3M3WA

Crystal strcuture of mouse pacsin3 bar domain mutant
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
288
structure length
280
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHGFRASRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSMQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 112
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3m3wA01
2EFKA 2Z0OA 2Q12A 1Y2OA 3G9GA 3LLLA 4I1QA 3CAZA 3QNIA 3QE6A 2FICA 2Z0VA 3Q0KA 4WPCA 3M3WA 4FZSA 4WPEA 2Q13A 3Q84A 2C08A 2D1LA 2RAJA 1I4LA 1I4DA 1ZWWA 3OK8A 3SYVA 4BNEA 2V0OA 4DCNC 3ABHA 1X03A 3I2WA 3ACOA 3HAHA 1I49A 1I4TA 4H8SA 3HAJA 3QWEA 2YKTA 2Z0NA 3DYTA 1URUA 2RAIA 4AVMA 2RAKA 4NSWA 4ATMA 2X3WA 1WDZA 2D4CA 4DYLA 1X04A 3HAIA 3SOGA 3PLTA 4AKVA 5C5BB 2X3VA 2X3XA 4NQIA 5C5BA 2EFLA 2ELBA
chains in the Genus database with same CATH superfamily
1Y2OA 1OA1A 2EWFA 4WPEA 2YIBA 4R5KA 3DX2A 3T49A 3I2WA 1TQUA 4EZPA 2EX3B 4E3CA 3D52A 3LVTA 3SOGA 4H6IA 3QNJA 1JQKA 2ND1A 3LLLA 4EZTA 3BUIA 2F1BA 1I4LA 3T4AG 4AZIA 4EZVA 3CZNA 4AVMA 1SU7A 2YIAA 4KIKA 1DKZA 3D51A 4JNEA 2ZXQA 4HR1A 1E2UA 2D4CA 5FIGA 2O0I1 1E9VA 2FYVA 3KAWA 2GAFD 3CVRA 2QXLA 4PO2A 3D4YA 4JWEA 3UITA 1HWWA 2RAJA 3SYVA 4IWQA 3ABHA 1I49A 2YKTA 3GI7A 4NSWA 2OZNB 1TQVA 3VKHA 2OW6A 3OWGA 2ELBA 4G6QA 3DX0A 3Q84A 2OO2A 2D1LA 2OBMA 2RAKA 5KBPA 4IM3A 1UPXA 2WINM 2YL9A 4IM2A 2Q12A 4I1QA 3RV1A 4R5LA 4FZPA 4H6HA 4IM0A 3EJSA 4HYBA 5FLEX 1X03A 4EZWA 3BVWA 2F18A 1WDZA 2YLAA 3PLTA 3RV0A 2EFLA 3I39X 4IW0A 1OA0A 3EJTA 4AZ6A 3BUDA 2FICA 4WPCA 2Q13A 2JNKA 3EJUA 3CZSA 3HAHA 1YWMA 2YI8A 4ATMA 3C7NA 3T47A 4EZYA 4R5IA 5C5BB 2X3VA 3QE6A 3OHXM 4EZNA 1LQ7A 2LXYA 2F7OA 3EJPA 2X5CA 3BUBA 3LMFA 4DCNC 3VEAA 4EZSA 3A98A 4JWDA 1SU6A 2PY6A 3BUQA 3D2FA 3B51X 3DDFA 4FZOA 2MI7A 1TQWA 3CAZA 2ND0A 2OW7A 4R5GA 4F01A 3QA8A 3O3NB 1ZWWA 3BVTA 3DX1A 2YL5A 1URUA 5TKYA 3B52X 3BVVA 4DYLA 3ER9B 3D4ZA 3CKDA 2WYHA 3DPQA 4EZUA 1O7DB 2F7QA 3KDRA 1W9MA 1ZYLA 3OK8A 2YIVX 3ERCC 2Z0NA 2LM0A 3CV5A 2X3XA 5C5BA 1SUFA 1R33A 1TQTA 3D2EA 4M0MA 3QNIA 2RT6A 4JWIA 3M3WA 2QFFA 1GN9A 4FM3A 2C08A 3T48A 4D8JA 4H8SA 1R34A 3O3OB 4B9QA 2Z8YA 3HAIA 3BVUA 4AZ7A 2YI9A 3ER8C 2JNSA 2Z0VA 4EZZA 1GNTA 1HXKA 3BUPA 1R5EA 2QKWA 3HAJA 4AZHA 2YL6A 3B53X 4AZCB 2YLLA 4F00A 2PMRA 3O3MB 4AZBA 3L3OM 2OBLA 4R5JA 2YL8A 2V0OA 1PS3A 3RPMA 1U00A 4E81A 2RAIA 4HY9A 3DDGA 4AZGA 2X3WA 1X04A 3VEBA 4JLCA 1DKYA 4JWCA 3EJQA 4JNFA 3I01A 1DKXA 4UDXX 4BNEA 2N3KA 1E1DA 3ACOA 3DX4A 3KAVA 3BLBA 3QWEA 3EJRA 2EFKA 1QWUA 3Q0KA 4IWPA 3ZEDA 2WYIA 4EZOA 4JL9A 1QX1A 3I04A 2F7PA 3DYTA 4UDYX 3L3PA 2NCZA 4AZCA 1QWNA 2Z0OA 1OAOA 4JN4A 3T46A 4FZSA 5E84A 3D50A 2ALWA 4KIKB 4EZRA 1GNLA 4HR1B 4AZ5A 2KHOA 4EZQA 4IWOA 4AKVA 4EZXA 3DPPA 3G9GA 1TQSA 2GA9D 3DPOA 1O7DC 1MJGA 2F1AA 1I4DA 1SU8A 1HTYA 3F7WA 1I4TA 4NPHA 3DX3A 3FD9A 2F7RA 4NQIA 2GF4A 3BVXA
chains in the Genus database with same CATH topology
2EFKA 2Z0OA 2Q12A 1Y2OA 3G9GA 3LLLA 4I1QA 3CAZA 3QNIA 3QE6A 2FICA 2Z0VA 3Q0KA 4WPCA 3M3WA 4FZSA 4WPEA 2Q13A 3Q84A 2C08A 2D1LA 2RAJA 1I4LA 1I4DA 1ZWWA 3OK8A 3SYVA 4BNEA 2V0OA 4DCNC 3ABHA 1X03A 3I2WA 3ACOA 3HAHA 1I49A 1I4TA 4H8SA 3HAJA 3QWEA 2YKTA 2Z0NA 3DYTA 1URUA 2RAIA 4AVMA 2RAKA 4NSWA 4ATMA 2X3WA 1WDZA 2D4CA 4DYLA 1X04A 3HAIA 3SOGA 3PLTA 4AKVA 5C5BB 2X3VA 2X3XA 4NQIA 5C5BA 2EFLA 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFK A;  2Z0O A;  2Q12 A;  1Y2O A;  3G9G A;  3LLL A;  4I1Q A;  3CAZ A;  3QNI A;  3QE6 A;  2FIC A;  2Z0V A;  3Q0K A;  4WPC A;  3M3W A;  4FZS A;  4WPE A;  2Q13 A;  3Q84 A;  2C08 A;  2D1L A;  2RAJ A;  1I4L A;  1I4D A;  1ZWW A;  3OK8 A;  3SYV A;  4BNE A;  2V0O A;  4DCN C;  3ABH A;  1X03 A;  3I2W A;  3ACO A;  3HAH A;  1I49 A;  1I4T A;  4H8S A;  3HAJ A;  3QWE A;  2YKT A;  2Z0N A;  3DYT A;  1URU A;  2RAI A;  4AVM A;  2RAK A;  4NSW A;  4ATM A;  2X3W A;  1WDZ A;  2D4C A;  4DYL A;  1X04 A;  3HAI A;  3SOG A;  3PLT A;  4AKV A;  5C5B B;  2X3V A;  2X3X A;  4NQI A;  5C5B A;  2EFL A;  2ELB A; 
#chains in the Genus database with same CATH topology
 1Y2O A;  1OA1 A;  2EWF A;  4WPE A;  2YIB A;  4R5K A;  3DX2 A;  3T49 A;  3I2W A;  1TQU A;  4EZP A;  2EX3 B;  4E3C A;  3D52 A;  3LVT A;  3SOG A;  4H6I A;  3QNJ A;  1JQK A;  2ND1 A;  3LLL A;  4EZT A;  3BUI A;  2F1B A;  1I4L A;  3T4A G;  4AZI A;  4EZV A;  3CZN A;  4AVM A;  1SU7 A;  2YIA A;  4KIK A;  1DKZ A;  3D51 A;  4JNE A;  2ZXQ A;  4HR1 A;  1E2U A;  2D4C A;  5FIG A;  2O0I 1;  1E9V A;  2FYV A;  3KAW A;  2GAF D;  3CVR A;  2QXL A;  4PO2 A;  3D4Y A;  4JWE A;  3UIT A;  1HWW A;  2RAJ A;  3SYV A;  4IWQ A;  3ABH A;  1I49 A;  2YKT A;  3GI7 A;  4NSW A;  2OZN B;  1TQV A;  3VKH A;  2OW6 A;  3OWG A;  2ELB A;  4G6Q A;  3DX0 A;  3Q84 A;  2OO2 A;  2D1L A;  2OBM A;  2RAK A;  5KBP A;  4IM3 A;  1UPX A;  2WIN M;  2YL9 A;  4IM2 A;  2Q12 A;  4I1Q A;  3RV1 A;  4R5L A;  4FZP A;  4H6H A;  4IM0 A;  3EJS A;  4HYB A;  5FLE X;  1X03 A;  4EZW A;  3BVW A;  2F18 A;  1WDZ A;  2YLA A;  3PLT A;  3RV0 A;  2EFL A;  3I39 X;  4IW0 A;  1OA0 A;  3EJT A;  4AZ6 A;  3BUD A;  2FIC A;  4WPC A;  2Q13 A;  2JNK A;  3EJU A;  3CZS A;  3HAH A;  1YWM A;  2YI8 A;  4ATM A;  3C7N A;  3T47 A;  4EZY A;  4R5I A;  5C5B B;  2X3V A;  3QE6 A;  3OHX M;  4EZN A;  1LQ7 A;  2LXY A;  2F7O A;  3EJP A;  2X5C A;  3BUB A;  3LMF A;  4DCN C;  3VEA A;  4EZS A;  3A98 A;  4JWD A;  1SU6 A;  2PY6 A;  3BUQ A;  3D2F A;  3B51 X;  3DDF A;  4FZO A;  2MI7 A;  1TQW A;  3CAZ A;  2ND0 A;  2OW7 A;  4R5G A;  4F01 A;  3QA8 A;  3O3N B;  1ZWW A;  3BVT A;  3DX1 A;  2YL5 A;  1URU A;  5TKY A;  3B52 X;  3BVV A;  4DYL A;  3ER9 B;  3D4Z A;  3CKD A;  2WYH A;  3DPQ A;  4EZU A;  1O7D B;  2F7Q A;  3KDR A;  1W9M A;  1ZYL A;  3OK8 A;  2YIV X;  3ERC C;  2Z0N A;  2LM0 A;  3CV5 A;  2X3X A;  5C5B A;  1SUF A;  1R33 A;  1TQT A;  3D2E A;  4M0M A;  3QNI A;  2RT6 A;  4JWI A;  3M3W A;  2QFF A;  1GN9 A;  4FM3 A;  2C08 A;  3T48 A;  4D8J A;  4H8S A;  1R34 A;  3O3O B;  4B9Q A;  2Z8Y A;  3HAI A;  3BVU A;  4AZ7 A;  2YI9 A;  3ER8 C;  2JNS A;  2Z0V A;  4EZZ A;  1GNT A;  1HXK A;  3BUP A;  1R5E A;  2QKW A;  3HAJ A;  4AZH A;  2YL6 A;  3B53 X;  4AZC B;  2YLL A;  4F00 A;  2PMR A;  3O3M B;  4AZB A;  3L3O M;  2OBL A;  4R5J A;  2YL8 A;  2V0O A;  1PS3 A;  3RPM A;  1U00 A;  4E81 A;  2RAI A;  4HY9 A;  3DDG A;  4AZG A;  2X3W A;  1X04 A;  3VEB A;  4JLC A;  1DKY A;  4JWC A;  3EJQ A;  4JNF A;  3I01 A;  1DKX A;  4UDX X;  4BNE A;  2N3K A;  1E1D A;  3ACO A;  3DX4 A;  3KAV A;  3BLB A;  3QWE A;  3EJR A;  2EFK A;  1QWU A;  3Q0K A;  4IWP A;  3ZED A;  2WYI A;  4EZO A;  4JL9 A;  1QX1 A;  3I04 A;  2F7P A;  3DYT A;  4UDY X;  3L3P A;  2NCZ A;  4AZC A;  1QWN A;  2Z0O A;  1OAO A;  4JN4 A;  3T46 A;  4FZS A;  5E84 A;  3D50 A;  2ALW A;  4KIK B;  4EZR A;  1GNL A;  4HR1 B;  4AZ5 A;  2KHO A;  4EZQ A;  4IWO A;  4AKV A;  4EZX A;  3DPP A;  3G9G A;  1TQS A;  2GA9 D;  3DPO A;  1O7D C;  1MJG A;  2F1A A;  1I4D A;  1SU8 A;  1HTY A;  3F7W A;  1I4T A;  4NPH A;  3DX3 A;  3FD9 A;  2F7R A;  4NQI A;  2GF4 A;  3BVX A; 
#chains in the Genus database with same CATH homology
 2EFK A;  2Z0O A;  2Q12 A;  1Y2O A;  3G9G A;  3LLL A;  4I1Q A;  3CAZ A;  3QNI A;  3QE6 A;  2FIC A;  2Z0V A;  3Q0K A;  4WPC A;  3M3W A;  4FZS A;  4WPE A;  2Q13 A;  3Q84 A;  2C08 A;  2D1L A;  2RAJ A;  1I4L A;  1I4D A;  1ZWW A;  3OK8 A;  3SYV A;  4BNE A;  2V0O A;  4DCN C;  3ABH A;  1X03 A;  3I2W A;  3ACO A;  3HAH A;  1I49 A;  1I4T A;  4H8S A;  3HAJ A;  3QWE A;  2YKT A;  2Z0N A;  3DYT A;  1URU A;  2RAI A;  4AVM A;  2RAK A;  4NSW A;  4ATM A;  2X3W A;  1WDZ A;  2D4C A;  4DYL A;  1X04 A;  3HAI A;  3SOG A;  3PLT A;  4AKV A;  5C5B B;  2X3V A;  2X3X A;  4NQI A;  5C5B A;  2EFL A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...