1YWMA

Crystal structure of the n-terminal domain of group b streptococcus alpha c protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
180
structure length
180
Chain Sequence
STIPGSAATLNTSITKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFTAKYVFRQGTKYYGDVSQLQSTGRASLTYNIFGEDGLPHVKTDGQIDIVSVALTIYDSTTLRDKIEEVRTNANDPKWTEESRTEVLTGLDTIKTDIDNNPKTQTDIDSKIVEVNELEKLLVLKLAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C protein alpha-antigen
publication title Crystal structure of the N-terminal domain of the group B streptococcus alpha C protein.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Surface active protein
total genus 59
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08829 AlphaC_N Alpha C protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.150 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Surface Active Protein 1ywmA02
2.60.500.10 Mainly Beta Sandwich Surface Active Protein fold Surface Active Protein domain 1ywmA01
2O0I1 1YWMA
chains in the Genus database with same CATH superfamily
3VEBA 1SU8A 3D2EA 2YIAA 2ND0A 4R5IA 1URUA 1ZWWA 3C7NA 3ERCC 5C5BB 4DCNC 3EJRA 2WINM 2EX3B 3CZSA 4FZPA 4AZCA 4EZOA 2RAIA 4EZVA 4BNEA 3Q0KA 4F01A 2D4CA 3RV0A 2X3WA 1OA1A 3CZNA 4JWCA 4WPEA 4E3CA 3EJUA 3DPPA 3ZEDA 1W9MA 2RT6A 3RPMA 4NQIA 1O7DB 1DKYA 1E2UA 4IM0A 4JWIA 4AZ7A 3OK8A 3T48A 2KHOA 2EWFA 1SU7A 1HWWA 2NCZA 3I39X 4HR1A 2ND1A 2X5CA 3DX1A 5FIGA 1SU6A 2LXYA 2RAJA 2GAFD 3A98A 2YL6A 1E1DA 4NSWA 3G9GA 3CKDA 1I4LA 1JQKA 3LLLA 2F1AA 3OWGA 1HXKA 5E84A 4EZRA 1I49A 1LQ7A 3BUDA 4E81A 4EZQA 4PO2A 2V0OA 1SUFA 2C08A 1YWMA 1OAOA 2X3XA 2YI9A 1I4TA 3ER9B 4D8JA 5C5BA 2PY6A 1GNTA 4G6QA 3D2FA 4JNFA 2YIBA 3DPOA 4EZXA 4AVMA 4EZWA 4AZ5A 2Z0NA 3M3WA 4JLCA 3D4YA 4B9QA 1I4DA 3VKHA 3BVTA 2OBLA 1ZYLA 4JWDA 1QWUA 1TQWA 1DKZA 2OO2A 4EZNA 1QWNA 4R5GA 4KIKB 3I01A 3O3MB 2D1LA 3QNIA 3DX0A 3ER8C 3EJSA 4AZBA 1TQSA 2GF4A 2Z0VA 3OHXM 3BUIA 4EZZA 3HAIA 3DYTA 3QE6A 1U00A 4NPHA 4EZSA 1R34A 1R33A 3HAHA 2F18A 2YKTA 3LMFA 3EJPA 1TQTA 4AZ6A 3BUBA 1QX1A 3DX2A 3BVWA 2QXLA 4EZPA 3T4AG 1MJGA 2O0I1 4UDXX 2PMRA 2WYHA 3O3OB 2EFKA 2EFLA 2YIVX 2YL9A 2ELBA 3BVUA 4IWOA 2QFFA 2OZNB 4H8SA 1UPXA 3BUQA 2Q13A 4IM2A 3EJTA 4ATMA 3T47A 4DYLA 3KDRA 4IW0A 3EJQA 3RV1A 1Y2OA 3O3NB 4F00A 3T49A 4FZOA 3SOGA 4HYBA 2Z0OA 4JNEA 1X03A 4FZSA 4AZGA 3KAWA 3DDFA 4M0MA 4I1QA 3I04A 3BVVA 4EZUA 4AZHA 1WDZA 1O7DC 4H6IA 2Q12A 3CAZA 4KIKA 2F7QA 4EZTA 4R5KA 2YLLA 1PS3A 2ZXQA 2QKWA 2F7RA 4HY9A 3D51A 2JNKA 2Z8YA 3D50A 4JN4A 3BLBA 5TKYA 1GN9A 3D4ZA 1HTYA 3BVXA 1DKXA 3FD9A 3T46A 3PLTA 3DDGA 3CVRA 3CV5A 3Q84A 3B52X 4UDYX 4IWPA 1GNLA 3QA8A 3DPQA 2RAKA 4R5LA 2YL8A 3DX3A 3L3OM 3ABHA 3BUPA 3QNJA 4AZCB 3I2WA 2F7OA 4AKVA 4AZIA 4H6HA 2YI8A 2WYIA 2GA9D 2MI7A 1OA0A 3B51X 1X04A 4IM3A 3HAJA 3ACOA 4FM3A 3L3PA 2N3KA 4IWQA 4JWEA 3GI7A 2FICA 2LM0A 2FYVA 5FLEX 1E9VA 3QWEA 2JNSA 2OW6A 3KAVA 2OBMA 4R5JA 3VEAA 2YLAA 2F1BA 4HR1B 3F7WA 4WPCA 1R5EA 1TQUA 4JL9A 3LVTA 2X3VA 3DX4A 2ALWA 2YL5A 4EZYA 2OW7A 2F7PA 5KBPA 3UITA 3B53X 3SYVA 3D52A 1TQVA
chains in the Genus database with same CATH topology
2O0I1 1YWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0I 1;  1YWM A; 
#chains in the Genus database with same CATH topology
 3VEB A;  1SU8 A;  3D2E A;  2YIA A;  2ND0 A;  4R5I A;  1URU A;  1ZWW A;  3C7N A;  3ERC C;  5C5B B;  4DCN C;  3EJR A;  2WIN M;  2EX3 B;  3CZS A;  4FZP A;  4AZC A;  4EZO A;  2RAI A;  4EZV A;  4BNE A;  3Q0K A;  4F01 A;  2D4C A;  3RV0 A;  2X3W A;  1OA1 A;  3CZN A;  4JWC A;  4WPE A;  4E3C A;  3EJU A;  3DPP A;  3ZED A;  1W9M A;  2RT6 A;  3RPM A;  4NQI A;  1O7D B;  1DKY A;  1E2U A;  4IM0 A;  4JWI A;  4AZ7 A;  3OK8 A;  3T48 A;  2KHO A;  2EWF A;  1SU7 A;  1HWW A;  2NCZ A;  3I39 X;  4HR1 A;  2ND1 A;  2X5C A;  3DX1 A;  5FIG A;  1SU6 A;  2LXY A;  2RAJ A;  2GAF D;  3A98 A;  2YL6 A;  1E1D A;  4NSW A;  3G9G A;  3CKD A;  1I4L A;  1JQK A;  3LLL A;  2F1A A;  3OWG A;  1HXK A;  5E84 A;  4EZR A;  1I49 A;  1LQ7 A;  3BUD A;  4E81 A;  4EZQ A;  4PO2 A;  2V0O A;  1SUF A;  2C08 A;  1YWM A;  1OAO A;  2X3X A;  2YI9 A;  1I4T A;  3ER9 B;  4D8J A;  5C5B A;  2PY6 A;  1GNT A;  4G6Q A;  3D2F A;  4JNF A;  2YIB A;  3DPO A;  4EZX A;  4AVM A;  4EZW A;  4AZ5 A;  2Z0N A;  3M3W A;  4JLC A;  3D4Y A;  4B9Q A;  1I4D A;  3VKH A;  3BVT A;  2OBL A;  1ZYL A;  4JWD A;  1QWU A;  1TQW A;  1DKZ A;  2OO2 A;  4EZN A;  1QWN A;  4R5G A;  4KIK B;  3I01 A;  3O3M B;  2D1L A;  3QNI A;  3DX0 A;  3ER8 C;  3EJS A;  4AZB A;  1TQS A;  2GF4 A;  2Z0V A;  3OHX M;  3BUI A;  4EZZ A;  3HAI A;  3DYT A;  3QE6 A;  1U00 A;  4NPH A;  4EZS A;  1R34 A;  1R33 A;  3HAH A;  2F18 A;  2YKT A;  3LMF A;  3EJP A;  1TQT A;  4AZ6 A;  3BUB A;  1QX1 A;  3DX2 A;  3BVW A;  2QXL A;  4EZP A;  3T4A G;  1MJG A;  2O0I 1;  4UDX X;  2PMR A;  2WYH A;  3O3O B;  2EFK A;  2EFL A;  2YIV X;  2YL9 A;  2ELB A;  3BVU A;  4IWO A;  2QFF A;  2OZN B;  4H8S A;  1UPX A;  3BUQ A;  2Q13 A;  4IM2 A;  3EJT A;  4ATM A;  3T47 A;  4DYL A;  3KDR A;  4IW0 A;  3EJQ A;  3RV1 A;  1Y2O A;  3O3N B;  4F00 A;  3T49 A;  4FZO A;  3SOG A;  4HYB A;  2Z0O A;  4JNE A;  1X03 A;  4FZS A;  4AZG A;  3KAW A;  3DDF A;  4M0M A;  4I1Q A;  3I04 A;  3BVV A;  4EZU A;  4AZH A;  1WDZ A;  1O7D C;  4H6I A;  2Q12 A;  3CAZ A;  4KIK A;  2F7Q A;  4EZT A;  4R5K A;  2YLL A;  1PS3 A;  2ZXQ A;  2QKW A;  2F7R A;  4HY9 A;  3D51 A;  2JNK A;  2Z8Y A;  3D50 A;  4JN4 A;  3BLB A;  5TKY A;  1GN9 A;  3D4Z A;  1HTY A;  3BVX A;  1DKX A;  3FD9 A;  3T46 A;  3PLT A;  3DDG A;  3CVR A;  3CV5 A;  3Q84 A;  3B52 X;  4UDY X;  4IWP A;  1GNL A;  3QA8 A;  3DPQ A;  2RAK A;  4R5L A;  2YL8 A;  3DX3 A;  3L3O M;  3ABH A;  3BUP A;  3QNJ A;  4AZC B;  3I2W A;  2F7O A;  4AKV A;  4AZI A;  4H6H A;  2YI8 A;  2WYI A;  2GA9 D;  2MI7 A;  1OA0 A;  3B51 X;  1X04 A;  4IM3 A;  3HAJ A;  3ACO A;  4FM3 A;  3L3P A;  2N3K A;  4IWQ A;  4JWE A;  3GI7 A;  2FIC A;  2LM0 A;  2FYV A;  5FLE X;  1E9V A;  3QWE A;  2JNS A;  2OW6 A;  3KAV A;  2OBM A;  4R5J A;  3VEA A;  2YLA A;  2F1B A;  4HR1 B;  3F7W A;  4WPC A;  1R5E A;  1TQU A;  4JL9 A;  3LVT A;  2X3V A;  3DX4 A;  2ALW A;  2YL5 A;  4EZY A;  2OW7 A;  2F7P A;  5KBP A;  3UIT A;  3B53 X;  3SYV A;  3D52 A;  1TQV A; 
#chains in the Genus database with same CATH homology
 2O0I 1;  1YWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...