1YWMA

Crystal structure of the n-terminal domain of group b streptococcus alpha c protein
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
180
structure length
180
Chain Sequence
STIPGSAATLNTSITKNIQNGNAYIDLYDVKLGKIDPLQLIVLEQGFTAKYVFRQGTKYYGDVSQLQSTGRASLTYNIFGEDGLPHVKTDGQIDIVSVALTIYDSTTLRDKIEEVRTNANDPKWTEESRTEVLTGLDTIKTDIDNNPKTQTDIDSKIVEVNELEKLLVLKLAAALEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C protein alpha-antigen
publication title Crystal structure of the N-terminal domain of the group B streptococcus alpha C protein.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Surface active protein
total genus 59
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08829 AlphaC_N Alpha C protein N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.150 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Surface Active Protein 1ywmA02
2.60.500.10 Mainly Beta Sandwich Surface Active Protein fold Surface Active Protein domain 1ywmA01
2O0I1 1YWMA
chains in the Genus database with same CATH superfamily
2GF4A 3BVTA 3RPMA 2OBLA 1HWWA 3QE6A 2N3KA 2YI9A 4EZPA 2ZXQA 3HAIA 1TQUA 3BUDA 4H8SA 3T46A 3DX2A 2X5CA 3KAVA 2D4CA 3BUQA 3SOGA 3O3MB 3VEAA 1DKXA 1ZYLA 4G6QA 3ER8C 3EJRA 4KIKB 5FLEX 3OK8A 2YKTA 4H6HA 4EZVA 2YL6A 4AZ7A 3BVWA 1U00A 3CV5A 2QFFA 3Q0KA 1PS3A 1HTYA 3VEBA 3D4ZA 2D1LA 2YIBA 3BVVA 3BUIA 1HXKA 4D8JA 2YLLA 3QNIA 2GAFD 3D52A 3T49A 2EWFA 2QKWA 1QWNA 4JWEA 4BNEA 2PY6A 4IWOA 2YL8A 1WDZA 3RV0A 4IM0A 4KIKA 2Z0NA 1DKYA 1X03A 2EFLA 2RAKA 2JNKA 3OWGA 1OA1A 3B52X 1OAOA 2OBMA 2QXLA 1O7DC 4DCNC 2Z0OA 5FIGA 4IWPA 4HR1B 1URUA 3HAJA 4JWCA 2ELBA 4JWDA 4NPHA 1TQWA 4UDYX 3EJSA 2Q12A 2O0I1 3F7WA 4FZSA 2ND0A 3EJQA 4FZPA 1DKZA 4R5LA 2C08A 2LXYA 1GNTA 3DPOA 2FICA 3ERCC 4AZ6A 2FYVA 1LQ7A 4NSWA 3KDRA 4IW0A 4EZNA 3DYTA 3L3OM 1E2UA 4R5KA 4HR1A 3D2FA 2ND1A 1I4LA 3L3PA 2X3WA 4B9QA 4EZQA 3PLTA 4AZGA 1ZWWA 4JLCA 2OW7A 3CKDA 3B51X 3QA8A 2OO2A 3QWEA 3ER9B 3D51A 2NCZA 3M3WA 3FD9A 3Q84A 3D50A 1R34A 4E3CA 2YL9A 4IM3A 3D2EA 3I04A 3CAZA 3OHXM 4HYBA 1R33A 5KBPA 3A98A 1QWUA 4EZTA 1MJGA 2OZNB 3GI7A 1I4DA 3I39X 3BUPA 3G9GA 3BVUA 4EZOA 3EJPA 4EZWA 2WYHA 2ALWA 4JNFA 4E81A 3ACOA 5C5BB 3SYVA 2WINM 2MI7A 3BVXA 4FM3A 1TQVA 3DDGA 2RAJA 1GN9A 3DDFA 1JQKA 4AKVA 2YL5A 4I1QA 1X04A 4HY9A 1E1DA 3BLBA 1QX1A 2Z8YA 3O3NB 1I49A 1SU6A 4PO2A 3BUBA 1UPXA 4AZ5A 3I01A 3ZEDA 4AZHA 3LVTA 1YWMA 3LMFA 5C5BA 2X3XA 2WYIA 2F1AA 3DX0A 4AZCA 4IM2A 3T4AG 3ABHA 2Z0VA 4AZBA 4EZSA 4JN4A 3T48A 3LLLA 3QNJA 2JNSA 1OA0A 1R5EA 2V0OA 2Q13A 2OW6A 2PMRA 4JL9A 1SU8A 2RAIA 3HAHA 4EZUA 4F01A 2YI8A 3DPQA 4EZYA 3EJTA 2KHOA 2LM0A 4IWQA 4R5GA 4UDXX 2F1BA 4WPEA 1Y2OA 4EZRA 1SUFA 4JWIA 3DX4A 4FZOA 3D4YA 3UITA 4ATMA 4EZXA 2YLAA 2RT6A 3RV1A 3CZSA 1TQSA 2F18A 4JNEA 2X3VA 2F7OA 1GNLA 3DX1A 3EJUA 4WPCA 2EFKA 3I2WA 5TKYA 4H6IA 1E9VA 4AZCB 1O7DB 4R5IA 1TQTA 3C7NA 4AZIA 2EX3B 3DX3A 1SU7A 3CZNA 3B53X 3T47A 2YIAA 4AVMA 1I4TA 2YIVX 3O3OB 4M0MA 2F7QA 3VKHA 5E84A 4DYLA 4NQIA 2F7RA 1W9MA 3KAWA 3CVRA 4EZZA 2F7PA 2GA9D 4R5JA 4F00A 3DPPA
chains in the Genus database with same CATH topology
2O0I1 1YWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0I 1;  1YWM A; 
#chains in the Genus database with same CATH topology
 2GF4 A;  3BVT A;  3RPM A;  2OBL A;  1HWW A;  3QE6 A;  2N3K A;  2YI9 A;  4EZP A;  2ZXQ A;  3HAI A;  1TQU A;  3BUD A;  4H8S A;  3T46 A;  3DX2 A;  2X5C A;  3KAV A;  2D4C A;  3BUQ A;  3SOG A;  3O3M B;  3VEA A;  1DKX A;  1ZYL A;  4G6Q A;  3ER8 C;  3EJR A;  4KIK B;  5FLE X;  3OK8 A;  2YKT A;  4H6H A;  4EZV A;  2YL6 A;  4AZ7 A;  3BVW A;  1U00 A;  3CV5 A;  2QFF A;  3Q0K A;  1PS3 A;  1HTY A;  3VEB A;  3D4Z A;  2D1L A;  2YIB A;  3BVV A;  3BUI A;  1HXK A;  4D8J A;  2YLL A;  3QNI A;  2GAF D;  3D52 A;  3T49 A;  2EWF A;  2QKW A;  1QWN A;  4JWE A;  4BNE A;  2PY6 A;  4IWO A;  2YL8 A;  1WDZ A;  3RV0 A;  4IM0 A;  4KIK A;  2Z0N A;  1DKY A;  1X03 A;  2EFL A;  2RAK A;  2JNK A;  3OWG A;  1OA1 A;  3B52 X;  1OAO A;  2OBM A;  2QXL A;  1O7D C;  4DCN C;  2Z0O A;  5FIG A;  4IWP A;  4HR1 B;  1URU A;  3HAJ A;  4JWC A;  2ELB A;  4JWD A;  4NPH A;  1TQW A;  4UDY X;  3EJS A;  2Q12 A;  2O0I 1;  3F7W A;  4FZS A;  2ND0 A;  3EJQ A;  4FZP A;  1DKZ A;  4R5L A;  2C08 A;  2LXY A;  1GNT A;  3DPO A;  2FIC A;  3ERC C;  4AZ6 A;  2FYV A;  1LQ7 A;  4NSW A;  3KDR A;  4IW0 A;  4EZN A;  3DYT A;  3L3O M;  1E2U A;  4R5K A;  4HR1 A;  3D2F A;  2ND1 A;  1I4L A;  3L3P A;  2X3W A;  4B9Q A;  4EZQ A;  3PLT A;  4AZG A;  1ZWW A;  4JLC A;  2OW7 A;  3CKD A;  3B51 X;  3QA8 A;  2OO2 A;  3QWE A;  3ER9 B;  3D51 A;  2NCZ A;  3M3W A;  3FD9 A;  3Q84 A;  3D50 A;  1R34 A;  4E3C A;  2YL9 A;  4IM3 A;  3D2E A;  3I04 A;  3CAZ A;  3OHX M;  4HYB A;  1R33 A;  5KBP A;  3A98 A;  1QWU A;  4EZT A;  1MJG A;  2OZN B;  3GI7 A;  1I4D A;  3I39 X;  3BUP A;  3G9G A;  3BVU A;  4EZO A;  3EJP A;  4EZW A;  2WYH A;  2ALW A;  4JNF A;  4E81 A;  3ACO A;  5C5B B;  3SYV A;  2WIN M;  2MI7 A;  3BVX A;  4FM3 A;  1TQV A;  3DDG A;  2RAJ A;  1GN9 A;  3DDF A;  1JQK A;  4AKV A;  2YL5 A;  4I1Q A;  1X04 A;  4HY9 A;  1E1D A;  3BLB A;  1QX1 A;  2Z8Y A;  3O3N B;  1I49 A;  1SU6 A;  4PO2 A;  3BUB A;  1UPX A;  4AZ5 A;  3I01 A;  3ZED A;  4AZH A;  3LVT A;  1YWM A;  3LMF A;  5C5B A;  2X3X A;  2WYI A;  2F1A A;  3DX0 A;  4AZC A;  4IM2 A;  3T4A G;  3ABH A;  2Z0V A;  4AZB A;  4EZS A;  4JN4 A;  3T48 A;  3LLL A;  3QNJ A;  2JNS A;  1OA0 A;  1R5E A;  2V0O A;  2Q13 A;  2OW6 A;  2PMR A;  4JL9 A;  1SU8 A;  2RAI A;  3HAH A;  4EZU A;  4F01 A;  2YI8 A;  3DPQ A;  4EZY A;  3EJT A;  2KHO A;  2LM0 A;  4IWQ A;  4R5G A;  4UDX X;  2F1B A;  4WPE A;  1Y2O A;  4EZR A;  1SUF A;  4JWI A;  3DX4 A;  4FZO A;  3D4Y A;  3UIT A;  4ATM A;  4EZX A;  2YLA A;  2RT6 A;  3RV1 A;  3CZS A;  1TQS A;  2F18 A;  4JNE A;  2X3V A;  2F7O A;  1GNL A;  3DX1 A;  3EJU A;  4WPC A;  2EFK A;  3I2W A;  5TKY A;  4H6I A;  1E9V A;  4AZC B;  1O7D B;  4R5I A;  1TQT A;  3C7N A;  4AZI A;  2EX3 B;  3DX3 A;  1SU7 A;  3CZN A;  3B53 X;  3T47 A;  2YIA A;  4AVM A;  1I4T A;  2YIV X;  3O3O B;  4M0M A;  2F7Q A;  3VKH A;  5E84 A;  4DYL A;  4NQI A;  2F7R A;  1W9M A;  3KAW A;  3CVR A;  4EZZ A;  2F7P A;  2GA9 D;  4R5J A;  4F00 A;  3DPP A; 
#chains in the Genus database with same CATH homology
 2O0I 1;  1YWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...