1OL1B

Cyclin a binding groove inhibitor h-cit-cit-leu-ile-(p-f-phe)-nh2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B02
3MI9B 2WFYB 3POMA 1VYWB 1JSTB 3EJ1B 3DDQB 3TNWB 2C4GB 4TTHA 2UZLB 4CRLB 5LMKB 2W99A 2C5XB 2CCHB 2V22B 1TFBA 4CFUB 2IW6B 2PHGA 4II5B 1GH6B 1OKVB 2C5VB 4EOLB 1XO2A 4Y72B 1KXUA 4EC9B 5IF1B 3BLRB 2WPAB 4EOPB 2PK2A 1N4MA 4UN0A 4EOJB 1H4LD 3BLHB 1OKWB 3MIAB 1G3NC 4BCNB 5ACBA 2WEVB 4I3ZB 3F5XB 1H1RB 3H4CA 2PK9B 1OGUB 4BCJB 5HVYB 2C6TB 4RODA 2BKZB 2JGZB 3MY5B 2PMIB 1OIYB 3QHWB 2IW8B 1GUXB 4F6WB 5HBHB 5L2WB 1AD6A 2WIPB 3EIDB 1OI9B 3TNIB 4IMYB 1OL1B 4NSTB 4CXAB 1H1SB 2B9RA 4EOKB 5HBJB 4CFUD 2WIHB 1GUXA 3LQ5B 4CFVB 4EOIB 4F7LB 5CYIB 1E9HB 2I53A 4BCIB 1JOWA 4F7NB 3DDPB 2WMBB 4G6LB 4F6UB 2EUFA 1JKWA 5EFQB 1H28B 1BU2A 4YC3B 4ELLA 4F7SB 3M03A 3QHRB 5IDPB 4FX3B 1GY3B 3K7AM 4EOSB 1P5EB 2WHBB 2WMAB 4BCGB 5FGKB 2W9ZA 4BCND 4CFMB 4EC8B 2QDJA 5HNBB 3MY1B 4EOMB 1H26B 4BCFB 1OIUB 3G33B 4YOZA 4BCMB 2X1NB 2F2CA 4BCQB 3BHVB 4EOQB 2WXVB 1PKDB 2CJMB 1QMZB 3TNHB 5LQFB 1OL2B 2G9XB 1D3UB 2UUEB 4BCPB 4CFWB 3DOGB 5HBEB 1FVVB 1H24B 1FINB 1UNGD 1C9BA 5IDNB 1URCB 2BPMB 4YOOA 4EOOB 1F5QB 1AISB 3BLQB 4F6SB 4F7JB 1H1QB 3EOCB 1O9KB 2IVXA 3RGFB 1UNLD 2UZEB 1H25B 5HQ0B 2W2HA 3TN8B 4KRCB 5I5ZB 3BHTB 4OGRB 5BNJB 2CCIB 4ROEA 4ROCA 2IW9B 1O9KA 4OR5B 2W96A 4ELJA 4EORB 2UZDB 4BCOB 5CEIB 1VINA 1UNHD 1W98B 2C5NB 4BCMD 4CFNB 4F70B 5ICPB 4BCKB 2UZBB 4YOSA 4BCQD 4KRDB 3O0GD 1VOLA 1JSUB 1ZP2A 2I40B 2R7GA 1H1PB 3BHUB 2W9FA 4BCHB 1H27B 4EONB 4CFXB 2C5OB
chains in the Genus database with same CATH superfamily
4HLQA 2WFYB 3POMA 3EJ1B 3HBLA 4TTHA 4LOCA 2CCHB 4CFUB 1GH6B 4EOLB 1KXUA 2KR6A 2PK2A 4EOJB 3HZJA 2BS3A 3VKGA 4AI6A 1H1RB 3H4CA 2PK9B 4QSHA 2JGZB 3A8HB 2PMIB 3X20B 2IW8B 3GTMS 1IREB 2WIPB 4IMYB 4AKIA 2ZPIB 2BS2A 3LQ5B 4F7LB 3VKHA 1TD6A 4G6LB 2EUFA 5EFQB 3TW6A 4FX3B 1GY3B 2WHBB 2WMAB 2W9ZA 4BCND 4EOMB 4HL4A 1H26B 4BCFB 2X1NB 1PKDB 4NC6A 3TNHB 5LQFB 3DOGB 1URCB 3BLQB 4F6SB 4AKGA 1H1QB 4HNTA 2D0QB 2QF7A 2ZPGB 1UNLD 2UZEB 4M6VA 3DJBA 3BHTB 3QYGB 2W96A 2CZ0B 2UZDB 2ZPHB 1UNHD 5ICPB 1JSUB 4BY7X 4EONB 4BCHB 2C5OB 2CZ7B 3DDQB 2CZ6B 4CRLB 2V22B 3TW7A 2AHJB 2QGSA 4II5B 1QLBA 3HO8A 3DTOA 3VYGB 3BLRB 1UGPB 4BCNB 5ACBA 4BCJB 3X28B 3WVEB 4RODA 1OIYB 1AD6A 1OI9B 1FKMA 1H1SB 4HNUA 5HBJB 2WIHB 4BBRM 1GUXA 5CYIB 4MIMA 1E9HB 3BG3A 2I53A 4YC3B 4OB2B 3QYBA 4CFMB 5FGKB 5HNBB 3G33B 4YOZA 3X26B 1UGSB 3BHVB 4MFDA 1QMZB 4ZGJB 2IN3A 1OL2B 1H24B 3NDQA 1UNGD 5IDNB 2ZPBB 2ZZDB 2CZ1B 4EOOB 1F5QB 1AISB 3EOCB 3VYHB 2IVXA 3RGFB 1H25B 2W2HA 3TN8B 4OGRB 4JX4A 3HB9A 4ROCA 2IW9B 1O9KA 4BCOB 1VINA 2C5NB 4CFNB 4F70B 2UZBB 4BCQD 3PO3S 1VOLA 2I40B 2R7GA 4CFXB 2W9FA 2WXVB 2PJQA 1VYWB 3TNWB 2C4GB 2W99A 2C5XB 3QWLA 2PHGA 4MFEA 1OKVB 1XO2A 4Y72B 4EC9B 5IF1B 1V29B 5DQVA 4EOPB 1N4MA 4UN0A 2WEVB 4I3ZB 2KMGA 3F5XB 2DPPB 3BG5A 2LW4A 2C6TB 3BG9A 2BKZB 2ZPEB 3QHWB 1GUXB 1UGRB 5L2WB 2B9RA 4EOKB 3QYEA 4EOIB 4BBSM 4BCIB 4BY1X 2WMBB 4FM4B 2DXCB 1JKWA 1BU2A 4ELLA 5IDPB 4BCGB 2QDJA 3MY1B 4OB1B 3X24B 3QYHB 2F2CA 4BCQB 4EOQB 2CJMB 1E7PA 2G9XB 1D3UB 1FVVB 2QFZA 3A8GB 2BPMB 1O9KB 2ZPFB 2G77A 4JX5A 5I5ZB 3X25B 3B57A 4OR5B 5CEIB 4ELJA 4EORB 4BCMD 2CYZB 4BCKB 4YOSA 3O0GD 1H1PB 3MI9B 4OB3B 1JSTB 4ZGDB 2UZLB 5LMKB 4JX6A 2ZCFB 1TFBA 2IW6B 1AHJB 4BXXX 2C5VB 5DQWA 2WPAB 1H4LD 3BLHB 1OKWB 3MIAB 1G3NC 2QDYB 3A8LB 1OGUB 5HVYB 3MY5B 3QZ9B 4F6WB 5HBHB 3EIDB 3TNIB 1OL1B 4NSTB 2QQ8A 4CXAB 5EJCA 4CFUD 4CFVB 5IHYA 4AKHA 1UGQB 1ENWA 1JOWA 4F7NB 3DDPB 4F6UB 2BS4A 1H28B 4F7SB 3M03A 3QHRB 2DXBB 4EOSB 3K7AM 1P5EB 4EC8B 1OIUB 2WJ9A 4BCMB 3KHIA 4HNVA 2UUEB 4BCPB 4CFWB 5HBEB 1FINB 1C9BA 3DL1A 2DD4B 4YOOA 4F7JB 2DD5B 4ZGEB 3A8OB 3HHTB 3WVDB 4Z6YA 5HQ0B 4KRCB 5BNJB 2CCIB 4ROEA 3QZ5B 1W98B 4OB0B 4KRDB 2DMEA 1ZP2A 3QXEB 3A8MB 3BHUB 1H27B
chains in the Genus database with same CATH topology
3MI9B 2WFYB 3POMA 1VYWB 1JSTB 3EJ1B 3DDQB 3TNWB 2C4GB 4TTHA 2UZLB 4CRLB 5LMKB 2W99A 2C5XB 2CCHB 2V22B 1TFBA 4CFUB 2IW6B 2PHGA 4II5B 1GH6B 1OKVB 2C5VB 4EOLB 1XO2A 4Y72B 1KXUA 4EC9B 5IF1B 3BLRB 2WPAB 4EOPB 2PK2A 1N4MA 4UN0A 4EOJB 1H4LD 3BLHB 1OKWB 3MIAB 1G3NC 4BCNB 5ACBA 2WEVB 4I3ZB 3F5XB 1H1RB 3H4CA 2PK9B 1OGUB 4BCJB 5HVYB 2C6TB 4RODA 2BKZB 2JGZB 3MY5B 2PMIB 1OIYB 3QHWB 2IW8B 1GUXB 4F6WB 5HBHB 5L2WB 1AD6A 2WIPB 3EIDB 1OI9B 3TNIB 4IMYB 1OL1B 4NSTB 4CXAB 1H1SB 2B9RA 4EOKB 5HBJB 4CFUD 2WIHB 1GUXA 3LQ5B 4CFVB 4EOIB 4F7LB 5CYIB 1E9HB 2I53A 4BCIB 1JOWA 4F7NB 3DDPB 2WMBB 4G6LB 4F6UB 2EUFA 1JKWA 5EFQB 1H28B 1BU2A 4YC3B 4ELLA 4F7SB 3M03A 3QHRB 5IDPB 4FX3B 1GY3B 3K7AM 4EOSB 1P5EB 2WHBB 2WMAB 4BCGB 5FGKB 2W9ZA 4BCND 4CFMB 4EC8B 2QDJA 5HNBB 3MY1B 4EOMB 1H26B 4BCFB 1OIUB 3G33B 4YOZA 4BCMB 2X1NB 2F2CA 4BCQB 3BHVB 4EOQB 2WXVB 1PKDB 2CJMB 1QMZB 3TNHB 5LQFB 1OL2B 2G9XB 1D3UB 2UUEB 4BCPB 4CFWB 3DOGB 5HBEB 1FVVB 1H24B 1FINB 1UNGD 1C9BA 5IDNB 1URCB 2BPMB 4YOOA 4EOOB 1F5QB 1AISB 3BLQB 4F6SB 4F7JB 1H1QB 3EOCB 1O9KB 2IVXA 3RGFB 1UNLD 2UZEB 1H25B 5HQ0B 2W2HA 3TN8B 4KRCB 5I5ZB 3BHTB 4OGRB 5BNJB 2CCIB 4ROEA 4ROCA 2IW9B 1O9KA 4OR5B 2W96A 4ELJA 4EORB 2UZDB 4BCOB 5CEIB 1VINA 1UNHD 1W98B 2C5NB 4BCMD 4CFNB 4F70B 5ICPB 4BCKB 2UZBB 4YOSA 4BCQD 4KRDB 3O0GD 1VOLA 1JSUB 1ZP2A 2I40B 2R7GA 1H1PB 3BHUB 2W9FA 4BCHB 1H27B 4EONB 4CFXB 2C5OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MI9 B;  2WFY B;  3POM A;  1VYW B;  1JST B;  3EJ1 B;  3DDQ B;  3TNW B;  2C4G B;  4TTH A;  2UZL B;  4CRL B;  5LMK B;  2W99 A;  2C5X B;  2CCH B;  2V22 B;  1TFB A;  4CFU B;  2IW6 B;  2PHG A;  4II5 B;  1GH6 B;  1OKV B;  2C5V B;  4EOL B;  1XO2 A;  4Y72 B;  1KXU A;  4EC9 B;  5IF1 B;  3BLR B;  2WPA B;  4EOP B;  2PK2 A;  1N4M A;  4UN0 A;  4EOJ B;  1H4L D;  3BLH B;  1OKW B;  3MIA B;  1G3N C;  4BCN B;  5ACB A;  2WEV B;  4I3Z B;  3F5X B;  1H1R B;  3H4C A;  2PK9 B;  1OGU B;  4BCJ B;  5HVY B;  2C6T B;  4ROD A;  2BKZ B;  2JGZ B;  3MY5 B;  2PMI B;  1OIY B;  3QHW B;  2IW8 B;  1GUX B;  4F6W B;  5HBH B;  5L2W B;  1AD6 A;  2WIP B;  3EID B;  1OI9 B;  3TNI B;  4IMY B;  1OL1 B;  4NST B;  4CXA B;  1H1S B;  2B9R A;  4EOK B;  5HBJ B;  4CFU D;  2WIH B;  1GUX A;  3LQ5 B;  4CFV B;  4EOI B;  4F7L B;  5CYI B;  1E9H B;  2I53 A;  4BCI B;  1JOW A;  4F7N B;  3DDP B;  2WMB B;  4G6L B;  4F6U B;  2EUF A;  1JKW A;  5EFQ B;  1H28 B;  1BU2 A;  4YC3 B;  4ELL A;  4F7S B;  3M03 A;  3QHR B;  5IDP B;  4FX3 B;  1GY3 B;  3K7A M;  4EOS B;  1P5E B;  2WHB B;  2WMA B;  4BCG B;  5FGK B;  2W9Z A;  4BCN D;  4CFM B;  4EC8 B;  2QDJ A;  5HNB B;  3MY1 B;  4EOM B;  1H26 B;  4BCF B;  1OIU B;  3G33 B;  4YOZ A;  4BCM B;  2X1N B;  2F2C A;  4BCQ B;  3BHV B;  4EOQ B;  2WXV B;  1PKD B;  2CJM B;  1QMZ B;  3TNH B;  5LQF B;  1OL2 B;  2G9X B;  1D3U B;  2UUE B;  4BCP B;  4CFW B;  3DOG B;  5HBE B;  1FVV B;  1H24 B;  1FIN B;  1UNG D;  1C9B A;  5IDN B;  1URC B;  2BPM B;  4YOO A;  4EOO B;  1F5Q B;  1AIS B;  3BLQ B;  4F6S B;  4F7J B;  1H1Q B;  3EOC B;  1O9K B;  2IVX A;  3RGF B;  1UNL D;  2UZE B;  1H25 B;  5HQ0 B;  2W2H A;  3TN8 B;  4KRC B;  5I5Z B;  3BHT B;  4OGR B;  5BNJ B;  2CCI B;  4ROE A;  4ROC A;  2IW9 B;  1O9K A;  4OR5 B;  2W96 A;  4ELJ A;  4EOR B;  2UZD B;  4BCO B;  5CEI B;  1VIN A;  1UNH D;  1W98 B;  2C5N B;  4BCM D;  4CFN B;  4F70 B;  5ICP B;  4BCK B;  2UZB B;  4YOS A;  4BCQ D;  4KRD B;  3O0G D;  1VOL A;  1JSU B;  1ZP2 A;  2I40 B;  2R7G A;  1H1P B;  3BHU B;  2W9F A;  4BCH B;  1H27 B;  4EON B;  4CFX B;  2C5O B; 
#chains in the Genus database with same CATH topology
 4HLQ A;  2WFY B;  3POM A;  3EJ1 B;  3HBL A;  4TTH A;  4LOC A;  2CCH B;  4CFU B;  1GH6 B;  4EOL B;  1KXU A;  2KR6 A;  2PK2 A;  4EOJ B;  3HZJ A;  2BS3 A;  3VKG A;  4AI6 A;  1H1R B;  3H4C A;  2PK9 B;  4QSH A;  2JGZ B;  3A8H B;  2PMI B;  3X20 B;  2IW8 B;  3GTM S;  1IRE B;  2WIP B;  4IMY B;  4AKI A;  2ZPI B;  2BS2 A;  3LQ5 B;  4F7L B;  3VKH A;  1TD6 A;  4G6L B;  2EUF A;  5EFQ B;  3TW6 A;  4FX3 B;  1GY3 B;  2WHB B;  2WMA B;  2W9Z A;  4BCN D;  4EOM B;  4HL4 A;  1H26 B;  4BCF B;  2X1N B;  1PKD B;  4NC6 A;  3TNH B;  5LQF B;  3DOG B;  1URC B;  3BLQ B;  4F6S B;  4AKG A;  1H1Q B;  4HNT A;  2D0Q B;  2QF7 A;  2ZPG B;  1UNL D;  2UZE B;  4M6V A;  3DJB A;  3BHT B;  3QYG B;  2W96 A;  2CZ0 B;  2UZD B;  2ZPH B;  1UNH D;  5ICP B;  1JSU B;  4BY7 X;  4EON B;  4BCH B;  2C5O B;  2CZ7 B;  3DDQ B;  2CZ6 B;  4CRL B;  2V22 B;  3TW7 A;  2AHJ B;  2QGS A;  4II5 B;  1QLB A;  3HO8 A;  3DTO A;  3VYG B;  3BLR B;  1UGP B;  4BCN B;  5ACB A;  4BCJ B;  3X28 B;  3WVE B;  4ROD A;  1OIY B;  1AD6 A;  1OI9 B;  1FKM A;  1H1S B;  4HNU A;  5HBJ B;  2WIH B;  4BBR M;  1GUX A;  5CYI B;  4MIM A;  1E9H B;  3BG3 A;  2I53 A;  4YC3 B;  4OB2 B;  3QYB A;  4CFM B;  5FGK B;  5HNB B;  3G33 B;  4YOZ A;  3X26 B;  1UGS B;  3BHV B;  4MFD A;  1QMZ B;  4ZGJ B;  2IN3 A;  1OL2 B;  1H24 B;  3NDQ A;  1UNG D;  5IDN B;  2ZPB B;  2ZZD B;  2CZ1 B;  4EOO B;  1F5Q B;  1AIS B;  3EOC B;  3VYH B;  2IVX A;  3RGF B;  1H25 B;  2W2H A;  3TN8 B;  4OGR B;  4JX4 A;  3HB9 A;  4ROC A;  2IW9 B;  1O9K A;  4BCO B;  1VIN A;  2C5N B;  4CFN B;  4F70 B;  2UZB B;  4BCQ D;  3PO3 S;  1VOL A;  2I40 B;  2R7G A;  4CFX B;  2W9F A;  2WXV B;  2PJQ A;  1VYW B;  3TNW B;  2C4G B;  2W99 A;  2C5X B;  3QWL A;  2PHG A;  4MFE A;  1OKV B;  1XO2 A;  4Y72 B;  4EC9 B;  5IF1 B;  1V29 B;  5DQV A;  4EOP B;  1N4M A;  4UN0 A;  2WEV B;  4I3Z B;  2KMG A;  3F5X B;  2DPP B;  3BG5 A;  2LW4 A;  2C6T B;  3BG9 A;  2BKZ B;  2ZPE B;  3QHW B;  1GUX B;  1UGR B;  5L2W B;  2B9R A;  4EOK B;  3QYE A;  4EOI B;  4BBS M;  4BCI B;  4BY1 X;  2WMB B;  4FM4 B;  2DXC B;  1JKW A;  1BU2 A;  4ELL A;  5IDP B;  4BCG B;  2QDJ A;  3MY1 B;  4OB1 B;  3X24 B;  3QYH B;  2F2C A;  4BCQ B;  4EOQ B;  2CJM B;  1E7P A;  2G9X B;  1D3U B;  1FVV B;  2QFZ A;  3A8G B;  2BPM B;  1O9K B;  2ZPF B;  2G77 A;  4JX5 A;  5I5Z B;  3X25 B;  3B57 A;  4OR5 B;  5CEI B;  4ELJ A;  4EOR B;  4BCM D;  2CYZ B;  4BCK B;  4YOS A;  3O0G D;  1H1P B;  3MI9 B;  4OB3 B;  1JST B;  4ZGD B;  2UZL B;  5LMK B;  4JX6 A;  2ZCF B;  1TFB A;  2IW6 B;  1AHJ B;  4BXX X;  2C5V B;  5DQW A;  2WPA B;  1H4L D;  3BLH B;  1OKW B;  3MIA B;  1G3N C;  2QDY B;  3A8L B;  1OGU B;  5HVY B;  3MY5 B;  3QZ9 B;  4F6W B;  5HBH B;  3EID B;  3TNI B;  1OL1 B;  4NST B;  2QQ8 A;  4CXA B;  5EJC A;  4CFU D;  4CFV B;  5IHY A;  4AKH A;  1UGQ B;  1ENW A;  1JOW A;  4F7N B;  3DDP B;  4F6U B;  2BS4 A;  1H28 B;  4F7S B;  3M03 A;  3QHR B;  2DXB B;  4EOS B;  3K7A M;  1P5E B;  4EC8 B;  1OIU B;  2WJ9 A;  4BCM B;  3KHI A;  4HNV A;  2UUE B;  4BCP B;  4CFW B;  5HBE B;  1FIN B;  1C9B A;  3DL1 A;  2DD4 B;  4YOO A;  4F7J B;  2DD5 B;  4ZGE B;  3A8O B;  3HHT B;  3WVD B;  4Z6Y A;  5HQ0 B;  4KRC B;  5BNJ B;  2CCI B;  4ROE A;  3QZ5 B;  1W98 B;  4OB0 B;  4KRD B;  2DME A;  1ZP2 A;  3QXE B;  3A8M B;  3BHU B;  1H27 B; 
#chains in the Genus database with same CATH homology
 3MI9 B;  2WFY B;  3POM A;  1VYW B;  1JST B;  3EJ1 B;  3DDQ B;  3TNW B;  2C4G B;  4TTH A;  2UZL B;  4CRL B;  5LMK B;  2W99 A;  2C5X B;  2CCH B;  2V22 B;  1TFB A;  4CFU B;  2IW6 B;  2PHG A;  4II5 B;  1GH6 B;  1OKV B;  2C5V B;  4EOL B;  1XO2 A;  4Y72 B;  1KXU A;  4EC9 B;  5IF1 B;  3BLR B;  2WPA B;  4EOP B;  2PK2 A;  1N4M A;  4UN0 A;  4EOJ B;  1H4L D;  3BLH B;  1OKW B;  3MIA B;  1G3N C;  4BCN B;  5ACB A;  2WEV B;  4I3Z B;  3F5X B;  1H1R B;  3H4C A;  2PK9 B;  1OGU B;  4BCJ B;  5HVY B;  2C6T B;  4ROD A;  2BKZ B;  2JGZ B;  3MY5 B;  2PMI B;  1OIY B;  3QHW B;  2IW8 B;  1GUX B;  4F6W B;  5HBH B;  5L2W B;  1AD6 A;  2WIP B;  3EID B;  1OI9 B;  3TNI B;  4IMY B;  1OL1 B;  4NST B;  4CXA B;  1H1S B;  2B9R A;  4EOK B;  5HBJ B;  4CFU D;  2WIH B;  1GUX A;  3LQ5 B;  4CFV B;  4EOI B;  4F7L B;  5CYI B;  1E9H B;  2I53 A;  4BCI B;  1JOW A;  4F7N B;  3DDP B;  2WMB B;  4G6L B;  4F6U B;  2EUF A;  1JKW A;  5EFQ B;  1H28 B;  1BU2 A;  4YC3 B;  4ELL A;  4F7S B;  3M03 A;  3QHR B;  5IDP B;  4FX3 B;  1GY3 B;  3K7A M;  4EOS B;  1P5E B;  2WHB B;  2WMA B;  4BCG B;  5FGK B;  2W9Z A;  4BCN D;  4CFM B;  4EC8 B;  2QDJ A;  5HNB B;  3MY1 B;  4EOM B;  1H26 B;  4BCF B;  1OIU B;  3G33 B;  4YOZ A;  4BCM B;  2X1N B;  2F2C A;  4BCQ B;  3BHV B;  4EOQ B;  2WXV B;  1PKD B;  2CJM B;  1QMZ B;  3TNH B;  5LQF B;  1OL2 B;  2G9X B;  1D3U B;  2UUE B;  4BCP B;  4CFW B;  3DOG B;  5HBE B;  1FVV B;  1H24 B;  1FIN B;  1UNG D;  1C9B A;  5IDN B;  1URC B;  2BPM B;  4YOO A;  4EOO B;  1F5Q B;  1AIS B;  3BLQ B;  4F6S B;  4F7J B;  1H1Q B;  3EOC B;  1O9K B;  2IVX A;  3RGF B;  1UNL D;  2UZE B;  1H25 B;  5HQ0 B;  2W2H A;  3TN8 B;  4KRC B;  5I5Z B;  3BHT B;  4OGR B;  5BNJ B;  2CCI B;  4ROE A;  4ROC A;  2IW9 B;  1O9K A;  4OR5 B;  2W96 A;  4ELJ A;  4EOR B;  2UZD B;  4BCO B;  5CEI B;  1VIN A;  1UNH D;  1W98 B;  2C5N B;  4BCM D;  4CFN B;  4F70 B;  5ICP B;  4BCK B;  2UZB B;  4YOS A;  4BCQ D;  4KRD B;  3O0G D;  1VOL A;  1JSU B;  1ZP2 A;  2I40 B;  2R7G A;  1H1P B;  3BHU B;  2W9F A;  4BCH B;  1H27 B;  4EON B;  4CFX B;  2C5O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...