2PMRA

Crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
76
structure length
76
Chain Sequence
CRERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAHGLLDSLRMLHRIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
total genus 34
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2pmrA00
2YL8A 4FZPA 4AZ7A 4AZ6A 2OO2A 4AZBA 2OZNB 2PMRA 4AZ5A 2YL5A 4AZIA 2YL9A 3RPMA 2JNKA 4AZCB 4FZOA 4AZGA 4AZHA 2YLLA 2YLAA 2YL6A 4AZCA
chains in the Genus database with same CATH superfamily
2O0I1 3EJTA 3T46A 4AKVA 2Z0VA 4WPEA 2F1AA 3CVRA 4HY9A 4H8SA 4JLCA 3C7NA 3DX4A 4JNFA 3FD9A 5E84A 2YI8A 4HR1A 3CZSA 4IM2A 3EJRA 4UDXX 1SU8A 2JNSA 4JN4A 2RAIA 3D52A 1E2UA 4AZ6A 3O3NB 4AZBA 2LM0A 4JL9A 4HYBA 3CAZA 4PO2A 2ZXQA 3I01A 3M3WA 4F00A 4IM0A 4AZGA 1Y2OA 2N3KA 3VEBA 4EZOA 2X3XA 5C5BB 4JWIA 4E81A 4FZPA 4R5LA 3B51X 3RV0A 2YIAA 1QWUA 3OK8A 4F01A 1URUA 4WPCA 3EJQA 1TQWA 2EFLA 2YKTA 1SUFA 4I1QA 3BUDA 1OA1A 3B52X 4JWEA 1O7DB 3BVUA 3DPQA 1OA0A 1QWNA 3CKDA 4NPHA 3O3MB 2F7PA 3BVVA 4IWOA 2NCZA 2OBLA 2YL9A 4NSWA 2Z8YA 2RT6A 4EZSA 3T49A 2RAKA 4KIKA 4R5JA 2EX3B 2FICA 1DKYA 2QXLA 2C08A 1UPXA 2D4CA 2F1BA 3I2WA 2PMRA 2X3VA 1MJGA 2ELBA 4EZUA 3HAHA 3PLTA 1O7DC 4EZPA 3L3OM 3BUIA 4EZZA 2OO2A 1TQVA 3DX1A 4R5GA 3OHXM 4IWQA 2Q12A 4HR1B 3OWGA 3DPPA 2LXYA 1GN9A 4H6IA 2JNKA 1HXKA 4UDYX 3BUQA 1TQUA 1WDZA 2YL6A 2V0OA 4NQIA 3CZNA 4B9QA 3HAJA 4IM3A 3DYTA 3QNIA 2EFKA 1ZYLA 3I04A 1TQSA 3Q84A 4E3CA 3ABHA 1DKXA 2OBMA 1I4LA 4EZVA 3D4ZA 3LLLA 2PY6A 2WINM 1GNLA 3ERCC 5KBPA 2EWFA 2Z0NA 1I4TA 3BUPA 2YIVX 1GNTA 4EZYA 3LVTA 4G6QA 2OW7A 3BVXA 3LMFA 3DX3A 4EZRA 1DKZA 4M0MA 1I4DA 3HAIA 3QWEA 3UITA 2F18A 5TKYA 3G9GA 4JNEA 3QNJA 3VKHA 3GI7A 4JWDA 4KIKB 2QFFA 1TQTA 3BLBA 1U00A 3EJUA 3DX2A 4AZCA 2YIBA 3L3PA 1R34A 3SOGA 2GAFD 4AZ5A 4EZXA 2YL5A 3DDGA 3ER9B 3O3OB 2Q13A 1OAOA 1W9MA 3A98A 4AVMA 4EZNA 1X03A 1PS3A 2F7RA 3D51A 3D4YA 2FYVA 3QE6A 3T47A 3RV1A 4DYLA 3ACOA 4EZTA 1I49A 2MI7A 2KHOA 3ER8C 3I39X 2RAJA 3RPMA 3Q0KA 3T48A 3F7WA 1SU6A 1LQ7A 2ALWA 3EJSA 1QX1A 2YLAA 4EZQA 2YL8A 1R33A 4AZ7A 1JQKA 4DCNC 3KDRA 1R5EA 2ND0A 4AZIA 4R5IA 2QKWA 2X5CA 3B53X 2F7QA 2WYIA 2Z0OA 3CV5A 3DX0A 3BVWA 3EJPA 3VEAA 3SYVA 2OZNB 4EZWA 2F7OA 3D2EA 3T4AG 2WYHA 4R5KA 4FZOA 1YWMA 3KAWA 3DDFA 5C5BA 1HWWA 2X3WA 4JWCA 4AZCB 2GF4A 3ZEDA 4AZHA 2D1LA 3D50A 4H6HA 3QA8A 3DPOA 5FIGA 4BNEA 3BUBA 2GA9D 2YI9A 4IW0A 1SU7A 1HTYA 2ND1A 5FLEX 3KAVA 4FM3A 4D8JA 3D2FA 1X04A 4FZSA 1E1DA 2OW6A 4ATMA 2YLLA 1ZWWA 4IWPA 3BVTA 1E9VA
chains in the Genus database with same CATH topology
2YL8A 4FZPA 4AZ7A 4AZ6A 2OO2A 4AZBA 2OZNB 2PMRA 4AZ5A 2YL5A 4AZIA 2YL9A 3RPMA 2JNKA 4AZCB 4FZOA 4AZGA 4AZHA 2YLLA 2YLAA 2YL6A 4AZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL8 A;  4FZP A;  4AZ7 A;  4AZ6 A;  2OO2 A;  4AZB A;  2OZN B;  2PMR A;  4AZ5 A;  2YL5 A;  4AZI A;  2YL9 A;  3RPM A;  2JNK A;  4AZC B;  4FZO A;  4AZG A;  4AZH A;  2YLL A;  2YLA A;  2YL6 A;  4AZC A; 
#chains in the Genus database with same CATH topology
 2O0I 1;  3EJT A;  3T46 A;  4AKV A;  2Z0V A;  4WPE A;  2F1A A;  3CVR A;  4HY9 A;  4H8S A;  4JLC A;  3C7N A;  3DX4 A;  4JNF A;  3FD9 A;  5E84 A;  2YI8 A;  4HR1 A;  3CZS A;  4IM2 A;  3EJR A;  4UDX X;  1SU8 A;  2JNS A;  4JN4 A;  2RAI A;  3D52 A;  1E2U A;  4AZ6 A;  3O3N B;  4AZB A;  2LM0 A;  4JL9 A;  4HYB A;  3CAZ A;  4PO2 A;  2ZXQ A;  3I01 A;  3M3W A;  4F00 A;  4IM0 A;  4AZG A;  1Y2O A;  2N3K A;  3VEB A;  4EZO A;  2X3X A;  5C5B B;  4JWI A;  4E81 A;  4FZP A;  4R5L A;  3B51 X;  3RV0 A;  2YIA A;  1QWU A;  3OK8 A;  4F01 A;  1URU A;  4WPC A;  3EJQ A;  1TQW A;  2EFL A;  2YKT A;  1SUF A;  4I1Q A;  3BUD A;  1OA1 A;  3B52 X;  4JWE A;  1O7D B;  3BVU A;  3DPQ A;  1OA0 A;  1QWN A;  3CKD A;  4NPH A;  3O3M B;  2F7P A;  3BVV A;  4IWO A;  2NCZ A;  2OBL A;  2YL9 A;  4NSW A;  2Z8Y A;  2RT6 A;  4EZS A;  3T49 A;  2RAK A;  4KIK A;  4R5J A;  2EX3 B;  2FIC A;  1DKY A;  2QXL A;  2C08 A;  1UPX A;  2D4C A;  2F1B A;  3I2W A;  2PMR A;  2X3V A;  1MJG A;  2ELB A;  4EZU A;  3HAH A;  3PLT A;  1O7D C;  4EZP A;  3L3O M;  3BUI A;  4EZZ A;  2OO2 A;  1TQV A;  3DX1 A;  4R5G A;  3OHX M;  4IWQ A;  2Q12 A;  4HR1 B;  3OWG A;  3DPP A;  2LXY A;  1GN9 A;  4H6I A;  2JNK A;  1HXK A;  4UDY X;  3BUQ A;  1TQU A;  1WDZ A;  2YL6 A;  2V0O A;  4NQI A;  3CZN A;  4B9Q A;  3HAJ A;  4IM3 A;  3DYT A;  3QNI A;  2EFK A;  1ZYL A;  3I04 A;  1TQS A;  3Q84 A;  4E3C A;  3ABH A;  1DKX A;  2OBM A;  1I4L A;  4EZV A;  3D4Z A;  3LLL A;  2PY6 A;  2WIN M;  1GNL A;  3ERC C;  5KBP A;  2EWF A;  2Z0N A;  1I4T A;  3BUP A;  2YIV X;  1GNT A;  4EZY A;  3LVT A;  4G6Q A;  2OW7 A;  3BVX A;  3LMF A;  3DX3 A;  4EZR A;  1DKZ A;  4M0M A;  1I4D A;  3HAI A;  3QWE A;  3UIT A;  2F18 A;  5TKY A;  3G9G A;  4JNE A;  3QNJ A;  3VKH A;  3GI7 A;  4JWD A;  4KIK B;  2QFF A;  1TQT A;  3BLB A;  1U00 A;  3EJU A;  3DX2 A;  4AZC A;  2YIB A;  3L3P A;  1R34 A;  3SOG A;  2GAF D;  4AZ5 A;  4EZX A;  2YL5 A;  3DDG A;  3ER9 B;  3O3O B;  2Q13 A;  1OAO A;  1W9M A;  3A98 A;  4AVM A;  4EZN A;  1X03 A;  1PS3 A;  2F7R A;  3D51 A;  3D4Y A;  2FYV A;  3QE6 A;  3T47 A;  3RV1 A;  4DYL A;  3ACO A;  4EZT A;  1I49 A;  2MI7 A;  2KHO A;  3ER8 C;  3I39 X;  2RAJ A;  3RPM A;  3Q0K A;  3T48 A;  3F7W A;  1SU6 A;  1LQ7 A;  2ALW A;  3EJS A;  1QX1 A;  2YLA A;  4EZQ A;  2YL8 A;  1R33 A;  4AZ7 A;  1JQK A;  4DCN C;  3KDR A;  1R5E A;  2ND0 A;  4AZI A;  4R5I A;  2QKW A;  2X5C A;  3B53 X;  2F7Q A;  2WYI A;  2Z0O A;  3CV5 A;  3DX0 A;  3BVW A;  3EJP A;  3VEA A;  3SYV A;  2OZN B;  4EZW A;  2F7O A;  3D2E A;  3T4A G;  2WYH A;  4R5K A;  4FZO A;  1YWM A;  3KAW A;  3DDF A;  5C5B A;  1HWW A;  2X3W A;  4JWC A;  4AZC B;  2GF4 A;  3ZED A;  4AZH A;  2D1L A;  3D50 A;  4H6H A;  3QA8 A;  3DPO A;  5FIG A;  4BNE A;  3BUB A;  2GA9 D;  2YI9 A;  4IW0 A;  1SU7 A;  1HTY A;  2ND1 A;  5FLE X;  3KAV A;  4FM3 A;  4D8J A;  3D2F A;  1X04 A;  4FZS A;  1E1D A;  2OW6 A;  4ATM A;  2YLL A;  1ZWW A;  4IWP A;  3BVT A;  1E9V A; 
#chains in the Genus database with same CATH homology
 2YL8 A;  4FZP A;  4AZ7 A;  4AZ6 A;  2OO2 A;  4AZB A;  2OZN B;  2PMR A;  4AZ5 A;  2YL5 A;  4AZI A;  2YL9 A;  3RPM A;  2JNK A;  4AZC B;  4FZO A;  4AZG A;  4AZH A;  2YLL A;  2YLA A;  2YL6 A;  4AZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...