFXB 1P5EB 2W96A 3A8GB 4F7LB 3POMA 5CYIB 4BBRM 3DOGB 1C9BA 2W9FA 4EOQB 3MI9B 3DTOA 1QMZB 5DQWA 3A8MB 3TNHB 5HBHB 1O9KA 4UN0A 2WPAB 1TD6A 2DD5B 3TNWB 4BCIB 2DD4B 1GUXB 3K7AM 2ZPHB 3KHIA 2I53A 4BCJB 4CFWB 3QYHB 3G33B 2UZEB 2G9XB 1KXUA 4BY1X 2X1NB 4BCFB 4BCKB 4ZGEB 5ACBA 1JSTB 4EOSB 1H1QB 1BU2A 2QF7A 4ELJA 4OGRB 3HO8A 4MFEA 4EONB 4M6VA 1OL2B 1UGSB 2BPMB 4LOCA 3HBLA
chains in the Genus database with same CATH topology
1N4MA 1F5QB 3EIDB 5LMKB 1FINB 1H1PB 4NSTB 3RGFB 2C5NB 4BCQD 4BCNB 5IF1B 1VOLA 1H26B 1H27B 4CFUB 1JOWA 1XO2A 2W9ZA 2PMIB 1UNLD 2W99A 1OL1B 3M03A 4I3ZB 5CEIB 4F6UB 1PKDB 3BHVB 3BLQB 3BHUB 4EOJB 5FGKB 4IMYB 2UZBB 5I5ZB 2UZDB 3QHWB 5HQ0B 4EC8B 4EOIB 1VINA 4EC9B 4BCOB 2WIHB 1H4LD 5BNJB 4BCPB 2UUEB 2IVXA 2WFYB 3TN8B 5L2WB 5LQFB 1H25B 1G3NC 2I40B 5HVYB 1D3UB 4Y72B 4F70B 4EOKB 1JKWA 4CFMB 4F6SB 4CFXB 2C5VB 1H28B 5HBJB 1P5EB 5EFQB 2W2HA 2W96A 4F7NB 1OI9B 3EOCB 4F7LB 3MY1B 3POMA 4BCMD 5CYIB 2PHGA 1E9HB 2PK2A 4KRCB 3DOGB 1C9BA 5ICPB 2W9FA 1OGUB 3BLRB 4EOQB 3BHTB 4II5B 3EJ1B 2WHBB 2C5OB 2IW9B 3MI9B 4BCND 2WMAB 3BLHB 2IW8B 1GUXA 1QMZB 1H24B 4CFUD 4EOMB 3DDPB 3MIAB 4CXAB 4BCGB 4YOZA 4YOSA 3TNHB 2C6TB 5HBHB 1OKVB 3LQ5B 4YOOA 4EOPB 1O9KA 4UN0A 4BCHB 1TFBA 4BCQB 4ELLA 1ZP2A 4EORB 2PK9B 2WPAB 2R7GA 2CJMB 4F7JB 2WEVB 1URCB 2UZLB 1OIYB 3DDQB 3TNWB 1OKWB 4F6WB 3H4CA 4G6LB 3MY5B 4BCIB 4CRLB 1GUXB 3F5XB 4F7SB 4KRDB 1AISB 3K7AM 4BCJB 4CFVB 2I53A 5IDNB 2F2CA 4EOOB 4CFWB 3G33B 2IW6B 4CFNB 2UZEB 1H1SB 1VYWB 4ROCA 2B9RA 1O9KB 2CCIB 2G9XB 2CCHB 3TNIB 5HNBB 1KXUA 3O0GD 2JGZB 4RODA 2X1NB 4YC3B 1AD6A 1UNHD 4BCFB 4BCKB 5ACBA 1JSTB 2WIPB 1UNGD 2WXVB 4EOSB 1H1QB 1BU2A 4FX3B 1JSUB 2C5XB 2QDJA 4ROEA 1OIUB 2EUFA 4ELJA 4OGRB 1W98B 1GY3B 1H1RB 1GH6B 3QHRB 2WMBB 2V22B 4BCMB 4EONB 5IDPB 4EOLB 4TTHA 1OL2B 2BKZB 2BPMB 2C4GB 1FVVB 5HBEB 4OR5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4M A;  1F5Q B;  3EID B;  5LMK B;  1FIN B;  1H1P B;  4NST B;  3RGF B;  2C5N B;  4BCQ D;  4BCN B;  5IF1 B;  1VOL A;  1H26 B;  1H27 B;  4CFU B;  1JOW A;  1XO2 A;  2W9Z A;  2PMI B;  1UNL D;  2W99 A;  1OL1 B;  3M03 A;  4I3Z B;  5CEI B;  4F6U B;  1PKD B;  3BHV B;  3BLQ B;  3BHU B;  4EOJ B;  5FGK B;  4IMY B;  2UZB B;  5I5Z B;  2UZD B;  3QHW B;  5HQ0 B;  4EC8 B;  4EOI B;  1VIN A;  4EC9 B;  4BCO B;  2WIH B;  1H4L D;  5BNJ B;  4BCP B;  2UUE B;  2IVX A;  2WFY B;  3TN8 B;  5L2W B;  5LQF B;  1H25 B;  1G3N C;  2I40 B;  5HVY B;  1D3U B;  4Y72 B;  4F70 B;  4EOK B;  1JKW A;  4CFM B;  4F6S B;  4CFX B;  2C5V B;  1H28 B;  5HBJ B;  1P5E B;  5EFQ B;  2W2H A;  2W96 A;  4F7N B;  1OI9 B;  3EOC B;  4F7L B;  3MY1 B;  3POM A;  4BCM D;  5CYI B;  2PHG A;  1E9H B;  2PK2 A;  4KRC B;  3DOG B;  1C9B A;  5ICP B;  2W9F A;  1OGU B;  3BLR B;  4EOQ B;  3BHT B;  4II5 B;  3EJ1 B;  2WHB B;  2C5O B;  2IW9 B;  3MI9 B;  4BCN D;  2WMA B;  3BLH B;  2IW8 B;  1GUX A;  1QMZ B;  1H24 B;  4CFU D;  4EOM B;  3DDP B;  3MIA B;  4CXA B;  4BCG B;  4YOZ A;  4YOS A;  3TNH B;  2C6T B;  5HBH B;  1OKV B;  3LQ5 B;  4YOO A;  4EOP B;  1O9K A;  4UN0 A;  4BCH B;  1TFB A;  4BCQ B;  4ELL A;  1ZP2 A;  4EOR B;  2PK9 B;  2WPA B;  2R7G A;  2CJM B;  4F7J B;  2WEV B;  1URC B;  2UZL B;  1OIY B;  3DDQ B;  3TNW B;  1OKW B;  4F6W B;  3H4C A;  4G6L B;  3MY5 B;  4BCI B;  4CRL B;  1GUX B;  3F5X B;  4F7S B;  4KRD B;  1AIS B;  3K7A M;  4BCJ B;  4CFV B;  2I53 A;  5IDN B;  2F2C A;  4EOO B;  4CFW B;  3G33 B;  2IW6 B;  4CFN B;  2UZE B;  1H1S B;  1VYW B;  4ROC A;  2B9R A;  1O9K B;  2CCI B;  2G9X B;  2CCH B;  3TNI B;  5HNB B;  1KXU A;  3O0G D;  2JGZ B;  4ROD A;  2X1N B;  4YC3 B;  1AD6 A;  1UNH D;  4BCF B;  4BCK B;  5ACB A;  1JST B;  2WIP B;  1UNG D;  2WXV B;  4EOS B;  1H1Q B;  1BU2 A;  4FX3 B;  1JSU B;  2C5X B;  2QDJ A;  4ROE A;  1OIU B;  2EUF A;  4ELJ A;  4OGR B;  1W98 B;  1GY3 B;  1H1R B;  1GH6 B;  3QHR B;  2WMB B;  2V22 B;  4BCM B;  4EON B;  5IDP B;  4EOL B;  4TTH A;  1OL2 B;  2BKZ B;  2BPM B;  2C4G B;  1FVV B;  5HBE B;  4OR5 B; 
#chains in the Genus database with same CATH topology
 1F5Q B;  2DXC B;  1UGR B;  1VOL A;  3M03 A;  4AI6 A;  5FGK B;  3WVE B;  4IMY B;  5I5Z B;  3HZJ A;  3DL1 A;  1H4L D;  4BCP B;  5LQF B;  2I40 B;  3BG9 A;  4F6S B;  2QFZ A;  5HBJ B;  5EFQ B;  4F7N B;  1OI9 B;  4OB1 B;  3EOC B;  4BBS M;  2CZ7 B;  2WJ9 A;  2PK2 A;  1E9H B;  2ZPF B;  3BLR B;  2C5O B;  3A8L B;  4BCN D;  3BLH B;  1GUX A;  1H24 B;  4CFU D;  3DDP B;  1UGQ B;  1IRE B;  2ZPG B;  2C6T B;  1OKV B;  4EOP B;  4ZGD B;  4BCH B;  4HLQ A;  4ELL A;  1ZP2 A;  2PK9 B;  3TW7 A;  2WEV B;  1URC B;  2UZL B;  3PO3 S;  1OIY B;  3WVD B;  3DDQ B;  5DQV A;  4F6W B;  3VKH A;  1QLB A;  1AIS B;  4F7S B;  4ZGJ B;  4EOO B;  5IDN B;  2F2C A;  2B9R A;  2CCI B;  2JGZ B;  4YC3 B;  1AD6 A;  1UNH D;  2BS4 A;  3B57 A;  1JSU B;  1OIU B;  1W98 B;  1GY3 B;  1H1R B;  1GH6 B;  2LW4 A;  2PJQ A;  2WMB B;  4JX6 A;  4BCM B;  5IDP B;  3TW6 A;  2BKZ B;  4OR5 B;  3EID B;  4NST B;  3RGF B;  5IF1 B;  2C5N B;  2BS3 A;  4MIM A;  4HNU A;  2G77 A;  2IN3 A;  5CEI B;  1PKD B;  4JX4 A;  2ZPI B;  3QYB A;  1VIN A;  4BCO B;  3X20 B;  2UUE B;  3TN8 B;  5L2W B;  3X24 B;  1G3N C;  1D3U B;  4Y72 B;  4MFD A;  4EOK B;  1JKW A;  4CFM B;  2CZ6 B;  2PHG A;  3QWL A;  4KRC B;  3BHT B;  3EJ1 B;  3A8H B;  2WHB B;  3QZ9 B;  2IW9 B;  2DME A;  2WMA B;  2IW8 B;  2ZCF B;  3NDQ A;  1E7P A;  3MIA B;  4BCG B;  4AKH A;  3VKG A;  4YOS A;  1TFB A;  4BCQ B;  4Z6Y A;  2R7G A;  2CJM B;  4F7J B;  3VYH B;  1OKW B;  4G6L B;  3MY5 B;  3F5X B;  4KRD B;  2ZZD B;  2IW6 B;  4CFN B;  1H1S B;  2ZPE B;  4ROC A;  2CCH B;  3O0G D;  2WXV B;  4FX3 B;  2C4G B;  4ROE A;  2EUF A;  3QHR B;  2CZ1 B;  1UGP B;  1V29 B;  2V22 B;  4OB2 B;  2AHJ B;  1FVV B;  5HBE B;  4JX5 A;  1N4M A;  4QSH A;  1H1P B;  2KMG A;  1H26 B;  3X28 B;  1XO2 A;  2W99 A;  2DPP B;  4F6U B;  4OB0 B;  3BLQ B;  3BHU B;  4EOJ B;  2UZB B;  3QHW B;  5HQ0 B;  4EC8 B;  4EOI B;  2CYZ B;  3X25 B;  3HB9 A;  2IVX A;  2WFY B;  3QYE A;  3X26 B;  2QQ8 A;  3BG5 A;  2KR6 A;  2C5V B;  1H28 B;  2W2H A;  3A8O B;  3MY1 B;  2DXB B;  4BCM D;  5ICP B;  1OGU B;  4II5 B;  4BXX X;  4AKG A;  4EOM B;  3QXE B;  4CXA B;  4YOZ A;  4OB3 B;  3LQ5 B;  4YOO A;  3HHT B;  2CZ0 B;  5IHY A;  4EOR B;  4AKI A;  4FM4 B;  3H4C A;  4CRL B;  4HNV A;  4CFV B;  3QZ5 B;  4NC6 A;  1FKM A;  1VYW B;  4HL4 A;  1O9K B;  3TNI B;  5HNB B;  4ROD A;  2WIP B;  1UNG D;  2ZPB B;  4HNT A;  4BY7 X;  2C5X B;  2QDJ A;  4EOL B;  4TTH A;  3VYG B;  1H25 B;  5EJC A;  3DJB A;  5LMK B;  1FIN B;  4BCQ D;  4BCN B;  2QDY B;  1H27 B;  2D0Q B;  4CFU B;  1JOW A;  2W9Z A;  2PMI B;  1UNL D;  3GTM S;  2QGS A;  1OL1 B;  3BG3 A;  4I3Z B;  1AHJ B;  3BHV B;  2UZD B;  4EC9 B;  2WIH B;  2BS2 A;  5BNJ B;  1ENW A;  5HVY B;  3QYG B;  4F70 B;  4CFX B;  1P5E B;  2W96 A;  3A8G B;  4F7L B;  3POM A;  5CYI B;  4BBR M;  3DOG B;  1C9B A;  2W9F A;  4EOQ B;  3MI9 B;  3DTO A;  1QMZ B;  5DQW A;  3A8M B;  3TNH B;  5HBH B;  1O9K A;  4UN0 A;  2WPA B;  1TD6 A;  2DD5 B;  3TNW B;  4BCI B;  2DD4 B;  1GUX B;  3K7A M;  2ZPH B;  3KHI A;  2I53 A;  4BCJ B;  4CFW B;  3QYH B;  3G33 B;  2UZE B;  2G9X B;  1KXU A;  4BY1 X;  2X1N B;  4BCF B;  4BCK B;  4ZGE B;  5ACB A;  1JST B;  4EOS B;  1H1Q B;  1BU2 A;  2QF7 A;  4ELJ A;  4OGR B;  3HO8 A;  4MFE A;  4EON B;  4M6V A;  1OL2 B;  1UGS B;  2BPM B;  4LOC A;  3HBL A; 
#chains in the Genus database with same CATH homology
 1N4M A;  1F5Q B;  3EID B;  5LMK B;  1FIN B;  1H1P B;  4NST B;  3RGF B;  2C5N B;  4BCQ D;  4BCN B;  5IF1 B;  1VOL A;  1H26 B;  1H27 B;  4CFU B;  1JOW A;  1XO2 A;  2W9Z A;  2PMI B;  1UNL D;  2W99 A;  1OL1 B;  3M03 A;  4I3Z B;  5CEI B;  4F6U B;  1PKD B;  3BHV B;  3BLQ B;  3BHU B;  4EOJ B;  5FGK B;  4IMY B;  2UZB B;  5I5Z B;  2UZD B;  3QHW B;  5HQ0 B;  4EC8 B;  4EOI B;  1VIN A;  4EC9 B;  4BCO B;  2WIH B;  1H4L D;  5BNJ B;  4BCP B;  2UUE B;  2IVX A;  2WFY B;  3TN8 B;  5L2W B;  5LQF B;  1H25 B;  1G3N C;  2I40 B;  5HVY B;  1D3U B;  4Y72 B;  4F70 B;  4EOK B;  1JKW A;  4CFM B;  4F6S B;  4CFX B;  2C5V B;  1H28 B;  5HBJ B;  1P5E B;  5EFQ B;  2W2H A;  2W96 A;  4F7N B;  1OI9 B;  3EOC B;  4F7L B;  3MY1 B;  3POM A;  4BCM D;  5CYI B;  2PHG A;  1E9H B;  2PK2 A;  4KRC B;  3DOG B;  1C9B A;  5ICP B;  2W9F A;  1OGU B;  3BLR B;  4EOQ B;  3BHT B;  4II5 B;  3EJ1 B;  2WHB B;  2C5O B;  2IW9 B;  3MI9 B;  4BCN D;  2WMA B;  3BLH B;  2IW8 B;  1GUX A;  1QMZ B;  1H24 B;  4CFU D;  4EOM B;  3DDP B;  3MIA B;  4CXA B;  4BCG B;  4YOZ A;  4YOS A;  3TNH B;  2C6T B;  5HBH B;  1OKV B;  3LQ5 B;  4YOO A;  4EOP B;  1O9K A;  4UN0 A;  4BCH B;  1TFB A;  4BCQ B;  4ELL A;  1ZP2 A;  4EOR B;  2PK9 B;  2WPA B;  2R7G A;  2CJM B;  4F7J B;  2WEV B;  1URC B;  2UZL B;  1OIY B;  3DDQ B;  3TNW B;  1OKW B;  4F6W B;  3H4C A;  4G6L B;  3MY5 B;  4BCI B;  4CRL B;  1GUX B;  3F5X B;  4F7S B;  4KRD B;  1AIS B;  3K7A M;  4BCJ B;  4CFV B;  2I53 A;  5IDN B;  2F2C A;  4EOO B;  4CFW B;  3G33 B;  2IW6 B;  4CFN B;  2UZE B;  1H1S B;  1VYW B;  4ROC A;  2B9R A;  1O9K B;  2CCI B;  2G9X B;  2CCH B;  3TNI B;  5HNB B;  1KXU A;  3O0G D;  2JGZ B;  4ROD A;  2X1N B;  4YC3 B;  1AD6 A;  1UNH D;  4BCF B;  4BCK B;  5ACB A;  1JST B;  2WIP B;  1UNG D;  2WXV B;  4EOS B;  1H1Q B;  1BU2 A;  4FX3 B;  1JSU B;  2C5X B;  2QDJ A;  4ROE A;  1OIU B;  2EUF A;  4ELJ A;  4OGR B;  1W98 B;  1GY3 B;  1H1R B;  1GH6 B;  3QHR B;  2WMB B;  2V22 B;  4BCM B;  4EON B;  5IDP B;  4EOL B;  4TTH A;  1OL2 B;  2BKZ B;  2BPM B;  2C4G B;  1FVV B;  5HBE B;  4OR5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...