1OL1B

Cyclin a binding groove inhibitor h-cit-cit-leu-ile-(p-f-phe)-nh2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords CELL DIVISION PROTEIN KINASE 2
total genus 88
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B02
1H24B 2CCHB 4Y72B 4EONB 1UNLD 2C5XB 3G33B 4F7LB 2W2HA 4BCOB 3H4CA 5ACBA 4EORB 2C5NB 1GY3B 5HBJB 3DDQB 3TN8B 1JSTB 3QHRB 1VOLA 1W98B 4KRDB 1G3NC 2PK2A 1OKVB 4YOSA 2C5VB 3RGFB 4ELJA 2UZBB 3TNIB 1H1SB 1P5EB 5HBHB 4UN0A 4BCHB 4EOSB 4FX3B 3M03A 3POMA 5HBEB 1OIUB 4YOZA 4BCQB 3F5XB 2V22B 5HNBB 3EJ1B 5IDNB 4OGRB 4YC3B 4ROCA 1XO2A 5BNJB 4I3ZB 4EOJB 4F6UB 2IW8B 3MI9B 1OL1B 4EOLB 4EOMB 5CYIB 4CFUD 4F7JB 1H26B 2PHGA 4G6LB 2JGZB 4BCMD 5L2WB 2EUFA 3QHWB 2IW9B 2QDJA 4BCKB 1TFBA 2WMBB 4BCPB 4F6WB 3BHUB 1FINB 4ELLA 4F7SB 4CFXB 1OL2B 3TNHB 2UUEB 1H28B 1O9KA 2C4GB 3O0GD 1F5QB 4BCFB 4YOOA 4EOIB 3EIDB 4EOKB 4II5B 4BCJB 2WIHB 1OKWB 2WMAB 4NSTB 4CXAB 3BHVB 4EC9B 1JOWA 5LMKB 5CEIB 2F2CA 3K7AM 1OIYB 4BCMB 1KXUA 4BCQD 4RODA 2CJMB 5IDPB 4CFUB 3BLQB 2C5OB 1BU2A 4EOPB 2WXVB 5FGKB 2UZLB 1OI9B 4KRCB 4EC8B 1H27B 2X1NB 2IW6B 4OR5B 1H25B 4EOQB 1D3UB 2UZDB 2W9FA 2I40B 1AISB 4CFNB 1C9BA 1O9KB 3TNWB 1AD6A 2W96A 4BCGB 2BKZB 1GUXB 2W9ZA 3BLRB 2CCIB 4F70B 1JKWA 1GH6B 2BPMB 2PK9B 1H1QB 2WIPB 4CRLB 4F6SB 2B9RA 3DOGB 4BCIB 2I53A 1FVVB 5IF1B 1H1RB 2WEVB 5I5ZB 1OGUB 2IVXA 3MY5B 4TTHA 5LQFB 1GUXA 1VINA 3BLHB 3MIAB 4ROEA 1QMZB 4CFWB 2R7GA 1VYWB 5HVYB 5HQ0B 2C6TB 2G9XB 2WFYB 1UNHD 2WPAB 2UZEB 3MY1B 5EFQB 4CFVB 1H4LD 3DDPB 2PMIB 4IMYB 4F7NB 1URCB 4BCNB 2W99A 1ZP2A 2WHBB 4BCND 4CFMB 5ICPB 1JSUB 1E9HB 1PKDB 3BHTB 4EOOB 3LQ5B 1UNGD 3EOCB 1H1PB 1N4MA
chains in the Genus database with same CATH superfamily
2CCHB 3G33B 4BCOB 4MFEA 1E7PA 3X28B 4YOSA 2UZBB 3QYHB 2KMGA 4FX3B 3POMA 5HBEB 3A8HB 4HLQA 3QYEA 5IDNB 1XO2A 3KHIA 4F6UB 3MI9B 4ZGEB 5CYIB 3HZJA 1H26B 4G6LB 3DTOA 2QDYB 2IW9B 3A8MB 4QSHA 4F6WB 1FINB 2QF7A 4F7SB 4CFXB 3TNHB 3VKHA 3O0GD 1F5QB 4EOIB 3EIDB 2KR6A 3BHVB 4CXAB 5LMKB 3A8LB 1KXUA 4JX6A 4BCQD 4RODA 2QGSA 3BG9A 4HNUA 4MFDA 3QYBA 1BU2A 4EOPB 4EC8B 2X1NB 3QZ5B 2W9FA 4CFNB 1AD6A 4BBSM 3X20B 1JKWA 1GH6B 2BPMB 2PK9B 2WIPB 4CRLB 1FVVB 1TD6A 3QXEB 2IVXA 3MY5B 3TW6A 4CFWB 2R7GA 4OB1B 2WFYB 4AKHA 4BY7X 3DDPB 2PMIB 4F7NB 1URCB 4OB3B 4LOCA 3HHTB 4JX4A 4EOOB 2DXBB 1UNGD 2ZPFB 4EONB 2W2HA 4F7LB 4MIMA 5ACBA 5HBJB 1VOLA 2PK2A 1OKVB 2C5VB 3M03A 2QQ8A 3F5XB 3EJ1B 4YC3B 4ROCA 4I3ZB 4EOMB 1OL1B 4CFUD 2PHGA 4BY1X 2JGZB 2G77A 3WVDB 4BCMD 5L2WB 2ZPIB 2WMBB 3BHUB 2DD5B 1H28B 1FKMA 2BS2A 4EOKB 4II5B 4NSTB 4BCMB 5IDPB 3VYHB 3WVEB 2CYZB 3BLQB 2C5OB 3X26B 2AHJB 5FGKB 2UZLB 1H27B 1H25B 2UZDB 1O9KB 3TNWB 2W96A 4AI6A 4F6SB 2B9RA 3DOGB 2I53A 2WEVB 2QFZA 4TTHA 1UGRB 3BLHB 1IREB 2ZPEB 5HQ0B 2WPAB 1H4LD 4IMYB 4BCNB 2W99A 1AHJB 4BBRM 1JSUB 1E9HB 3EOCB 1H1PB 1N4MA 1H24B 2C5XB 5IHYA 1UGQB 4EORB 1GY3B 4NC6A 1JSTB 3QHRB 1W98B 3HB9A 1H1SB 5HBHB 2BS4A 4EOSB 2IN3A 4AKIA 2D0QB 2V22B 5DQVA 5HNBB 4OGRB 3A8OB 4EOJB 4EOLB 3QZ9B 2EUFA 2QDJA 3BG5A 1QLBA 4BCKB 4BCPB 1ENWA 3VKGA 4ELLA 4ZGDB 1OL2B 1O9KA 2C4GB 4YOOA 2WIHB 1OKWB 2WMAB 5CEIB 2F2CA 2CJMB 3HO8A 2WXVB 1OI9B 2CZ6B 2IW6B 2ZZDB 5DQWA 3BG3A 1UGSB 2DMEA 2I40B 1AISB 1C9BA 3PO3S 2BKZB 2W9ZA 3BLRB 2CCIB 4BCIB 5IF1B 3HBLA 5I5ZB 3VYGB 2ZCFB 4ROEA 2CZ0B 1VYWB 2G9XB 2CZ1B 1UNHD 3MY1B 4AKGA 2ZPBB 4BCND 3QWLA 4CFMB 5ICPB 3BHTB 3LQ5B 4BXXX 4Y72B 1UNLD 3H4CA 4ZGJB 2C5NB 2DPPB 3TN8B 4HL4A 2DXCB 4KRDB 1G3NC 3RGFB 4ELJA 4M6VA 3TNIB 4HNTA 1P5EB 4UN0A 1V29B 4BCHB 3TW7A 3DJBA 1OIUB 4YOZA 4BCQB 4OB0B 1UGPB 4FM4B 5BNJB 2IW8B 4F7JB 3QYGB 2ZPHB 4HNVA 2DD4B 3QHWB 4Z6YA 1TFBA 3DL1A 3B57A 3GTMS 2ZPGB 2UUEB 4JX5A 2LW4A 4BCFB 4BCJB 4OB2B 4EC9B 1JOWA 3K7AM 1OIYB 2WJ9A 4CFUB 4KRCB 4OR5B 3X24B 4EOQB 1D3UB 2CZ7B 5EJCA 3X25B 4BCGB 2BS3A 1GUXB 4F70B 1H1QB 1H1RB 1OGUB 5LQFB 1GUXA 1VINA 3MIAB 2PJQA 1QMZB 5HVYB 2C6TB 3A8GB 2UZEB 3NDQA 5EFQB 4CFVB 1ZP2A 2WHBB 1PKDB 3DDQB
chains in the Genus database with same CATH topology
1H24B 2CCHB 4Y72B 4EONB 1UNLD 2C5XB 3G33B 4F7LB 2W2HA 4BCOB 3H4CA 5ACBA 4EORB 2C5NB 1GY3B 5HBJB 3DDQB 3TN8B 1JSTB 3QHRB 1VOLA 1W98B 4KRDB 1G3NC 2PK2A 1OKVB 4YOSA 2C5VB 3RGFB 4ELJA 2UZBB 3TNIB 1H1SB 1P5EB 5HBHB 4UN0A 4BCHB 4EOSB 4FX3B 3M03A 3POMA 5HBEB 1OIUB 4YOZA 4BCQB 3F5XB 2V22B 5HNBB 3EJ1B 5IDNB 4OGRB 4YC3B 4ROCA 1XO2A 5BNJB 4I3ZB 4EOJB 4F6UB 2IW8B 3MI9B 1OL1B 4EOLB 4EOMB 5CYIB 4CFUD 4F7JB 1H26B 2PHGA 4G6LB 2JGZB 4BCMD 5L2WB 2EUFA 3QHWB 2IW9B 2QDJA 4BCKB 1TFBA 2WMBB 4BCPB 4F6WB 3BHUB 1FINB 4ELLA 4F7SB 4CFXB 1OL2B 3TNHB 2UUEB 1H28B 1O9KA 2C4GB 3O0GD 1F5QB 4BCFB 4YOOA 4EOIB 3EIDB 4EOKB 4II5B 4BCJB 2WIHB 1OKWB 2WMAB 4NSTB 4CXAB 3BHVB 4EC9B 1JOWA 5LMKB 5CEIB 2F2CA 3K7AM 1OIYB 4BCMB 1KXUA 4BCQD 4RODA 2CJMB 5IDPB 4CFUB 3BLQB 2C5OB 1BU2A 4EOPB 2WXVB 5FGKB 2UZLB 1OI9B 4KRCB 4EC8B 1H27B 2X1NB 2IW6B 4OR5B 1H25B 4EOQB 1D3UB 2UZDB 2W9FA 2I40B 1AISB 4CFNB 1C9BA 1O9KB 3TNWB 1AD6A 2W96A 4BCGB 2BKZB 1GUXB 2W9ZA 3BLRB 2CCIB 4F70B 1JKWA 1GH6B 2BPMB 2PK9B 1H1QB 2WIPB 4CRLB 4F6SB 2B9RA 3DOGB 4BCIB 2I53A 1FVVB 5IF1B 1H1RB 2WEVB 5I5ZB 1OGUB 2IVXA 3MY5B 4TTHA 5LQFB 1GUXA 1VINA 3BLHB 3MIAB 4ROEA 1QMZB 4CFWB 2R7GA 1VYWB 5HVYB 5HQ0B 2C6TB 2G9XB 2WFYB 1UNHD 2WPAB 2UZEB 3MY1B 5EFQB 4CFVB 1H4LD 3DDPB 2PMIB 4IMYB 4F7NB 1URCB 4BCNB 2W99A 1ZP2A 2WHBB 4BCND 4CFMB 5ICPB 1JSUB 1E9HB 1PKDB 3BHTB 4EOOB 3LQ5B 1UNGD 3EOCB 1H1PB 1N4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H24 B;  2CCH B;  4Y72 B;  4EON B;  1UNL D;  2C5X B;  3G33 B;  4F7L B;  2W2H A;  4BCO B;  3H4C A;  5ACB A;  4EOR B;  2C5N B;  1GY3 B;  5HBJ B;  3DDQ B;  3TN8 B;  1JST B;  3QHR B;  1VOL A;  1W98 B;  4KRD B;  1G3N C;  2PK2 A;  1OKV B;  4YOS A;  2C5V B;  3RGF B;  4ELJ A;  2UZB B;  3TNI B;  1H1S B;  1P5E B;  5HBH B;  4UN0 A;  4BCH B;  4EOS B;  4FX3 B;  3M03 A;  3POM A;  5HBE B;  1OIU B;  4YOZ A;  4BCQ B;  3F5X B;  2V22 B;  5HNB B;  3EJ1 B;  5IDN B;  4OGR B;  4YC3 B;  4ROC A;  1XO2 A;  5BNJ B;  4I3Z B;  4EOJ B;  4F6U B;  2IW8 B;  3MI9 B;  1OL1 B;  4EOL B;  4EOM B;  5CYI B;  4CFU D;  4F7J B;  1H26 B;  2PHG A;  4G6L B;  2JGZ B;  4BCM D;  5L2W B;  2EUF A;  3QHW B;  2IW9 B;  2QDJ A;  4BCK B;  1TFB A;  2WMB B;  4BCP B;  4F6W B;  3BHU B;  1FIN B;  4ELL A;  4F7S B;  4CFX B;  1OL2 B;  3TNH B;  2UUE B;  1H28 B;  1O9K A;  2C4G B;  3O0G D;  1F5Q B;  4BCF B;  4YOO A;  4EOI B;  3EID B;  4EOK B;  4II5 B;  4BCJ B;  2WIH B;  1OKW B;  2WMA B;  4NST B;  4CXA B;  3BHV B;  4EC9 B;  1JOW A;  5LMK B;  5CEI B;  2F2C A;  3K7A M;  1OIY B;  4BCM B;  1KXU A;  4BCQ D;  4ROD A;  2CJM B;  5IDP B;  4CFU B;  3BLQ B;  2C5O B;  1BU2 A;  4EOP B;  2WXV B;  5FGK B;  2UZL B;  1OI9 B;  4KRC B;  4EC8 B;  1H27 B;  2X1N B;  2IW6 B;  4OR5 B;  1H25 B;  4EOQ B;  1D3U B;  2UZD B;  2W9F A;  2I40 B;  1AIS B;  4CFN B;  1C9B A;  1O9K B;  3TNW B;  1AD6 A;  2W96 A;  4BCG B;  2BKZ B;  1GUX B;  2W9Z A;  3BLR B;  2CCI B;  4F70 B;  1JKW A;  1GH6 B;  2BPM B;  2PK9 B;  1H1Q B;  2WIP B;  4CRL B;  4F6S B;  2B9R A;  3DOG B;  4BCI B;  2I53 A;  1FVV B;  5IF1 B;  1H1R B;  2WEV B;  5I5Z B;  1OGU B;  2IVX A;  3MY5 B;  4TTH A;  5LQF B;  1GUX A;  1VIN A;  3BLH B;  3MIA B;  4ROE A;  1QMZ B;  4CFW B;  2R7G A;  1VYW B;  5HVY B;  5HQ0 B;  2C6T B;  2G9X B;  2WFY B;  1UNH D;  2WPA B;  2UZE B;  3MY1 B;  5EFQ B;  4CFV B;  1H4L D;  3DDP B;  2PMI B;  4IMY B;  4F7N B;  1URC B;  4BCN B;  2W99 A;  1ZP2 A;  2WHB B;  4BCN D;  4CFM B;  5ICP B;  1JSU B;  1E9H B;  1PKD B;  3BHT B;  4EOO B;  3LQ5 B;  1UNG D;  3EOC B;  1H1P B;  1N4M A; 
#chains in the Genus database with same CATH topology
 2CCH B;  3G33 B;  4BCO B;  4MFE A;  1E7P A;  3X28 B;  4YOS A;  2UZB B;  3QYH B;  2KMG A;  4FX3 B;  3POM A;  5HBE B;  3A8H B;  4HLQ A;  3QYE A;  5IDN B;  1XO2 A;  3KHI A;  4F6U B;  3MI9 B;  4ZGE B;  5CYI B;  3HZJ A;  1H26 B;  4G6L B;  3DTO A;  2QDY B;  2IW9 B;  3A8M B;  4QSH A;  4F6W B;  1FIN B;  2QF7 A;  4F7S B;  4CFX B;  3TNH B;  3VKH A;  3O0G D;  1F5Q B;  4EOI B;  3EID B;  2KR6 A;  3BHV B;  4CXA B;  5LMK B;  3A8L B;  1KXU A;  4JX6 A;  4BCQ D;  4ROD A;  2QGS A;  3BG9 A;  4HNU A;  4MFD A;  3QYB A;  1BU2 A;  4EOP B;  4EC8 B;  2X1N B;  3QZ5 B;  2W9F A;  4CFN B;  1AD6 A;  4BBS M;  3X20 B;  1JKW A;  1GH6 B;  2BPM B;  2PK9 B;  2WIP B;  4CRL B;  1FVV B;  1TD6 A;  3QXE B;  2IVX A;  3MY5 B;  3TW6 A;  4CFW B;  2R7G A;  4OB1 B;  2WFY B;  4AKH A;  4BY7 X;  3DDP B;  2PMI B;  4F7N B;  1URC B;  4OB3 B;  4LOC A;  3HHT B;  4JX4 A;  4EOO B;  2DXB B;  1UNG D;  2ZPF B;  4EON B;  2W2H A;  4F7L B;  4MIM A;  5ACB A;  5HBJ B;  1VOL A;  2PK2 A;  1OKV B;  2C5V B;  3M03 A;  2QQ8 A;  3F5X B;  3EJ1 B;  4YC3 B;  4ROC A;  4I3Z B;  4EOM B;  1OL1 B;  4CFU D;  2PHG A;  4BY1 X;  2JGZ B;  2G77 A;  3WVD B;  4BCM D;  5L2W B;  2ZPI B;  2WMB B;  3BHU B;  2DD5 B;  1H28 B;  1FKM A;  2BS2 A;  4EOK B;  4II5 B;  4NST B;  4BCM B;  5IDP B;  3VYH B;  3WVE B;  2CYZ B;  3BLQ B;  2C5O B;  3X26 B;  2AHJ B;  5FGK B;  2UZL B;  1H27 B;  1H25 B;  2UZD B;  1O9K B;  3TNW B;  2W96 A;  4AI6 A;  4F6S B;  2B9R A;  3DOG B;  2I53 A;  2WEV B;  2QFZ A;  4TTH A;  1UGR B;  3BLH B;  1IRE B;  2ZPE B;  5HQ0 B;  2WPA B;  1H4L D;  4IMY B;  4BCN B;  2W99 A;  1AHJ B;  4BBR M;  1JSU B;  1E9H B;  3EOC B;  1H1P B;  1N4M A;  1H24 B;  2C5X B;  5IHY A;  1UGQ B;  4EOR B;  1GY3 B;  4NC6 A;  1JST B;  3QHR B;  1W98 B;  3HB9 A;  1H1S B;  5HBH B;  2BS4 A;  4EOS B;  2IN3 A;  4AKI A;  2D0Q B;  2V22 B;  5DQV A;  5HNB B;  4OGR B;  3A8O B;  4EOJ B;  4EOL B;  3QZ9 B;  2EUF A;  2QDJ A;  3BG5 A;  1QLB A;  4BCK B;  4BCP B;  1ENW A;  3VKG A;  4ELL A;  4ZGD B;  1OL2 B;  1O9K A;  2C4G B;  4YOO A;  2WIH B;  1OKW B;  2WMA B;  5CEI B;  2F2C A;  2CJM B;  3HO8 A;  2WXV B;  1OI9 B;  2CZ6 B;  2IW6 B;  2ZZD B;  5DQW A;  3BG3 A;  1UGS B;  2DME A;  2I40 B;  1AIS B;  1C9B A;  3PO3 S;  2BKZ B;  2W9Z A;  3BLR B;  2CCI B;  4BCI B;  5IF1 B;  3HBL A;  5I5Z B;  3VYG B;  2ZCF B;  4ROE A;  2CZ0 B;  1VYW B;  2G9X B;  2CZ1 B;  1UNH D;  3MY1 B;  4AKG A;  2ZPB B;  4BCN D;  3QWL A;  4CFM B;  5ICP B;  3BHT B;  3LQ5 B;  4BXX X;  4Y72 B;  1UNL D;  3H4C A;  4ZGJ B;  2C5N B;  2DPP B;  3TN8 B;  4HL4 A;  2DXC B;  4KRD B;  1G3N C;  3RGF B;  4ELJ A;  4M6V A;  3TNI B;  4HNT A;  1P5E B;  4UN0 A;  1V29 B;  4BCH B;  3TW7 A;  3DJB A;  1OIU B;  4YOZ A;  4BCQ B;  4OB0 B;  1UGP B;  4FM4 B;  5BNJ B;  2IW8 B;  4F7J B;  3QYG B;  2ZPH B;  4HNV A;  2DD4 B;  3QHW B;  4Z6Y A;  1TFB A;  3DL1 A;  3B57 A;  3GTM S;  2ZPG B;  2UUE B;  4JX5 A;  2LW4 A;  4BCF B;  4BCJ B;  4OB2 B;  4EC9 B;  1JOW A;  3K7A M;  1OIY B;  2WJ9 A;  4CFU B;  4KRC B;  4OR5 B;  3X24 B;  4EOQ B;  1D3U B;  2CZ7 B;  5EJC A;  3X25 B;  4BCG B;  2BS3 A;  1GUX B;  4F70 B;  1H1Q B;  1H1R B;  1OGU B;  5LQF B;  1GUX A;  1VIN A;  3MIA B;  2PJQ A;  1QMZ B;  5HVY B;  2C6T B;  3A8G B;  2UZE B;  3NDQ A;  5EFQ B;  4CFV B;  1ZP2 A;  2WHB B;  1PKD B;  3DDQ B; 
#chains in the Genus database with same CATH homology
 1H24 B;  2CCH B;  4Y72 B;  4EON B;  1UNL D;  2C5X B;  3G33 B;  4F7L B;  2W2H A;  4BCO B;  3H4C A;  5ACB A;  4EOR B;  2C5N B;  1GY3 B;  5HBJ B;  3DDQ B;  3TN8 B;  1JST B;  3QHR B;  1VOL A;  1W98 B;  4KRD B;  1G3N C;  2PK2 A;  1OKV B;  4YOS A;  2C5V B;  3RGF B;  4ELJ A;  2UZB B;  3TNI B;  1H1S B;  1P5E B;  5HBH B;  4UN0 A;  4BCH B;  4EOS B;  4FX3 B;  3M03 A;  3POM A;  5HBE B;  1OIU B;  4YOZ A;  4BCQ B;  3F5X B;  2V22 B;  5HNB B;  3EJ1 B;  5IDN B;  4OGR B;  4YC3 B;  4ROC A;  1XO2 A;  5BNJ B;  4I3Z B;  4EOJ B;  4F6U B;  2IW8 B;  3MI9 B;  1OL1 B;  4EOL B;  4EOM B;  5CYI B;  4CFU D;  4F7J B;  1H26 B;  2PHG A;  4G6L B;  2JGZ B;  4BCM D;  5L2W B;  2EUF A;  3QHW B;  2IW9 B;  2QDJ A;  4BCK B;  1TFB A;  2WMB B;  4BCP B;  4F6W B;  3BHU B;  1FIN B;  4ELL A;  4F7S B;  4CFX B;  1OL2 B;  3TNH B;  2UUE B;  1H28 B;  1O9K A;  2C4G B;  3O0G D;  1F5Q B;  4BCF B;  4YOO A;  4EOI B;  3EID B;  4EOK B;  4II5 B;  4BCJ B;  2WIH B;  1OKW B;  2WMA B;  4NST B;  4CXA B;  3BHV B;  4EC9 B;  1JOW A;  5LMK B;  5CEI B;  2F2C A;  3K7A M;  1OIY B;  4BCM B;  1KXU A;  4BCQ D;  4ROD A;  2CJM B;  5IDP B;  4CFU B;  3BLQ B;  2C5O B;  1BU2 A;  4EOP B;  2WXV B;  5FGK B;  2UZL B;  1OI9 B;  4KRC B;  4EC8 B;  1H27 B;  2X1N B;  2IW6 B;  4OR5 B;  1H25 B;  4EOQ B;  1D3U B;  2UZD B;  2W9F A;  2I40 B;  1AIS B;  4CFN B;  1C9B A;  1O9K B;  3TNW B;  1AD6 A;  2W96 A;  4BCG B;  2BKZ B;  1GUX B;  2W9Z A;  3BLR B;  2CCI B;  4F70 B;  1JKW A;  1GH6 B;  2BPM B;  2PK9 B;  1H1Q B;  2WIP B;  4CRL B;  4F6S B;  2B9R A;  3DOG B;  4BCI B;  2I53 A;  1FVV B;  5IF1 B;  1H1R B;  2WEV B;  5I5Z B;  1OGU B;  2IVX A;  3MY5 B;  4TTH A;  5LQF B;  1GUX A;  1VIN A;  3BLH B;  3MIA B;  4ROE A;  1QMZ B;  4CFW B;  2R7G A;  1VYW B;  5HVY B;  5HQ0 B;  2C6T B;  2G9X B;  2WFY B;  1UNH D;  2WPA B;  2UZE B;  3MY1 B;  5EFQ B;  4CFV B;  1H4L D;  3DDP B;  2PMI B;  4IMY B;  4F7N B;  1URC B;  4BCN B;  2W99 A;  1ZP2 A;  2WHB B;  4BCN D;  4CFM B;  5ICP B;  1JSU B;  1E9H B;  1PKD B;  3BHT B;  4EOO B;  3LQ5 B;  1UNG D;  3EOC B;  1H1P B;  1N4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...