2PMRA

Crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
76
structure length
76
Chain Sequence
b'CRERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAHGLLDSLRMLHRIIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 34
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2pmrA00
2YL8A 2PMRA 4AZCA 4AZCB 4FZPA 4AZGA 2YL6A 4AZHA 2JNKA 4AZIA 4AZ5A 3RPMA 2YLAA 2YL9A 4AZ6A 2YLLA 4AZ7A 2OO2A 4FZOA 4AZBA 2YL5A 2OZNB
chains in the Genus database with same CATH superfamily
4EZTA 3EJTA 2OW7A 3D4ZA 4WPCA 2RT6A 3SYVA 2X3VA 2YI8A 5FIGA 4E3CA 3T47A 3I04A 3BVVA 2N3KA 4AKVA 3UITA 2YLLA 4EZYA 4EZSA 3B52X 2EWFA 3PLTA 4AZCA 1MJGA 4R5KA 4NSWA 3D4YA 3QNJA 4FZSA 2Z0OA 1DKXA 2GAFD 2YL9A 2PY6A 5FLEX 3F7WA 3T48A 1O7DC 1TQSA 5E84A 3BVWA 1O7DB 2YKTA 3HAHA 1HTYA 1QWUA 2Q13A 4D8JA 1QWNA 1I4DA 3DYTA 1X04A 1GNTA 2ND0A 4AZCB 1GNLA 1E1DA 3DX3A 2LXYA 3EJSA 4B9QA 4UDYX 1DKYA 1E2UA 3DX0A 4EZPA 3BLBA 3M3WA 2QKWA 2D4CA 3EJPA 4IM3A 3RV1A 1SU6A 1LQ7A 3DX4A 2GF4A 1ZWWA 4EZNA 4WPEA 4EZZA 3VKHA 3EJQA 3HAJA 3BUPA 2LM0A 2MI7A 2Z0VA 4AZHA 3I39X 1DKZA 1GN9A 4AZ5A 1HXKA 2YLAA 4EZXA 3T49A 4NPHA 2NCZA 1OA0A 4AZ6A 3DPOA 3KAVA 2ALWA 3D51A 3B51X 3HAIA 2YIVX 3ER9B 1TQTA 1I4LA 4R5LA 4JWDA 5KBPA 4H8SA 2C08A 3D2EA 3D50A 3OWGA 1I49A 4JWEA 2F7QA 4EZWA 3DPQA 3T46A 4IW0A 2OZNB 3FD9A 4EZUA 4NQIA 2X5CA 1JQKA 3BVXA 1R33A 1TQWA 3B53X 3BUQA 4FZOA 3LLLA 2Z0NA 4F00A 1SU7A 3Q84A 2WYIA 3LVTA 4JWCA 3OHXM 4KIKA 1E9VA 1Y2OA 4AZIA 2RAJA 1SUFA 3EJRA 2FICA 2OO2A 2WINM 4AZBA 5TKYA 4HR1A 2YIBA 1X03A 1W9MA 4JNEA 2JNKA 2RAIA 4EZQA 2F7OA 4IWOA 2F7RA 3BUIA 4AVMA 4JNFA 2X3WA 2EFLA 1U00A 4H6HA 2V0OA 4FZPA 3VEAA 2GA9D 3KAWA 3ABHA 1ZYLA 1TQUA 4KIKB 2ND1A 4EZVA 1R34A 3OK8A 1OA1A 3KDRA 4JLCA 4M0MA 3O3MB 1SU8A 1I4TA 4HR1B 1TQVA 3EJUA 1PS3A 3L3PA 3QWEA 4R5GA 4I1QA 4IM0A 3BVUA 4JWIA 5C5BA 3ZEDA 1WDZA 2JNSA 2OBLA 3RV0A 1R5EA 3C7NA 4UDXX 3CZSA 4EZOA 2QXLA 4IWQA 3LMFA 3CZNA 4R5JA 3ERCC 3DX2A 2F7PA 3CKDA 2X3XA 2PMRA 3DDGA 2QFFA 2F1AA 4G6QA 2OBMA 2YL6A 3DDFA 4HY9A 3O3NB 4E81A 3BUBA 1HWWA 2F18A 2D1LA 2Q12A 4JL9A 3QA8A 3D52A 5C5BB 4IWPA 3BVTA 3A98A 1QX1A 3ER8C 3O3OB 3G9GA 4H6IA 2RAKA 4BNEA 3D2FA 4FM3A 4PO2A 2Z8YA 4ATMA 3DX1A 4IM2A 3Q0KA 2YL5A 2EX3B 3QE6A 4F01A 2EFKA 3ACOA 1URUA 4HYBA 2WYHA 3QNIA 3CVRA 2O0I1 4DYLA 3SOGA 3CAZA 2ELBA 4JN4A 4DCNC 2KHOA 3RPMA 2F1BA 3DPPA 2YL8A 1YWMA 3VEBA 2YIAA 4AZGA 2YI9A 3I01A 3L3OM 2FYVA 3CV5A 4R5IA 1UPXA 3I2WA 1OAOA 3GI7A 2ZXQA 3T4AG 4EZRA 2OW6A 4AZ7A 3BUDA
chains in the Genus database with same CATH topology
2YL8A 2PMRA 4AZCA 4AZCB 4FZPA 4AZGA 2YL6A 4AZHA 2JNKA 4AZIA 4AZ5A 3RPMA 2YLAA 2YL9A 4AZ6A 2YLLA 4AZ7A 2OO2A 4FZOA 4AZBA 2YL5A 2OZNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL8 A;  2PMR A;  4AZC A;  4AZC B;  4FZP A;  4AZG A;  2YL6 A;  4AZH A;  2JNK A;  4AZI A;  4AZ5 A;  3RPM A;  2YLA A;  2YL9 A;  4AZ6 A;  2YLL A;  4AZ7 A;  2OO2 A;  4FZO A;  4AZB A;  2YL5 A;  2OZN B; 
#chains in the Genus database with same CATH topology
 4EZT A;  3EJT A;  2OW7 A;  3D4Z A;  4WPC A;  2RT6 A;  3SYV A;  2X3V A;  2YI8 A;  5FIG A;  4E3C A;  3T47 A;  3I04 A;  3BVV A;  2N3K A;  4AKV A;  3UIT A;  2YLL A;  4EZY A;  4EZS A;  3B52 X;  2EWF A;  3PLT A;  4AZC A;  1MJG A;  4R5K A;  4NSW A;  3D4Y A;  3QNJ A;  4FZS A;  2Z0O A;  1DKX A;  2GAF D;  2YL9 A;  2PY6 A;  5FLE X;  3F7W A;  3T48 A;  1O7D C;  1TQS A;  5E84 A;  3BVW A;  1O7D B;  2YKT A;  3HAH A;  1HTY A;  1QWU A;  2Q13 A;  4D8J A;  1QWN A;  1I4D A;  3DYT A;  1X04 A;  1GNT A;  2ND0 A;  4AZC B;  1GNL A;  1E1D A;  3DX3 A;  2LXY A;  3EJS A;  4B9Q A;  4UDY X;  1DKY A;  1E2U A;  3DX0 A;  4EZP A;  3BLB A;  3M3W A;  2QKW A;  2D4C A;  3EJP A;  4IM3 A;  3RV1 A;  1SU6 A;  1LQ7 A;  3DX4 A;  2GF4 A;  1ZWW A;  4EZN A;  4WPE A;  4EZZ A;  3VKH A;  3EJQ A;  3HAJ A;  3BUP A;  2LM0 A;  2MI7 A;  2Z0V A;  4AZH A;  3I39 X;  1DKZ A;  1GN9 A;  4AZ5 A;  1HXK A;  2YLA A;  4EZX A;  3T49 A;  4NPH A;  2NCZ A;  1OA0 A;  4AZ6 A;  3DPO A;  3KAV A;  2ALW A;  3D51 A;  3B51 X;  3HAI A;  2YIV X;  3ER9 B;  1TQT A;  1I4L A;  4R5L A;  4JWD A;  5KBP A;  4H8S A;  2C08 A;  3D2E A;  3D50 A;  3OWG A;  1I49 A;  4JWE A;  2F7Q A;  4EZW A;  3DPQ A;  3T46 A;  4IW0 A;  2OZN B;  3FD9 A;  4EZU A;  4NQI A;  2X5C A;  1JQK A;  3BVX A;  1R33 A;  1TQW A;  3B53 X;  3BUQ A;  4FZO A;  3LLL A;  2Z0N A;  4F00 A;  1SU7 A;  3Q84 A;  2WYI A;  3LVT A;  4JWC A;  3OHX M;  4KIK A;  1E9V A;  1Y2O A;  4AZI A;  2RAJ A;  1SUF A;  3EJR A;  2FIC A;  2OO2 A;  2WIN M;  4AZB A;  5TKY A;  4HR1 A;  2YIB A;  1X03 A;  1W9M A;  4JNE A;  2JNK A;  2RAI A;  4EZQ A;  2F7O A;  4IWO A;  2F7R A;  3BUI A;  4AVM A;  4JNF A;  2X3W A;  2EFL A;  1U00 A;  4H6H A;  2V0O A;  4FZP A;  3VEA A;  2GA9 D;  3KAW A;  3ABH A;  1ZYL A;  1TQU A;  4KIK B;  2ND1 A;  4EZV A;  1R34 A;  3OK8 A;  1OA1 A;  3KDR A;  4JLC A;  4M0M A;  3O3M B;  1SU8 A;  1I4T A;  4HR1 B;  1TQV A;  3EJU A;  1PS3 A;  3L3P A;  3QWE A;  4R5G A;  4I1Q A;  4IM0 A;  3BVU A;  4JWI A;  5C5B A;  3ZED A;  1WDZ A;  2JNS A;  2OBL A;  3RV0 A;  1R5E A;  3C7N A;  4UDX X;  3CZS A;  4EZO A;  2QXL A;  4IWQ A;  3LMF A;  3CZN A;  4R5J A;  3ERC C;  3DX2 A;  2F7P A;  3CKD A;  2X3X A;  2PMR A;  3DDG A;  2QFF A;  2F1A A;  4G6Q A;  2OBM A;  2YL6 A;  3DDF A;  4HY9 A;  3O3N B;  4E81 A;  3BUB A;  1HWW A;  2F18 A;  2D1L A;  2Q12 A;  4JL9 A;  3QA8 A;  3D52 A;  5C5B B;  4IWP A;  3BVT A;  3A98 A;  1QX1 A;  3ER8 C;  3O3O B;  3G9G A;  4H6I A;  2RAK A;  4BNE A;  3D2F A;  4FM3 A;  4PO2 A;  2Z8Y A;  4ATM A;  3DX1 A;  4IM2 A;  3Q0K A;  2YL5 A;  2EX3 B;  3QE6 A;  4F01 A;  2EFK A;  3ACO A;  1URU A;  4HYB A;  2WYH A;  3QNI A;  3CVR A;  2O0I 1;  4DYL A;  3SOG A;  3CAZ A;  2ELB A;  4JN4 A;  4DCN C;  2KHO A;  3RPM A;  2F1B A;  3DPP A;  2YL8 A;  1YWM A;  3VEB A;  2YIA A;  4AZG A;  2YI9 A;  3I01 A;  3L3O M;  2FYV A;  3CV5 A;  4R5I A;  1UPX A;  3I2W A;  1OAO A;  3GI7 A;  2ZXQ A;  3T4A G;  4EZR A;  2OW6 A;  4AZ7 A;  3BUD A; 
#chains in the Genus database with same CATH homology
 2YL8 A;  2PMR A;  4AZC A;  4AZC B;  4FZP A;  4AZG A;  2YL6 A;  4AZH A;  2JNK A;  4AZI A;  4AZ5 A;  3RPM A;  2YLA A;  2YL9 A;  4AZ6 A;  2YLL A;  4AZ7 A;  2OO2 A;  4FZO A;  4AZB A;  2YL5 A;  2OZN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...