1I49A

Crystal structure analysis of arfaptin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
201
structure length
201
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i49A00
2X3XA 3DYTA 3HAHA 1Y2OA 1X03A 3HAJA 3QWEA 2Q13A 2Z0VA 2EFKA 2D4CA 3ACOA 3OK8A 2RAKA 4I1QA 2Z0OA 4WPCA 5C5BB 4FZSA 4BNEA 2D1LA 2X3VA 4DYLA 4ATMA 5C5BA 3Q0KA 1I49A 4NQIA 2YKTA 2RAIA 4AKVA 2RAJA 1WDZA 3G9GA 3CAZA 1URUA 3Q84A 2C08A 3QE6A 1I4TA 2V0OA 2Z0NA 2Q12A 3M3WA 3QNIA 3SYVA 2FICA 2X3WA 3LLLA 4AVMA 1ZWWA 3ABHA 1I4DA 3HAIA 1X04A 2EFLA 3PLTA 2ELBA 4NSWA 3SOGA 4DCNC 4WPEA 3I2WA 1I4LA 4H8SA
chains in the Genus database with same CATH superfamily
4EZSA 3QWEA 3BVWA 1DKYA 4F01A 4AZCB 1OA1A 3QA8A 4R5LA 2F7QA 3I01A 3CZNA 3EJPA 4AVMA 3EJQA 4EZVA 2GF4A 1X04A 3SOGA 3I2WA 1HWWA 4FZOA 4I1QA 4DYLA 2LXYA 2RAIA 4EZRA 3G9GA 2GA9D 1E9VA 4JWIA 1O7DB 3PLTA 4NSWA 3EJSA 1U00A 1QWUA 4AZBA 4B9QA 2Z0VA 3DDGA 4EZTA 4WPCA 3KDRA 4R5IA 3KAWA 1OA0A 4E81A 1R33A 4FZPA 5TKYA 3C7NA 3Q84A 2QXLA 3QE6A 1I4TA 3ERCC 4EZQA 2X3XA 3KAVA 1SU8A 1X03A 3DX2A 2Z0OA 4FZSA 2EWFA 2YI9A 1MJGA 1QX1A 5FLEX 2NCZA 4NQIA 3D51A 2PMRA 4IM2A 3QNIA 4UDXX 2YLAA 4DCNC 5E84A 2JNKA 3ER9B 2RAKA 2F7OA 4FM3A 1GNTA 2GAFD 4UDYX 1SU7A 2V0OA 1JQKA 1HXKA 3LLLA 3O3NB 2YIVX 3D2EA 2YL8A 3DDFA 2WYHA 3BUIA 2N3KA 1E2UA 3BUQA 3HAHA 3HAJA 3BLBA 3OK8A 4BNEA 2F1AA 4R5GA 3CKDA 3ZEDA 4JNEA 2C08A 1O7DC 3T49A 4H8SA 3O3OB 3DPOA 3T48A 2X3VA 2PY6A 3Q0KA 4IWOA 4KIKA 2JNSA 1DKXA 1W9MA 3BUDA 3T46A 3DX4A 2OZNB 3O3MB 1GN9A 2Q12A 4EZOA 2OBLA 2WINM 1R5EA 3B52X 2F7PA 1GNLA 1OAOA 2Q13A 5KBPA 4EZXA 2OO2A 4EZYA 3D50A 4EZUA 4ATMA 3F7WA 4H6IA 4AZIA 3DPQA 2X3WA 4JL9A 2YIBA 4JLCA 3OHXM 1Y2OA 4HR1A 2EFKA 2YI8A 4AZ5A 4JN4A 2FYVA 2RAJA 4IWPA 1LQ7A 3CAZA 4AZ6A 2FICA 3BVUA 1ZWWA 3RV0A 1SUFA 1TQSA 3DX3A 3DX1A 3DYTA 2KHOA 4KIKB 3QNJA 4AKVA 3D4ZA 4M0MA 3DX0A 4EZNA 3EJRA 3GI7A 3T47A 1R34A 2OW7A 2QFFA 3L3OM 3CV5A 2MI7A 4AZ7A 5C5BA 2RT6A 3A98A 2YKTA 3OWGA 2YIAA 4IWQA 3LMFA 1I4DA 2EX3B 4EZPA 4WPEA 2ND0A 4HR1B 3UITA 3FD9A 4EZWA 4JNFA 2D4CA 2LM0A 3VEBA 2YLLA 4PO2A 4JWCA 3VKHA 1TQWA 4JWEA 3L3PA 3LVTA 3RPMA 3B53X 5FIGA 2D1LA 1I49A 3BUPA 1WDZA 3BUBA 1URUA 2QKWA 1E1DA 1DKZA 3RV1A 3ER8C 3T4AG 4IW0A 1YWMA 1QWNA 5C5BB 4H6HA 4IM3A 3BVTA 2YL5A 4AZCA 3I39X 3BVXA 2ND1A 4HYBA 3M3WA 4R5JA 3SYVA 2F1BA 1HTYA 2F7RA 1SU6A 3HAIA 2OW6A 4HY9A 3D4YA 4G6QA 4NPHA 3DPPA 3CZSA 3EJUA 2YL6A 1PS3A 4R5KA 2F18A 3BVVA 4D8JA 4IM0A 2Z8YA 2O0I1 3EJTA 4AZHA 1TQVA 1TQTA 4JWDA 3D2FA 3I04A 3ACOA 1TQUA 4AZGA 3D52A 4E3CA 2OBMA 1UPXA 2ALWA 4F00A 3B51X 3VEAA 4EZZA 2YL9A 2Z0NA 2ZXQA 3ABHA 3CVRA 2EFLA 2ELBA 2WYIA 1ZYLA 1I4LA 2X5CA
chains in the Genus database with same CATH topology
2X3XA 3DYTA 3HAHA 1Y2OA 1X03A 3HAJA 3QWEA 2Q13A 2Z0VA 2EFKA 2D4CA 3ACOA 3OK8A 2RAKA 4I1QA 2Z0OA 4WPCA 5C5BB 4FZSA 4BNEA 2D1LA 2X3VA 4DYLA 4ATMA 5C5BA 3Q0KA 1I49A 4NQIA 2YKTA 2RAIA 4AKVA 2RAJA 1WDZA 3G9GA 3CAZA 1URUA 3Q84A 2C08A 3QE6A 1I4TA 2V0OA 2Z0NA 2Q12A 3M3WA 3QNIA 3SYVA 2FICA 2X3WA 3LLLA 4AVMA 1ZWWA 3ABHA 1I4DA 3HAIA 1X04A 2EFLA 3PLTA 2ELBA 4NSWA 3SOGA 4DCNC 4WPEA 3I2WA 1I4LA 4H8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3X A;  3DYT A;  3HAH A;  1Y2O A;  1X03 A;  3HAJ A;  3QWE A;  2Q13 A;  2Z0V A;  2EFK A;  2D4C A;  3ACO A;  3OK8 A;  2RAK A;  4I1Q A;  2Z0O A;  4WPC A;  5C5B B;  4FZS A;  4BNE A;  2D1L A;  2X3V A;  4DYL A;  4ATM A;  5C5B A;  3Q0K A;  1I49 A;  4NQI A;  2YKT A;  2RAI A;  4AKV A;  2RAJ A;  1WDZ A;  3G9G A;  3CAZ A;  1URU A;  3Q84 A;  2C08 A;  3QE6 A;  1I4T A;  2V0O A;  2Z0N A;  2Q12 A;  3M3W A;  3QNI A;  3SYV A;  2FIC A;  2X3W A;  3LLL A;  4AVM A;  1ZWW A;  3ABH A;  1I4D A;  3HAI A;  1X04 A;  2EFL A;  3PLT A;  2ELB A;  4NSW A;  3SOG A;  4DCN C;  4WPE A;  3I2W A;  1I4L A;  4H8S A; 
#chains in the Genus database with same CATH topology
 4EZS A;  3QWE A;  3BVW A;  1DKY A;  4F01 A;  4AZC B;  1OA1 A;  3QA8 A;  4R5L A;  2F7Q A;  3I01 A;  3CZN A;  3EJP A;  4AVM A;  3EJQ A;  4EZV A;  2GF4 A;  1X04 A;  3SOG A;  3I2W A;  1HWW A;  4FZO A;  4I1Q A;  4DYL A;  2LXY A;  2RAI A;  4EZR A;  3G9G A;  2GA9 D;  1E9V A;  4JWI A;  1O7D B;  3PLT A;  4NSW A;  3EJS A;  1U00 A;  1QWU A;  4AZB A;  4B9Q A;  2Z0V A;  3DDG A;  4EZT A;  4WPC A;  3KDR A;  4R5I A;  3KAW A;  1OA0 A;  4E81 A;  1R33 A;  4FZP A;  5TKY A;  3C7N A;  3Q84 A;  2QXL A;  3QE6 A;  1I4T A;  3ERC C;  4EZQ A;  2X3X A;  3KAV A;  1SU8 A;  1X03 A;  3DX2 A;  2Z0O A;  4FZS A;  2EWF A;  2YI9 A;  1MJG A;  1QX1 A;  5FLE X;  2NCZ A;  4NQI A;  3D51 A;  2PMR A;  4IM2 A;  3QNI A;  4UDX X;  2YLA A;  4DCN C;  5E84 A;  2JNK A;  3ER9 B;  2RAK A;  2F7O A;  4FM3 A;  1GNT A;  2GAF D;  4UDY X;  1SU7 A;  2V0O A;  1JQK A;  1HXK A;  3LLL A;  3O3N B;  2YIV X;  3D2E A;  2YL8 A;  3DDF A;  2WYH A;  3BUI A;  2N3K A;  1E2U A;  3BUQ A;  3HAH A;  3HAJ A;  3BLB A;  3OK8 A;  4BNE A;  2F1A A;  4R5G A;  3CKD A;  3ZED A;  4JNE A;  2C08 A;  1O7D C;  3T49 A;  4H8S A;  3O3O B;  3DPO A;  3T48 A;  2X3V A;  2PY6 A;  3Q0K A;  4IWO A;  4KIK A;  2JNS A;  1DKX A;  1W9M A;  3BUD A;  3T46 A;  3DX4 A;  2OZN B;  3O3M B;  1GN9 A;  2Q12 A;  4EZO A;  2OBL A;  2WIN M;  1R5E A;  3B52 X;  2F7P A;  1GNL A;  1OAO A;  2Q13 A;  5KBP A;  4EZX A;  2OO2 A;  4EZY A;  3D50 A;  4EZU A;  4ATM A;  3F7W A;  4H6I A;  4AZI A;  3DPQ A;  2X3W A;  4JL9 A;  2YIB A;  4JLC A;  3OHX M;  1Y2O A;  4HR1 A;  2EFK A;  2YI8 A;  4AZ5 A;  4JN4 A;  2FYV A;  2RAJ A;  4IWP A;  1LQ7 A;  3CAZ A;  4AZ6 A;  2FIC A;  3BVU A;  1ZWW A;  3RV0 A;  1SUF A;  1TQS A;  3DX3 A;  3DX1 A;  3DYT A;  2KHO A;  4KIK B;  3QNJ A;  4AKV A;  3D4Z A;  4M0M A;  3DX0 A;  4EZN A;  3EJR A;  3GI7 A;  3T47 A;  1R34 A;  2OW7 A;  2QFF A;  3L3O M;  3CV5 A;  2MI7 A;  4AZ7 A;  5C5B A;  2RT6 A;  3A98 A;  2YKT A;  3OWG A;  2YIA A;  4IWQ A;  3LMF A;  1I4D A;  2EX3 B;  4EZP A;  4WPE A;  2ND0 A;  4HR1 B;  3UIT A;  3FD9 A;  4EZW A;  4JNF A;  2D4C A;  2LM0 A;  3VEB A;  2YLL A;  4PO2 A;  4JWC A;  3VKH A;  1TQW A;  4JWE A;  3L3P A;  3LVT A;  3RPM A;  3B53 X;  5FIG A;  2D1L A;  1I49 A;  3BUP A;  1WDZ A;  3BUB A;  1URU A;  2QKW A;  1E1D A;  1DKZ A;  3RV1 A;  3ER8 C;  3T4A G;  4IW0 A;  1YWM A;  1QWN A;  5C5B B;  4H6H A;  4IM3 A;  3BVT A;  2YL5 A;  4AZC A;  3I39 X;  3BVX A;  2ND1 A;  4HYB A;  3M3W A;  4R5J A;  3SYV A;  2F1B A;  1HTY A;  2F7R A;  1SU6 A;  3HAI A;  2OW6 A;  4HY9 A;  3D4Y A;  4G6Q A;  4NPH A;  3DPP A;  3CZS A;  3EJU A;  2YL6 A;  1PS3 A;  4R5K A;  2F18 A;  3BVV A;  4D8J A;  4IM0 A;  2Z8Y A;  2O0I 1;  3EJT A;  4AZH A;  1TQV A;  1TQT A;  4JWD A;  3D2F A;  3I04 A;  3ACO A;  1TQU A;  4AZG A;  3D52 A;  4E3C A;  2OBM A;  1UPX A;  2ALW A;  4F00 A;  3B51 X;  3VEA A;  4EZZ A;  2YL9 A;  2Z0N A;  2ZXQ A;  3ABH A;  3CVR A;  2EFL A;  2ELB A;  2WYI A;  1ZYL A;  1I4L A;  2X5C A; 
#chains in the Genus database with same CATH homology
 2X3X A;  3DYT A;  3HAH A;  1Y2O A;  1X03 A;  3HAJ A;  3QWE A;  2Q13 A;  2Z0V A;  2EFK A;  2D4C A;  3ACO A;  3OK8 A;  2RAK A;  4I1Q A;  2Z0O A;  4WPC A;  5C5B B;  4FZS A;  4BNE A;  2D1L A;  2X3V A;  4DYL A;  4ATM A;  5C5B A;  3Q0K A;  1I49 A;  4NQI A;  2YKT A;  2RAI A;  4AKV A;  2RAJ A;  1WDZ A;  3G9G A;  3CAZ A;  1URU A;  3Q84 A;  2C08 A;  3QE6 A;  1I4T A;  2V0O A;  2Z0N A;  2Q12 A;  3M3W A;  3QNI A;  3SYV A;  2FIC A;  2X3W A;  3LLL A;  4AVM A;  1ZWW A;  3ABH A;  1I4D A;  3HAI A;  1X04 A;  2EFL A;  3PLT A;  2ELB A;  4NSW A;  3SOG A;  4DCN C;  4WPE A;  3I2W A;  1I4L A;  4H8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...