4BCKB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 91
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB02
4F7SB 4OGRB 4CXAB 2UZBB 1JKWA 2PHGA 4EOLB 2WMAB 2W99A 5LQFB 4BCOB 1URCB 4CFWB 3G33B 4ROCA 3TNIB 4EOIB 4ELJA 1F5QB 1AD6A 3M03A 2CJMB 4YOSA 4G6LB 5IDNB 2W96A 4CFUD 1UNGD 3BLHB 4BCPB 4EOOB 5CEIB 5HBEB 5HVYB 2IVXA 2C5NB 3MI9B 4BCMD 1VINA 5I5ZB 4ELLA 2C5XB 2BKZB 2I53A 5BNJB 4CFXB 3LQ5B 5ACBA 1JOWA 2R7GA 1OL2B 1OL1B 4F6SB 1W98B 2C5OB 3DDQB 1GUXA 3BHTB 1GUXB 4F6WB 1O9KB 4BCQB 1H1PB 2CCIB 2WHBB 5FGKB 2PK2A 4CRLB 1JSTB 2IW8B 3TNHB 2WIHB 4CFNB 4BCIB 2IW6B 4F7JB 3MIAB 1H24B 3TN8B 1C9BA 4YOZA 1VOLA 4BCFB 2UUEB 2WFYB 4CFMB 2F2CA 2W9FA 2PK9B 3BHVB 4BCND 4EOSB 2X1NB 3DDPB 3POMA 3TNWB 1AISB 1JSUB 1H4LD 4YC3B 3QHWB 1OIYB 4EORB 1E9HB 1QMZB 4BCKB 1OGUB 4FX3B 4RODA 1O9KA 4UN0A 2I40B 4NSTB 4CFUB 2PMIB 1H1SB 3BLQB 2UZDB 1KXUA 1UNHD 4BCMB 2B9RA 4CFVB 3EJ1B 2G9XB 2WEVB 3MY1B 2BPMB 3BLRB 4EC8B 2WMBB 4EC9B 1D3UB 2CCHB 1P5EB 5LMKB 4EOKB 4II5B 1PKDB 5HBHB 5L2WB 2WXVB 1FVVB 1TFBA 2UZLB 1FINB 1GH6B 4OR5B 3EIDB 3MY5B 4KRCB 4I3ZB 1XO2A 2QDJA 3EOCB 1H25B 1OI9B 4Y72B 4EOMB 1N4MA 5EFQB 2WIPB 2WPAB 2IW9B 5IDPB 3QHRB 4IMYB 1GY3B 2C5VB 4EOJB 2EUFA 4BCNB 1H26B 1ZP2A 4ROEA 4BCJB 4F7LB 2C6TB 1G3NC 2JGZB 3O0GD 1H1QB 1H1RB 3H4CA 1UNLD 4BCQD 5IF1B 3RGFB 1VYWB 4EOPB 2C4GB 2V22B 1BU2A 4F7NB 2W2HA 4YOOA 5CYIB 2UZEB 3DOGB 4EONB 1OKVB 4F6UB 5HNBB 4F70B 4KRDB 5HBJB 1H27B 5HQ0B 4BCGB 3K7AM 3F5XB 4TTHA 4EOQB 1H28B 2W9ZA 1OIUB 5ICPB 1OKWB 3BHUB 4BCHB
chains in the Genus database with same CATH superfamily
4F7SB 4OGRB 2UZBB 3VKGA 2W99A 5LQFB 2ZPIB 1F5QB 4YOSA 1UGSB 2W96A 1TD6A 3BLHB 4BCPB 4EOOB 5HBEB 2C5NB 3MI9B 3BG9A 4CFXB 1JOWA 4BBRM 1OL1B 3BHTB 1GUXB 2PK2A 4NC6A 3QYGB 4JX6A 1FKMA 2ZPHB 4BCFB 3PO3S 2QDYB 2UUEB 2WFYB 2PK9B 4BCND 4EOSB 2CZ1B 2X1NB 4ZGJB 1AISB 1E9HB 2CZ6B 4RODA 1O9KA 4AI6A 4NSTB 4CFUB 2PMIB 2UZDB 1UNHD 4HL4A 2B9RA 2WEVB 3BLRB 1D3UB 4EC9B 1P5EB 5LMKB 4EOKB 1PKDB 2WXVB 2UZLB 1XO2A 2QDJA 3EOCB 2KMGA 5EFQB 2WIPB 2ZPEB 4IMYB 2C5VB 4FM4B 4OB1B 4F7LB 3KHIA 5IF1B 2DMEA 2C4GB 1BU2A 2W2HA 4YOOA 3BG5A 3QZ9B 2PJQA 3DOGB 3DTOA 2KR6A 5HNBB 4ZGDB 1QLBA 5ICPB 1H28B 4CXAB 2ZPBB 2DPPB 3TW6A 4ELJA 1AD6A 3M03A 4CFUD 2CJMB 4AKHA 4G6LB 4QSHA 1UNGD 2WJ9A 5HVYB 5I5ZB 2IVXA 2I53A 2R7GA 3A8HB 3GTMS 2C5OB 1GUXA 3WVEB 4CRLB 2CZ0B 3TNHB 4CFNB 2WIHB 3QXEB 3TN8B 4YOZA 1VOLA 2W9FA 4JX4A 4AKIA 3DDPB 1JSUB 1H4LD 4EORB 2ZCFB 3BLQB 1KXUA 3QYBA 2DXCB 2DD5B 3EJ1B 3X24B 1FVVB 3EIDB 4Y72B 4EOMB 3WVDB 4Z6YA 1ENWA 1GY3B 1H26B 4ROEA 3DJBA 1H1QB 3H4CA 3NDQA 4BXXX 1VYWB 4EOPB 5CYIB 1OKVB 2QQ8A 4KRDB 3B57A 2ZPFB 4TTHA 4EOQB 3X26B 4BCHB 4BY1X 4LOCA 1JKWA 4MFDA 4EOLB 3BG3A 4BCOB 1URCB 4CFWB 3G33B 1IREB 4ROCA 4BY7X 2AHJB 2BS2A 1VINA 2C5XB 3HB9A 5BNJB 3LQ5B 3X28B 1OL2B 4F6SB 1W98B 2DXBB 3VKHA 4M6VA 3A8LB 1O9KB 2IN3A 2DD4B 1H1PB 2CCIB 2WHBB 1E7PA 4JX5A 4BBSM 1JSTB 4F7JB 3A8OB 1H24B 1C9BA 2QFZA 3BHVB 5EJCA 5DQVA 3TNWB 2QGSA 4YC3B 1OIYB 4BCKB 3X20B 1H1SB 4BCMB 4CFVB 2G9XB 4EC8B 3VYHB 2WMBB 4OB3B 4II5B 5HBHB 5L2WB 1TFBA 4KRCB 2CZ7B 1N4MA 4HNTA 4MFEA 3QHRB 5IHYA 2EUFA 1ZP2A 2C6TB 3O0GD 1H1RB 3A8MB 1UNLD 3HZJA 3RGFB 3QYEA 2D0QB 2UZEB 4ZGEB 4EONB 4HLQA 4F6UB 4HNUA 3QZ5B 3F5XB 1AHJB 2W9ZA 1OKWB 3DL1A 2PHGA 2WMAB 3VYGB 3TW7A 3TNIB 4EOIB 5IDNB 3HHTB 5CEIB 4BCMD 4ELLA 2BKZB 5ACBA 3DDQB 2BS4A 4F6WB 4BCQB 4HNVA 5FGKB 2IW8B 4BCIB 2IW6B 3MIAB 1UGQB 4CFMB 2F2CA 4OB0B 3A8GB 2ZPGB 3POMA 1UGPB 3QWLA 3QHWB 2BS3A 1QMZB 1OGUB 4FX3B 4UN0A 2I40B 3MY1B 2BPMB 3QYHB 2LW4A 2QF7A 2CCHB 1FINB 1GH6B 4OB2B 4OR5B 3MY5B 2CYZB 4I3ZB 4AKGA 3X25B 1H25B 1OI9B 2G77A 5DQWA 2WPAB 2IW9B 5IDPB 4EOJB 4BCNB 2ZZDB 4BCJB 4MIMA 2JGZB 1G3NC 4BCQD 2V22B 4F7NB 3HBLA 1UGRB 4F70B 5HBJB 1H27B 1V29B 5HQ0B 3K7AM 4BCGB 1OIUB 3HO8A 3BHUB
chains in the Genus database with same CATH topology
4F7SB 4OGRB 4CXAB 2UZBB 1JKWA 2PHGA 4EOLB 2WMAB 2W99A 5LQFB 4BCOB 1URCB 4CFWB 3G33B 4ROCA 3TNIB 4EOIB 4ELJA 1F5QB 1AD6A 3M03A 2CJMB 4YOSA 4G6LB 5IDNB 2W96A 4CFUD 1UNGD 3BLHB 4BCPB 4EOOB 5CEIB 5HBEB 5HVYB 2IVXA 2C5NB 3MI9B 4BCMD 1VINA 5I5ZB 4ELLA 2C5XB 2BKZB 2I53A 5BNJB 4CFXB 3LQ5B 5ACBA 1JOWA 2R7GA 1OL2B 1OL1B 4F6SB 1W98B 2C5OB 3DDQB 1GUXA 3BHTB 1GUXB 4F6WB 1O9KB 4BCQB 1H1PB 2CCIB 2WHBB 5FGKB 2PK2A 4CRLB 1JSTB 2IW8B 3TNHB 2WIHB 4CFNB 4BCIB 2IW6B 4F7JB 3MIAB 1H24B 3TN8B 1C9BA 4YOZA 1VOLA 4BCFB 2UUEB 2WFYB 4CFMB 2F2CA 2W9FA 2PK9B 3BHVB 4BCND 4EOSB 2X1NB 3DDPB 3POMA 3TNWB 1AISB 1JSUB 1H4LD 4YC3B 3QHWB 1OIYB 4EORB 1E9HB 1QMZB 4BCKB 1OGUB 4FX3B 4RODA 1O9KA 4UN0A 2I40B 4NSTB 4CFUB 2PMIB 1H1SB 3BLQB 2UZDB 1KXUA 1UNHD 4BCMB 2B9RA 4CFVB 3EJ1B 2G9XB 2WEVB 3MY1B 2BPMB 3BLRB 4EC8B 2WMBB 4EC9B 1D3UB 2CCHB 1P5EB 5LMKB 4EOKB 4II5B 1PKDB 5HBHB 5L2WB 2WXVB 1FVVB 1TFBA 2UZLB 1FINB 1GH6B 4OR5B 3EIDB 3MY5B 4KRCB 4I3ZB 1XO2A 2QDJA 3EOCB 1H25B 1OI9B 4Y72B 4EOMB 1N4MA 5EFQB 2WIPB 2WPAB 2IW9B 5IDPB 3QHRB 4IMYB 1GY3B 2C5VB 4EOJB 2EUFA 4BCNB 1H26B 1ZP2A 4ROEA 4BCJB 4F7LB 2C6TB 1G3NC 2JGZB 3O0GD 1H1QB 1H1RB 3H4CA 1UNLD 4BCQD 5IF1B 3RGFB 1VYWB 4EOPB 2C4GB 2V22B 1BU2A 4F7NB 2W2HA 4YOOA 5CYIB 2UZEB 3DOGB 4EONB 1OKVB 4F6UB 5HNBB 4F70B 4KRDB 5HBJB 1H27B 5HQ0B 4BCGB 3K7AM 3F5XB 4TTHA 4EOQB 1H28B 2W9ZA 1OIUB 5ICPB 1OKWB 3BHUB 4BCHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7S B;  4OGR B;  4CXA B;  2UZB B;  1JKW A;  2PHG A;  4EOL B;  2WMA B;  2W99 A;  5LQF B;  4BCO B;  1URC B;  4CFW B;  3G33 B;  4ROC A;  3TNI B;  4EOI B;  4ELJ A;  1F5Q B;  1AD6 A;  3M03 A;  2CJM B;  4YOS A;  4G6L B;  5IDN B;  2W96 A;  4CFU D;  1UNG D;  3BLH B;  4BCP B;  4EOO B;  5CEI B;  5HBE B;  5HVY B;  2IVX A;  2C5N B;  3MI9 B;  4BCM D;  1VIN A;  5I5Z B;  4ELL A;  2C5X B;  2BKZ B;  2I53 A;  5BNJ B;  4CFX B;  3LQ5 B;  5ACB A;  1JOW A;  2R7G A;  1OL2 B;  1OL1 B;  4F6S B;  1W98 B;  2C5O B;  3DDQ B;  1GUX A;  3BHT B;  1GUX B;  4F6W B;  1O9K B;  4BCQ B;  1H1P B;  2CCI B;  2WHB B;  5FGK B;  2PK2 A;  4CRL B;  1JST B;  2IW8 B;  3TNH B;  2WIH B;  4CFN B;  4BCI B;  2IW6 B;  4F7J B;  3MIA B;  1H24 B;  3TN8 B;  1C9B A;  4YOZ A;  1VOL A;  4BCF B;  2UUE B;  2WFY B;  4CFM B;  2F2C A;  2W9F A;  2PK9 B;  3BHV B;  4BCN D;  4EOS B;  2X1N B;  3DDP B;  3POM A;  3TNW B;  1AIS B;  1JSU B;  1H4L D;  4YC3 B;  3QHW B;  1OIY B;  4EOR B;  1E9H B;  1QMZ B;  4BCK B;  1OGU B;  4FX3 B;  4ROD A;  1O9K A;  4UN0 A;  2I40 B;  4NST B;  4CFU B;  2PMI B;  1H1S B;  3BLQ B;  2UZD B;  1KXU A;  1UNH D;  4BCM B;  2B9R A;  4CFV B;  3EJ1 B;  2G9X B;  2WEV B;  3MY1 B;  2BPM B;  3BLR B;  4EC8 B;  2WMB B;  4EC9 B;  1D3U B;  2CCH B;  1P5E B;  5LMK B;  4EOK B;  4II5 B;  1PKD B;  5HBH B;  5L2W B;  2WXV B;  1FVV B;  1TFB A;  2UZL B;  1FIN B;  1GH6 B;  4OR5 B;  3EID B;  3MY5 B;  4KRC B;  4I3Z B;  1XO2 A;  2QDJ A;  3EOC B;  1H25 B;  1OI9 B;  4Y72 B;  4EOM B;  1N4M A;  5EFQ B;  2WIP B;  2WPA B;  2IW9 B;  5IDP B;  3QHR B;  4IMY B;  1GY3 B;  2C5V B;  4EOJ B;  2EUF A;  4BCN B;  1H26 B;  1ZP2 A;  4ROE A;  4BCJ B;  4F7L B;  2C6T B;  1G3N C;  2JGZ B;  3O0G D;  1H1Q B;  1H1R B;  3H4C A;  1UNL D;  4BCQ D;  5IF1 B;  3RGF B;  1VYW B;  4EOP B;  2C4G B;  2V22 B;  1BU2 A;  4F7N B;  2W2H A;  4YOO A;  5CYI B;  2UZE B;  3DOG B;  4EON B;  1OKV B;  4F6U B;  5HNB B;  4F70 B;  4KRD B;  5HBJ B;  1H27 B;  5HQ0 B;  4BCG B;  3K7A M;  3F5X B;  4TTH A;  4EOQ B;  1H28 B;  2W9Z A;  1OIU B;  5ICP B;  1OKW B;  3BHU B;  4BCH B; 
#chains in the Genus database with same CATH topology
 4F7S B;  4OGR B;  2UZB B;  3VKG A;  2W99 A;  5LQF B;  2ZPI B;  1F5Q B;  4YOS A;  1UGS B;  2W96 A;  1TD6 A;  3BLH B;  4BCP B;  4EOO B;  5HBE B;  2C5N B;  3MI9 B;  3BG9 A;  4CFX B;  1JOW A;  4BBR M;  1OL1 B;  3BHT B;  1GUX B;  2PK2 A;  4NC6 A;  3QYG B;  4JX6 A;  1FKM A;  2ZPH B;  4BCF B;  3PO3 S;  2QDY B;  2UUE B;  2WFY B;  2PK9 B;  4BCN D;  4EOS B;  2CZ1 B;  2X1N B;  4ZGJ B;  1AIS B;  1E9H B;  2CZ6 B;  4ROD A;  1O9K A;  4AI6 A;  4NST B;  4CFU B;  2PMI B;  2UZD B;  1UNH D;  4HL4 A;  2B9R A;  2WEV B;  3BLR B;  1D3U B;  4EC9 B;  1P5E B;  5LMK B;  4EOK B;  1PKD B;  2WXV B;  2UZL B;  1XO2 A;  2QDJ A;  3EOC B;  2KMG A;  5EFQ B;  2WIP B;  2ZPE B;  4IMY B;  2C5V B;  4FM4 B;  4OB1 B;  4F7L B;  3KHI A;  5IF1 B;  2DME A;  2C4G B;  1BU2 A;  2W2H A;  4YOO A;  3BG5 A;  3QZ9 B;  2PJQ A;  3DOG B;  3DTO A;  2KR6 A;  5HNB B;  4ZGD B;  1QLB A;  5ICP B;  1H28 B;  4CXA B;  2ZPB B;  2DPP B;  3TW6 A;  4ELJ A;  1AD6 A;  3M03 A;  4CFU D;  2CJM B;  4AKH A;  4G6L B;  4QSH A;  1UNG D;  2WJ9 A;  5HVY B;  5I5Z B;  2IVX A;  2I53 A;  2R7G A;  3A8H B;  3GTM S;  2C5O B;  1GUX A;  3WVE B;  4CRL B;  2CZ0 B;  3TNH B;  4CFN B;  2WIH B;  3QXE B;  3TN8 B;  4YOZ A;  1VOL A;  2W9F A;  4JX4 A;  4AKI A;  3DDP B;  1JSU B;  1H4L D;  4EOR B;  2ZCF B;  3BLQ B;  1KXU A;  3QYB A;  2DXC B;  2DD5 B;  3EJ1 B;  3X24 B;  1FVV B;  3EID B;  4Y72 B;  4EOM B;  3WVD B;  4Z6Y A;  1ENW A;  1GY3 B;  1H26 B;  4ROE A;  3DJB A;  1H1Q B;  3H4C A;  3NDQ A;  4BXX X;  1VYW B;  4EOP B;  5CYI B;  1OKV B;  2QQ8 A;  4KRD B;  3B57 A;  2ZPF B;  4TTH A;  4EOQ B;  3X26 B;  4BCH B;  4BY1 X;  4LOC A;  1JKW A;  4MFD A;  4EOL B;  3BG3 A;  4BCO B;  1URC B;  4CFW B;  3G33 B;  1IRE B;  4ROC A;  4BY7 X;  2AHJ B;  2BS2 A;  1VIN A;  2C5X B;  3HB9 A;  5BNJ B;  3LQ5 B;  3X28 B;  1OL2 B;  4F6S B;  1W98 B;  2DXB B;  3VKH A;  4M6V A;  3A8L B;  1O9K B;  2IN3 A;  2DD4 B;  1H1P B;  2CCI B;  2WHB B;  1E7P A;  4JX5 A;  4BBS M;  1JST B;  4F7J B;  3A8O B;  1H24 B;  1C9B A;  2QFZ A;  3BHV B;  5EJC A;  5DQV A;  3TNW B;  2QGS A;  4YC3 B;  1OIY B;  4BCK B;  3X20 B;  1H1S B;  4BCM B;  4CFV B;  2G9X B;  4EC8 B;  3VYH B;  2WMB B;  4OB3 B;  4II5 B;  5HBH B;  5L2W B;  1TFB A;  4KRC B;  2CZ7 B;  1N4M A;  4HNT A;  4MFE A;  3QHR B;  5IHY A;  2EUF A;  1ZP2 A;  2C6T B;  3O0G D;  1H1R B;  3A8M B;  1UNL D;  3HZJ A;  3RGF B;  3QYE A;  2D0Q B;  2UZE B;  4ZGE B;  4EON B;  4HLQ A;  4F6U B;  4HNU A;  3QZ5 B;  3F5X B;  1AHJ B;  2W9Z A;  1OKW B;  3DL1 A;  2PHG A;  2WMA B;  3VYG B;  3TW7 A;  3TNI B;  4EOI B;  5IDN B;  3HHT B;  5CEI B;  4BCM D;  4ELL A;  2BKZ B;  5ACB A;  3DDQ B;  2BS4 A;  4F6W B;  4BCQ B;  4HNV A;  5FGK B;  2IW8 B;  4BCI B;  2IW6 B;  3MIA B;  1UGQ B;  4CFM B;  2F2C A;  4OB0 B;  3A8G B;  2ZPG B;  3POM A;  1UGP B;  3QWL A;  3QHW B;  2BS3 A;  1QMZ B;  1OGU B;  4FX3 B;  4UN0 A;  2I40 B;  3MY1 B;  2BPM B;  3QYH B;  2LW4 A;  2QF7 A;  2CCH B;  1FIN B;  1GH6 B;  4OB2 B;  4OR5 B;  3MY5 B;  2CYZ B;  4I3Z B;  4AKG A;  3X25 B;  1H25 B;  1OI9 B;  2G77 A;  5DQW A;  2WPA B;  2IW9 B;  5IDP B;  4EOJ B;  4BCN B;  2ZZD B;  4BCJ B;  4MIM A;  2JGZ B;  1G3N C;  4BCQ D;  2V22 B;  4F7N B;  3HBL A;  1UGR B;  4F70 B;  5HBJ B;  1H27 B;  1V29 B;  5HQ0 B;  3K7A M;  4BCG B;  1OIU B;  3HO8 A;  3BHU B; 
#chains in the Genus database with same CATH homology
 4F7S B;  4OGR B;  4CXA B;  2UZB B;  1JKW A;  2PHG A;  4EOL B;  2WMA B;  2W99 A;  5LQF B;  4BCO B;  1URC B;  4CFW B;  3G33 B;  4ROC A;  3TNI B;  4EOI B;  4ELJ A;  1F5Q B;  1AD6 A;  3M03 A;  2CJM B;  4YOS A;  4G6L B;  5IDN B;  2W96 A;  4CFU D;  1UNG D;  3BLH B;  4BCP B;  4EOO B;  5CEI B;  5HBE B;  5HVY B;  2IVX A;  2C5N B;  3MI9 B;  4BCM D;  1VIN A;  5I5Z B;  4ELL A;  2C5X B;  2BKZ B;  2I53 A;  5BNJ B;  4CFX B;  3LQ5 B;  5ACB A;  1JOW A;  2R7G A;  1OL2 B;  1OL1 B;  4F6S B;  1W98 B;  2C5O B;  3DDQ B;  1GUX A;  3BHT B;  1GUX B;  4F6W B;  1O9K B;  4BCQ B;  1H1P B;  2CCI B;  2WHB B;  5FGK B;  2PK2 A;  4CRL B;  1JST B;  2IW8 B;  3TNH B;  2WIH B;  4CFN B;  4BCI B;  2IW6 B;  4F7J B;  3MIA B;  1H24 B;  3TN8 B;  1C9B A;  4YOZ A;  1VOL A;  4BCF B;  2UUE B;  2WFY B;  4CFM B;  2F2C A;  2W9F A;  2PK9 B;  3BHV B;  4BCN D;  4EOS B;  2X1N B;  3DDP B;  3POM A;  3TNW B;  1AIS B;  1JSU B;  1H4L D;  4YC3 B;  3QHW B;  1OIY B;  4EOR B;  1E9H B;  1QMZ B;  4BCK B;  1OGU B;  4FX3 B;  4ROD A;  1O9K A;  4UN0 A;  2I40 B;  4NST B;  4CFU B;  2PMI B;  1H1S B;  3BLQ B;  2UZD B;  1KXU A;  1UNH D;  4BCM B;  2B9R A;  4CFV B;  3EJ1 B;  2G9X B;  2WEV B;  3MY1 B;  2BPM B;  3BLR B;  4EC8 B;  2WMB B;  4EC9 B;  1D3U B;  2CCH B;  1P5E B;  5LMK B;  4EOK B;  4II5 B;  1PKD B;  5HBH B;  5L2W B;  2WXV B;  1FVV B;  1TFB A;  2UZL B;  1FIN B;  1GH6 B;  4OR5 B;  3EID B;  3MY5 B;  4KRC B;  4I3Z B;  1XO2 A;  2QDJ A;  3EOC B;  1H25 B;  1OI9 B;  4Y72 B;  4EOM B;  1N4M A;  5EFQ B;  2WIP B;  2WPA B;  2IW9 B;  5IDP B;  3QHR B;  4IMY B;  1GY3 B;  2C5V B;  4EOJ B;  2EUF A;  4BCN B;  1H26 B;  1ZP2 A;  4ROE A;  4BCJ B;  4F7L B;  2C6T B;  1G3N C;  2JGZ B;  3O0G D;  1H1Q B;  1H1R B;  3H4C A;  1UNL D;  4BCQ D;  5IF1 B;  3RGF B;  1VYW B;  4EOP B;  2C4G B;  2V22 B;  1BU2 A;  4F7N B;  2W2H A;  4YOO A;  5CYI B;  2UZE B;  3DOG B;  4EON B;  1OKV B;  4F6U B;  5HNB B;  4F70 B;  4KRD B;  5HBJ B;  1H27 B;  5HQ0 B;  4BCG B;  3K7A M;  3F5X B;  4TTH A;  4EOQ B;  1H28 B;  2W9Z A;  1OIU B;  5ICP B;  1OKW B;  3BHU B;  4BCH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...