3M3WA

Crystal strcuture of mouse pacsin3 bar domain mutant
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
288
structure length
280
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHGFRASRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSMQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
total genus 112
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3m3wA01
4DYLA 1I4TA 1URUA 3LLLA 4I1QA 3M3WA 4WPCA 2Q13A 2V0OA 2ELBA 1I49A 3QE6A 1X04A 1I4DA 3Q84A 2EFKA 4NQIA 4ATMA 2Z0NA 3QWEA 1ZWWA 4WPEA 4DCNC 2EFLA 2FICA 3G9GA 3HAJA 3OK8A 4NSWA 3Q0KA 1WDZA 2Q12A 3HAHA 2Z0OA 3ABHA 4AVMA 2D4CA 2RAIA 2X3WA 4FZSA 1X03A 4AKVA 2C08A 2RAKA 2YKTA 3ACOA 3I2WA 2D1LA 3QNIA 5C5BB 2RAJA 3CAZA 3PLTA 1I4LA 2X3XA 2X3VA 5C5BA 3SOGA 3SYVA 1Y2OA 3HAIA 4H8SA 4BNEA 3DYTA 2Z0VA
chains in the Genus database with same CATH superfamily
4DYLA 4IM0A 2LXYA 2QKWA 3M3WA 3RPMA 2V0OA 2ELBA 1QX1A 3BUBA 2ND0A 4B9QA 1SU7A 2F1AA 3BVXA 4AKVA 2RAKA 3DDFA 2KHOA 4H8SA 4FZSA 3KDRA 1E2UA 4AZIA 3DX4A 2OO2A 1TQUA 2O0I1 3O3NB 3CVRA 2OBLA 2LM0A 2FICA 4HR1B 4NSWA 2YL5A 3BUPA 4AVMA 2PMRA 3ERCC 4F01A 3D4ZA 3D2EA 1HXKA 3L3PA 1ZYLA 1YWMA 3EJTA 5E84A 4D8JA 2PY6A 1OAOA 3BUDA 3DX0A 4UDYX 1URUA 3DPPA 3T47A 1TQVA 2OZNB 2EFLA 1GNTA 3UITA 3D50A 4AZCB 1QWUA 5FIGA 1LQ7A 3BVUA 3FD9A 2RAJA 3OHXM 4IWQA 3SOGA 1SU8A 3BUQA 1R34A 2Q13A 3QE6A 4IWOA 3D4YA 1QWNA 3KAVA 3B52X 2D4CA 2D1LA 4JLCA 3BVWA 2YIAA 4EZSA 4EZWA 4HY9A 2YL6A 2YLLA 2WINM 3OWGA 2F18A 2FYVA 3D52A 1I4TA 2ALWA 2F7PA 2F1BA 4EZXA 2YI9A 4NQIA 5FLEX 1OA0A 3BLBA 3G9GA 4R5GA 3ABHA 4AZBA 3DDGA 1R5EA 4IW0A 1DKYA 1PS3A 2YLAA 3LLLA 2Z0VA 3VEBA 3QNJA 4ATMA 1SU6A 4M0MA 4KIKA 5TKYA 1WDZA 1DKZA 3A98A 3HAHA 3ACOA 3C7NA 3I2WA 3QA8A 4EZRA 2YI8A 3VKHA 4PO2A 3DPOA 4JNFA 3KAWA 2Z0NA 2GAFD 2Z8YA 1U00A 3CZNA 3GI7A 2X3XA 3RV0A 4JN4A 4EZTA 4EZVA 3DX3A 1I49A 3BVVA 4E3CA 4JWDA 4AZ5A 4DCNC 2ND1A 5KBPA 2N3KA 2Q12A 4EZYA 4AZ6A 4AZ7A 3L3OM 4JWIA 2MI7A 3CZSA 2YIBA 1HTYA 3I04A 3DX1A 1X04A 4JWEA 4JNEA 4G6QA 3Q0KA 4R5IA 4HR1A 3EJUA 3VEAA 4EZQA 4UDXX 3EJQA 2GF4A 3ER8C 3PLTA 1I4LA 4JL9A 4EZOA 5C5BA 1JQKA 2X5CA 4BNEA 2YL9A 4H6HA 3ER9B 2WYIA 1TQSA 2EFKA 3BVTA 3QWEA 1DKXA 3T4AG 3I01A 4AZCA 1E1DA 2RAIA 3T48A 2C08A 3QNIA 3CAZA 1W9MA 4EZZA 1Y2OA 3O3OB 4WPCA 2QXLA 4R5LA 1I4DA 2EWFA 1HWWA 3CV5A 1UPXA 3RV1A 1X03A 3T46A 4EZUA 2QFFA 3EJSA 4HYBA 4FZPA 1O7DC 4FZOA 1MJGA 3F7WA 4IM3A 3ZEDA 3EJRA 2JNSA 1ZWWA 1TQTA 4IM2A 3DPQA 5C5BB 1R33A 2F7OA 3D2FA 3HAIA 2OBMA 1GNLA 4I1QA 3LVTA 1OA1A 4JWCA 4F00A 4IWPA 4R5KA 3Q84A 2ZXQA 1O7DB 4WPEA 3LMFA 2YIVX 1SUFA 3HAJA 4FM3A 3OK8A 2Z0OA 3CKDA 2YL8A 2X3WA 2YKTA 4NPHA 1GN9A 3SYVA 4R5JA 2F7QA 3B51X 3EJPA 4AZHA 1TQWA 4E81A 2OW7A 2WYHA 4KIKB 3BUIA 3T49A 2EX3B 2NCZA 4AZGA 3D51A 2RT6A 3B53X 4H6IA 2F7RA 1E9VA 4EZNA 2OW6A 3O3MB 3DX2A 2X3VA 3I39X 4EZPA 2JNKA 2GA9D 3DYTA
chains in the Genus database with same CATH topology
4DYLA 1I4TA 1URUA 3LLLA 4I1QA 3M3WA 4WPCA 2Q13A 2V0OA 2ELBA 1I49A 3QE6A 1X04A 1I4DA 3Q84A 2EFKA 4NQIA 4ATMA 2Z0NA 3QWEA 1ZWWA 4WPEA 4DCNC 2EFLA 2FICA 3G9GA 3HAJA 3OK8A 4NSWA 3Q0KA 1WDZA 2Q12A 3HAHA 2Z0OA 3ABHA 4AVMA 2D4CA 2RAIA 2X3WA 4FZSA 1X03A 4AKVA 2C08A 2RAKA 2YKTA 3ACOA 3I2WA 2D1LA 3QNIA 5C5BB 2RAJA 3CAZA 3PLTA 1I4LA 2X3XA 2X3VA 5C5BA 3SOGA 3SYVA 1Y2OA 3HAIA 4H8SA 4BNEA 3DYTA 2Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  1I4T A;  1URU A;  3LLL A;  4I1Q A;  3M3W A;  4WPC A;  2Q13 A;  2V0O A;  2ELB A;  1I49 A;  3QE6 A;  1X04 A;  1I4D A;  3Q84 A;  2EFK A;  4NQI A;  4ATM A;  2Z0N A;  3QWE A;  1ZWW A;  4WPE A;  4DCN C;  2EFL A;  2FIC A;  3G9G A;  3HAJ A;  3OK8 A;  4NSW A;  3Q0K A;  1WDZ A;  2Q12 A;  3HAH A;  2Z0O A;  3ABH A;  4AVM A;  2D4C A;  2RAI A;  2X3W A;  4FZS A;  1X03 A;  4AKV A;  2C08 A;  2RAK A;  2YKT A;  3ACO A;  3I2W A;  2D1L A;  3QNI A;  5C5B B;  2RAJ A;  3CAZ A;  3PLT A;  1I4L A;  2X3X A;  2X3V A;  5C5B A;  3SOG A;  3SYV A;  1Y2O A;  3HAI A;  4H8S A;  4BNE A;  3DYT A;  2Z0V A; 
#chains in the Genus database with same CATH topology
 4DYL A;  4IM0 A;  2LXY A;  2QKW A;  3M3W A;  3RPM A;  2V0O A;  2ELB A;  1QX1 A;  3BUB A;  2ND0 A;  4B9Q A;  1SU7 A;  2F1A A;  3BVX A;  4AKV A;  2RAK A;  3DDF A;  2KHO A;  4H8S A;  4FZS A;  3KDR A;  1E2U A;  4AZI A;  3DX4 A;  2OO2 A;  1TQU A;  2O0I 1;  3O3N B;  3CVR A;  2OBL A;  2LM0 A;  2FIC A;  4HR1 B;  4NSW A;  2YL5 A;  3BUP A;  4AVM A;  2PMR A;  3ERC C;  4F01 A;  3D4Z A;  3D2E A;  1HXK A;  3L3P A;  1ZYL A;  1YWM A;  3EJT A;  5E84 A;  4D8J A;  2PY6 A;  1OAO A;  3BUD A;  3DX0 A;  4UDY X;  1URU A;  3DPP A;  3T47 A;  1TQV A;  2OZN B;  2EFL A;  1GNT A;  3UIT A;  3D50 A;  4AZC B;  1QWU A;  5FIG A;  1LQ7 A;  3BVU A;  3FD9 A;  2RAJ A;  3OHX M;  4IWQ A;  3SOG A;  1SU8 A;  3BUQ A;  1R34 A;  2Q13 A;  3QE6 A;  4IWO A;  3D4Y A;  1QWN A;  3KAV A;  3B52 X;  2D4C A;  2D1L A;  4JLC A;  3BVW A;  2YIA A;  4EZS A;  4EZW A;  4HY9 A;  2YL6 A;  2YLL A;  2WIN M;  3OWG A;  2F18 A;  2FYV A;  3D52 A;  1I4T A;  2ALW A;  2F7P A;  2F1B A;  4EZX A;  2YI9 A;  4NQI A;  5FLE X;  1OA0 A;  3BLB A;  3G9G A;  4R5G A;  3ABH A;  4AZB A;  3DDG A;  1R5E A;  4IW0 A;  1DKY A;  1PS3 A;  2YLA A;  3LLL A;  2Z0V A;  3VEB A;  3QNJ A;  4ATM A;  1SU6 A;  4M0M A;  4KIK A;  5TKY A;  1WDZ A;  1DKZ A;  3A98 A;  3HAH A;  3ACO A;  3C7N A;  3I2W A;  3QA8 A;  4EZR A;  2YI8 A;  3VKH A;  4PO2 A;  3DPO A;  4JNF A;  3KAW A;  2Z0N A;  2GAF D;  2Z8Y A;  1U00 A;  3CZN A;  3GI7 A;  2X3X A;  3RV0 A;  4JN4 A;  4EZT A;  4EZV A;  3DX3 A;  1I49 A;  3BVV A;  4E3C A;  4JWD A;  4AZ5 A;  4DCN C;  2ND1 A;  5KBP A;  2N3K A;  2Q12 A;  4EZY A;  4AZ6 A;  4AZ7 A;  3L3O M;  4JWI A;  2MI7 A;  3CZS A;  2YIB A;  1HTY A;  3I04 A;  3DX1 A;  1X04 A;  4JWE A;  4JNE A;  4G6Q A;  3Q0K A;  4R5I A;  4HR1 A;  3EJU A;  3VEA A;  4EZQ A;  4UDX X;  3EJQ A;  2GF4 A;  3ER8 C;  3PLT A;  1I4L A;  4JL9 A;  4EZO A;  5C5B A;  1JQK A;  2X5C A;  4BNE A;  2YL9 A;  4H6H A;  3ER9 B;  2WYI A;  1TQS A;  2EFK A;  3BVT A;  3QWE A;  1DKX A;  3T4A G;  3I01 A;  4AZC A;  1E1D A;  2RAI A;  3T48 A;  2C08 A;  3QNI A;  3CAZ A;  1W9M A;  4EZZ A;  1Y2O A;  3O3O B;  4WPC A;  2QXL A;  4R5L A;  1I4D A;  2EWF A;  1HWW A;  3CV5 A;  1UPX A;  3RV1 A;  1X03 A;  3T46 A;  4EZU A;  2QFF A;  3EJS A;  4HYB A;  4FZP A;  1O7D C;  4FZO A;  1MJG A;  3F7W A;  4IM3 A;  3ZED A;  3EJR A;  2JNS A;  1ZWW A;  1TQT A;  4IM2 A;  3DPQ A;  5C5B B;  1R33 A;  2F7O A;  3D2F A;  3HAI A;  2OBM A;  1GNL A;  4I1Q A;  3LVT A;  1OA1 A;  4JWC A;  4F00 A;  4IWP A;  4R5K A;  3Q84 A;  2ZXQ A;  1O7D B;  4WPE A;  3LMF A;  2YIV X;  1SUF A;  3HAJ A;  4FM3 A;  3OK8 A;  2Z0O A;  3CKD A;  2YL8 A;  2X3W A;  2YKT A;  4NPH A;  1GN9 A;  3SYV A;  4R5J A;  2F7Q A;  3B51 X;  3EJP A;  4AZH A;  1TQW A;  4E81 A;  2OW7 A;  2WYH A;  4KIK B;  3BUI A;  3T49 A;  2EX3 B;  2NCZ A;  4AZG A;  3D51 A;  2RT6 A;  3B53 X;  4H6I A;  2F7R A;  1E9V A;  4EZN A;  2OW6 A;  3O3M B;  3DX2 A;  2X3V A;  3I39 X;  4EZP A;  2JNK A;  2GA9 D;  3DYT A; 
#chains in the Genus database with same CATH homology
 4DYL A;  1I4T A;  1URU A;  3LLL A;  4I1Q A;  3M3W A;  4WPC A;  2Q13 A;  2V0O A;  2ELB A;  1I49 A;  3QE6 A;  1X04 A;  1I4D A;  3Q84 A;  2EFK A;  4NQI A;  4ATM A;  2Z0N A;  3QWE A;  1ZWW A;  4WPE A;  4DCN C;  2EFL A;  2FIC A;  3G9G A;  3HAJ A;  3OK8 A;  4NSW A;  3Q0K A;  1WDZ A;  2Q12 A;  3HAH A;  2Z0O A;  3ABH A;  4AVM A;  2D4C A;  2RAI A;  2X3W A;  4FZS A;  1X03 A;  4AKV A;  2C08 A;  2RAK A;  2YKT A;  3ACO A;  3I2W A;  2D1L A;  3QNI A;  5C5B B;  2RAJ A;  3CAZ A;  3PLT A;  1I4L A;  2X3X A;  2X3V A;  5C5B A;  3SOG A;  3SYV A;  1Y2O A;  3HAI A;  4H8S A;  4BNE A;  3DYT A;  2Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...