1OL1B

Cyclin a binding groove inhibitor h-cit-cit-leu-ile-(p-f-phe)-nh2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
258
structure length
258
Chain Sequence
VPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 2
publication title Insights Into Cyclin Groove Recognition. Complex Crystal Structures and Inhibitor Design Through Ligand Exchange
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 258
sequence length 258
chains with identical sequence D
ec nomenclature
pdb deposition date 2003-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 1ol1B02
1FINB 4F7NB 1KXUA 2IW6B 1URCB 4ROCA 3K7AM 2IW9B 5CYIB 3EIDB 2WHBB 3TN8B 3H4CA 4CFVB 4BCNB 4YOSA 4EOQB 4TTHA 4CFMB 4ELLA 2I40B 1H1QB 5BNJB 4BCMB 2I53A 4YC3B 4F6WB 1QMZB 4YOOA 5HVYB 1O9KB 4BCND 1H1SB 4IMYB 2WIPB 1H25B 1H27B 4BCMD 4BCGB 4BCFB 4II5B 1G3NC 4OGRB 2W2HA 3BLRB 1AD6A 4EC8B 5HQ0B 1H28B 5IDNB 2BPMB 3G33B 4CXAB 2UZDB 3MIAB 4ROEA 3POMA 3BHTB 3DDPB 5I5ZB 2WXVB 1OIYB 4BCHB 3TNHB 1F5QB 2R7GA 3F5XB 4NSTB 4F7LB 2C5XB 1JOWA 1OI9B 3EOCB 4G6LB 2C5VB 1W98B 4F70B 4EOLB 1C9BA 4EOSB 1VOLA 3LQ5B 1UNLD 5IF1B 4RODA 2UZEB 3MY1B 2C4GB 2W9FA 2WFYB 2G9XB 1OKWB 4BCQB 2W99A 5EFQB 1H24B 1XO2A 1GUXA 1O9KA 2WEVB 3BLQB 5HNBB 4CFXB 1D3UB 4YOZA 1E9HB 2EUFA 2WIHB 2IVXA 1OKVB 4BCQD 3QHRB 5ICPB 3BHVB 4BCOB 1JKWA 1H4LD 2X1NB 3MY5B 3BLHB 3M03A 4CFWB 1UNGD 4EC9B 1N4MA 2PHGA 2BKZB 1P5EB 4FX3B 4F7JB 2PK2A 1OGUB 2V22B 4KRCB 4CFUB 3TNWB 4EONB 4ELJA 1JSTB 2UZLB 4BCKB 2F2CA 2IW8B 2CCHB 1AISB 2PK9B 5HBHB 1FVVB 4CRLB 4CFUD 5LMKB 4F6UB 2WMBB 1OL1B 2C5OB 5IDPB 3RGFB 4EOKB 1BU2A 2W9ZA 1H1PB 1H1RB 2UUEB 4EOPB 4F7SB 2PMIB 4EORB 4BCJB 5CEIB 2WPAB 2C6TB 4EOIB 5HBEB 4F6SB 4CFNB 1TFBA 4I3ZB 3QHWB 4EOOB 4Y72B 1VYWB 2UZBB 3EJ1B 3DDQB 1GH6B 5HBJB 5ACBA 4OR5B 4EOJB 1H26B 2C5NB 4EOMB 5FGKB 5LQFB 3BHUB 1GUXB 2CJMB 2W96A 1JSUB 4KRDB 2QDJA 3O0GD 5L2WB 1UNHD 2CCIB 4BCPB 2WMAB 1GY3B 1VINA 1PKDB 1OIUB 1ZP2A 4BCIB 1OL2B 2JGZB 3MI9B 2B9RA 3DOGB 4UN0A 3TNIB
chains in the Genus database with same CATH superfamily
1FINB 4ROCA 3VKGA 5CYIB 2KR6A 2WHBB 2ZPFB 2BS3A 3TW6A 4TTHA 4CFMB 2ZPEB 1H1SB 3VKHA 2WIPB 4BCMD 2W2HA 4II5B 1G3NC 3BLRB 5IDNB 2BPMB 3PO3S 2ZPIB 2CZ0B 3DDPB 1F5QB 2C5XB 2QGSA 1JOWA 3EOCB 4F70B 4EOSB 1VOLA 3BG5A 4JX6A 4OB1B 5IF1B 2UZEB 3MY1B 2G9XB 4BCQB 4BY1X 2W99A 3BLQB 1D3UB 1E9HB 2WIHB 4ZGDB 3QHRB 3BHVB 1UGPB 1H4LD 3MY5B 3M03A 1UNGD 4AKGA 1N4MA 2PHGA 4F7JB 3QWLA 1QLBA 1ENWA 4JX4A 2F2CA 1AISB 5DQWA 3X24B 5IDPB 3WVDB 3A8OB 2UUEB 1AHJB 2DMEA 2PMIB 3HO8A 4JX5A 2DXBB 5CEIB 2ZZDB 3QHWB 2IN3A 4Y72B 3A8GB 3DDQB 5HBJB 4EOJB 5LQFB 3QYBA 3GTMS 3HZJA 2CJMB 4KRDB 4HLQA 2QDJA 4MIMA 2JGZB 2B9RA 5EJCA 4ELLA 2ZPBB 3TNIB 4AI6A 4EOQB 5BNJB 1QMZB 5HVYB 4BCND 3X20B 1H25B 1H28B 3MIAB 4ROEA 5I5ZB 5DQVA 4BCHB 2QDYB 4Z6YA 4NSTB 3KHIA 4G6LB 4EOLB 4FM4B 3HHTB 3X25B 3LQ5B 1H24B 2D0QB 1GUXA 1O9KA 4HNVA 2LW4A 5HNBB 4CFXB 4OB0B 2X1NB 4CFWB 3QYGB 2BS2A 2CZ6B 4BY7X 4KRCB 4CFUB 4EONB 3A8LB 4ZGEB 1UGQB 2CYZB 1H1PB 1H1RB 3NDQA 2PJQA 3A8HB 4QSHA 5HBEB 4F6SB 4CFNB 1VYWB 2UZBB 1GH6B 2C5NB 1GUXB 3O0GD 5L2WB 4BCPB 2WMAB 1PKDB 1ZP2A 3MI9B 4UN0A 3X26B 4ZGJB 1KXUA 2IW6B 1URCB 2IW9B 3BG3A 3EIDB 3DJBA 4OB2B 4YOSA 4MFEA 4BCMB 2I53A 4YC3B 4F6WB 4YOOA 3B57A 2CZ1B 4LOCA 4BCGB 4BCFB 4EC8B 4OB3B 4CXAB 3POMA 3BHTB 3BG9A 2R7GA 3F5XB 1W98B 2AHJB 2ZPHB 1C9BA 4AKHA 4M6VA 4BXXX 1UNLD 4RODA 2C4GB 2W9FA 2WFYB 2DPPB 5EFQB 1XO2A 2WEVB 2BS4A 4YOZA 2EUFA 1OKVB 2IVXA 4BCQD 1V29B 4BCOB 1JKWA 4EC9B 4HNUA 2BKZB 4FX3B 2PK2A 2V22B 3VYHB 3TNWB 4ELJA 1JSTB 4BCKB 2QQ8A 2CCHB 4CRLB 5LMKB 1FKMA 2WMBB 3VYGB 3RGFB 1UGRB 2W9ZA 4HL4A 4F7SB 4EORB 4BCJB 2WPAB 2ZPGB 2C6TB 3DTOA 4MFDA 4EOOB 3EJ1B 3DL1A 5ACBA 2DD5B 1H26B 3BHUB 4AKIA 2CCIB 1GY3B 4BCIB 4NC6A 3DOGB 3X28B 3HB9A 4F7NB 3A8MB 3K7AM 3TN8B 3H4CA 4CFVB 4BCNB 2I40B 1H1QB 1O9KB 4IMYB 1H27B 4OGRB 1AD6A 5HQ0B 4BBRM 2QF7A 3G33B 2UZDB 1TD6A 2WXVB 1OIYB 3TNHB 4F7LB 3HBLA 2ZCFB 2G77A 1OI9B 2C5VB 3TW7A 1E7PA 2KMGA 1OKWB 3QXEB 3QZ5B 5ICPB 1IREB 3BLHB 1P5EB 5IHYA 1OGUB 2UZLB 2DXCB 2IW8B 2PK9B 5HBHB 1FVVB 4CFUD 2CZ7B 4F6UB 1OL1B 2C5OB 3QZ9B 4EOKB 1BU2A 4EOPB 3WVEB 4HNTA 4EOIB 1TFBA 4I3ZB 2WJ9A 4OR5B 4EOMB 5FGKB 3QYEA 2DD4B 2W96A 1JSUB 1UGSB 2QFZA 1UNHD 1VINA 4BBSM 1OIUB 1OL2B 3QYHB
chains in the Genus database with same CATH topology
1FINB 4F7NB 1KXUA 2IW6B 1URCB 4ROCA 3K7AM 2IW9B 5CYIB 3EIDB 2WHBB 3TN8B 3H4CA 4CFVB 4BCNB 4YOSA 4EOQB 4TTHA 4CFMB 4ELLA 2I40B 1H1QB 5BNJB 4BCMB 2I53A 4YC3B 4F6WB 1QMZB 4YOOA 5HVYB 1O9KB 4BCND 1H1SB 4IMYB 2WIPB 1H25B 1H27B 4BCMD 4BCGB 4BCFB 4II5B 1G3NC 4OGRB 2W2HA 3BLRB 1AD6A 4EC8B 5HQ0B 1H28B 5IDNB 2BPMB 3G33B 4CXAB 2UZDB 3MIAB 4ROEA 3POMA 3BHTB 3DDPB 5I5ZB 2WXVB 1OIYB 4BCHB 3TNHB 1F5QB 2R7GA 3F5XB 4NSTB 4F7LB 2C5XB 1JOWA 1OI9B 3EOCB 4G6LB 2C5VB 1W98B 4F70B 4EOLB 1C9BA 4EOSB 1VOLA 3LQ5B 1UNLD 5IF1B 4RODA 2UZEB 3MY1B 2C4GB 2W9FA 2WFYB 2G9XB 1OKWB 4BCQB 2W99A 5EFQB 1H24B 1XO2A 1GUXA 1O9KA 2WEVB 3BLQB 5HNBB 4CFXB 1D3UB 4YOZA 1E9HB 2EUFA 2WIHB 2IVXA 1OKVB 4BCQD 3QHRB 5ICPB 3BHVB 4BCOB 1JKWA 1H4LD 2X1NB 3MY5B 3BLHB 3M03A 4CFWB 1UNGD 4EC9B 1N4MA 2PHGA 2BKZB 1P5EB 4FX3B 4F7JB 2PK2A 1OGUB 2V22B 4KRCB 4CFUB 3TNWB 4EONB 4ELJA 1JSTB 2UZLB 4BCKB 2F2CA 2IW8B 2CCHB 1AISB 2PK9B 5HBHB 1FVVB 4CRLB 4CFUD 5LMKB 4F6UB 2WMBB 1OL1B 2C5OB 5IDPB 3RGFB 4EOKB 1BU2A 2W9ZA 1H1PB 1H1RB 2UUEB 4EOPB 4F7SB 2PMIB 4EORB 4BCJB 5CEIB 2WPAB 2C6TB 4EOIB 5HBEB 4F6SB 4CFNB 1TFBA 4I3ZB 3QHWB 4EOOB 4Y72B 1VYWB 2UZBB 3EJ1B 3DDQB 1GH6B 5HBJB 5ACBA 4OR5B 4EOJB 1H26B 2C5NB 4EOMB 5FGKB 5LQFB 3BHUB 1GUXB 2CJMB 2W96A 1JSUB 4KRDB 2QDJA 3O0GD 5L2WB 1UNHD 2CCIB 4BCPB 2WMAB 1GY3B 1VINA 1PKDB 1OIUB 1ZP2A 4BCIB 1OL2B 2JGZB 3MI9B 2B9RA 3DOGB 4UN0A 3TNIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIN B;  4F7N B;  1KXU A;  2IW6 B;  1URC B;  4ROC A;  3K7A M;  2IW9 B;  5CYI B;  3EID B;  2WHB B;  3TN8 B;  3H4C A;  4CFV B;  4BCN B;  4YOS A;  4EOQ B;  4TTH A;  4CFM B;  4ELL A;  2I40 B;  1H1Q B;  5BNJ B;  4BCM B;  2I53 A;  4YC3 B;  4F6W B;  1QMZ B;  4YOO A;  5HVY B;  1O9K B;  4BCN D;  1H1S B;  4IMY B;  2WIP B;  1H25 B;  1H27 B;  4BCM D;  4BCG B;  4BCF B;  4II5 B;  1G3N C;  4OGR B;  2W2H A;  3BLR B;  1AD6 A;  4EC8 B;  5HQ0 B;  1H28 B;  5IDN B;  2BPM B;  3G33 B;  4CXA B;  2UZD B;  3MIA B;  4ROE A;  3POM A;  3BHT B;  3DDP B;  5I5Z B;  2WXV B;  1OIY B;  4BCH B;  3TNH B;  1F5Q B;  2R7G A;  3F5X B;  4NST B;  4F7L B;  2C5X B;  1JOW A;  1OI9 B;  3EOC B;  4G6L B;  2C5V B;  1W98 B;  4F70 B;  4EOL B;  1C9B A;  4EOS B;  1VOL A;  3LQ5 B;  1UNL D;  5IF1 B;  4ROD A;  2UZE B;  3MY1 B;  2C4G B;  2W9F A;  2WFY B;  2G9X B;  1OKW B;  4BCQ B;  2W99 A;  5EFQ B;  1H24 B;  1XO2 A;  1GUX A;  1O9K A;  2WEV B;  3BLQ B;  5HNB B;  4CFX B;  1D3U B;  4YOZ A;  1E9H B;  2EUF A;  2WIH B;  2IVX A;  1OKV B;  4BCQ D;  3QHR B;  5ICP B;  3BHV B;  4BCO B;  1JKW A;  1H4L D;  2X1N B;  3MY5 B;  3BLH B;  3M03 A;  4CFW B;  1UNG D;  4EC9 B;  1N4M A;  2PHG A;  2BKZ B;  1P5E B;  4FX3 B;  4F7J B;  2PK2 A;  1OGU B;  2V22 B;  4KRC B;  4CFU B;  3TNW B;  4EON B;  4ELJ A;  1JST B;  2UZL B;  4BCK B;  2F2C A;  2IW8 B;  2CCH B;  1AIS B;  2PK9 B;  5HBH B;  1FVV B;  4CRL B;  4CFU D;  5LMK B;  4F6U B;  2WMB B;  1OL1 B;  2C5O B;  5IDP B;  3RGF B;  4EOK B;  1BU2 A;  2W9Z A;  1H1P B;  1H1R B;  2UUE B;  4EOP B;  4F7S B;  2PMI B;  4EOR B;  4BCJ B;  5CEI B;  2WPA B;  2C6T B;  4EOI B;  5HBE B;  4F6S B;  4CFN B;  1TFB A;  4I3Z B;  3QHW B;  4EOO B;  4Y72 B;  1VYW B;  2UZB B;  3EJ1 B;  3DDQ B;  1GH6 B;  5HBJ B;  5ACB A;  4OR5 B;  4EOJ B;  1H26 B;  2C5N B;  4EOM B;  5FGK B;  5LQF B;  3BHU B;  1GUX B;  2CJM B;  2W96 A;  1JSU B;  4KRD B;  2QDJ A;  3O0G D;  5L2W B;  1UNH D;  2CCI B;  4BCP B;  2WMA B;  1GY3 B;  1VIN A;  1PKD B;  1OIU B;  1ZP2 A;  4BCI B;  1OL2 B;  2JGZ B;  3MI9 B;  2B9R A;  3DOG B;  4UN0 A;  3TNI B; 
#chains in the Genus database with same CATH topology
 1FIN B;  4ROC A;  3VKG A;  5CYI B;  2KR6 A;  2WHB B;  2ZPF B;  2BS3 A;  3TW6 A;  4TTH A;  4CFM B;  2ZPE B;  1H1S B;  3VKH A;  2WIP B;  4BCM D;  2W2H A;  4II5 B;  1G3N C;  3BLR B;  5IDN B;  2BPM B;  3PO3 S;  2ZPI B;  2CZ0 B;  3DDP B;  1F5Q B;  2C5X B;  2QGS A;  1JOW A;  3EOC B;  4F70 B;  4EOS B;  1VOL A;  3BG5 A;  4JX6 A;  4OB1 B;  5IF1 B;  2UZE B;  3MY1 B;  2G9X B;  4BCQ B;  4BY1 X;  2W99 A;  3BLQ B;  1D3U B;  1E9H B;  2WIH B;  4ZGD B;  3QHR B;  3BHV B;  1UGP B;  1H4L D;  3MY5 B;  3M03 A;  1UNG D;  4AKG A;  1N4M A;  2PHG A;  4F7J B;  3QWL A;  1QLB A;  1ENW A;  4JX4 A;  2F2C A;  1AIS B;  5DQW A;  3X24 B;  5IDP B;  3WVD B;  3A8O B;  2UUE B;  1AHJ B;  2DME A;  2PMI B;  3HO8 A;  4JX5 A;  2DXB B;  5CEI B;  2ZZD B;  3QHW B;  2IN3 A;  4Y72 B;  3A8G B;  3DDQ B;  5HBJ B;  4EOJ B;  5LQF B;  3QYB A;  3GTM S;  3HZJ A;  2CJM B;  4KRD B;  4HLQ A;  2QDJ A;  4MIM A;  2JGZ B;  2B9R A;  5EJC A;  4ELL A;  2ZPB B;  3TNI B;  4AI6 A;  4EOQ B;  5BNJ B;  1QMZ B;  5HVY B;  4BCN D;  3X20 B;  1H25 B;  1H28 B;  3MIA B;  4ROE A;  5I5Z B;  5DQV A;  4BCH B;  2QDY B;  4Z6Y A;  4NST B;  3KHI A;  4G6L B;  4EOL B;  4FM4 B;  3HHT B;  3X25 B;  3LQ5 B;  1H24 B;  2D0Q B;  1GUX A;  1O9K A;  4HNV A;  2LW4 A;  5HNB B;  4CFX B;  4OB0 B;  2X1N B;  4CFW B;  3QYG B;  2BS2 A;  2CZ6 B;  4BY7 X;  4KRC B;  4CFU B;  4EON B;  3A8L B;  4ZGE B;  1UGQ B;  2CYZ B;  1H1P B;  1H1R B;  3NDQ A;  2PJQ A;  3A8H B;  4QSH A;  5HBE B;  4F6S B;  4CFN B;  1VYW B;  2UZB B;  1GH6 B;  2C5N B;  1GUX B;  3O0G D;  5L2W B;  4BCP B;  2WMA B;  1PKD B;  1ZP2 A;  3MI9 B;  4UN0 A;  3X26 B;  4ZGJ B;  1KXU A;  2IW6 B;  1URC B;  2IW9 B;  3BG3 A;  3EID B;  3DJB A;  4OB2 B;  4YOS A;  4MFE A;  4BCM B;  2I53 A;  4YC3 B;  4F6W B;  4YOO A;  3B57 A;  2CZ1 B;  4LOC A;  4BCG B;  4BCF B;  4EC8 B;  4OB3 B;  4CXA B;  3POM A;  3BHT B;  3BG9 A;  2R7G A;  3F5X B;  1W98 B;  2AHJ B;  2ZPH B;  1C9B A;  4AKH A;  4M6V A;  4BXX X;  1UNL D;  4ROD A;  2C4G B;  2W9F A;  2WFY B;  2DPP B;  5EFQ B;  1XO2 A;  2WEV B;  2BS4 A;  4YOZ A;  2EUF A;  1OKV B;  2IVX A;  4BCQ D;  1V29 B;  4BCO B;  1JKW A;  4EC9 B;  4HNU A;  2BKZ B;  4FX3 B;  2PK2 A;  2V22 B;  3VYH B;  3TNW B;  4ELJ A;  1JST B;  4BCK B;  2QQ8 A;  2CCH B;  4CRL B;  5LMK B;  1FKM A;  2WMB B;  3VYG B;  3RGF B;  1UGR B;  2W9Z A;  4HL4 A;  4F7S B;  4EOR B;  4BCJ B;  2WPA B;  2ZPG B;  2C6T B;  3DTO A;  4MFD A;  4EOO B;  3EJ1 B;  3DL1 A;  5ACB A;  2DD5 B;  1H26 B;  3BHU B;  4AKI A;  2CCI B;  1GY3 B;  4BCI B;  4NC6 A;  3DOG B;  3X28 B;  3HB9 A;  4F7N B;  3A8M B;  3K7A M;  3TN8 B;  3H4C A;  4CFV B;  4BCN B;  2I40 B;  1H1Q B;  1O9K B;  4IMY B;  1H27 B;  4OGR B;  1AD6 A;  5HQ0 B;  4BBR M;  2QF7 A;  3G33 B;  2UZD B;  1TD6 A;  2WXV B;  1OIY B;  3TNH B;  4F7L B;  3HBL A;  2ZCF B;  2G77 A;  1OI9 B;  2C5V B;  3TW7 A;  1E7P A;  2KMG A;  1OKW B;  3QXE B;  3QZ5 B;  5ICP B;  1IRE B;  3BLH B;  1P5E B;  5IHY A;  1OGU B;  2UZL B;  2DXC B;  2IW8 B;  2PK9 B;  5HBH B;  1FVV B;  4CFU D;  2CZ7 B;  4F6U B;  1OL1 B;  2C5O B;  3QZ9 B;  4EOK B;  1BU2 A;  4EOP B;  3WVE B;  4HNT A;  4EOI B;  1TFB A;  4I3Z B;  2WJ9 A;  4OR5 B;  4EOM B;  5FGK B;  3QYE A;  2DD4 B;  2W96 A;  1JSU B;  1UGS B;  2QFZ A;  1UNH D;  1VIN A;  4BBS M;  1OIU B;  1OL2 B;  3QYH B; 
#chains in the Genus database with same CATH homology
 1FIN B;  4F7N B;  1KXU A;  2IW6 B;  1URC B;  4ROC A;  3K7A M;  2IW9 B;  5CYI B;  3EID B;  2WHB B;  3TN8 B;  3H4C A;  4CFV B;  4BCN B;  4YOS A;  4EOQ B;  4TTH A;  4CFM B;  4ELL A;  2I40 B;  1H1Q B;  5BNJ B;  4BCM B;  2I53 A;  4YC3 B;  4F6W B;  1QMZ B;  4YOO A;  5HVY B;  1O9K B;  4BCN D;  1H1S B;  4IMY B;  2WIP B;  1H25 B;  1H27 B;  4BCM D;  4BCG B;  4BCF B;  4II5 B;  1G3N C;  4OGR B;  2W2H A;  3BLR B;  1AD6 A;  4EC8 B;  5HQ0 B;  1H28 B;  5IDN B;  2BPM B;  3G33 B;  4CXA B;  2UZD B;  3MIA B;  4ROE A;  3POM A;  3BHT B;  3DDP B;  5I5Z B;  2WXV B;  1OIY B;  4BCH B;  3TNH B;  1F5Q B;  2R7G A;  3F5X B;  4NST B;  4F7L B;  2C5X B;  1JOW A;  1OI9 B;  3EOC B;  4G6L B;  2C5V B;  1W98 B;  4F70 B;  4EOL B;  1C9B A;  4EOS B;  1VOL A;  3LQ5 B;  1UNL D;  5IF1 B;  4ROD A;  2UZE B;  3MY1 B;  2C4G B;  2W9F A;  2WFY B;  2G9X B;  1OKW B;  4BCQ B;  2W99 A;  5EFQ B;  1H24 B;  1XO2 A;  1GUX A;  1O9K A;  2WEV B;  3BLQ B;  5HNB B;  4CFX B;  1D3U B;  4YOZ A;  1E9H B;  2EUF A;  2WIH B;  2IVX A;  1OKV B;  4BCQ D;  3QHR B;  5ICP B;  3BHV B;  4BCO B;  1JKW A;  1H4L D;  2X1N B;  3MY5 B;  3BLH B;  3M03 A;  4CFW B;  1UNG D;  4EC9 B;  1N4M A;  2PHG A;  2BKZ B;  1P5E B;  4FX3 B;  4F7J B;  2PK2 A;  1OGU B;  2V22 B;  4KRC B;  4CFU B;  3TNW B;  4EON B;  4ELJ A;  1JST B;  2UZL B;  4BCK B;  2F2C A;  2IW8 B;  2CCH B;  1AIS B;  2PK9 B;  5HBH B;  1FVV B;  4CRL B;  4CFU D;  5LMK B;  4F6U B;  2WMB B;  1OL1 B;  2C5O B;  5IDP B;  3RGF B;  4EOK B;  1BU2 A;  2W9Z A;  1H1P B;  1H1R B;  2UUE B;  4EOP B;  4F7S B;  2PMI B;  4EOR B;  4BCJ B;  5CEI B;  2WPA B;  2C6T B;  4EOI B;  5HBE B;  4F6S B;  4CFN B;  1TFB A;  4I3Z B;  3QHW B;  4EOO B;  4Y72 B;  1VYW B;  2UZB B;  3EJ1 B;  3DDQ B;  1GH6 B;  5HBJ B;  5ACB A;  4OR5 B;  4EOJ B;  1H26 B;  2C5N B;  4EOM B;  5FGK B;  5LQF B;  3BHU B;  1GUX B;  2CJM B;  2W96 A;  1JSU B;  4KRD B;  2QDJ A;  3O0G D;  5L2W B;  1UNH D;  2CCI B;  4BCP B;  2WMA B;  1GY3 B;  1VIN A;  1PKD B;  1OIU B;  1ZP2 A;  4BCI B;  1OL2 B;  2JGZ B;  3MI9 B;  2B9R A;  3DOG B;  4UN0 A;  3TNI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...