4BCKB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
b'PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/cell cycle
total genus 91
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB02
2WEVB 4EONB 3O0GD 2G9XB 3BLRB 1VYWB 3F5XB 1H4LD 1F5QB 1JSUB 1OKWB 1OIYB 2BKZB 4BCQB 1OIUB 1GY3B 1N4MA 4YOSA 4EOPB 4CFMB 2V22B 1H27B 2W9FA 4II5B 1UNHD 4KRDB 2IW8B 1OL1B 4CRLB 1H1PB 4BCJB 3EIDB 2PMIB 5LQFB 5CYIB 1AISB 4KRCB 2PHGA 3TNWB 5CEIB 4TTHA 1AD6A 4YC3B 5HNBB 3EOCB 2CCIB 1GUXA 2CCHB 4CFUD 4ELJA 1O9KB 1OL2B 3POMA 4CXAB 1JOWA 1XO2A 4BCGB 2UUEB 4EOMB 2WHBB 4BCHB 1TFBA 4Y72B 1H1QB 5IDPB 1OI9B 3G33B 5FGKB 4EOOB 4F7SB 4BCMB 4CFVB 4G6LB 2UZLB 5HQ0B 5L2WB 4ROCA 3M03A 5EFQB 5I5ZB 3DDPB 4F6WB 4OGRB 4EC9B 4BCOB 3EJ1B 1H26B 2WMAB 3QHRB 1URCB 4BCND 2UZBB 4FX3B 4EOSB 2C4GB 2EUFA 1GH6B 1UNGD 2JGZB 2W96A 2IW6B 2PK9B 4F7JB 5IF1B 5LMKB 3MY5B 2IVXA 1FVVB 3K7AM 1H25B 3DDQB 2W9ZA 3MI9B 1PKDB 2WMBB 4CFUB 2UZDB 2C5OB 2W99A 1VOLA 4F70B 1UNLD 4F6SB 3BHVB 1H24B 4ROEA 4BCFB 4CFNB 2BPMB 5HVYB 1C9BA 1H1SB 1VINA 5HBHB 2WIHB 4EORB 2W2HA 3BHUB 4YOOA 3TNHB 3TNIB 4UN0A 4EOJB 4BCIB 2QDJA 1QMZB 1ZP2A 4BCKB 5BNJB 1H28B 3BLHB 3LQ5B 4EOQB 1D3UB 4CFXB 1BU2A 5ICPB 2WXVB 5HBEB 4BCNB 2WIPB 4ELLA 1H1RB 1JSTB 4EOIB 1O9KA 3BHTB 2X1NB 2IW9B 4EC8B 5IDNB 1JKWA 2WFYB 4BCQD 5HBJB 1G3NC 2I40B 5ACBA 3TN8B 2B9RA 3QHWB 3BLQB 3DOGB 3MIAB 4EOLB 4YOZA 1W98B 4BCPB 1OGUB 2C6TB 2CJMB 2F2CA 4F7NB 2I53A 2R7GA 4NSTB 2C5XB 4I3ZB 1KXUA 1P5EB 4IMYB 1FINB 4EOKB 3H4CA 2PK2A 4RODA 1GUXB 2WPAB 3MY1B 4CFWB 4F6UB 3RGFB 1OKVB 1E9HB 4OR5B 4F7LB 4BCMD 2C5NB 2UZEB 2C5VB
chains in the Genus database with same CATH superfamily
3O0GD 3BLRB 1OKWB 2BKZB 4HLQA 3HO8A 4BCQB 4Z6YA 2V22B 3X20B 3B57A 3QYHB 4BBRM 4KRDB 1OL1B 5LQFB 4BCJB 3EIDB 2AHJB 4NC6A 1AISB 4M6VA 1AD6A 5HNBB 3QZ9B 2ZPEB 1O9KB 4CXAB 1XO2A 4AI6A 3DL1A 4EOOB 4CFVB 5L2WB 5IHYA 3EJ1B 3X25B 3VYGB 4BCND 1FKMA 1GH6B 1UGRB 1H25B 2WMBB 2BS4A 4CFUB 2UZDB 2W99A 1VOLA 4F6SB 1H24B 4BCFB 2DMEA 1H1SB 1VINA 5HBHB 2W2HA 3BHUB 2ZPIB 2QDJA 4JX6A 1ZP2A 5BNJB 3BLHB 3LQ5B 2DXBB 2DD5B 4EC8B 1JKWA 3BLQB 5DQVA 2F2CA 4FM4B 3TW7A 2I53A 4I3ZB 3X26B 4HNTA 4BY7X 4F6UB 4OR5B 2C5NB 4BY1X 2C5VB 2LW4A 1V29B 4EONB 2G9XB 3QYBA 3BG3A 2QDYB 4CFMB 2KR6A 1H27B 1UNHD 3QYGB 1H1PB 2PMIB 2PHGA 3TNWB 5CEIB 4TTHA 4HNVA 2CCHB 2CZ6B 4BCMB 3KHIA 3M03A 1UGPB 2QGSA 4F6WB 4EC9B 2QF7A 3A8GB 1H26B 1URCB 2JGZB 4F7JB 3MY5B 3VKHA 3X24B 1FVVB 3K7AM 4OB2B 1UGQB 3QXEB 3BHVB 1AHJB 3DJBA 2BPMB 2BS3A 2WIHB 4EORB 3TNIB 1QLBA 1H28B 4EOQB 1D3UB 1ENWA 4CFXB 2WXVB 4BCNB 2WIPB 1O9KA 2IW9B 4AKHA 4JX4A 5HBJB 3TN8B 3QHWB 3DOGB 4YOZA 3WVDB 2CJMB 3BG9A 2DD4B 2C5XB 3NDQA 2PK2A 4MIMA 4RODA 1GUXB 3MY1B 4CFWB 3RGFB 1E9HB 1UGSB 3HBLA 1TD6A 2UZEB 3VYHB 2WEVB 4BXXX 1H4LD 1F5QB 1JSUB 1OIYB 4YOSA 4OB3B 1N4MA 4HL4A 2IW8B 3HZJA 4CRLB 2PJQA 5CYIB 4KRCB 2CZ7B 3EOCB 1GUXA 4ELJA 2D0QB 1OL2B 3POMA 2ZCFB 1TFBA 4Y72B 1H1QB 3QWLA 3G33B 5FGKB 4G6LB 2UZLB 3DDPB 4OGRB 2QFZA 3QZ5B 2WMAB 2IN3A 3HB9A 2UZBB 3A8MB 1UNGD 2ZPFB 2W96A 2IW6B 5LMKB 2ZZDB 2ZPGB 2CZ1B 2KMGA 2G77A 5DQWA 2W9ZA 2C5OB 4F70B 1UNLD 2ZPHB 4ROEA 5HVYB 1C9BA 3DTOA 3WVEB 4EOJB 2CZ0B 3BG5A 1QMZB 4JX5A 1BU2A 4OB1B 5EJCA 1H1RB 1JSTB 4EOIB 3BHTB 2X1NB 3GTMS 2QQ8A 5IDNB 2WFYB 4BCQD 1G3NC 4BBSM 2B9RA 4EOLB 3MIAB 4BCPB 4AKIA 4F7NB 4NSTB 1KXUA 1P5EB 3H4CA 2WJ9A 4F7LB 4LOCA 3TW6A 1VYWB 3F5XB 1OIUB 1GY3B 1IREB 4EOPB 2W9FA 4II5B 4QSHA 4YC3B 3HHTB 2CCIB 4CFUD 1JOWA 2BS2A 4BCGB 2UUEB 4EOMB 2WHBB 4BCHB 5IDPB 1OI9B 4F7SB 4OB0B 2CYZB 5HQ0B 4ROCA 3X28B 5EFQB 5I5ZB 4BCOB 4AKGA 3PO3S 3QHRB 3A8OB 4FX3B 4EOSB 2C4GB 2EUFA 4ZGJB 2PK9B 5IF1B 3A8LB 2IVXA 4ZGEB 4MFDA 3DDQB 3MI9B 1PKDB 4MFEA 3VKGA 4CFNB 4HNUA 4YOOA 3TNHB 1E7PA 2ZPBB 4UN0A 4BCIB 4BCKB 2DPPB 5ICPB 5HBEB 4ELLA 3QYEA 3A8HB 5ACBA 2I40B 2DXCB 1W98B 1OGUB 2C6TB 2R7GA 4IMYB 1FINB 4EOKB 2WPAB 4ZGDB 1OKVB 4BCMD
chains in the Genus database with same CATH topology
2WEVB 4EONB 3O0GD 2G9XB 3BLRB 1VYWB 3F5XB 1H4LD 1F5QB 1JSUB 1OKWB 1OIYB 2BKZB 4BCQB 1OIUB 1GY3B 1N4MA 4YOSA 4EOPB 4CFMB 2V22B 1H27B 2W9FA 4II5B 1UNHD 4KRDB 2IW8B 1OL1B 4CRLB 1H1PB 4BCJB 3EIDB 2PMIB 5LQFB 5CYIB 1AISB 4KRCB 2PHGA 3TNWB 5CEIB 4TTHA 1AD6A 4YC3B 5HNBB 3EOCB 2CCIB 1GUXA 2CCHB 4CFUD 4ELJA 1O9KB 1OL2B 3POMA 4CXAB 1JOWA 1XO2A 4BCGB 2UUEB 4EOMB 2WHBB 4BCHB 1TFBA 4Y72B 1H1QB 5IDPB 1OI9B 3G33B 5FGKB 4EOOB 4F7SB 4BCMB 4CFVB 4G6LB 2UZLB 5HQ0B 5L2WB 4ROCA 3M03A 5EFQB 5I5ZB 3DDPB 4F6WB 4OGRB 4EC9B 4BCOB 3EJ1B 1H26B 2WMAB 3QHRB 1URCB 4BCND 2UZBB 4FX3B 4EOSB 2C4GB 2EUFA 1GH6B 1UNGD 2JGZB 2W96A 2IW6B 2PK9B 4F7JB 5IF1B 5LMKB 3MY5B 2IVXA 1FVVB 3K7AM 1H25B 3DDQB 2W9ZA 3MI9B 1PKDB 2WMBB 4CFUB 2UZDB 2C5OB 2W99A 1VOLA 4F70B 1UNLD 4F6SB 3BHVB 1H24B 4ROEA 4BCFB 4CFNB 2BPMB 5HVYB 1C9BA 1H1SB 1VINA 5HBHB 2WIHB 4EORB 2W2HA 3BHUB 4YOOA 3TNHB 3TNIB 4UN0A 4EOJB 4BCIB 2QDJA 1QMZB 1ZP2A 4BCKB 5BNJB 1H28B 3BLHB 3LQ5B 4EOQB 1D3UB 4CFXB 1BU2A 5ICPB 2WXVB 5HBEB 4BCNB 2WIPB 4ELLA 1H1RB 1JSTB 4EOIB 1O9KA 3BHTB 2X1NB 2IW9B 4EC8B 5IDNB 1JKWA 2WFYB 4BCQD 5HBJB 1G3NC 2I40B 5ACBA 3TN8B 2B9RA 3QHWB 3BLQB 3DOGB 3MIAB 4EOLB 4YOZA 1W98B 4BCPB 1OGUB 2C6TB 2CJMB 2F2CA 4F7NB 2I53A 2R7GA 4NSTB 2C5XB 4I3ZB 1KXUA 1P5EB 4IMYB 1FINB 4EOKB 3H4CA 2PK2A 4RODA 1GUXB 2WPAB 3MY1B 4CFWB 4F6UB 3RGFB 1OKVB 1E9HB 4OR5B 4F7LB 4BCMD 2C5NB 2UZEB 2C5VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WEV B;  4EON B;  3O0G D;  2G9X B;  3BLR B;  1VYW B;  3F5X B;  1H4L D;  1F5Q B;  1JSU B;  1OKW B;  1OIY B;  2BKZ B;  4BCQ B;  1OIU B;  1GY3 B;  1N4M A;  4YOS A;  4EOP B;  4CFM B;  2V22 B;  1H27 B;  2W9F A;  4II5 B;  1UNH D;  4KRD B;  2IW8 B;  1OL1 B;  4CRL B;  1H1P B;  4BCJ B;  3EID B;  2PMI B;  5LQF B;  5CYI B;  1AIS B;  4KRC B;  2PHG A;  3TNW B;  5CEI B;  4TTH A;  1AD6 A;  4YC3 B;  5HNB B;  3EOC B;  2CCI B;  1GUX A;  2CCH B;  4CFU D;  4ELJ A;  1O9K B;  1OL2 B;  3POM A;  4CXA B;  1JOW A;  1XO2 A;  4BCG B;  2UUE B;  4EOM B;  2WHB B;  4BCH B;  1TFB A;  4Y72 B;  1H1Q B;  5IDP B;  1OI9 B;  3G33 B;  5FGK B;  4EOO B;  4F7S B;  4BCM B;  4CFV B;  4G6L B;  2UZL B;  5HQ0 B;  5L2W B;  4ROC A;  3M03 A;  5EFQ B;  5I5Z B;  3DDP B;  4F6W B;  4OGR B;  4EC9 B;  4BCO B;  3EJ1 B;  1H26 B;  2WMA B;  3QHR B;  1URC B;  4BCN D;  2UZB B;  4FX3 B;  4EOS B;  2C4G B;  2EUF A;  1GH6 B;  1UNG D;  2JGZ B;  2W96 A;  2IW6 B;  2PK9 B;  4F7J B;  5IF1 B;  5LMK B;  3MY5 B;  2IVX A;  1FVV B;  3K7A M;  1H25 B;  3DDQ B;  2W9Z A;  3MI9 B;  1PKD B;  2WMB B;  4CFU B;  2UZD B;  2C5O B;  2W99 A;  1VOL A;  4F70 B;  1UNL D;  4F6S B;  3BHV B;  1H24 B;  4ROE A;  4BCF B;  4CFN B;  2BPM B;  5HVY B;  1C9B A;  1H1S B;  1VIN A;  5HBH B;  2WIH B;  4EOR B;  2W2H A;  3BHU B;  4YOO A;  3TNH B;  3TNI B;  4UN0 A;  4EOJ B;  4BCI B;  2QDJ A;  1QMZ B;  1ZP2 A;  4BCK B;  5BNJ B;  1H28 B;  3BLH B;  3LQ5 B;  4EOQ B;  1D3U B;  4CFX B;  1BU2 A;  5ICP B;  2WXV B;  5HBE B;  4BCN B;  2WIP B;  4ELL A;  1H1R B;  1JST B;  4EOI B;  1O9K A;  3BHT B;  2X1N B;  2IW9 B;  4EC8 B;  5IDN B;  1JKW A;  2WFY B;  4BCQ D;  5HBJ B;  1G3N C;  2I40 B;  5ACB A;  3TN8 B;  2B9R A;  3QHW B;  3BLQ B;  3DOG B;  3MIA B;  4EOL B;  4YOZ A;  1W98 B;  4BCP B;  1OGU B;  2C6T B;  2CJM B;  2F2C A;  4F7N B;  2I53 A;  2R7G A;  4NST B;  2C5X B;  4I3Z B;  1KXU A;  1P5E B;  4IMY B;  1FIN B;  4EOK B;  3H4C A;  2PK2 A;  4ROD A;  1GUX B;  2WPA B;  3MY1 B;  4CFW B;  4F6U B;  3RGF B;  1OKV B;  1E9H B;  4OR5 B;  4F7L B;  4BCM D;  2C5N B;  2UZE B;  2C5V B; 
#chains in the Genus database with same CATH topology
 3O0G D;  3BLR B;  1OKW B;  2BKZ B;  4HLQ A;  3HO8 A;  4BCQ B;  4Z6Y A;  2V22 B;  3X20 B;  3B57 A;  3QYH B;  4BBR M;  4KRD B;  1OL1 B;  5LQF B;  4BCJ B;  3EID B;  2AHJ B;  4NC6 A;  1AIS B;  4M6V A;  1AD6 A;  5HNB B;  3QZ9 B;  2ZPE B;  1O9K B;  4CXA B;  1XO2 A;  4AI6 A;  3DL1 A;  4EOO B;  4CFV B;  5L2W B;  5IHY A;  3EJ1 B;  3X25 B;  3VYG B;  4BCN D;  1FKM A;  1GH6 B;  1UGR B;  1H25 B;  2WMB B;  2BS4 A;  4CFU B;  2UZD B;  2W99 A;  1VOL A;  4F6S B;  1H24 B;  4BCF B;  2DME A;  1H1S B;  1VIN A;  5HBH B;  2W2H A;  3BHU B;  2ZPI B;  2QDJ A;  4JX6 A;  1ZP2 A;  5BNJ B;  3BLH B;  3LQ5 B;  2DXB B;  2DD5 B;  4EC8 B;  1JKW A;  3BLQ B;  5DQV A;  2F2C A;  4FM4 B;  3TW7 A;  2I53 A;  4I3Z B;  3X26 B;  4HNT A;  4BY7 X;  4F6U B;  4OR5 B;  2C5N B;  4BY1 X;  2C5V B;  2LW4 A;  1V29 B;  4EON B;  2G9X B;  3QYB A;  3BG3 A;  2QDY B;  4CFM B;  2KR6 A;  1H27 B;  1UNH D;  3QYG B;  1H1P B;  2PMI B;  2PHG A;  3TNW B;  5CEI B;  4TTH A;  4HNV A;  2CCH B;  2CZ6 B;  4BCM B;  3KHI A;  3M03 A;  1UGP B;  2QGS A;  4F6W B;  4EC9 B;  2QF7 A;  3A8G B;  1H26 B;  1URC B;  2JGZ B;  4F7J B;  3MY5 B;  3VKH A;  3X24 B;  1FVV B;  3K7A M;  4OB2 B;  1UGQ B;  3QXE B;  3BHV B;  1AHJ B;  3DJB A;  2BPM B;  2BS3 A;  2WIH B;  4EOR B;  3TNI B;  1QLB A;  1H28 B;  4EOQ B;  1D3U B;  1ENW A;  4CFX B;  2WXV B;  4BCN B;  2WIP B;  1O9K A;  2IW9 B;  4AKH A;  4JX4 A;  5HBJ B;  3TN8 B;  3QHW B;  3DOG B;  4YOZ A;  3WVD B;  2CJM B;  3BG9 A;  2DD4 B;  2C5X B;  3NDQ A;  2PK2 A;  4MIM A;  4ROD A;  1GUX B;  3MY1 B;  4CFW B;  3RGF B;  1E9H B;  1UGS B;  3HBL A;  1TD6 A;  2UZE B;  3VYH B;  2WEV B;  4BXX X;  1H4L D;  1F5Q B;  1JSU B;  1OIY B;  4YOS A;  4OB3 B;  1N4M A;  4HL4 A;  2IW8 B;  3HZJ A;  4CRL B;  2PJQ A;  5CYI B;  4KRC B;  2CZ7 B;  3EOC B;  1GUX A;  4ELJ A;  2D0Q B;  1OL2 B;  3POM A;  2ZCF B;  1TFB A;  4Y72 B;  1H1Q B;  3QWL A;  3G33 B;  5FGK B;  4G6L B;  2UZL B;  3DDP B;  4OGR B;  2QFZ A;  3QZ5 B;  2WMA B;  2IN3 A;  3HB9 A;  2UZB B;  3A8M B;  1UNG D;  2ZPF B;  2W96 A;  2IW6 B;  5LMK B;  2ZZD B;  2ZPG B;  2CZ1 B;  2KMG A;  2G77 A;  5DQW A;  2W9Z A;  2C5O B;  4F70 B;  1UNL D;  2ZPH B;  4ROE A;  5HVY B;  1C9B A;  3DTO A;  3WVE B;  4EOJ B;  2CZ0 B;  3BG5 A;  1QMZ B;  4JX5 A;  1BU2 A;  4OB1 B;  5EJC A;  1H1R B;  1JST B;  4EOI B;  3BHT B;  2X1N B;  3GTM S;  2QQ8 A;  5IDN B;  2WFY B;  4BCQ D;  1G3N C;  4BBS M;  2B9R A;  4EOL B;  3MIA B;  4BCP B;  4AKI A;  4F7N B;  4NST B;  1KXU A;  1P5E B;  3H4C A;  2WJ9 A;  4F7L B;  4LOC A;  3TW6 A;  1VYW B;  3F5X B;  1OIU B;  1GY3 B;  1IRE B;  4EOP B;  2W9F A;  4II5 B;  4QSH A;  4YC3 B;  3HHT B;  2CCI B;  4CFU D;  1JOW A;  2BS2 A;  4BCG B;  2UUE B;  4EOM B;  2WHB B;  4BCH B;  5IDP B;  1OI9 B;  4F7S B;  4OB0 B;  2CYZ B;  5HQ0 B;  4ROC A;  3X28 B;  5EFQ B;  5I5Z B;  4BCO B;  4AKG A;  3PO3 S;  3QHR B;  3A8O B;  4FX3 B;  4EOS B;  2C4G B;  2EUF A;  4ZGJ B;  2PK9 B;  5IF1 B;  3A8L B;  2IVX A;  4ZGE B;  4MFD A;  3DDQ B;  3MI9 B;  1PKD B;  4MFE A;  3VKG A;  4CFN B;  4HNU A;  4YOO A;  3TNH B;  1E7P A;  2ZPB B;  4UN0 A;  4BCI B;  4BCK B;  2DPP B;  5ICP B;  5HBE B;  4ELL A;  3QYE A;  3A8H B;  5ACB A;  2I40 B;  2DXC B;  1W98 B;  1OGU B;  2C6T B;  2R7G A;  4IMY B;  1FIN B;  4EOK B;  2WPA B;  4ZGD B;  1OKV B;  4BCM D; 
#chains in the Genus database with same CATH homology
 2WEV B;  4EON B;  3O0G D;  2G9X B;  3BLR B;  1VYW B;  3F5X B;  1H4L D;  1F5Q B;  1JSU B;  1OKW B;  1OIY B;  2BKZ B;  4BCQ B;  1OIU B;  1GY3 B;  1N4M A;  4YOS A;  4EOP B;  4CFM B;  2V22 B;  1H27 B;  2W9F A;  4II5 B;  1UNH D;  4KRD B;  2IW8 B;  1OL1 B;  4CRL B;  1H1P B;  4BCJ B;  3EID B;  2PMI B;  5LQF B;  5CYI B;  1AIS B;  4KRC B;  2PHG A;  3TNW B;  5CEI B;  4TTH A;  1AD6 A;  4YC3 B;  5HNB B;  3EOC B;  2CCI B;  1GUX A;  2CCH B;  4CFU D;  4ELJ A;  1O9K B;  1OL2 B;  3POM A;  4CXA B;  1JOW A;  1XO2 A;  4BCG B;  2UUE B;  4EOM B;  2WHB B;  4BCH B;  1TFB A;  4Y72 B;  1H1Q B;  5IDP B;  1OI9 B;  3G33 B;  5FGK B;  4EOO B;  4F7S B;  4BCM B;  4CFV B;  4G6L B;  2UZL B;  5HQ0 B;  5L2W B;  4ROC A;  3M03 A;  5EFQ B;  5I5Z B;  3DDP B;  4F6W B;  4OGR B;  4EC9 B;  4BCO B;  3EJ1 B;  1H26 B;  2WMA B;  3QHR B;  1URC B;  4BCN D;  2UZB B;  4FX3 B;  4EOS B;  2C4G B;  2EUF A;  1GH6 B;  1UNG D;  2JGZ B;  2W96 A;  2IW6 B;  2PK9 B;  4F7J B;  5IF1 B;  5LMK B;  3MY5 B;  2IVX A;  1FVV B;  3K7A M;  1H25 B;  3DDQ B;  2W9Z A;  3MI9 B;  1PKD B;  2WMB B;  4CFU B;  2UZD B;  2C5O B;  2W99 A;  1VOL A;  4F70 B;  1UNL D;  4F6S B;  3BHV B;  1H24 B;  4ROE A;  4BCF B;  4CFN B;  2BPM B;  5HVY B;  1C9B A;  1H1S B;  1VIN A;  5HBH B;  2WIH B;  4EOR B;  2W2H A;  3BHU B;  4YOO A;  3TNH B;  3TNI B;  4UN0 A;  4EOJ B;  4BCI B;  2QDJ A;  1QMZ B;  1ZP2 A;  4BCK B;  5BNJ B;  1H28 B;  3BLH B;  3LQ5 B;  4EOQ B;  1D3U B;  4CFX B;  1BU2 A;  5ICP B;  2WXV B;  5HBE B;  4BCN B;  2WIP B;  4ELL A;  1H1R B;  1JST B;  4EOI B;  1O9K A;  3BHT B;  2X1N B;  2IW9 B;  4EC8 B;  5IDN B;  1JKW A;  2WFY B;  4BCQ D;  5HBJ B;  1G3N C;  2I40 B;  5ACB A;  3TN8 B;  2B9R A;  3QHW B;  3BLQ B;  3DOG B;  3MIA B;  4EOL B;  4YOZ A;  1W98 B;  4BCP B;  1OGU B;  2C6T B;  2CJM B;  2F2C A;  4F7N B;  2I53 A;  2R7G A;  4NST B;  2C5X B;  4I3Z B;  1KXU A;  1P5E B;  4IMY B;  1FIN B;  4EOK B;  3H4C A;  2PK2 A;  4ROD A;  1GUX B;  2WPA B;  3MY1 B;  4CFW B;  4F6U B;  3RGF B;  1OKV B;  1E9H B;  4OR5 B;  4F7L B;  4BCM D;  2C5N B;  2UZE B;  2C5V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...