1YWMA

Crystal structure of the n-terminal domain of group b streptococcus alpha c protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
180
structure length
180
Chain Sequence
STIPGSAATLNTSITKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFTAKYVFRQGTKYYGDVSQLQSTGRASLTYNIFGEDGLPHVKTDGQIDIVSVALTIYDSTTLRDKIEEVRTNANDPKWTEESRTEVLTGLDTIKTDIDNNPKTQTDIDSKIVEVNELEKLLVLKLAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Surface active protein
molecule keywords C protein alpha-antigen
publication title Crystal structure of the N-terminal domain of the group B streptococcus alpha C protein.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 59
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08829 AlphaC_N Alpha C protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.150 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Surface Active Protein 1ywmA02
2.60.500.10 Mainly Beta Sandwich Surface Active Protein fold Surface Active Protein domain 1ywmA01
2O0I1 1YWMA
chains in the Genus database with same CATH superfamily
2Z8YA 4H8SA 1GN9A 2MI7A 4E81A 4NSWA 3EJPA 2C08A 1DKXA 1E9VA 1TQSA 3CAZA 1QWUA 3M3WA 2QKWA 3B51X 1WDZA 2PY6A 1O7DB 2RAKA 2QFFA 3SYVA 3A98A 2PMRA 3ER8C 2F7OA 5FIGA 1LQ7A 2F7RA 4EZXA 3L3OM 2V0OA 1I4LA 1I49A 4EZNA 4H6IA 1I4TA 2OW6A 2RT6A 2Z0NA 3DPPA 3B53X 1OAOA 2QXLA 1TQWA 2OW7A 4JWIA 3HAJA 2KHOA 4B9QA 4PO2A 4JWDA 3KAVA 3EJUA 2X3XA 2JNSA 3C7NA 4BNEA 4ATMA 4HR1A 4H6HA 4IWPA 4JL9A 2YIVX 2YI8A 1R5EA 1SU7A 1W9MA 4EZVA 1R34A 3D2FA 4IWOA 3BVXA 4E3CA 2GA9D 2Z0VA 4FZPA 3KDRA 3DX4A 1TQTA 3EJSA 3CVRA 3DX0A 2GF4A 3O3MB 3LMFA 2F7PA 3DX3A 3QNJA 3L3PA 1DKYA 2LXYA 4UDYX 2EX3B 1R33A 4AZCA 3D4ZA 3ABHA 3GI7A 4AZBA 4FZOA 3QWEA 2D4CA 3D2EA 3T48A 1GNLA 5E84A 3QA8A 2FYVA 4AZGA 4R5LA 2OBMA 3BUPA 3ER9B 4EZTA 1UPXA 4EZUA 3DDFA 2ELBA 2WYHA 3DPOA 3CKDA 3I01A 2YL8A 3VEBA 1HTYA 1JQKA 3ACOA 4FM3A 4UDXX 3UITA 3BUIA 2RAJA 2Z0OA 3FD9A 2OZNB 1X03A 2EWFA 2YLLA 2YL5A 4I1QA 3O3NB 2YL9A 4D8JA 4R5JA 3RV0A 3PLTA 2FICA 2YIAA 1SUFA 4AZ5A 4AZIA 4IW0A 2O0I1 3T49A 3BUBA 3BLBA 1TQVA 3D51A 4WPCA 3SOGA 3CZNA 2YIBA 3DDGA 1QWNA 2D1LA 3HAIA 3T46A 4HR1B 2OO2A 1TQUA 3DX1A 4R5GA 3OK8A 3T47A 3F7WA 5FLEX 2N3KA 2OBLA 2WYIA 4DYLA 3VKHA 3EJRA 2JNKA 1ZWWA 1MJGA 4JWEA 4KIKA 4JWCA 4F00A 3VEAA 2ND1A 1U00A 2GAFD 1O7DC 2YKTA 3LLLA 3D50A 1HWWA 3BVTA 1HXKA 4AZCB 2WINM 3LVTA 4EZYA 2Q13A 4IWQA 4IM0A 1QX1A 4HY9A 4WPEA 1GNTA 2RAIA 1E2UA 4JNEA 1DKZA 3KAWA 4NPHA 1SU6A 3CV5A 3G9GA 3I04A 4JN4A 3ERCC 4NQIA 3BVUA 1SU8A 2LM0A 3I2WA 4R5KA 3D52A 2X5CA 2YLAA 2F1BA 3D4YA 1PS3A 3RPMA 4EZRA 3OHXM 4AVMA 1E1DA 4IM3A 3BVVA 2F7QA 3HAHA 2X3WA 3Q0KA 5TKYA 4EZQA 3EJTA 3RV1A 1Y2OA 1YWMA 4G6QA 3T4AG 4FZSA 3EJQA 3QNIA 5KBPA 4IM2A 2ND0A 4AZ7A 3B52X 3Q84A 3BUQA 5C5BA 2X3VA 4EZPA 3I39X 3CZSA 3O3OB 2EFLA 1URUA 4HYBA 3OWGA 4JLCA 5C5BB 4DCNC 2ALWA 1I4DA 4JNFA 4EZWA 2YI9A 4R5IA 1OA0A 2ZXQA 4AZHA 2F1AA 3DX2A 2EFKA 3DYTA 4M0MA 2F18A 3DPQA 3BUDA 1X04A 2YL6A 3QE6A 4KIKB 4AZ6A 2NCZA 4F01A 4AKVA 3ZEDA 3BVWA 1ZYLA 4EZSA 2Q12A 1OA1A 4EZZA 4EZOA
chains in the Genus database with same CATH topology
2O0I1 1YWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0I 1;  1YWM A; 
#chains in the Genus database with same CATH topology
 2Z8Y A;  4H8S A;  1GN9 A;  2MI7 A;  4E81 A;  4NSW A;  3EJP A;  2C08 A;  1DKX A;  1E9V A;  1TQS A;  3CAZ A;  1QWU A;  3M3W A;  2QKW A;  3B51 X;  1WDZ A;  2PY6 A;  1O7D B;  2RAK A;  2QFF A;  3SYV A;  3A98 A;  2PMR A;  3ER8 C;  2F7O A;  5FIG A;  1LQ7 A;  2F7R A;  4EZX A;  3L3O M;  2V0O A;  1I4L A;  1I49 A;  4EZN A;  4H6I A;  1I4T A;  2OW6 A;  2RT6 A;  2Z0N A;  3DPP A;  3B53 X;  1OAO A;  2QXL A;  1TQW A;  2OW7 A;  4JWI A;  3HAJ A;  2KHO A;  4B9Q A;  4PO2 A;  4JWD A;  3KAV A;  3EJU A;  2X3X A;  2JNS A;  3C7N A;  4BNE A;  4ATM A;  4HR1 A;  4H6H A;  4IWP A;  4JL9 A;  2YIV X;  2YI8 A;  1R5E A;  1SU7 A;  1W9M A;  4EZV A;  1R34 A;  3D2F A;  4IWO A;  3BVX A;  4E3C A;  2GA9 D;  2Z0V A;  4FZP A;  3KDR A;  3DX4 A;  1TQT A;  3EJS A;  3CVR A;  3DX0 A;  2GF4 A;  3O3M B;  3LMF A;  2F7P A;  3DX3 A;  3QNJ A;  3L3P A;  1DKY A;  2LXY A;  4UDY X;  2EX3 B;  1R33 A;  4AZC A;  3D4Z A;  3ABH A;  3GI7 A;  4AZB A;  4FZO A;  3QWE A;  2D4C A;  3D2E A;  3T48 A;  1GNL A;  5E84 A;  3QA8 A;  2FYV A;  4AZG A;  4R5L A;  2OBM A;  3BUP A;  3ER9 B;  4EZT A;  1UPX A;  4EZU A;  3DDF A;  2ELB A;  2WYH A;  3DPO A;  3CKD A;  3I01 A;  2YL8 A;  3VEB A;  1HTY A;  1JQK A;  3ACO A;  4FM3 A;  4UDX X;  3UIT A;  3BUI A;  2RAJ A;  2Z0O A;  3FD9 A;  2OZN B;  1X03 A;  2EWF A;  2YLL A;  2YL5 A;  4I1Q A;  3O3N B;  2YL9 A;  4D8J A;  4R5J A;  3RV0 A;  3PLT A;  2FIC A;  2YIA A;  1SUF A;  4AZ5 A;  4AZI A;  4IW0 A;  2O0I 1;  3T49 A;  3BUB A;  3BLB A;  1TQV A;  3D51 A;  4WPC A;  3SOG A;  3CZN A;  2YIB A;  3DDG A;  1QWN A;  2D1L A;  3HAI A;  3T46 A;  4HR1 B;  2OO2 A;  1TQU A;  3DX1 A;  4R5G A;  3OK8 A;  3T47 A;  3F7W A;  5FLE X;  2N3K A;  2OBL A;  2WYI A;  4DYL A;  3VKH A;  3EJR A;  2JNK A;  1ZWW A;  1MJG A;  4JWE A;  4KIK A;  4JWC A;  4F00 A;  3VEA A;  2ND1 A;  1U00 A;  2GAF D;  1O7D C;  2YKT A;  3LLL A;  3D50 A;  1HWW A;  3BVT A;  1HXK A;  4AZC B;  2WIN M;  3LVT A;  4EZY A;  2Q13 A;  4IWQ A;  4IM0 A;  1QX1 A;  4HY9 A;  4WPE A;  1GNT A;  2RAI A;  1E2U A;  4JNE A;  1DKZ A;  3KAW A;  4NPH A;  1SU6 A;  3CV5 A;  3G9G A;  3I04 A;  4JN4 A;  3ERC C;  4NQI A;  3BVU A;  1SU8 A;  2LM0 A;  3I2W A;  4R5K A;  3D52 A;  2X5C A;  2YLA A;  2F1B A;  3D4Y A;  1PS3 A;  3RPM A;  4EZR A;  3OHX M;  4AVM A;  1E1D A;  4IM3 A;  3BVV A;  2F7Q A;  3HAH A;  2X3W A;  3Q0K A;  5TKY A;  4EZQ A;  3EJT A;  3RV1 A;  1Y2O A;  1YWM A;  4G6Q A;  3T4A G;  4FZS A;  3EJQ A;  3QNI A;  5KBP A;  4IM2 A;  2ND0 A;  4AZ7 A;  3B52 X;  3Q84 A;  3BUQ A;  5C5B A;  2X3V A;  4EZP A;  3I39 X;  3CZS A;  3O3O B;  2EFL A;  1URU A;  4HYB A;  3OWG A;  4JLC A;  5C5B B;  4DCN C;  2ALW A;  1I4D A;  4JNF A;  4EZW A;  2YI9 A;  4R5I A;  1OA0 A;  2ZXQ A;  4AZH A;  2F1A A;  3DX2 A;  2EFK A;  3DYT A;  4M0M A;  2F18 A;  3DPQ A;  3BUD A;  1X04 A;  2YL6 A;  3QE6 A;  4KIK B;  4AZ6 A;  2NCZ A;  4F01 A;  4AKV A;  3ZED A;  3BVW A;  1ZYL A;  4EZS A;  2Q12 A;  1OA1 A;  4EZZ A;  4EZO A; 
#chains in the Genus database with same CATH homology
 2O0I 1;  1YWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...