4BCKB

Structure of cdk2 in complex with cyclin a and a 2-amino-4-heteroaryl- pyrimidine inhibitor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
257
structure length
257
Chain Sequence
PDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/cell cycle
molecule keywords CYCLIN-DEPENDENT KINASE 2
publication title Comparative Structural and Functional Studies of 4-(Thiazol- 5-Yl)-2-(Phenylamino)Pyrimidine-5-Carbonitrile Cdk9 Inhibitors Suggest the Basis for Isotype Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 257
sequence length 257
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4bckB02
3M03A 4F6UB 3BHVB 3BLRB 2PK9B 5HBEB 2C4GB 2UZLB 4CFNB 1KXUA 4BCQB 1H1RB 4CRLB 2C5NB 3TN8B 5HNBB 4IMYB 4F7LB 1OKWB 2IW9B 1H28B 1XO2A 4CFUD 1GH6B 1JSTB 4BCHB 5HVYB 4KRCB 2QDJA 2X1NB 3BHUB 2WHBB 2UUEB 4BCKB 2W9ZA 1H24B 1FVVB 1JOWA 2BPMB 2F2CA 4BCJB 4BCPB 5HBJB 4BCQD 4F7SB 5BNJB 1OI9B 3MY5B 2WEVB 4EOQB 5IDPB 2G9XB 4EONB 2I40B 2IVXA 4EOOB 5CEIB 3DDQB 3EIDB 2W99A 1OGUB 1H1SB 1H25B 1OL2B 5IDNB 5IF1B 5HQ0B 1JSUB 3MI9B 2V22B 4EOMB 3LQ5B 4F70B 2WIHB 4EOPB 2W9FA 2WPAB 1JKWA 3DDPB 4OR5B 1C9BA 1GY3B 2IW6B 5CYIB 2PMIB 4OGRB 3K7AM 4F7JB 1GUXA 3EJ1B 4ROCA 1AISB 3MY1B 1H1PB 1OIUB 4BCGB 4F7NB 5ACBA 4CXAB 3TNHB 1QMZB 3F5XB 2C5XB 4CFXB 1FINB 2CCHB 4NSTB 2UZBB 1OL1B 4EORB 2PK2A 2WMBB 1VYWB 4EOIB 2IW8B 3BLHB 4YC3B 4CFMB 4EC9B 4YOSA 1URCB 4BCIB 2WFYB 2CCIB 4UN0A 4II5B 3QHRB 1H4LD 2C6TB 2WMAB 3BLQB 4CFVB 2R7GA 4BCMB 3MIAB 4I3ZB 4TTHA 4ELLA 1H27B 4CFWB 2C5VB 3O0GD 3POMA 2B9RA 1BU2A 1UNGD 5LMKB 1O9KB 1UNHD 2W96A 1N4MA 4ELJA 2WIPB 5FGKB 5I5ZB 4EOLB 4BCNB 3EOCB 4YOZA 3TNIB 5HBHB 2UZEB 3TNWB 1OKVB 4BCOB 1OIYB 4FX3B 3H4CA 1VOLA 4BCFB 1G3NC 1P5EB 4G6LB 1AD6A 3QHWB 4ROEA 4EC8B 2I53A 1H1QB 3G33B 4BCMD 1PKDB 5EFQB 4EOKB 2EUFA 1O9KA 2BKZB 1VINA 4EOSB 3BHTB 1F5QB 5L2WB 5LQFB 1D3UB 2WXVB 2CJMB 1E9HB 2C5OB 1UNLD 2JGZB 4BCND 4KRDB 4F6WB 4EOJB 3DOGB 1H26B 2UZDB 4Y72B 3RGFB 4CFUB 5ICPB 4RODA 1ZP2A 4YOOA 1GUXB 2W2HA 4F6SB 2PHGA 1W98B 1TFBA
chains in the Genus database with same CATH superfamily
4NC6A 4HL4A 2C4GB 2ZPBB 2C5NB 2CZ0B 4FM4B 4IMYB 3GTMS 3QYBA 1GH6B 4KRCB 2X1NB 3A8OB 4JX4A 1TD6A 1H24B 4AI6A 2BPMB 2F2CA 2CZ1B 4HLQA 3X20B 1H1SB 4EOMB 4F70B 4OR5B 2CZ7B 3WVEB 4OGRB 1H1PB 5ACBA 2QGSA 3TNHB 2CCHB 2UZBB 3X26B 3BLHB 4YC3B 2AHJB 4YOSA 1URCB 2CCIB 2KR6A 3QYHB 4II5B 3A8HB 3MIAB 4CFWB 3DJBA 3HB9A 1O9KB 2WIPB 4EOLB 4BCNB 4YOZA 5HBHB 1OIYB 4BCFB 4G6LB 1AD6A 2I53A 1UGQB 2ZCFB 4AKHA 1F5QB 3QZ9B 1D3UB 2CJMB 1AHJB 2JGZB 4BCND 1E7PA 4EOJB 1H26B 4Y72B 5ICPB 4RODA 4YOOA 3QZ5B 2W2HA 1W98B 3M03A 4F6UB 3BHVB 2PK9B 1KXUA 4BY1X 2BS2A 2WJ9A 1UGSB 5HNBB 4F7LB 1V29B 3NDQA 1OKWB 2IW9B 1H28B 2ZPHB 4M6VA 4HNTA 2DMEA 2IN3A 2LW4A 4OB1B 1JOWA 4BCJB 4BCPB 5HBJB 4F7SB 5BNJB 5IDPB 2WEVB 4EOQB 2G9XB 4EONB 3HBLA 3DDQB 2G77A 1OGUB 1OL2B 3A8MB 1UGPB 5IF1B 4OB2B 1JSUB 3MI9B 2W9FA 1JKWA 3A8LB 5EJCA 3HO8A 2ZPIB 3K7AM 4ROCA 4MIMA 3MY1B 1OIUB 4F7NB 3DL1A 2BS3A 2C5XB 1FINB 4HNVA 2QQ8A 4EORB 4EOIB 2IW8B 4EC9B 2KMGA 2WFYB 4LOCA 3QHRB 2WMAB 4BCMB 4TTHA 2C5VB 3O0GD 3POMA 2B9RA 4BXXX 3TNIB 4ZGDB 4Z6YA 2UZEB 3TNWB 1OKVB 5DQVA 1VOLA 4EC8B 3QHWB 3G33B 4BCMD 5EFQB 1O9KA 3BHTB 1E9HB 2C5OB 1UNLD 4MFDA 4QSHA 2D0QB 3DOGB 2UZDB 3QWLA 1TFBA 4JX5A 3BLRB 3WVDB 3QYGB 1FKMA 4BCQB 2PJQA 1QLBA 4ZGJB 2DXCB 3VKHA 3TW7A 5HVYB 1JSTB 2WHBB 2UUEB 3A8GB 4BCKB 1FVVB 4BBRM 4BCQD 1OI9B 4MFEA 3QXEB 4EOOB 1H25B 3X24B 3LQ5B 2WIHB 2WPAB 2DPPB 5CYIB 3HHTB 1GUXA 4JX6A 2ZPGB 2BS4A 4BCGB 3VYHB 1QMZB 3HZJA 4CFXB 2ZPFB 4NSTB 1OL1B 2PK2A 2WMBB 1VYWB 4OB0B 2C6TB 4CFVB 2CYZB 4I3ZB 3X28B 2QF7A 1UNGD 2W96A 4HNUA 3EOCB 4OB3B 3X25B 1G3NC 4ROEA 1H1QB 2EUFA 2BKZB 1VINA 2CZ6B 4EOSB 5L2WB 2DD4B 2QFZA 4CFUB 4F6SB 2PHGA 3TW6A 5HBEB 2UZLB 4CFNB 1H1RB 1IREB 4CRLB 3BG5A 3TN8B 1UGRB 2ZPEB 1XO2A 4CFUD 4BCHB 2QDJA 3BHUB 2W9ZA 3BG3A 4AKIA 3B57A 3MY5B 5CEIB 2I40B 2IVXA 3EIDB 2W99A 2DXBB 5IDNB 5HQ0B 2V22B 5DQWA 2QDYB 4EOPB 3DDPB 1C9BA 3PO3S 2DD5B 1GY3B 2IW6B 2PMIB 4F7JB 3EJ1B 1AISB 4BY7X 4CXAB 3F5XB 4CFMB 1ENWA 4BCIB 4UN0A 4BBSM 1H4LD 2ZZDB 3BLQB 3VYGB 2R7GA 4ELLA 1H27B 5IHYA 3DTOA 1BU2A 5LMKB 1UNHD 1N4MA 4ELJA 5FGKB 5I5ZB 4AKGA 3QYEA 4BCOB 4FX3B 3H4CA 1P5EB 1PKDB 3KHIA 3VKGA 5LQFB 2WXVB 4KRDB 4F6WB 3BG9A 4ZGEB 3RGFB 1ZP2A 1GUXB 4EOKB
chains in the Genus database with same CATH topology
3M03A 4F6UB 3BHVB 3BLRB 2PK9B 5HBEB 2C4GB 2UZLB 4CFNB 1KXUA 4BCQB 1H1RB 4CRLB 2C5NB 3TN8B 5HNBB 4IMYB 4F7LB 1OKWB 2IW9B 1H28B 1XO2A 4CFUD 1GH6B 1JSTB 4BCHB 5HVYB 4KRCB 2QDJA 2X1NB 3BHUB 2WHBB 2UUEB 4BCKB 2W9ZA 1H24B 1FVVB 1JOWA 2BPMB 2F2CA 4BCJB 4BCPB 5HBJB 4BCQD 4F7SB 5BNJB 1OI9B 3MY5B 2WEVB 4EOQB 5IDPB 2G9XB 4EONB 2I40B 2IVXA 4EOOB 5CEIB 3DDQB 3EIDB 2W99A 1OGUB 1H1SB 1H25B 1OL2B 5IDNB 5IF1B 5HQ0B 1JSUB 3MI9B 2V22B 4EOMB 3LQ5B 4F70B 2WIHB 4EOPB 2W9FA 2WPAB 1JKWA 3DDPB 4OR5B 1C9BA 1GY3B 2IW6B 5CYIB 2PMIB 4OGRB 3K7AM 4F7JB 1GUXA 3EJ1B 4ROCA 1AISB 3MY1B 1H1PB 1OIUB 4BCGB 4F7NB 5ACBA 4CXAB 3TNHB 1QMZB 3F5XB 2C5XB 4CFXB 1FINB 2CCHB 4NSTB 2UZBB 1OL1B 4EORB 2PK2A 2WMBB 1VYWB 4EOIB 2IW8B 3BLHB 4YC3B 4CFMB 4EC9B 4YOSA 1URCB 4BCIB 2WFYB 2CCIB 4UN0A 4II5B 3QHRB 1H4LD 2C6TB 2WMAB 3BLQB 4CFVB 2R7GA 4BCMB 3MIAB 4I3ZB 4TTHA 4ELLA 1H27B 4CFWB 2C5VB 3O0GD 3POMA 2B9RA 1BU2A 1UNGD 5LMKB 1O9KB 1UNHD 2W96A 1N4MA 4ELJA 2WIPB 5FGKB 5I5ZB 4EOLB 4BCNB 3EOCB 4YOZA 3TNIB 5HBHB 2UZEB 3TNWB 1OKVB 4BCOB 1OIYB 4FX3B 3H4CA 1VOLA 4BCFB 1G3NC 1P5EB 4G6LB 1AD6A 3QHWB 4ROEA 4EC8B 2I53A 1H1QB 3G33B 4BCMD 1PKDB 5EFQB 4EOKB 2EUFA 1O9KA 2BKZB 1VINA 4EOSB 3BHTB 1F5QB 5L2WB 5LQFB 1D3UB 2WXVB 2CJMB 1E9HB 2C5OB 1UNLD 2JGZB 4BCND 4KRDB 4F6WB 4EOJB 3DOGB 1H26B 2UZDB 4Y72B 3RGFB 4CFUB 5ICPB 4RODA 1ZP2A 4YOOA 1GUXB 2W2HA 4F6SB 2PHGA 1W98B 1TFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M03 A;  4F6U B;  3BHV B;  3BLR B;  2PK9 B;  5HBE B;  2C4G B;  2UZL B;  4CFN B;  1KXU A;  4BCQ B;  1H1R B;  4CRL B;  2C5N B;  3TN8 B;  5HNB B;  4IMY B;  4F7L B;  1OKW B;  2IW9 B;  1H28 B;  1XO2 A;  4CFU D;  1GH6 B;  1JST B;  4BCH B;  5HVY B;  4KRC B;  2QDJ A;  2X1N B;  3BHU B;  2WHB B;  2UUE B;  4BCK B;  2W9Z A;  1H24 B;  1FVV B;  1JOW A;  2BPM B;  2F2C A;  4BCJ B;  4BCP B;  5HBJ B;  4BCQ D;  4F7S B;  5BNJ B;  1OI9 B;  3MY5 B;  2WEV B;  4EOQ B;  5IDP B;  2G9X B;  4EON B;  2I40 B;  2IVX A;  4EOO B;  5CEI B;  3DDQ B;  3EID B;  2W99 A;  1OGU B;  1H1S B;  1H25 B;  1OL2 B;  5IDN B;  5IF1 B;  5HQ0 B;  1JSU B;  3MI9 B;  2V22 B;  4EOM B;  3LQ5 B;  4F70 B;  2WIH B;  4EOP B;  2W9F A;  2WPA B;  1JKW A;  3DDP B;  4OR5 B;  1C9B A;  1GY3 B;  2IW6 B;  5CYI B;  2PMI B;  4OGR B;  3K7A M;  4F7J B;  1GUX A;  3EJ1 B;  4ROC A;  1AIS B;  3MY1 B;  1H1P B;  1OIU B;  4BCG B;  4F7N B;  5ACB A;  4CXA B;  3TNH B;  1QMZ B;  3F5X B;  2C5X B;  4CFX B;  1FIN B;  2CCH B;  4NST B;  2UZB B;  1OL1 B;  4EOR B;  2PK2 A;  2WMB B;  1VYW B;  4EOI B;  2IW8 B;  3BLH B;  4YC3 B;  4CFM B;  4EC9 B;  4YOS A;  1URC B;  4BCI B;  2WFY B;  2CCI B;  4UN0 A;  4II5 B;  3QHR B;  1H4L D;  2C6T B;  2WMA B;  3BLQ B;  4CFV B;  2R7G A;  4BCM B;  3MIA B;  4I3Z B;  4TTH A;  4ELL A;  1H27 B;  4CFW B;  2C5V B;  3O0G D;  3POM A;  2B9R A;  1BU2 A;  1UNG D;  5LMK B;  1O9K B;  1UNH D;  2W96 A;  1N4M A;  4ELJ A;  2WIP B;  5FGK B;  5I5Z B;  4EOL B;  4BCN B;  3EOC B;  4YOZ A;  3TNI B;  5HBH B;  2UZE B;  3TNW B;  1OKV B;  4BCO B;  1OIY B;  4FX3 B;  3H4C A;  1VOL A;  4BCF B;  1G3N C;  1P5E B;  4G6L B;  1AD6 A;  3QHW B;  4ROE A;  4EC8 B;  2I53 A;  1H1Q B;  3G33 B;  4BCM D;  1PKD B;  5EFQ B;  4EOK B;  2EUF A;  1O9K A;  2BKZ B;  1VIN A;  4EOS B;  3BHT B;  1F5Q B;  5L2W B;  5LQF B;  1D3U B;  2WXV B;  2CJM B;  1E9H B;  2C5O B;  1UNL D;  2JGZ B;  4BCN D;  4KRD B;  4F6W B;  4EOJ B;  3DOG B;  1H26 B;  2UZD B;  4Y72 B;  3RGF B;  4CFU B;  5ICP B;  4ROD A;  1ZP2 A;  4YOO A;  1GUX B;  2W2H A;  4F6S B;  2PHG A;  1W98 B;  1TFB A; 
#chains in the Genus database with same CATH topology
 4NC6 A;  4HL4 A;  2C4G B;  2ZPB B;  2C5N B;  2CZ0 B;  4FM4 B;  4IMY B;  3GTM S;  3QYB A;  1GH6 B;  4KRC B;  2X1N B;  3A8O B;  4JX4 A;  1TD6 A;  1H24 B;  4AI6 A;  2BPM B;  2F2C A;  2CZ1 B;  4HLQ A;  3X20 B;  1H1S B;  4EOM B;  4F70 B;  4OR5 B;  2CZ7 B;  3WVE B;  4OGR B;  1H1P B;  5ACB A;  2QGS A;  3TNH B;  2CCH B;  2UZB B;  3X26 B;  3BLH B;  4YC3 B;  2AHJ B;  4YOS A;  1URC B;  2CCI B;  2KR6 A;  3QYH B;  4II5 B;  3A8H B;  3MIA B;  4CFW B;  3DJB A;  3HB9 A;  1O9K B;  2WIP B;  4EOL B;  4BCN B;  4YOZ A;  5HBH B;  1OIY B;  4BCF B;  4G6L B;  1AD6 A;  2I53 A;  1UGQ B;  2ZCF B;  4AKH A;  1F5Q B;  3QZ9 B;  1D3U B;  2CJM B;  1AHJ B;  2JGZ B;  4BCN D;  1E7P A;  4EOJ B;  1H26 B;  4Y72 B;  5ICP B;  4ROD A;  4YOO A;  3QZ5 B;  2W2H A;  1W98 B;  3M03 A;  4F6U B;  3BHV B;  2PK9 B;  1KXU A;  4BY1 X;  2BS2 A;  2WJ9 A;  1UGS B;  5HNB B;  4F7L B;  1V29 B;  3NDQ A;  1OKW B;  2IW9 B;  1H28 B;  2ZPH B;  4M6V A;  4HNT A;  2DME A;  2IN3 A;  2LW4 A;  4OB1 B;  1JOW A;  4BCJ B;  4BCP B;  5HBJ B;  4F7S B;  5BNJ B;  5IDP B;  2WEV B;  4EOQ B;  2G9X B;  4EON B;  3HBL A;  3DDQ B;  2G77 A;  1OGU B;  1OL2 B;  3A8M B;  1UGP B;  5IF1 B;  4OB2 B;  1JSU B;  3MI9 B;  2W9F A;  1JKW A;  3A8L B;  5EJC A;  3HO8 A;  2ZPI B;  3K7A M;  4ROC A;  4MIM A;  3MY1 B;  1OIU B;  4F7N B;  3DL1 A;  2BS3 A;  2C5X B;  1FIN B;  4HNV A;  2QQ8 A;  4EOR B;  4EOI B;  2IW8 B;  4EC9 B;  2KMG A;  2WFY B;  4LOC A;  3QHR B;  2WMA B;  4BCM B;  4TTH A;  2C5V B;  3O0G D;  3POM A;  2B9R A;  4BXX X;  3TNI B;  4ZGD B;  4Z6Y A;  2UZE B;  3TNW B;  1OKV B;  5DQV A;  1VOL A;  4EC8 B;  3QHW B;  3G33 B;  4BCM D;  5EFQ B;  1O9K A;  3BHT B;  1E9H B;  2C5O B;  1UNL D;  4MFD A;  4QSH A;  2D0Q B;  3DOG B;  2UZD B;  3QWL A;  1TFB A;  4JX5 A;  3BLR B;  3WVD B;  3QYG B;  1FKM A;  4BCQ B;  2PJQ A;  1QLB A;  4ZGJ B;  2DXC B;  3VKH A;  3TW7 A;  5HVY B;  1JST B;  2WHB B;  2UUE B;  3A8G B;  4BCK B;  1FVV B;  4BBR M;  4BCQ D;  1OI9 B;  4MFE A;  3QXE B;  4EOO B;  1H25 B;  3X24 B;  3LQ5 B;  2WIH B;  2WPA B;  2DPP B;  5CYI B;  3HHT B;  1GUX A;  4JX6 A;  2ZPG B;  2BS4 A;  4BCG B;  3VYH B;  1QMZ B;  3HZJ A;  4CFX B;  2ZPF B;  4NST B;  1OL1 B;  2PK2 A;  2WMB B;  1VYW B;  4OB0 B;  2C6T B;  4CFV B;  2CYZ B;  4I3Z B;  3X28 B;  2QF7 A;  1UNG D;  2W96 A;  4HNU A;  3EOC B;  4OB3 B;  3X25 B;  1G3N C;  4ROE A;  1H1Q B;  2EUF A;  2BKZ B;  1VIN A;  2CZ6 B;  4EOS B;  5L2W B;  2DD4 B;  2QFZ A;  4CFU B;  4F6S B;  2PHG A;  3TW6 A;  5HBE B;  2UZL B;  4CFN B;  1H1R B;  1IRE B;  4CRL B;  3BG5 A;  3TN8 B;  1UGR B;  2ZPE B;  1XO2 A;  4CFU D;  4BCH B;  2QDJ A;  3BHU B;  2W9Z A;  3BG3 A;  4AKI A;  3B57 A;  3MY5 B;  5CEI B;  2I40 B;  2IVX A;  3EID B;  2W99 A;  2DXB B;  5IDN B;  5HQ0 B;  2V22 B;  5DQW A;  2QDY B;  4EOP B;  3DDP B;  1C9B A;  3PO3 S;  2DD5 B;  1GY3 B;  2IW6 B;  2PMI B;  4F7J B;  3EJ1 B;  1AIS B;  4BY7 X;  4CXA B;  3F5X B;  4CFM B;  1ENW A;  4BCI B;  4UN0 A;  4BBS M;  1H4L D;  2ZZD B;  3BLQ B;  3VYG B;  2R7G A;  4ELL A;  1H27 B;  5IHY A;  3DTO A;  1BU2 A;  5LMK B;  1UNH D;  1N4M A;  4ELJ A;  5FGK B;  5I5Z B;  4AKG A;  3QYE A;  4BCO B;  4FX3 B;  3H4C A;  1P5E B;  1PKD B;  3KHI A;  3VKG A;  5LQF B;  2WXV B;  4KRD B;  4F6W B;  3BG9 A;  4ZGE B;  3RGF B;  1ZP2 A;  1GUX B;  4EOK B; 
#chains in the Genus database with same CATH homology
 3M03 A;  4F6U B;  3BHV B;  3BLR B;  2PK9 B;  5HBE B;  2C4G B;  2UZL B;  4CFN B;  1KXU A;  4BCQ B;  1H1R B;  4CRL B;  2C5N B;  3TN8 B;  5HNB B;  4IMY B;  4F7L B;  1OKW B;  2IW9 B;  1H28 B;  1XO2 A;  4CFU D;  1GH6 B;  1JST B;  4BCH B;  5HVY B;  4KRC B;  2QDJ A;  2X1N B;  3BHU B;  2WHB B;  2UUE B;  4BCK B;  2W9Z A;  1H24 B;  1FVV B;  1JOW A;  2BPM B;  2F2C A;  4BCJ B;  4BCP B;  5HBJ B;  4BCQ D;  4F7S B;  5BNJ B;  1OI9 B;  3MY5 B;  2WEV B;  4EOQ B;  5IDP B;  2G9X B;  4EON B;  2I40 B;  2IVX A;  4EOO B;  5CEI B;  3DDQ B;  3EID B;  2W99 A;  1OGU B;  1H1S B;  1H25 B;  1OL2 B;  5IDN B;  5IF1 B;  5HQ0 B;  1JSU B;  3MI9 B;  2V22 B;  4EOM B;  3LQ5 B;  4F70 B;  2WIH B;  4EOP B;  2W9F A;  2WPA B;  1JKW A;  3DDP B;  4OR5 B;  1C9B A;  1GY3 B;  2IW6 B;  5CYI B;  2PMI B;  4OGR B;  3K7A M;  4F7J B;  1GUX A;  3EJ1 B;  4ROC A;  1AIS B;  3MY1 B;  1H1P B;  1OIU B;  4BCG B;  4F7N B;  5ACB A;  4CXA B;  3TNH B;  1QMZ B;  3F5X B;  2C5X B;  4CFX B;  1FIN B;  2CCH B;  4NST B;  2UZB B;  1OL1 B;  4EOR B;  2PK2 A;  2WMB B;  1VYW B;  4EOI B;  2IW8 B;  3BLH B;  4YC3 B;  4CFM B;  4EC9 B;  4YOS A;  1URC B;  4BCI B;  2WFY B;  2CCI B;  4UN0 A;  4II5 B;  3QHR B;  1H4L D;  2C6T B;  2WMA B;  3BLQ B;  4CFV B;  2R7G A;  4BCM B;  3MIA B;  4I3Z B;  4TTH A;  4ELL A;  1H27 B;  4CFW B;  2C5V B;  3O0G D;  3POM A;  2B9R A;  1BU2 A;  1UNG D;  5LMK B;  1O9K B;  1UNH D;  2W96 A;  1N4M A;  4ELJ A;  2WIP B;  5FGK B;  5I5Z B;  4EOL B;  4BCN B;  3EOC B;  4YOZ A;  3TNI B;  5HBH B;  2UZE B;  3TNW B;  1OKV B;  4BCO B;  1OIY B;  4FX3 B;  3H4C A;  1VOL A;  4BCF B;  1G3N C;  1P5E B;  4G6L B;  1AD6 A;  3QHW B;  4ROE A;  4EC8 B;  2I53 A;  1H1Q B;  3G33 B;  4BCM D;  1PKD B;  5EFQ B;  4EOK B;  2EUF A;  1O9K A;  2BKZ B;  1VIN A;  4EOS B;  3BHT B;  1F5Q B;  5L2W B;  5LQF B;  1D3U B;  2WXV B;  2CJM B;  1E9H B;  2C5O B;  1UNL D;  2JGZ B;  4BCN D;  4KRD B;  4F6W B;  4EOJ B;  3DOG B;  1H26 B;  2UZD B;  4Y72 B;  3RGF B;  4CFU B;  5ICP B;  4ROD A;  1ZP2 A;  4YOO A;  1GUX B;  2W2H A;  4F6S B;  2PHG A;  1W98 B;  1TFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...