2PMRA

Crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
76
structure length
76
Chain Sequence
CRERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAHGLLDSLRMLHRIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
total genus 34
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2pmrA00
4AZ6A 4AZCA 4AZ7A 2JNKA 4AZHA 2YL6A 4AZ5A 4AZGA 3RPMA 4FZPA 2YLLA 4FZOA 4AZIA 2OZNB 2YL5A 2PMRA 4AZCB 2YLAA 2YL8A 2YL9A 2OO2A 4AZBA
chains in the Genus database with same CATH superfamily
1YWMA 4AZ5A 3D4ZA 4EZPA 4FZSA 4ATMA 4KIKA 3BLBA 4JWEA 3HAJA 2F7PA 2QXLA 3BVUA 2YIAA 1I49A 4AVMA 4EZTA 2LXYA 4KIKB 3DPQA 4AZHA 3T46A 2F7QA 1TQUA 4WPCA 1TQTA 2ZXQA 4BNEA 3F7WA 2YL9A 4IWQA 2RAIA 4R5IA 2F1BA 2FYVA 2F1AA 2OO2A 3DDGA 4DYLA 4AZ6A 3G9GA 3RV0A 5FLEX 1I4TA 4AZGA 2WYIA 2JNSA 3RPMA 2GAFD 3L3OM 2Q12A 4HR1A 1UPXA 1ZWWA 3DYTA 1TQWA 4HR1B 3T4AG 4M0MA 3RV1A 3C7NA 3DX2A 1SU6A 4IW0A 3BVTA 2F7OA 1LQ7A 4R5JA 2LM0A 3SOGA 1OA1A 1I4LA 1R5EA 3VKHA 2OBMA 2EFKA 2F18A 3DDFA 3BUDA 3KAVA 1QX1A 4G6QA 3ER8C 3KDRA 3T47A 3KAWA 3BVWA 4EZYA 2OBLA 2FICA 3DPOA 4H6HA 2D1LA 3CZNA 2Z8YA 3BUPA 3EJTA 3O3NB 3I2WA 4F01A 1R34A 1E1DA 1MJGA 4NQIA 1U00A 1X03A 4AZIA 3I01A 3OWGA 1ZYLA 1WDZA 2EWFA 4D8JA 4AZBA 3ABHA 2F7RA 4JLCA 1OAOA 4AZ7A 3BVXA 3DX1A 4IWPA 2OW7A 1GNLA 2OZNB 3L3PA 4NPHA 2YL5A 3HAIA 2X5CA 1TQSA 4JL9A 1DKZA 3UITA 3ER9B 2YKTA 2WYHA 3LLLA 1JQKA 3Q84A 4UDYX 1O7DC 4FZPA 1GNTA 4FZOA 5FIGA 1R33A 2YI9A 3SYVA 1O7DB 3T48A 3ERCC 3B51X 2RT6A 4NSWA 3LMFA 3BUIA 2PY6A 4R5LA 2JNKA 4H8SA 4EZOA 1DKYA 3D2EA 3QNJA 2ALWA 4HYBA 3OK8A 3PLTA 3DX4A 3QA8A 4EZWA 5TKYA 2YL6A 3ZEDA 3B53X 3T49A 4E81A 4EZQA 3A98A 2YLLA 3EJRA 1I4DA 1URUA 4JN4A 2KHOA 4IM3A 4F00A 1GN9A 2RAJA 4AZCA 4JWCA 4JNFA 2EFLA 3CV5A 4E3CA 3QE6A 3Q0KA 4JWIA 3OHXM 3EJUA 2QKWA 3BUBA 2O0I1 4JNEA 4AZCB 4EZSA 4WPEA 1SU7A 2NCZA 3D2FA 4EZZA 2C08A 4UDXX 3QNIA 4AKVA 1E2UA 3DX3A 1QWUA 3CZSA 1QWNA 3LVTA 3D51A 2Z0NA 3BUQA 4JWDA 4IM2A 3CAZA 2EX3B 4B9QA 2YI8A 3ACOA 2YIBA 4EZVA 1Y2OA 2X3XA 1TQVA 3EJQA 3O3OB 1SU8A 2D4CA 1HTYA 3D52A 4HY9A 2GA9D 4FM3A 2MI7A 2YIVX 1DKXA 3CVRA 3FD9A 2YL8A 2X3VA 3VEBA 4DCNC 4R5KA 4EZNA 4EZUA 2ND0A 2ELBA 5C5BA 3GI7A 3BVVA 3EJSA 5KBPA 3D4YA 4PO2A 5E84A 3QWEA 5C5BB 4R5GA 2N3KA 3I04A 3CKDA 3M3WA 4H6IA 2Z0VA 3DX0A 2QFFA 4IM0A 3EJPA 1X04A 3B52X 1SUFA 4IWOA 1PS3A 1HXKA 3D50A 1E9VA 2OW6A 4I1QA 1OA0A 3O3MB 3DPPA 2ND1A 2V0OA 1HWWA 3HAHA 3I39X 4EZRA 3VEAA 4EZXA 2PMRA 1W9MA 2RAKA 2GF4A 2YLAA 2Q13A 2WINM 2X3WA 2Z0OA
chains in the Genus database with same CATH topology
4AZ6A 4AZCA 4AZ7A 2JNKA 4AZHA 2YL6A 4AZ5A 4AZGA 3RPMA 4FZPA 2YLLA 4FZOA 4AZIA 2OZNB 2YL5A 2PMRA 4AZCB 2YLAA 2YL8A 2YL9A 2OO2A 4AZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZ6 A;  4AZC A;  4AZ7 A;  2JNK A;  4AZH A;  2YL6 A;  4AZ5 A;  4AZG A;  3RPM A;  4FZP A;  2YLL A;  4FZO A;  4AZI A;  2OZN B;  2YL5 A;  2PMR A;  4AZC B;  2YLA A;  2YL8 A;  2YL9 A;  2OO2 A;  4AZB A; 
#chains in the Genus database with same CATH topology
 1YWM A;  4AZ5 A;  3D4Z A;  4EZP A;  4FZS A;  4ATM A;  4KIK A;  3BLB A;  4JWE A;  3HAJ A;  2F7P A;  2QXL A;  3BVU A;  2YIA A;  1I49 A;  4AVM A;  4EZT A;  2LXY A;  4KIK B;  3DPQ A;  4AZH A;  3T46 A;  2F7Q A;  1TQU A;  4WPC A;  1TQT A;  2ZXQ A;  4BNE A;  3F7W A;  2YL9 A;  4IWQ A;  2RAI A;  4R5I A;  2F1B A;  2FYV A;  2F1A A;  2OO2 A;  3DDG A;  4DYL A;  4AZ6 A;  3G9G A;  3RV0 A;  5FLE X;  1I4T A;  4AZG A;  2WYI A;  2JNS A;  3RPM A;  2GAF D;  3L3O M;  2Q12 A;  4HR1 A;  1UPX A;  1ZWW A;  3DYT A;  1TQW A;  4HR1 B;  3T4A G;  4M0M A;  3RV1 A;  3C7N A;  3DX2 A;  1SU6 A;  4IW0 A;  3BVT A;  2F7O A;  1LQ7 A;  4R5J A;  2LM0 A;  3SOG A;  1OA1 A;  1I4L A;  1R5E A;  3VKH A;  2OBM A;  2EFK A;  2F18 A;  3DDF A;  3BUD A;  3KAV A;  1QX1 A;  4G6Q A;  3ER8 C;  3KDR A;  3T47 A;  3KAW A;  3BVW A;  4EZY A;  2OBL A;  2FIC A;  3DPO A;  4H6H A;  2D1L A;  3CZN A;  2Z8Y A;  3BUP A;  3EJT A;  3O3N B;  3I2W A;  4F01 A;  1R34 A;  1E1D A;  1MJG A;  4NQI A;  1U00 A;  1X03 A;  4AZI A;  3I01 A;  3OWG A;  1ZYL A;  1WDZ A;  2EWF A;  4D8J A;  4AZB A;  3ABH A;  2F7R A;  4JLC A;  1OAO A;  4AZ7 A;  3BVX A;  3DX1 A;  4IWP A;  2OW7 A;  1GNL A;  2OZN B;  3L3P A;  4NPH A;  2YL5 A;  3HAI A;  2X5C A;  1TQS A;  4JL9 A;  1DKZ A;  3UIT A;  3ER9 B;  2YKT A;  2WYH A;  3LLL A;  1JQK A;  3Q84 A;  4UDY X;  1O7D C;  4FZP A;  1GNT A;  4FZO A;  5FIG A;  1R33 A;  2YI9 A;  3SYV A;  1O7D B;  3T48 A;  3ERC C;  3B51 X;  2RT6 A;  4NSW A;  3LMF A;  3BUI A;  2PY6 A;  4R5L A;  2JNK A;  4H8S A;  4EZO A;  1DKY A;  3D2E A;  3QNJ A;  2ALW A;  4HYB A;  3OK8 A;  3PLT A;  3DX4 A;  3QA8 A;  4EZW A;  5TKY A;  2YL6 A;  3ZED A;  3B53 X;  3T49 A;  4E81 A;  4EZQ A;  3A98 A;  2YLL A;  3EJR A;  1I4D A;  1URU A;  4JN4 A;  2KHO A;  4IM3 A;  4F00 A;  1GN9 A;  2RAJ A;  4AZC A;  4JWC A;  4JNF A;  2EFL A;  3CV5 A;  4E3C A;  3QE6 A;  3Q0K A;  4JWI A;  3OHX M;  3EJU A;  2QKW A;  3BUB A;  2O0I 1;  4JNE A;  4AZC B;  4EZS A;  4WPE A;  1SU7 A;  2NCZ A;  3D2F A;  4EZZ A;  2C08 A;  4UDX X;  3QNI A;  4AKV A;  1E2U A;  3DX3 A;  1QWU A;  3CZS A;  1QWN A;  3LVT A;  3D51 A;  2Z0N A;  3BUQ A;  4JWD A;  4IM2 A;  3CAZ A;  2EX3 B;  4B9Q A;  2YI8 A;  3ACO A;  2YIB A;  4EZV A;  1Y2O A;  2X3X A;  1TQV A;  3EJQ A;  3O3O B;  1SU8 A;  2D4C A;  1HTY A;  3D52 A;  4HY9 A;  2GA9 D;  4FM3 A;  2MI7 A;  2YIV X;  1DKX A;  3CVR A;  3FD9 A;  2YL8 A;  2X3V A;  3VEB A;  4DCN C;  4R5K A;  4EZN A;  4EZU A;  2ND0 A;  2ELB A;  5C5B A;  3GI7 A;  3BVV A;  3EJS A;  5KBP A;  3D4Y A;  4PO2 A;  5E84 A;  3QWE A;  5C5B B;  4R5G A;  2N3K A;  3I04 A;  3CKD A;  3M3W A;  4H6I A;  2Z0V A;  3DX0 A;  2QFF A;  4IM0 A;  3EJP A;  1X04 A;  3B52 X;  1SUF A;  4IWO A;  1PS3 A;  1HXK A;  3D50 A;  1E9V A;  2OW6 A;  4I1Q A;  1OA0 A;  3O3M B;  3DPP A;  2ND1 A;  2V0O A;  1HWW A;  3HAH A;  3I39 X;  4EZR A;  3VEA A;  4EZX A;  2PMR A;  1W9M A;  2RAK A;  2GF4 A;  2YLA A;  2Q13 A;  2WIN M;  2X3W A;  2Z0O A; 
#chains in the Genus database with same CATH homology
 4AZ6 A;  4AZC A;  4AZ7 A;  2JNK A;  4AZH A;  2YL6 A;  4AZ5 A;  4AZG A;  3RPM A;  4FZP A;  2YLL A;  4FZO A;  4AZI A;  2OZN B;  2YL5 A;  2PMR A;  4AZC B;  2YLA A;  2YL8 A;  2YL9 A;  2OO2 A;  4AZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...