2PMRA

Crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
76
structure length
76
Chain Sequence
CRERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAHGLLDSLRMLHRIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 34
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2pmrA00
4AZGA 2YL6A 2OZNB 4AZIA 4AZ6A 2YL5A 2YLLA 2YL8A 2JNKA 4AZCA 4AZ7A 4AZBA 4AZCB 4AZHA 3RPMA 2PMRA 2YLAA 4FZPA 2OO2A 4FZOA 4AZ5A 2YL9A
chains in the Genus database with same CATH superfamily
4NSWA 3G9GA 3CV5A 5C5BB 1DKZA 2YIVX 3D4YA 3I2WA 4IWPA 4UDYX 4HR1B 3KAVA 3D2FA 4EZXA 3BVUA 2EWFA 3Q84A 1OA0A 1ZWWA 3HAJA 2F1AA 2JNKA 1SUFA 1I4TA 2RAKA 5KBPA 3C7NA 4JN4A 4EZWA 2EX3B 4UDXX 4KIKA 3BUQA 3DX4A 3QNJA 1JQKA 2ELBA 2X3WA 2YI9A 1O7DC 2PY6A 2GAFD 3LVTA 2EFLA 2OW7A 3O3NB 4HR1A 3RPMA 4B9QA 4EZYA 4PO2A 4DCNC 1W9MA 2NCZA 2WYIA 1LQ7A 3D52A 4JLCA 2FYVA 3CZNA 3T48A 1DKXA 3M3WA 4EZZA 3EJRA 3DPQA 4KIKB 4EZPA 3ERCC 2OBMA 1TQSA 4FM3A 4H6IA 4H8SA 2YIAA 4G6QA 4AZGA 3VEBA 3DDFA 3PLTA 3O3MB 2Q13A 2ND1A 1HWWA 3D51A 1PS3A 2Q12A 4AZIA 3D2EA 3OHXM 2YL5A 3DX1A 3RV1A 4AKVA 2EFKA 3DPPA 2JNSA 4R5LA 4FZSA 1I49A 4E3CA 3D50A 2YLLA 3VKHA 4M0MA 3SYVA 2QFFA 3CKDA 2Z0VA 1R33A 2F18A 3BUIA 3KDRA 1E2UA 4HY9A 4AZCA 4E81A 1E9VA 3I01A 2X5CA 3QE6A 4AZHA 2FICA 3BVWA 1QX1A 2Z0OA 3ER9B 3BUPA 3QA8A 4EZQA 3DYTA 3HAHA 3CZSA 2ZXQA 4IW0A 3VEAA 3QWEA 4EZTA 2Z8YA 1E1DA 1QWUA 1X03A 4FZOA 4EZRA 1X04A 2LM0A 4AZ5A 4IWOA 4BNEA 3O3OB 1ZYLA 2YL9A 1GNTA 1O7DB 2F7OA 3DX2A 3T46A 4AVMA 2OBLA 3CVRA 3BVTA 2YL6A 4ATMA 1TQWA 3T49A 2F7PA 1UPXA 1YWMA 2RAIA 2Z0NA 3EJQA 2F7RA 4IM0A 1TQUA 1HXKA 2ND0A 2QXLA 2C08A 2YL8A 1QWNA 1WDZA 3BUDA 4JWIA 1I4LA 5TKYA 3OWGA 4I1QA 4JNFA 2N3KA 3KAWA 4F00A 4H6HA 2X3VA 4AZCB 1DKYA 3EJSA 4R5GA 3L3OM 2D1LA 3EJTA 2X3XA 2PMRA 3LLLA 2YLAA 5C5BA 3DPOA 3BUBA 3BVXA 2RT6A 3DX3A 3SOGA 2YI8A 3T4AG 2OO2A 1R5EA 3ER8C 2MI7A 3FD9A 1R34A 4JWDA 3EJPA 1U00A 2KHOA 3DDGA 3ZEDA 4DYLA 4EZUA 3LMFA 4WPCA 4R5KA 3A98A 1GNLA 4WPEA 1URUA 1OAOA 2O0I1 2F1BA 2YKTA 2YIBA 1TQVA 1OA1A 2OZNB 4JWCA 4AZ6A 4IM3A 3DX0A 1SU6A 2GF4A 3HAIA 1SU7A 1TQTA 1GN9A 4R5IA 1I4DA 3BLBA 3ABHA 5FIGA 4R5JA 2V0OA 3D4ZA 3I39X 1HTYA 3ACOA 3L3PA 4JNEA 4NQIA 3RV0A 3CAZA 2WYHA 3UITA 4D8JA 3EJUA 2ALWA 1MJGA 4JL9A 4AZ7A 3T47A 3BVVA 2OW6A 4AZBA 4EZNA 2GA9D 4IM2A 2D4CA 2F7QA 4EZOA 4HYBA 4JWEA 2RAJA 3OK8A 4EZSA 5FLEX 2QKWA 1SU8A 2LXYA 3B53X 3B51X 3QNIA 4FZPA 3I04A 4F01A 3F7WA 5E84A 4IWQA 4EZVA 3B52X 4NPHA 1Y2OA 2WINM 3GI7A 3Q0KA
chains in the Genus database with same CATH topology
4AZGA 2YL6A 2OZNB 4AZIA 4AZ6A 2YL5A 2YLLA 2YL8A 2JNKA 4AZCA 4AZ7A 4AZBA 4AZCB 4AZHA 3RPMA 2PMRA 2YLAA 4FZPA 2OO2A 4FZOA 4AZ5A 2YL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZG A;  2YL6 A;  2OZN B;  4AZI A;  4AZ6 A;  2YL5 A;  2YLL A;  2YL8 A;  2JNK A;  4AZC A;  4AZ7 A;  4AZB A;  4AZC B;  4AZH A;  3RPM A;  2PMR A;  2YLA A;  4FZP A;  2OO2 A;  4FZO A;  4AZ5 A;  2YL9 A; 
#chains in the Genus database with same CATH topology
 4NSW A;  3G9G A;  3CV5 A;  5C5B B;  1DKZ A;  2YIV X;  3D4Y A;  3I2W A;  4IWP A;  4UDY X;  4HR1 B;  3KAV A;  3D2F A;  4EZX A;  3BVU A;  2EWF A;  3Q84 A;  1OA0 A;  1ZWW A;  3HAJ A;  2F1A A;  2JNK A;  1SUF A;  1I4T A;  2RAK A;  5KBP A;  3C7N A;  4JN4 A;  4EZW A;  2EX3 B;  4UDX X;  4KIK A;  3BUQ A;  3DX4 A;  3QNJ A;  1JQK A;  2ELB A;  2X3W A;  2YI9 A;  1O7D C;  2PY6 A;  2GAF D;  3LVT A;  2EFL A;  2OW7 A;  3O3N B;  4HR1 A;  3RPM A;  4B9Q A;  4EZY A;  4PO2 A;  4DCN C;  1W9M A;  2NCZ A;  2WYI A;  1LQ7 A;  3D52 A;  4JLC A;  2FYV A;  3CZN A;  3T48 A;  1DKX A;  3M3W A;  4EZZ A;  3EJR A;  3DPQ A;  4KIK B;  4EZP A;  3ERC C;  2OBM A;  1TQS A;  4FM3 A;  4H6I A;  4H8S A;  2YIA A;  4G6Q A;  4AZG A;  3VEB A;  3DDF A;  3PLT A;  3O3M B;  2Q13 A;  2ND1 A;  1HWW A;  3D51 A;  1PS3 A;  2Q12 A;  4AZI A;  3D2E A;  3OHX M;  2YL5 A;  3DX1 A;  3RV1 A;  4AKV A;  2EFK A;  3DPP A;  2JNS A;  4R5L A;  4FZS A;  1I49 A;  4E3C A;  3D50 A;  2YLL A;  3VKH A;  4M0M A;  3SYV A;  2QFF A;  3CKD A;  2Z0V A;  1R33 A;  2F18 A;  3BUI A;  3KDR A;  1E2U A;  4HY9 A;  4AZC A;  4E81 A;  1E9V A;  3I01 A;  2X5C A;  3QE6 A;  4AZH A;  2FIC A;  3BVW A;  1QX1 A;  2Z0O A;  3ER9 B;  3BUP A;  3QA8 A;  4EZQ A;  3DYT A;  3HAH A;  3CZS A;  2ZXQ A;  4IW0 A;  3VEA A;  3QWE A;  4EZT A;  2Z8Y A;  1E1D A;  1QWU A;  1X03 A;  4FZO A;  4EZR A;  1X04 A;  2LM0 A;  4AZ5 A;  4IWO A;  4BNE A;  3O3O B;  1ZYL A;  2YL9 A;  1GNT A;  1O7D B;  2F7O A;  3DX2 A;  3T46 A;  4AVM A;  2OBL A;  3CVR A;  3BVT A;  2YL6 A;  4ATM A;  1TQW A;  3T49 A;  2F7P A;  1UPX A;  1YWM A;  2RAI A;  2Z0N A;  3EJQ A;  2F7R A;  4IM0 A;  1TQU A;  1HXK A;  2ND0 A;  2QXL A;  2C08 A;  2YL8 A;  1QWN A;  1WDZ A;  3BUD A;  4JWI A;  1I4L A;  5TKY A;  3OWG A;  4I1Q A;  4JNF A;  2N3K A;  3KAW A;  4F00 A;  4H6H A;  2X3V A;  4AZC B;  1DKY A;  3EJS A;  4R5G A;  3L3O M;  2D1L A;  3EJT A;  2X3X A;  2PMR A;  3LLL A;  2YLA A;  5C5B A;  3DPO A;  3BUB A;  3BVX A;  2RT6 A;  3DX3 A;  3SOG A;  2YI8 A;  3T4A G;  2OO2 A;  1R5E A;  3ER8 C;  2MI7 A;  3FD9 A;  1R34 A;  4JWD A;  3EJP A;  1U00 A;  2KHO A;  3DDG A;  3ZED A;  4DYL A;  4EZU A;  3LMF A;  4WPC A;  4R5K A;  3A98 A;  1GNL A;  4WPE A;  1URU A;  1OAO A;  2O0I 1;  2F1B A;  2YKT A;  2YIB A;  1TQV A;  1OA1 A;  2OZN B;  4JWC A;  4AZ6 A;  4IM3 A;  3DX0 A;  1SU6 A;  2GF4 A;  3HAI A;  1SU7 A;  1TQT A;  1GN9 A;  4R5I A;  1I4D A;  3BLB A;  3ABH A;  5FIG A;  4R5J A;  2V0O A;  3D4Z A;  3I39 X;  1HTY A;  3ACO A;  3L3P A;  4JNE A;  4NQI A;  3RV0 A;  3CAZ A;  2WYH A;  3UIT A;  4D8J A;  3EJU A;  2ALW A;  1MJG A;  4JL9 A;  4AZ7 A;  3T47 A;  3BVV A;  2OW6 A;  4AZB A;  4EZN A;  2GA9 D;  4IM2 A;  2D4C A;  2F7Q A;  4EZO A;  4HYB A;  4JWE A;  2RAJ A;  3OK8 A;  4EZS A;  5FLE X;  2QKW A;  1SU8 A;  2LXY A;  3B53 X;  3B51 X;  3QNI A;  4FZP A;  3I04 A;  4F01 A;  3F7W A;  5E84 A;  4IWQ A;  4EZV A;  3B52 X;  4NPH A;  1Y2O A;  2WIN M;  3GI7 A;  3Q0K A; 
#chains in the Genus database with same CATH homology
 4AZG A;  2YL6 A;  2OZN B;  4AZI A;  4AZ6 A;  2YL5 A;  2YLL A;  2YL8 A;  2JNK A;  4AZC A;  4AZ7 A;  4AZB A;  4AZC B;  4AZH A;  3RPM A;  2PMR A;  2YLA A;  4FZP A;  2OO2 A;  4FZO A;  4AZ5 A;  2YL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...