2PMRA

Crystal structure of a protein of unknown function from methanobacterium thermoautotrophicum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
76
structure length
76
Chain Sequence
CRERIEKDLELLEKNLMEMKSIKLSDDEEAVVERALNYRDDSVYYLEKGDHITSFGCITYAHGLLDSLRMLHRIIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein of unknown function from Methanobacterium thermoautotrophicum.
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 34
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2pmrA00
2YL5A 2PMRA 2JNKA 2YLLA 4AZ7A 4FZOA 3RPMA 4AZCA 4AZ6A 2OZNB 4AZHA 2YL9A 4AZIA 2YL6A 4AZGA 4AZ5A 2OO2A 4AZBA 2YLAA 2YL8A 4FZPA 4AZCB
chains in the Genus database with same CATH superfamily
2GAFD 4EZQA 5KBPA 1OA0A 3VKHA 3QNJA 2ELBA 2WYIA 3ACOA 4E3CA 1R33A 5FLEX 4EZXA 2PMRA 2JNSA 3GI7A 1O7DC 2JNKA 2EX3B 4FM3A 3I2WA 2Z0OA 4G6QA 3D50A 3DX4A 2PY6A 3D2FA 2FICA 4R5IA 3KAWA 1W9MA 5C5BB 2NCZA 1MJGA 2F7PA 1DKYA 3DYTA 3DPPA 3I39X 1TQSA 3EJUA 4IWOA 3DDGA 4ATMA 3LVTA 3CVRA 2Q12A 2F1AA 1QWUA 2QKWA 3DX0A 3D52A 1HXKA 3D4ZA 3LLLA 4JNFA 4JWCA 1TQVA 2EFKA 3BUDA 3T46A 3ZEDA 4AZBA 3OHXM 2OW6A 3BUIA 3OWGA 4NSWA 3HAJA 2QFFA 1ZYLA 1ZWWA 3DDFA 4UDXX 3UITA 4AZCB 2D4CA 4EZUA 3D4YA 3ERCC 2X3XA 3RV1A 2LM0A 3CKDA 3BVTA 1TQUA 2EFLA 4E81A 2D1LA 2RAIA 2YI8A 3DPQA 4HR1B 4IM2A 3BUQA 4D8JA 2OBLA 4F01A 4IWQA 4EZOA 3CAZA 2ND1A 1E9VA 4JNEA 1R5EA 1JQKA 3RPMA 4AKVA 4IW0A 3M3WA 3KDRA 3BVVA 4I1QA 4AZ6A 2F7RA 3BLBA 2ALWA 2F1BA 3QNIA 3OK8A 3O3OB 2WINM 2LXYA 3EJQA 3DX1A 2OBMA 4JWEA 2GA9D 1I4LA 2FYVA 1SUFA 2YL9A 4H6IA 3HAHA 1TQWA 1SU7A 2KHOA 1WDZA 1OA1A 4AZ5A 3FD9A 2EWFA 1DKXA 3EJTA 1SU6A 2MI7A 2RAKA 1X04A 3L3PA 4R5GA 2YL8A 2YIAA 4FZPA 4BNEA 4EZVA 3Q84A 3T48A 1GNTA 3VEAA 1I4TA 2RT6A 1O7DB 1QX1A 5C5BA 3ER8C 4JWDA 3T4AG 1E2UA 3F7WA 4EZTA 3DX2A 4EZZA 4EZPA 4EZWA 3D51A 2ZXQA 4B9QA 1TQTA 2YLLA 2O0I1 4AZ7A 3VEBA 1URUA 3O3MB 4FZOA 4EZYA 4IM3A 2YI9A 4AVMA 3T49A 4DYLA 1OAOA 1QWNA 2QXLA 3D2EA 4JL9A 4IM0A 4WPCA 4NPHA 2OZNB 3B51X 5TKYA 2C08A 2GF4A 1PS3A 4JN4A 3L3OM 3I04A 1Y2OA 3B53X 1I4DA 3CZNA 4AZGA 2F18A 4R5KA 3QE6A 3CV5A 5FIGA 3BVWA 4F00A 2YLAA 3PLTA 2ND0A 4DCNC 2YKTA 3DPOA 2YIBA 1I49A 3C7NA 3BVXA 3Q0KA 1LQ7A 4KIKB 4EZNA 2RAJA 3O3NB 3EJRA 1UPXA 2V0OA 4M0MA 1U00A 2F7QA 2N3KA 3B52X 1YWMA 2YL5A 3EJPA 3SOGA 1DKZA 2F7OA 2Z0VA 3DX3A 3ABHA 3BVUA 4EZSA 5E84A 2YIVX 4UDYX 2Q13A 3BUPA 2OW7A 3QWEA 1HTYA 3I01A 4H6HA 4R5JA 2Z8YA 4FZSA 4HR1A 1GNLA 4AZCA 3HAIA 4JWIA 3RV0A 4AZHA 3QA8A 1GN9A 1HWWA 4PO2A 4KIKA 3T47A 1SU8A 4IWPA 4R5LA 2WYHA 3BUBA 3CZSA 4AZIA 3ER9B 2YL6A 4H8SA 2OO2A 3SYVA 3KAVA 4JLCA 3G9GA 4EZRA 4HY9A 2X3VA 4WPEA 1R34A 2X5CA 3EJSA 4HYBA 2X3WA 3A98A 4NQIA 1E1DA 2Z0NA 1X03A 3LMFA
chains in the Genus database with same CATH topology
2YL5A 2PMRA 2JNKA 2YLLA 4AZ7A 4FZOA 3RPMA 4AZCA 4AZ6A 2OZNB 4AZHA 2YL9A 4AZIA 2YL6A 4AZGA 4AZ5A 2OO2A 4AZBA 2YLAA 2YL8A 4FZPA 4AZCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YL5 A;  2PMR A;  2JNK A;  2YLL A;  4AZ7 A;  4FZO A;  3RPM A;  4AZC A;  4AZ6 A;  2OZN B;  4AZH A;  2YL9 A;  4AZI A;  2YL6 A;  4AZG A;  4AZ5 A;  2OO2 A;  4AZB A;  2YLA A;  2YL8 A;  4FZP A;  4AZC B; 
#chains in the Genus database with same CATH topology
 2GAF D;  4EZQ A;  5KBP A;  1OA0 A;  3VKH A;  3QNJ A;  2ELB A;  2WYI A;  3ACO A;  4E3C A;  1R33 A;  5FLE X;  4EZX A;  2PMR A;  2JNS A;  3GI7 A;  1O7D C;  2JNK A;  2EX3 B;  4FM3 A;  3I2W A;  2Z0O A;  4G6Q A;  3D50 A;  3DX4 A;  2PY6 A;  3D2F A;  2FIC A;  4R5I A;  3KAW A;  1W9M A;  5C5B B;  2NCZ A;  1MJG A;  2F7P A;  1DKY A;  3DYT A;  3DPP A;  3I39 X;  1TQS A;  3EJU A;  4IWO A;  3DDG A;  4ATM A;  3LVT A;  3CVR A;  2Q12 A;  2F1A A;  1QWU A;  2QKW A;  3DX0 A;  3D52 A;  1HXK A;  3D4Z A;  3LLL A;  4JNF A;  4JWC A;  1TQV A;  2EFK A;  3BUD A;  3T46 A;  3ZED A;  4AZB A;  3OHX M;  2OW6 A;  3BUI A;  3OWG A;  4NSW A;  3HAJ A;  2QFF A;  1ZYL A;  1ZWW A;  3DDF A;  4UDX X;  3UIT A;  4AZC B;  2D4C A;  4EZU A;  3D4Y A;  3ERC C;  2X3X A;  3RV1 A;  2LM0 A;  3CKD A;  3BVT A;  1TQU A;  2EFL A;  4E81 A;  2D1L A;  2RAI A;  2YI8 A;  3DPQ A;  4HR1 B;  4IM2 A;  3BUQ A;  4D8J A;  2OBL A;  4F01 A;  4IWQ A;  4EZO A;  3CAZ A;  2ND1 A;  1E9V A;  4JNE A;  1R5E A;  1JQK A;  3RPM A;  4AKV A;  4IW0 A;  3M3W A;  3KDR A;  3BVV A;  4I1Q A;  4AZ6 A;  2F7R A;  3BLB A;  2ALW A;  2F1B A;  3QNI A;  3OK8 A;  3O3O B;  2WIN M;  2LXY A;  3EJQ A;  3DX1 A;  2OBM A;  4JWE A;  2GA9 D;  1I4L A;  2FYV A;  1SUF A;  2YL9 A;  4H6I A;  3HAH A;  1TQW A;  1SU7 A;  2KHO A;  1WDZ A;  1OA1 A;  4AZ5 A;  3FD9 A;  2EWF A;  1DKX A;  3EJT A;  1SU6 A;  2MI7 A;  2RAK A;  1X04 A;  3L3P A;  4R5G A;  2YL8 A;  2YIA A;  4FZP A;  4BNE A;  4EZV A;  3Q84 A;  3T48 A;  1GNT A;  3VEA A;  1I4T A;  2RT6 A;  1O7D B;  1QX1 A;  5C5B A;  3ER8 C;  4JWD A;  3T4A G;  1E2U A;  3F7W A;  4EZT A;  3DX2 A;  4EZZ A;  4EZP A;  4EZW A;  3D51 A;  2ZXQ A;  4B9Q A;  1TQT A;  2YLL A;  2O0I 1;  4AZ7 A;  3VEB A;  1URU A;  3O3M B;  4FZO A;  4EZY A;  4IM3 A;  2YI9 A;  4AVM A;  3T49 A;  4DYL A;  1OAO A;  1QWN A;  2QXL A;  3D2E A;  4JL9 A;  4IM0 A;  4WPC A;  4NPH A;  2OZN B;  3B51 X;  5TKY A;  2C08 A;  2GF4 A;  1PS3 A;  4JN4 A;  3L3O M;  3I04 A;  1Y2O A;  3B53 X;  1I4D A;  3CZN A;  4AZG A;  2F18 A;  4R5K A;  3QE6 A;  3CV5 A;  5FIG A;  3BVW A;  4F00 A;  2YLA A;  3PLT A;  2ND0 A;  4DCN C;  2YKT A;  3DPO A;  2YIB A;  1I49 A;  3C7N A;  3BVX A;  3Q0K A;  1LQ7 A;  4KIK B;  4EZN A;  2RAJ A;  3O3N B;  3EJR A;  1UPX A;  2V0O A;  4M0M A;  1U00 A;  2F7Q A;  2N3K A;  3B52 X;  1YWM A;  2YL5 A;  3EJP A;  3SOG A;  1DKZ A;  2F7O A;  2Z0V A;  3DX3 A;  3ABH A;  3BVU A;  4EZS A;  5E84 A;  2YIV X;  4UDY X;  2Q13 A;  3BUP A;  2OW7 A;  3QWE A;  1HTY A;  3I01 A;  4H6H A;  4R5J A;  2Z8Y A;  4FZS A;  4HR1 A;  1GNL A;  4AZC A;  3HAI A;  4JWI A;  3RV0 A;  4AZH A;  3QA8 A;  1GN9 A;  1HWW A;  4PO2 A;  4KIK A;  3T47 A;  1SU8 A;  4IWP A;  4R5L A;  2WYH A;  3BUB A;  3CZS A;  4AZI A;  3ER9 B;  2YL6 A;  4H8S A;  2OO2 A;  3SYV A;  3KAV A;  4JLC A;  3G9G A;  4EZR A;  4HY9 A;  2X3V A;  4WPE A;  1R34 A;  2X5C A;  3EJS A;  4HYB A;  2X3W A;  3A98 A;  4NQI A;  1E1D A;  2Z0N A;  1X03 A;  3LMF A; 
#chains in the Genus database with same CATH homology
 2YL5 A;  2PMR A;  2JNK A;  2YLL A;  4AZ7 A;  4FZO A;  3RPM A;  4AZC A;  4AZ6 A;  2OZN B;  4AZH A;  2YL9 A;  4AZI A;  2YL6 A;  4AZG A;  4AZ5 A;  2OO2 A;  4AZB A;  2YLA A;  2YL8 A;  4FZP A;  4AZC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...