1OL1B

Cyclin a binding groove inhibitor h-cit-cit-leu-ile-(p-f-phe)-nh2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
b'VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B02
5LMKB 5HBHB 2WEVB 1G3NC 5HBJB 4NSTB 1UNGD 5CYIB 2X1NB 1FVVB 4BCPB 3DOGB 2C5VB 3EJ1B 4EOPB 2W96A 3RGFB 4CFUB 2PK2A 4BCQD 4BCMB 3EIDB 4F6SB 2UUEB 1H25B 2G9XB 2R7GA 3O0GD 4ROCA 2IW9B 3H4CA 5IDNB 4CXAB 3TNIB 4CFMB 2CCIB 3LQ5B 1O9KA 3BHTB 1QMZB 3DDPB 3G33B 4EC9B 2WIHB 4TTHA 2IW8B 4I3ZB 2EUFA 4OR5B 2C6TB 2I40B 2C4GB 2UZBB 1W98B 4Y72B 1H1RB 2BPMB 4II5B 4ELJA 1H1QB 1JOWA 2C5XB 4YOOA 4CFUD 4F6WB 1OGUB 2WMBB 4BCMD 4BCND 1KXUA 4OGRB 1C9BA 1AD6A 1O9KB 2WIPB 1H4LD 3M03A 5ACBA 1JSTB 3EOCB 1OL2B 2QDJA 1UNLD 4F7LB 2C5OB 5IDPB 1OIUB 1D3UB 4BCHB 4CRLB 4FX3B 4F7JB 2B9RA 4F6UB 1JSUB 2IW6B 2I53A 4YC3B 5FGKB 1P5EB 4YOSA 4F7NB 1TFBA 3MY1B 4YOZA 4BCNB 1ZP2A 4KRCB 2F2CA 2PK9B 4IMYB 5HBEB 1VINA 1GY3B 3MY5B 2IVXA 2PHGA 2WXVB 3TNWB 3QHRB 3TNHB 5HVYB 2WMAB 4EOMB 1OIYB 1OKVB 5EFQB 2W9ZA 4BCOB 4EOKB 5HQ0B 1F5QB 1OKWB 4EONB 2UZLB 4BCGB 4EOOB 1AISB 3F5XB 2W9FA 1JKWA 4G6LB 3BHUB 5HNBB 4BCFB 4CFNB 1H1SB 2PMIB 4EOQB 5BNJB 4EOSB 1FINB 5L2WB 4ROEA 4BCKB 5ICPB 3BLHB 1GUXA 1OI9B 1URCB 2WHBB 1BU2A 1H24B 2UZEB 3BLQB 4BCIB 4EOIB 1H27B 2CCHB 3BHVB 5IF1B 1E9HB 2C5NB 4EC8B 4KRDB 1UNHD 1PKDB 3POMA 3MI9B 2WPAB 4F70B 5LQFB 1H28B 1H26B 4CFXB 4EOLB 2WFYB 1XO2A 3BLRB 3QHWB 1GUXB 2W99A 3K7AM 1VOLA 1OL1B 3TN8B 2BKZB 2UZDB 4BCJB 2JGZB 4EORB 4RODA 1H1PB 3DDQB 5CEIB 4ELLA 5I5ZB 4CFWB 1GH6B 2CJMB 4UN0A 4F7SB 4BCQB 1VYWB 4EOJB 2V22B 4CFVB 3MIAB 2W2HA 1N4MA
chains in the Genus database with same CATH superfamily
5HBHB 4NSTB 5CYIB 3DOGB 2WJ9A 4CFUB 1H25B 3O0GD 3H4CA 3DDPB 3A8OB 2IW8B 4OR5B 2I40B 2C4GB 2UZBB 4Y72B 1H1RB 2BPMB 4II5B 4ELJA 2C5XB 4YOOA 4F6WB 2WMBB 4BCMD 1KXUA 3HB9A 3A8MB 4AI6A 1O9KB 2WIPB 1JSTB 3EOCB 1UNLD 2CZ7B 2C5OB 5IDPB 4CRLB 4FX3B 4BXXX 1FKMA 1JSUB 3X20B 1TFBA 4BCNB 4KRCB 2F2CA 2PK9B 2ZPHB 3QZ9B 5HBEB 2BS3A 3TNHB 4EOMB 5I5ZB 4EOKB 3VYHB 3HHTB 3PO3S 3TW7A 2QFZA 3BHUB 4BCFB 2PMIB 5BNJB 5L2WB 5ICPB 3BLHB 3GTMS 2WHBB 3BLQB 4MFEA 1E9HB 3X26B 1E7PA 2G77A 2DMEA 4BCJB 4JX5A 4RODA 5CEIB 1GH6B 1UGQB 2LW4A 2CZ6B 4EOJB 2W2HA 5LMKB 2DD4B 5HBJB 4ZGEB 4EOPB 2QQ8A 2ZPIB 4BCMB 3QYBA 2G9XB 2R7GA 1O9KA 4EC9B 3A8GB 4I3ZB 2EUFA 1JOWA 4HL4A 2ZZDB 2BS4A 1H4LD 3M03A 1UGSB 4HLQA 4F7JB 4OB3B 4F6UB 2IW6B 3X24B 4ZGDB 1ZP2A 1VINA 2PHGA 2WXVB 5HVYB 2WMAB 1OKWB 4BCGB 3F5XB 1JKWA 4G6LB 2DXCB 1AHJB 4OB1B 3KHIA 1BU2A 2UZEB 3A8HB 1H27B 2CCHB 3BHVB 5IF1B 4KRDB 4F70B 2ZPGB 1XO2A 3BLRB 3QHWB 1VOLA 1OL1B 4MIMA 1QLBA 3A8LB 1H1PB 3DDQB 3DL1A 2PJQA 4BY1X 1VYWB 2DD5B 5DQVA 2V22B 4CFVB 2ZPFB 3BG9A 4JX4A 3VKHA 2WEVB 1G3NC 2X1NB 4BCPB 2C5VB 3RGFB 2UUEB 4ROCA 2IW9B 4CXAB 3TNIB 3BG3A 5IHYA 1QMZB 2C6TB 1W98B 2DPPB 4BBRM 3BG5A 1H1QB 3QWLA 5EJCA 2BS2A 4OGRB 1AD6A 3QYEA 3HO8A 1OL2B 1ENWA 2QDJA 2ZCFB 2IN3A 4F7LB 4YC3B 5FGKB 4HNUA 3MY1B 4IMYB 3WVEB 1GY3B 4AKGA 3TNWB 4BY7X 3QHRB 3DTOA 5EFQB 4BCOB 4EOOB 1H1SB 4EOSB 1UGPB 2D0QB 4BCKB 1URCB 2KR6A 1H24B 3TW6A 2KMGA 4NC6A 1UNHD 3POMA 4AKHA 3MI9B 2WPAB 4CFXB 4EOLB 3WVDB 1GUXB 2W99A 3K7AM 2BKZB 2UZDB 2JGZB 4EORB 4ELLA 4HNVA 4UN0A 4LOCA 2CZ0B 3QYHB 1N4MA 1UNGD 1FVVB 3EJ1B 2W96A 4OB2B 4QSHA 2DXBB 3QXEB 3HBLA 3X28B 2PK2A 4BCQD 1IREB 3EIDB 4F6SB 5IDNB 4CFMB 2CCIB 3LQ5B 3BHTB 3G33B 2WIHB 4AKIA 4TTHA 4CFUD 1OGUB 3NDQA 4JX6A 1C9BA 2AHJB 5ACBA 1TD6A 1D3UB 1OIUB 3QYGB 4BCHB 2B9RA 1V29B 2I53A 1P5EB 4YOSA 4F7NB 4YOZA 2ZPBB 3DJBA 4HNTA 3MY5B 2IVXA 3VKGA 2QGSA 3HZJA 1OIYB 1OKVB 4EONB 2W9ZA 4ZGJB 1AISB 5HQ0B 1F5QB 1UGRB 2UZLB 2W9FA 5DQWA 2CYZB 4EOQB 5HNBB 4CFNB 1FINB 4ROEA 4BCND 4BCIB 1GUXA 1OI9B 4FM4B 4EOIB 4Z6YA 2C5NB 4EC8B 1PKDB 5LQFB 1H28B 2QDYB 1H26B 2ZPEB 2WFYB 2CZ1B 3TN8B 4BBSM 4M6VA 3X25B 3VYGB 4CFWB 2CJMB 2QF7A 3B57A 4F7SB 4BCQB 4MFDA 3QZ5B 3MIAB 4OB0B
chains in the Genus database with same CATH topology
5LMKB 5HBHB 2WEVB 1G3NC 5HBJB 4NSTB 1UNGD 5CYIB 2X1NB 1FVVB 4BCPB 3DOGB 2C5VB 3EJ1B 4EOPB 2W96A 3RGFB 4CFUB 2PK2A 4BCQD 4BCMB 3EIDB 4F6SB 2UUEB 1H25B 2G9XB 2R7GA 3O0GD 4ROCA 2IW9B 3H4CA 5IDNB 4CXAB 3TNIB 4CFMB 2CCIB 3LQ5B 1O9KA 3BHTB 1QMZB 3DDPB 3G33B 4EC9B 2WIHB 4TTHA 2IW8B 4I3ZB 2EUFA 4OR5B 2C6TB 2I40B 2C4GB 2UZBB 1W98B 4Y72B 1H1RB 2BPMB 4II5B 4ELJA 1H1QB 1JOWA 2C5XB 4YOOA 4CFUD 4F6WB 1OGUB 2WMBB 4BCMD 4BCND 1KXUA 4OGRB 1C9BA 1AD6A 1O9KB 2WIPB 1H4LD 3M03A 5ACBA 1JSTB 3EOCB 1OL2B 2QDJA 1UNLD 4F7LB 2C5OB 5IDPB 1OIUB 1D3UB 4BCHB 4CRLB 4FX3B 4F7JB 2B9RA 4F6UB 1JSUB 2IW6B 2I53A 4YC3B 5FGKB 1P5EB 4YOSA 4F7NB 1TFBA 3MY1B 4YOZA 4BCNB 1ZP2A 4KRCB 2F2CA 2PK9B 4IMYB 5HBEB 1VINA 1GY3B 3MY5B 2IVXA 2PHGA 2WXVB 3TNWB 3QHRB 3TNHB 5HVYB 2WMAB 4EOMB 1OIYB 1OKVB 5EFQB 2W9ZA 4BCOB 4EOKB 5HQ0B 1F5QB 1OKWB 4EONB 2UZLB 4BCGB 4EOOB 1AISB 3F5XB 2W9FA 1JKWA 4G6LB 3BHUB 5HNBB 4BCFB 4CFNB 1H1SB 2PMIB 4EOQB 5BNJB 4EOSB 1FINB 5L2WB 4ROEA 4BCKB 5ICPB 3BLHB 1GUXA 1OI9B 1URCB 2WHBB 1BU2A 1H24B 2UZEB 3BLQB 4BCIB 4EOIB 1H27B 2CCHB 3BHVB 5IF1B 1E9HB 2C5NB 4EC8B 4KRDB 1UNHD 1PKDB 3POMA 3MI9B 2WPAB 4F70B 5LQFB 1H28B 1H26B 4CFXB 4EOLB 2WFYB 1XO2A 3BLRB 3QHWB 1GUXB 2W99A 3K7AM 1VOLA 1OL1B 3TN8B 2BKZB 2UZDB 4BCJB 2JGZB 4EORB 4RODA 1H1PB 3DDQB 5CEIB 4ELLA 5I5ZB 4CFWB 1GH6B 2CJMB 4UN0A 4F7SB 4BCQB 1VYWB 4EOJB 2V22B 4CFVB 3MIAB 2W2HA 1N4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMK B;  5HBH B;  2WEV B;  1G3N C;  5HBJ B;  4NST B;  1UNG D;  5CYI B;  2X1N B;  1FVV B;  4BCP B;  3DOG B;  2C5V B;  3EJ1 B;  4EOP B;  2W96 A;  3RGF B;  4CFU B;  2PK2 A;  4BCQ D;  4BCM B;  3EID B;  4F6S B;  2UUE B;  1H25 B;  2G9X B;  2R7G A;  3O0G D;  4ROC A;  2IW9 B;  3H4C A;  5IDN B;  4CXA B;  3TNI B;  4CFM B;  2CCI B;  3LQ5 B;  1O9K A;  3BHT B;  1QMZ B;  3DDP B;  3G33 B;  4EC9 B;  2WIH B;  4TTH A;  2IW8 B;  4I3Z B;  2EUF A;  4OR5 B;  2C6T B;  2I40 B;  2C4G B;  2UZB B;  1W98 B;  4Y72 B;  1H1R B;  2BPM B;  4II5 B;  4ELJ A;  1H1Q B;  1JOW A;  2C5X B;  4YOO A;  4CFU D;  4F6W B;  1OGU B;  2WMB B;  4BCM D;  4BCN D;  1KXU A;  4OGR B;  1C9B A;  1AD6 A;  1O9K B;  2WIP B;  1H4L D;  3M03 A;  5ACB A;  1JST B;  3EOC B;  1OL2 B;  2QDJ A;  1UNL D;  4F7L B;  2C5O B;  5IDP B;  1OIU B;  1D3U B;  4BCH B;  4CRL B;  4FX3 B;  4F7J B;  2B9R A;  4F6U B;  1JSU B;  2IW6 B;  2I53 A;  4YC3 B;  5FGK B;  1P5E B;  4YOS A;  4F7N B;  1TFB A;  3MY1 B;  4YOZ A;  4BCN B;  1ZP2 A;  4KRC B;  2F2C A;  2PK9 B;  4IMY B;  5HBE B;  1VIN A;  1GY3 B;  3MY5 B;  2IVX A;  2PHG A;  2WXV B;  3TNW B;  3QHR B;  3TNH B;  5HVY B;  2WMA B;  4EOM B;  1OIY B;  1OKV B;  5EFQ B;  2W9Z A;  4BCO B;  4EOK B;  5HQ0 B;  1F5Q B;  1OKW B;  4EON B;  2UZL B;  4BCG B;  4EOO B;  1AIS B;  3F5X B;  2W9F A;  1JKW A;  4G6L B;  3BHU B;  5HNB B;  4BCF B;  4CFN B;  1H1S B;  2PMI B;  4EOQ B;  5BNJ B;  4EOS B;  1FIN B;  5L2W B;  4ROE A;  4BCK B;  5ICP B;  3BLH B;  1GUX A;  1OI9 B;  1URC B;  2WHB B;  1BU2 A;  1H24 B;  2UZE B;  3BLQ B;  4BCI B;  4EOI B;  1H27 B;  2CCH B;  3BHV B;  5IF1 B;  1E9H B;  2C5N B;  4EC8 B;  4KRD B;  1UNH D;  1PKD B;  3POM A;  3MI9 B;  2WPA B;  4F70 B;  5LQF B;  1H28 B;  1H26 B;  4CFX B;  4EOL B;  2WFY B;  1XO2 A;  3BLR B;  3QHW B;  1GUX B;  2W99 A;  3K7A M;  1VOL A;  1OL1 B;  3TN8 B;  2BKZ B;  2UZD B;  4BCJ B;  2JGZ B;  4EOR B;  4ROD A;  1H1P B;  3DDQ B;  5CEI B;  4ELL A;  5I5Z B;  4CFW B;  1GH6 B;  2CJM B;  4UN0 A;  4F7S B;  4BCQ B;  1VYW B;  4EOJ B;  2V22 B;  4CFV B;  3MIA B;  2W2H A;  1N4M A; 
#chains in the Genus database with same CATH topology
 5HBH B;  4NST B;  5CYI B;  3DOG B;  2WJ9 A;  4CFU B;  1H25 B;  3O0G D;  3H4C A;  3DDP B;  3A8O B;  2IW8 B;  4OR5 B;  2I40 B;  2C4G B;  2UZB B;  4Y72 B;  1H1R B;  2BPM B;  4II5 B;  4ELJ A;  2C5X B;  4YOO A;  4F6W B;  2WMB B;  4BCM D;  1KXU A;  3HB9 A;  3A8M B;  4AI6 A;  1O9K B;  2WIP B;  1JST B;  3EOC B;  1UNL D;  2CZ7 B;  2C5O B;  5IDP B;  4CRL B;  4FX3 B;  4BXX X;  1FKM A;  1JSU B;  3X20 B;  1TFB A;  4BCN B;  4KRC B;  2F2C A;  2PK9 B;  2ZPH B;  3QZ9 B;  5HBE B;  2BS3 A;  3TNH B;  4EOM B;  5I5Z B;  4EOK B;  3VYH B;  3HHT B;  3PO3 S;  3TW7 A;  2QFZ A;  3BHU B;  4BCF B;  2PMI B;  5BNJ B;  5L2W B;  5ICP B;  3BLH B;  3GTM S;  2WHB B;  3BLQ B;  4MFE A;  1E9H B;  3X26 B;  1E7P A;  2G77 A;  2DME A;  4BCJ B;  4JX5 A;  4ROD A;  5CEI B;  1GH6 B;  1UGQ B;  2LW4 A;  2CZ6 B;  4EOJ B;  2W2H A;  5LMK B;  2DD4 B;  5HBJ B;  4ZGE B;  4EOP B;  2QQ8 A;  2ZPI B;  4BCM B;  3QYB A;  2G9X B;  2R7G A;  1O9K A;  4EC9 B;  3A8G B;  4I3Z B;  2EUF A;  1JOW A;  4HL4 A;  2ZZD B;  2BS4 A;  1H4L D;  3M03 A;  1UGS B;  4HLQ A;  4F7J B;  4OB3 B;  4F6U B;  2IW6 B;  3X24 B;  4ZGD B;  1ZP2 A;  1VIN A;  2PHG A;  2WXV B;  5HVY B;  2WMA B;  1OKW B;  4BCG B;  3F5X B;  1JKW A;  4G6L B;  2DXC B;  1AHJ B;  4OB1 B;  3KHI A;  1BU2 A;  2UZE B;  3A8H B;  1H27 B;  2CCH B;  3BHV B;  5IF1 B;  4KRD B;  4F70 B;  2ZPG B;  1XO2 A;  3BLR B;  3QHW B;  1VOL A;  1OL1 B;  4MIM A;  1QLB A;  3A8L B;  1H1P B;  3DDQ B;  3DL1 A;  2PJQ A;  4BY1 X;  1VYW B;  2DD5 B;  5DQV A;  2V22 B;  4CFV B;  2ZPF B;  3BG9 A;  4JX4 A;  3VKH A;  2WEV B;  1G3N C;  2X1N B;  4BCP B;  2C5V B;  3RGF B;  2UUE B;  4ROC A;  2IW9 B;  4CXA B;  3TNI B;  3BG3 A;  5IHY A;  1QMZ B;  2C6T B;  1W98 B;  2DPP B;  4BBR M;  3BG5 A;  1H1Q B;  3QWL A;  5EJC A;  2BS2 A;  4OGR B;  1AD6 A;  3QYE A;  3HO8 A;  1OL2 B;  1ENW A;  2QDJ A;  2ZCF B;  2IN3 A;  4F7L B;  4YC3 B;  5FGK B;  4HNU A;  3MY1 B;  4IMY B;  3WVE B;  1GY3 B;  4AKG A;  3TNW B;  4BY7 X;  3QHR B;  3DTO A;  5EFQ B;  4BCO B;  4EOO B;  1H1S B;  4EOS B;  1UGP B;  2D0Q B;  4BCK B;  1URC B;  2KR6 A;  1H24 B;  3TW6 A;  2KMG A;  4NC6 A;  1UNH D;  3POM A;  4AKH A;  3MI9 B;  2WPA B;  4CFX B;  4EOL B;  3WVD B;  1GUX B;  2W99 A;  3K7A M;  2BKZ B;  2UZD B;  2JGZ B;  4EOR B;  4ELL A;  4HNV A;  4UN0 A;  4LOC A;  2CZ0 B;  3QYH B;  1N4M A;  1UNG D;  1FVV B;  3EJ1 B;  2W96 A;  4OB2 B;  4QSH A;  2DXB B;  3QXE B;  3HBL A;  3X28 B;  2PK2 A;  4BCQ D;  1IRE B;  3EID B;  4F6S B;  5IDN B;  4CFM B;  2CCI B;  3LQ5 B;  3BHT B;  3G33 B;  2WIH B;  4AKI A;  4TTH A;  4CFU D;  1OGU B;  3NDQ A;  4JX6 A;  1C9B A;  2AHJ B;  5ACB A;  1TD6 A;  1D3U B;  1OIU B;  3QYG B;  4BCH B;  2B9R A;  1V29 B;  2I53 A;  1P5E B;  4YOS A;  4F7N B;  4YOZ A;  2ZPB B;  3DJB A;  4HNT A;  3MY5 B;  2IVX A;  3VKG A;  2QGS A;  3HZJ A;  1OIY B;  1OKV B;  4EON B;  2W9Z A;  4ZGJ B;  1AIS B;  5HQ0 B;  1F5Q B;  1UGR B;  2UZL B;  2W9F A;  5DQW A;  2CYZ B;  4EOQ B;  5HNB B;  4CFN B;  1FIN B;  4ROE A;  4BCN D;  4BCI B;  1GUX A;  1OI9 B;  4FM4 B;  4EOI B;  4Z6Y A;  2C5N B;  4EC8 B;  1PKD B;  5LQF B;  1H28 B;  2QDY B;  1H26 B;  2ZPE B;  2WFY B;  2CZ1 B;  3TN8 B;  4BBS M;  4M6V A;  3X25 B;  3VYG B;  4CFW B;  2CJM B;  2QF7 A;  3B57 A;  4F7S B;  4BCQ B;  4MFD A;  3QZ5 B;  3MIA B;  4OB0 B; 
#chains in the Genus database with same CATH homology
 5LMK B;  5HBH B;  2WEV B;  1G3N C;  5HBJ B;  4NST B;  1UNG D;  5CYI B;  2X1N B;  1FVV B;  4BCP B;  3DOG B;  2C5V B;  3EJ1 B;  4EOP B;  2W96 A;  3RGF B;  4CFU B;  2PK2 A;  4BCQ D;  4BCM B;  3EID B;  4F6S B;  2UUE B;  1H25 B;  2G9X B;  2R7G A;  3O0G D;  4ROC A;  2IW9 B;  3H4C A;  5IDN B;  4CXA B;  3TNI B;  4CFM B;  2CCI B;  3LQ5 B;  1O9K A;  3BHT B;  1QMZ B;  3DDP B;  3G33 B;  4EC9 B;  2WIH B;  4TTH A;  2IW8 B;  4I3Z B;  2EUF A;  4OR5 B;  2C6T B;  2I40 B;  2C4G B;  2UZB B;  1W98 B;  4Y72 B;  1H1R B;  2BPM B;  4II5 B;  4ELJ A;  1H1Q B;  1JOW A;  2C5X B;  4YOO A;  4CFU D;  4F6W B;  1OGU B;  2WMB B;  4BCM D;  4BCN D;  1KXU A;  4OGR B;  1C9B A;  1AD6 A;  1O9K B;  2WIP B;  1H4L D;  3M03 A;  5ACB A;  1JST B;  3EOC B;  1OL2 B;  2QDJ A;  1UNL D;  4F7L B;  2C5O B;  5IDP B;  1OIU B;  1D3U B;  4BCH B;  4CRL B;  4FX3 B;  4F7J B;  2B9R A;  4F6U B;  1JSU B;  2IW6 B;  2I53 A;  4YC3 B;  5FGK B;  1P5E B;  4YOS A;  4F7N B;  1TFB A;  3MY1 B;  4YOZ A;  4BCN B;  1ZP2 A;  4KRC B;  2F2C A;  2PK9 B;  4IMY B;  5HBE B;  1VIN A;  1GY3 B;  3MY5 B;  2IVX A;  2PHG A;  2WXV B;  3TNW B;  3QHR B;  3TNH B;  5HVY B;  2WMA B;  4EOM B;  1OIY B;  1OKV B;  5EFQ B;  2W9Z A;  4BCO B;  4EOK B;  5HQ0 B;  1F5Q B;  1OKW B;  4EON B;  2UZL B;  4BCG B;  4EOO B;  1AIS B;  3F5X B;  2W9F A;  1JKW A;  4G6L B;  3BHU B;  5HNB B;  4BCF B;  4CFN B;  1H1S B;  2PMI B;  4EOQ B;  5BNJ B;  4EOS B;  1FIN B;  5L2W B;  4ROE A;  4BCK B;  5ICP B;  3BLH B;  1GUX A;  1OI9 B;  1URC B;  2WHB B;  1BU2 A;  1H24 B;  2UZE B;  3BLQ B;  4BCI B;  4EOI B;  1H27 B;  2CCH B;  3BHV B;  5IF1 B;  1E9H B;  2C5N B;  4EC8 B;  4KRD B;  1UNH D;  1PKD B;  3POM A;  3MI9 B;  2WPA B;  4F70 B;  5LQF B;  1H28 B;  1H26 B;  4CFX B;  4EOL B;  2WFY B;  1XO2 A;  3BLR B;  3QHW B;  1GUX B;  2W99 A;  3K7A M;  1VOL A;  1OL1 B;  3TN8 B;  2BKZ B;  2UZD B;  4BCJ B;  2JGZ B;  4EOR B;  4ROD A;  1H1P B;  3DDQ B;  5CEI B;  4ELL A;  5I5Z B;  4CFW B;  1GH6 B;  2CJM B;  4UN0 A;  4F7S B;  4BCQ B;  1VYW B;  4EOJ B;  2V22 B;  4CFV B;  3MIA B;  2W2H A;  1N4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...