1I49A

Crystal structure analysis of arfaptin
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
201
structure length
201
Chain Sequence
SRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYSLLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCKNGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAARLEYDAYRTDLEELSLGPRDAGTRGRLESAQATFQAHRDKYEKLRGDVAIKLKFLEENKIKVMHKQLLLFHNAVSAYFAGNQKQLEQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ARFAPTIN 2
publication title The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 97
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-02-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 1i49A00
3QNIA 3M3WA 4NQIA 4AVMA 3I2WA 4DCNC 3HAJA 3G9GA 4H8SA 2RAJA 2Z0VA 2X3WA 4BNEA 2X3XA 1I4LA 3LLLA 3Q84A 3QE6A 5C5BB 3SOGA 2C08A 5C5BA 4NSWA 2RAKA 4WPCA 2ELBA 1ZWWA 3HAHA 4ATMA 3PLTA 4AKVA 3SYVA 3QWEA 1I4TA 2YKTA 2D4CA 3ACOA 3Q0KA 4I1QA 1I4DA 1X04A 3CAZA 2Q13A 2EFLA 1Y2OA 3HAIA 2RAIA 1WDZA 1URUA 2Z0NA 2D1LA 3DYTA 4DYLA 2FICA 4FZSA 2X3VA 4WPEA 2EFKA 1X03A 2Q12A 3ABHA 3OK8A 2V0OA 1I49A 2Z0OA
chains in the Genus database with same CATH superfamily
1OAOA 4AVMA 3ER9B 3I2WA 2F18A 2X3WA 1I4LA 3BUBA 3BVTA 4B9QA 2YIAA 4EZRA 3CZNA 3HAHA 4IWOA 4AKVA 3UITA 2EWFA 1WDZA 1TQWA 1DKYA 2JNKA 3DPOA 4WPCA 4EZQA 1DKZA 4JN4A 2Z0VA 2C08A 3D4ZA 2ND1A 3BVVA 3DPQA 1OA0A 1JQKA 3ERCC 1SU7A 2RAIA 2FICA 3CZSA 3EJRA 5FLEX 3QNIA 5C5BB 3A98A 2RAKA 1O7DB 2PY6A 4NPHA 3T49A 1OA1A 3CAZA 3VKHA 2QKWA 5E84A 1ZYLA 3KAVA 4BNEA 2YLLA 4EZVA 2LXYA 1E9VA 1R33A 3SYVA 4IM3A 4HY9A 3ACOA 3QNJA 3I01A 4I1QA 1X04A 1URUA 2Z0NA 4EZOA 3BUDA 2X3VA 3LMFA 4JWIA 3ZEDA 4EZSA 1GN9A 3T46A 4KIKA 3BUIA 1U00A 4H6HA 4E81A 3QWEA 4EZWA 3T4AG 3BVWA 4R5GA 4D8JA 2RT6A 4EZPA 4JWEA 2EX3B 5TKYA 2YL6A 3ER8C 2N3KA 3EJQA 2YLAA 4HR1B 3SOGA 5KBPA 1YWMA 3PLTA 2OW6A 2F7RA 3T47A 2GF4A 3F7WA 3B51X 3O3NB 1MJGA 2F7PA 2X5CA 4AZ7A 4IM0A 4EZUA 4WPEA 3ABHA 2F7OA 1SUFA 3M3WA 3OHXM 4FZOA 1TQUA 2OW7A 4NSWA 1TQTA 3VEBA 2OBLA 5FIGA 1E2UA 4AZHA 4E3CA 3EJPA 4AZCA 4FZPA 4F00A 4EZTA 4IWPA 4AZBA 4UDYX 2F1AA 4JLCA 3KDRA 2YL8A 3VEAA 2Z8YA 1LQ7A 2GA9D 4EZYA 1E1DA 3RPMA 3HAJA 4AZ5A 3OWGA 4F01A 3B52X 2O0I1 3D52A 4FM3A 2ZXQA 1PS3A 4DYLA 4FZSA 2ND0A 2EFKA 4JWDA 3I04A 3KAWA 3O3MB 3L3OM 3D50A 1ZWWA 3Q0KA 2WYHA 2YL9A 1R5EA 4JWCA 3CVRA 4G6QA 3BUPA 2Z0OA 4R5KA 3DX4A 4EZZA 1SU8A 2RAJA 2YI9A 3RV1A 3LVTA 1I4TA 2F1BA 2F7QA 4JNEA 2Q13A 4JL9A 3DYTA 1TQSA 3D4YA 4PO2A 4HYBA 2YIVX 2OZNB 4EZXA 2QFFA 4AZCB 1GNTA 3T48A 4M0MA 1QWNA 4R5IA 2GAFD 1I49A 1QWUA 3L3PA 3G9GA 4UDXX 4H6IA 2QXLA 3QE6A 4HR1A 1HTYA 2YL5A 2ELBA 4ATMA 3DPPA 1DKXA 1I4DA 1HXKA 3BLBA 3I39X 2EFLA 4AZGA 3BVXA 3DX1A 3D2FA 4EZNA 4IW0A 1O7DC 2OO2A 1QX1A 4JNFA 4NQIA 3RV0A 3CKDA 4H8SA 1HWWA 2X3XA 3LLLA 4KIKB 3D51A 3CV5A 3BUQA 3DDFA 4AZIA 3EJTA 3EJSA 3DX3A 1Y2OA 2MI7A 2D1LA 1X03A 4AZ6A 4R5JA 2WYIA 3DDGA 3DX0A 4DCNC 2LM0A 3B53X 1SU6A 3Q84A 2FYVA 5C5BA 3C7NA 2YI8A 2D4CA 1R34A 2WINM 2KHOA 3HAIA 3EJUA 3D2EA 1GNLA 2JNSA 2YIBA 2V0OA 2PMRA 1TQVA 3BVUA 3FD9A 3DX2A 4R5LA 4IWQA 2YKTA 4IM2A 3QA8A 2OBMA 1UPXA 3GI7A 2NCZA 2Q12A 3O3OB 3OK8A 2ALWA 1W9MA
chains in the Genus database with same CATH topology
3QNIA 3M3WA 4NQIA 4AVMA 3I2WA 4DCNC 3HAJA 3G9GA 4H8SA 2RAJA 2Z0VA 2X3WA 4BNEA 2X3XA 1I4LA 3LLLA 3Q84A 3QE6A 5C5BB 3SOGA 2C08A 5C5BA 4NSWA 2RAKA 4WPCA 2ELBA 1ZWWA 3HAHA 4ATMA 3PLTA 4AKVA 3SYVA 3QWEA 1I4TA 2YKTA 2D4CA 3ACOA 3Q0KA 4I1QA 1I4DA 1X04A 3CAZA 2Q13A 2EFLA 1Y2OA 3HAIA 2RAIA 1WDZA 1URUA 2Z0NA 2D1LA 3DYTA 4DYLA 2FICA 4FZSA 2X3VA 4WPEA 2EFKA 1X03A 2Q12A 3ABHA 3OK8A 2V0OA 1I49A 2Z0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNI A;  3M3W A;  4NQI A;  4AVM A;  3I2W A;  4DCN C;  3HAJ A;  3G9G A;  4H8S A;  2RAJ A;  2Z0V A;  2X3W A;  4BNE A;  2X3X A;  1I4L A;  3LLL A;  3Q84 A;  3QE6 A;  5C5B B;  3SOG A;  2C08 A;  5C5B A;  4NSW A;  2RAK A;  4WPC A;  2ELB A;  1ZWW A;  3HAH A;  4ATM A;  3PLT A;  4AKV A;  3SYV A;  3QWE A;  1I4T A;  2YKT A;  2D4C A;  3ACO A;  3Q0K A;  4I1Q A;  1I4D A;  1X04 A;  3CAZ A;  2Q13 A;  2EFL A;  1Y2O A;  3HAI A;  2RAI A;  1WDZ A;  1URU A;  2Z0N A;  2D1L A;  3DYT A;  4DYL A;  2FIC A;  4FZS A;  2X3V A;  4WPE A;  2EFK A;  1X03 A;  2Q12 A;  3ABH A;  3OK8 A;  2V0O A;  1I49 A;  2Z0O A; 
#chains in the Genus database with same CATH topology
 1OAO A;  4AVM A;  3ER9 B;  3I2W A;  2F18 A;  2X3W A;  1I4L A;  3BUB A;  3BVT A;  4B9Q A;  2YIA A;  4EZR A;  3CZN A;  3HAH A;  4IWO A;  4AKV A;  3UIT A;  2EWF A;  1WDZ A;  1TQW A;  1DKY A;  2JNK A;  3DPO A;  4WPC A;  4EZQ A;  1DKZ A;  4JN4 A;  2Z0V A;  2C08 A;  3D4Z A;  2ND1 A;  3BVV A;  3DPQ A;  1OA0 A;  1JQK A;  3ERC C;  1SU7 A;  2RAI A;  2FIC A;  3CZS A;  3EJR A;  5FLE X;  3QNI A;  5C5B B;  3A98 A;  2RAK A;  1O7D B;  2PY6 A;  4NPH A;  3T49 A;  1OA1 A;  3CAZ A;  3VKH A;  2QKW A;  5E84 A;  1ZYL A;  3KAV A;  4BNE A;  2YLL A;  4EZV A;  2LXY A;  1E9V A;  1R33 A;  3SYV A;  4IM3 A;  4HY9 A;  3ACO A;  3QNJ A;  3I01 A;  4I1Q A;  1X04 A;  1URU A;  2Z0N A;  4EZO A;  3BUD A;  2X3V A;  3LMF A;  4JWI A;  3ZED A;  4EZS A;  1GN9 A;  3T46 A;  4KIK A;  3BUI A;  1U00 A;  4H6H A;  4E81 A;  3QWE A;  4EZW A;  3T4A G;  3BVW A;  4R5G A;  4D8J A;  2RT6 A;  4EZP A;  4JWE A;  2EX3 B;  5TKY A;  2YL6 A;  3ER8 C;  2N3K A;  3EJQ A;  2YLA A;  4HR1 B;  3SOG A;  5KBP A;  1YWM A;  3PLT A;  2OW6 A;  2F7R A;  3T47 A;  2GF4 A;  3F7W A;  3B51 X;  3O3N B;  1MJG A;  2F7P A;  2X5C A;  4AZ7 A;  4IM0 A;  4EZU A;  4WPE A;  3ABH A;  2F7O A;  1SUF A;  3M3W A;  3OHX M;  4FZO A;  1TQU A;  2OW7 A;  4NSW A;  1TQT A;  3VEB A;  2OBL A;  5FIG A;  1E2U A;  4AZH A;  4E3C A;  3EJP A;  4AZC A;  4FZP A;  4F00 A;  4EZT A;  4IWP A;  4AZB A;  4UDY X;  2F1A A;  4JLC A;  3KDR A;  2YL8 A;  3VEA A;  2Z8Y A;  1LQ7 A;  2GA9 D;  4EZY A;  1E1D A;  3RPM A;  3HAJ A;  4AZ5 A;  3OWG A;  4F01 A;  3B52 X;  2O0I 1;  3D52 A;  4FM3 A;  2ZXQ A;  1PS3 A;  4DYL A;  4FZS A;  2ND0 A;  2EFK A;  4JWD A;  3I04 A;  3KAW A;  3O3M B;  3L3O M;  3D50 A;  1ZWW A;  3Q0K A;  2WYH A;  2YL9 A;  1R5E A;  4JWC A;  3CVR A;  4G6Q A;  3BUP A;  2Z0O A;  4R5K A;  3DX4 A;  4EZZ A;  1SU8 A;  2RAJ A;  2YI9 A;  3RV1 A;  3LVT A;  1I4T A;  2F1B A;  2F7Q A;  4JNE A;  2Q13 A;  4JL9 A;  3DYT A;  1TQS A;  3D4Y A;  4PO2 A;  4HYB A;  2YIV X;  2OZN B;  4EZX A;  2QFF A;  4AZC B;  1GNT A;  3T48 A;  4M0M A;  1QWN A;  4R5I A;  2GAF D;  1I49 A;  1QWU A;  3L3P A;  3G9G A;  4UDX X;  4H6I A;  2QXL A;  3QE6 A;  4HR1 A;  1HTY A;  2YL5 A;  2ELB A;  4ATM A;  3DPP A;  1DKX A;  1I4D A;  1HXK A;  3BLB A;  3I39 X;  2EFL A;  4AZG A;  3BVX A;  3DX1 A;  3D2F A;  4EZN A;  4IW0 A;  1O7D C;  2OO2 A;  1QX1 A;  4JNF A;  4NQI A;  3RV0 A;  3CKD A;  4H8S A;  1HWW A;  2X3X A;  3LLL A;  4KIK B;  3D51 A;  3CV5 A;  3BUQ A;  3DDF A;  4AZI A;  3EJT A;  3EJS A;  3DX3 A;  1Y2O A;  2MI7 A;  2D1L A;  1X03 A;  4AZ6 A;  4R5J A;  2WYI A;  3DDG A;  3DX0 A;  4DCN C;  2LM0 A;  3B53 X;  1SU6 A;  3Q84 A;  2FYV A;  5C5B A;  3C7N A;  2YI8 A;  2D4C A;  1R34 A;  2WIN M;  2KHO A;  3HAI A;  3EJU A;  3D2E A;  1GNL A;  2JNS A;  2YIB A;  2V0O A;  2PMR A;  1TQV A;  3BVU A;  3FD9 A;  3DX2 A;  4R5L A;  4IWQ A;  2YKT A;  4IM2 A;  3QA8 A;  2OBM A;  1UPX A;  3GI7 A;  2NCZ A;  2Q12 A;  3O3O B;  3OK8 A;  2ALW A;  1W9M A; 
#chains in the Genus database with same CATH homology
 3QNI A;  3M3W A;  4NQI A;  4AVM A;  3I2W A;  4DCN C;  3HAJ A;  3G9G A;  4H8S A;  2RAJ A;  2Z0V A;  2X3W A;  4BNE A;  2X3X A;  1I4L A;  3LLL A;  3Q84 A;  3QE6 A;  5C5B B;  3SOG A;  2C08 A;  5C5B A;  4NSW A;  2RAK A;  4WPC A;  2ELB A;  1ZWW A;  3HAH A;  4ATM A;  3PLT A;  4AKV A;  3SYV A;  3QWE A;  1I4T A;  2YKT A;  2D4C A;  3ACO A;  3Q0K A;  4I1Q A;  1I4D A;  1X04 A;  3CAZ A;  2Q13 A;  2EFL A;  1Y2O A;  3HAI A;  2RAI A;  1WDZ A;  1URU A;  2Z0N A;  2D1L A;  3DYT A;  4DYL A;  2FIC A;  4FZS A;  2X3V A;  4WPE A;  2EFK A;  1X03 A;  2Q12 A;  3ABH A;  3OK8 A;  2V0O A;  1I49 A;  2Z0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...