3M3WA

Crystal strcuture of mouse pacsin3 bar domain mutant
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
288
structure length
280
Chain Sequence
GSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKAYAQQLADWARKWRGAVEKGPQYGTLEKAWHAFFTAAERLSELHLEVREKLHGPDSERVRTWQRGAFHGFRASRAAEDGFRKAQKPWLKRLKEVEASKKSYHTARKDEKTAQTRESHAKADSSMQLRKLQERVGRCTKEAEKMKTQYEQTLAELNRYTPRYMEDMEQAFESCQAAERQRLLFFKDVLLTLHQHLDLSSSDKFHELHRDLQQSIEAASDEEDLRWWRSTHGPGMAMNWPQFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C and casein kinase II substrate protein 3
publication title Rigidity of wedge loop in PACSIN 3 protein is a key factor in dictating diameters of tubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Endocytosis
total genus 112
structure length 280
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3m3wA01
3PLTA 1WDZA 4H8SA 3HAIA 4DYLA 1ZWWA 3M3WA 1X03A 2YKTA 3HAJA 4AVMA 2D1LA 4I1QA 3ACOA 1I4TA 2C08A 3Q84A 3Q0KA 2ELBA 3DYTA 4BNEA 1I4DA 3HAHA 2EFLA 2EFKA 4FZSA 4DCNC 1I4LA 2RAKA 3G9GA 3ABHA 4NSWA 2D4CA 4WPEA 4ATMA 2X3XA 3OK8A 3LLLA 5C5BA 5C5BB 1Y2OA 2X3WA 1I49A 2Z0NA 1URUA 3CAZA 2RAIA 4NQIA 2Z0VA 3QNIA 2V0OA 2X3VA 3SOGA 4AKVA 1X04A 3QWEA 2FICA 2Z0OA 2Q13A 3QE6A 4WPCA 2RAJA 3I2WA 3SYVA 2Q12A
chains in the Genus database with same CATH superfamily
4H6IA 4EZNA 3QNJA 4AZBA 3BUBA 4EZXA 1TQTA 1O7DB 3HAHA 3KAWA 1R34A 2YI9A 5KBPA 4HYBA 2MI7A 3CVRA 3RV1A 3C7NA 3B53X 3SOGA 4DYLA 4AVMA 2JNKA 1I4TA 2YI8A 1I4LA 4IM0A 3BUPA 4D8JA 2RT6A 2LM0A 2OW7A 1TQSA 4R5KA 4IWOA 4HY9A 2ND0A 4IWQA 4EZVA 1ZWWA 2X5CA 2EWFA 1I4DA 2YIBA 4F01A 1TQVA 4NSWA 1YWMA 1TQUA 3DX4A 2ND1A 4E3CA 2N3KA 3QNIA 5FIGA 1DKXA 4AKVA 2F7OA 1SU6A 3BVUA 1UPXA 2Q12A 3D4YA 3EJRA 4FZOA 4AZCA 3Q0KA 4EZWA 2YLLA 3D2EA 1DKYA 3OHXM 1R33A 2ALWA 4UDYX 5C5BB 4IM3A 1URUA 3L3PA 2V0OA 3CZSA 1JQKA 4EZUA 3KDRA 2QFFA 4H8SA 2JNSA 4UDXX 4F00A 2O0I1 4BNEA 3T47A 2YLAA 3G9GA 2F7QA 3EJSA 4FM3A 4IWPA 1E2UA 4EZRA 3SYVA 3DPOA 1SU8A 1U00A 4R5JA 2F1BA 4EZSA 3F7WA 3DDGA 1OAOA 3O3NB 5C5BA 1GNLA 4R5GA 2X3VA 4EZZA 3QWEA 3D4ZA 4JLCA 3EJTA 3VEBA 2QKWA 2D1LA 3EJPA 4AZCB 4EZQA 4JWIA 4H6HA 3DX0A 2PY6A 1QWUA 3LLLA 4G6QA 2WYHA 2OW6A 3DX2A 2Z8YA 1WDZA 1QWNA 3DYTA 1O7DC 3EJQA 3BVVA 1OA0A 1GN9A 3T49A 3I2WA 3BLBA 1QX1A 3M3WA 3I01A 4JWEA 4M0MA 2C08A 5E84A 5FLEX 4EZTA 4JNEA 5TKYA 2NCZA 4R5IA 2D4CA 1TQWA 4JWCA 2X3WA 2F7RA 2OBMA 3LMFA 4R5LA 3O3MB 4E81A 2YIAA 2F7PA 1ZYLA 3DX1A 3B52X 3FD9A 4DCNC 2RAKA 3T46A 3BVWA 3ER9B 2F18A 3OK8A 4JWDA 2FICA 3CZNA 4JN4A 3HAIA 2YL5A 2ELBA 2GF4A 2EFLA 2EFKA 2WYIA 3DDFA 3ER8C 1Y2OA 3CAZA 2Z0VA 3D52A 4KIKA 3KAVA 1GNTA 4AZGA 3Q84A 3B51X 2OO2A 3L3OM 2PMRA 4FZSA 2X3XA 2ZXQA 2FYVA 4PO2A 2RAIA 4NQIA 3DPQA 4AZ6A 4JL9A 4NPHA 3I39X 3LVTA 3D50A 3VKHA 4IW0A 3RV0A 3BVTA 2YL6A 4EZYA 3ACOA 4HR1A 4EZOA 3A98A 2QXLA 2F1AA 1E9VA 3ZEDA 3GI7A 3BVXA 1HTYA 4AZIA 3DX3A 1MJGA 3T48A 3D2FA 3BUQA 2Q13A 3I04A 4I1QA 3PLTA 3ERCC 3HAJA 3CV5A 1SUFA 4JNFA 2GAFD 3UITA 2LXYA 3O3OB 4AZHA 1X04A 4KIKB 1HWWA 1E1DA 3BUIA 1LQ7A 3D51A 2GA9D 2EX3B 2WINM 2YL9A 4WPEA 1OA1A 4ATMA 3T4AG 3EJUA 1I49A 4EZPA 3VEAA 1HXKA 2YIVX 3DPPA 1R5EA 2Z0OA 3QE6A 2RAJA 3CKDA 2YL8A 3OWGA 1X03A 2YKTA 2OBLA 4AZ7A 3BUDA 4IM2A 1PS3A 4HR1B 4AZ5A 4B9QA 3ABHA 2KHOA 1W9MA 3QA8A 2OZNB 2Z0NA 4FZPA 1DKZA 1SU7A 4WPCA 3RPMA
chains in the Genus database with same CATH topology
3PLTA 1WDZA 4H8SA 3HAIA 4DYLA 1ZWWA 3M3WA 1X03A 2YKTA 3HAJA 4AVMA 2D1LA 4I1QA 3ACOA 1I4TA 2C08A 3Q84A 3Q0KA 2ELBA 3DYTA 4BNEA 1I4DA 3HAHA 2EFLA 2EFKA 4FZSA 4DCNC 1I4LA 2RAKA 3G9GA 3ABHA 4NSWA 2D4CA 4WPEA 4ATMA 2X3XA 3OK8A 3LLLA 5C5BA 5C5BB 1Y2OA 2X3WA 1I49A 2Z0NA 1URUA 3CAZA 2RAIA 4NQIA 2Z0VA 3QNIA 2V0OA 2X3VA 3SOGA 4AKVA 1X04A 3QWEA 2FICA 2Z0OA 2Q13A 3QE6A 4WPCA 2RAJA 3I2WA 3SYVA 2Q12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PLT A;  1WDZ A;  4H8S A;  3HAI A;  4DYL A;  1ZWW A;  3M3W A;  1X03 A;  2YKT A;  3HAJ A;  4AVM A;  2D1L A;  4I1Q A;  3ACO A;  1I4T A;  2C08 A;  3Q84 A;  3Q0K A;  2ELB A;  3DYT A;  4BNE A;  1I4D A;  3HAH A;  2EFL A;  2EFK A;  4FZS A;  4DCN C;  1I4L A;  2RAK A;  3G9G A;  3ABH A;  4NSW A;  2D4C A;  4WPE A;  4ATM A;  2X3X A;  3OK8 A;  3LLL A;  5C5B A;  5C5B B;  1Y2O A;  2X3W A;  1I49 A;  2Z0N A;  1URU A;  3CAZ A;  2RAI A;  4NQI A;  2Z0V A;  3QNI A;  2V0O A;  2X3V A;  3SOG A;  4AKV A;  1X04 A;  3QWE A;  2FIC A;  2Z0O A;  2Q13 A;  3QE6 A;  4WPC A;  2RAJ A;  3I2W A;  3SYV A;  2Q12 A; 
#chains in the Genus database with same CATH topology
 4H6I A;  4EZN A;  3QNJ A;  4AZB A;  3BUB A;  4EZX A;  1TQT A;  1O7D B;  3HAH A;  3KAW A;  1R34 A;  2YI9 A;  5KBP A;  4HYB A;  2MI7 A;  3CVR A;  3RV1 A;  3C7N A;  3B53 X;  3SOG A;  4DYL A;  4AVM A;  2JNK A;  1I4T A;  2YI8 A;  1I4L A;  4IM0 A;  3BUP A;  4D8J A;  2RT6 A;  2LM0 A;  2OW7 A;  1TQS A;  4R5K A;  4IWO A;  4HY9 A;  2ND0 A;  4IWQ A;  4EZV A;  1ZWW A;  2X5C A;  2EWF A;  1I4D A;  2YIB A;  4F01 A;  1TQV A;  4NSW A;  1YWM A;  1TQU A;  3DX4 A;  2ND1 A;  4E3C A;  2N3K A;  3QNI A;  5FIG A;  1DKX A;  4AKV A;  2F7O A;  1SU6 A;  3BVU A;  1UPX A;  2Q12 A;  3D4Y A;  3EJR A;  4FZO A;  4AZC A;  3Q0K A;  4EZW A;  2YLL A;  3D2E A;  1DKY A;  3OHX M;  1R33 A;  2ALW A;  4UDY X;  5C5B B;  4IM3 A;  1URU A;  3L3P A;  2V0O A;  3CZS A;  1JQK A;  4EZU A;  3KDR A;  2QFF A;  4H8S A;  2JNS A;  4UDX X;  4F00 A;  2O0I 1;  4BNE A;  3T47 A;  2YLA A;  3G9G A;  2F7Q A;  3EJS A;  4FM3 A;  4IWP A;  1E2U A;  4EZR A;  3SYV A;  3DPO A;  1SU8 A;  1U00 A;  4R5J A;  2F1B A;  4EZS A;  3F7W A;  3DDG A;  1OAO A;  3O3N B;  5C5B A;  1GNL A;  4R5G A;  2X3V A;  4EZZ A;  3QWE A;  3D4Z A;  4JLC A;  3EJT A;  3VEB A;  2QKW A;  2D1L A;  3EJP A;  4AZC B;  4EZQ A;  4JWI A;  4H6H A;  3DX0 A;  2PY6 A;  1QWU A;  3LLL A;  4G6Q A;  2WYH A;  2OW6 A;  3DX2 A;  2Z8Y A;  1WDZ A;  1QWN A;  3DYT A;  1O7D C;  3EJQ A;  3BVV A;  1OA0 A;  1GN9 A;  3T49 A;  3I2W A;  3BLB A;  1QX1 A;  3M3W A;  3I01 A;  4JWE A;  4M0M A;  2C08 A;  5E84 A;  5FLE X;  4EZT A;  4JNE A;  5TKY A;  2NCZ A;  4R5I A;  2D4C A;  1TQW A;  4JWC A;  2X3W A;  2F7R A;  2OBM A;  3LMF A;  4R5L A;  3O3M B;  4E81 A;  2YIA A;  2F7P A;  1ZYL A;  3DX1 A;  3B52 X;  3FD9 A;  4DCN C;  2RAK A;  3T46 A;  3BVW A;  3ER9 B;  2F18 A;  3OK8 A;  4JWD A;  2FIC A;  3CZN A;  4JN4 A;  3HAI A;  2YL5 A;  2ELB A;  2GF4 A;  2EFL A;  2EFK A;  2WYI A;  3DDF A;  3ER8 C;  1Y2O A;  3CAZ A;  2Z0V A;  3D52 A;  4KIK A;  3KAV A;  1GNT A;  4AZG A;  3Q84 A;  3B51 X;  2OO2 A;  3L3O M;  2PMR A;  4FZS A;  2X3X A;  2ZXQ A;  2FYV A;  4PO2 A;  2RAI A;  4NQI A;  3DPQ A;  4AZ6 A;  4JL9 A;  4NPH A;  3I39 X;  3LVT A;  3D50 A;  3VKH A;  4IW0 A;  3RV0 A;  3BVT A;  2YL6 A;  4EZY A;  3ACO A;  4HR1 A;  4EZO A;  3A98 A;  2QXL A;  2F1A A;  1E9V A;  3ZED A;  3GI7 A;  3BVX A;  1HTY A;  4AZI A;  3DX3 A;  1MJG A;  3T48 A;  3D2F A;  3BUQ A;  2Q13 A;  3I04 A;  4I1Q A;  3PLT A;  3ERC C;  3HAJ A;  3CV5 A;  1SUF A;  4JNF A;  2GAF D;  3UIT A;  2LXY A;  3O3O B;  4AZH A;  1X04 A;  4KIK B;  1HWW A;  1E1D A;  3BUI A;  1LQ7 A;  3D51 A;  2GA9 D;  2EX3 B;  2WIN M;  2YL9 A;  4WPE A;  1OA1 A;  4ATM A;  3T4A G;  3EJU A;  1I49 A;  4EZP A;  3VEA A;  1HXK A;  2YIV X;  3DPP A;  1R5E A;  2Z0O A;  3QE6 A;  2RAJ A;  3CKD A;  2YL8 A;  3OWG A;  1X03 A;  2YKT A;  2OBL A;  4AZ7 A;  3BUD A;  4IM2 A;  1PS3 A;  4HR1 B;  4AZ5 A;  4B9Q A;  3ABH A;  2KHO A;  1W9M A;  3QA8 A;  2OZN B;  2Z0N A;  4FZP A;  1DKZ A;  1SU7 A;  4WPC A;  3RPM A; 
#chains in the Genus database with same CATH homology
 3PLT A;  1WDZ A;  4H8S A;  3HAI A;  4DYL A;  1ZWW A;  3M3W A;  1X03 A;  2YKT A;  3HAJ A;  4AVM A;  2D1L A;  4I1Q A;  3ACO A;  1I4T A;  2C08 A;  3Q84 A;  3Q0K A;  2ELB A;  3DYT A;  4BNE A;  1I4D A;  3HAH A;  2EFL A;  2EFK A;  4FZS A;  4DCN C;  1I4L A;  2RAK A;  3G9G A;  3ABH A;  4NSW A;  2D4C A;  4WPE A;  4ATM A;  2X3X A;  3OK8 A;  3LLL A;  5C5B A;  5C5B B;  1Y2O A;  2X3W A;  1I49 A;  2Z0N A;  1URU A;  3CAZ A;  2RAI A;  4NQI A;  2Z0V A;  3QNI A;  2V0O A;  2X3V A;  3SOG A;  4AKV A;  1X04 A;  3QWE A;  2FIC A;  2Z0O A;  2Q13 A;  3QE6 A;  4WPC A;  2RAJ A;  3I2W A;  3SYV A;  2Q12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...